data_1SID
# 
_entry.id   1SID 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SID         
WWPDB D_1000176382 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SID 
_pdbx_database_status.recvd_initial_deposition_date   1995-12-12 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Stehle, T.'     1 
'Harrison, S.C.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Crystal structures of murine polyomavirus in complex with straight-chain and branched-chain sialyloligosaccharide receptor fragments.
;
Structure         4   183 194 1996 STRUE6 UK 0969-2126 2005 ? 8805524 '10.1016/S0969-2126(96)00021-4' 
1       'The Structure of Simian Virus 40 Refined at 3.1 Angstroms Resolution' 'To be Published' ?   ?   ?   ?    ?      ?  ? 0353 
? ?       ?                               
2       
;Structure Determination of Simian Virus 40 and Murine Polyomavirus by a Combination of 5-Fold and 30-Fold Electron Density Averaging
;
'To be Published' ?   ?   ?   ?    ?      ?  ?         0353 ? ?       ?                               
3       'Structure of Murine Polyomavirus Complexed with an Oligosaccharide Receptor Fragment' Nature            369 160 ?   1994 
NATUAS UK 0028-0836 0006 ? ?       ?                               
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Stehle, T.'       1  
primary 'Harrison, S.C.'   2  
1       'Stehle, T.'       3  
1       'Gamblin, S.J.'    4  
1       'Yan, Y.'          5  
1       'Harrison, S.C.'   6  
2       'Yan, Y.'          7  
2       'Stehle, T.'       8  
2       'Liddington, R.C.' 9  
2       'Zhao, H.C.'       10 
2       'Harrison, S.C.'   11 
3       'Stehle, T.'       12 
3       'Yan, Y.'          13 
3       'Benjamin, T.L.'   14 
3       'Harrison, S.C.'   15 
# 
_cell.entry_id           1SID 
_cell.length_a           570.000 
_cell.length_b           570.000 
_cell.length_c           570.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              720 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1SID 
_symmetry.space_group_name_H-M             'I 2 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                197 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'POLYOMAVIRUS COAT PROTEIN VP1' 42405.109 6 ? ? ? ? 
2 non-polymer man 'O-SIALIC ACID'                 309.270   6 ? ? ? ? 
3 non-polymer man BETA-D-GALACTOSE                180.156   6 ? ? ? ? 
4 non-polymer man BETA-D-GLUCOSE                  180.156   6 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;APKRKAGVSKCETKCTKACPRPAPVPKLLIKGGMEVLDLVTGPDSVTEIEAFLNPRMGQPPTPESLTEGGQYYGWSRGIN
LATSDTEDSPGNNTLPTWSMAKLQLPMLNEDLTCDTLQMWEAVSVKTEVVGSGSLLDVHGFNKPTDTVNTKGISTPVEGS
QYHVFAVGGEPLDLQGLVTDARTKYKEEGVVTIKTITKKDMVNKDQVLNPISKAKLDKDGMYPVEIWHPDPAKNENTRYF
GNYTGGTTTPPVLQFTNTLTTVLLDENGVGPLCKGEGLYLSCVDIMGWRVTRNYDVHHWRGLPRYFKITLRKRWVKNPYP
MASLISSLFNNMLPQVQGQPMEGENTQVEEVRVYDGTEPVPGDPDMTRYVDRFGKTKTVFPGN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;APKRKAGVSKCETKCTKACPRPAPVPKLLIKGGMEVLDLVTGPDSVTEIEAFLNPRMGQPPTPESLTEGGQYYGWSRGIN
LATSDTEDSPGNNTLPTWSMAKLQLPMLNEDLTCDTLQMWEAVSVKTEVVGSGSLLDVHGFNKPTDTVNTKGISTPVEGS
QYHVFAVGGEPLDLQGLVTDARTKYKEEGVVTIKTITKKDMVNKDQVLNPISKAKLDKDGMYPVEIWHPDPAKNENTRYF
GNYTGGTTTPPVLQFTNTLTTVLLDENGVGPLCKGEGLYLSCVDIMGWRVTRNYDVHHWRGLPRYFKITLRKRWVKNPYP
MASLISSLFNNMLPQVQGQPMEGENTQVEEVRVYDGTEPVPGDPDMTRYVDRFGKTKTVFPGN
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PRO n 
1 3   LYS n 
1 4   ARG n 
1 5   LYS n 
1 6   ALA n 
1 7   GLY n 
1 8   VAL n 
1 9   SER n 
1 10  LYS n 
1 11  CYS n 
1 12  GLU n 
1 13  THR n 
1 14  LYS n 
1 15  CYS n 
1 16  THR n 
1 17  LYS n 
1 18  ALA n 
1 19  CYS n 
1 20  PRO n 
1 21  ARG n 
1 22  PRO n 
1 23  ALA n 
1 24  PRO n 
1 25  VAL n 
1 26  PRO n 
1 27  LYS n 
1 28  LEU n 
1 29  LEU n 
1 30  ILE n 
1 31  LYS n 
1 32  GLY n 
1 33  GLY n 
1 34  MET n 
1 35  GLU n 
1 36  VAL n 
1 37  LEU n 
1 38  ASP n 
1 39  LEU n 
1 40  VAL n 
1 41  THR n 
1 42  GLY n 
1 43  PRO n 
1 44  ASP n 
1 45  SER n 
1 46  VAL n 
1 47  THR n 
1 48  GLU n 
1 49  ILE n 
1 50  GLU n 
1 51  ALA n 
1 52  PHE n 
1 53  LEU n 
1 54  ASN n 
1 55  PRO n 
1 56  ARG n 
1 57  MET n 
1 58  GLY n 
1 59  GLN n 
1 60  PRO n 
1 61  PRO n 
1 62  THR n 
1 63  PRO n 
1 64  GLU n 
1 65  SER n 
1 66  LEU n 
1 67  THR n 
1 68  GLU n 
1 69  GLY n 
1 70  GLY n 
1 71  GLN n 
1 72  TYR n 
1 73  TYR n 
1 74  GLY n 
1 75  TRP n 
1 76  SER n 
1 77  ARG n 
1 78  GLY n 
1 79  ILE n 
1 80  ASN n 
1 81  LEU n 
1 82  ALA n 
1 83  THR n 
1 84  SER n 
1 85  ASP n 
1 86  THR n 
1 87  GLU n 
1 88  ASP n 
1 89  SER n 
1 90  PRO n 
1 91  GLY n 
1 92  ASN n 
1 93  ASN n 
1 94  THR n 
1 95  LEU n 
1 96  PRO n 
1 97  THR n 
1 98  TRP n 
1 99  SER n 
1 100 MET n 
1 101 ALA n 
1 102 LYS n 
1 103 LEU n 
1 104 GLN n 
1 105 LEU n 
1 106 PRO n 
1 107 MET n 
1 108 LEU n 
1 109 ASN n 
1 110 GLU n 
1 111 ASP n 
1 112 LEU n 
1 113 THR n 
1 114 CYS n 
1 115 ASP n 
1 116 THR n 
1 117 LEU n 
1 118 GLN n 
1 119 MET n 
1 120 TRP n 
1 121 GLU n 
1 122 ALA n 
1 123 VAL n 
1 124 SER n 
1 125 VAL n 
1 126 LYS n 
1 127 THR n 
1 128 GLU n 
1 129 VAL n 
1 130 VAL n 
1 131 GLY n 
1 132 SER n 
1 133 GLY n 
1 134 SER n 
1 135 LEU n 
1 136 LEU n 
1 137 ASP n 
1 138 VAL n 
1 139 HIS n 
1 140 GLY n 
1 141 PHE n 
1 142 ASN n 
1 143 LYS n 
1 144 PRO n 
1 145 THR n 
1 146 ASP n 
1 147 THR n 
1 148 VAL n 
1 149 ASN n 
1 150 THR n 
1 151 LYS n 
1 152 GLY n 
1 153 ILE n 
1 154 SER n 
1 155 THR n 
1 156 PRO n 
1 157 VAL n 
1 158 GLU n 
1 159 GLY n 
1 160 SER n 
1 161 GLN n 
1 162 TYR n 
1 163 HIS n 
1 164 VAL n 
1 165 PHE n 
1 166 ALA n 
1 167 VAL n 
1 168 GLY n 
1 169 GLY n 
1 170 GLU n 
1 171 PRO n 
1 172 LEU n 
1 173 ASP n 
1 174 LEU n 
1 175 GLN n 
1 176 GLY n 
1 177 LEU n 
1 178 VAL n 
1 179 THR n 
1 180 ASP n 
1 181 ALA n 
1 182 ARG n 
1 183 THR n 
1 184 LYS n 
1 185 TYR n 
1 186 LYS n 
1 187 GLU n 
1 188 GLU n 
1 189 GLY n 
1 190 VAL n 
1 191 VAL n 
1 192 THR n 
1 193 ILE n 
1 194 LYS n 
1 195 THR n 
1 196 ILE n 
1 197 THR n 
1 198 LYS n 
1 199 LYS n 
1 200 ASP n 
1 201 MET n 
1 202 VAL n 
1 203 ASN n 
1 204 LYS n 
1 205 ASP n 
1 206 GLN n 
1 207 VAL n 
1 208 LEU n 
1 209 ASN n 
1 210 PRO n 
1 211 ILE n 
1 212 SER n 
1 213 LYS n 
1 214 ALA n 
1 215 LYS n 
1 216 LEU n 
1 217 ASP n 
1 218 LYS n 
1 219 ASP n 
1 220 GLY n 
1 221 MET n 
1 222 TYR n 
1 223 PRO n 
1 224 VAL n 
1 225 GLU n 
1 226 ILE n 
1 227 TRP n 
1 228 HIS n 
1 229 PRO n 
1 230 ASP n 
1 231 PRO n 
1 232 ALA n 
1 233 LYS n 
1 234 ASN n 
1 235 GLU n 
1 236 ASN n 
1 237 THR n 
1 238 ARG n 
1 239 TYR n 
1 240 PHE n 
1 241 GLY n 
1 242 ASN n 
1 243 TYR n 
1 244 THR n 
1 245 GLY n 
1 246 GLY n 
1 247 THR n 
1 248 THR n 
1 249 THR n 
1 250 PRO n 
1 251 PRO n 
1 252 VAL n 
1 253 LEU n 
1 254 GLN n 
1 255 PHE n 
1 256 THR n 
1 257 ASN n 
1 258 THR n 
1 259 LEU n 
1 260 THR n 
1 261 THR n 
1 262 VAL n 
1 263 LEU n 
1 264 LEU n 
1 265 ASP n 
1 266 GLU n 
1 267 ASN n 
1 268 GLY n 
1 269 VAL n 
1 270 GLY n 
1 271 PRO n 
1 272 LEU n 
1 273 CYS n 
1 274 LYS n 
1 275 GLY n 
1 276 GLU n 
1 277 GLY n 
1 278 LEU n 
1 279 TYR n 
1 280 LEU n 
1 281 SER n 
1 282 CYS n 
1 283 VAL n 
1 284 ASP n 
1 285 ILE n 
1 286 MET n 
1 287 GLY n 
1 288 TRP n 
1 289 ARG n 
1 290 VAL n 
1 291 THR n 
1 292 ARG n 
1 293 ASN n 
1 294 TYR n 
1 295 ASP n 
1 296 VAL n 
1 297 HIS n 
1 298 HIS n 
1 299 TRP n 
1 300 ARG n 
1 301 GLY n 
1 302 LEU n 
1 303 PRO n 
1 304 ARG n 
1 305 TYR n 
1 306 PHE n 
1 307 LYS n 
1 308 ILE n 
1 309 THR n 
1 310 LEU n 
1 311 ARG n 
1 312 LYS n 
1 313 ARG n 
1 314 TRP n 
1 315 VAL n 
1 316 LYS n 
1 317 ASN n 
1 318 PRO n 
1 319 TYR n 
1 320 PRO n 
1 321 MET n 
1 322 ALA n 
1 323 SER n 
1 324 LEU n 
1 325 ILE n 
1 326 SER n 
1 327 SER n 
1 328 LEU n 
1 329 PHE n 
1 330 ASN n 
1 331 ASN n 
1 332 MET n 
1 333 LEU n 
1 334 PRO n 
1 335 GLN n 
1 336 VAL n 
1 337 GLN n 
1 338 GLY n 
1 339 GLN n 
1 340 PRO n 
1 341 MET n 
1 342 GLU n 
1 343 GLY n 
1 344 GLU n 
1 345 ASN n 
1 346 THR n 
1 347 GLN n 
1 348 VAL n 
1 349 GLU n 
1 350 GLU n 
1 351 VAL n 
1 352 ARG n 
1 353 VAL n 
1 354 TYR n 
1 355 ASP n 
1 356 GLY n 
1 357 THR n 
1 358 GLU n 
1 359 PRO n 
1 360 VAL n 
1 361 PRO n 
1 362 GLY n 
1 363 ASP n 
1 364 PRO n 
1 365 ASP n 
1 366 MET n 
1 367 THR n 
1 368 ARG n 
1 369 TYR n 
1 370 VAL n 
1 371 ASP n 
1 372 ARG n 
1 373 PHE n 
1 374 GLY n 
1 375 LYS n 
1 376 THR n 
1 377 LYS n 
1 378 THR n 
1 379 VAL n 
1 380 PHE n 
1 381 PRO n 
1 382 GLY n 
1 383 ASN n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Mouse polyomavirus (strain p16 small-plaque)' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      47935 
_entity_src_nat.genus                      Polyomavirus 
_entity_src_nat.species                    'Murine polyomavirus' 
_entity_src_nat.strain                     'SMALL-PLAQUE P16' 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    COA1_POVMP 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P49302 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;APKRKSGVSKCETKCTKACPRPAPVPKLLIKGGMEVLDLVTGPDSVTEIEAFLNPRMGQPPTPESLTEGGQYYGWSRGIN
LATSDTEDSPGNNTLPTWSMAKLQLPMLNEDLTCDTLQMWEAVSVKTEVVGSGSLLDVHGFNKPTDTVNTKGISTPVEGS
QYHVFAVGGEPLDLQGLVTDARTKYKEEGVVTIKTITKKDMVNKDQVLNPISKAKLDKDGMYPVEIWHPDPAKNENTRYF
GNYTGGTTTPPVLQFTNTLTTVLLDENGVGPLCKGEGLYLSCVDIMGWRVTRNYDVHHWRGLPRYFKITLRKRWVKNPYP
MASLISSLFNNMLPQVQGQPMEGENTQVEEVRVYDGTEPVPGDPDMTRYVDRFGKTKTVFPGN
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1SID A 1 ? 383 ? P49302 1 ? 383 ? 1 383 
2 1 1SID B 1 ? 383 ? P49302 1 ? 383 ? 1 383 
3 1 1SID C 1 ? 383 ? P49302 1 ? 383 ? 1 383 
4 1 1SID D 1 ? 383 ? P49302 1 ? 383 ? 1 383 
5 1 1SID E 1 ? 383 ? P49302 1 ? 383 ? 1 383 
6 1 1SID F 1 ? 383 ? P49302 1 ? 383 ? 1 383 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1SID ALA A 6 ? UNP P49302 SER 6 CONFLICT 6 1 
2 1SID ALA B 6 ? UNP P49302 SER 6 CONFLICT 6 2 
3 1SID ALA C 6 ? UNP P49302 SER 6 CONFLICT 6 3 
4 1SID ALA D 6 ? UNP P49302 SER 6 CONFLICT 6 4 
5 1SID ALA E 6 ? UNP P49302 SER 6 CONFLICT 6 5 
6 1SID ALA F 6 ? UNP P49302 SER 6 CONFLICT 6 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
BGC saccharide          . BETA-D-GLUCOSE   ? 'C6 H12 O6'      180.156 
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GAL D-saccharide        . BETA-D-GALACTOSE ? 'C6 H12 O6'      180.156 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
SIA non-polymer         . 'O-SIALIC ACID'  ? 'C11 H19 N O9'   309.270 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1SID 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_reflns.entry_id                     1SID 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             12.0 
_reflns.d_resolution_high            3.65 
_reflns.number_obs                   242373 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         73.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1SID 
_refine.ls_number_reflns_obs                     242373 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             12.0 
_refine.ls_d_res_high                            3.65 
_refine.ls_percent_reflns_obs                    73.0 
_refine.ls_R_factor_obs                          0.236 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.236 
_refine.ls_R_factor_R_free                       0.253 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        16745 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         258 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               17003 
_refine_hist.d_res_high                       3.65 
_refine_hist.d_res_low                        12.0 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given    ? 1.00000000  0.00000000  0.00000000  0.00000000  1.00000000  0.00000000 0.00000000  0.00000000 1.00000000 0.00000 
0.00000 0.00000 
2 generate ? 0.30901699  -0.80901699 0.50000000  0.80901699  0.50000000  0.30901699 -0.50000000 0.30901699 0.80901699 0.00000 
0.00000 0.00000 
3 generate ? -0.80901699 -0.50000000 0.30901699  0.50000000  -0.30901699 0.80901699 -0.30901699 0.80901699 0.50000000 0.00000 
0.00000 0.00000 
4 generate ? -0.80901699 0.50000000  -0.30901699 -0.50000000 -0.30901699 0.80901699 0.30901699  0.80901699 0.50000000 0.00000 
0.00000 0.00000 
5 generate ? 0.30901699  0.80901699  -0.50000000 -0.80901699 0.50000000  0.30901699 0.50000000  0.30901699 0.80901699 0.00000 
0.00000 0.00000 
# 
_struct.entry_id                  1SID 
_struct.title                     
;MURINE POLYOMAVIRUS COMPLEXED WITH 3'SIALYL LACTOSE
;
_struct.pdbx_descriptor           'POLYOMAVIRUS COAT PROTEIN VP1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SID 
_struct_keywords.pdbx_keywords   VIRUS 
_struct_keywords.text            'COAT PROTEIN, Icosahedral virus, Virus' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 2 ? 
K N N 3 ? 
L N N 4 ? 
M N N 2 ? 
N N N 3 ? 
O N N 4 ? 
P N N 2 ? 
Q N N 3 ? 
R N N 4 ? 
S N N 2 ? 
T N N 3 ? 
U N N 4 ? 
V N N 2 ? 
W N N 3 ? 
X N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;SPACE GROUP I23, A=570 ANG.  THERE ARE TWO VIRIONS PER UNIT
CELL AND 30 VP1 MONOMERS IN THE CRYSTALLOGRAPHIC ASYMMETRIC
UNIT.

IN THIS STRUCTURE THERE ARE INVADING ARMS OF
SYMMETRY-RELATED NEIGHBORING MONOMERS THAT INVADE THE
REFERENCE PENTAMER.  IN REFINEMENT, THE AUTHORS USED
RESIDUES 337 TO THE C-TERMINUS FROM THE SYMMETRY-RELATED
MONOMERS.  IN THIS ENTRY, RESIDUES 337 TO THE C-TERMINUS
ARE PRESENTED AS THE ACTUAL ARM OF THE MONOMER (THAT
INVADES ANOTHER PENTAMER).  BECAUSE THE REFINEMENT DID NOT
USE A BOND BETWEEN RESIDUES 336 AND 337 (BECAUSE THEY
BELONGED TO DIFFERENT CHAINS), THE GEOMETRY OF THAT BOND
IS NOT ACCURATE.

A STRICT PENTAMER SURROUNDED BY FIVE LOCAL PENTAMERS
CONSTITUTES THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT.
APPLICATION OF THE FIRST FIVE MATRICES TO THE COORDINATE
SET GENERATES THAT CRYSTALLOGRAPHIC ASYMMETRIC UNIT.
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  MET A 34  ? ASP A 38  ? MET A 34  ASP A 38  5 ? 5  
HELX_P HELX_P2  2  SER A 132 ? LEU A 136 ? SER A 132 LEU A 136 5 ? 5  
HELX_P HELX_P3  3  ILE A 193 ? ILE A 196 ? ILE A 193 ILE A 196 1 ? 4  
HELX_P HELX_P4  4  ASP A 205 ? LEU A 208 ? ASP A 205 LEU A 208 1 ? 4  
HELX_P HELX_P5  5  SER A 323 ? SER A 326 ? SER A 323 SER A 326 1 ? 4  
HELX_P HELX_P6  6  MET B 34  ? ASP B 38  ? MET B 34  ASP B 38  5 ? 5  
HELX_P HELX_P7  7  SER B 132 ? LEU B 136 ? SER B 132 LEU B 136 5 ? 5  
HELX_P HELX_P8  8  ILE B 193 ? ILE B 196 ? ILE B 193 ILE B 196 1 ? 4  
HELX_P HELX_P9  9  ASP B 205 ? LEU B 208 ? ASP B 205 LEU B 208 1 ? 4  
HELX_P HELX_P10 10 MET B 321 ? ASN B 331 ? MET B 321 ASN B 331 1 ? 11 
HELX_P HELX_P11 11 MET C 34  ? ASP C 38  ? MET C 34  ASP C 38  5 ? 5  
HELX_P HELX_P12 12 SER C 132 ? LEU C 136 ? SER C 132 LEU C 136 5 ? 5  
HELX_P HELX_P13 13 ILE C 193 ? ILE C 196 ? ILE C 193 ILE C 196 1 ? 4  
HELX_P HELX_P14 14 ASP C 205 ? LEU C 208 ? ASP C 205 LEU C 208 1 ? 4  
HELX_P HELX_P15 15 MET C 321 ? SER C 327 ? MET C 321 SER C 327 1 ? 7  
HELX_P HELX_P16 16 VAL C 370 ? ARG C 372 ? VAL C 370 ARG C 372 5 ? 3  
HELX_P HELX_P17 17 MET D 34  ? ASP D 38  ? MET D 34  ASP D 38  1 ? 5  
HELX_P HELX_P18 18 SER D 132 ? LEU D 136 ? SER D 132 LEU D 136 5 ? 5  
HELX_P HELX_P19 19 ASN D 203 ? GLN D 206 ? ASN D 203 GLN D 206 5 ? 4  
HELX_P HELX_P20 20 MET D 321 ? MET D 332 ? MET D 321 MET D 332 1 ? 12 
HELX_P HELX_P21 21 MET E 34  ? ASP E 38  ? MET E 34  ASP E 38  5 ? 5  
HELX_P HELX_P22 22 SER E 132 ? LEU E 136 ? SER E 132 LEU E 136 5 ? 5  
HELX_P HELX_P23 23 ILE E 193 ? ILE E 196 ? ILE E 193 ILE E 196 1 ? 4  
HELX_P HELX_P24 24 ASN E 203 ? GLN E 206 ? ASN E 203 GLN E 206 5 ? 4  
HELX_P HELX_P25 25 MET E 321 ? MET E 332 ? MET E 321 MET E 332 1 ? 12 
HELX_P HELX_P26 26 MET F 34  ? ASP F 38  ? MET F 34  ASP F 38  5 ? 5  
HELX_P HELX_P27 27 SER F 132 ? LEU F 136 ? SER F 132 LEU F 136 5 ? 5  
HELX_P HELX_P28 28 ILE F 193 ? ILE F 196 ? ILE F 193 ILE F 196 1 ? 4  
HELX_P HELX_P29 29 MET F 321 ? MET F 332 ? MET F 321 MET F 332 5 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 19  SG ? ? ? 1_555 B CYS 114 SG ? ? A CYS 19  B CYS 114 1_555 ? ? ? ? ? ? ? 2.018 ? 
disulf2  disulf ? ? A CYS 114 SG ? ? ? 1_555 E CYS 19  SG ? ? A CYS 114 E CYS 19  1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf3  disulf ? ? B CYS 19  SG ? ? ? 1_555 C CYS 114 SG ? ? B CYS 19  C CYS 114 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf4  disulf ? ? C CYS 19  SG ? ? ? 1_555 D CYS 114 SG ? ? C CYS 19  D CYS 114 1_555 ? ? ? ? ? ? ? 2.019 ? 
disulf5  disulf ? ? D CYS 19  SG ? ? ? 1_555 E CYS 114 SG ? ? D CYS 19  E CYS 114 1_555 ? ? ? ? ? ? ? 2.028 ? 
covale1  covale ? ? G SIA .   C2 ? ? ? 1_555 H GAL .   O3 ? ? A SIA 384 A GAL 385 1_555 ? ? ? ? ? ? ? 1.373 ? 
covale2  covale ? ? J SIA .   C2 ? ? ? 1_555 K GAL .   O3 ? ? B SIA 384 B GAL 385 1_555 ? ? ? ? ? ? ? 1.380 ? 
covale3  covale ? ? M SIA .   C2 ? ? ? 1_555 N GAL .   O3 ? ? C SIA 384 C GAL 385 1_555 ? ? ? ? ? ? ? 1.378 ? 
covale4  covale ? ? P SIA .   C2 ? ? ? 1_555 Q GAL .   O3 ? ? D SIA 384 D GAL 385 1_555 ? ? ? ? ? ? ? 1.379 ? 
covale5  covale ? ? S SIA .   C2 ? ? ? 1_555 T GAL .   O3 ? ? E SIA 384 E GAL 385 1_555 ? ? ? ? ? ? ? 1.367 ? 
covale6  covale ? ? V SIA .   C2 ? ? ? 1_555 W GAL .   O3 ? ? F SIA 384 F GAL 385 1_555 ? ? ? ? ? ? ? 1.385 ? 
covale7  covale ? ? H GAL .   C1 ? ? ? 1_555 I BGC .   O4 ? ? A GAL 385 A BGC 386 1_555 ? ? ? ? ? ? ? 1.390 ? 
covale8  covale ? ? K GAL .   C1 ? ? ? 1_555 L BGC .   O4 ? ? B GAL 385 B BGC 386 1_555 ? ? ? ? ? ? ? 1.374 ? 
covale9  covale ? ? N GAL .   C1 ? ? ? 1_555 O BGC .   O4 ? ? C GAL 385 C BGC 386 1_555 ? ? ? ? ? ? ? 1.383 ? 
covale10 covale ? ? Q GAL .   C1 ? ? ? 1_555 R BGC .   O4 ? ? D GAL 385 D BGC 386 1_555 ? ? ? ? ? ? ? 1.381 ? 
covale11 covale ? ? T GAL .   C1 ? ? ? 1_555 U BGC .   O4 ? ? E GAL 385 E BGC 386 1_555 ? ? ? ? ? ? ? 1.385 ? 
covale12 covale ? ? W GAL .   C1 ? ? ? 1_555 X BGC .   O4 ? ? F GAL 385 F BGC 386 1_555 ? ? ? ? ? ? ? 1.394 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 5 ? 
C  ? 3 ? 
D  ? 5 ? 
E  ? 2 ? 
F  ? 5 ? 
G  ? 3 ? 
H  ? 5 ? 
I  ? 2 ? 
J  ? 3 ? 
K  ? 3 ? 
L  ? 3 ? 
M  ? 4 ? 
N  ? 3 ? 
O  ? 5 ? 
P  ? 4 ? 
Q  ? 2 ? 
R  ? 2 ? 
S  ? 4 ? 
T  ? 4 ? 
U  ? 2 ? 
V  ? 2 ? 
W  ? 2 ? 
X  ? 2 ? 
Y  ? 2 ? 
Z  ? 2 ? 
AA ? 2 ? 
BB ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
C  1 2 ? anti-parallel 
C  2 3 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
D  4 5 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
F  4 5 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
H  4 5 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
M  3 4 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
O  4 5 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
Q  1 2 ? anti-parallel 
R  1 2 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
S  3 4 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
T  3 4 ? anti-parallel 
U  1 2 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
X  1 2 ? anti-parallel 
Y  1 2 ? anti-parallel 
Z  1 2 ? anti-parallel 
AA 1 2 ? anti-parallel 
BB 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 VAL A 46  ? LEU A 53  ? VAL A 46  LEU A 53  
A  2 PRO A 303 ? LYS A 316 ? PRO A 303 LYS A 316 
A  3 THR A 116 ? VAL A 130 ? THR A 116 VAL A 130 
A  4 THR A 260 ? VAL A 262 ? THR A 260 VAL A 262 
B  1 SER A 99  ? GLN A 104 ? SER A 99  GLN A 104 
B  2 GLY A 277 ? ILE A 285 ? GLY A 277 ILE A 285 
B  3 GLN A 161 ? GLY A 168 ? GLN A 161 GLY A 168 
B  4 THR A 237 ? THR A 244 ? THR A 237 THR A 244 
B  5 VAL E 252 ? THR E 256 ? VAL E 252 THR E 256 
C  1 LYS A 213 ? LYS A 215 ? LYS A 213 LYS A 215 
C  2 ASP A 173 ? GLY A 176 ? ASP A 173 GLY A 176 
C  3 TRP A 227 ? PRO A 229 ? TRP A 227 PRO A 229 
D  1 VAL A 252 ? THR A 256 ? VAL A 252 THR A 256 
D  2 THR B 237 ? THR B 244 ? THR B 237 THR B 244 
D  3 GLN B 161 ? GLY B 168 ? GLN B 161 GLY B 168 
D  4 GLY B 277 ? ILE B 285 ? GLY B 277 ILE B 285 
D  5 SER B 99  ? GLN B 104 ? SER B 99  GLN B 104 
E  1 ARG A 368 ? VAL A 370 ? ARG A 368 VAL A 370 
E  2 LYS A 375 ? LYS A 377 ? LYS A 375 LYS A 377 
F  1 ILE B 30  ? GLY B 32  ? ILE B 30  GLY B 32  
F  2 VAL F 348 ? TYR F 354 ? VAL F 348 TYR F 354 
F  3 VAL B 46  ? LEU B 53  ? VAL B 46  LEU B 53  
F  4 PRO B 303 ? LYS B 316 ? PRO B 303 LYS B 316 
F  5 THR B 116 ? VAL B 130 ? THR B 116 VAL B 130 
G  1 LYS B 213 ? LYS B 215 ? LYS B 213 LYS B 215 
G  2 ASP B 173 ? GLY B 176 ? ASP B 173 GLY B 176 
G  3 TRP B 227 ? PRO B 229 ? TRP B 227 PRO B 229 
H  1 VAL B 252 ? THR B 256 ? VAL B 252 THR B 256 
H  2 THR C 237 ? THR C 244 ? THR C 237 THR C 244 
H  3 GLN C 161 ? GLY C 168 ? GLN C 161 GLY C 168 
H  4 GLY C 277 ? ILE C 285 ? GLY C 277 ILE C 285 
H  5 SER C 99  ? GLN C 104 ? SER C 99  GLN C 104 
I  1 ARG B 368 ? VAL B 370 ? ARG B 368 VAL B 370 
I  2 LYS B 375 ? LYS B 377 ? LYS B 375 LYS B 377 
J  1 THR C 47  ? LEU C 53  ? THR C 47  LEU C 53  
J  2 PRO C 303 ? VAL C 315 ? PRO C 303 VAL C 315 
J  3 LEU C 117 ? VAL C 130 ? LEU C 117 VAL C 130 
K  1 LYS C 213 ? LYS C 215 ? LYS C 213 LYS C 215 
K  2 ASP C 173 ? GLY C 176 ? ASP C 173 GLY C 176 
K  3 TRP C 227 ? PRO C 229 ? TRP C 227 PRO C 229 
L  1 THR D 47  ? LEU D 53  ? THR D 47  LEU D 53  
L  2 PRO D 303 ? LYS D 316 ? PRO D 303 LYS D 316 
L  3 THR D 116 ? VAL D 130 ? THR D 116 VAL D 130 
M  1 SER D 99  ? GLN D 104 ? SER D 99  GLN D 104 
M  2 GLY D 277 ? ILE D 285 ? GLY D 277 ILE D 285 
M  3 GLN D 161 ? GLY D 168 ? GLN D 161 GLY D 168 
M  4 THR D 237 ? THR D 244 ? THR D 237 THR D 244 
N  1 LYS D 213 ? LYS D 215 ? LYS D 213 LYS D 215 
N  2 ASP D 173 ? GLY D 176 ? ASP D 173 GLY D 176 
N  3 TRP D 227 ? PRO D 229 ? TRP D 227 PRO D 229 
O  1 VAL D 252 ? THR D 256 ? VAL D 252 THR D 256 
O  2 THR E 237 ? THR E 244 ? THR E 237 THR E 244 
O  3 GLN E 161 ? GLY E 168 ? GLN E 161 GLY E 168 
O  4 GLY E 277 ? ILE E 285 ? GLY E 277 ILE E 285 
O  5 SER E 99  ? GLN E 104 ? SER E 99  GLN E 104 
P  1 VAL E 46  ? LEU E 53  ? VAL E 46  LEU E 53  
P  2 ARG E 304 ? LYS E 316 ? ARG E 304 LYS E 316 
P  3 THR E 116 ? VAL E 129 ? THR E 116 VAL E 129 
P  4 THR E 260 ? VAL E 262 ? THR E 260 VAL E 262 
Q  1 LEU E 174 ? GLY E 176 ? LEU E 174 GLY E 176 
Q  2 TRP E 227 ? PRO E 229 ? TRP E 227 PRO E 229 
R  1 THR E 367 ? TYR E 369 ? THR E 367 TYR E 369 
R  2 THR E 376 ? THR E 378 ? THR E 376 THR E 378 
S  1 THR F 47  ? LEU F 53  ? THR F 47  LEU F 53  
S  2 PRO F 303 ? VAL F 315 ? PRO F 303 VAL F 315 
S  3 LEU F 117 ? VAL F 130 ? LEU F 117 VAL F 130 
S  4 PRO F 271 ? CYS F 273 ? PRO F 271 CYS F 273 
T  1 SER F 99  ? GLN F 104 ? SER F 99  GLN F 104 
T  2 GLY F 277 ? ILE F 285 ? GLY F 277 ILE F 285 
T  3 GLN F 161 ? GLY F 168 ? GLN F 161 GLY F 168 
T  4 THR F 237 ? THR F 244 ? THR F 237 THR F 244 
U  1 LEU F 174 ? GLY F 176 ? LEU F 174 GLY F 176 
U  2 TRP F 227 ? PRO F 229 ? TRP F 227 PRO F 229 
V  1 ILE A 285 ? TRP A 288 ? ILE A 285 TRP A 288 
V  2 TRP A 299 ? GLY A 301 ? TRP A 299 GLY A 301 
W  1 PRO B 24  ? LEU B 28  ? PRO B 24  LEU B 28  
W  2 TYR F 354 ? PRO F 359 ? TYR F 354 PRO F 359 
X  1 ILE B 285 ? TRP B 288 ? ILE B 285 TRP B 288 
X  2 TRP B 299 ? GLY B 301 ? TRP B 299 GLY B 301 
Y  1 ILE C 285 ? VAL C 290 ? ILE C 285 VAL C 290 
Y  2 HIS C 297 ? GLY C 301 ? HIS C 297 GLY C 301 
Z  1 ILE D 285 ? TRP D 288 ? ILE D 285 TRP D 288 
Z  2 TRP D 299 ? GLY D 301 ? TRP D 299 GLY D 301 
AA 1 ILE E 285 ? TRP E 288 ? ILE E 285 TRP E 288 
AA 2 TRP E 299 ? GLY E 301 ? TRP E 299 GLY E 301 
BB 1 ILE F 285 ? TRP F 288 ? ILE F 285 TRP F 288 
BB 2 TRP F 299 ? GLY F 301 ? TRP F 299 GLY F 301 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O THR A 47  ? O THR A 47  N LEU A 310 ? N LEU A 310 
A  2 3 O PRO A 303 ? O PRO A 303 N VAL A 130 ? N VAL A 130 
A  3 4 O VAL A 125 ? O VAL A 125 N THR A 261 ? N THR A 261 
B  1 2 O SER A 99  ? O SER A 99  N CYS A 282 ? N CYS A 282 
B  2 3 O TYR A 279 ? O TYR A 279 N GLY A 168 ? N GLY A 168 
B  3 4 O GLN A 161 ? O GLN A 161 N THR A 244 ? N THR A 244 
B  4 5 O GLY A 241 ? O GLY A 241 N PHE E 255 ? N PHE E 255 
C  1 2 O ALA A 214 ? O ALA A 214 N LEU A 174 ? N LEU A 174 
C  2 3 O GLN A 175 ? O GLN A 175 N HIS A 228 ? N HIS A 228 
D  1 2 O LEU A 253 ? O LEU A 253 N TYR B 243 ? N TYR B 243 
D  2 3 O ARG B 238 ? O ARG B 238 N VAL B 167 ? N VAL B 167 
D  3 4 O TYR B 162 ? O TYR B 162 N ILE B 285 ? N ILE B 285 
D  4 5 O LEU B 278 ? O LEU B 278 N LEU B 103 ? N LEU B 103 
E  1 2 O TYR A 369 ? O TYR A 369 N THR A 376 ? N THR A 376 
F  1 2 O ILE B 30  ? O ILE B 30  N VAL F 353 ? N VAL F 353 
F  2 3 O GLU F 349 ? O GLU F 349 N GLU B 50  ? N GLU B 50  
F  3 4 O THR B 47  ? O THR B 47  N LEU B 310 ? N LEU B 310 
F  4 5 O PRO B 303 ? O PRO B 303 N VAL B 130 ? N VAL B 130 
G  1 2 O ALA B 214 ? O ALA B 214 N LEU B 174 ? N LEU B 174 
G  2 3 O GLN B 175 ? O GLN B 175 N HIS B 228 ? N HIS B 228 
H  1 2 O LEU B 253 ? O LEU B 253 N TYR C 243 ? N TYR C 243 
H  2 3 O ARG C 238 ? O ARG C 238 N VAL C 167 ? N VAL C 167 
H  3 4 O TYR C 162 ? O TYR C 162 N ILE C 285 ? N ILE C 285 
H  4 5 O LEU C 278 ? O LEU C 278 N LEU C 103 ? N LEU C 103 
I  1 2 O TYR B 369 ? O TYR B 369 N THR B 376 ? N THR B 376 
J  1 2 O THR C 47  ? O THR C 47  N LEU C 310 ? N LEU C 310 
J  2 3 O PRO C 303 ? O PRO C 303 N VAL C 130 ? N VAL C 130 
K  1 2 O ALA C 214 ? O ALA C 214 N LEU C 174 ? N LEU C 174 
K  2 3 O GLN C 175 ? O GLN C 175 N HIS C 228 ? N HIS C 228 
L  1 2 O THR D 47  ? O THR D 47  N LEU D 310 ? N LEU D 310 
L  2 3 O PRO D 303 ? O PRO D 303 N VAL D 130 ? N VAL D 130 
M  1 2 O SER D 99  ? O SER D 99  N CYS D 282 ? N CYS D 282 
M  2 3 O TYR D 279 ? O TYR D 279 N GLY D 168 ? N GLY D 168 
M  3 4 O GLN D 161 ? O GLN D 161 N THR D 244 ? N THR D 244 
N  1 2 O ALA D 214 ? O ALA D 214 N LEU D 174 ? N LEU D 174 
N  2 3 O GLN D 175 ? O GLN D 175 N HIS D 228 ? N HIS D 228 
O  1 2 O LEU D 253 ? O LEU D 253 N TYR E 243 ? N TYR E 243 
O  2 3 O ARG E 238 ? O ARG E 238 N VAL E 167 ? N VAL E 167 
O  3 4 O TYR E 162 ? O TYR E 162 N ILE E 285 ? N ILE E 285 
O  4 5 O LEU E 278 ? O LEU E 278 N LEU E 103 ? N LEU E 103 
P  1 2 O THR E 47  ? O THR E 47  N LEU E 310 ? N LEU E 310 
P  2 3 O TYR E 305 ? O TYR E 305 N GLU E 128 ? N GLU E 128 
P  3 4 O VAL E 125 ? O VAL E 125 N THR E 261 ? N THR E 261 
Q  1 2 O GLN E 175 ? O GLN E 175 N HIS E 228 ? N HIS E 228 
R  1 2 O THR E 367 ? O THR E 367 N THR E 378 ? N THR E 378 
S  1 2 O THR F 47  ? O THR F 47  N LEU F 310 ? N LEU F 310 
S  2 3 O PRO F 303 ? O PRO F 303 N VAL F 130 ? N VAL F 130 
S  3 4 O TRP F 120 ? O TRP F 120 N CYS F 273 ? N CYS F 273 
T  1 2 O SER F 99  ? O SER F 99  N CYS F 282 ? N CYS F 282 
T  2 3 O TYR F 279 ? O TYR F 279 N GLY F 168 ? N GLY F 168 
T  3 4 O GLN F 161 ? O GLN F 161 N THR F 244 ? N THR F 244 
U  1 2 O GLN F 175 ? O GLN F 175 N HIS F 228 ? N HIS F 228 
V  1 2 O MET A 286 ? O MET A 286 N ARG A 300 ? N ARG A 300 
W  1 2 O VAL B 25  ? O VAL B 25  N GLU F 358 ? N GLU F 358 
X  1 2 O MET B 286 ? O MET B 286 N ARG B 300 ? N ARG B 300 
Y  1 2 O MET C 286 ? O MET C 286 N ARG C 300 ? N ARG C 300 
Z  1 2 O MET D 286 ? O MET D 286 N ARG D 300 ? N ARG D 300 
AA 1 2 O MET E 286 ? O MET E 286 N ARG E 300 ? N ARG E 300 
BB 1 2 O MET F 286 ? O MET F 286 N ARG F 300 ? N ARG F 300 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE SIA A 384' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GAL A 385' 
AC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE BGC A 386' 
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SIA B 384' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GAL B 385' 
AC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE BGC B 386' 
AC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SIA C 384' 
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GAL C 385' 
AC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE BGC C 386' 
BC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SIA D 384' 
BC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GAL D 385' 
BC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE BGC D 386' 
BC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SIA E 384' 
BC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GAL E 385' 
BC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE BGC E 386' 
BC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SIA F 384' 
BC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE GAL F 385' 
BC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE BGC F 386' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8 TYR A 72  ? TYR A 72  . ? 1_555 ? 
2  AC1 8 ARG A 77  ? ARG A 77  . ? 1_555 ? 
3  AC1 8 GLY A 78  ? GLY A 78  . ? 1_555 ? 
4  AC1 8 THR A 291 ? THR A 291 . ? 1_555 ? 
5  AC1 8 VAL A 296 ? VAL A 296 . ? 1_555 ? 
6  AC1 8 HIS A 298 ? HIS A 298 . ? 1_555 ? 
7  AC1 8 GAL H .   ? GAL A 385 . ? 1_555 ? 
8  AC1 8 ASP B 85  ? ASP B 85  . ? 1_555 ? 
9  AC2 4 GLY A 78  ? GLY A 78  . ? 1_555 ? 
10 AC2 4 ASN A 93  ? ASN A 93  . ? 1_555 ? 
11 AC2 4 SIA G .   ? SIA A 384 . ? 1_555 ? 
12 AC2 4 BGC I .   ? BGC A 386 . ? 1_555 ? 
13 AC3 1 GAL H .   ? GAL A 385 . ? 1_555 ? 
14 AC4 6 TYR B 72  ? TYR B 72  . ? 1_555 ? 
15 AC4 6 ARG B 77  ? ARG B 77  . ? 1_555 ? 
16 AC4 6 THR B 291 ? THR B 291 . ? 1_555 ? 
17 AC4 6 VAL B 296 ? VAL B 296 . ? 1_555 ? 
18 AC4 6 HIS B 298 ? HIS B 298 . ? 1_555 ? 
19 AC4 6 GAL K .   ? GAL B 385 . ? 1_555 ? 
20 AC5 4 GLY B 78  ? GLY B 78  . ? 1_555 ? 
21 AC5 4 ASN B 93  ? ASN B 93  . ? 1_555 ? 
22 AC5 4 SIA J .   ? SIA B 384 . ? 1_555 ? 
23 AC5 4 BGC L .   ? BGC B 386 . ? 1_555 ? 
24 AC6 1 GAL K .   ? GAL B 385 . ? 1_555 ? 
25 AC7 5 TYR C 72  ? TYR C 72  . ? 1_555 ? 
26 AC7 5 ARG C 77  ? ARG C 77  . ? 1_555 ? 
27 AC7 5 THR C 291 ? THR C 291 . ? 1_555 ? 
28 AC7 5 HIS C 298 ? HIS C 298 . ? 1_555 ? 
29 AC7 5 GAL N .   ? GAL C 385 . ? 1_555 ? 
30 AC8 4 GLY C 78  ? GLY C 78  . ? 1_555 ? 
31 AC8 4 ASN C 93  ? ASN C 93  . ? 1_555 ? 
32 AC8 4 SIA M .   ? SIA C 384 . ? 1_555 ? 
33 AC8 4 BGC O .   ? BGC C 386 . ? 1_555 ? 
34 AC9 1 GAL N .   ? GAL C 385 . ? 1_555 ? 
35 BC1 6 TYR D 72  ? TYR D 72  . ? 1_555 ? 
36 BC1 6 ARG D 77  ? ARG D 77  . ? 1_555 ? 
37 BC1 6 VAL D 296 ? VAL D 296 . ? 1_555 ? 
38 BC1 6 HIS D 298 ? HIS D 298 . ? 1_555 ? 
39 BC1 6 GAL Q .   ? GAL D 385 . ? 1_555 ? 
40 BC1 6 ASP E 85  ? ASP E 85  . ? 1_555 ? 
41 BC2 4 GLY D 78  ? GLY D 78  . ? 1_555 ? 
42 BC2 4 ASN D 93  ? ASN D 93  . ? 1_555 ? 
43 BC2 4 SIA P .   ? SIA D 384 . ? 1_555 ? 
44 BC2 4 BGC R .   ? BGC D 386 . ? 1_555 ? 
45 BC3 1 GAL Q .   ? GAL D 385 . ? 1_555 ? 
46 BC4 7 TYR E 72  ? TYR E 72  . ? 1_555 ? 
47 BC4 7 ARG E 77  ? ARG E 77  . ? 1_555 ? 
48 BC4 7 GLY E 78  ? GLY E 78  . ? 1_555 ? 
49 BC4 7 THR E 291 ? THR E 291 . ? 1_555 ? 
50 BC4 7 VAL E 296 ? VAL E 296 . ? 1_555 ? 
51 BC4 7 HIS E 298 ? HIS E 298 . ? 1_555 ? 
52 BC4 7 GAL T .   ? GAL E 385 . ? 1_555 ? 
53 BC5 6 GLY E 78  ? GLY E 78  . ? 1_555 ? 
54 BC5 6 ILE E 79  ? ILE E 79  . ? 1_555 ? 
55 BC5 6 ASN E 93  ? ASN E 93  . ? 1_555 ? 
56 BC5 6 THR E 94  ? THR E 94  . ? 1_555 ? 
57 BC5 6 SIA S .   ? SIA E 384 . ? 1_555 ? 
58 BC5 6 BGC U .   ? BGC E 386 . ? 1_555 ? 
59 BC6 1 GAL T .   ? GAL E 385 . ? 1_555 ? 
60 BC7 7 TYR F 72  ? TYR F 72  . ? 1_555 ? 
61 BC7 7 ARG F 77  ? ARG F 77  . ? 1_555 ? 
62 BC7 7 THR F 291 ? THR F 291 . ? 1_555 ? 
63 BC7 7 ASN F 293 ? ASN F 293 . ? 1_555 ? 
64 BC7 7 VAL F 296 ? VAL F 296 . ? 1_555 ? 
65 BC7 7 HIS F 298 ? HIS F 298 . ? 1_555 ? 
66 BC7 7 GAL W .   ? GAL F 385 . ? 1_555 ? 
67 BC8 5 GLY F 78  ? GLY F 78  . ? 1_555 ? 
68 BC8 5 ILE F 79  ? ILE F 79  . ? 1_555 ? 
69 BC8 5 ASN F 93  ? ASN F 93  . ? 1_555 ? 
70 BC8 5 SIA V .   ? SIA F 384 . ? 1_555 ? 
71 BC8 5 BGC X .   ? BGC F 386 . ? 1_555 ? 
72 BC9 1 GAL W .   ? GAL F 385 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1SID 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SID 
_atom_sites.fract_transf_matrix[1][1]   0.001754 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.001754 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.001754 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . LYS A 1 17  ? -3.815  57.131  174.225 1.00 207.13 ? 17  LYS A N   1 
ATOM   2     C CA  . LYS A 1 17  ? -3.265  56.237  173.196 1.00 205.59 ? 17  LYS A CA  1 
ATOM   3     C C   . LYS A 1 17  ? -3.475  54.758  173.608 1.00 202.72 ? 17  LYS A C   1 
ATOM   4     O O   . LYS A 1 17  ? -3.995  53.940  172.817 1.00 204.42 ? 17  LYS A O   1 
ATOM   5     C CB  . LYS A 1 17  ? -1.760  56.556  172.961 1.00 205.91 ? 17  LYS A CB  1 
ATOM   6     C CG  . LYS A 1 17  ? -1.092  55.913  171.705 1.00 205.54 ? 17  LYS A CG  1 
ATOM   7     C CD  . LYS A 1 17  ? 0.304   56.519  171.365 1.00 202.33 ? 17  LYS A CD  1 
ATOM   8     C CE  . LYS A 1 17  ? 1.362   56.266  172.451 1.00 200.20 ? 17  LYS A CE  1 
ATOM   9     N NZ  . LYS A 1 17  ? 2.697   56.863  172.124 1.00 197.69 ? 17  LYS A NZ  1 
ATOM   10    N N   . ALA A 1 18  ? -3.129  54.449  174.864 1.00 196.37 ? 18  ALA A N   1 
ATOM   11    C CA  . ALA A 1 18  ? -3.252  53.094  175.411 1.00 184.95 ? 18  ALA A CA  1 
ATOM   12    C C   . ALA A 1 18  ? -3.256  53.061  176.947 1.00 174.87 ? 18  ALA A C   1 
ATOM   13    O O   . ALA A 1 18  ? -3.609  54.045  177.626 1.00 173.85 ? 18  ALA A O   1 
ATOM   14    C CB  . ALA A 1 18  ? -2.121  52.173  174.850 1.00 187.12 ? 18  ALA A CB  1 
ATOM   15    N N   . CYS A 1 19  ? -2.815  51.924  177.472 1.00 161.19 ? 19  CYS A N   1 
ATOM   16    C CA  . CYS A 1 19  ? -2.777  51.715  178.891 1.00 146.80 ? 19  CYS A CA  1 
ATOM   17    C C   . CYS A 1 19  ? -1.496  51.073  179.340 1.00 141.39 ? 19  CYS A C   1 
ATOM   18    O O   . CYS A 1 19  ? -0.954  50.188  178.660 1.00 143.15 ? 19  CYS A O   1 
ATOM   19    C CB  . CYS A 1 19  ? -3.936  50.819  179.286 1.00 139.92 ? 19  CYS A CB  1 
ATOM   20    S SG  . CYS A 1 19  ? -5.514  51.644  178.980 1.00 131.36 ? 19  CYS A SG  1 
ATOM   21    N N   . PRO A 1 20  ? -0.922  51.604  180.426 1.00 134.00 ? 20  PRO A N   1 
ATOM   22    C CA  . PRO A 1 20  ? 0.313   51.034  180.954 1.00 127.77 ? 20  PRO A CA  1 
ATOM   23    C C   . PRO A 1 20  ? -0.160  49.740  181.637 1.00 124.22 ? 20  PRO A C   1 
ATOM   24    O O   . PRO A 1 20  ? -1.296  49.685  182.125 1.00 124.62 ? 20  PRO A O   1 
ATOM   25    C CB  . PRO A 1 20  ? 0.772   52.103  181.952 1.00 126.87 ? 20  PRO A CB  1 
ATOM   26    C CG  . PRO A 1 20  ? -0.511  52.734  182.405 1.00 125.97 ? 20  PRO A CG  1 
ATOM   27    C CD  . PRO A 1 20  ? -1.290  52.847  181.131 1.00 130.27 ? 20  PRO A CD  1 
ATOM   28    N N   . ARG A 1 21  ? 0.658   48.691  181.625 1.00 118.98 ? 21  ARG A N   1 
ATOM   29    C CA  . ARG A 1 21  ? 0.261   47.414  182.241 1.00 115.35 ? 21  ARG A CA  1 
ATOM   30    C C   . ARG A 1 21  ? 1.120   46.974  183.439 1.00 103.28 ? 21  ARG A C   1 
ATOM   31    O O   . ARG A 1 21  ? 2.186   46.369  183.271 1.00 103.59 ? 21  ARG A O   1 
ATOM   32    C CB  . ARG A 1 21  ? 0.189   46.309  181.170 1.00 129.21 ? 21  ARG A CB  1 
ATOM   33    C CG  . ARG A 1 21  ? 1.047   46.566  179.913 1.00 145.86 ? 21  ARG A CG  1 
ATOM   34    C CD  . ARG A 1 21  ? 1.005   45.389  178.923 1.00 161.51 ? 21  ARG A CD  1 
ATOM   35    N NE  . ARG A 1 21  ? 1.980   45.535  177.830 1.00 177.06 ? 21  ARG A NE  1 
ATOM   36    C CZ  . ARG A 1 21  ? 2.812   44.573  177.402 1.00 184.64 ? 21  ARG A CZ  1 
ATOM   37    N NH1 . ARG A 1 21  ? 2.809   43.357  177.970 1.00 189.07 ? 21  ARG A NH1 1 
ATOM   38    N NH2 . ARG A 1 21  ? 3.667   44.831  176.407 1.00 188.14 ? 21  ARG A NH2 1 
ATOM   39    N N   . PRO A 1 22  ? 0.641   47.242  184.666 1.00 91.07  ? 22  PRO A N   1 
ATOM   40    C CA  . PRO A 1 22  ? 1.338   46.897  185.898 1.00 84.79  ? 22  PRO A CA  1 
ATOM   41    C C   . PRO A 1 22  ? 1.887   45.494  185.853 1.00 80.23  ? 22  PRO A C   1 
ATOM   42    O O   . PRO A 1 22  ? 1.391   44.634  185.123 1.00 77.21  ? 22  PRO A O   1 
ATOM   43    C CB  . PRO A 1 22  ? 0.243   47.044  186.942 1.00 83.83  ? 22  PRO A CB  1 
ATOM   44    C CG  . PRO A 1 22  ? -0.521  48.164  186.437 1.00 82.45  ? 22  PRO A CG  1 
ATOM   45    C CD  . PRO A 1 22  ? -0.679  47.798  184.986 1.00 86.88  ? 22  PRO A CD  1 
ATOM   46    N N   . ALA A 1 23  ? 2.948   45.278  186.609 1.00 76.36  ? 23  ALA A N   1 
ATOM   47    C CA  . ALA A 1 23  ? 3.560   43.970  186.647 1.00 72.97  ? 23  ALA A CA  1 
ATOM   48    C C   . ALA A 1 23  ? 2.573   42.894  187.112 1.00 70.19  ? 23  ALA A C   1 
ATOM   49    O O   . ALA A 1 23  ? 1.651   43.161  187.874 1.00 68.70  ? 23  ALA A O   1 
ATOM   50    C CB  . ALA A 1 23  ? 4.775   44.004  187.551 1.00 75.83  ? 23  ALA A CB  1 
ATOM   51    N N   . PRO A 1 24  ? 2.677   41.695  186.543 1.00 67.39  ? 24  PRO A N   1 
ATOM   52    C CA  . PRO A 1 24  ? 1.824   40.554  186.876 1.00 63.87  ? 24  PRO A CA  1 
ATOM   53    C C   . PRO A 1 24  ? 2.254   39.955  188.162 1.00 58.15  ? 24  PRO A C   1 
ATOM   54    O O   . PRO A 1 24  ? 3.419   39.616  188.390 1.00 55.42  ? 24  PRO A O   1 
ATOM   55    C CB  . PRO A 1 24  ? 2.066   39.585  185.739 1.00 66.06  ? 24  PRO A CB  1 
ATOM   56    C CG  . PRO A 1 24  ? 2.266   40.506  184.612 1.00 72.42  ? 24  PRO A CG  1 
ATOM   57    C CD  . PRO A 1 24  ? 3.225   41.531  185.195 1.00 70.36  ? 24  PRO A CD  1 
ATOM   58    N N   . VAL A 1 25  ? 1.246   39.708  188.953 1.00 54.05  ? 25  VAL A N   1 
ATOM   59    C CA  . VAL A 1 25  ? 1.434   39.182  190.253 1.00 50.53  ? 25  VAL A CA  1 
ATOM   60    C C   . VAL A 1 25  ? 0.371   38.165  190.514 1.00 50.96  ? 25  VAL A C   1 
ATOM   61    O O   . VAL A 1 25  ? -0.661  38.139  189.861 1.00 51.59  ? 25  VAL A O   1 
ATOM   62    C CB  . VAL A 1 25  ? 1.317   40.332  191.219 1.00 47.67  ? 25  VAL A CB  1 
ATOM   63    C CG1 . VAL A 1 25  ? 1.014   39.870  192.626 1.00 51.04  ? 25  VAL A CG1 1 
ATOM   64    C CG2 . VAL A 1 25  ? 2.586   41.083  191.182 1.00 46.82  ? 25  VAL A CG2 1 
ATOM   65    N N   . PRO A 1 26  ? 0.667   37.222  191.382 1.00 52.76  ? 26  PRO A N   1 
ATOM   66    C CA  . PRO A 1 26  ? -0.321  36.210  191.699 1.00 56.73  ? 26  PRO A CA  1 
ATOM   67    C C   . PRO A 1 26  ? -1.564  36.905  192.256 1.00 59.75  ? 26  PRO A C   1 
ATOM   68    O O   . PRO A 1 26  ? -1.499  37.695  193.217 1.00 55.32  ? 26  PRO A O   1 
ATOM   69    C CB  . PRO A 1 26  ? 0.395   35.382  192.763 1.00 62.34  ? 26  PRO A CB  1 
ATOM   70    C CG  . PRO A 1 26  ? 1.450   36.333  193.320 1.00 59.59  ? 26  PRO A CG  1 
ATOM   71    C CD  . PRO A 1 26  ? 1.933   36.945  192.061 1.00 55.64  ? 26  PRO A CD  1 
ATOM   72    N N   . LYS A 1 27  ? -2.693  36.643  191.620 1.00 62.03  ? 27  LYS A N   1 
ATOM   73    C CA  . LYS A 1 27  ? -3.916  37.263  192.063 1.00 62.58  ? 27  LYS A CA  1 
ATOM   74    C C   . LYS A 1 27  ? -4.458  36.577  193.297 1.00 54.85  ? 27  LYS A C   1 
ATOM   75    O O   . LYS A 1 27  ? -4.566  35.332  193.359 1.00 47.72  ? 27  LYS A O   1 
ATOM   76    C CB  . LYS A 1 27  ? -4.962  37.269  190.949 1.00 74.61  ? 27  LYS A CB  1 
ATOM   77    C CG  . LYS A 1 27  ? -5.942  36.092  190.963 1.00 89.26  ? 27  LYS A CG  1 
ATOM   78    C CD  . LYS A 1 27  ? -6.979  36.216  189.839 1.00 102.81 ? 27  LYS A CD  1 
ATOM   79    C CE  . LYS A 1 27  ? -7.841  37.476  190.001 1.00 113.71 ? 27  LYS A CE  1 
ATOM   80    N NZ  . LYS A 1 27  ? -8.832  37.665  188.889 1.00 122.70 ? 27  LYS A NZ  1 
ATOM   81    N N   . LEU A 1 28  ? -4.745  37.408  194.291 1.00 49.09  ? 28  LEU A N   1 
ATOM   82    C CA  . LEU A 1 28  ? -5.315  36.932  195.528 1.00 45.70  ? 28  LEU A CA  1 
ATOM   83    C C   . LEU A 1 28  ? -6.696  36.465  195.189 1.00 43.39  ? 28  LEU A C   1 
ATOM   84    O O   . LEU A 1 28  ? -7.342  36.999  194.298 1.00 45.23  ? 28  LEU A O   1 
ATOM   85    C CB  . LEU A 1 28  ? -5.434  38.037  196.550 1.00 45.02  ? 28  LEU A CB  1 
ATOM   86    C CG  . LEU A 1 28  ? -6.235  37.527  197.742 1.00 44.37  ? 28  LEU A CG  1 
ATOM   87    C CD1 . LEU A 1 28  ? -5.517  36.365  198.444 1.00 51.86  ? 28  LEU A CD1 1 
ATOM   88    C CD2 . LEU A 1 28  ? -6.452  38.672  198.670 1.00 47.14  ? 28  LEU A CD2 1 
ATOM   89    N N   . LEU A 1 29  ? -7.184  35.517  195.951 1.00 39.94  ? 29  LEU A N   1 
ATOM   90    C CA  . LEU A 1 29  ? -8.477  34.995  195.670 1.00 37.61  ? 29  LEU A CA  1 
ATOM   91    C C   . LEU A 1 29  ? -9.389  35.252  196.729 1.00 34.95  ? 29  LEU A C   1 
ATOM   92    O O   . LEU A 1 29  ? -10.582 35.342  196.519 1.00 30.42  ? 29  LEU A O   1 
ATOM   93    C CB  . LEU A 1 29  ? -8.389  33.514  195.554 1.00 43.08  ? 29  LEU A CB  1 
ATOM   94    C CG  . LEU A 1 29  ? -8.125  33.475  194.081 1.00 53.96  ? 29  LEU A CG  1 
ATOM   95    C CD1 . LEU A 1 29  ? -7.734  32.092  193.655 1.00 60.35  ? 29  LEU A CD1 1 
ATOM   96    C CD2 . LEU A 1 29  ? -9.398  33.978  193.400 1.00 55.34  ? 29  LEU A CD2 1 
ATOM   97    N N   . ILE A 1 30  ? -8.806  35.239  197.904 1.00 36.65  ? 30  ILE A N   1 
ATOM   98    C CA  . ILE A 1 30  ? -9.555  35.395  199.101 1.00 36.49  ? 30  ILE A CA  1 
ATOM   99    C C   . ILE A 1 30  ? -8.560  35.300  200.198 1.00 34.15  ? 30  ILE A C   1 
ATOM   100   O O   . ILE A 1 30  ? -7.542  34.622  200.067 1.00 36.36  ? 30  ILE A O   1 
ATOM   101   C CB  . ILE A 1 30  ? -10.478 34.210  199.244 1.00 41.76  ? 30  ILE A CB  1 
ATOM   102   C CG1 . ILE A 1 30  ? -11.125 34.217  200.619 1.00 46.82  ? 30  ILE A CG1 1 
ATOM   103   C CG2 . ILE A 1 30  ? -9.716  32.924  198.949 1.00 38.41  ? 30  ILE A CG2 1 
ATOM   104   C CD1 . ILE A 1 30  ? -12.291 33.251  200.711 1.00 60.08  ? 30  ILE A CD1 1 
ATOM   105   N N   . LYS A 1 31  ? -8.841  35.975  201.283 1.00 31.52  ? 31  LYS A N   1 
ATOM   106   C CA  . LYS A 1 31  ? -7.935  35.907  202.375 1.00 38.25  ? 31  LYS A CA  1 
ATOM   107   C C   . LYS A 1 31  ? -8.787  36.032  203.568 1.00 43.36  ? 31  LYS A C   1 
ATOM   108   O O   . LYS A 1 31  ? -9.942  36.427  203.466 1.00 46.24  ? 31  LYS A O   1 
ATOM   109   C CB  . LYS A 1 31  ? -6.921  37.037  202.328 1.00 40.94  ? 31  LYS A CB  1 
ATOM   110   C CG  . LYS A 1 31  ? -7.151  38.178  203.319 1.00 46.92  ? 31  LYS A CG  1 
ATOM   111   C CD  . LYS A 1 31  ? -6.016  39.192  203.185 1.00 59.53  ? 31  LYS A CD  1 
ATOM   112   C CE  . LYS A 1 31  ? -6.180  40.403  204.110 1.00 70.74  ? 31  LYS A CE  1 
ATOM   113   N NZ  . LYS A 1 31  ? -5.272  41.562  203.710 1.00 74.23  ? 31  LYS A NZ  1 
ATOM   114   N N   . GLY A 1 32  ? -8.192  35.688  204.698 1.00 51.60  ? 32  GLY A N   1 
ATOM   115   C CA  . GLY A 1 32  ? -8.860  35.738  205.974 1.00 60.91  ? 32  GLY A CA  1 
ATOM   116   C C   . GLY A 1 32  ? -8.289  34.632  206.841 1.00 66.49  ? 32  GLY A C   1 
ATOM   117   O O   . GLY A 1 32  ? -7.068  34.541  207.037 1.00 64.93  ? 32  GLY A O   1 
ATOM   118   N N   . GLY A 1 33  ? -9.179  33.757  207.306 1.00 71.93  ? 33  GLY A N   1 
ATOM   119   C CA  . GLY A 1 33  ? -8.811  32.646  208.178 1.00 72.25  ? 33  GLY A CA  1 
ATOM   120   C C   . GLY A 1 33  ? -9.096  31.290  207.567 1.00 69.09  ? 33  GLY A C   1 
ATOM   121   O O   . GLY A 1 33  ? -9.470  31.192  206.397 1.00 65.43  ? 33  GLY A O   1 
ATOM   122   N N   . MET A 1 34  ? -9.033  30.251  208.384 1.00 67.01  ? 34  MET A N   1 
ATOM   123   C CA  . MET A 1 34  ? -9.212  28.907  207.859 1.00 69.01  ? 34  MET A CA  1 
ATOM   124   C C   . MET A 1 34  ? -10.381 28.655  206.893 1.00 65.72  ? 34  MET A C   1 
ATOM   125   O O   . MET A 1 34  ? -10.252 27.928  205.899 1.00 61.34  ? 34  MET A O   1 
ATOM   126   C CB  . MET A 1 34  ? -9.156  27.893  209.003 1.00 76.99  ? 34  MET A CB  1 
ATOM   127   C CG  . MET A 1 34  ? -7.747  27.742  209.604 1.00 77.55  ? 34  MET A CG  1 
ATOM   128   S SD  . MET A 1 34  ? -6.507  27.217  208.357 1.00 73.95  ? 34  MET A SD  1 
ATOM   129   C CE  . MET A 1 34  ? -6.569  25.415  208.527 1.00 85.42  ? 34  MET A CE  1 
ATOM   130   N N   . GLU A 1 35  ? -11.490 29.321  207.143 1.00 65.89  ? 35  GLU A N   1 
ATOM   131   C CA  . GLU A 1 35  ? -12.681 29.185  206.309 1.00 69.60  ? 35  GLU A CA  1 
ATOM   132   C C   . GLU A 1 35  ? -12.371 29.357  204.839 1.00 67.92  ? 35  GLU A C   1 
ATOM   133   O O   . GLU A 1 35  ? -12.993 28.782  203.949 1.00 69.10  ? 35  GLU A O   1 
ATOM   134   C CB  . GLU A 1 35  ? -13.691 30.259  206.684 1.00 74.52  ? 35  GLU A CB  1 
ATOM   135   C CG  . GLU A 1 35  ? -13.228 31.681  206.372 1.00 81.84  ? 35  GLU A CG  1 
ATOM   136   C CD  . GLU A 1 35  ? -12.327 32.293  207.441 1.00 86.10  ? 35  GLU A CD  1 
ATOM   137   O OE1 . GLU A 1 35  ? -11.891 31.587  208.395 1.00 86.49  ? 35  GLU A OE1 1 
ATOM   138   O OE2 . GLU A 1 35  ? -12.069 33.514  207.319 1.00 88.51  ? 35  GLU A OE2 1 
ATOM   139   N N   . VAL A 1 36  ? -11.446 30.244  204.592 1.00 64.87  ? 36  VAL A N   1 
ATOM   140   C CA  . VAL A 1 36  ? -11.065 30.532  203.254 1.00 65.88  ? 36  VAL A CA  1 
ATOM   141   C C   . VAL A 1 36  ? -10.804 29.236  202.455 1.00 65.56  ? 36  VAL A C   1 
ATOM   142   O O   . VAL A 1 36  ? -11.343 29.058  201.360 1.00 62.98  ? 36  VAL A O   1 
ATOM   143   C CB  . VAL A 1 36  ? -9.852  31.484  203.315 1.00 69.76  ? 36  VAL A CB  1 
ATOM   144   C CG1 . VAL A 1 36  ? -9.370  31.854  201.928 1.00 74.49  ? 36  VAL A CG1 1 
ATOM   145   C CG2 . VAL A 1 36  ? -10.216 32.744  204.122 1.00 66.34  ? 36  VAL A CG2 1 
ATOM   146   N N   . LEU A 1 37  ? -10.101 28.289  203.073 1.00 67.55  ? 37  LEU A N   1 
ATOM   147   C CA  . LEU A 1 37  ? -9.731  27.026  202.432 1.00 72.94  ? 37  LEU A CA  1 
ATOM   148   C C   . LEU A 1 37  ? -10.849 26.381  201.655 1.00 77.09  ? 37  LEU A C   1 
ATOM   149   O O   . LEU A 1 37  ? -10.635 25.768  200.602 1.00 78.70  ? 37  LEU A O   1 
ATOM   150   C CB  . LEU A 1 37  ? -9.256  26.030  203.481 1.00 73.53  ? 37  LEU A CB  1 
ATOM   151   C CG  . LEU A 1 37  ? -7.833  26.174  204.013 1.00 73.84  ? 37  LEU A CG  1 
ATOM   152   C CD1 . LEU A 1 37  ? -7.678  27.489  204.691 1.00 76.19  ? 37  LEU A CD1 1 
ATOM   153   C CD2 . LEU A 1 37  ? -7.520  25.073  205.004 1.00 78.07  ? 37  LEU A CD2 1 
ATOM   154   N N   . ASP A 1 38  ? -12.038 26.519  202.226 1.00 81.65  ? 38  ASP A N   1 
ATOM   155   C CA  . ASP A 1 38  ? -13.274 25.964  201.700 1.00 86.41  ? 38  ASP A CA  1 
ATOM   156   C C   . ASP A 1 38  ? -13.567 26.351  200.293 1.00 84.90  ? 38  ASP A C   1 
ATOM   157   O O   . ASP A 1 38  ? -14.304 25.673  199.584 1.00 86.17  ? 38  ASP A O   1 
ATOM   158   C CB  . ASP A 1 38  ? -14.444 26.389  202.574 1.00 96.08  ? 38  ASP A CB  1 
ATOM   159   C CG  . ASP A 1 38  ? -14.397 25.757  203.954 1.00 107.00 ? 38  ASP A CG  1 
ATOM   160   O OD1 . ASP A 1 38  ? -13.355 25.142  204.310 1.00 113.21 ? 38  ASP A OD1 1 
ATOM   161   O OD2 . ASP A 1 38  ? -15.410 25.872  204.685 1.00 114.14 ? 38  ASP A OD2 1 
ATOM   162   N N   . LEU A 1 39  ? -13.071 27.496  199.893 1.00 82.88  ? 39  LEU A N   1 
ATOM   163   C CA  . LEU A 1 39  ? -13.319 27.886  198.548 1.00 83.91  ? 39  LEU A CA  1 
ATOM   164   C C   . LEU A 1 39  ? -12.788 26.779  197.665 1.00 84.10  ? 39  LEU A C   1 
ATOM   165   O O   . LEU A 1 39  ? -11.811 26.112  197.996 1.00 86.86  ? 39  LEU A O   1 
ATOM   166   C CB  . LEU A 1 39  ? -12.607 29.182  198.257 1.00 87.00  ? 39  LEU A CB  1 
ATOM   167   C CG  . LEU A 1 39  ? -12.799 29.785  196.868 1.00 91.28  ? 39  LEU A CG  1 
ATOM   168   C CD1 . LEU A 1 39  ? -14.099 29.322  196.137 1.00 91.51  ? 39  LEU A CD1 1 
ATOM   169   C CD2 . LEU A 1 39  ? -12.763 31.303  197.078 1.00 93.75  ? 39  LEU A CD2 1 
ATOM   170   N N   . VAL A 1 40  ? -13.531 26.493  196.617 1.00 83.65  ? 40  VAL A N   1 
ATOM   171   C CA  . VAL A 1 40  ? -13.131 25.501  195.659 1.00 85.84  ? 40  VAL A CA  1 
ATOM   172   C C   . VAL A 1 40  ? -11.910 26.059  195.001 1.00 84.99  ? 40  VAL A C   1 
ATOM   173   O O   . VAL A 1 40  ? -11.931 26.648  193.923 1.00 87.65  ? 40  VAL A O   1 
ATOM   174   C CB  . VAL A 1 40  ? -14.162 25.365  194.643 1.00 92.27  ? 40  VAL A CB  1 
ATOM   175   C CG1 . VAL A 1 40  ? -13.685 24.411  193.567 1.00 98.11  ? 40  VAL A CG1 1 
ATOM   176   C CG2 . VAL A 1 40  ? -15.427 24.894  195.314 1.00 100.53 ? 40  VAL A CG2 1 
ATOM   177   N N   . THR A 1 41  ? -10.827 25.826  195.686 1.00 85.45  ? 41  THR A N   1 
ATOM   178   C CA  . THR A 1 41  ? -9.530  26.311  195.317 1.00 85.52  ? 41  THR A CA  1 
ATOM   179   C C   . THR A 1 41  ? -9.015  25.961  193.903 1.00 80.05  ? 41  THR A C   1 
ATOM   180   O O   . THR A 1 41  ? -8.059  26.552  193.428 1.00 77.73  ? 41  THR A O   1 
ATOM   181   C CB  . THR A 1 41  ? -8.553  25.886  196.463 1.00 92.70  ? 41  THR A CB  1 
ATOM   182   O OG1 . THR A 1 41  ? -9.087  24.707  197.121 1.00 97.68  ? 41  THR A OG1 1 
ATOM   183   C CG2 . THR A 1 41  ? -8.409  27.029  197.522 1.00 88.85  ? 41  THR A CG2 1 
ATOM   184   N N   . GLY A 1 42  ? -9.664  25.068  193.179 1.00 75.23  ? 42  GLY A N   1 
ATOM   185   C CA  . GLY A 1 42  ? -9.098  24.773  191.879 1.00 76.75  ? 42  GLY A CA  1 
ATOM   186   C C   . GLY A 1 42  ? -7.870  23.901  192.106 1.00 75.86  ? 42  GLY A C   1 
ATOM   187   O O   . GLY A 1 42  ? -7.754  23.357  193.192 1.00 75.39  ? 42  GLY A O   1 
ATOM   188   N N   . PRO A 1 43  ? -6.912  23.787  191.164 1.00 76.05  ? 43  PRO A N   1 
ATOM   189   C CA  . PRO A 1 43  ? -5.730  22.939  191.351 1.00 76.35  ? 43  PRO A CA  1 
ATOM   190   C C   . PRO A 1 43  ? -4.351  23.598  191.501 1.00 77.17  ? 43  PRO A C   1 
ATOM   191   O O   . PRO A 1 43  ? -3.461  23.083  192.191 1.00 80.41  ? 43  PRO A O   1 
ATOM   192   C CB  . PRO A 1 43  ? -5.758  22.112  190.088 1.00 75.16  ? 43  PRO A CB  1 
ATOM   193   C CG  . PRO A 1 43  ? -6.036  23.178  189.071 1.00 75.71  ? 43  PRO A CG  1 
ATOM   194   C CD  . PRO A 1 43  ? -7.050  24.122  189.738 1.00 77.60  ? 43  PRO A CD  1 
ATOM   195   N N   . ASP A 1 44  ? -4.129  24.701  190.817 1.00 76.19  ? 44  ASP A N   1 
ATOM   196   C CA  . ASP A 1 44  ? -2.831  25.318  190.938 1.00 74.78  ? 44  ASP A CA  1 
ATOM   197   C C   . ASP A 1 44  ? -2.921  26.418  191.942 1.00 68.45  ? 44  ASP A C   1 
ATOM   198   O O   . ASP A 1 44  ? -2.017  27.231  192.096 1.00 63.46  ? 44  ASP A O   1 
ATOM   199   C CB  . ASP A 1 44  ? -2.379  25.771  189.576 1.00 85.23  ? 44  ASP A CB  1 
ATOM   200   C CG  . ASP A 1 44  ? -2.343  24.615  188.594 1.00 92.94  ? 44  ASP A CG  1 
ATOM   201   O OD1 . ASP A 1 44  ? -2.259  23.442  189.057 1.00 94.09  ? 44  ASP A OD1 1 
ATOM   202   O OD2 . ASP A 1 44  ? -2.430  24.870  187.371 1.00 97.79  ? 44  ASP A OD2 1 
ATOM   203   N N   . SER A 1 45  ? -4.039  26.390  192.654 1.00 64.32  ? 45  SER A N   1 
ATOM   204   C CA  . SER A 1 45  ? -4.314  27.318  193.714 1.00 62.70  ? 45  SER A CA  1 
ATOM   205   C C   . SER A 1 45  ? -3.159  27.190  194.665 1.00 59.01  ? 45  SER A C   1 
ATOM   206   O O   . SER A 1 45  ? -2.363  26.236  194.608 1.00 62.03  ? 45  SER A O   1 
ATOM   207   C CB  . SER A 1 45  ? -5.574  26.900  194.463 1.00 65.99  ? 45  SER A CB  1 
ATOM   208   O OG  . SER A 1 45  ? -5.426  25.651  195.128 1.00 65.92  ? 45  SER A OG  1 
ATOM   209   N N   . VAL A 1 46  ? -3.065  28.146  195.560 1.00 53.70  ? 46  VAL A N   1 
ATOM   210   C CA  . VAL A 1 46  ? -2.008  28.093  196.510 1.00 45.32  ? 46  VAL A CA  1 
ATOM   211   C C   . VAL A 1 46  ? -2.509  28.649  197.764 1.00 42.53  ? 46  VAL A C   1 
ATOM   212   O O   . VAL A 1 46  ? -3.166  29.701  197.801 1.00 41.79  ? 46  VAL A O   1 
ATOM   213   C CB  . VAL A 1 46  ? -0.878  28.957  196.165 1.00 44.00  ? 46  VAL A CB  1 
ATOM   214   C CG1 . VAL A 1 46  ? 0.292   28.463  196.910 1.00 46.99  ? 46  VAL A CG1 1 
ATOM   215   C CG2 . VAL A 1 46  ? -0.650  28.994  194.687 1.00 50.79  ? 46  VAL A CG2 1 
ATOM   216   N N   . THR A 1 47  ? -1.991  28.082  198.817 1.00 37.93  ? 47  THR A N   1 
ATOM   217   C CA  . THR A 1 47  ? -2.450  28.520  200.071 1.00 35.93  ? 47  THR A CA  1 
ATOM   218   C C   . THR A 1 47  ? -1.352  28.935  200.991 1.00 34.45  ? 47  THR A C   1 
ATOM   219   O O   . THR A 1 47  ? -0.319  28.262  201.109 1.00 34.20  ? 47  THR A O   1 
ATOM   220   C CB  . THR A 1 47  ? -3.278  27.431  200.627 1.00 38.11  ? 47  THR A CB  1 
ATOM   221   O OG1 . THR A 1 47  ? -4.112  26.897  199.554 1.00 36.61  ? 47  THR A OG1 1 
ATOM   222   C CG2 . THR A 1 47  ? -4.081  27.979  201.813 1.00 36.60  ? 47  THR A CG2 1 
ATOM   223   N N   . GLU A 1 48  ? -1.525  30.128  201.528 1.00 35.30  ? 48  GLU A N   1 
ATOM   224   C CA  . GLU A 1 48  ? -0.560  30.675  202.463 1.00 42.62  ? 48  GLU A CA  1 
ATOM   225   C C   . GLU A 1 48  ? -1.208  30.639  203.840 1.00 37.88  ? 48  GLU A C   1 
ATOM   226   O O   . GLU A 1 48  ? -2.335  31.101  204.015 1.00 41.66  ? 48  GLU A O   1 
ATOM   227   C CB  . GLU A 1 48  ? -0.138  32.121  202.080 1.00 50.90  ? 48  GLU A CB  1 
ATOM   228   C CG  . GLU A 1 48  ? 0.930   32.222  200.923 1.00 69.22  ? 48  GLU A CG  1 
ATOM   229   C CD  . GLU A 1 48  ? 1.506   33.651  200.641 1.00 77.80  ? 48  GLU A CD  1 
ATOM   230   O OE1 . GLU A 1 48  ? 1.195   34.593  201.414 1.00 83.87  ? 48  GLU A OE1 1 
ATOM   231   O OE2 . GLU A 1 48  ? 2.294   33.828  199.656 1.00 79.91  ? 48  GLU A OE2 1 
ATOM   232   N N   . ILE A 1 49  ? -0.535  30.030  204.802 1.00 29.61  ? 49  ILE A N   1 
ATOM   233   C CA  . ILE A 1 49  ? -1.105  29.980  206.116 1.00 22.01  ? 49  ILE A CA  1 
ATOM   234   C C   . ILE A 1 49  ? -0.123  30.415  207.147 1.00 22.67  ? 49  ILE A C   1 
ATOM   235   O O   . ILE A 1 49  ? 0.955   29.827  207.306 1.00 21.04  ? 49  ILE A O   1 
ATOM   236   C CB  . ILE A 1 49  ? -1.561  28.605  206.438 1.00 21.97  ? 49  ILE A CB  1 
ATOM   237   C CG1 . ILE A 1 49  ? -2.424  28.092  205.285 1.00 19.12  ? 49  ILE A CG1 1 
ATOM   238   C CG2 . ILE A 1 49  ? -2.263  28.607  207.797 1.00 17.90  ? 49  ILE A CG2 1 
ATOM   239   C CD1 . ILE A 1 49  ? -2.915  26.700  205.500 1.00 26.10  ? 49  ILE A CD1 1 
ATOM   240   N N   . GLU A 1 50  ? -0.480  31.492  207.813 1.00 23.94  ? 50  GLU A N   1 
ATOM   241   C CA  . GLU A 1 50  ? 0.367   32.025  208.852 1.00 30.47  ? 50  GLU A CA  1 
ATOM   242   C C   . GLU A 1 50  ? -0.244  31.560  210.137 1.00 28.87  ? 50  GLU A C   1 
ATOM   243   O O   . GLU A 1 50  ? -1.464  31.593  210.294 1.00 28.49  ? 50  GLU A O   1 
ATOM   244   C CB  . GLU A 1 50  ? 0.402   33.560  208.842 1.00 41.11  ? 50  GLU A CB  1 
ATOM   245   C CG  . GLU A 1 50  ? 1.065   34.214  207.629 1.00 55.88  ? 50  GLU A CG  1 
ATOM   246   C CD  . GLU A 1 50  ? 0.112   34.464  206.436 1.00 71.48  ? 50  GLU A CD  1 
ATOM   247   O OE1 . GLU A 1 50  ? -0.918  33.737  206.276 1.00 78.71  ? 50  GLU A OE1 1 
ATOM   248   O OE2 . GLU A 1 50  ? 0.415   35.403  205.651 1.00 72.31  ? 50  GLU A OE2 1 
ATOM   249   N N   . ALA A 1 51  ? 0.604   31.115  211.049 1.00 28.24  ? 51  ALA A N   1 
ATOM   250   C CA  . ALA A 1 51  ? 0.174   30.650  212.351 1.00 26.79  ? 51  ALA A CA  1 
ATOM   251   C C   . ALA A 1 51  ? 1.347   30.775  213.274 1.00 26.91  ? 51  ALA A C   1 
ATOM   252   O O   . ALA A 1 51  ? 2.444   31.188  212.871 1.00 26.33  ? 51  ALA A O   1 
ATOM   253   C CB  . ALA A 1 51  ? -0.267  29.223  212.291 1.00 26.55  ? 51  ALA A CB  1 
ATOM   254   N N   . PHE A 1 52  ? 1.148   30.372  214.511 1.00 27.71  ? 52  PHE A N   1 
ATOM   255   C CA  . PHE A 1 52  ? 2.231   30.482  215.451 1.00 30.74  ? 52  PHE A CA  1 
ATOM   256   C C   . PHE A 1 52  ? 1.995   29.580  216.597 1.00 32.61  ? 52  PHE A C   1 
ATOM   257   O O   . PHE A 1 52  ? 0.866   29.269  216.962 1.00 31.60  ? 52  PHE A O   1 
ATOM   258   C CB  . PHE A 1 52  ? 2.299   31.875  216.009 1.00 33.76  ? 52  PHE A CB  1 
ATOM   259   C CG  . PHE A 1 52  ? 1.126   32.219  216.854 1.00 37.73  ? 52  PHE A CG  1 
ATOM   260   C CD1 . PHE A 1 52  ? -0.020  32.732  216.278 1.00 37.71  ? 52  PHE A CD1 1 
ATOM   261   C CD2 . PHE A 1 52  ? 1.172   32.040  218.234 1.00 39.98  ? 52  PHE A CD2 1 
ATOM   262   C CE1 . PHE A 1 52  ? -1.102  33.065  217.063 1.00 39.92  ? 52  PHE A CE1 1 
ATOM   263   C CE2 . PHE A 1 52  ? 0.088   32.376  219.033 1.00 39.68  ? 52  PHE A CE2 1 
ATOM   264   C CZ  . PHE A 1 52  ? -1.050  32.891  218.446 1.00 41.29  ? 52  PHE A CZ  1 
ATOM   265   N N   . LEU A 1 53  ? 3.079   29.249  217.245 1.00 35.64  ? 53  LEU A N   1 
ATOM   266   C CA  . LEU A 1 53  ? 2.969   28.376  218.356 1.00 42.07  ? 53  LEU A CA  1 
ATOM   267   C C   . LEU A 1 53  ? 3.564   29.092  219.510 1.00 47.12  ? 53  LEU A C   1 
ATOM   268   O O   . LEU A 1 53  ? 4.529   29.860  219.349 1.00 47.17  ? 53  LEU A O   1 
ATOM   269   C CB  . LEU A 1 53  ? 3.743   27.094  218.084 1.00 44.24  ? 53  LEU A CB  1 
ATOM   270   C CG  . LEU A 1 53  ? 3.123   25.972  217.235 1.00 48.07  ? 53  LEU A CG  1 
ATOM   271   C CD1 . LEU A 1 53  ? 2.089   26.486  216.232 1.00 48.84  ? 53  LEU A CD1 1 
ATOM   272   C CD2 . LEU A 1 53  ? 4.245   25.173  216.527 1.00 50.28  ? 53  LEU A CD2 1 
ATOM   273   N N   . ASN A 1 54  ? 2.898   28.941  220.648 1.00 53.04  ? 54  ASN A N   1 
ATOM   274   C CA  . ASN A 1 54  ? 3.381   29.515  221.889 1.00 56.91  ? 54  ASN A CA  1 
ATOM   275   C C   . ASN A 1 54  ? 4.201   28.393  222.519 1.00 52.79  ? 54  ASN A C   1 
ATOM   276   O O   . ASN A 1 54  ? 3.903   27.205  222.351 1.00 46.70  ? 54  ASN A O   1 
ATOM   277   C CB  . ASN A 1 54  ? 2.239   30.064  222.778 1.00 65.66  ? 54  ASN A CB  1 
ATOM   278   C CG  . ASN A 1 54  ? 1.997   31.599  222.568 1.00 74.01  ? 54  ASN A CG  1 
ATOM   279   O OD1 . ASN A 1 54  ? 0.994   32.014  221.978 1.00 78.45  ? 54  ASN A OD1 1 
ATOM   280   N ND2 . ASN A 1 54  ? 2.919   32.424  223.063 1.00 71.47  ? 54  ASN A ND2 1 
ATOM   281   N N   . PRO A 1 55  ? 5.330   28.762  223.117 1.00 54.76  ? 55  PRO A N   1 
ATOM   282   C CA  . PRO A 1 55  ? 6.350   27.959  223.793 1.00 59.63  ? 55  PRO A CA  1 
ATOM   283   C C   . PRO A 1 55  ? 5.885   27.299  225.050 1.00 63.19  ? 55  PRO A C   1 
ATOM   284   O O   . PRO A 1 55  ? 6.090   27.823  226.143 1.00 64.23  ? 55  PRO A O   1 
ATOM   285   C CB  . PRO A 1 55  ? 7.415   28.993  224.112 1.00 60.73  ? 55  PRO A CB  1 
ATOM   286   C CG  . PRO A 1 55  ? 6.573   30.195  224.453 1.00 56.55  ? 55  PRO A CG  1 
ATOM   287   C CD  . PRO A 1 55  ? 5.569   30.198  223.341 1.00 54.43  ? 55  PRO A CD  1 
ATOM   288   N N   . ARG A 1 56  ? 5.309   26.120  224.937 1.00 68.15  ? 56  ARG A N   1 
ATOM   289   C CA  . ARG A 1 56  ? 4.836   25.500  226.154 1.00 73.47  ? 56  ARG A CA  1 
ATOM   290   C C   . ARG A 1 56  ? 5.856   24.615  226.872 1.00 76.50  ? 56  ARG A C   1 
ATOM   291   O O   . ARG A 1 56  ? 5.906   23.399  226.711 1.00 80.53  ? 56  ARG A O   1 
ATOM   292   C CB  . ARG A 1 56  ? 3.409   24.944  225.958 1.00 71.82  ? 56  ARG A CB  1 
ATOM   293   C CG  . ARG A 1 56  ? 2.405   26.166  225.866 1.00 75.93  ? 56  ARG A CG  1 
ATOM   294   C CD  . ARG A 1 56  ? 0.947   25.963  225.414 1.00 73.78  ? 56  ARG A CD  1 
ATOM   295   N NE  . ARG A 1 56  ? 0.873   25.831  223.976 1.00 77.20  ? 56  ARG A NE  1 
ATOM   296   C CZ  . ARG A 1 56  ? 1.264   24.731  223.350 1.00 81.33  ? 56  ARG A CZ  1 
ATOM   297   N NH1 . ARG A 1 56  ? 1.715   23.713  224.071 1.00 80.39  ? 56  ARG A NH1 1 
ATOM   298   N NH2 . ARG A 1 56  ? 1.335   24.686  222.025 1.00 82.10  ? 56  ARG A NH2 1 
ATOM   299   N N   . MET A 1 57  ? 6.744   25.311  227.581 1.00 78.27  ? 57  MET A N   1 
ATOM   300   C CA  . MET A 1 57  ? 7.822   24.734  228.372 1.00 79.15  ? 57  MET A CA  1 
ATOM   301   C C   . MET A 1 57  ? 7.592   25.276  229.755 1.00 79.02  ? 57  MET A C   1 
ATOM   302   O O   . MET A 1 57  ? 7.488   26.493  229.947 1.00 75.37  ? 57  MET A O   1 
ATOM   303   C CB  . MET A 1 57  ? 9.180   25.219  227.874 1.00 83.85  ? 57  MET A CB  1 
ATOM   304   C CG  . MET A 1 57  ? 9.159   26.612  227.246 1.00 91.12  ? 57  MET A CG  1 
ATOM   305   S SD  . MET A 1 57  ? 10.717  27.535  227.322 1.00 91.24  ? 57  MET A SD  1 
ATOM   306   C CE  . MET A 1 57  ? 10.369  28.475  228.772 1.00 93.37  ? 57  MET A CE  1 
ATOM   307   N N   . GLY A 1 58  ? 7.486   24.362  230.709 1.00 83.68  ? 58  GLY A N   1 
ATOM   308   C CA  . GLY A 1 58  ? 7.227   24.736  232.088 1.00 90.28  ? 58  GLY A CA  1 
ATOM   309   C C   . GLY A 1 58  ? 5.743   24.962  232.416 1.00 93.41  ? 58  GLY A C   1 
ATOM   310   O O   . GLY A 1 58  ? 4.882   24.067  232.233 1.00 94.93  ? 58  GLY A O   1 
ATOM   311   N N   . GLN A 1 59  ? 5.457   26.175  232.901 1.00 91.75  ? 59  GLN A N   1 
ATOM   312   C CA  . GLN A 1 59  ? 4.112   26.606  233.294 1.00 85.12  ? 59  GLN A CA  1 
ATOM   313   C C   . GLN A 1 59  ? 3.154   26.587  232.139 1.00 79.06  ? 59  GLN A C   1 
ATOM   314   O O   . GLN A 1 59  ? 3.414   27.168  231.082 1.00 79.67  ? 59  GLN A O   1 
ATOM   315   C CB  . GLN A 1 59  ? 4.129   28.027  233.880 1.00 86.58  ? 59  GLN A CB  1 
ATOM   316   C CG  . GLN A 1 59  ? 2.741   28.644  234.108 1.00 88.11  ? 59  GLN A CG  1 
ATOM   317   C CD  . GLN A 1 59  ? 2.067   28.204  235.400 1.00 87.76  ? 59  GLN A CD  1 
ATOM   318   O OE1 . GLN A 1 59  ? 2.520   27.278  236.087 1.00 84.43  ? 59  GLN A OE1 1 
ATOM   319   N NE2 . GLN A 1 59  ? 0.990   28.895  235.754 1.00 89.67  ? 59  GLN A NE2 1 
ATOM   320   N N   . PRO A 1 60  ? 2.018   25.938  232.342 1.00 73.02  ? 60  PRO A N   1 
ATOM   321   C CA  . PRO A 1 60  ? 0.980   25.826  231.340 1.00 69.01  ? 60  PRO A CA  1 
ATOM   322   C C   . PRO A 1 60  ? 0.220   27.137  231.376 1.00 65.42  ? 60  PRO A C   1 
ATOM   323   O O   . PRO A 1 60  ? 0.314   27.911  232.345 1.00 57.81  ? 60  PRO A O   1 
ATOM   324   C CB  . PRO A 1 60  ? 0.127   24.711  231.901 1.00 72.83  ? 60  PRO A CB  1 
ATOM   325   C CG  . PRO A 1 60  ? 0.126   25.068  233.353 1.00 74.54  ? 60  PRO A CG  1 
ATOM   326   C CD  . PRO A 1 60  ? 1.587   25.330  233.609 1.00 72.85  ? 60  PRO A CD  1 
ATOM   327   N N   . PRO A 1 61  ? -0.617  27.350  230.365 1.00 65.46  ? 61  PRO A N   1 
ATOM   328   C CA  . PRO A 1 61  ? -1.431  28.553  230.244 1.00 71.67  ? 61  PRO A CA  1 
ATOM   329   C C   . PRO A 1 61  ? -2.252  28.786  231.515 1.00 81.02  ? 61  PRO A C   1 
ATOM   330   O O   . PRO A 1 61  ? -1.835  29.537  232.416 1.00 82.33  ? 61  PRO A O   1 
ATOM   331   C CB  . PRO A 1 61  ? -2.336  28.210  229.071 1.00 70.29  ? 61  PRO A CB  1 
ATOM   332   C CG  . PRO A 1 61  ? -2.411  26.668  229.115 1.00 68.16  ? 61  PRO A CG  1 
ATOM   333   C CD  . PRO A 1 61  ? -0.996  26.343  229.362 1.00 62.60  ? 61  PRO A CD  1 
ATOM   334   N N   . THR A 1 62  ? -3.368  28.060  231.571 1.00 89.17  ? 62  THR A N   1 
ATOM   335   C CA  . THR A 1 62  ? -4.404  28.038  232.608 1.00 93.28  ? 62  THR A CA  1 
ATOM   336   C C   . THR A 1 62  ? -4.436  28.937  233.853 1.00 97.69  ? 62  THR A C   1 
ATOM   337   O O   . THR A 1 62  ? -5.423  29.664  234.063 1.00 100.40 ? 62  THR A O   1 
ATOM   338   C CB  . THR A 1 62  ? -4.697  26.579  233.003 1.00 92.79  ? 62  THR A CB  1 
ATOM   339   O OG1 . THR A 1 62  ? -3.474  25.961  233.419 1.00 90.72  ? 62  THR A OG1 1 
ATOM   340   C CG2 . THR A 1 62  ? -5.299  25.853  231.812 1.00 93.56  ? 62  THR A CG2 1 
ATOM   341   N N   . PRO A 1 63  ? -3.473  28.854  234.743 1.00 99.47  ? 63  PRO A N   1 
ATOM   342   C CA  . PRO A 1 63  ? -3.614  29.759  235.884 1.00 102.51 ? 63  PRO A CA  1 
ATOM   343   C C   . PRO A 1 63  ? -3.393  31.250  235.454 1.00 104.45 ? 63  PRO A C   1 
ATOM   344   O O   . PRO A 1 63  ? -2.329  31.833  235.663 1.00 107.62 ? 63  PRO A O   1 
ATOM   345   C CB  . PRO A 1 63  ? -2.556  29.254  236.867 1.00 103.22 ? 63  PRO A CB  1 
ATOM   346   C CG  . PRO A 1 63  ? -2.280  27.816  236.387 1.00 101.49 ? 63  PRO A CG  1 
ATOM   347   C CD  . PRO A 1 63  ? -2.290  27.956  234.929 1.00 97.05  ? 63  PRO A CD  1 
ATOM   348   N N   . GLU A 1 64  ? -4.404  31.855  234.865 1.00 102.39 ? 64  GLU A N   1 
ATOM   349   C CA  . GLU A 1 64  ? -4.261  33.192  234.378 1.00 103.69 ? 64  GLU A CA  1 
ATOM   350   C C   . GLU A 1 64  ? -3.919  34.273  235.361 1.00 101.50 ? 64  GLU A C   1 
ATOM   351   O O   . GLU A 1 64  ? -3.483  35.350  234.969 1.00 101.74 ? 64  GLU A O   1 
ATOM   352   C CB  . GLU A 1 64  ? -5.477  33.628  233.644 1.00 111.18 ? 64  GLU A CB  1 
ATOM   353   C CG  . GLU A 1 64  ? -5.720  32.864  232.406 1.00 127.47 ? 64  GLU A CG  1 
ATOM   354   C CD  . GLU A 1 64  ? -7.174  32.868  232.064 1.00 137.76 ? 64  GLU A CD  1 
ATOM   355   O OE1 . GLU A 1 64  ? -7.940  32.276  232.855 1.00 146.07 ? 64  GLU A OE1 1 
ATOM   356   O OE2 . GLU A 1 64  ? -7.551  33.505  231.052 1.00 143.29 ? 64  GLU A OE2 1 
ATOM   357   N N   . SER A 1 65  ? -4.223  34.062  236.630 1.00 101.71 ? 65  SER A N   1 
ATOM   358   C CA  . SER A 1 65  ? -3.887  35.085  237.578 1.00 103.24 ? 65  SER A CA  1 
ATOM   359   C C   . SER A 1 65  ? -2.410  35.102  237.751 1.00 101.88 ? 65  SER A C   1 
ATOM   360   O O   . SER A 1 65  ? -1.789  34.127  238.137 1.00 97.67  ? 65  SER A O   1 
ATOM   361   C CB  . SER A 1 65  ? -4.562  34.903  238.923 1.00 108.39 ? 65  SER A CB  1 
ATOM   362   O OG  . SER A 1 65  ? -4.250  36.012  239.766 1.00 112.44 ? 65  SER A OG  1 
ATOM   363   N N   . LEU A 1 66  ? -1.846  36.267  237.543 1.00 106.26 ? 66  LEU A N   1 
ATOM   364   C CA  . LEU A 1 66  ? -0.418  36.443  237.668 1.00 114.70 ? 66  LEU A CA  1 
ATOM   365   C C   . LEU A 1 66  ? -0.034  36.470  239.135 1.00 117.32 ? 66  LEU A C   1 
ATOM   366   O O   . LEU A 1 66  ? 0.927   37.129  239.514 1.00 117.45 ? 66  LEU A O   1 
ATOM   367   C CB  . LEU A 1 66  ? -0.019  37.756  237.000 1.00 122.10 ? 66  LEU A CB  1 
ATOM   368   C CG  . LEU A 1 66  ? -0.955  38.444  235.990 1.00 128.23 ? 66  LEU A CG  1 
ATOM   369   C CD1 . LEU A 1 66  ? -0.279  39.751  235.551 1.00 132.50 ? 66  LEU A CD1 1 
ATOM   370   C CD2 . LEU A 1 66  ? -1.308  37.547  234.779 1.00 128.03 ? 66  LEU A CD2 1 
ATOM   371   N N   . THR A 1 67  ? -0.797  35.771  239.963 1.00 121.08 ? 67  THR A N   1 
ATOM   372   C CA  . THR A 1 67  ? -0.532  35.730  241.391 1.00 129.56 ? 67  THR A CA  1 
ATOM   373   C C   . THR A 1 67  ? -0.595  34.286  241.822 1.00 133.87 ? 67  THR A C   1 
ATOM   374   O O   . THR A 1 67  ? 0.175   33.838  242.678 1.00 134.57 ? 67  THR A O   1 
ATOM   375   C CB  . THR A 1 67  ? -1.625  36.464  242.135 1.00 133.09 ? 67  THR A CB  1 
ATOM   376   O OG1 . THR A 1 67  ? -2.886  35.888  241.779 1.00 133.95 ? 67  THR A OG1 1 
ATOM   377   C CG2 . THR A 1 67  ? -1.629  37.929  241.748 1.00 138.51 ? 67  THR A CG2 1 
ATOM   378   N N   . GLU A 1 68  ? -1.558  33.583  241.226 1.00 139.23 ? 68  GLU A N   1 
ATOM   379   C CA  . GLU A 1 68  ? -1.801  32.162  241.481 1.00 146.51 ? 68  GLU A CA  1 
ATOM   380   C C   . GLU A 1 68  ? -0.881  31.309  240.597 1.00 145.39 ? 68  GLU A C   1 
ATOM   381   O O   . GLU A 1 68  ? -0.400  30.235  240.999 1.00 147.00 ? 68  GLU A O   1 
ATOM   382   C CB  . GLU A 1 68  ? -3.259  31.819  241.165 1.00 152.76 ? 68  GLU A CB  1 
ATOM   383   C CG  . GLU A 1 68  ? -4.296  32.476  242.077 1.00 165.19 ? 68  GLU A CG  1 
ATOM   384   C CD  . GLU A 1 68  ? -5.739  32.176  241.650 1.00 171.88 ? 68  GLU A CD  1 
ATOM   385   O OE1 . GLU A 1 68  ? -6.156  30.991  241.721 1.00 176.07 ? 68  GLU A OE1 1 
ATOM   386   O OE2 . GLU A 1 68  ? -6.450  33.127  241.235 1.00 176.31 ? 68  GLU A OE2 1 
ATOM   387   N N   . GLY A 1 69  ? -0.677  31.794  239.374 1.00 143.37 ? 69  GLY A N   1 
ATOM   388   C CA  . GLY A 1 69  ? 0.187   31.122  238.425 1.00 137.95 ? 69  GLY A CA  1 
ATOM   389   C C   . GLY A 1 69  ? 1.455   31.944  238.323 1.00 133.94 ? 69  GLY A C   1 
ATOM   390   O O   . GLY A 1 69  ? 2.367   31.606  237.515 1.00 134.80 ? 69  GLY A O   1 
ATOM   391   N N   . GLY A 1 70  ? 1.483   33.054  239.080 1.00 128.64 ? 70  GLY A N   1 
ATOM   392   C CA  . GLY A 1 70  ? 2.618   33.957  239.107 1.00 116.69 ? 70  GLY A CA  1 
ATOM   393   C C   . GLY A 1 70  ? 2.859   34.511  237.730 1.00 108.76 ? 70  GLY A C   1 
ATOM   394   O O   . GLY A 1 70  ? 3.404   35.601  237.545 1.00 110.80 ? 70  GLY A O   1 
ATOM   395   N N   . GLN A 1 71  ? 2.299   33.785  236.777 1.00 97.51  ? 71  GLN A N   1 
ATOM   396   C CA  . GLN A 1 71  ? 2.473   34.044  235.415 1.00 86.53  ? 71  GLN A CA  1 
ATOM   397   C C   . GLN A 1 71  ? 3.890   34.006  235.009 1.00 81.40  ? 71  GLN A C   1 
ATOM   398   O O   . GLN A 1 71  ? 4.721   34.876  235.243 1.00 77.61  ? 71  GLN A O   1 
ATOM   399   C CB  . GLN A 1 71  ? 1.539   35.047  234.833 1.00 85.29  ? 71  GLN A CB  1 
ATOM   400   C CG  . GLN A 1 71  ? 0.181   34.340  234.626 1.00 83.42  ? 71  GLN A CG  1 
ATOM   401   C CD  . GLN A 1 71  ? 0.291   32.803  234.827 1.00 81.86  ? 71  GLN A CD  1 
ATOM   402   O OE1 . GLN A 1 71  ? 0.955   32.136  234.076 1.00 76.42  ? 71  GLN A OE1 1 
ATOM   403   N NE2 . GLN A 1 71  ? -0.261  32.321  235.896 1.00 83.78  ? 71  GLN A NE2 1 
ATOM   404   N N   . TYR A 1 72  ? 4.104   32.711  235.024 1.00 78.38  ? 72  TYR A N   1 
ATOM   405   C CA  . TYR A 1 72  ? 5.343   32.125  234.662 1.00 79.34  ? 72  TYR A CA  1 
ATOM   406   C C   . TYR A 1 72  ? 5.059   31.556  233.267 1.00 75.06  ? 72  TYR A C   1 
ATOM   407   O O   . TYR A 1 72  ? 5.963   31.078  232.582 1.00 77.10  ? 72  TYR A O   1 
ATOM   408   C CB  . TYR A 1 72  ? 5.679   31.060  235.700 1.00 85.92  ? 72  TYR A CB  1 
ATOM   409   C CG  . TYR A 1 72  ? 5.923   31.614  237.105 1.00 93.69  ? 72  TYR A CG  1 
ATOM   410   C CD1 . TYR A 1 72  ? 6.470   32.907  237.316 1.00 98.06  ? 72  TYR A CD1 1 
ATOM   411   C CD2 . TYR A 1 72  ? 5.706   30.801  238.221 1.00 96.10  ? 72  TYR A CD2 1 
ATOM   412   C CE1 . TYR A 1 72  ? 6.801   33.342  238.619 1.00 101.10 ? 72  TYR A CE1 1 
ATOM   413   C CE2 . TYR A 1 72  ? 6.031   31.218  239.515 1.00 99.80  ? 72  TYR A CE2 1 
ATOM   414   C CZ  . TYR A 1 72  ? 6.584   32.481  239.712 1.00 101.94 ? 72  TYR A CZ  1 
ATOM   415   O OH  . TYR A 1 72  ? 6.970   32.844  240.989 1.00 102.02 ? 72  TYR A OH  1 
ATOM   416   N N   . TYR A 1 73  ? 3.811   31.702  232.812 1.00 67.75  ? 73  TYR A N   1 
ATOM   417   C CA  . TYR A 1 73  ? 3.429   31.217  231.494 1.00 63.77  ? 73  TYR A CA  1 
ATOM   418   C C   . TYR A 1 73  ? 4.494   31.667  230.555 1.00 64.57  ? 73  TYR A C   1 
ATOM   419   O O   . TYR A 1 73  ? 4.690   32.868  230.340 1.00 61.47  ? 73  TYR A O   1 
ATOM   420   C CB  . TYR A 1 73  ? 2.120   31.808  231.030 1.00 59.15  ? 73  TYR A CB  1 
ATOM   421   C CG  . TYR A 1 73  ? 1.639   31.196  229.742 1.00 57.31  ? 73  TYR A CG  1 
ATOM   422   C CD1 . TYR A 1 73  ? 1.725   29.830  229.514 1.00 58.50  ? 73  TYR A CD1 1 
ATOM   423   C CD2 . TYR A 1 73  ? 1.044   31.974  228.769 1.00 61.92  ? 73  TYR A CD2 1 
ATOM   424   C CE1 . TYR A 1 73  ? 1.213   29.242  228.319 1.00 59.25  ? 73  TYR A CE1 1 
ATOM   425   C CE2 . TYR A 1 73  ? 0.530   31.409  227.569 1.00 62.57  ? 73  TYR A CE2 1 
ATOM   426   C CZ  . TYR A 1 73  ? 0.609   30.040  227.332 1.00 59.70  ? 73  TYR A CZ  1 
ATOM   427   O OH  . TYR A 1 73  ? 0.112   29.511  226.111 1.00 54.26  ? 73  TYR A OH  1 
ATOM   428   N N   . GLY A 1 74  ? 5.211   30.688  230.024 1.00 67.19  ? 74  GLY A N   1 
ATOM   429   C CA  . GLY A 1 74  ? 6.303   31.007  229.129 1.00 69.78  ? 74  GLY A CA  1 
ATOM   430   C C   . GLY A 1 74  ? 7.539   31.103  229.984 1.00 68.12  ? 74  GLY A C   1 
ATOM   431   O O   . GLY A 1 74  ? 8.303   32.072  229.950 1.00 60.93  ? 74  GLY A O   1 
ATOM   432   N N   . TRP A 1 75  ? 7.718   30.058  230.766 1.00 69.66  ? 75  TRP A N   1 
ATOM   433   C CA  . TRP A 1 75  ? 8.841   29.973  231.647 1.00 73.72  ? 75  TRP A CA  1 
ATOM   434   C C   . TRP A 1 75  ? 8.800   28.657  232.367 1.00 78.24  ? 75  TRP A C   1 
ATOM   435   O O   . TRP A 1 75  ? 7.732   28.075  232.555 1.00 77.42  ? 75  TRP A O   1 
ATOM   436   C CB  . TRP A 1 75  ? 8.790   31.086  232.670 1.00 70.86  ? 75  TRP A CB  1 
ATOM   437   C CG  . TRP A 1 75  ? 9.659   32.218  232.365 1.00 73.48  ? 75  TRP A CG  1 
ATOM   438   C CD1 . TRP A 1 75  ? 11.025  32.212  232.241 1.00 79.14  ? 75  TRP A CD1 1 
ATOM   439   C CD2 . TRP A 1 75  ? 9.254   33.559  232.251 1.00 75.10  ? 75  TRP A CD2 1 
ATOM   440   N NE1 . TRP A 1 75  ? 11.499  33.493  232.071 1.00 73.72  ? 75  TRP A NE1 1 
ATOM   441   C CE2 . TRP A 1 75  ? 10.432  34.342  232.075 1.00 75.55  ? 75  TRP A CE2 1 
ATOM   442   C CE3 . TRP A 1 75  ? 8.014   34.190  232.295 1.00 78.57  ? 75  TRP A CE3 1 
ATOM   443   C CZ2 . TRP A 1 75  ? 10.397  35.720  231.945 1.00 78.15  ? 75  TRP A CZ2 1 
ATOM   444   C CZ3 . TRP A 1 75  ? 7.977   35.562  232.167 1.00 85.99  ? 75  TRP A CZ3 1 
ATOM   445   C CH2 . TRP A 1 75  ? 9.169   36.320  231.993 1.00 84.02  ? 75  TRP A CH2 1 
ATOM   446   N N   . SER A 1 76  ? 9.986   28.149  232.675 1.00 86.58  ? 76  SER A N   1 
ATOM   447   C CA  . SER A 1 76  ? 10.127  26.912  233.415 1.00 91.99  ? 76  SER A CA  1 
ATOM   448   C C   . SER A 1 76  ? 9.837   27.448  234.797 1.00 90.29  ? 76  SER A C   1 
ATOM   449   O O   . SER A 1 76  ? 10.259  28.555  235.115 1.00 91.16  ? 76  SER A O   1 
ATOM   450   C CB  . SER A 1 76  ? 11.567  26.397  233.300 1.00 97.48  ? 76  SER A CB  1 
ATOM   451   O OG  . SER A 1 76  ? 11.923  26.022  231.961 1.00 103.58 ? 76  SER A OG  1 
ATOM   452   N N   . ARG A 1 77  ? 9.081   26.718  235.599 1.00 90.01  ? 77  ARG A N   1 
ATOM   453   C CA  . ARG A 1 77  ? 8.745   27.254  236.894 1.00 91.34  ? 77  ARG A CA  1 
ATOM   454   C C   . ARG A 1 77  ? 9.877   27.490  237.821 1.00 89.47  ? 77  ARG A C   1 
ATOM   455   O O   . ARG A 1 77  ? 10.289  28.610  238.002 1.00 91.22  ? 77  ARG A O   1 
ATOM   456   C CB  . ARG A 1 77  ? 7.598   26.529  237.576 1.00 92.59  ? 77  ARG A CB  1 
ATOM   457   C CG  . ARG A 1 77  ? 6.447   27.498  237.708 1.00 100.04 ? 77  ARG A CG  1 
ATOM   458   C CD  . ARG A 1 77  ? 5.312   26.988  238.483 1.00 107.62 ? 77  ARG A CD  1 
ATOM   459   N NE  . ARG A 1 77  ? 5.115   27.775  239.689 1.00 121.64 ? 77  ARG A NE  1 
ATOM   460   C CZ  . ARG A 1 77  ? 3.941   27.893  240.302 1.00 130.81 ? 77  ARG A CZ  1 
ATOM   461   N NH1 . ARG A 1 77  ? 2.860   27.282  239.802 1.00 135.66 ? 77  ARG A NH1 1 
ATOM   462   N NH2 . ARG A 1 77  ? 3.861   28.543  241.458 1.00 137.16 ? 77  ARG A NH2 1 
ATOM   463   N N   . GLY A 1 78  ? 10.371  26.465  238.455 1.00 86.72  ? 78  GLY A N   1 
ATOM   464   C CA  . GLY A 1 78  ? 11.474  26.716  239.334 1.00 88.18  ? 78  GLY A CA  1 
ATOM   465   C C   . GLY A 1 78  ? 12.447  25.729  238.829 1.00 90.89  ? 78  GLY A C   1 
ATOM   466   O O   . GLY A 1 78  ? 12.243  25.172  237.761 1.00 95.16  ? 78  GLY A O   1 
ATOM   467   N N   . ILE A 1 79  ? 13.527  25.526  239.550 1.00 94.09  ? 79  ILE A N   1 
ATOM   468   C CA  . ILE A 1 79  ? 14.455  24.530  239.106 1.00 101.49 ? 79  ILE A CA  1 
ATOM   469   C C   . ILE A 1 79  ? 14.615  23.438  240.144 1.00 105.70 ? 79  ILE A C   1 
ATOM   470   O O   . ILE A 1 79  ? 15.412  23.530  241.088 1.00 107.89 ? 79  ILE A O   1 
ATOM   471   C CB  . ILE A 1 79  ? 15.752  25.120  238.667 1.00 102.20 ? 79  ILE A CB  1 
ATOM   472   C CG1 . ILE A 1 79  ? 15.465  26.267  237.714 1.00 105.86 ? 79  ILE A CG1 1 
ATOM   473   C CG2 . ILE A 1 79  ? 16.477  24.092  237.838 1.00 106.17 ? 79  ILE A CG2 1 
ATOM   474   C CD1 . ILE A 1 79  ? 14.819  25.796  236.435 1.00 107.26 ? 79  ILE A CD1 1 
ATOM   475   N N   . ASN A 1 80  ? 13.731  22.455  240.005 1.00 110.28 ? 80  ASN A N   1 
ATOM   476   C CA  . ASN A 1 80  ? 13.673  21.289  240.866 1.00 111.52 ? 80  ASN A CA  1 
ATOM   477   C C   . ASN A 1 80  ? 14.986  20.594  240.667 1.00 107.69 ? 80  ASN A C   1 
ATOM   478   O O   . ASN A 1 80  ? 15.181  19.894  239.671 1.00 105.55 ? 80  ASN A O   1 
ATOM   479   C CB  . ASN A 1 80  ? 12.523  20.368  240.428 1.00 124.21 ? 80  ASN A CB  1 
ATOM   480   C CG  . ASN A 1 80  ? 12.389  19.109  241.293 1.00 134.40 ? 80  ASN A CG  1 
ATOM   481   O OD1 . ASN A 1 80  ? 11.829  18.091  240.858 1.00 140.61 ? 80  ASN A OD1 1 
ATOM   482   N ND2 . ASN A 1 80  ? 12.828  19.198  242.544 1.00 142.10 ? 80  ASN A ND2 1 
ATOM   483   N N   . LEU A 1 81  ? 15.932  20.913  241.541 1.00 106.60 ? 81  LEU A N   1 
ATOM   484   C CA  . LEU A 1 81  ? 17.242  20.297  241.474 1.00 108.74 ? 81  LEU A CA  1 
ATOM   485   C C   . LEU A 1 81  ? 17.086  18.852  241.943 1.00 109.09 ? 81  LEU A C   1 
ATOM   486   O O   . LEU A 1 81  ? 15.978  18.397  242.230 1.00 109.07 ? 81  LEU A O   1 
ATOM   487   C CB  . LEU A 1 81  ? 18.218  21.040  242.380 1.00 111.30 ? 81  LEU A CB  1 
ATOM   488   C CG  . LEU A 1 81  ? 19.688  20.835  242.010 1.00 113.59 ? 81  LEU A CG  1 
ATOM   489   C CD1 . LEU A 1 81  ? 20.006  21.648  240.767 1.00 115.04 ? 81  LEU A CD1 1 
ATOM   490   C CD2 . LEU A 1 81  ? 20.597  21.245  243.165 1.00 118.53 ? 81  LEU A CD2 1 
ATOM   491   N N   . ALA A 1 82  ? 18.185  18.119  242.007 1.00 109.43 ? 82  ALA A N   1 
ATOM   492   C CA  . ALA A 1 82  ? 18.112  16.747  242.467 1.00 111.15 ? 82  ALA A CA  1 
ATOM   493   C C   . ALA A 1 82  ? 18.749  16.639  243.851 1.00 113.31 ? 82  ALA A C   1 
ATOM   494   O O   . ALA A 1 82  ? 19.349  17.603  244.359 1.00 113.55 ? 82  ALA A O   1 
ATOM   495   C CB  . ALA A 1 82  ? 18.795  15.840  241.497 1.00 108.21 ? 82  ALA A CB  1 
ATOM   496   N N   . THR A 1 83  ? 18.608  15.466  244.458 1.00 114.23 ? 83  THR A N   1 
ATOM   497   C CA  . THR A 1 83  ? 19.143  15.214  245.784 1.00 114.39 ? 83  THR A CA  1 
ATOM   498   C C   . THR A 1 83  ? 20.545  14.653  245.799 1.00 114.23 ? 83  THR A C   1 
ATOM   499   O O   . THR A 1 83  ? 21.326  14.960  246.694 1.00 115.94 ? 83  THR A O   1 
ATOM   500   C CB  . THR A 1 83  ? 18.215  14.306  246.555 1.00 115.07 ? 83  THR A CB  1 
ATOM   501   O OG1 . THR A 1 83  ? 17.515  15.095  247.520 1.00 117.76 ? 83  THR A OG1 1 
ATOM   502   C CG2 . THR A 1 83  ? 18.978  13.167  247.234 1.00 119.75 ? 83  THR A CG2 1 
ATOM   503   N N   . SER A 1 84  ? 20.833  13.770  244.858 1.00 114.51 ? 84  SER A N   1 
ATOM   504   C CA  . SER A 1 84  ? 22.146  13.189  244.766 1.00 116.21 ? 84  SER A CA  1 
ATOM   505   C C   . SER A 1 84  ? 22.204  12.282  243.584 1.00 116.45 ? 84  SER A C   1 
ATOM   506   O O   . SER A 1 84  ? 21.176  11.929  243.034 1.00 116.70 ? 84  SER A O   1 
ATOM   507   C CB  . SER A 1 84  ? 22.455  12.367  245.991 1.00 118.40 ? 84  SER A CB  1 
ATOM   508   O OG  . SER A 1 84  ? 23.726  11.778  245.816 1.00 124.97 ? 84  SER A OG  1 
ATOM   509   N N   . ASP A 1 85  ? 23.414  11.846  243.254 1.00 118.39 ? 85  ASP A N   1 
ATOM   510   C CA  . ASP A 1 85  ? 23.654  10.932  242.138 1.00 120.83 ? 85  ASP A CA  1 
ATOM   511   C C   . ASP A 1 85  ? 22.575  9.855   242.186 1.00 120.85 ? 85  ASP A C   1 
ATOM   512   O O   . ASP A 1 85  ? 22.056  9.414   241.164 1.00 123.46 ? 85  ASP A O   1 
ATOM   513   C CB  . ASP A 1 85  ? 25.047  10.299  242.284 1.00 121.87 ? 85  ASP A CB  1 
ATOM   514   C CG  . ASP A 1 85  ? 25.556  9.650   240.992 1.00 123.17 ? 85  ASP A CG  1 
ATOM   515   O OD1 . ASP A 1 85  ? 26.069  10.378  240.105 1.00 125.89 ? 85  ASP A OD1 1 
ATOM   516   O OD2 . ASP A 1 85  ? 25.472  8.405   240.875 1.00 119.17 ? 85  ASP A OD2 1 
ATOM   517   N N   . THR A 1 86  ? 22.170  9.516   243.399 1.00 119.43 ? 86  THR A N   1 
ATOM   518   C CA  . THR A 1 86  ? 21.134  8.530   243.574 1.00 120.29 ? 86  THR A CA  1 
ATOM   519   C C   . THR A 1 86  ? 19.763  9.086   243.250 1.00 116.06 ? 86  THR A C   1 
ATOM   520   O O   . THR A 1 86  ? 18.945  8.434   242.619 1.00 113.90 ? 86  THR A O   1 
ATOM   521   C CB  . THR A 1 86  ? 21.085  8.075   245.027 1.00 126.63 ? 86  THR A CB  1 
ATOM   522   O OG1 . THR A 1 86  ? 19.940  7.222   245.216 1.00 134.54 ? 86  THR A OG1 1 
ATOM   523   C CG2 . THR A 1 86  ? 20.993  9.304   245.986 1.00 127.25 ? 86  THR A CG2 1 
ATOM   524   N N   . GLU A 1 87  ? 19.527  10.310  243.701 1.00 112.13 ? 87  GLU A N   1 
ATOM   525   C CA  . GLU A 1 87  ? 18.226  10.923  243.571 1.00 115.23 ? 87  GLU A CA  1 
ATOM   526   C C   . GLU A 1 87  ? 18.153  12.132  242.649 1.00 129.67 ? 87  GLU A C   1 
ATOM   527   O O   . GLU A 1 87  ? 18.724  13.183  242.954 1.00 116.56 ? 87  GLU A O   1 
ATOM   528   C CB  . GLU A 1 87  ? 17.724  11.305  244.907 1.00 114.23 ? 87  GLU A CB  1 
ATOM   529   C CG  . GLU A 1 87  ? 16.415  11.938  244.800 1.00 114.74 ? 87  GLU A CG  1 
ATOM   530   C CD  . GLU A 1 87  ? 15.495  11.359  245.799 1.00 115.23 ? 87  GLU A CD  1 
ATOM   531   O OE1 . GLU A 1 87  ? 15.932  10.408  246.517 1.00 119.11 ? 87  GLU A OE1 1 
ATOM   532   O OE2 . GLU A 1 87  ? 14.344  11.844  245.862 1.00 103.23 ? 87  GLU A OE2 1 
ATOM   533   N N   . ASP A 1 88  ? 17.289  12.027  241.643 1.00 113.13 ? 88  ASP A N   1 
ATOM   534   C CA  . ASP A 1 88  ? 17.033  13.114  240.715 1.00 108.27 ? 88  ASP A CA  1 
ATOM   535   C C   . ASP A 1 88  ? 15.562  13.234  240.362 1.00 103.56 ? 88  ASP A C   1 
ATOM   536   O O   . ASP A 1 88  ? 15.035  12.474  239.525 1.00 99.31  ? 88  ASP A O   1 
ATOM   537   C CB  . ASP A 1 88  ? 17.807  12.962  239.403 1.00 112.53 ? 88  ASP A CB  1 
ATOM   538   C CG  . ASP A 1 88  ? 17.511  14.103  238.409 1.00 115.19 ? 88  ASP A CG  1 
ATOM   539   O OD1 . ASP A 1 88  ? 17.235  15.240  238.874 1.00 115.79 ? 88  ASP A OD1 1 
ATOM   540   O OD2 . ASP A 1 88  ? 17.549  13.883  237.188 1.00 113.60 ? 88  ASP A OD2 1 
ATOM   541   N N   . SER A 1 89  ? 14.890  14.165  240.994 1.00 99.52  ? 89  SER A N   1 
ATOM   542   C CA  . SER A 1 89  ? 13.498  14.365  240.687 1.00 95.42  ? 89  SER A CA  1 
ATOM   543   C C   . SER A 1 89  ? 13.376  15.572  239.799 1.00 93.60  ? 89  SER A C   1 
ATOM   544   O O   . SER A 1 89  ? 13.921  16.634  240.071 1.00 90.67  ? 89  SER A O   1 
ATOM   545   C CB  . SER A 1 89  ? 12.654  14.565  241.922 1.00 97.98  ? 89  SER A CB  1 
ATOM   546   O OG  . SER A 1 89  ? 11.291  14.663  241.538 1.00 99.02  ? 89  SER A OG  1 
ATOM   547   N N   . PRO A 1 90  ? 12.705  15.385  238.679 1.00 92.35  ? 90  PRO A N   1 
ATOM   548   C CA  . PRO A 1 90  ? 12.421  16.350  237.628 1.00 89.73  ? 90  PRO A CA  1 
ATOM   549   C C   . PRO A 1 90  ? 11.604  17.533  238.067 1.00 84.99  ? 90  PRO A C   1 
ATOM   550   O O   . PRO A 1 90  ? 12.141  18.618  238.229 1.00 84.94  ? 90  PRO A O   1 
ATOM   551   C CB  . PRO A 1 90  ? 11.654  15.517  236.616 1.00 94.04  ? 90  PRO A CB  1 
ATOM   552   C CG  . PRO A 1 90  ? 12.348  14.219  236.720 1.00 97.02  ? 90  PRO A CG  1 
ATOM   553   C CD  . PRO A 1 90  ? 12.445  14.019  238.208 1.00 95.30  ? 90  PRO A CD  1 
ATOM   554   N N   . GLY A 1 91  ? 10.310  17.316  238.276 1.00 79.24  ? 91  GLY A N   1 
ATOM   555   C CA  . GLY A 1 91  ? 9.433   18.413  238.638 1.00 77.66  ? 91  GLY A CA  1 
ATOM   556   C C   . GLY A 1 91  ? 8.869   18.804  237.292 1.00 76.78  ? 91  GLY A C   1 
ATOM   557   O O   . GLY A 1 91  ? 9.490   19.522  236.515 1.00 74.51  ? 91  GLY A O   1 
ATOM   558   N N   . ASN A 1 92  ? 7.672   18.329  237.010 1.00 78.64  ? 92  ASN A N   1 
ATOM   559   C CA  . ASN A 1 92  ? 7.063   18.569  235.713 1.00 82.20  ? 92  ASN A CA  1 
ATOM   560   C C   . ASN A 1 92  ? 6.942   20.004  235.180 1.00 79.83  ? 92  ASN A C   1 
ATOM   561   O O   . ASN A 1 92  ? 6.751   20.248  233.987 1.00 78.89  ? 92  ASN A O   1 
ATOM   562   C CB  . ASN A 1 92  ? 5.759   17.765  235.603 1.00 87.83  ? 92  ASN A CB  1 
ATOM   563   C CG  . ASN A 1 92  ? 6.013   16.313  235.141 1.00 90.58  ? 92  ASN A CG  1 
ATOM   564   O OD1 . ASN A 1 92  ? 7.056   15.708  235.469 1.00 90.65  ? 92  ASN A OD1 1 
ATOM   565   N ND2 . ASN A 1 92  ? 5.096   15.774  234.340 1.00 91.34  ? 92  ASN A ND2 1 
ATOM   566   N N   . ASN A 1 93  ? 7.169   20.961  236.046 1.00 77.96  ? 93  ASN A N   1 
ATOM   567   C CA  . ASN A 1 93  ? 7.077   22.339  235.643 1.00 79.79  ? 93  ASN A CA  1 
ATOM   568   C C   . ASN A 1 93  ? 8.482   22.878  235.645 1.00 74.98  ? 93  ASN A C   1 
ATOM   569   O O   . ASN A 1 93  ? 8.704   24.080  235.659 1.00 75.59  ? 93  ASN A O   1 
ATOM   570   C CB  . ASN A 1 93  ? 6.170   23.102  236.600 1.00 91.48  ? 93  ASN A CB  1 
ATOM   571   C CG  . ASN A 1 93  ? 6.146   22.485  237.997 1.00 104.00 ? 93  ASN A CG  1 
ATOM   572   O OD1 . ASN A 1 93  ? 5.892   21.275  238.166 1.00 111.66 ? 93  ASN A OD1 1 
ATOM   573   N ND2 . ASN A 1 93  ? 6.426   23.304  239.004 1.00 111.01 ? 93  ASN A ND2 1 
ATOM   574   N N   . THR A 1 94  ? 9.435   21.966  235.663 1.00 68.37  ? 94  THR A N   1 
ATOM   575   C CA  . THR A 1 94  ? 10.841  22.315  235.619 1.00 68.91  ? 94  THR A CA  1 
ATOM   576   C C   . THR A 1 94  ? 11.238  21.561  234.394 1.00 66.85  ? 94  THR A C   1 
ATOM   577   O O   . THR A 1 94  ? 12.344  21.038  234.262 1.00 68.89  ? 94  THR A O   1 
ATOM   578   C CB  . THR A 1 94  ? 11.590  21.771  236.838 1.00 71.94  ? 94  THR A CB  1 
ATOM   579   O OG1 . THR A 1 94  ? 11.068  22.417  238.008 1.00 78.06  ? 94  THR A OG1 1 
ATOM   580   C CG2 . THR A 1 94  ? 13.139  22.008  236.729 1.00 68.80  ? 94  THR A CG2 1 
ATOM   581   N N   . LEU A 1 95  ? 10.302  21.528  233.466 1.00 64.56  ? 95  LEU A N   1 
ATOM   582   C CA  . LEU A 1 95  ? 10.543  20.790  232.271 1.00 65.08  ? 95  LEU A CA  1 
ATOM   583   C C   . LEU A 1 95  ? 10.048  21.297  230.935 1.00 64.07  ? 95  LEU A C   1 
ATOM   584   O O   . LEU A 1 95  ? 8.881   21.161  230.552 1.00 70.68  ? 95  LEU A O   1 
ATOM   585   C CB  . LEU A 1 95  ? 10.127  19.353  232.501 1.00 63.25  ? 95  LEU A CB  1 
ATOM   586   C CG  . LEU A 1 95  ? 11.436  18.620  232.651 1.00 63.66  ? 95  LEU A CG  1 
ATOM   587   C CD1 . LEU A 1 95  ? 11.285  17.425  233.555 1.00 68.33  ? 95  LEU A CD1 1 
ATOM   588   C CD2 . LEU A 1 95  ? 11.934  18.293  231.234 1.00 68.93  ? 95  LEU A CD2 1 
ATOM   589   N N   . PRO A 1 96  ? 10.921  21.991  230.241 1.00 58.10  ? 96  PRO A N   1 
ATOM   590   C CA  . PRO A 1 96  ? 10.572  22.510  228.936 1.00 52.50  ? 96  PRO A CA  1 
ATOM   591   C C   . PRO A 1 96  ? 10.230  21.286  228.066 1.00 49.50  ? 96  PRO A C   1 
ATOM   592   O O   . PRO A 1 96  ? 10.926  20.239  228.113 1.00 46.46  ? 96  PRO A O   1 
ATOM   593   C CB  . PRO A 1 96  ? 11.860  23.194  228.528 1.00 54.02  ? 96  PRO A CB  1 
ATOM   594   C CG  . PRO A 1 96  ? 12.909  22.438  229.346 1.00 58.97  ? 96  PRO A CG  1 
ATOM   595   C CD  . PRO A 1 96  ? 12.264  22.403  230.641 1.00 55.44  ? 96  PRO A CD  1 
ATOM   596   N N   . THR A 1 97  ? 9.153   21.428  227.297 1.00 44.51  ? 97  THR A N   1 
ATOM   597   C CA  . THR A 1 97  ? 8.645   20.357  226.449 1.00 46.42  ? 97  THR A CA  1 
ATOM   598   C C   . THR A 1 97  ? 8.240   20.734  225.042 1.00 45.38  ? 97  THR A C   1 
ATOM   599   O O   . THR A 1 97  ? 7.792   21.845  224.795 1.00 45.01  ? 97  THR A O   1 
ATOM   600   C CB  . THR A 1 97  ? 7.413   19.828  227.047 1.00 50.67  ? 97  THR A CB  1 
ATOM   601   O OG1 . THR A 1 97  ? 6.555   20.933  227.335 1.00 60.26  ? 97  THR A OG1 1 
ATOM   602   C CG2 . THR A 1 97  ? 7.725   19.125  228.321 1.00 59.14  ? 97  THR A CG2 1 
ATOM   603   N N   . TRP A 1 98  ? 8.267   19.741  224.161 1.00 49.34  ? 98  TRP A N   1 
ATOM   604   C CA  . TRP A 1 98  ? 7.928   19.904  222.751 1.00 54.92  ? 98  TRP A CA  1 
ATOM   605   C C   . TRP A 1 98  ? 6.579   20.501  222.466 1.00 53.77  ? 98  TRP A C   1 
ATOM   606   O O   . TRP A 1 98  ? 5.568   19.854  222.722 1.00 59.60  ? 98  TRP A O   1 
ATOM   607   C CB  . TRP A 1 98  ? 7.992   18.562  222.030 1.00 62.45  ? 98  TRP A CB  1 
ATOM   608   C CG  . TRP A 1 98  ? 9.331   18.263  221.460 1.00 68.99  ? 98  TRP A CG  1 
ATOM   609   C CD1 . TRP A 1 98  ? 10.282  17.442  221.985 1.00 72.44  ? 98  TRP A CD1 1 
ATOM   610   C CD2 . TRP A 1 98  ? 9.895   18.825  220.284 1.00 70.45  ? 98  TRP A CD2 1 
ATOM   611   N NE1 . TRP A 1 98  ? 11.409  17.464  221.214 1.00 72.97  ? 98  TRP A NE1 1 
ATOM   612   C CE2 . TRP A 1 98  ? 11.199  18.308  220.159 1.00 73.38  ? 98  TRP A CE2 1 
ATOM   613   C CE3 . TRP A 1 98  ? 9.430   19.731  219.328 1.00 75.15  ? 98  TRP A CE3 1 
ATOM   614   C CZ2 . TRP A 1 98  ? 12.048  18.666  219.117 1.00 77.75  ? 98  TRP A CZ2 1 
ATOM   615   C CZ3 . TRP A 1 98  ? 10.273  20.093  218.291 1.00 80.24  ? 98  TRP A CZ3 1 
ATOM   616   C CH2 . TRP A 1 98  ? 11.572  19.559  218.195 1.00 81.07  ? 98  TRP A CH2 1 
ATOM   617   N N   . SER A 1 99  ? 6.580   21.680  221.846 1.00 49.59  ? 99  SER A N   1 
ATOM   618   C CA  . SER A 1 99  ? 5.365   22.400  221.465 1.00 48.52  ? 99  SER A CA  1 
ATOM   619   C C   . SER A 1 99  ? 5.035   22.053  220.008 1.00 48.84  ? 99  SER A C   1 
ATOM   620   O O   . SER A 1 99  ? 5.900   22.138  219.130 1.00 51.69  ? 99  SER A O   1 
ATOM   621   C CB  . SER A 1 99  ? 5.588   23.915  221.581 1.00 48.40  ? 99  SER A CB  1 
ATOM   622   O OG  . SER A 1 99  ? 6.535   24.247  222.598 1.00 53.17  ? 99  SER A OG  1 
ATOM   623   N N   . MET A 1 100 ? 3.797   21.662  219.736 1.00 49.37  ? 100 MET A N   1 
ATOM   624   C CA  . MET A 1 100 ? 3.415   21.321  218.365 1.00 54.02  ? 100 MET A CA  1 
ATOM   625   C C   . MET A 1 100 ? 1.945   21.603  218.103 1.00 54.09  ? 100 MET A C   1 
ATOM   626   O O   . MET A 1 100 ? 1.249   22.084  219.002 1.00 59.91  ? 100 MET A O   1 
ATOM   627   C CB  . MET A 1 100 ? 3.687   19.852  218.091 1.00 58.10  ? 100 MET A CB  1 
ATOM   628   C CG  . MET A 1 100 ? 2.789   18.885  218.886 1.00 67.95  ? 100 MET A CG  1 
ATOM   629   S SD  . MET A 1 100 ? 1.036   18.795  218.397 1.00 71.95  ? 100 MET A SD  1 
ATOM   630   C CE  . MET A 1 100 ? 1.057   17.668  216.955 1.00 74.61  ? 100 MET A CE  1 
ATOM   631   N N   . ALA A 1 101 ? 1.479   21.315  216.882 1.00 51.54  ? 101 ALA A N   1 
ATOM   632   C CA  . ALA A 1 101 ? 0.076   21.525  216.513 1.00 50.50  ? 101 ALA A CA  1 
ATOM   633   C C   . ALA A 1 101 ? -0.293  20.991  215.149 1.00 51.49  ? 101 ALA A C   1 
ATOM   634   O O   . ALA A 1 101 ? 0.585   20.646  214.339 1.00 51.08  ? 101 ALA A O   1 
ATOM   635   C CB  . ALA A 1 101 ? -0.262  22.974  216.565 1.00 50.82  ? 101 ALA A CB  1 
ATOM   636   N N   . LYS A 1 102 ? -1.597  20.970  214.874 1.00 51.22  ? 102 LYS A N   1 
ATOM   637   C CA  . LYS A 1 102 ? -2.039  20.494  213.581 1.00 51.65  ? 102 LYS A CA  1 
ATOM   638   C C   . LYS A 1 102 ? -3.076  21.327  212.926 1.00 46.60  ? 102 LYS A C   1 
ATOM   639   O O   . LYS A 1 102 ? -4.163  21.513  213.465 1.00 46.00  ? 102 LYS A O   1 
ATOM   640   C CB  . LYS A 1 102 ? -2.581  19.083  213.630 1.00 56.77  ? 102 LYS A CB  1 
ATOM   641   C CG  . LYS A 1 102 ? -3.162  18.690  212.286 1.00 64.66  ? 102 LYS A CG  1 
ATOM   642   C CD  . LYS A 1 102 ? -3.734  17.282  212.275 1.00 77.10  ? 102 LYS A CD  1 
ATOM   643   C CE  . LYS A 1 102 ? -5.165  17.221  212.821 1.00 84.19  ? 102 LYS A CE  1 
ATOM   644   N NZ  . LYS A 1 102 ? -5.838  15.893  212.542 1.00 90.76  ? 102 LYS A NZ  1 
ATOM   645   N N   . LEU A 1 103 ? -2.754  21.738  211.710 1.00 44.91  ? 103 LEU A N   1 
ATOM   646   C CA  . LEU A 1 103 ? -3.660  22.521  210.910 1.00 44.00  ? 103 LEU A CA  1 
ATOM   647   C C   . LEU A 1 103 ? -4.415  21.515  210.167 1.00 41.15  ? 103 LEU A C   1 
ATOM   648   O O   . LEU A 1 103 ? -3.841  20.619  209.558 1.00 32.88  ? 103 LEU A O   1 
ATOM   649   C CB  . LEU A 1 103 ? -2.957  23.375  209.873 1.00 46.74  ? 103 LEU A CB  1 
ATOM   650   C CG  . LEU A 1 103 ? -2.261  24.600  210.425 1.00 47.34  ? 103 LEU A CG  1 
ATOM   651   C CD1 . LEU A 1 103 ? -3.167  25.281  211.425 1.00 41.65  ? 103 LEU A CD1 1 
ATOM   652   C CD2 . LEU A 1 103 ? -0.973  24.157  211.083 1.00 49.56  ? 103 LEU A CD2 1 
ATOM   653   N N   . GLN A 1 104 ? -5.711  21.699  210.172 1.00 41.87  ? 104 GLN A N   1 
ATOM   654   C CA  . GLN A 1 104 ? -6.522  20.783  209.468 1.00 46.32  ? 104 GLN A CA  1 
ATOM   655   C C   . GLN A 1 104 ? -7.028  21.380  208.163 1.00 43.76  ? 104 GLN A C   1 
ATOM   656   O O   . GLN A 1 104 ? -8.001  22.147  208.117 1.00 45.46  ? 104 GLN A O   1 
ATOM   657   C CB  . GLN A 1 104 ? -7.636  20.314  210.369 1.00 58.29  ? 104 GLN A CB  1 
ATOM   658   C CG  . GLN A 1 104 ? -8.449  19.199  209.744 1.00 76.84  ? 104 GLN A CG  1 
ATOM   659   C CD  . GLN A 1 104 ? -7.588  18.170  209.039 1.00 82.47  ? 104 GLN A CD  1 
ATOM   660   O OE1 . GLN A 1 104 ? -7.245  17.123  209.615 1.00 89.00  ? 104 GLN A OE1 1 
ATOM   661   N NE2 . GLN A 1 104 ? -7.232  18.455  207.786 1.00 85.94  ? 104 GLN A NE2 1 
ATOM   662   N N   . LEU A 1 105 ? -6.359  20.998  207.090 1.00 39.20  ? 105 LEU A N   1 
ATOM   663   C CA  . LEU A 1 105 ? -6.706  21.487  205.785 1.00 39.30  ? 105 LEU A CA  1 
ATOM   664   C C   . LEU A 1 105 ? -7.945  20.801  205.330 1.00 44.24  ? 105 LEU A C   1 
ATOM   665   O O   . LEU A 1 105 ? -8.435  19.920  206.007 1.00 46.62  ? 105 LEU A O   1 
ATOM   666   C CB  . LEU A 1 105 ? -5.573  21.236  204.838 1.00 37.62  ? 105 LEU A CB  1 
ATOM   667   C CG  . LEU A 1 105 ? -4.428  22.175  205.179 1.00 40.67  ? 105 LEU A CG  1 
ATOM   668   C CD1 . LEU A 1 105 ? -3.741  21.758  206.482 1.00 43.90  ? 105 LEU A CD1 1 
ATOM   669   C CD2 . LEU A 1 105 ? -3.446  22.175  204.041 1.00 43.10  ? 105 LEU A CD2 1 
ATOM   670   N N   . PRO A 1 106 ? -8.494  21.206  204.187 1.00 49.19  ? 106 PRO A N   1 
ATOM   671   C CA  . PRO A 1 106 ? -9.712  20.589  203.676 1.00 56.30  ? 106 PRO A CA  1 
ATOM   672   C C   . PRO A 1 106 ? -9.382  19.371  202.847 1.00 61.07  ? 106 PRO A C   1 
ATOM   673   O O   . PRO A 1 106 ? -8.235  19.180  202.493 1.00 59.46  ? 106 PRO A O   1 
ATOM   674   C CB  . PRO A 1 106 ? -10.289 21.693  202.809 1.00 56.61  ? 106 PRO A CB  1 
ATOM   675   C CG  . PRO A 1 106 ? -9.090  22.209  202.160 1.00 56.46  ? 106 PRO A CG  1 
ATOM   676   C CD  . PRO A 1 106 ? -8.072  22.291  203.295 1.00 50.80  ? 106 PRO A CD  1 
ATOM   677   N N   . MET A 1 107 ? -10.400 18.567  202.546 1.00 72.25  ? 107 MET A N   1 
ATOM   678   C CA  . MET A 1 107 ? -10.263 17.348  201.747 1.00 85.60  ? 107 MET A CA  1 
ATOM   679   C C   . MET A 1 107 ? -10.217 17.773  200.284 1.00 86.05  ? 107 MET A C   1 
ATOM   680   O O   . MET A 1 107 ? -11.026 18.583  199.864 1.00 86.07  ? 107 MET A O   1 
ATOM   681   C CB  . MET A 1 107 ? -11.473 16.440  202.002 1.00 101.06 ? 107 MET A CB  1 
ATOM   682   C CG  . MET A 1 107 ? -11.179 14.930  201.932 1.00 124.36 ? 107 MET A CG  1 
ATOM   683   S SD  . MET A 1 107 ? -10.987 14.178  200.255 1.00 146.19 ? 107 MET A SD  1 
ATOM   684   C CE  . MET A 1 107 ? -12.575 13.198  200.162 1.00 148.01 ? 107 MET A CE  1 
ATOM   685   N N   . LEU A 1 108 ? -9.317  17.201  199.496 1.00 89.00  ? 108 LEU A N   1 
ATOM   686   C CA  . LEU A 1 108 ? -9.181  17.623  198.103 1.00 96.60  ? 108 LEU A CA  1 
ATOM   687   C C   . LEU A 1 108 ? -9.740  16.715  197.011 1.00 102.07 ? 108 LEU A C   1 
ATOM   688   O O   . LEU A 1 108 ? -10.119 17.166  195.916 1.00 101.32 ? 108 LEU A O   1 
ATOM   689   C CB  . LEU A 1 108 ? -7.702  17.910  197.819 1.00 97.99  ? 108 LEU A CB  1 
ATOM   690   C CG  . LEU A 1 108 ? -7.074  19.240  198.269 1.00 100.16 ? 108 LEU A CG  1 
ATOM   691   C CD1 . LEU A 1 108 ? -7.648  19.710  199.581 1.00 102.81 ? 108 LEU A CD1 1 
ATOM   692   C CD2 . LEU A 1 108 ? -5.567  19.104  198.369 1.00 99.99  ? 108 LEU A CD2 1 
ATOM   693   N N   . ASN A 1 109 ? -9.733  15.425  197.286 1.00 109.34 ? 109 ASN A N   1 
ATOM   694   C CA  . ASN A 1 109 ? -10.200 14.461  196.323 1.00 117.14 ? 109 ASN A CA  1 
ATOM   695   C C   . ASN A 1 109 ? -11.704 14.224  196.428 1.00 118.82 ? 109 ASN A C   1 
ATOM   696   O O   . ASN A 1 109 ? -12.298 14.459  197.468 1.00 118.33 ? 109 ASN A O   1 
ATOM   697   C CB  . ASN A 1 109 ? -9.424  13.171  196.540 1.00 124.54 ? 109 ASN A CB  1 
ATOM   698   C CG  . ASN A 1 109 ? -9.638  12.183  195.435 1.00 134.40 ? 109 ASN A CG  1 
ATOM   699   O OD1 . ASN A 1 109 ? -10.003 11.040  195.691 1.00 141.86 ? 109 ASN A OD1 1 
ATOM   700   N ND2 . ASN A 1 109 ? -9.424  12.612  194.188 1.00 139.14 ? 109 ASN A ND2 1 
ATOM   701   N N   . GLU A 1 110 ? -12.333 13.813  195.337 1.00 122.40 ? 110 GLU A N   1 
ATOM   702   C CA  . GLU A 1 110 ? -13.767 13.533  195.364 1.00 127.61 ? 110 GLU A CA  1 
ATOM   703   C C   . GLU A 1 110 ? -14.158 12.519  194.293 1.00 125.86 ? 110 GLU A C   1 
ATOM   704   O O   . GLU A 1 110 ? -15.046 11.703  194.496 1.00 124.89 ? 110 GLU A O   1 
ATOM   705   C CB  . GLU A 1 110 ? -14.583 14.815  195.199 1.00 138.47 ? 110 GLU A CB  1 
ATOM   706   C CG  . GLU A 1 110 ? -14.273 15.597  193.910 1.00 158.45 ? 110 GLU A CG  1 
ATOM   707   C CD  . GLU A 1 110 ? -15.398 16.567  193.472 1.00 167.53 ? 110 GLU A CD  1 
ATOM   708   O OE1 . GLU A 1 110 ? -15.870 17.386  194.305 1.00 172.77 ? 110 GLU A OE1 1 
ATOM   709   O OE2 . GLU A 1 110 ? -15.798 16.514  192.277 1.00 173.79 ? 110 GLU A OE2 1 
ATOM   710   N N   . ASP A 1 111 ? -13.501 12.581  193.146 1.00 125.73 ? 111 ASP A N   1 
ATOM   711   C CA  . ASP A 1 111 ? -13.769 11.652  192.059 1.00 126.18 ? 111 ASP A CA  1 
ATOM   712   C C   . ASP A 1 111 ? -12.928 10.412  192.314 1.00 122.66 ? 111 ASP A C   1 
ATOM   713   O O   . ASP A 1 111 ? -11.726 10.385  192.007 1.00 121.32 ? 111 ASP A O   1 
ATOM   714   C CB  . ASP A 1 111 ? -13.359 12.292  190.738 1.00 135.92 ? 111 ASP A CB  1 
ATOM   715   C CG  . ASP A 1 111 ? -13.445 11.331  189.577 1.00 144.43 ? 111 ASP A CG  1 
ATOM   716   O OD1 . ASP A 1 111 ? -14.577 10.897  189.269 1.00 147.64 ? 111 ASP A OD1 1 
ATOM   717   O OD2 . ASP A 1 111 ? -12.385 10.997  188.989 1.00 151.11 ? 111 ASP A OD2 1 
ATOM   718   N N   . LEU A 1 112 ? -13.533 9.391   192.906 1.00 120.38 ? 112 LEU A N   1 
ATOM   719   C CA  . LEU A 1 112 ? -12.749 8.205   193.190 1.00 122.35 ? 112 LEU A CA  1 
ATOM   720   C C   . LEU A 1 112 ? -12.627 7.338   191.981 1.00 124.84 ? 112 LEU A C   1 
ATOM   721   O O   . LEU A 1 112 ? -11.805 6.428   191.953 1.00 124.60 ? 112 LEU A O   1 
ATOM   722   C CB  . LEU A 1 112 ? -13.309 7.381   194.347 1.00 122.87 ? 112 LEU A CB  1 
ATOM   723   C CG  . LEU A 1 112 ? -12.215 6.449   194.911 1.00 125.21 ? 112 LEU A CG  1 
ATOM   724   C CD1 . LEU A 1 112 ? -11.168 7.276   195.657 1.00 126.96 ? 112 LEU A CD1 1 
ATOM   725   C CD2 . LEU A 1 112 ? -12.779 5.381   195.836 1.00 124.30 ? 112 LEU A CD2 1 
ATOM   726   N N   . THR A 1 113 ? -13.407 7.651   190.954 1.00 129.74 ? 113 THR A N   1 
ATOM   727   C CA  . THR A 1 113 ? -13.372 6.859   189.729 1.00 136.01 ? 113 THR A CA  1 
ATOM   728   C C   . THR A 1 113 ? -11.958 6.761   189.194 1.00 138.74 ? 113 THR A C   1 
ATOM   729   O O   . THR A 1 113 ? -11.633 5.842   188.433 1.00 138.32 ? 113 THR A O   1 
ATOM   730   C CB  . THR A 1 113 ? -14.269 7.446   188.615 1.00 136.76 ? 113 THR A CB  1 
ATOM   731   O OG1 . THR A 1 113 ? -13.576 8.491   187.909 1.00 135.30 ? 113 THR A OG1 1 
ATOM   732   C CG2 . THR A 1 113 ? -15.561 7.980   189.216 1.00 141.07 ? 113 THR A CG2 1 
ATOM   733   N N   . CYS A 1 114 ? -11.114 7.701   189.608 1.00 142.29 ? 114 CYS A N   1 
ATOM   734   C CA  . CYS A 1 114 ? -9.754  7.693   189.138 1.00 146.16 ? 114 CYS A CA  1 
ATOM   735   C C   . CYS A 1 114 ? -8.682  7.192   190.075 1.00 144.66 ? 114 CYS A C   1 
ATOM   736   O O   . CYS A 1 114 ? -8.739  7.368   191.297 1.00 143.92 ? 114 CYS A O   1 
ATOM   737   C CB  . CYS A 1 114 ? -9.341  9.050   188.612 1.00 150.02 ? 114 CYS A CB  1 
ATOM   738   S SG  . CYS A 1 114 ? -8.096  8.797   187.316 1.00 159.28 ? 114 CYS A SG  1 
ATOM   739   N N   . ASP A 1 115 ? -7.646  6.651   189.445 1.00 143.37 ? 115 ASP A N   1 
ATOM   740   C CA  . ASP A 1 115 ? -6.485  6.126   190.132 1.00 140.44 ? 115 ASP A CA  1 
ATOM   741   C C   . ASP A 1 115 ? -5.574  7.301   190.392 1.00 132.76 ? 115 ASP A C   1 
ATOM   742   O O   . ASP A 1 115 ? -4.366  7.159   190.524 1.00 131.49 ? 115 ASP A O   1 
ATOM   743   C CB  . ASP A 1 115 ? -5.773  5.108   189.236 1.00 150.59 ? 115 ASP A CB  1 
ATOM   744   C CG  . ASP A 1 115 ? -6.211  3.668   189.512 1.00 157.91 ? 115 ASP A CG  1 
ATOM   745   O OD1 . ASP A 1 115 ? -5.774  3.115   190.557 1.00 162.53 ? 115 ASP A OD1 1 
ATOM   746   O OD2 . ASP A 1 115 ? -6.968  3.090   188.686 1.00 161.53 ? 115 ASP A OD2 1 
ATOM   747   N N   . THR A 1 116 ? -6.174  8.469   190.498 1.00 125.57 ? 116 THR A N   1 
ATOM   748   C CA  . THR A 1 116 ? -5.419  9.666   190.707 1.00 119.16 ? 116 THR A CA  1 
ATOM   749   C C   . THR A 1 116 ? -6.141  10.527  191.722 1.00 116.58 ? 116 THR A C   1 
ATOM   750   O O   . THR A 1 116 ? -7.258  11.019  191.489 1.00 116.11 ? 116 THR A O   1 
ATOM   751   C CB  . THR A 1 116 ? -5.228  10.394  189.377 1.00 117.38 ? 116 THR A CB  1 
ATOM   752   O OG1 . THR A 1 116 ? -4.634  9.489   188.428 1.00 117.07 ? 116 THR A OG1 1 
ATOM   753   C CG2 . THR A 1 116 ? -4.341  11.609  189.547 1.00 114.52 ? 116 THR A CG2 1 
ATOM   754   N N   . LEU A 1 117 ? -5.543  10.560  192.904 1.00 112.65 ? 117 LEU A N   1 
ATOM   755   C CA  . LEU A 1 117 ? -6.039  11.327  194.028 1.00 109.42 ? 117 LEU A CA  1 
ATOM   756   C C   . LEU A 1 117 ? -5.203  12.587  194.056 1.00 104.58 ? 117 LEU A C   1 
ATOM   757   O O   . LEU A 1 117 ? -4.241  12.708  193.295 1.00 105.91 ? 117 LEU A O   1 
ATOM   758   C CB  . LEU A 1 117 ? -5.872  10.534  195.319 1.00 116.67 ? 117 LEU A CB  1 
ATOM   759   C CG  . LEU A 1 117 ? -6.913  9.427   195.551 1.00 124.47 ? 117 LEU A CG  1 
ATOM   760   C CD1 . LEU A 1 117 ? -7.196  8.614   194.283 1.00 126.39 ? 117 LEU A CD1 1 
ATOM   761   C CD2 . LEU A 1 117 ? -6.457  8.522   196.690 1.00 131.28 ? 117 LEU A CD2 1 
ATOM   762   N N   . GLN A 1 118 ? -5.511  13.493  194.971 1.00 96.58  ? 118 GLN A N   1 
ATOM   763   C CA  . GLN A 1 118 ? -4.798  14.760  195.027 1.00 86.65  ? 118 GLN A CA  1 
ATOM   764   C C   . GLN A 1 118 ? -4.649  15.150  196.470 1.00 77.41  ? 118 GLN A C   1 
ATOM   765   O O   . GLN A 1 118 ? -5.580  14.942  197.250 1.00 75.71  ? 118 GLN A O   1 
ATOM   766   C CB  . GLN A 1 118 ? -5.644  15.791  194.289 1.00 88.34  ? 118 GLN A CB  1 
ATOM   767   C CG  . GLN A 1 118 ? -5.114  17.194  194.209 1.00 92.32  ? 118 GLN A CG  1 
ATOM   768   C CD  . GLN A 1 118 ? -6.085  18.119  193.467 1.00 96.15  ? 118 GLN A CD  1 
ATOM   769   O OE1 . GLN A 1 118 ? -5.675  18.937  192.640 1.00 98.26  ? 118 GLN A OE1 1 
ATOM   770   N NE2 . GLN A 1 118 ? -7.384  17.984  193.759 1.00 97.89  ? 118 GLN A NE2 1 
ATOM   771   N N   . MET A 1 119 ? -3.485  15.664  196.847 1.00 67.75  ? 119 MET A N   1 
ATOM   772   C CA  . MET A 1 119 ? -3.309  16.067  198.226 1.00 62.33  ? 119 MET A CA  1 
ATOM   773   C C   . MET A 1 119 ? -2.413  17.253  198.462 1.00 55.77  ? 119 MET A C   1 
ATOM   774   O O   . MET A 1 119 ? -1.660  17.719  197.583 1.00 46.10  ? 119 MET A O   1 
ATOM   775   C CB  . MET A 1 119 ? -2.920  14.892  199.149 1.00 70.41  ? 119 MET A CB  1 
ATOM   776   C CG  . MET A 1 119 ? -1.461  14.401  199.066 1.00 78.37  ? 119 MET A CG  1 
ATOM   777   S SD  . MET A 1 119 ? -0.968  13.098  200.289 1.00 84.71  ? 119 MET A SD  1 
ATOM   778   C CE  . MET A 1 119 ? -0.671  11.718  199.212 1.00 80.55  ? 119 MET A CE  1 
ATOM   779   N N   . TRP A 1 120 ? -2.568  17.759  199.676 1.00 50.84  ? 120 TRP A N   1 
ATOM   780   C CA  . TRP A 1 120 ? -1.838  18.910  200.126 1.00 50.26  ? 120 TRP A CA  1 
ATOM   781   C C   . TRP A 1 120 ? -0.370  18.645  200.244 1.00 48.50  ? 120 TRP A C   1 
ATOM   782   O O   . TRP A 1 120 ? 0.059   17.699  200.916 1.00 46.40  ? 120 TRP A O   1 
ATOM   783   C CB  . TRP A 1 120 ? -2.363  19.372  201.468 1.00 52.94  ? 120 TRP A CB  1 
ATOM   784   C CG  . TRP A 1 120 ? -3.681  20.059  201.410 1.00 54.93  ? 120 TRP A CG  1 
ATOM   785   C CD1 . TRP A 1 120 ? -4.752  19.814  202.199 1.00 58.38  ? 120 TRP A CD1 1 
ATOM   786   C CD2 . TRP A 1 120 ? -4.034  21.170  200.597 1.00 56.91  ? 120 TRP A CD2 1 
ATOM   787   N NE1 . TRP A 1 120 ? -5.750  20.713  201.948 1.00 54.23  ? 120 TRP A NE1 1 
ATOM   788   C CE2 . TRP A 1 120 ? -5.334  21.558  200.965 1.00 56.31  ? 120 TRP A CE2 1 
ATOM   789   C CE3 . TRP A 1 120 ? -3.377  21.881  199.600 1.00 64.47  ? 120 TRP A CE3 1 
ATOM   790   C CZ2 . TRP A 1 120 ? -5.993  22.629  200.370 1.00 63.23  ? 120 TRP A CZ2 1 
ATOM   791   C CZ3 . TRP A 1 120 ? -4.038  22.959  199.001 1.00 71.37  ? 120 TRP A CZ3 1 
ATOM   792   C CH2 . TRP A 1 120 ? -5.333  23.320  199.391 1.00 68.99  ? 120 TRP A CH2 1 
ATOM   793   N N   . GLU A 1 121 ? 0.396   19.541  199.643 1.00 47.19  ? 121 GLU A N   1 
ATOM   794   C CA  . GLU A 1 121 ? 1.832   19.442  199.670 1.00 43.09  ? 121 GLU A CA  1 
ATOM   795   C C   . GLU A 1 121 ? 2.445   20.749  200.140 1.00 37.36  ? 121 GLU A C   1 
ATOM   796   O O   . GLU A 1 121 ? 2.144   21.820  199.608 1.00 37.26  ? 121 GLU A O   1 
ATOM   797   C CB  . GLU A 1 121 ? 2.340   19.107  198.289 1.00 44.97  ? 121 GLU A CB  1 
ATOM   798   C CG  . GLU A 1 121 ? 3.788   18.744  198.309 1.00 51.37  ? 121 GLU A CG  1 
ATOM   799   C CD  . GLU A 1 121 ? 4.518   19.240  197.094 1.00 55.20  ? 121 GLU A CD  1 
ATOM   800   O OE1 . GLU A 1 121 ? 4.561   18.524  196.056 1.00 51.58  ? 121 GLU A OE1 1 
ATOM   801   O OE2 . GLU A 1 121 ? 5.043   20.373  197.171 1.00 58.75  ? 121 GLU A OE2 1 
ATOM   802   N N   . ALA A 1 122 ? 3.294   20.657  201.153 1.00 32.55  ? 122 ALA A N   1 
ATOM   803   C CA  . ALA A 1 122 ? 3.943   21.839  201.699 1.00 28.55  ? 122 ALA A CA  1 
ATOM   804   C C   . ALA A 1 122 ? 5.192   22.149  200.935 1.00 24.12  ? 122 ALA A C   1 
ATOM   805   O O   . ALA A 1 122 ? 6.053   21.279  200.755 1.00 22.67  ? 122 ALA A O   1 
ATOM   806   C CB  . ALA A 1 122 ? 4.277   21.648  203.116 1.00 34.37  ? 122 ALA A CB  1 
ATOM   807   N N   . VAL A 1 123 ? 5.366   23.433  200.667 1.00 18.07  ? 123 VAL A N   1 
ATOM   808   C CA  . VAL A 1 123 ? 6.480   23.878  199.874 1.00 16.55  ? 123 VAL A CA  1 
ATOM   809   C C   . VAL A 1 123 ? 7.583   24.622  200.558 1.00 18.04  ? 123 VAL A C   1 
ATOM   810   O O   . VAL A 1 123 ? 8.768   24.302  200.422 1.00 21.15  ? 123 VAL A O   1 
ATOM   811   C CB  . VAL A 1 123 ? 5.972   24.690  198.742 1.00 15.73  ? 123 VAL A CB  1 
ATOM   812   C CG1 . VAL A 1 123 ? 7.103   25.440  198.091 1.00 12.72  ? 123 VAL A CG1 1 
ATOM   813   C CG2 . VAL A 1 123 ? 5.283   23.755  197.761 1.00 17.08  ? 123 VAL A CG2 1 
ATOM   814   N N   . SER A 1 124 ? 7.222   25.659  201.260 1.00 16.93  ? 124 SER A N   1 
ATOM   815   C CA  . SER A 1 124 ? 8.251   26.386  201.925 1.00 19.49  ? 124 SER A CA  1 
ATOM   816   C C   . SER A 1 124 ? 7.655   27.018  203.122 1.00 19.89  ? 124 SER A C   1 
ATOM   817   O O   . SER A 1 124 ? 6.456   26.855  203.427 1.00 17.56  ? 124 SER A O   1 
ATOM   818   C CB  . SER A 1 124 ? 8.829   27.409  200.989 1.00 22.03  ? 124 SER A CB  1 
ATOM   819   O OG  . SER A 1 124 ? 7.807   27.844  200.119 1.00 32.66  ? 124 SER A OG  1 
ATOM   820   N N   . VAL A 1 125 ? 8.453   27.809  203.785 1.00 23.12  ? 125 VAL A N   1 
ATOM   821   C CA  . VAL A 1 125 ? 7.910   28.367  204.957 1.00 31.52  ? 125 VAL A CA  1 
ATOM   822   C C   . VAL A 1 125 ? 8.773   29.411  205.555 1.00 35.81  ? 125 VAL A C   1 
ATOM   823   O O   . VAL A 1 125 ? 9.978   29.225  205.743 1.00 36.92  ? 125 VAL A O   1 
ATOM   824   C CB  . VAL A 1 125 ? 7.779   27.278  205.998 1.00 33.11  ? 125 VAL A CB  1 
ATOM   825   C CG1 . VAL A 1 125 ? 9.145   26.649  206.229 1.00 24.65  ? 125 VAL A CG1 1 
ATOM   826   C CG2 . VAL A 1 125 ? 7.218   27.853  207.295 1.00 35.11  ? 125 VAL A CG2 1 
ATOM   827   N N   . LYS A 1 126 ? 8.171   30.541  205.836 1.00 39.37  ? 126 LYS A N   1 
ATOM   828   C CA  . LYS A 1 126 ? 8.950   31.524  206.510 1.00 44.55  ? 126 LYS A CA  1 
ATOM   829   C C   . LYS A 1 126 ? 8.600   31.230  207.947 1.00 42.48  ? 126 LYS A C   1 
ATOM   830   O O   . LYS A 1 126 ? 7.507   30.720  208.253 1.00 38.46  ? 126 LYS A O   1 
ATOM   831   C CB  . LYS A 1 126 ? 8.482   32.938  206.183 1.00 53.85  ? 126 LYS A CB  1 
ATOM   832   C CG  . LYS A 1 126 ? 8.555   33.392  204.714 1.00 61.75  ? 126 LYS A CG  1 
ATOM   833   C CD  . LYS A 1 126 ? 8.627   34.957  204.634 1.00 66.90  ? 126 LYS A CD  1 
ATOM   834   C CE  . LYS A 1 126 ? 8.581   35.526  203.198 1.00 72.89  ? 126 LYS A CE  1 
ATOM   835   N NZ  . LYS A 1 126 ? 8.897   37.005  203.099 1.00 76.53  ? 126 LYS A NZ  1 
ATOM   836   N N   . THR A 1 127 ? 9.550   31.474  208.825 1.00 42.40  ? 127 THR A N   1 
ATOM   837   C CA  . THR A 1 127 ? 9.276   31.333  210.247 1.00 48.55  ? 127 THR A CA  1 
ATOM   838   C C   . THR A 1 127 ? 10.171  32.265  211.059 1.00 48.91  ? 127 THR A C   1 
ATOM   839   O O   . THR A 1 127 ? 11.301  32.610  210.631 1.00 56.03  ? 127 THR A O   1 
ATOM   840   C CB  . THR A 1 127 ? 9.307   29.896  210.749 1.00 50.77  ? 127 THR A CB  1 
ATOM   841   O OG1 . THR A 1 127 ? 9.485   29.896  212.168 1.00 56.72  ? 127 THR A OG1 1 
ATOM   842   C CG2 . THR A 1 127 ? 10.404  29.123  210.106 1.00 57.98  ? 127 THR A CG2 1 
ATOM   843   N N   . GLU A 1 128 ? 9.677   32.673  212.226 1.00 46.12  ? 128 GLU A N   1 
ATOM   844   C CA  . GLU A 1 128 ? 10.415  33.631  213.018 1.00 44.31  ? 128 GLU A CA  1 
ATOM   845   C C   . GLU A 1 128 ? 10.036  33.543  214.455 1.00 42.48  ? 128 GLU A C   1 
ATOM   846   O O   . GLU A 1 128 ? 8.863   33.379  214.817 1.00 40.67  ? 128 GLU A O   1 
ATOM   847   C CB  . GLU A 1 128 ? 10.081  35.018  212.501 1.00 52.13  ? 128 GLU A CB  1 
ATOM   848   C CG  . GLU A 1 128 ? 10.929  36.175  212.939 1.00 63.51  ? 128 GLU A CG  1 
ATOM   849   C CD  . GLU A 1 128 ? 10.350  37.482  212.397 1.00 68.59  ? 128 GLU A CD  1 
ATOM   850   O OE1 . GLU A 1 128 ? 9.930   37.503  211.213 1.00 72.72  ? 128 GLU A OE1 1 
ATOM   851   O OE2 . GLU A 1 128 ? 10.273  38.481  213.149 1.00 70.82  ? 128 GLU A OE2 1 
ATOM   852   N N   . VAL A 1 129 ? 11.065  33.601  215.275 1.00 40.00  ? 129 VAL A N   1 
ATOM   853   C CA  . VAL A 1 129 ? 10.854  33.547  216.689 1.00 40.29  ? 129 VAL A CA  1 
ATOM   854   C C   . VAL A 1 129 ? 10.830  34.960  217.096 1.00 37.99  ? 129 VAL A C   1 
ATOM   855   O O   . VAL A 1 129 ? 11.808  35.698  216.927 1.00 34.65  ? 129 VAL A O   1 
ATOM   856   C CB  . VAL A 1 129 ? 11.947  32.865  217.416 1.00 43.82  ? 129 VAL A CB  1 
ATOM   857   C CG1 . VAL A 1 129 ? 11.832  33.201  218.903 1.00 47.28  ? 129 VAL A CG1 1 
ATOM   858   C CG2 . VAL A 1 129 ? 11.816  31.368  217.196 1.00 46.41  ? 129 VAL A CG2 1 
ATOM   859   N N   . VAL A 1 130 ? 9.777   35.279  217.810 1.00 35.96  ? 130 VAL A N   1 
ATOM   860   C CA  . VAL A 1 130 ? 9.592   36.635  218.169 1.00 34.65  ? 130 VAL A CA  1 
ATOM   861   C C   . VAL A 1 130 ? 9.691   37.068  219.536 1.00 35.94  ? 130 VAL A C   1 
ATOM   862   O O   . VAL A 1 130 ? 9.129   36.430  220.432 1.00 36.74  ? 130 VAL A O   1 
ATOM   863   C CB  . VAL A 1 130 ? 8.266   37.087  217.768 1.00 30.61  ? 130 VAL A CB  1 
ATOM   864   C CG1 . VAL A 1 130 ? 8.437   37.963  216.562 1.00 41.28  ? 130 VAL A CG1 1 
ATOM   865   C CG2 . VAL A 1 130 ? 7.353   35.892  217.537 1.00 25.96  ? 130 VAL A CG2 1 
ATOM   866   N N   . GLY A 1 131 ? 10.302  38.241  219.667 1.00 33.70  ? 131 GLY A N   1 
ATOM   867   C CA  . GLY A 1 131 ? 10.359  38.844  220.976 1.00 33.86  ? 131 GLY A CA  1 
ATOM   868   C C   . GLY A 1 131 ? 11.658  38.882  221.683 1.00 29.83  ? 131 GLY A C   1 
ATOM   869   O O   . GLY A 1 131 ? 11.736  39.104  222.893 1.00 23.39  ? 131 GLY A O   1 
ATOM   870   N N   . SER A 1 132 ? 12.685  38.807  220.886 1.00 29.33  ? 132 SER A N   1 
ATOM   871   C CA  . SER A 1 132 ? 14.009  38.832  221.427 1.00 36.97  ? 132 SER A CA  1 
ATOM   872   C C   . SER A 1 132 ? 14.199  40.119  222.215 1.00 38.91  ? 132 SER A C   1 
ATOM   873   O O   . SER A 1 132 ? 14.976  40.165  223.175 1.00 40.91  ? 132 SER A O   1 
ATOM   874   C CB  . SER A 1 132 ? 14.949  38.732  220.265 1.00 38.31  ? 132 SER A CB  1 
ATOM   875   O OG  . SER A 1 132 ? 14.216  38.065  219.245 1.00 45.27  ? 132 SER A OG  1 
ATOM   876   N N   . GLY A 1 133 ? 13.412  41.136  221.863 1.00 39.68  ? 133 GLY A N   1 
ATOM   877   C CA  . GLY A 1 133 ? 13.501  42.416  222.560 1.00 40.62  ? 133 GLY A CA  1 
ATOM   878   C C   . GLY A 1 133 ? 13.129  42.303  224.024 1.00 38.43  ? 133 GLY A C   1 
ATOM   879   O O   . GLY A 1 133 ? 13.707  42.945  224.897 1.00 31.96  ? 133 GLY A O   1 
ATOM   880   N N   . SER A 1 134 ? 12.146  41.454  224.264 1.00 37.21  ? 134 SER A N   1 
ATOM   881   C CA  . SER A 1 134 ? 11.648  41.183  225.582 1.00 41.40  ? 134 SER A CA  1 
ATOM   882   C C   . SER A 1 134 ? 12.847  41.013  226.535 1.00 44.57  ? 134 SER A C   1 
ATOM   883   O O   . SER A 1 134 ? 12.922  41.605  227.609 1.00 49.99  ? 134 SER A O   1 
ATOM   884   C CB  . SER A 1 134 ? 10.807  39.898  225.484 1.00 40.82  ? 134 SER A CB  1 
ATOM   885   O OG  . SER A 1 134 ? 10.723  39.158  226.698 1.00 47.55  ? 134 SER A OG  1 
ATOM   886   N N   . LEU A 1 135 ? 13.882  40.373  226.043 1.00 42.31  ? 135 LEU A N   1 
ATOM   887   C CA  . LEU A 1 135 ? 15.019  40.092  226.867 1.00 46.14  ? 135 LEU A CA  1 
ATOM   888   C C   . LEU A 1 135 ? 15.860  41.309  227.145 1.00 48.50  ? 135 LEU A C   1 
ATOM   889   O O   . LEU A 1 135 ? 16.995  41.201  227.590 1.00 49.15  ? 135 LEU A O   1 
ATOM   890   C CB  . LEU A 1 135 ? 15.817  39.018  226.184 1.00 53.45  ? 135 LEU A CB  1 
ATOM   891   C CG  . LEU A 1 135 ? 14.999  37.745  225.917 1.00 62.09  ? 135 LEU A CG  1 
ATOM   892   C CD1 . LEU A 1 135 ? 13.827  37.946  224.949 1.00 67.80  ? 135 LEU A CD1 1 
ATOM   893   C CD2 . LEU A 1 135 ? 15.923  36.679  225.353 1.00 65.76  ? 135 LEU A CD2 1 
ATOM   894   N N   . LEU A 1 136 ? 15.290  42.476  226.894 1.00 53.48  ? 136 LEU A N   1 
ATOM   895   C CA  . LEU A 1 136 ? 15.974  43.737  227.120 1.00 59.62  ? 136 LEU A CA  1 
ATOM   896   C C   . LEU A 1 136 ? 15.540  44.402  228.398 1.00 65.42  ? 136 LEU A C   1 
ATOM   897   O O   . LEU A 1 136 ? 15.969  45.535  228.718 1.00 61.73  ? 136 LEU A O   1 
ATOM   898   C CB  . LEU A 1 136 ? 15.730  44.660  225.958 1.00 57.74  ? 136 LEU A CB  1 
ATOM   899   C CG  . LEU A 1 136 ? 16.510  44.073  224.807 1.00 56.75  ? 136 LEU A CG  1 
ATOM   900   C CD1 . LEU A 1 136 ? 16.365  44.927  223.549 1.00 54.92  ? 136 LEU A CD1 1 
ATOM   901   C CD2 . LEU A 1 136 ? 17.955  43.984  225.289 1.00 58.86  ? 136 LEU A CD2 1 
ATOM   902   N N   . ASP A 1 137 ? 14.637  43.711  229.091 1.00 71.92  ? 137 ASP A N   1 
ATOM   903   C CA  . ASP A 1 137 ? 14.153  44.190  230.361 1.00 78.48  ? 137 ASP A CA  1 
ATOM   904   C C   . ASP A 1 137 ? 15.242  43.805  231.294 1.00 79.50  ? 137 ASP A C   1 
ATOM   905   O O   . ASP A 1 137 ? 15.467  42.624  231.536 1.00 80.29  ? 137 ASP A O   1 
ATOM   906   C CB  . ASP A 1 137 ? 12.882  43.494  230.827 1.00 84.58  ? 137 ASP A CB  1 
ATOM   907   C CG  . ASP A 1 137 ? 12.466  43.949  232.224 1.00 91.25  ? 137 ASP A CG  1 
ATOM   908   O OD1 . ASP A 1 137 ? 13.118  44.865  232.773 1.00 94.02  ? 137 ASP A OD1 1 
ATOM   909   O OD2 . ASP A 1 137 ? 11.498  43.408  232.788 1.00 95.87  ? 137 ASP A OD2 1 
ATOM   910   N N   . VAL A 1 138 ? 15.920  44.806  231.817 1.00 81.16  ? 138 VAL A N   1 
ATOM   911   C CA  . VAL A 1 138 ? 17.012  44.547  232.720 1.00 83.21  ? 138 VAL A CA  1 
ATOM   912   C C   . VAL A 1 138 ? 16.762  44.986  234.137 1.00 87.85  ? 138 VAL A C   1 
ATOM   913   O O   . VAL A 1 138 ? 17.660  44.915  234.985 1.00 86.11  ? 138 VAL A O   1 
ATOM   914   C CB  . VAL A 1 138 ? 18.274  45.124  232.185 1.00 79.39  ? 138 VAL A CB  1 
ATOM   915   C CG1 . VAL A 1 138 ? 18.976  44.052  231.393 1.00 75.35  ? 138 VAL A CG1 1 
ATOM   916   C CG2 . VAL A 1 138 ? 17.958  46.339  231.309 1.00 79.63  ? 138 VAL A CG2 1 
ATOM   917   N N   . HIS A 1 139 ? 15.565  45.533  234.355 1.00 93.11  ? 139 HIS A N   1 
ATOM   918   C CA  . HIS A 1 139 ? 15.120  45.931  235.690 1.00 96.55  ? 139 HIS A CA  1 
ATOM   919   C C   . HIS A 1 139 ? 14.360  44.692  236.211 1.00 101.17 ? 139 HIS A C   1 
ATOM   920   O O   . HIS A 1 139 ? 14.747  43.556  235.877 1.00 104.78 ? 139 HIS A O   1 
ATOM   921   C CB  . HIS A 1 139 ? 14.249  47.209  235.663 1.00 91.63  ? 139 HIS A CB  1 
ATOM   922   C CG  . HIS A 1 139 ? 13.191  47.224  234.606 1.00 88.52  ? 139 HIS A CG  1 
ATOM   923   N ND1 . HIS A 1 139 ? 13.359  47.859  233.393 1.00 87.42  ? 139 HIS A ND1 1 
ATOM   924   C CD2 . HIS A 1 139 ? 11.940  46.709  234.592 1.00 85.75  ? 139 HIS A CD2 1 
ATOM   925   C CE1 . HIS A 1 139 ? 12.254  47.730  232.679 1.00 86.10  ? 139 HIS A CE1 1 
ATOM   926   N NE2 . HIS A 1 139 ? 11.378  47.036  233.384 1.00 83.31  ? 139 HIS A NE2 1 
ATOM   927   N N   . GLY A 1 140 ? 13.312  44.872  237.015 1.00 103.83 ? 140 GLY A N   1 
ATOM   928   C CA  . GLY A 1 140 ? 12.574  43.707  237.506 1.00 104.63 ? 140 GLY A CA  1 
ATOM   929   C C   . GLY A 1 140 ? 13.373  42.900  238.515 1.00 100.15 ? 140 GLY A C   1 
ATOM   930   O O   . GLY A 1 140 ? 14.412  43.381  238.974 1.00 98.72  ? 140 GLY A O   1 
ATOM   931   N N   . PHE A 1 141 ? 12.903  41.720  238.918 1.00 96.59  ? 141 PHE A N   1 
ATOM   932   C CA  . PHE A 1 141 ? 13.715  40.996  239.875 1.00 94.23  ? 141 PHE A CA  1 
ATOM   933   C C   . PHE A 1 141 ? 14.406  39.716  239.549 1.00 89.27  ? 141 PHE A C   1 
ATOM   934   O O   . PHE A 1 141 ? 13.883  38.614  239.734 1.00 94.07  ? 141 PHE A O   1 
ATOM   935   C CB  . PHE A 1 141 ? 13.137  40.947  241.284 1.00 99.79  ? 141 PHE A CB  1 
ATOM   936   C CG  . PHE A 1 141 ? 14.053  41.571  242.282 1.00 103.17 ? 141 PHE A CG  1 
ATOM   937   C CD1 . PHE A 1 141 ? 15.329  42.004  241.864 1.00 104.47 ? 141 PHE A CD1 1 
ATOM   938   C CD2 . PHE A 1 141 ? 13.638  41.852  243.561 1.00 102.79 ? 141 PHE A CD2 1 
ATOM   939   C CE1 . PHE A 1 141 ? 16.170  42.720  242.702 1.00 105.30 ? 141 PHE A CE1 1 
ATOM   940   C CE2 . PHE A 1 141 ? 14.467  42.567  244.408 1.00 109.42 ? 141 PHE A CE2 1 
ATOM   941   C CZ  . PHE A 1 141 ? 15.744  43.011  243.972 1.00 108.35 ? 141 PHE A CZ  1 
ATOM   942   N N   . ASN A 1 142 ? 15.667  39.900  239.219 1.00 78.94  ? 142 ASN A N   1 
ATOM   943   C CA  . ASN A 1 142 ? 16.562  38.838  238.877 1.00 71.36  ? 142 ASN A CA  1 
ATOM   944   C C   . ASN A 1 142 ? 17.791  39.224  239.663 1.00 67.42  ? 142 ASN A C   1 
ATOM   945   O O   . ASN A 1 142 ? 17.880  40.342  240.201 1.00 63.20  ? 142 ASN A O   1 
ATOM   946   C CB  . ASN A 1 142 ? 16.880  38.844  237.378 1.00 73.56  ? 142 ASN A CB  1 
ATOM   947   C CG  . ASN A 1 142 ? 15.658  38.586  236.506 1.00 74.33  ? 142 ASN A CG  1 
ATOM   948   O OD1 . ASN A 1 142 ? 15.187  39.470  235.784 1.00 77.28  ? 142 ASN A OD1 1 
ATOM   949   N ND2 . ASN A 1 142 ? 15.156  37.365  236.546 1.00 68.34  ? 142 ASN A ND2 1 
ATOM   950   N N   . LYS A 1 143 ? 18.682  38.256  239.822 1.00 65.65  ? 143 LYS A N   1 
ATOM   951   C CA  . LYS A 1 143 ? 19.932  38.447  240.537 1.00 67.76  ? 143 LYS A CA  1 
ATOM   952   C C   . LYS A 1 143 ? 20.524  39.717  239.968 1.00 66.38  ? 143 LYS A C   1 
ATOM   953   O O   . LYS A 1 143 ? 20.464  39.955  238.775 1.00 69.02  ? 143 LYS A O   1 
ATOM   954   C CB  . LYS A 1 143 ? 20.827  37.239  240.269 1.00 74.59  ? 143 LYS A CB  1 
ATOM   955   C CG  . LYS A 1 143 ? 21.967  36.980  241.262 1.00 87.98  ? 143 LYS A CG  1 
ATOM   956   C CD  . LYS A 1 143 ? 22.316  35.454  241.321 1.00 98.51  ? 143 LYS A CD  1 
ATOM   957   C CE  . LYS A 1 143 ? 23.563  35.120  242.185 1.00 106.62 ? 143 LYS A CE  1 
ATOM   958   N NZ  . LYS A 1 143 ? 23.838  33.642  242.402 1.00 111.14 ? 143 LYS A NZ  1 
ATOM   959   N N   . PRO A 1 144 ? 20.998  40.604  240.818 1.00 66.75  ? 144 PRO A N   1 
ATOM   960   C CA  . PRO A 1 144 ? 21.522  41.770  240.139 1.00 69.20  ? 144 PRO A CA  1 
ATOM   961   C C   . PRO A 1 144 ? 22.903  41.575  239.620 1.00 72.83  ? 144 PRO A C   1 
ATOM   962   O O   . PRO A 1 144 ? 23.522  40.529  239.810 1.00 72.65  ? 144 PRO A O   1 
ATOM   963   C CB  . PRO A 1 144 ? 21.482  42.827  241.222 1.00 69.52  ? 144 PRO A CB  1 
ATOM   964   C CG  . PRO A 1 144 ? 20.302  42.409  242.015 1.00 74.26  ? 144 PRO A CG  1 
ATOM   965   C CD  . PRO A 1 144 ? 20.625  40.955  242.183 1.00 71.73  ? 144 PRO A CD  1 
ATOM   966   N N   . THR A 1 145 ? 23.334  42.588  238.891 1.00 78.48  ? 145 THR A N   1 
ATOM   967   C CA  . THR A 1 145 ? 24.652  42.659  238.308 1.00 84.47  ? 145 THR A CA  1 
ATOM   968   C C   . THR A 1 145 ? 25.612  42.657  239.478 1.00 92.68  ? 145 THR A C   1 
ATOM   969   O O   . THR A 1 145 ? 26.564  41.867  239.552 1.00 94.67  ? 145 THR A O   1 
ATOM   970   C CB  . THR A 1 145 ? 24.793  43.994  237.651 1.00 80.37  ? 145 THR A CB  1 
ATOM   971   O OG1 . THR A 1 145 ? 23.641  44.221  236.835 1.00 75.95  ? 145 THR A OG1 1 
ATOM   972   C CG2 . THR A 1 145 ? 26.077  44.060  236.845 1.00 85.19  ? 145 THR A CG2 1 
ATOM   973   N N   . ASP A 1 146 ? 25.404  43.652  240.327 1.00 99.48  ? 146 ASP A N   1 
ATOM   974   C CA  . ASP A 1 146 ? 26.170  43.812  241.533 1.00 105.50 ? 146 ASP A CA  1 
ATOM   975   C C   . ASP A 1 146 ? 25.263  43.183  242.560 1.00 110.36 ? 146 ASP A C   1 
ATOM   976   O O   . ASP A 1 146 ? 24.152  43.644  242.806 1.00 109.59 ? 146 ASP A O   1 
ATOM   977   C CB  . ASP A 1 146 ? 26.360  45.278  241.852 1.00 105.05 ? 146 ASP A CB  1 
ATOM   978   C CG  . ASP A 1 146 ? 27.010  45.485  243.177 1.00 107.90 ? 146 ASP A CG  1 
ATOM   979   O OD1 . ASP A 1 146 ? 28.212  45.158  243.296 1.00 109.88 ? 146 ASP A OD1 1 
ATOM   980   O OD2 . ASP A 1 146 ? 26.307  45.951  244.100 1.00 108.03 ? 146 ASP A OD2 1 
ATOM   981   N N   . THR A 1 147 ? 25.696  42.042  243.056 1.00 117.26 ? 147 THR A N   1 
ATOM   982   C CA  . THR A 1 147 ? 24.948  41.292  244.047 1.00 123.12 ? 147 THR A CA  1 
ATOM   983   C C   . THR A 1 147 ? 25.124  42.003  245.363 1.00 123.55 ? 147 THR A C   1 
ATOM   984   O O   . THR A 1 147 ? 24.168  42.253  246.107 1.00 125.03 ? 147 THR A O   1 
ATOM   985   C CB  . THR A 1 147 ? 25.568  39.905  244.195 1.00 126.55 ? 147 THR A CB  1 
ATOM   986   O OG1 . THR A 1 147 ? 26.980  40.041  244.459 1.00 127.58 ? 147 THR A OG1 1 
ATOM   987   C CG2 . THR A 1 147 ? 25.364  39.108  242.909 1.00 130.63 ? 147 THR A CG2 1 
ATOM   988   N N   . VAL A 1 148 ? 26.395  42.289  245.614 1.00 122.28 ? 148 VAL A N   1 
ATOM   989   C CA  . VAL A 1 148 ? 26.903  42.955  246.791 1.00 121.00 ? 148 VAL A CA  1 
ATOM   990   C C   . VAL A 1 148 ? 25.959  44.001  247.353 1.00 121.20 ? 148 VAL A C   1 
ATOM   991   O O   . VAL A 1 148 ? 25.243  43.757  248.313 1.00 125.40 ? 148 VAL A O   1 
ATOM   992   C CB  . VAL A 1 148 ? 28.228  43.617  246.446 1.00 118.74 ? 148 VAL A CB  1 
ATOM   993   C CG1 . VAL A 1 148 ? 28.895  44.118  247.688 1.00 120.87 ? 148 VAL A CG1 1 
ATOM   994   C CG2 . VAL A 1 148 ? 29.113  42.639  245.681 1.00 119.79 ? 148 VAL A CG2 1 
ATOM   995   N N   . ASN A 1 149 ? 25.920  45.157  246.724 1.00 118.82 ? 149 ASN A N   1 
ATOM   996   C CA  . ASN A 1 149 ? 25.066  46.213  247.199 1.00 118.50 ? 149 ASN A CA  1 
ATOM   997   C C   . ASN A 1 149 ? 23.723  46.074  246.563 1.00 112.86 ? 149 ASN A C   1 
ATOM   998   O O   . ASN A 1 149 ? 22.903  46.985  246.613 1.00 111.94 ? 149 ASN A O   1 
ATOM   999   C CB  . ASN A 1 149 ? 25.690  47.529  246.824 1.00 131.79 ? 149 ASN A CB  1 
ATOM   1000  C CG  . ASN A 1 149 ? 27.145  47.580  247.193 1.00 141.70 ? 149 ASN A CG  1 
ATOM   1001  O OD1 . ASN A 1 149 ? 27.481  47.646  248.373 1.00 149.72 ? 149 ASN A OD1 1 
ATOM   1002  N ND2 . ASN A 1 149 ? 28.024  47.492  246.197 1.00 147.13 ? 149 ASN A ND2 1 
ATOM   1003  N N   . THR A 1 150 ? 23.493  44.912  245.976 1.00 108.52 ? 150 THR A N   1 
ATOM   1004  C CA  . THR A 1 150 ? 22.246  44.634  245.305 1.00 108.79 ? 150 THR A CA  1 
ATOM   1005  C C   . THR A 1 150 ? 21.973  45.742  244.296 1.00 108.59 ? 150 THR A C   1 
ATOM   1006  O O   . THR A 1 150 ? 20.964  46.457  244.391 1.00 107.96 ? 150 THR A O   1 
ATOM   1007  C CB  . THR A 1 150 ? 21.088  44.541  246.314 1.00 109.96 ? 150 THR A CB  1 
ATOM   1008  O OG1 . THR A 1 150 ? 21.324  43.447  247.213 1.00 109.55 ? 150 THR A OG1 1 
ATOM   1009  C CG2 . THR A 1 150 ? 19.744  44.353  245.580 1.00 110.99 ? 150 THR A CG2 1 
ATOM   1010  N N   . LYS A 1 151 ? 22.893  45.917  243.351 1.00 108.97 ? 151 LYS A N   1 
ATOM   1011  C CA  . LYS A 1 151 ? 22.719  46.949  242.341 1.00 107.82 ? 151 LYS A CA  1 
ATOM   1012  C C   . LYS A 1 151 ? 23.035  46.525  240.909 1.00 100.83 ? 151 LYS A C   1 
ATOM   1013  O O   . LYS A 1 151 ? 23.342  45.363  240.632 1.00 98.95  ? 151 LYS A O   1 
ATOM   1014  C CB  . LYS A 1 151 ? 23.530  48.189  242.725 1.00 115.98 ? 151 LYS A CB  1 
ATOM   1015  C CG  . LYS A 1 151 ? 22.719  49.486  242.679 1.00 127.47 ? 151 LYS A CG  1 
ATOM   1016  C CD  . LYS A 1 151 ? 21.419  49.384  243.503 1.00 136.12 ? 151 LYS A CD  1 
ATOM   1017  C CE  . LYS A 1 151 ? 21.670  49.297  245.007 1.00 139.18 ? 151 LYS A CE  1 
ATOM   1018  N NZ  . LYS A 1 151 ? 20.535  48.652  245.732 1.00 143.39 ? 151 LYS A NZ  1 
ATOM   1019  N N   . GLY A 1 152 ? 22.840  47.450  239.982 1.00 94.33  ? 152 GLY A N   1 
ATOM   1020  C CA  . GLY A 1 152 ? 23.152  47.149  238.609 1.00 88.02  ? 152 GLY A CA  1 
ATOM   1021  C C   . GLY A 1 152 ? 22.013  46.918  237.656 1.00 82.85  ? 152 GLY A C   1 
ATOM   1022  O O   . GLY A 1 152 ? 21.406  47.855  237.157 1.00 82.63  ? 152 GLY A O   1 
ATOM   1023  N N   . ILE A 1 153 ? 21.749  45.652  237.389 1.00 77.78  ? 153 ILE A N   1 
ATOM   1024  C CA  . ILE A 1 153 ? 20.736  45.257  236.443 1.00 70.69  ? 153 ILE A CA  1 
ATOM   1025  C C   . ILE A 1 153 ? 20.236  43.945  236.912 1.00 66.77  ? 153 ILE A C   1 
ATOM   1026  O O   . ILE A 1 153 ? 21.030  43.091  237.290 1.00 64.69  ? 153 ILE A O   1 
ATOM   1027  C CB  . ILE A 1 153 ? 21.382  44.882  235.119 1.00 73.54  ? 153 ILE A CB  1 
ATOM   1028  C CG1 . ILE A 1 153 ? 22.011  46.083  234.429 1.00 73.90  ? 153 ILE A CG1 1 
ATOM   1029  C CG2 . ILE A 1 153 ? 20.414  44.123  234.272 1.00 72.75  ? 153 ILE A CG2 1 
ATOM   1030  C CD1 . ILE A 1 153 ? 21.037  47.102  234.000 1.00 84.36  ? 153 ILE A CD1 1 
ATOM   1031  N N   . SER A 1 154 ? 18.934  43.751  236.861 1.00 64.44  ? 154 SER A N   1 
ATOM   1032  C CA  . SER A 1 154 ? 18.429  42.450  237.235 1.00 64.07  ? 154 SER A CA  1 
ATOM   1033  C C   . SER A 1 154 ? 18.732  41.660  235.997 1.00 59.78  ? 154 SER A C   1 
ATOM   1034  O O   . SER A 1 154 ? 18.077  41.788  234.968 1.00 55.40  ? 154 SER A O   1 
ATOM   1035  C CB  . SER A 1 154 ? 16.933  42.435  237.581 1.00 69.45  ? 154 SER A CB  1 
ATOM   1036  O OG  . SER A 1 154 ? 16.734  42.226  238.988 1.00 68.03  ? 154 SER A OG  1 
ATOM   1037  N N   . THR A 1 155 ? 19.914  41.079  236.089 1.00 59.94  ? 155 THR A N   1 
ATOM   1038  C CA  . THR A 1 155 ? 20.550  40.232  235.108 1.00 63.66  ? 155 THR A CA  1 
ATOM   1039  C C   . THR A 1 155 ? 19.654  39.404  234.206 1.00 63.46  ? 155 THR A C   1 
ATOM   1040  O O   . THR A 1 155 ? 19.153  38.356  234.629 1.00 58.98  ? 155 THR A O   1 
ATOM   1041  C CB  . THR A 1 155 ? 21.482  39.300  235.835 1.00 65.98  ? 155 THR A CB  1 
ATOM   1042  O OG1 . THR A 1 155 ? 22.463  40.077  236.553 1.00 69.10  ? 155 THR A OG1 1 
ATOM   1043  C CG2 . THR A 1 155 ? 22.128  38.326  234.854 1.00 71.49  ? 155 THR A CG2 1 
ATOM   1044  N N   . PRO A 1 156 ? 19.655  39.737  232.895 1.00 65.14  ? 156 PRO A N   1 
ATOM   1045  C CA  . PRO A 1 156 ? 18.900  39.155  231.774 1.00 66.26  ? 156 PRO A CA  1 
ATOM   1046  C C   . PRO A 1 156 ? 18.987  37.656  231.642 1.00 67.02  ? 156 PRO A C   1 
ATOM   1047  O O   . PRO A 1 156 ? 19.699  36.971  232.398 1.00 70.58  ? 156 PRO A O   1 
ATOM   1048  C CB  . PRO A 1 156 ? 19.543  39.806  230.561 1.00 65.75  ? 156 PRO A CB  1 
ATOM   1049  C CG  . PRO A 1 156 ? 20.971  39.883  230.996 1.00 65.93  ? 156 PRO A CG  1 
ATOM   1050  C CD  . PRO A 1 156 ? 20.796  40.499  232.364 1.00 63.29  ? 156 PRO A CD  1 
ATOM   1051  N N   . VAL A 1 157 ? 18.266  37.148  230.654 1.00 64.00  ? 157 VAL A N   1 
ATOM   1052  C CA  . VAL A 1 157 ? 18.286  35.725  230.433 1.00 65.92  ? 157 VAL A CA  1 
ATOM   1053  C C   . VAL A 1 157 ? 19.667  35.444  229.936 1.00 69.30  ? 157 VAL A C   1 
ATOM   1054  O O   . VAL A 1 157 ? 20.258  36.269  229.223 1.00 72.75  ? 157 VAL A O   1 
ATOM   1055  C CB  . VAL A 1 157 ? 17.358  35.314  229.345 1.00 64.10  ? 157 VAL A CB  1 
ATOM   1056  C CG1 . VAL A 1 157 ? 17.022  33.860  229.492 1.00 63.26  ? 157 VAL A CG1 1 
ATOM   1057  C CG2 . VAL A 1 157 ? 16.150  36.190  229.359 1.00 65.01  ? 157 VAL A CG2 1 
ATOM   1058  N N   . GLU A 1 158 ? 20.187  34.299  230.336 1.00 70.04  ? 158 GLU A N   1 
ATOM   1059  C CA  . GLU A 1 158 ? 21.508  33.885  229.930 1.00 72.49  ? 158 GLU A CA  1 
ATOM   1060  C C   . GLU A 1 158 ? 21.453  32.389  229.962 1.00 70.98  ? 158 GLU A C   1 
ATOM   1061  O O   . GLU A 1 158 ? 20.514  31.835  230.523 1.00 74.55  ? 158 GLU A O   1 
ATOM   1062  C CB  . GLU A 1 158 ? 22.558  34.386  230.933 1.00 78.77  ? 158 GLU A CB  1 
ATOM   1063  C CG  . GLU A 1 158 ? 22.803  35.912  230.900 1.00 88.27  ? 158 GLU A CG  1 
ATOM   1064  C CD  . GLU A 1 158 ? 24.209  36.316  231.349 1.00 92.33  ? 158 GLU A CD  1 
ATOM   1065  O OE1 . GLU A 1 158 ? 24.623  35.884  232.454 1.00 94.35  ? 158 GLU A OE1 1 
ATOM   1066  O OE2 . GLU A 1 158 ? 24.894  37.066  230.599 1.00 94.20  ? 158 GLU A OE2 1 
ATOM   1067  N N   . GLY A 1 159 ? 22.389  31.739  229.281 1.00 67.11  ? 159 GLY A N   1 
ATOM   1068  C CA  . GLY A 1 159 ? 22.450  30.286  229.315 1.00 62.98  ? 159 GLY A CA  1 
ATOM   1069  C C   . GLY A 1 159 ? 22.320  29.470  228.049 1.00 58.15  ? 159 GLY A C   1 
ATOM   1070  O O   . GLY A 1 159 ? 22.315  30.006  226.939 1.00 58.51  ? 159 GLY A O   1 
ATOM   1071  N N   . SER A 1 160 ? 22.279  28.149  228.224 1.00 54.03  ? 160 SER A N   1 
ATOM   1072  C CA  . SER A 1 160 ? 22.121  27.241  227.095 1.00 50.19  ? 160 SER A CA  1 
ATOM   1073  C C   . SER A 1 160 ? 20.805  27.621  226.437 1.00 44.04  ? 160 SER A C   1 
ATOM   1074  O O   . SER A 1 160 ? 19.861  28.052  227.104 1.00 42.09  ? 160 SER A O   1 
ATOM   1075  C CB  . SER A 1 160 ? 22.056  25.770  227.550 1.00 49.90  ? 160 SER A CB  1 
ATOM   1076  O OG  . SER A 1 160 ? 23.308  25.289  228.015 1.00 46.48  ? 160 SER A OG  1 
ATOM   1077  N N   . GLN A 1 161 ? 20.766  27.543  225.123 1.00 37.50  ? 161 GLN A N   1 
ATOM   1078  C CA  . GLN A 1 161 ? 19.552  27.859  224.427 1.00 32.95  ? 161 GLN A CA  1 
ATOM   1079  C C   . GLN A 1 161 ? 19.400  26.770  223.388 1.00 30.82  ? 161 GLN A C   1 
ATOM   1080  O O   . GLN A 1 161 ? 20.345  26.010  223.112 1.00 30.46  ? 161 GLN A O   1 
ATOM   1081  C CB  . GLN A 1 161 ? 19.600  29.282  223.866 1.00 35.88  ? 161 GLN A CB  1 
ATOM   1082  C CG  . GLN A 1 161 ? 20.945  29.678  223.264 1.00 39.67  ? 161 GLN A CG  1 
ATOM   1083  C CD  . GLN A 1 161 ? 21.176  31.192  223.189 1.00 41.77  ? 161 GLN A CD  1 
ATOM   1084  O OE1 . GLN A 1 161 ? 20.729  31.888  222.245 1.00 44.25  ? 161 GLN A OE1 1 
ATOM   1085  N NE2 . GLN A 1 161 ? 21.904  31.703  224.169 1.00 37.98  ? 161 GLN A NE2 1 
ATOM   1086  N N   . TYR A 1 162 ? 18.195  26.641  222.866 1.00 26.35  ? 162 TYR A N   1 
ATOM   1087  C CA  . TYR A 1 162 ? 17.914  25.591  221.917 1.00 29.49  ? 162 TYR A CA  1 
ATOM   1088  C C   . TYR A 1 162 ? 16.657  25.969  221.208 1.00 32.95  ? 162 TYR A C   1 
ATOM   1089  O O   . TYR A 1 162 ? 15.683  26.420  221.833 1.00 32.65  ? 162 TYR A O   1 
ATOM   1090  C CB  . TYR A 1 162 ? 17.685  24.327  222.708 1.00 32.97  ? 162 TYR A CB  1 
ATOM   1091  C CG  . TYR A 1 162 ? 17.211  23.096  221.989 1.00 34.72  ? 162 TYR A CG  1 
ATOM   1092  C CD1 . TYR A 1 162 ? 15.855  22.804  221.877 1.00 34.87  ? 162 TYR A CD1 1 
ATOM   1093  C CD2 . TYR A 1 162 ? 18.114  22.094  221.674 1.00 39.66  ? 162 TYR A CD2 1 
ATOM   1094  C CE1 . TYR A 1 162 ? 15.419  21.520  221.507 1.00 37.10  ? 162 TYR A CE1 1 
ATOM   1095  C CE2 . TYR A 1 162 ? 17.694  20.813  221.299 1.00 40.95  ? 162 TYR A CE2 1 
ATOM   1096  C CZ  . TYR A 1 162 ? 16.351  20.515  221.229 1.00 38.38  ? 162 TYR A CZ  1 
ATOM   1097  O OH  . TYR A 1 162 ? 15.988  19.194  220.982 1.00 34.77  ? 162 TYR A OH  1 
ATOM   1098  N N   . HIS A 1 163 ? 16.686  25.799  219.896 1.00 34.19  ? 163 HIS A N   1 
ATOM   1099  C CA  . HIS A 1 163 ? 15.551  26.142  219.061 1.00 35.71  ? 163 HIS A CA  1 
ATOM   1100  C C   . HIS A 1 163 ? 15.563  25.109  218.022 1.00 29.51  ? 163 HIS A C   1 
ATOM   1101  O O   . HIS A 1 163 ? 16.625  24.795  217.511 1.00 26.67  ? 163 HIS A O   1 
ATOM   1102  C CB  . HIS A 1 163 ? 15.766  27.478  218.369 1.00 41.38  ? 163 HIS A CB  1 
ATOM   1103  C CG  . HIS A 1 163 ? 16.098  28.578  219.307 1.00 54.08  ? 163 HIS A CG  1 
ATOM   1104  N ND1 . HIS A 1 163 ? 15.183  29.078  220.204 1.00 59.54  ? 163 HIS A ND1 1 
ATOM   1105  C CD2 . HIS A 1 163 ? 17.266  29.222  219.555 1.00 60.78  ? 163 HIS A CD2 1 
ATOM   1106  C CE1 . HIS A 1 163 ? 15.772  29.980  220.971 1.00 68.85  ? 163 HIS A CE1 1 
ATOM   1107  N NE2 . HIS A 1 163 ? 17.039  30.087  220.598 1.00 66.14  ? 163 HIS A NE2 1 
ATOM   1108  N N   . VAL A 1 164 ? 14.394  24.596  217.689 1.00 23.93  ? 164 VAL A N   1 
ATOM   1109  C CA  . VAL A 1 164 ? 14.293  23.576  216.677 1.00 21.81  ? 164 VAL A CA  1 
ATOM   1110  C C   . VAL A 1 164 ? 12.893  23.648  216.219 1.00 18.41  ? 164 VAL A C   1 
ATOM   1111  O O   . VAL A 1 164 ? 12.056  24.242  216.895 1.00 19.17  ? 164 VAL A O   1 
ATOM   1112  C CB  . VAL A 1 164 ? 14.403  22.161  217.286 1.00 26.07  ? 164 VAL A CB  1 
ATOM   1113  C CG1 . VAL A 1 164 ? 14.675  21.128  216.209 1.00 27.32  ? 164 VAL A CG1 1 
ATOM   1114  C CG2 . VAL A 1 164 ? 15.469  22.108  218.356 1.00 32.90  ? 164 VAL A CG2 1 
ATOM   1115  N N   . PHE A 1 165 ? 12.635  22.987  215.102 1.00 17.19  ? 165 PHE A N   1 
ATOM   1116  C CA  . PHE A 1 165 ? 11.300  22.879  214.567 1.00 15.38  ? 165 PHE A CA  1 
ATOM   1117  C C   . PHE A 1 165 ? 11.286  22.092  213.284 1.00 13.93  ? 165 PHE A C   1 
ATOM   1118  O O   . PHE A 1 165 ? 12.328  21.829  212.646 1.00 10.00  ? 165 PHE A O   1 
ATOM   1119  C CB  . PHE A 1 165 ? 10.710  24.221  214.273 1.00 18.55  ? 165 PHE A CB  1 
ATOM   1120  C CG  . PHE A 1 165 ? 11.209  24.777  213.033 1.00 27.85  ? 165 PHE A CG  1 
ATOM   1121  C CD1 . PHE A 1 165 ? 12.433  25.417  213.005 1.00 32.37  ? 165 PHE A CD1 1 
ATOM   1122  C CD2 . PHE A 1 165 ? 10.496  24.623  211.861 1.00 33.38  ? 165 PHE A CD2 1 
ATOM   1123  C CE1 . PHE A 1 165 ? 12.950  25.908  211.812 1.00 34.40  ? 165 PHE A CE1 1 
ATOM   1124  C CE2 . PHE A 1 165 ? 11.007  25.108  210.662 1.00 36.36  ? 165 PHE A CE2 1 
ATOM   1125  C CZ  . PHE A 1 165 ? 12.238  25.756  210.639 1.00 31.93  ? 165 PHE A CZ  1 
ATOM   1126  N N   . ALA A 1 166 ? 10.061  21.926  212.815 1.00 14.09  ? 166 ALA A N   1 
ATOM   1127  C CA  . ALA A 1 166 ? 9.813   21.175  211.621 1.00 17.15  ? 166 ALA A CA  1 
ATOM   1128  C C   . ALA A 1 166 ? 8.411   21.370  211.178 1.00 17.30  ? 166 ALA A C   1 
ATOM   1129  O O   . ALA A 1 166 ? 7.553   21.837  211.927 1.00 16.02  ? 166 ALA A O   1 
ATOM   1130  C CB  . ALA A 1 166 ? 9.999   19.749  211.912 1.00 23.20  ? 166 ALA A CB  1 
ATOM   1131  N N   . VAL A 1 167 ? 8.160   20.828  210.004 1.00 21.56  ? 167 VAL A N   1 
ATOM   1132  C CA  . VAL A 1 167 ? 6.863   20.929  209.387 1.00 28.47  ? 167 VAL A CA  1 
ATOM   1133  C C   . VAL A 1 167 ? 6.618   19.637  208.684 1.00 34.19  ? 167 VAL A C   1 
ATOM   1134  O O   . VAL A 1 167 ? 7.431   19.274  207.841 1.00 39.63  ? 167 VAL A O   1 
ATOM   1135  C CB  . VAL A 1 167 ? 6.930   21.929  208.300 1.00 24.08  ? 167 VAL A CB  1 
ATOM   1136  C CG1 . VAL A 1 167 ? 5.559   22.357  207.939 1.00 24.58  ? 167 VAL A CG1 1 
ATOM   1137  C CG2 . VAL A 1 167 ? 7.808   23.077  208.722 1.00 25.33  ? 167 VAL A CG2 1 
ATOM   1138  N N   . GLY A 1 168 ? 5.505   18.962  208.965 1.00 39.15  ? 168 GLY A N   1 
ATOM   1139  C CA  . GLY A 1 168 ? 5.263   17.683  208.297 1.00 44.43  ? 168 GLY A CA  1 
ATOM   1140  C C   . GLY A 1 168 ? 3.860   17.253  207.865 1.00 48.77  ? 168 GLY A C   1 
ATOM   1141  O O   . GLY A 1 168 ? 2.862   17.866  208.284 1.00 50.56  ? 168 GLY A O   1 
ATOM   1142  N N   . GLY A 1 169 ? 3.793   16.202  207.026 1.00 51.93  ? 169 GLY A N   1 
ATOM   1143  C CA  . GLY A 1 169 ? 2.527   15.658  206.514 1.00 53.89  ? 169 GLY A CA  1 
ATOM   1144  C C   . GLY A 1 169 ? 1.933   14.569  207.392 1.00 53.75  ? 169 GLY A C   1 
ATOM   1145  O O   . GLY A 1 169 ? 0.881   13.991  207.118 1.00 49.43  ? 169 GLY A O   1 
ATOM   1146  N N   . GLU A 1 170 ? 2.677   14.297  208.450 1.00 56.30  ? 170 GLU A N   1 
ATOM   1147  C CA  . GLU A 1 170 ? 2.359   13.344  209.484 1.00 59.11  ? 170 GLU A CA  1 
ATOM   1148  C C   . GLU A 1 170 ? 3.038   13.979  210.698 1.00 56.16  ? 170 GLU A C   1 
ATOM   1149  O O   . GLU A 1 170 ? 3.770   14.966  210.566 1.00 55.82  ? 170 GLU A O   1 
ATOM   1150  C CB  . GLU A 1 170 ? 2.945   11.990  209.145 1.00 67.52  ? 170 GLU A CB  1 
ATOM   1151  C CG  . GLU A 1 170 ? 4.202   12.088  208.364 1.00 81.05  ? 170 GLU A CG  1 
ATOM   1152  C CD  . GLU A 1 170 ? 4.657   10.753  207.884 1.00 94.11  ? 170 GLU A CD  1 
ATOM   1153  O OE1 . GLU A 1 170 ? 5.021   9.909   208.726 1.00 101.91 ? 170 GLU A OE1 1 
ATOM   1154  O OE2 . GLU A 1 170 ? 4.639   10.537  206.658 1.00 98.29  ? 170 GLU A OE2 1 
ATOM   1155  N N   . PRO A 1 171 ? 2.758   13.482  211.901 1.00 54.46  ? 171 PRO A N   1 
ATOM   1156  C CA  . PRO A 1 171 ? 3.400   14.101  213.062 1.00 54.82  ? 171 PRO A CA  1 
ATOM   1157  C C   . PRO A 1 171 ? 4.870   13.801  213.088 1.00 53.88  ? 171 PRO A C   1 
ATOM   1158  O O   . PRO A 1 171 ? 5.331   12.845  212.464 1.00 48.69  ? 171 PRO A O   1 
ATOM   1159  C CB  . PRO A 1 171 ? 2.696   13.447  214.221 1.00 55.20  ? 171 PRO A CB  1 
ATOM   1160  C CG  . PRO A 1 171 ? 2.526   12.061  213.692 1.00 60.08  ? 171 PRO A CG  1 
ATOM   1161  C CD  . PRO A 1 171 ? 2.045   12.258  212.281 1.00 54.77  ? 171 PRO A CD  1 
ATOM   1162  N N   . LEU A 1 172 ? 5.580   14.582  213.883 1.00 56.16  ? 172 LEU A N   1 
ATOM   1163  C CA  . LEU A 1 172 ? 7.016   14.447  213.996 1.00 59.61  ? 172 LEU A CA  1 
ATOM   1164  C C   . LEU A 1 172 ? 7.474   13.127  214.593 1.00 61.10  ? 172 LEU A C   1 
ATOM   1165  O O   . LEU A 1 172 ? 7.120   12.808  215.727 1.00 62.78  ? 172 LEU A O   1 
ATOM   1166  C CB  . LEU A 1 172 ? 7.550   15.596  214.847 1.00 63.59  ? 172 LEU A CB  1 
ATOM   1167  C CG  . LEU A 1 172 ? 9.063   15.780  215.056 1.00 67.31  ? 172 LEU A CG  1 
ATOM   1168  C CD1 . LEU A 1 172 ? 9.451   15.536  216.503 1.00 69.69  ? 172 LEU A CD1 1 
ATOM   1169  C CD2 . LEU A 1 172 ? 9.880   14.897  214.099 1.00 73.98  ? 172 LEU A CD2 1 
ATOM   1170  N N   . ASP A 1 173 ? 8.295   12.380  213.861 1.00 63.29  ? 173 ASP A N   1 
ATOM   1171  C CA  . ASP A 1 173 ? 8.812   11.115  214.389 1.00 65.37  ? 173 ASP A CA  1 
ATOM   1172  C C   . ASP A 1 173 ? 10.007  11.437  215.247 1.00 61.84  ? 173 ASP A C   1 
ATOM   1173  O O   . ASP A 1 173 ? 10.936  12.141  214.810 1.00 63.08  ? 173 ASP A O   1 
ATOM   1174  C CB  . ASP A 1 173 ? 9.294   10.189  213.276 1.00 75.95  ? 173 ASP A CB  1 
ATOM   1175  C CG  . ASP A 1 173 ? 8.167   9.623   212.451 1.00 83.09  ? 173 ASP A CG  1 
ATOM   1176  O OD1 . ASP A 1 173 ? 7.619   10.349  211.582 1.00 87.53  ? 173 ASP A OD1 1 
ATOM   1177  O OD2 . ASP A 1 173 ? 7.823   8.438   212.677 1.00 88.60  ? 173 ASP A OD2 1 
ATOM   1178  N N   . LEU A 1 174 ? 10.016  10.924  216.461 1.00 54.98  ? 174 LEU A N   1 
ATOM   1179  C CA  . LEU A 1 174 ? 11.156  11.210  217.293 1.00 51.42  ? 174 LEU A CA  1 
ATOM   1180  C C   . LEU A 1 174 ? 11.765  9.991   217.963 1.00 50.71  ? 174 LEU A C   1 
ATOM   1181  O O   . LEU A 1 174 ? 11.289  8.861   217.783 1.00 49.39  ? 174 LEU A O   1 
ATOM   1182  C CB  . LEU A 1 174 ? 10.845  12.344  218.255 1.00 47.22  ? 174 LEU A CB  1 
ATOM   1183  C CG  . LEU A 1 174 ? 9.541   12.200  218.986 1.00 46.83  ? 174 LEU A CG  1 
ATOM   1184  C CD1 . LEU A 1 174 ? 9.827   11.322  220.157 1.00 51.63  ? 174 LEU A CD1 1 
ATOM   1185  C CD2 . LEU A 1 174 ? 9.057   13.538  219.451 1.00 46.15  ? 174 LEU A CD2 1 
ATOM   1186  N N   . GLN A 1 175 ? 12.857  10.225  218.683 1.00 48.73  ? 175 GLN A N   1 
ATOM   1187  C CA  . GLN A 1 175 ? 13.593  9.177   219.348 1.00 44.60  ? 175 GLN A CA  1 
ATOM   1188  C C   . GLN A 1 175 ? 14.251  9.795   220.503 1.00 43.88  ? 175 GLN A C   1 
ATOM   1189  O O   . GLN A 1 175 ? 15.049  10.706  220.352 1.00 42.01  ? 175 GLN A O   1 
ATOM   1190  C CB  . GLN A 1 175 ? 14.710  8.664   218.489 1.00 41.73  ? 175 GLN A CB  1 
ATOM   1191  C CG  . GLN A 1 175 ? 15.072  7.320   218.898 1.00 44.69  ? 175 GLN A CG  1 
ATOM   1192  C CD  . GLN A 1 175 ? 16.493  7.195   219.201 1.00 47.50  ? 175 GLN A CD  1 
ATOM   1193  O OE1 . GLN A 1 175 ? 17.311  6.865   218.320 1.00 47.46  ? 175 GLN A OE1 1 
ATOM   1194  N NE2 . GLN A 1 175 ? 16.827  7.400   220.469 1.00 49.58  ? 175 GLN A NE2 1 
ATOM   1195  N N   . GLY A 1 176 ? 13.942  9.313   221.683 1.00 46.25  ? 176 GLY A N   1 
ATOM   1196  C CA  . GLY A 1 176 ? 14.522  9.914   222.863 1.00 45.11  ? 176 GLY A CA  1 
ATOM   1197  C C   . GLY A 1 176 ? 15.818  9.281   223.295 1.00 42.59  ? 176 GLY A C   1 
ATOM   1198  O O   . GLY A 1 176 ? 16.131  8.135   222.920 1.00 37.12  ? 176 GLY A O   1 
ATOM   1199  N N   . LEU A 1 177 ? 16.599  10.100  224.017 1.00 43.32  ? 177 LEU A N   1 
ATOM   1200  C CA  . LEU A 1 177 ? 17.901  9.768   224.671 1.00 48.37  ? 177 LEU A CA  1 
ATOM   1201  C C   . LEU A 1 177 ? 18.041  10.750  225.746 1.00 52.27  ? 177 LEU A C   1 
ATOM   1202  O O   . LEU A 1 177 ? 17.851  11.926  225.509 1.00 55.82  ? 177 LEU A O   1 
ATOM   1203  C CB  . LEU A 1 177 ? 19.176  10.018  223.849 1.00 49.20  ? 177 LEU A CB  1 
ATOM   1204  C CG  . LEU A 1 177 ? 18.905  8.974   222.757 1.00 43.62  ? 177 LEU A CG  1 
ATOM   1205  C CD1 . LEU A 1 177 ? 19.919  9.143   221.545 1.00 44.60  ? 177 LEU A CD1 1 
ATOM   1206  C CD2 . LEU A 1 177 ? 18.763  7.460   223.323 1.00 59.97  ? 177 LEU A CD2 1 
ATOM   1207  N N   . VAL A 1 178 ? 18.571  10.270  226.854 1.00 54.24  ? 178 VAL A N   1 
ATOM   1208  C CA  . VAL A 1 178 ? 18.689  11.117  228.000 1.00 62.08  ? 178 VAL A CA  1 
ATOM   1209  C C   . VAL A 1 178 ? 20.094  11.138  228.598 1.00 67.29  ? 178 VAL A C   1 
ATOM   1210  O O   . VAL A 1 178 ? 20.974  10.370  228.201 1.00 69.80  ? 178 VAL A O   1 
ATOM   1211  C CB  . VAL A 1 178 ? 17.745  10.617  229.028 1.00 63.62  ? 178 VAL A CB  1 
ATOM   1212  C CG1 . VAL A 1 178 ? 18.173  9.226   229.446 1.00 65.95  ? 178 VAL A CG1 1 
ATOM   1213  C CG2 . VAL A 1 178 ? 17.692  11.557  230.211 1.00 68.92  ? 178 VAL A CG2 1 
ATOM   1214  N N   . THR A 1 179 ? 20.288  12.078  229.529 1.00 72.44  ? 179 THR A N   1 
ATOM   1215  C CA  . THR A 1 179 ? 21.510  12.247  230.285 1.00 78.49  ? 179 THR A CA  1 
ATOM   1216  C C   . THR A 1 179 ? 21.529  11.041  231.226 1.00 84.20  ? 179 THR A C   1 
ATOM   1217  O O   . THR A 1 179 ? 22.207  10.062  230.959 1.00 88.64  ? 179 THR A O   1 
ATOM   1218  C CB  . THR A 1 179 ? 21.447  13.537  231.145 1.00 79.64  ? 179 THR A CB  1 
ATOM   1219  O OG1 . THR A 1 179 ? 20.261  14.277  230.821 1.00 78.76  ? 179 THR A OG1 1 
ATOM   1220  C CG2 . THR A 1 179 ? 22.656  14.415  230.901 1.00 83.96  ? 179 THR A CG2 1 
ATOM   1221  N N   . ASP A 1 180 ? 20.708  11.057  232.272 1.00 87.09  ? 180 ASP A N   1 
ATOM   1222  C CA  . ASP A 1 180 ? 20.693  9.943   233.214 1.00 86.98  ? 180 ASP A CA  1 
ATOM   1223  C C   . ASP A 1 180 ? 19.554  8.985   233.063 1.00 83.97  ? 180 ASP A C   1 
ATOM   1224  O O   . ASP A 1 180 ? 18.421  9.312   233.369 1.00 82.82  ? 180 ASP A O   1 
ATOM   1225  C CB  . ASP A 1 180 ? 20.697  10.442  234.634 1.00 91.67  ? 180 ASP A CB  1 
ATOM   1226  C CG  . ASP A 1 180 ? 21.750  9.791   235.442 1.00 101.43 ? 180 ASP A CG  1 
ATOM   1227  O OD1 . ASP A 1 180 ? 22.372  8.814   234.947 1.00 103.15 ? 180 ASP A OD1 1 
ATOM   1228  O OD2 . ASP A 1 180 ? 21.962  10.275  236.569 1.00 108.48 ? 180 ASP A OD2 1 
ATOM   1229  N N   . ALA A 1 181 ? 19.877  7.743   232.755 1.00 83.54  ? 181 ALA A N   1 
ATOM   1230  C CA  . ALA A 1 181 ? 18.844  6.732   232.561 1.00 86.15  ? 181 ALA A CA  1 
ATOM   1231  C C   . ALA A 1 181 ? 18.067  6.491   233.847 1.00 86.07  ? 181 ALA A C   1 
ATOM   1232  O O   . ALA A 1 181 ? 17.140  5.687   233.901 1.00 87.35  ? 181 ALA A O   1 
ATOM   1233  C CB  . ALA A 1 181 ? 19.474  5.439   232.081 1.00 87.99  ? 181 ALA A CB  1 
ATOM   1234  N N   . ARG A 1 182 ? 18.434  7.232   234.872 1.00 85.65  ? 182 ARG A N   1 
ATOM   1235  C CA  . ARG A 1 182 ? 17.824  7.078   236.149 1.00 88.28  ? 182 ARG A CA  1 
ATOM   1236  C C   . ARG A 1 182 ? 16.618  7.935   236.391 1.00 89.64  ? 182 ARG A C   1 
ATOM   1237  O O   . ARG A 1 182 ? 15.566  7.453   236.792 1.00 89.94  ? 182 ARG A O   1 
ATOM   1238  C CB  . ARG A 1 182 ? 18.855  7.418   237.194 1.00 91.18  ? 182 ARG A CB  1 
ATOM   1239  C CG  . ARG A 1 182 ? 20.209  6.861   236.881 1.00 93.97  ? 182 ARG A CG  1 
ATOM   1240  C CD  . ARG A 1 182 ? 21.126  7.496   237.842 1.00 100.80 ? 182 ARG A CD  1 
ATOM   1241  N NE  . ARG A 1 182 ? 22.397  6.813   237.989 1.00 108.65 ? 182 ARG A NE  1 
ATOM   1242  C CZ  . ARG A 1 182 ? 23.427  7.339   238.648 1.00 115.28 ? 182 ARG A CZ  1 
ATOM   1243  N NH1 . ARG A 1 182 ? 23.318  8.543   239.195 1.00 118.02 ? 182 ARG A NH1 1 
ATOM   1244  N NH2 . ARG A 1 182 ? 24.565  6.661   238.783 1.00 121.52 ? 182 ARG A NH2 1 
ATOM   1245  N N   . THR A 1 183 ? 16.786  9.219   236.161 1.00 90.57  ? 183 THR A N   1 
ATOM   1246  C CA  . THR A 1 183 ? 15.760  10.194  236.440 1.00 90.81  ? 183 THR A CA  1 
ATOM   1247  C C   . THR A 1 183 ? 14.349  9.781   236.772 1.00 89.79  ? 183 THR A C   1 
ATOM   1248  O O   . THR A 1 183 ? 13.669  8.997   236.094 1.00 85.50  ? 183 THR A O   1 
ATOM   1249  C CB  . THR A 1 183 ? 15.757  11.278  235.387 1.00 93.28  ? 183 THR A CB  1 
ATOM   1250  O OG1 . THR A 1 183 ? 17.117  11.567  235.035 1.00 96.01  ? 183 THR A OG1 1 
ATOM   1251  C CG2 . THR A 1 183 ? 15.120  12.565  235.957 1.00 94.59  ? 183 THR A CG2 1 
ATOM   1252  N N   . LYS A 1 184 ? 13.934  10.378  237.862 1.00 92.63  ? 184 LYS A N   1 
ATOM   1253  C CA  . LYS A 1 184 ? 12.655  10.155  238.446 1.00 99.82  ? 184 LYS A CA  1 
ATOM   1254  C C   . LYS A 1 184 ? 11.547  10.824  237.674 1.00 96.95  ? 184 LYS A C   1 
ATOM   1255  O O   . LYS A 1 184 ? 10.676  11.434  238.273 1.00 99.22  ? 184 LYS A O   1 
ATOM   1256  C CB  . LYS A 1 184 ? 12.696  10.731  239.860 1.00 113.41 ? 184 LYS A CB  1 
ATOM   1257  C CG  . LYS A 1 184 ? 13.494  9.894   240.859 1.00 130.33 ? 184 LYS A CG  1 
ATOM   1258  C CD  . LYS A 1 184 ? 15.013  9.824   240.570 1.00 141.04 ? 184 LYS A CD  1 
ATOM   1259  C CE  . LYS A 1 184 ? 15.760  8.768   241.458 1.00 146.78 ? 184 LYS A CE  1 
ATOM   1260  N NZ  . LYS A 1 184 ? 15.766  8.953   242.974 1.00 148.83 ? 184 LYS A NZ  1 
ATOM   1261  N N   . TYR A 1 185 ? 11.581  10.771  236.354 1.00 94.27  ? 185 TYR A N   1 
ATOM   1262  C CA  . TYR A 1 185 ? 10.543  11.432  235.569 1.00 92.23  ? 185 TYR A CA  1 
ATOM   1263  C C   . TYR A 1 185 ? 9.212   10.988  236.088 1.00 92.65  ? 185 TYR A C   1 
ATOM   1264  O O   . TYR A 1 185 ? 9.011   9.794   236.238 1.00 91.94  ? 185 TYR A O   1 
ATOM   1265  C CB  . TYR A 1 185 ? 10.690  11.062  234.101 1.00 92.30  ? 185 TYR A CB  1 
ATOM   1266  C CG  . TYR A 1 185 ? 11.849  11.770  233.464 1.00 93.70  ? 185 TYR A CG  1 
ATOM   1267  C CD1 . TYR A 1 185 ? 11.901  13.152  233.487 1.00 94.00  ? 185 TYR A CD1 1 
ATOM   1268  C CD2 . TYR A 1 185 ? 12.917  11.075  232.888 1.00 92.40  ? 185 TYR A CD2 1 
ATOM   1269  C CE1 . TYR A 1 185 ? 12.979  13.856  232.965 1.00 93.52  ? 185 TYR A CE1 1 
ATOM   1270  C CE2 . TYR A 1 185 ? 14.017  11.777  232.354 1.00 91.73  ? 185 TYR A CE2 1 
ATOM   1271  C CZ  . TYR A 1 185 ? 14.035  13.183  232.401 1.00 91.88  ? 185 TYR A CZ  1 
ATOM   1272  O OH  . TYR A 1 185 ? 15.079  13.942  231.899 1.00 87.39  ? 185 TYR A OH  1 
ATOM   1273  N N   . LYS A 1 186 ? 8.335   11.912  236.461 1.00 96.77  ? 186 LYS A N   1 
ATOM   1274  C CA  . LYS A 1 186 ? 7.039   11.476  236.973 1.00 105.81 ? 186 LYS A CA  1 
ATOM   1275  C C   . LYS A 1 186 ? 6.396   10.844  235.791 1.00 109.03 ? 186 LYS A C   1 
ATOM   1276  O O   . LYS A 1 186 ? 6.465   11.381  234.702 1.00 107.81 ? 186 LYS A O   1 
ATOM   1277  C CB  . LYS A 1 186 ? 6.176   12.624  237.464 1.00 110.04 ? 186 LYS A CB  1 
ATOM   1278  C CG  . LYS A 1 186 ? 6.736   13.325  238.673 1.00 118.99 ? 186 LYS A CG  1 
ATOM   1279  C CD  . LYS A 1 186 ? 7.933   14.187  238.286 1.00 129.19 ? 186 LYS A CD  1 
ATOM   1280  C CE  . LYS A 1 186 ? 9.148   13.882  239.144 1.00 135.75 ? 186 LYS A CE  1 
ATOM   1281  N NZ  . LYS A 1 186 ? 8.940   14.139  240.598 1.00 141.93 ? 186 LYS A NZ  1 
ATOM   1282  N N   . GLU A 1 187 ? 5.866   9.649   235.963 1.00 116.74 ? 187 GLU A N   1 
ATOM   1283  C CA  . GLU A 1 187 ? 5.255   9.003   234.827 1.00 125.09 ? 187 GLU A CA  1 
ATOM   1284  C C   . GLU A 1 187 ? 3.918   9.609   234.631 1.00 121.99 ? 187 GLU A C   1 
ATOM   1285  O O   . GLU A 1 187 ? 3.213   9.282   233.678 1.00 121.00 ? 187 GLU A O   1 
ATOM   1286  C CB  . GLU A 1 187 ? 5.151   7.498   235.005 1.00 139.56 ? 187 GLU A CB  1 
ATOM   1287  C CG  . GLU A 1 187 ? 4.691   7.023   236.377 1.00 159.96 ? 187 GLU A CG  1 
ATOM   1288  C CD  . GLU A 1 187 ? 4.937   5.520   236.562 1.00 171.14 ? 187 GLU A CD  1 
ATOM   1289  O OE1 . GLU A 1 187 ? 4.179   4.713   235.965 1.00 178.65 ? 187 GLU A OE1 1 
ATOM   1290  O OE2 . GLU A 1 187 ? 5.908   5.150   237.276 1.00 177.79 ? 187 GLU A OE2 1 
ATOM   1291  N N   . GLU A 1 188 ? 3.565   10.505  235.537 1.00 119.91 ? 188 GLU A N   1 
ATOM   1292  C CA  . GLU A 1 188 ? 2.299   11.148  235.379 1.00 121.58 ? 188 GLU A CA  1 
ATOM   1293  C C   . GLU A 1 188 ? 2.376   12.612  234.952 1.00 115.15 ? 188 GLU A C   1 
ATOM   1294  O O   . GLU A 1 188 ? 2.918   13.455  235.681 1.00 114.40 ? 188 GLU A O   1 
ATOM   1295  C CB  . GLU A 1 188 ? 1.413   10.956  236.605 1.00 132.68 ? 188 GLU A CB  1 
ATOM   1296  C CG  . GLU A 1 188 ? -0.058  10.963  236.195 1.00 152.17 ? 188 GLU A CG  1 
ATOM   1297  C CD  . GLU A 1 188 ? -0.266  10.346  234.791 1.00 164.76 ? 188 GLU A CD  1 
ATOM   1298  O OE1 . GLU A 1 188 ? -0.382  9.103   234.696 1.00 173.41 ? 188 GLU A OE1 1 
ATOM   1299  O OE2 . GLU A 1 188 ? -0.278  11.098  233.779 1.00 171.36 ? 188 GLU A OE2 1 
ATOM   1300  N N   . GLY A 1 189 ? 1.849   12.885  233.749 1.00 106.99 ? 189 GLY A N   1 
ATOM   1301  C CA  . GLY A 1 189 ? 1.824   14.233  233.186 1.00 96.87  ? 189 GLY A CA  1 
ATOM   1302  C C   . GLY A 1 189 ? 2.981   14.593  232.266 1.00 89.05  ? 189 GLY A C   1 
ATOM   1303  O O   . GLY A 1 189 ? 3.449   15.736  232.253 1.00 88.93  ? 189 GLY A O   1 
ATOM   1304  N N   . VAL A 1 190 ? 3.429   13.620  231.480 1.00 80.88  ? 190 VAL A N   1 
ATOM   1305  C CA  . VAL A 1 190 ? 4.543   13.809  230.560 1.00 71.14  ? 190 VAL A CA  1 
ATOM   1306  C C   . VAL A 1 190 ? 4.800   12.507  229.810 1.00 65.69  ? 190 VAL A C   1 
ATOM   1307  O O   . VAL A 1 190 ? 4.517   11.433  230.313 1.00 66.38  ? 190 VAL A O   1 
ATOM   1308  C CB  . VAL A 1 190 ? 5.834   14.205  231.313 1.00 67.79  ? 190 VAL A CB  1 
ATOM   1309  C CG1 . VAL A 1 190 ? 6.368   13.052  232.127 1.00 66.42  ? 190 VAL A CG1 1 
ATOM   1310  C CG2 . VAL A 1 190 ? 6.863   14.619  230.336 1.00 72.03  ? 190 VAL A CG2 1 
ATOM   1311  N N   . VAL A 1 191 ? 5.277   12.581  228.584 1.00 60.65  ? 191 VAL A N   1 
ATOM   1312  C CA  . VAL A 1 191 ? 5.545   11.343  227.900 1.00 57.25  ? 191 VAL A CA  1 
ATOM   1313  C C   . VAL A 1 191 ? 6.987   11.145  228.174 1.00 55.32  ? 191 VAL A C   1 
ATOM   1314  O O   . VAL A 1 191 ? 7.788   12.046  227.947 1.00 58.25  ? 191 VAL A O   1 
ATOM   1315  C CB  . VAL A 1 191 ? 5.388   11.435  226.432 1.00 58.51  ? 191 VAL A CB  1 
ATOM   1316  C CG1 . VAL A 1 191 ? 4.980   10.085  225.926 1.00 61.79  ? 191 VAL A CG1 1 
ATOM   1317  C CG2 . VAL A 1 191 ? 4.400   12.509  226.069 1.00 58.56  ? 191 VAL A CG2 1 
ATOM   1318  N N   . THR A 1 192 ? 7.332   9.969   228.653 1.00 51.54  ? 192 THR A N   1 
ATOM   1319  C CA  . THR A 1 192 ? 8.710   9.704   228.981 1.00 48.28  ? 192 THR A CA  1 
ATOM   1320  C C   . THR A 1 192 ? 8.996   8.334   228.454 1.00 46.04  ? 192 THR A C   1 
ATOM   1321  O O   . THR A 1 192 ? 8.076   7.552   228.230 1.00 42.52  ? 192 THR A O   1 
ATOM   1322  C CB  . THR A 1 192 ? 8.925   9.708   230.486 1.00 49.88  ? 192 THR A CB  1 
ATOM   1323  O OG1 . THR A 1 192 ? 8.102   10.711  231.106 1.00 49.69  ? 192 THR A OG1 1 
ATOM   1324  C CG2 . THR A 1 192 ? 10.356  9.987   230.787 1.00 46.36  ? 192 THR A CG2 1 
ATOM   1325  N N   . ILE A 1 193 ? 10.276  8.059   228.266 1.00 48.69  ? 193 ILE A N   1 
ATOM   1326  C CA  . ILE A 1 193 ? 10.749  6.782   227.730 1.00 54.02  ? 193 ILE A CA  1 
ATOM   1327  C C   . ILE A 1 193 ? 9.945   5.582   228.191 1.00 58.37  ? 193 ILE A C   1 
ATOM   1328  O O   . ILE A 1 193 ? 9.602   4.705   227.401 1.00 54.95  ? 193 ILE A O   1 
ATOM   1329  C CB  . ILE A 1 193 ? 12.250  6.536   228.054 1.00 52.77  ? 193 ILE A CB  1 
ATOM   1330  C CG1 . ILE A 1 193 ? 12.827  7.675   228.917 1.00 54.09  ? 193 ILE A CG1 1 
ATOM   1331  C CG2 . ILE A 1 193 ? 13.037  6.437   226.767 1.00 48.07  ? 193 ILE A CG2 1 
ATOM   1332  C CD1 . ILE A 1 193 ? 12.302  7.767   230.344 1.00 50.13  ? 193 ILE A CD1 1 
ATOM   1333  N N   . LYS A 1 194 ? 9.634   5.571   229.478 1.00 68.93  ? 194 LYS A N   1 
ATOM   1334  C CA  . LYS A 1 194 ? 8.879   4.467   230.061 1.00 79.87  ? 194 LYS A CA  1 
ATOM   1335  C C   . LYS A 1 194 ? 7.401   4.625   229.801 1.00 78.52  ? 194 LYS A C   1 
ATOM   1336  O O   . LYS A 1 194 ? 6.708   3.679   229.484 1.00 77.45  ? 194 LYS A O   1 
ATOM   1337  C CB  . LYS A 1 194 ? 9.124   4.336   231.564 1.00 92.69  ? 194 LYS A CB  1 
ATOM   1338  C CG  . LYS A 1 194 ? 8.710   5.560   232.424 1.00 112.37 ? 194 LYS A CG  1 
ATOM   1339  C CD  . LYS A 1 194 ? 9.562   6.846   232.190 1.00 126.42 ? 194 LYS A CD  1 
ATOM   1340  C CE  . LYS A 1 194 ? 9.113   8.034   233.066 1.00 133.04 ? 194 LYS A CE  1 
ATOM   1341  N NZ  . LYS A 1 194 ? 9.443   7.902   234.512 1.00 140.39 ? 194 LYS A NZ  1 
ATOM   1342  N N   . THR A 1 195 ? 6.928   5.853   229.899 1.00 79.35  ? 195 THR A N   1 
ATOM   1343  C CA  . THR A 1 195 ? 5.541   6.155   229.664 1.00 82.07  ? 195 THR A CA  1 
ATOM   1344  C C   . THR A 1 195 ? 5.233   5.516   228.319 1.00 80.57  ? 195 THR A C   1 
ATOM   1345  O O   . THR A 1 195 ? 4.154   5.012   228.105 1.00 81.40  ? 195 THR A O   1 
ATOM   1346  C CB  . THR A 1 195 ? 5.309   7.701   229.704 1.00 84.22  ? 195 THR A CB  1 
ATOM   1347  O OG1 . THR A 1 195 ? 6.426   8.349   230.345 1.00 86.52  ? 195 THR A OG1 1 
ATOM   1348  C CG2 . THR A 1 195 ? 4.064   8.020   230.546 1.00 89.02  ? 195 THR A CG2 1 
ATOM   1349  N N   . ILE A 1 196 ? 6.251   5.391   227.485 1.00 80.75  ? 196 ILE A N   1 
ATOM   1350  C CA  . ILE A 1 196 ? 6.080   4.765   226.189 1.00 84.60  ? 196 ILE A CA  1 
ATOM   1351  C C   . ILE A 1 196 ? 6.446   3.290   226.181 1.00 84.16  ? 196 ILE A C   1 
ATOM   1352  O O   . ILE A 1 196 ? 5.704   2.458   225.679 1.00 83.11  ? 196 ILE A O   1 
ATOM   1353  C CB  . ILE A 1 196 ? 6.828   5.532   225.098 1.00 88.95  ? 196 ILE A CB  1 
ATOM   1354  C CG1 . ILE A 1 196 ? 7.473   4.579   224.087 1.00 96.46  ? 196 ILE A CG1 1 
ATOM   1355  C CG2 . ILE A 1 196 ? 7.861   6.435   225.722 1.00 90.17  ? 196 ILE A CG2 1 
ATOM   1356  C CD1 . ILE A 1 196 ? 6.483   3.889   223.134 1.00 104.97 ? 196 ILE A CD1 1 
ATOM   1357  N N   . THR A 1 197 ? 7.627   2.970   226.662 1.00 85.96  ? 197 THR A N   1 
ATOM   1358  C CA  . THR A 1 197 ? 8.021   1.583   226.715 1.00 92.35  ? 197 THR A CA  1 
ATOM   1359  C C   . THR A 1 197 ? 7.873   1.392   228.171 1.00 97.33  ? 197 THR A C   1 
ATOM   1360  O O   . THR A 1 197 ? 8.467   2.096   228.954 1.00 98.61  ? 197 THR A O   1 
ATOM   1361  C CB  . THR A 1 197 ? 9.422   1.322   226.207 1.00 94.87  ? 197 THR A CB  1 
ATOM   1362  O OG1 . THR A 1 197 ? 9.370   0.082   225.501 1.00 98.18  ? 197 THR A OG1 1 
ATOM   1363  C CG2 . THR A 1 197 ? 10.503  1.197   227.358 1.00 91.85  ? 197 THR A CG2 1 
ATOM   1364  N N   . LYS A 1 198 ? 6.959   0.544   228.552 1.00 104.53 ? 198 LYS A N   1 
ATOM   1365  C CA  . LYS A 1 198 ? 6.700   0.356   229.967 1.00 113.24 ? 198 LYS A CA  1 
ATOM   1366  C C   . LYS A 1 198 ? 7.983   0.280   230.783 1.00 114.67 ? 198 LYS A C   1 
ATOM   1367  O O   . LYS A 1 198 ? 8.262   1.105   231.668 1.00 117.45 ? 198 LYS A O   1 
ATOM   1368  C CB  . LYS A 1 198 ? 5.894   -0.908  230.088 1.00 123.08 ? 198 LYS A CB  1 
ATOM   1369  C CG  . LYS A 1 198 ? 5.310   -1.300  228.723 1.00 136.27 ? 198 LYS A CG  1 
ATOM   1370  C CD  . LYS A 1 198 ? 3.955   -0.599  228.440 1.00 145.49 ? 198 LYS A CD  1 
ATOM   1371  C CE  . LYS A 1 198 ? 4.004   0.949   228.384 1.00 150.01 ? 198 LYS A CE  1 
ATOM   1372  N NZ  . LYS A 1 198 ? 2.650   1.554   228.194 1.00 149.33 ? 198 LYS A NZ  1 
ATOM   1373  N N   . LYS A 1 199 ? 8.741   -0.753  230.478 1.00 114.70 ? 199 LYS A N   1 
ATOM   1374  C CA  . LYS A 1 199 ? 10.001  -1.015  231.128 1.00 114.28 ? 199 LYS A CA  1 
ATOM   1375  C C   . LYS A 1 199 ? 10.779  0.258   231.350 1.00 109.35 ? 199 LYS A C   1 
ATOM   1376  O O   . LYS A 1 199 ? 10.895  1.072   230.444 1.00 105.37 ? 199 LYS A O   1 
ATOM   1377  C CB  . LYS A 1 199 ? 10.806  -1.942  230.241 1.00 123.30 ? 199 LYS A CB  1 
ATOM   1378  C CG  . LYS A 1 199 ? 10.030  -3.196  229.871 1.00 132.60 ? 199 LYS A CG  1 
ATOM   1379  C CD  . LYS A 1 199 ? 10.370  -3.721  228.474 1.00 141.59 ? 199 LYS A CD  1 
ATOM   1380  C CE  . LYS A 1 199 ? 9.554   -3.028  227.382 1.00 147.40 ? 199 LYS A CE  1 
ATOM   1381  N NZ  . LYS A 1 199 ? 9.892   -3.594  226.036 1.00 151.20 ? 199 LYS A NZ  1 
ATOM   1382  N N   . ASP A 1 200 ? 11.327  0.408   232.547 1.00 108.57 ? 200 ASP A N   1 
ATOM   1383  C CA  . ASP A 1 200 ? 12.118  1.578   232.876 1.00 110.57 ? 200 ASP A CA  1 
ATOM   1384  C C   . ASP A 1 200 ? 13.218  1.845   231.867 1.00 106.90 ? 200 ASP A C   1 
ATOM   1385  O O   . ASP A 1 200 ? 13.438  1.061   230.939 1.00 106.17 ? 200 ASP A O   1 
ATOM   1386  C CB  . ASP A 1 200 ? 12.751  1.448   234.257 1.00 121.56 ? 200 ASP A CB  1 
ATOM   1387  C CG  . ASP A 1 200 ? 11.805  1.828   235.370 1.00 131.12 ? 200 ASP A CG  1 
ATOM   1388  O OD1 . ASP A 1 200 ? 11.037  2.811   235.204 1.00 138.00 ? 200 ASP A OD1 1 
ATOM   1389  O OD2 . ASP A 1 200 ? 11.843  1.142   236.418 1.00 137.50 ? 200 ASP A OD2 1 
ATOM   1390  N N   . MET A 1 201 ? 13.945  2.935   232.094 1.00 102.91 ? 201 MET A N   1 
ATOM   1391  C CA  . MET A 1 201 ? 15.023  3.345   231.204 1.00 99.30  ? 201 MET A CA  1 
ATOM   1392  C C   . MET A 1 201 ? 16.183  2.400   231.345 1.00 97.57  ? 201 MET A C   1 
ATOM   1393  O O   . MET A 1 201 ? 16.411  1.863   232.424 1.00 98.03  ? 201 MET A O   1 
ATOM   1394  C CB  . MET A 1 201 ? 15.536  4.723   231.581 1.00 99.04  ? 201 MET A CB  1 
ATOM   1395  C CG  . MET A 1 201 ? 14.490  5.719   231.985 1.00 101.56 ? 201 MET A CG  1 
ATOM   1396  S SD  . MET A 1 201 ? 15.133  7.353   231.673 1.00 101.02 ? 201 MET A SD  1 
ATOM   1397  C CE  . MET A 1 201 ? 15.828  7.052   230.049 1.00 95.84  ? 201 MET A CE  1 
ATOM   1398  N N   . VAL A 1 202 ? 16.942  2.231   230.271 1.00 94.65  ? 202 VAL A N   1 
ATOM   1399  C CA  . VAL A 1 202 ? 18.115  1.371   230.301 1.00 92.76  ? 202 VAL A CA  1 
ATOM   1400  C C   . VAL A 1 202 ? 19.308  2.262   230.007 1.00 89.91  ? 202 VAL A C   1 
ATOM   1401  O O   . VAL A 1 202 ? 19.148  3.332   229.424 1.00 93.34  ? 202 VAL A O   1 
ATOM   1402  C CB  . VAL A 1 202 ? 18.057  0.299   229.218 1.00 93.62  ? 202 VAL A CB  1 
ATOM   1403  C CG1 . VAL A 1 202 ? 18.839  -0.917  229.677 1.00 97.46  ? 202 VAL A CG1 1 
ATOM   1404  C CG2 . VAL A 1 202 ? 16.606  -0.044  228.852 1.00 96.30  ? 202 VAL A CG2 1 
ATOM   1405  N N   . ASN A 1 203 ? 20.510  1.835   230.368 1.00 85.09  ? 203 ASN A N   1 
ATOM   1406  C CA  . ASN A 1 203 ? 21.675  2.667   230.086 1.00 81.66  ? 203 ASN A CA  1 
ATOM   1407  C C   . ASN A 1 203 ? 21.756  3.027   228.597 1.00 80.39  ? 203 ASN A C   1 
ATOM   1408  O O   . ASN A 1 203 ? 22.437  3.963   228.219 1.00 81.09  ? 203 ASN A O   1 
ATOM   1409  C CB  . ASN A 1 203 ? 22.949  1.952   230.486 1.00 77.64  ? 203 ASN A CB  1 
ATOM   1410  C CG  . ASN A 1 203 ? 23.140  0.677   229.734 1.00 78.43  ? 203 ASN A CG  1 
ATOM   1411  O OD1 . ASN A 1 203 ? 22.257  0.266   228.992 1.00 81.52  ? 203 ASN A OD1 1 
ATOM   1412  N ND2 . ASN A 1 203 ? 24.277  0.024   229.926 1.00 75.54  ? 203 ASN A ND2 1 
ATOM   1413  N N   . LYS A 1 204 ? 21.056  2.285   227.754 1.00 79.46  ? 204 LYS A N   1 
ATOM   1414  C CA  . LYS A 1 204 ? 21.073  2.542   226.323 1.00 80.98  ? 204 LYS A CA  1 
ATOM   1415  C C   . LYS A 1 204 ? 20.217  3.714   225.925 1.00 76.71  ? 204 LYS A C   1 
ATOM   1416  O O   . LYS A 1 204 ? 20.491  4.389   224.933 1.00 77.40  ? 204 LYS A O   1 
ATOM   1417  C CB  . LYS A 1 204 ? 20.640  1.302   225.583 1.00 91.47  ? 204 LYS A CB  1 
ATOM   1418  C CG  . LYS A 1 204 ? 21.571  0.122   225.852 1.00 109.71 ? 204 LYS A CG  1 
ATOM   1419  C CD  . LYS A 1 204 ? 21.059  -1.204  225.259 1.00 127.19 ? 204 LYS A CD  1 
ATOM   1420  C CE  . LYS A 1 204 ? 21.011  -1.206  223.713 1.00 138.87 ? 204 LYS A CE  1 
ATOM   1421  N NZ  . LYS A 1 204 ? 20.029  -0.224  223.108 1.00 148.38 ? 204 LYS A NZ  1 
ATOM   1422  N N   . ASP A 1 205 ? 19.137  3.919   226.661 1.00 72.15  ? 205 ASP A N   1 
ATOM   1423  C CA  . ASP A 1 205 ? 18.283  5.054   226.399 1.00 68.74  ? 205 ASP A CA  1 
ATOM   1424  C C   . ASP A 1 205 ? 19.250  6.197   226.620 1.00 66.45  ? 205 ASP A C   1 
ATOM   1425  O O   . ASP A 1 205 ? 19.279  7.141   225.846 1.00 70.09  ? 205 ASP A O   1 
ATOM   1426  C CB  . ASP A 1 205 ? 17.143  5.153   227.423 1.00 72.06  ? 205 ASP A CB  1 
ATOM   1427  C CG  . ASP A 1 205 ? 16.166  3.979   227.360 1.00 72.80  ? 205 ASP A CG  1 
ATOM   1428  O OD1 . ASP A 1 205 ? 16.602  2.852   227.062 1.00 74.45  ? 205 ASP A OD1 1 
ATOM   1429  O OD2 . ASP A 1 205 ? 14.966  4.168   227.667 1.00 72.65  ? 205 ASP A OD2 1 
ATOM   1430  N N   . GLN A 1 206 ? 20.113  6.036   227.623 1.00 60.78  ? 206 GLN A N   1 
ATOM   1431  C CA  . GLN A 1 206 ? 21.118  7.031   227.984 1.00 57.89  ? 206 GLN A CA  1 
ATOM   1432  C C   . GLN A 1 206 ? 22.018  7.449   226.810 1.00 54.62  ? 206 GLN A C   1 
ATOM   1433  O O   . GLN A 1 206 ? 22.653  8.504   226.838 1.00 54.89  ? 206 GLN A O   1 
ATOM   1434  C CB  . GLN A 1 206 ? 21.929  6.531   229.178 1.00 61.52  ? 206 GLN A CB  1 
ATOM   1435  C CG  . GLN A 1 206 ? 22.824  7.545   229.818 1.00 67.09  ? 206 GLN A CG  1 
ATOM   1436  C CD  . GLN A 1 206 ? 23.378  7.073   231.149 1.00 73.24  ? 206 GLN A CD  1 
ATOM   1437  O OE1 . GLN A 1 206 ? 24.375  6.351   231.192 1.00 81.14  ? 206 GLN A OE1 1 
ATOM   1438  N NE2 . GLN A 1 206 ? 22.751  7.496   232.245 1.00 71.10  ? 206 GLN A NE2 1 
ATOM   1439  N N   . VAL A 1 207 ? 22.112  6.614   225.784 1.00 49.81  ? 207 VAL A N   1 
ATOM   1440  C CA  . VAL A 1 207 ? 22.876  7.009   224.612 1.00 45.39  ? 207 VAL A CA  1 
ATOM   1441  C C   . VAL A 1 207 ? 22.066  6.863   223.361 1.00 46.89  ? 207 VAL A C   1 
ATOM   1442  O O   . VAL A 1 207 ? 21.703  7.870   222.806 1.00 56.16  ? 207 VAL A O   1 
ATOM   1443  C CB  . VAL A 1 207 ? 24.176  6.347   224.462 1.00 41.39  ? 207 VAL A CB  1 
ATOM   1444  C CG1 . VAL A 1 207 ? 25.111  6.897   225.513 1.00 41.97  ? 207 VAL A CG1 1 
ATOM   1445  C CG2 . VAL A 1 207 ? 23.989  4.872   224.509 1.00 40.77  ? 207 VAL A CG2 1 
ATOM   1446  N N   . LEU A 1 208 ? 21.841  5.685   222.816 1.00 41.57  ? 208 LEU A N   1 
ATOM   1447  C CA  . LEU A 1 208 ? 20.972  5.706   221.658 1.00 40.54  ? 208 LEU A CA  1 
ATOM   1448  C C   . LEU A 1 208 ? 20.059  4.575   221.795 1.00 44.17  ? 208 LEU A C   1 
ATOM   1449  O O   . LEU A 1 208 ? 20.400  3.452   221.390 1.00 41.76  ? 208 LEU A O   1 
ATOM   1450  C CB  . LEU A 1 208 ? 21.679  5.597   220.315 1.00 36.27  ? 208 LEU A CB  1 
ATOM   1451  C CG  . LEU A 1 208 ? 20.693  5.897   219.161 1.00 33.78  ? 208 LEU A CG  1 
ATOM   1452  C CD1 . LEU A 1 208 ? 21.478  6.309   217.993 1.00 35.91  ? 208 LEU A CD1 1 
ATOM   1453  C CD2 . LEU A 1 208 ? 19.768  4.766   218.745 1.00 30.79  ? 208 LEU A CD2 1 
ATOM   1454  N N   . ASN A 1 209 ? 18.908  4.824   222.402 1.00 47.70  ? 209 ASN A N   1 
ATOM   1455  C CA  . ASN A 1 209 ? 18.002  3.714   222.489 1.00 51.63  ? 209 ASN A CA  1 
ATOM   1456  C C   . ASN A 1 209 ? 17.046  3.590   221.305 1.00 48.57  ? 209 ASN A C   1 
ATOM   1457  O O   . ASN A 1 209 ? 16.053  4.312   221.191 1.00 52.04  ? 209 ASN A O   1 
ATOM   1458  C CB  . ASN A 1 209 ? 17.272  3.643   223.797 1.00 55.49  ? 209 ASN A CB  1 
ATOM   1459  C CG  . ASN A 1 209 ? 16.825  2.261   224.052 1.00 58.61  ? 209 ASN A CG  1 
ATOM   1460  O OD1 . ASN A 1 209 ? 17.472  1.329   223.544 1.00 56.43  ? 209 ASN A OD1 1 
ATOM   1461  N ND2 . ASN A 1 209 ? 15.695  2.081   224.741 1.00 63.37  ? 209 ASN A ND2 1 
ATOM   1462  N N   . PRO A 1 210 ? 17.299  2.608   220.448 1.00 43.63  ? 210 PRO A N   1 
ATOM   1463  C CA  . PRO A 1 210 ? 16.554  2.297   219.240 1.00 45.88  ? 210 PRO A CA  1 
ATOM   1464  C C   . PRO A 1 210 ? 15.138  1.865   219.446 1.00 52.23  ? 210 PRO A C   1 
ATOM   1465  O O   . PRO A 1 210 ? 14.440  1.509   218.486 1.00 53.17  ? 210 PRO A O   1 
ATOM   1466  C CB  . PRO A 1 210 ? 17.390  1.211   218.608 1.00 44.64  ? 210 PRO A CB  1 
ATOM   1467  C CG  . PRO A 1 210 ? 18.752  1.531   219.124 1.00 45.89  ? 210 PRO A CG  1 
ATOM   1468  C CD  . PRO A 1 210 ? 18.448  1.723   220.555 1.00 41.23  ? 210 PRO A CD  1 
ATOM   1469  N N   . ILE A 1 211 ? 14.716  1.823   220.701 1.00 58.38  ? 211 ILE A N   1 
ATOM   1470  C CA  . ILE A 1 211 ? 13.330  1.478   220.968 1.00 65.02  ? 211 ILE A CA  1 
ATOM   1471  C C   . ILE A 1 211 ? 12.703  2.771   221.392 1.00 62.14  ? 211 ILE A C   1 
ATOM   1472  O O   . ILE A 1 211 ? 11.625  3.128   220.925 1.00 63.62  ? 211 ILE A O   1 
ATOM   1473  C CB  . ILE A 1 211 ? 13.113  0.498   222.103 1.00 69.82  ? 211 ILE A CB  1 
ATOM   1474  C CG1 . ILE A 1 211 ? 14.083  -0.672  222.009 1.00 76.55  ? 211 ILE A CG1 1 
ATOM   1475  C CG2 . ILE A 1 211 ? 11.698  -0.050  221.980 1.00 76.64  ? 211 ILE A CG2 1 
ATOM   1476  C CD1 . ILE A 1 211 ? 15.520  -0.311  222.303 1.00 81.86  ? 211 ILE A CD1 1 
ATOM   1477  N N   . SER A 1 212 ? 13.389  3.460   222.292 1.00 58.04  ? 212 SER A N   1 
ATOM   1478  C CA  . SER A 1 212 ? 12.932  4.741   222.779 1.00 58.99  ? 212 SER A CA  1 
ATOM   1479  C C   . SER A 1 212 ? 12.787  5.723   221.603 1.00 58.63  ? 212 SER A C   1 
ATOM   1480  O O   . SER A 1 212 ? 13.590  6.639   221.379 1.00 57.07  ? 212 SER A O   1 
ATOM   1481  C CB  . SER A 1 212 ? 13.888  5.204   223.861 1.00 60.13  ? 212 SER A CB  1 
ATOM   1482  O OG  . SER A 1 212 ? 14.010  4.147   224.806 1.00 60.86  ? 212 SER A OG  1 
ATOM   1483  N N   . LYS A 1 213 ? 11.706  5.485   220.876 1.00 58.87  ? 213 LYS A N   1 
ATOM   1484  C CA  . LYS A 1 213 ? 11.315  6.199   219.692 1.00 61.60  ? 213 LYS A CA  1 
ATOM   1485  C C   . LYS A 1 213 ? 9.842   6.402   219.901 1.00 63.18  ? 213 LYS A C   1 
ATOM   1486  O O   . LYS A 1 213 ? 9.098   5.435   220.112 1.00 58.87  ? 213 LYS A O   1 
ATOM   1487  C CB  . LYS A 1 213 ? 11.453  5.303   218.456 1.00 61.68  ? 213 LYS A CB  1 
ATOM   1488  C CG  . LYS A 1 213 ? 12.819  4.743   218.185 1.00 62.01  ? 213 LYS A CG  1 
ATOM   1489  C CD  . LYS A 1 213 ? 13.394  5.360   216.933 1.00 63.89  ? 213 LYS A CD  1 
ATOM   1490  C CE  . LYS A 1 213 ? 14.835  4.912   216.741 1.00 67.87  ? 213 LYS A CE  1 
ATOM   1491  N NZ  . LYS A 1 213 ? 15.674  5.786   215.837 1.00 72.49  ? 213 LYS A NZ  1 
ATOM   1492  N N   . ALA A 1 214 ? 9.415   7.649   219.787 1.00 67.53  ? 214 ALA A N   1 
ATOM   1493  C CA  . ALA A 1 214 ? 8.010   7.980   219.941 1.00 70.30  ? 214 ALA A CA  1 
ATOM   1494  C C   . ALA A 1 214 ? 7.523   8.833   218.761 1.00 69.89  ? 214 ALA A C   1 
ATOM   1495  O O   . ALA A 1 214 ? 8.053   8.762   217.635 1.00 69.43  ? 214 ALA A O   1 
ATOM   1496  C CB  . ALA A 1 214 ? 7.795   8.716   221.264 1.00 70.38  ? 214 ALA A CB  1 
ATOM   1497  N N   . LYS A 1 215 ? 6.488   9.616   219.030 1.00 68.05  ? 215 LYS A N   1 
ATOM   1498  C CA  . LYS A 1 215 ? 5.910   10.519  218.058 1.00 67.12  ? 215 LYS A CA  1 
ATOM   1499  C C   . LYS A 1 215 ? 5.438   11.738  218.835 1.00 63.73  ? 215 LYS A C   1 
ATOM   1500  O O   . LYS A 1 215 ? 5.199   11.658  220.031 1.00 61.37  ? 215 LYS A O   1 
ATOM   1501  C CB  . LYS A 1 215 ? 4.743   9.848   217.351 1.00 70.60  ? 215 LYS A CB  1 
ATOM   1502  C CG  . LYS A 1 215 ? 5.179   8.861   216.299 1.00 81.32  ? 215 LYS A CG  1 
ATOM   1503  C CD  . LYS A 1 215 ? 3.979   8.276   215.568 1.00 95.51  ? 215 LYS A CD  1 
ATOM   1504  C CE  . LYS A 1 215 ? 4.361   7.608   214.223 1.00 105.08 ? 215 LYS A CE  1 
ATOM   1505  N NZ  . LYS A 1 215 ? 4.752   8.549   213.090 1.00 114.53 ? 215 LYS A NZ  1 
ATOM   1506  N N   . LEU A 1 216 ? 5.396   12.888  218.186 1.00 60.69  ? 216 LEU A N   1 
ATOM   1507  C CA  . LEU A 1 216 ? 4.935   14.085  218.857 1.00 58.66  ? 216 LEU A CA  1 
ATOM   1508  C C   . LEU A 1 216 ? 3.457   14.137  218.629 1.00 62.06  ? 216 LEU A C   1 
ATOM   1509  O O   . LEU A 1 216 ? 3.034   14.810  217.677 1.00 67.17  ? 216 LEU A O   1 
ATOM   1510  C CB  . LEU A 1 216 ? 5.527   15.322  218.208 1.00 53.30  ? 216 LEU A CB  1 
ATOM   1511  C CG  . LEU A 1 216 ? 6.268   16.219  219.193 1.00 55.70  ? 216 LEU A CG  1 
ATOM   1512  C CD1 . LEU A 1 216 ? 6.437   17.576  218.527 1.00 61.29  ? 216 LEU A CD1 1 
ATOM   1513  C CD2 . LEU A 1 216 ? 5.529   16.350  220.540 1.00 49.60  ? 216 LEU A CD2 1 
ATOM   1514  N N   . ASP A 1 217 ? 2.689   13.347  219.383 1.00 62.78  ? 217 ASP A N   1 
ATOM   1515  C CA  . ASP A 1 217 ? 1.248   13.369  219.208 1.00 63.87  ? 217 ASP A CA  1 
ATOM   1516  C C   . ASP A 1 217 ? 0.717   14.311  220.222 1.00 59.85  ? 217 ASP A C   1 
ATOM   1517  O O   . ASP A 1 217 ? -0.060  15.188  219.915 1.00 60.32  ? 217 ASP A O   1 
ATOM   1518  C CB  . ASP A 1 217 ? 0.595   11.982  219.276 1.00 75.45  ? 217 ASP A CB  1 
ATOM   1519  C CG  . ASP A 1 217 ? 1.240   11.078  220.285 1.00 90.19  ? 217 ASP A CG  1 
ATOM   1520  O OD1 . ASP A 1 217 ? 0.843   11.172  221.448 1.00 100.93 ? 217 ASP A OD1 1 
ATOM   1521  O OD2 . ASP A 1 217 ? 2.120   10.254  219.940 1.00 98.31  ? 217 ASP A OD2 1 
ATOM   1522  N N   . LYS A 1 218 ? 1.173   14.194  221.441 1.00 57.54  ? 218 LYS A N   1 
ATOM   1523  C CA  . LYS A 1 218 ? 0.683   15.147  222.399 1.00 61.97  ? 218 LYS A CA  1 
ATOM   1524  C C   . LYS A 1 218 ? 1.551   16.378  222.311 1.00 59.46  ? 218 LYS A C   1 
ATOM   1525  O O   . LYS A 1 218 ? 2.737   16.315  222.001 1.00 58.80  ? 218 LYS A O   1 
ATOM   1526  C CB  . LYS A 1 218 ? 0.694   14.592  223.830 1.00 70.90  ? 218 LYS A CB  1 
ATOM   1527  C CG  . LYS A 1 218 ? -0.561  13.824  224.264 1.00 81.72  ? 218 LYS A CG  1 
ATOM   1528  C CD  . LYS A 1 218 ? -0.825  12.664  223.314 1.00 96.34  ? 218 LYS A CD  1 
ATOM   1529  C CE  . LYS A 1 218 ? -1.957  11.712  223.737 1.00 104.76 ? 218 LYS A CE  1 
ATOM   1530  N NZ  . LYS A 1 218 ? -2.238  10.706  222.639 1.00 113.60 ? 218 LYS A NZ  1 
ATOM   1531  N N   . ASP A 1 219 ? 0.946   17.504  222.604 1.00 60.78  ? 219 ASP A N   1 
ATOM   1532  C CA  . ASP A 1 219 ? 1.654   18.752  222.604 1.00 65.94  ? 219 ASP A CA  1 
ATOM   1533  C C   . ASP A 1 219 ? 2.059   19.075  224.039 1.00 66.83  ? 219 ASP A C   1 
ATOM   1534  O O   . ASP A 1 219 ? 1.474   18.547  224.971 1.00 68.32  ? 219 ASP A O   1 
ATOM   1535  C CB  . ASP A 1 219 ? 0.725   19.821  222.061 1.00 70.92  ? 219 ASP A CB  1 
ATOM   1536  C CG  . ASP A 1 219 ? 1.033   21.199  222.593 1.00 76.42  ? 219 ASP A CG  1 
ATOM   1537  O OD1 . ASP A 1 219 ? 0.788   21.451  223.801 1.00 77.91  ? 219 ASP A OD1 1 
ATOM   1538  O OD2 . ASP A 1 219 ? 1.514   22.042  221.798 1.00 81.29  ? 219 ASP A OD2 1 
ATOM   1539  N N   . GLY A 1 220 ? 3.045   19.959  224.196 1.00 69.07  ? 220 GLY A N   1 
ATOM   1540  C CA  . GLY A 1 220 ? 3.527   20.389  225.501 1.00 68.50  ? 220 GLY A CA  1 
ATOM   1541  C C   . GLY A 1 220 ? 3.707   19.208  226.415 1.00 69.73  ? 220 GLY A C   1 
ATOM   1542  O O   . GLY A 1 220 ? 3.626   19.318  227.651 1.00 67.05  ? 220 GLY A O   1 
ATOM   1543  N N   . MET A 1 221 ? 4.000   18.071  225.803 1.00 70.64  ? 221 MET A N   1 
ATOM   1544  C CA  . MET A 1 221 ? 4.121   16.883  226.594 1.00 74.82  ? 221 MET A CA  1 
ATOM   1545  C C   . MET A 1 221 ? 5.473   16.241  226.556 1.00 72.62  ? 221 MET A C   1 
ATOM   1546  O O   . MET A 1 221 ? 6.133   16.124  227.582 1.00 75.88  ? 221 MET A O   1 
ATOM   1547  C CB  . MET A 1 221 ? 3.040   15.880  226.206 1.00 81.07  ? 221 MET A CB  1 
ATOM   1548  C CG  . MET A 1 221 ? 2.513   15.045  227.386 1.00 85.88  ? 221 MET A CG  1 
ATOM   1549  S SD  . MET A 1 221 ? 1.649   15.996  228.676 1.00 90.07  ? 221 MET A SD  1 
ATOM   1550  C CE  . MET A 1 221 ? -0.041  15.958  227.997 1.00 90.37  ? 221 MET A CE  1 
ATOM   1551  N N   . TYR A 1 222 ? 5.893   15.770  225.403 1.00 65.81  ? 222 TYR A N   1 
ATOM   1552  C CA  . TYR A 1 222 ? 7.195   15.152  225.387 1.00 60.06  ? 222 TYR A CA  1 
ATOM   1553  C C   . TYR A 1 222 ? 8.120   16.287  225.726 1.00 59.73  ? 222 TYR A C   1 
ATOM   1554  O O   . TYR A 1 222 ? 7.957   17.385  225.197 1.00 59.02  ? 222 TYR A O   1 
ATOM   1555  C CB  . TYR A 1 222 ? 7.497   14.664  224.010 1.00 56.98  ? 222 TYR A CB  1 
ATOM   1556  C CG  . TYR A 1 222 ? 6.400   13.836  223.475 1.00 55.19  ? 222 TYR A CG  1 
ATOM   1557  C CD1 . TYR A 1 222 ? 5.218   14.417  223.036 1.00 56.12  ? 222 TYR A CD1 1 
ATOM   1558  C CD2 . TYR A 1 222 ? 6.524   12.464  223.430 1.00 54.85  ? 222 TYR A CD2 1 
ATOM   1559  C CE1 . TYR A 1 222 ? 4.170   13.634  222.563 1.00 58.84  ? 222 TYR A CE1 1 
ATOM   1560  C CE2 . TYR A 1 222 ? 5.489   11.669  222.965 1.00 54.76  ? 222 TYR A CE2 1 
ATOM   1561  C CZ  . TYR A 1 222 ? 4.311   12.252  222.536 1.00 54.05  ? 222 TYR A CZ  1 
ATOM   1562  O OH  . TYR A 1 222 ? 3.281   11.439  222.131 1.00 45.21  ? 222 TYR A OH  1 
ATOM   1563  N N   . PRO A 1 223 ? 8.976   16.104  226.731 1.00 59.74  ? 223 PRO A N   1 
ATOM   1564  C CA  . PRO A 1 223 ? 9.902   17.177  227.094 1.00 63.69  ? 223 PRO A CA  1 
ATOM   1565  C C   . PRO A 1 223 ? 11.081  17.111  226.150 1.00 66.81  ? 223 PRO A C   1 
ATOM   1566  O O   . PRO A 1 223 ? 11.443  16.032  225.655 1.00 66.94  ? 223 PRO A O   1 
ATOM   1567  C CB  . PRO A 1 223 ? 10.304  16.823  228.514 1.00 61.45  ? 223 PRO A CB  1 
ATOM   1568  C CG  . PRO A 1 223 ? 10.318  15.352  228.468 1.00 62.57  ? 223 PRO A CG  1 
ATOM   1569  C CD  . PRO A 1 223 ? 9.085   14.975  227.661 1.00 58.34  ? 223 PRO A CD  1 
ATOM   1570  N N   . VAL A 1 224 ? 11.676  18.259  225.877 1.00 67.33  ? 224 VAL A N   1 
ATOM   1571  C CA  . VAL A 1 224 ? 12.807  18.282  224.966 1.00 69.42  ? 224 VAL A CA  1 
ATOM   1572  C C   . VAL A 1 224 ? 13.961  17.588  225.578 1.00 68.98  ? 224 VAL A C   1 
ATOM   1573  O O   . VAL A 1 224 ? 14.788  17.005  224.886 1.00 67.11  ? 224 VAL A O   1 
ATOM   1574  C CB  . VAL A 1 224 ? 13.289  19.650  224.727 1.00 72.91  ? 224 VAL A CB  1 
ATOM   1575  C CG1 . VAL A 1 224 ? 12.687  20.162  223.463 1.00 77.60  ? 224 VAL A CG1 1 
ATOM   1576  C CG2 . VAL A 1 224 ? 12.983  20.519  225.950 1.00 76.71  ? 224 VAL A CG2 1 
ATOM   1577  N N   . GLU A 1 225 ? 14.043  17.723  226.890 1.00 68.73  ? 225 GLU A N   1 
ATOM   1578  C CA  . GLU A 1 225 ? 15.111  17.108  227.630 1.00 69.74  ? 225 GLU A CA  1 
ATOM   1579  C C   . GLU A 1 225 ? 15.222  15.580  227.375 1.00 65.81  ? 225 GLU A C   1 
ATOM   1580  O O   . GLU A 1 225 ? 16.279  14.976  227.604 1.00 62.54  ? 225 GLU A O   1 
ATOM   1581  C CB  . GLU A 1 225 ? 14.899  17.430  229.104 1.00 72.57  ? 225 GLU A CB  1 
ATOM   1582  C CG  . GLU A 1 225 ? 16.068  17.059  229.982 1.00 75.82  ? 225 GLU A CG  1 
ATOM   1583  C CD  . GLU A 1 225 ? 15.901  17.567  231.386 1.00 76.73  ? 225 GLU A CD  1 
ATOM   1584  O OE1 . GLU A 1 225 ? 15.857  18.824  231.557 1.00 76.47  ? 225 GLU A OE1 1 
ATOM   1585  O OE2 . GLU A 1 225 ? 15.799  16.705  232.302 1.00 71.89  ? 225 GLU A OE2 1 
ATOM   1586  N N   . ILE A 1 226 ? 14.181  15.000  226.776 1.00 62.72  ? 226 ILE A N   1 
ATOM   1587  C CA  . ILE A 1 226 ? 14.124  13.561  226.509 1.00 63.48  ? 226 ILE A CA  1 
ATOM   1588  C C   . ILE A 1 226 ? 13.997  13.100  225.065 1.00 63.22  ? 226 ILE A C   1 
ATOM   1589  O O   . ILE A 1 226 ? 14.632  12.125  224.628 1.00 61.55  ? 226 ILE A O   1 
ATOM   1590  C CB  . ILE A 1 226 ? 12.915  12.954  227.225 1.00 66.04  ? 226 ILE A CB  1 
ATOM   1591  C CG1 . ILE A 1 226 ? 13.141  12.989  228.737 1.00 69.00  ? 226 ILE A CG1 1 
ATOM   1592  C CG2 . ILE A 1 226 ? 12.593  11.545  226.682 1.00 65.99  ? 226 ILE A CG2 1 
ATOM   1593  C CD1 . ILE A 1 226 ? 12.041  12.324  229.531 1.00 69.14  ? 226 ILE A CD1 1 
ATOM   1594  N N   . TRP A 1 227 ? 13.094  13.746  224.357 1.00 64.31  ? 227 TRP A N   1 
ATOM   1595  C CA  . TRP A 1 227 ? 12.804  13.378  222.987 1.00 67.12  ? 227 TRP A CA  1 
ATOM   1596  C C   . TRP A 1 227 ? 13.510  14.142  221.886 1.00 64.15  ? 227 TRP A C   1 
ATOM   1597  O O   . TRP A 1 227 ? 13.672  15.368  221.972 1.00 63.91  ? 227 TRP A O   1 
ATOM   1598  C CB  . TRP A 1 227 ? 11.320  13.476  222.816 1.00 73.64  ? 227 TRP A CB  1 
ATOM   1599  C CG  . TRP A 1 227 ? 10.668  12.655  223.800 1.00 75.62  ? 227 TRP A CG  1 
ATOM   1600  C CD1 . TRP A 1 227 ? 9.999   13.065  224.904 1.00 76.77  ? 227 TRP A CD1 1 
ATOM   1601  C CD2 . TRP A 1 227 ? 10.582  11.251  223.761 1.00 78.19  ? 227 TRP A CD2 1 
ATOM   1602  N NE1 . TRP A 1 227 ? 9.479   11.989  225.555 1.00 79.72  ? 227 TRP A NE1 1 
ATOM   1603  C CE2 . TRP A 1 227 ? 9.823   10.856  224.870 1.00 79.28  ? 227 TRP A CE2 1 
ATOM   1604  C CE3 . TRP A 1 227 ? 11.070  10.279  222.880 1.00 82.25  ? 227 TRP A CE3 1 
ATOM   1605  C CZ2 . TRP A 1 227 ? 9.533   9.528   225.128 1.00 82.45  ? 227 TRP A CZ2 1 
ATOM   1606  C CZ3 . TRP A 1 227 ? 10.786  8.963   223.127 1.00 83.96  ? 227 TRP A CZ3 1 
ATOM   1607  C CH2 . TRP A 1 227 ? 10.022  8.593   224.244 1.00 85.56  ? 227 TRP A CH2 1 
ATOM   1608  N N   . HIS A 1 228 ? 13.899  13.423  220.833 1.00 59.58  ? 228 HIS A N   1 
ATOM   1609  C CA  . HIS A 1 228 ? 14.603  14.058  219.730 1.00 57.45  ? 228 HIS A CA  1 
ATOM   1610  C C   . HIS A 1 228 ? 14.104  13.688  218.371 1.00 53.06  ? 228 HIS A C   1 
ATOM   1611  O O   . HIS A 1 228 ? 13.616  12.595  218.146 1.00 49.58  ? 228 HIS A O   1 
ATOM   1612  C CB  . HIS A 1 228 ? 16.096  13.764  219.776 1.00 60.88  ? 228 HIS A CB  1 
ATOM   1613  C CG  . HIS A 1 228 ? 16.716  14.037  221.100 1.00 65.43  ? 228 HIS A CG  1 
ATOM   1614  N ND1 . HIS A 1 228 ? 17.404  15.203  221.375 1.00 66.49  ? 228 HIS A ND1 1 
ATOM   1615  C CD2 . HIS A 1 228 ? 16.741  13.299  222.239 1.00 63.91  ? 228 HIS A CD2 1 
ATOM   1616  C CE1 . HIS A 1 228 ? 17.822  15.167  222.627 1.00 72.32  ? 228 HIS A CE1 1 
ATOM   1617  N NE2 . HIS A 1 228 ? 17.435  14.022  223.172 1.00 69.74  ? 228 HIS A NE2 1 
ATOM   1618  N N   . PRO A 1 229 ? 14.284  14.599  217.424 1.00 51.20  ? 229 PRO A N   1 
ATOM   1619  C CA  . PRO A 1 229 ? 13.872  14.419  216.046 1.00 49.84  ? 229 PRO A CA  1 
ATOM   1620  C C   . PRO A 1 229 ? 14.703  13.263  215.602 1.00 47.96  ? 229 PRO A C   1 
ATOM   1621  O O   . PRO A 1 229 ? 15.918  13.381  215.406 1.00 46.70  ? 229 PRO A O   1 
ATOM   1622  C CB  . PRO A 1 229 ? 14.348  15.697  215.408 1.00 55.29  ? 229 PRO A CB  1 
ATOM   1623  C CG  . PRO A 1 229 ? 15.619  15.979  216.180 1.00 56.48  ? 229 PRO A CG  1 
ATOM   1624  C CD  . PRO A 1 229 ? 15.148  15.781  217.561 1.00 51.88  ? 229 PRO A CD  1 
ATOM   1625  N N   . ASP A 1 230 ? 14.088  12.106  215.635 1.00 48.37  ? 230 ASP A N   1 
ATOM   1626  C CA  . ASP A 1 230 ? 14.802  10.925  215.249 1.00 52.73  ? 230 ASP A CA  1 
ATOM   1627  C C   . ASP A 1 230 ? 14.876  10.918  213.754 1.00 53.01  ? 230 ASP A C   1 
ATOM   1628  O O   . ASP A 1 230 ? 13.859  11.214  213.114 1.00 53.31  ? 230 ASP A O   1 
ATOM   1629  C CB  . ASP A 1 230 ? 14.038  9.692   215.706 1.00 61.63  ? 230 ASP A CB  1 
ATOM   1630  C CG  . ASP A 1 230 ? 14.322  8.455   214.851 1.00 66.80  ? 230 ASP A CG  1 
ATOM   1631  O OD1 . ASP A 1 230 ? 15.513  8.124   214.608 1.00 67.65  ? 230 ASP A OD1 1 
ATOM   1632  O OD2 . ASP A 1 230 ? 13.335  7.787   214.450 1.00 70.81  ? 230 ASP A OD2 1 
ATOM   1633  N N   . PRO A 1 231 ? 16.108  10.815  213.187 1.00 51.88  ? 231 PRO A N   1 
ATOM   1634  C CA  . PRO A 1 231 ? 16.189  10.774  211.712 1.00 51.68  ? 231 PRO A CA  1 
ATOM   1635  C C   . PRO A 1 231 ? 15.786  9.345   211.351 1.00 52.02  ? 231 PRO A C   1 
ATOM   1636  O O   . PRO A 1 231 ? 16.535  8.398   211.611 1.00 50.09  ? 231 PRO A O   1 
ATOM   1637  C CB  . PRO A 1 231 ? 17.674  11.074  211.412 1.00 47.93  ? 231 PRO A CB  1 
ATOM   1638  C CG  . PRO A 1 231 ? 18.385  10.776  212.728 1.00 45.22  ? 231 PRO A CG  1 
ATOM   1639  C CD  . PRO A 1 231 ? 17.406  11.192  213.785 1.00 46.61  ? 231 PRO A CD  1 
ATOM   1640  N N   . ALA A 1 232 ? 14.554  9.157   210.891 1.00 52.63  ? 232 ALA A N   1 
ATOM   1641  C CA  . ALA A 1 232 ? 14.155  7.804   210.579 1.00 53.60  ? 232 ALA A CA  1 
ATOM   1642  C C   . ALA A 1 232 ? 14.894  7.301   209.312 1.00 55.97  ? 232 ALA A C   1 
ATOM   1643  O O   . ALA A 1 232 ? 16.004  7.735   208.938 1.00 52.49  ? 232 ALA A O   1 
ATOM   1644  C CB  . ALA A 1 232 ? 12.583  7.698   210.459 1.00 42.14  ? 232 ALA A CB  1 
ATOM   1645  N N   . LYS A 1 233 ? 14.360  6.238   208.767 1.00 59.30  ? 233 LYS A N   1 
ATOM   1646  C CA  . LYS A 1 233 ? 14.896  5.727   207.542 1.00 64.46  ? 233 LYS A CA  1 
ATOM   1647  C C   . LYS A 1 233 ? 14.179  6.642   206.585 1.00 70.52  ? 233 LYS A C   1 
ATOM   1648  O O   . LYS A 1 233 ? 14.810  7.293   205.749 1.00 67.99  ? 233 LYS A O   1 
ATOM   1649  C CB  . LYS A 1 233 ? 14.411  4.299   207.302 1.00 68.57  ? 233 LYS A CB  1 
ATOM   1650  C CG  . LYS A 1 233 ? 12.958  4.102   207.699 1.00 76.05  ? 233 LYS A CG  1 
ATOM   1651  C CD  . LYS A 1 233 ? 12.452  2.707   207.500 1.00 83.48  ? 233 LYS A CD  1 
ATOM   1652  C CE  . LYS A 1 233 ? 12.869  2.095   206.187 1.00 87.03  ? 233 LYS A CE  1 
ATOM   1653  N NZ  . LYS A 1 233 ? 12.519  0.646   206.300 1.00 92.13  ? 233 LYS A NZ  1 
ATOM   1654  N N   . ASN A 1 234 ? 12.855  6.755   206.849 1.00 81.96  ? 234 ASN A N   1 
ATOM   1655  C CA  . ASN A 1 234 ? 11.809  7.525   206.101 1.00 88.35  ? 234 ASN A CA  1 
ATOM   1656  C C   . ASN A 1 234 ? 11.258  8.771   206.906 1.00 84.34  ? 234 ASN A C   1 
ATOM   1657  O O   . ASN A 1 234 ? 11.072  8.686   208.140 1.00 83.05  ? 234 ASN A O   1 
ATOM   1658  C CB  . ASN A 1 234 ? 10.594  6.585   205.724 1.00 96.82  ? 234 ASN A CB  1 
ATOM   1659  C CG  . ASN A 1 234 ? 10.980  5.348   204.806 1.00 101.34 ? 234 ASN A CG  1 
ATOM   1660  O OD1 . ASN A 1 234 ? 10.206  4.938   203.912 1.00 100.77 ? 234 ASN A OD1 1 
ATOM   1661  N ND2 . ASN A 1 234 ? 12.150  4.758   205.047 1.00 98.57  ? 234 ASN A ND2 1 
ATOM   1662  N N   . GLU A 1 235 ? 10.969  9.881   206.192 1.00 78.95  ? 235 GLU A N   1 
ATOM   1663  C CA  . GLU A 1 235 ? 10.466  11.140  206.792 1.00 69.84  ? 235 GLU A CA  1 
ATOM   1664  C C   . GLU A 1 235 ? 9.702   12.082  205.845 1.00 64.79  ? 235 GLU A C   1 
ATOM   1665  O O   . GLU A 1 235 ? 10.185  12.461  204.761 1.00 60.54  ? 235 GLU A O   1 
ATOM   1666  C CB  . GLU A 1 235 ? 11.600  11.936  207.431 1.00 66.06  ? 235 GLU A CB  1 
ATOM   1667  C CG  . GLU A 1 235 ? 11.179  12.607  208.702 1.00 63.25  ? 235 GLU A CG  1 
ATOM   1668  C CD  . GLU A 1 235 ? 11.312  11.708  209.936 1.00 66.26  ? 235 GLU A CD  1 
ATOM   1669  O OE1 . GLU A 1 235 ? 11.993  10.629  209.848 1.00 57.38  ? 235 GLU A OE1 1 
ATOM   1670  O OE2 . GLU A 1 235 ? 10.764  12.139  210.998 1.00 62.94  ? 235 GLU A OE2 1 
ATOM   1671  N N   . ASN A 1 236 ? 8.532   12.504  206.311 1.00 60.52  ? 236 ASN A N   1 
ATOM   1672  C CA  . ASN A 1 236 ? 7.661   13.387  205.560 1.00 57.79  ? 236 ASN A CA  1 
ATOM   1673  C C   . ASN A 1 236 ? 7.557   14.676  206.354 1.00 58.12  ? 236 ASN A C   1 
ATOM   1674  O O   . ASN A 1 236 ? 6.517   15.336  206.367 1.00 60.19  ? 236 ASN A O   1 
ATOM   1675  C CB  . ASN A 1 236 ? 6.290   12.725  205.365 1.00 54.10  ? 236 ASN A CB  1 
ATOM   1676  C CG  . ASN A 1 236 ? 5.331   13.538  204.480 1.00 57.34  ? 236 ASN A CG  1 
ATOM   1677  O OD1 . ASN A 1 236 ? 5.698   14.094  203.436 1.00 53.12  ? 236 ASN A OD1 1 
ATOM   1678  N ND2 . ASN A 1 236 ? 4.069   13.552  204.880 1.00 59.25  ? 236 ASN A ND2 1 
ATOM   1679  N N   . THR A 1 237 ? 8.656   15.023  207.020 1.00 59.02  ? 237 THR A N   1 
ATOM   1680  C CA  . THR A 1 237 ? 8.761   16.260  207.805 1.00 58.63  ? 237 THR A CA  1 
ATOM   1681  C C   . THR A 1 237 ? 10.180  16.798  207.601 1.00 51.60  ? 237 THR A C   1 
ATOM   1682  O O   . THR A 1 237 ? 11.087  16.045  207.261 1.00 53.18  ? 237 THR A O   1 
ATOM   1683  C CB  . THR A 1 237 ? 8.540   16.006  209.318 1.00 64.99  ? 237 THR A CB  1 
ATOM   1684  O OG1 . THR A 1 237 ? 7.433   15.111  209.500 1.00 72.22  ? 237 THR A OG1 1 
ATOM   1685  C CG2 . THR A 1 237 ? 8.247   17.325  210.057 1.00 68.03  ? 237 THR A CG2 1 
ATOM   1686  N N   . ARG A 1 238 ? 10.361  18.100  207.701 1.00 44.30  ? 238 ARG A N   1 
ATOM   1687  C CA  . ARG A 1 238 ? 11.686  18.663  207.534 1.00 37.98  ? 238 ARG A CA  1 
ATOM   1688  C C   . ARG A 1 238 ? 11.819  19.262  208.864 1.00 31.07  ? 238 ARG A C   1 
ATOM   1689  O O   . ARG A 1 238 ? 10.866  19.854  209.374 1.00 24.29  ? 238 ARG A O   1 
ATOM   1690  C CB  . ARG A 1 238 ? 11.704  19.812  206.521 1.00 48.19  ? 238 ARG A CB  1 
ATOM   1691  C CG  . ARG A 1 238 ? 11.067  19.522  205.173 1.00 53.13  ? 238 ARG A CG  1 
ATOM   1692  C CD  . ARG A 1 238 ? 11.978  18.690  204.293 1.00 58.36  ? 238 ARG A CD  1 
ATOM   1693  N NE  . ARG A 1 238 ? 11.244  18.117  203.171 1.00 62.68  ? 238 ARG A NE  1 
ATOM   1694  C CZ  . ARG A 1 238 ? 10.761  16.879  203.147 1.00 67.56  ? 238 ARG A CZ  1 
ATOM   1695  N NH1 . ARG A 1 238 ? 10.949  16.077  204.194 1.00 71.36  ? 238 ARG A NH1 1 
ATOM   1696  N NH2 . ARG A 1 238 ? 10.093  16.442  202.077 1.00 70.19  ? 238 ARG A NH2 1 
ATOM   1697  N N   . TYR A 1 239 ? 13.000  19.187  209.413 1.00 26.22  ? 239 TYR A N   1 
ATOM   1698  C CA  . TYR A 1 239 ? 13.137  19.767  210.714 1.00 29.49  ? 239 TYR A CA  1 
ATOM   1699  C C   . TYR A 1 239 ? 14.495  20.258  210.821 1.00 28.68  ? 239 TYR A C   1 
ATOM   1700  O O   . TYR A 1 239 ? 15.371  19.836  210.035 1.00 29.68  ? 239 TYR A O   1 
ATOM   1701  C CB  . TYR A 1 239 ? 13.034  18.717  211.771 1.00 34.16  ? 239 TYR A CB  1 
ATOM   1702  C CG  . TYR A 1 239 ? 14.158  17.703  211.684 1.00 39.17  ? 239 TYR A CG  1 
ATOM   1703  C CD1 . TYR A 1 239 ? 14.165  16.743  210.684 1.00 38.76  ? 239 TYR A CD1 1 
ATOM   1704  C CD2 . TYR A 1 239 ? 15.156  17.643  212.663 1.00 39.12  ? 239 TYR A CD2 1 
ATOM   1705  C CE1 . TYR A 1 239 ? 15.114  15.743  210.670 1.00 39.92  ? 239 TYR A CE1 1 
ATOM   1706  C CE2 . TYR A 1 239 ? 16.115  16.640  212.650 1.00 41.61  ? 239 TYR A CE2 1 
ATOM   1707  C CZ  . TYR A 1 239 ? 16.079  15.689  211.649 1.00 42.34  ? 239 TYR A CZ  1 
ATOM   1708  O OH  . TYR A 1 239 ? 16.974  14.646  211.616 1.00 51.49  ? 239 TYR A OH  1 
ATOM   1709  N N   . PHE A 1 240 ? 14.689  21.040  211.881 1.00 27.92  ? 240 PHE A N   1 
ATOM   1710  C CA  . PHE A 1 240 ? 15.968  21.632  212.193 1.00 32.22  ? 240 PHE A CA  1 
ATOM   1711  C C   . PHE A 1 240 ? 15.962  22.542  213.374 1.00 30.67  ? 240 PHE A C   1 
ATOM   1712  O O   . PHE A 1 240 ? 14.931  23.092  213.782 1.00 27.02  ? 240 PHE A O   1 
ATOM   1713  C CB  . PHE A 1 240 ? 16.530  22.426  211.025 1.00 41.71  ? 240 PHE A CB  1 
ATOM   1714  C CG  . PHE A 1 240 ? 15.536  22.701  209.939 1.00 50.62  ? 240 PHE A CG  1 
ATOM   1715  C CD1 . PHE A 1 240 ? 14.231  23.072  210.246 1.00 51.18  ? 240 PHE A CD1 1 
ATOM   1716  C CD2 . PHE A 1 240 ? 15.883  22.465  208.604 1.00 53.55  ? 240 PHE A CD2 1 
ATOM   1717  C CE1 . PHE A 1 240 ? 13.300  23.183  209.249 1.00 58.72  ? 240 PHE A CE1 1 
ATOM   1718  C CE2 . PHE A 1 240 ? 14.955  22.578  207.595 1.00 53.87  ? 240 PHE A CE2 1 
ATOM   1719  C CZ  . PHE A 1 240 ? 13.663  22.933  207.908 1.00 58.79  ? 240 PHE A CZ  1 
ATOM   1720  N N   . GLY A 1 241 ? 17.175  22.762  213.846 1.00 31.42  ? 241 GLY A N   1 
ATOM   1721  C CA  . GLY A 1 241 ? 17.404  23.626  214.970 1.00 39.27  ? 241 GLY A CA  1 
ATOM   1722  C C   . GLY A 1 241 ? 18.785  23.337  215.501 1.00 43.55  ? 241 GLY A C   1 
ATOM   1723  O O   . GLY A 1 241 ? 19.540  22.578  214.894 1.00 44.87  ? 241 GLY A O   1 
ATOM   1724  N N   . ASN A 1 242 ? 19.091  23.886  216.671 1.00 48.47  ? 242 ASN A N   1 
ATOM   1725  C CA  . ASN A 1 242 ? 20.401  23.681  217.272 1.00 53.00  ? 242 ASN A CA  1 
ATOM   1726  C C   . ASN A 1 242 ? 20.530  23.964  218.781 1.00 52.74  ? 242 ASN A C   1 
ATOM   1727  O O   . ASN A 1 242 ? 19.807  24.805  219.373 1.00 51.14  ? 242 ASN A O   1 
ATOM   1728  C CB  . ASN A 1 242 ? 21.384  24.585  216.610 1.00 63.34  ? 242 ASN A CB  1 
ATOM   1729  C CG  . ASN A 1 242 ? 21.293  25.966  217.153 1.00 72.76  ? 242 ASN A CG  1 
ATOM   1730  O OD1 . ASN A 1 242 ? 22.112  26.370  217.993 1.00 81.64  ? 242 ASN A OD1 1 
ATOM   1731  N ND2 . ASN A 1 242 ? 20.229  26.682  216.763 1.00 78.47  ? 242 ASN A ND2 1 
ATOM   1732  N N   . TYR A 1 243 ? 21.556  23.341  219.349 1.00 48.99  ? 243 TYR A N   1 
ATOM   1733  C CA  . TYR A 1 243 ? 21.848  23.460  220.745 1.00 42.53  ? 243 TYR A CA  1 
ATOM   1734  C C   . TYR A 1 243 ? 23.014  24.395  220.851 1.00 38.49  ? 243 TYR A C   1 
ATOM   1735  O O   . TYR A 1 243 ? 23.915  24.411  220.000 1.00 36.49  ? 243 TYR A O   1 
ATOM   1736  C CB  . TYR A 1 243 ? 22.175  22.087  221.320 1.00 41.35  ? 243 TYR A CB  1 
ATOM   1737  C CG  . TYR A 1 243 ? 22.726  22.168  222.701 1.00 44.53  ? 243 TYR A CG  1 
ATOM   1738  C CD1 . TYR A 1 243 ? 21.962  22.673  223.744 1.00 46.69  ? 243 TYR A CD1 1 
ATOM   1739  C CD2 . TYR A 1 243 ? 24.041  21.785  222.966 1.00 49.53  ? 243 TYR A CD2 1 
ATOM   1740  C CE1 . TYR A 1 243 ? 22.501  22.800  225.048 1.00 55.27  ? 243 TYR A CE1 1 
ATOM   1741  C CE2 . TYR A 1 243 ? 24.602  21.901  224.253 1.00 51.04  ? 243 TYR A CE2 1 
ATOM   1742  C CZ  . TYR A 1 243 ? 23.830  22.411  225.301 1.00 54.43  ? 243 TYR A CZ  1 
ATOM   1743  O OH  . TYR A 1 243 ? 24.397  22.561  226.580 1.00 54.73  ? 243 TYR A OH  1 
ATOM   1744  N N   . THR A 1 244 ? 22.991  25.147  221.929 1.00 35.76  ? 244 THR A N   1 
ATOM   1745  C CA  . THR A 1 244 ? 24.008  26.125  222.211 1.00 38.57  ? 244 THR A CA  1 
ATOM   1746  C C   . THR A 1 244 ? 24.123  26.030  223.690 1.00 40.71  ? 244 THR A C   1 
ATOM   1747  O O   . THR A 1 244 ? 23.337  26.626  224.426 1.00 37.93  ? 244 THR A O   1 
ATOM   1748  C CB  . THR A 1 244 ? 23.475  27.482  221.903 1.00 39.83  ? 244 THR A CB  1 
ATOM   1749  O OG1 . THR A 1 244 ? 22.404  27.322  220.971 1.00 44.75  ? 244 THR A OG1 1 
ATOM   1750  C CG2 . THR A 1 244 ? 24.541  28.380  221.314 1.00 39.77  ? 244 THR A CG2 1 
ATOM   1751  N N   . GLY A 1 245 ? 25.027  25.162  224.110 1.00 45.35  ? 245 GLY A N   1 
ATOM   1752  C CA  . GLY A 1 245 ? 25.263  24.929  225.523 1.00 49.86  ? 245 GLY A CA  1 
ATOM   1753  C C   . GLY A 1 245 ? 25.793  26.077  226.322 1.00 51.22  ? 245 GLY A C   1 
ATOM   1754  O O   . GLY A 1 245 ? 26.035  27.147  225.770 1.00 49.82  ? 245 GLY A O   1 
ATOM   1755  N N   . GLY A 1 246 ? 25.927  25.879  227.624 1.00 52.28  ? 246 GLY A N   1 
ATOM   1756  C CA  . GLY A 1 246 ? 26.463  26.964  228.409 1.00 58.89  ? 246 GLY A CA  1 
ATOM   1757  C C   . GLY A 1 246 ? 25.648  27.456  229.574 1.00 61.58  ? 246 GLY A C   1 
ATOM   1758  O O   . GLY A 1 246 ? 24.419  27.315  229.643 1.00 62.96  ? 246 GLY A O   1 
ATOM   1759  N N   . THR A 1 247 ? 26.357  28.165  230.434 1.00 61.85  ? 247 THR A N   1 
ATOM   1760  C CA  . THR A 1 247 ? 25.810  28.682  231.666 1.00 62.64  ? 247 THR A CA  1 
ATOM   1761  C C   . THR A 1 247 ? 25.487  30.159  231.637 1.00 60.68  ? 247 THR A C   1 
ATOM   1762  O O   . THR A 1 247 ? 24.448  30.601  232.114 1.00 59.04  ? 247 THR A O   1 
ATOM   1763  C CB  . THR A 1 247 ? 26.834  28.414  232.750 1.00 64.32  ? 247 THR A CB  1 
ATOM   1764  O OG1 . THR A 1 247 ? 28.136  28.726  232.234 1.00 69.95  ? 247 THR A OG1 1 
ATOM   1765  C CG2 . THR A 1 247 ? 26.826  26.954  233.113 1.00 64.38  ? 247 THR A CG2 1 
ATOM   1766  N N   . THR A 1 248 ? 26.429  30.923  231.125 1.00 62.35  ? 248 THR A N   1 
ATOM   1767  C CA  . THR A 1 248 ? 26.291  32.359  231.040 1.00 68.64  ? 248 THR A CA  1 
ATOM   1768  C C   . THR A 1 248 ? 25.948  32.724  229.604 1.00 69.41  ? 248 THR A C   1 
ATOM   1769  O O   . THR A 1 248 ? 25.466  33.821  229.325 1.00 75.33  ? 248 THR A O   1 
ATOM   1770  C CB  . THR A 1 248 ? 27.615  33.026  231.425 1.00 74.10  ? 248 THR A CB  1 
ATOM   1771  O OG1 . THR A 1 248 ? 28.683  32.425  230.671 1.00 84.50  ? 248 THR A OG1 1 
ATOM   1772  C CG2 . THR A 1 248 ? 27.897  32.827  232.913 1.00 80.10  ? 248 THR A CG2 1 
ATOM   1773  N N   . THR A 1 249 ? 26.326  31.820  228.701 1.00 66.05  ? 249 THR A N   1 
ATOM   1774  C CA  . THR A 1 249 ? 26.095  31.887  227.257 1.00 62.08  ? 249 THR A CA  1 
ATOM   1775  C C   . THR A 1 249 ? 25.028  32.898  226.801 1.00 57.68  ? 249 THR A C   1 
ATOM   1776  O O   . THR A 1 249 ? 23.834  32.697  227.037 1.00 62.71  ? 249 THR A O   1 
ATOM   1777  C CB  . THR A 1 249 ? 25.685  30.500  226.859 1.00 63.83  ? 249 THR A CB  1 
ATOM   1778  O OG1 . THR A 1 249 ? 26.729  29.607  227.269 1.00 68.23  ? 249 THR A OG1 1 
ATOM   1779  C CG2 . THR A 1 249 ? 25.387  30.401  225.383 1.00 68.66  ? 249 THR A CG2 1 
ATOM   1780  N N   . PRO A 1 250 ? 25.434  33.969  226.099 1.00 48.96  ? 250 PRO A N   1 
ATOM   1781  C CA  . PRO A 1 250 ? 24.486  34.985  225.637 1.00 42.01  ? 250 PRO A CA  1 
ATOM   1782  C C   . PRO A 1 250 ? 23.596  34.448  224.599 1.00 38.72  ? 250 PRO A C   1 
ATOM   1783  O O   . PRO A 1 250 ? 23.948  33.555  223.847 1.00 40.08  ? 250 PRO A O   1 
ATOM   1784  C CB  . PRO A 1 250 ? 25.361  36.054  225.020 1.00 39.35  ? 250 PRO A CB  1 
ATOM   1785  C CG  . PRO A 1 250 ? 26.678  35.825  225.649 1.00 50.26  ? 250 PRO A CG  1 
ATOM   1786  C CD  . PRO A 1 250 ? 26.788  34.323  225.680 1.00 49.58  ? 250 PRO A CD  1 
ATOM   1787  N N   . PRO A 1 251 ? 22.395  34.966  224.571 1.00 39.92  ? 251 PRO A N   1 
ATOM   1788  C CA  . PRO A 1 251 ? 21.366  34.579  223.622 1.00 41.67  ? 251 PRO A CA  1 
ATOM   1789  C C   . PRO A 1 251 ? 21.461  35.428  222.367 1.00 41.17  ? 251 PRO A C   1 
ATOM   1790  O O   . PRO A 1 251 ? 21.975  36.557  222.386 1.00 38.58  ? 251 PRO A O   1 
ATOM   1791  C CB  . PRO A 1 251 ? 20.098  34.843  224.408 1.00 46.52  ? 251 PRO A CB  1 
ATOM   1792  C CG  . PRO A 1 251 ? 20.476  36.091  225.199 1.00 47.34  ? 251 PRO A CG  1 
ATOM   1793  C CD  . PRO A 1 251 ? 21.856  35.785  225.669 1.00 43.28  ? 251 PRO A CD  1 
ATOM   1794  N N   . VAL A 1 252 ? 21.004  34.873  221.260 1.00 40.55  ? 252 VAL A N   1 
ATOM   1795  C CA  . VAL A 1 252 ? 21.054  35.617  220.019 1.00 43.94  ? 252 VAL A CA  1 
ATOM   1796  C C   . VAL A 1 252 ? 19.910  35.228  219.161 1.00 46.16  ? 252 VAL A C   1 
ATOM   1797  O O   . VAL A 1 252 ? 19.620  34.033  219.028 1.00 48.64  ? 252 VAL A O   1 
ATOM   1798  C CB  . VAL A 1 252 ? 22.249  35.279  219.210 1.00 44.46  ? 252 VAL A CB  1 
ATOM   1799  C CG1 . VAL A 1 252 ? 22.905  36.553  218.755 1.00 45.53  ? 252 VAL A CG1 1 
ATOM   1800  C CG2 . VAL A 1 252 ? 23.166  34.344  219.980 1.00 47.07  ? 252 VAL A CG2 1 
ATOM   1801  N N   . LEU A 1 253 ? 19.322  36.201  218.487 1.00 45.22  ? 253 LEU A N   1 
ATOM   1802  C CA  . LEU A 1 253 ? 18.203  35.845  217.680 1.00 47.70  ? 253 LEU A CA  1 
ATOM   1803  C C   . LEU A 1 253 ? 18.136  36.564  216.405 1.00 49.44  ? 253 LEU A C   1 
ATOM   1804  O O   . LEU A 1 253 ? 18.744  37.599  216.274 1.00 48.20  ? 253 LEU A O   1 
ATOM   1805  C CB  . LEU A 1 253 ? 16.914  36.064  218.423 1.00 53.22  ? 253 LEU A CB  1 
ATOM   1806  C CG  . LEU A 1 253 ? 16.089  34.838  218.036 1.00 57.76  ? 253 LEU A CG  1 
ATOM   1807  C CD1 . LEU A 1 253 ? 16.310  33.782  219.123 1.00 59.00  ? 253 LEU A CD1 1 
ATOM   1808  C CD2 . LEU A 1 253 ? 14.602  35.168  217.823 1.00 57.88  ? 253 LEU A CD2 1 
ATOM   1809  N N   . GLN A 1 254 ? 17.242  36.094  215.542 1.00 53.99  ? 254 GLN A N   1 
ATOM   1810  C CA  . GLN A 1 254 ? 17.070  36.638  214.213 1.00 58.68  ? 254 GLN A CA  1 
ATOM   1811  C C   . GLN A 1 254 ? 15.768  37.209  213.766 1.00 55.66  ? 254 GLN A C   1 
ATOM   1812  O O   . GLN A 1 254 ? 14.884  36.498  213.272 1.00 56.99  ? 254 GLN A O   1 
ATOM   1813  C CB  . GLN A 1 254 ? 17.499  35.588  213.227 1.00 71.92  ? 254 GLN A CB  1 
ATOM   1814  C CG  . GLN A 1 254 ? 18.947  35.264  213.449 1.00 90.11  ? 254 GLN A CG  1 
ATOM   1815  C CD  . GLN A 1 254 ? 19.769  36.531  213.662 1.00 95.28  ? 254 GLN A CD  1 
ATOM   1816  O OE1 . GLN A 1 254 ? 19.381  37.622  213.218 1.00 97.70  ? 254 GLN A OE1 1 
ATOM   1817  N NE2 . GLN A 1 254 ? 20.884  36.400  214.374 1.00 100.27 ? 254 GLN A NE2 1 
ATOM   1818  N N   . PHE A 1 255 ? 15.711  38.521  213.804 1.00 55.08  ? 255 PHE A N   1 
ATOM   1819  C CA  . PHE A 1 255 ? 14.522  39.183  213.392 1.00 54.52  ? 255 PHE A CA  1 
ATOM   1820  C C   . PHE A 1 255 ? 14.421  39.347  211.896 1.00 52.86  ? 255 PHE A C   1 
ATOM   1821  O O   . PHE A 1 255 ? 15.153  40.163  211.319 1.00 52.29  ? 255 PHE A O   1 
ATOM   1822  C CB  . PHE A 1 255 ? 14.428  40.541  214.052 1.00 60.24  ? 255 PHE A CB  1 
ATOM   1823  C CG  . PHE A 1 255 ? 13.894  40.484  215.412 1.00 70.32  ? 255 PHE A CG  1 
ATOM   1824  C CD1 . PHE A 1 255 ? 12.772  39.696  215.692 1.00 81.57  ? 255 PHE A CD1 1 
ATOM   1825  C CD2 . PHE A 1 255 ? 14.474  41.216  216.429 1.00 75.50  ? 255 PHE A CD2 1 
ATOM   1826  C CE1 . PHE A 1 255 ? 12.206  39.633  217.004 1.00 89.69  ? 255 PHE A CE1 1 
ATOM   1827  C CE2 . PHE A 1 255 ? 13.935  41.173  217.741 1.00 87.22  ? 255 PHE A CE2 1 
ATOM   1828  C CZ  . PHE A 1 255 ? 12.789  40.375  218.032 1.00 90.96  ? 255 PHE A CZ  1 
ATOM   1829  N N   . THR A 1 256 ? 13.687  38.440  211.250 1.00 46.64  ? 256 THR A N   1 
ATOM   1830  C CA  . THR A 1 256 ? 13.385  38.629  209.838 1.00 42.85  ? 256 THR A CA  1 
ATOM   1831  C C   . THR A 1 256 ? 12.219  38.095  209.066 1.00 44.49  ? 256 THR A C   1 
ATOM   1832  O O   . THR A 1 256 ? 11.998  36.898  208.795 1.00 44.93  ? 256 THR A O   1 
ATOM   1833  C CB  . THR A 1 256 ? 14.517  38.888  208.860 1.00 38.28  ? 256 THR A CB  1 
ATOM   1834  O OG1 . THR A 1 256 ? 14.158  40.058  208.110 1.00 28.12  ? 256 THR A OG1 1 
ATOM   1835  C CG2 . THR A 1 256 ? 14.601  37.770  207.840 1.00 42.03  ? 256 THR A CG2 1 
ATOM   1836  N N   . ASN A 1 257 ? 11.788  39.166  208.427 1.00 44.70  ? 257 ASN A N   1 
ATOM   1837  C CA  . ASN A 1 257 ? 10.694  39.379  207.552 1.00 45.61  ? 257 ASN A CA  1 
ATOM   1838  C C   . ASN A 1 257 ? 10.977  38.799  206.181 1.00 43.57  ? 257 ASN A C   1 
ATOM   1839  O O   . ASN A 1 257 ? 10.139  38.151  205.567 1.00 43.54  ? 257 ASN A O   1 
ATOM   1840  C CB  . ASN A 1 257 ? 10.672  40.897  207.495 1.00 50.30  ? 257 ASN A CB  1 
ATOM   1841  C CG  . ASN A 1 257 ? 9.725   41.436  206.513 1.00 61.90  ? 257 ASN A CG  1 
ATOM   1842  O OD1 . ASN A 1 257 ? 8.658   40.880  206.285 1.00 68.98  ? 257 ASN A OD1 1 
ATOM   1843  N ND2 . ASN A 1 257 ? 10.095  42.558  205.915 1.00 64.94  ? 257 ASN A ND2 1 
ATOM   1844  N N   . THR A 1 258 ? 12.206  38.992  205.746 1.00 41.60  ? 258 THR A N   1 
ATOM   1845  C CA  . THR A 1 258 ? 12.666  38.589  204.429 1.00 46.60  ? 258 THR A CA  1 
ATOM   1846  C C   . THR A 1 258 ? 12.778  37.147  203.957 1.00 52.80  ? 258 THR A C   1 
ATOM   1847  O O   . THR A 1 258 ? 12.363  36.836  202.810 1.00 55.36  ? 258 THR A O   1 
ATOM   1848  C CB  . THR A 1 258 ? 14.012  39.183  204.186 1.00 46.05  ? 258 THR A CB  1 
ATOM   1849  O OG1 . THR A 1 258 ? 14.385  39.937  205.349 1.00 45.65  ? 258 THR A OG1 1 
ATOM   1850  C CG2 . THR A 1 258 ? 13.984  40.056  202.928 1.00 50.07  ? 258 THR A CG2 1 
ATOM   1851  N N   . LEU A 1 259 ? 13.334  36.264  204.791 1.00 56.07  ? 259 LEU A N   1 
ATOM   1852  C CA  . LEU A 1 259 ? 13.534  34.915  204.307 1.00 57.85  ? 259 LEU A CA  1 
ATOM   1853  C C   . LEU A 1 259 ? 12.642  33.710  204.499 1.00 57.11  ? 259 LEU A C   1 
ATOM   1854  O O   . LEU A 1 259 ? 12.232  33.354  205.607 1.00 60.48  ? 259 LEU A O   1 
ATOM   1855  C CB  . LEU A 1 259 ? 14.994  34.536  204.403 1.00 63.02  ? 259 LEU A CB  1 
ATOM   1856  C CG  . LEU A 1 259 ? 15.560  34.436  202.933 1.00 76.16  ? 259 LEU A CG  1 
ATOM   1857  C CD1 . LEU A 1 259 ? 15.333  33.023  202.212 1.00 80.88  ? 259 LEU A CD1 1 
ATOM   1858  C CD2 . LEU A 1 259 ? 15.108  35.629  201.968 1.00 76.08  ? 259 LEU A CD2 1 
ATOM   1859  N N   . THR A 1 260 ? 12.425  33.060  203.358 1.00 52.89  ? 260 THR A N   1 
ATOM   1860  C CA  . THR A 1 260 ? 11.601  31.873  203.209 1.00 57.09  ? 260 THR A CA  1 
ATOM   1861  C C   . THR A 1 260 ? 12.435  30.637  203.103 1.00 51.50  ? 260 THR A C   1 
ATOM   1862  O O   . THR A 1 260 ? 13.501  30.677  202.489 1.00 56.16  ? 260 THR A O   1 
ATOM   1863  C CB  . THR A 1 260 ? 10.865  31.927  201.907 1.00 64.98  ? 260 THR A CB  1 
ATOM   1864  O OG1 . THR A 1 260 ? 10.488  33.289  201.672 1.00 78.61  ? 260 THR A OG1 1 
ATOM   1865  C CG2 . THR A 1 260 ? 9.621   30.982  201.924 1.00 72.65  ? 260 THR A CG2 1 
ATOM   1866  N N   . THR A 1 261 ? 11.887  29.519  203.579 1.00 44.67  ? 261 THR A N   1 
ATOM   1867  C CA  . THR A 1 261 ? 12.597  28.254  203.541 1.00 35.24  ? 261 THR A CA  1 
ATOM   1868  C C   . THR A 1 261 ? 11.874  27.187  202.838 1.00 34.62  ? 261 THR A C   1 
ATOM   1869  O O   . THR A 1 261 ? 10.680  26.951  203.064 1.00 29.88  ? 261 THR A O   1 
ATOM   1870  C CB  . THR A 1 261 ? 12.852  27.709  204.868 1.00 31.93  ? 261 THR A CB  1 
ATOM   1871  O OG1 . THR A 1 261 ? 13.386  28.746  205.686 1.00 31.90  ? 261 THR A OG1 1 
ATOM   1872  C CG2 . THR A 1 261 ? 13.828  26.574  204.736 1.00 27.73  ? 261 THR A CG2 1 
ATOM   1873  N N   . VAL A 1 262 ? 12.676  26.383  202.177 1.00 32.01  ? 262 VAL A N   1 
ATOM   1874  C CA  . VAL A 1 262 ? 12.085  25.357  201.400 1.00 34.97  ? 262 VAL A CA  1 
ATOM   1875  C C   . VAL A 1 262 ? 11.978  23.984  201.940 1.00 39.36  ? 262 VAL A C   1 
ATOM   1876  O O   . VAL A 1 262 ? 12.952  23.241  202.040 1.00 43.29  ? 262 VAL A O   1 
ATOM   1877  C CB  . VAL A 1 262 ? 12.706  25.288  200.112 1.00 32.40  ? 262 VAL A CB  1 
ATOM   1878  C CG1 . VAL A 1 262 ? 11.748  24.615  199.181 1.00 31.71  ? 262 VAL A CG1 1 
ATOM   1879  C CG2 . VAL A 1 262 ? 13.040  26.679  199.683 1.00 32.52  ? 262 VAL A CG2 1 
ATOM   1880  N N   . LEU A 1 263 ? 10.731  23.604  202.113 1.00 39.98  ? 263 LEU A N   1 
ATOM   1881  C CA  . LEU A 1 263 ? 10.426  22.307  202.637 1.00 43.02  ? 263 LEU A CA  1 
ATOM   1882  C C   . LEU A 1 263 ? 10.518  21.346  201.497 1.00 47.32  ? 263 LEU A C   1 
ATOM   1883  O O   . LEU A 1 263 ? 10.350  20.148  201.707 1.00 53.40  ? 263 LEU A O   1 
ATOM   1884  C CB  . LEU A 1 263 ? 9.016   22.281  203.181 1.00 40.70  ? 263 LEU A CB  1 
ATOM   1885  C CG  . LEU A 1 263 ? 8.662   23.669  203.659 1.00 44.58  ? 263 LEU A CG  1 
ATOM   1886  C CD1 . LEU A 1 263 ? 7.221   23.693  204.101 1.00 48.84  ? 263 LEU A CD1 1 
ATOM   1887  C CD2 . LEU A 1 263 ? 9.640   24.083  204.734 1.00 42.07  ? 263 LEU A CD2 1 
ATOM   1888  N N   . LEU A 1 264 ? 10.727  21.835  200.278 1.00 48.18  ? 264 LEU A N   1 
ATOM   1889  C CA  . LEU A 1 264 ? 10.810  20.891  199.184 1.00 50.22  ? 264 LEU A CA  1 
ATOM   1890  C C   . LEU A 1 264 ? 11.924  19.936  199.366 1.00 54.54  ? 264 LEU A C   1 
ATOM   1891  O O   . LEU A 1 264 ? 12.992  20.276  199.880 1.00 56.00  ? 264 LEU A O   1 
ATOM   1892  C CB  . LEU A 1 264 ? 10.871  21.534  197.834 1.00 48.92  ? 264 LEU A CB  1 
ATOM   1893  C CG  . LEU A 1 264 ? 9.580   21.016  197.226 1.00 51.82  ? 264 LEU A CG  1 
ATOM   1894  C CD1 . LEU A 1 264 ? 8.402   21.493  198.077 1.00 52.53  ? 264 LEU A CD1 1 
ATOM   1895  C CD2 . LEU A 1 264 ? 9.427   21.496  195.807 1.00 56.02  ? 264 LEU A CD2 1 
ATOM   1896  N N   . ASP A 1 265 ? 11.653  18.705  199.000 1.00 60.51  ? 265 ASP A N   1 
ATOM   1897  C CA  . ASP A 1 265 ? 12.661  17.721  199.225 1.00 71.87  ? 265 ASP A CA  1 
ATOM   1898  C C   . ASP A 1 265 ? 13.616  17.615  198.074 1.00 75.00  ? 265 ASP A C   1 
ATOM   1899  O O   . ASP A 1 265 ? 13.617  18.456  197.182 1.00 76.34  ? 265 ASP A O   1 
ATOM   1900  C CB  . ASP A 1 265 ? 12.024  16.372  199.572 1.00 77.26  ? 265 ASP A CB  1 
ATOM   1901  C CG  . ASP A 1 265 ? 11.499  15.650  198.372 1.00 79.00  ? 265 ASP A CG  1 
ATOM   1902  O OD1 . ASP A 1 265 ? 11.200  16.343  197.375 1.00 73.89  ? 265 ASP A OD1 1 
ATOM   1903  O OD2 . ASP A 1 265 ? 11.408  14.394  198.434 1.00 81.68  ? 265 ASP A OD2 1 
ATOM   1904  N N   . GLU A 1 266 ? 14.413  16.556  198.116 1.00 79.41  ? 266 GLU A N   1 
ATOM   1905  C CA  . GLU A 1 266 ? 15.400  16.252  197.106 1.00 85.16  ? 266 GLU A CA  1 
ATOM   1906  C C   . GLU A 1 266 ? 14.705  16.009  195.767 1.00 83.88  ? 266 GLU A C   1 
ATOM   1907  O O   . GLU A 1 266 ? 15.327  16.104  194.729 1.00 83.90  ? 266 GLU A O   1 
ATOM   1908  C CB  . GLU A 1 266 ? 16.167  14.976  197.499 1.00 96.08  ? 266 GLU A CB  1 
ATOM   1909  C CG  . GLU A 1 266 ? 16.749  14.933  198.939 1.00 116.92 ? 266 GLU A CG  1 
ATOM   1910  C CD  . GLU A 1 266 ? 17.222  13.513  199.397 1.00 130.23 ? 266 GLU A CD  1 
ATOM   1911  O OE1 . GLU A 1 266 ? 17.431  12.598  198.551 1.00 139.12 ? 266 GLU A OE1 1 
ATOM   1912  O OE2 . GLU A 1 266 ? 17.375  13.312  200.635 1.00 136.89 ? 266 GLU A OE2 1 
ATOM   1913  N N   . ASN A 1 267 ? 13.411  15.719  195.782 1.00 83.00  ? 267 ASN A N   1 
ATOM   1914  C CA  . ASN A 1 267 ? 12.697  15.429  194.537 1.00 83.16  ? 267 ASN A CA  1 
ATOM   1915  C C   . ASN A 1 267 ? 11.551  16.392  194.222 1.00 79.89  ? 267 ASN A C   1 
ATOM   1916  O O   . ASN A 1 267 ? 10.698  16.138  193.344 1.00 78.05  ? 267 ASN A O   1 
ATOM   1917  C CB  . ASN A 1 267 ? 12.208  13.984  194.567 1.00 90.99  ? 267 ASN A CB  1 
ATOM   1918  C CG  . ASN A 1 267 ? 13.325  12.993  194.905 1.00 94.92  ? 267 ASN A CG  1 
ATOM   1919  O OD1 . ASN A 1 267 ? 14.292  12.850  194.141 1.00 96.54  ? 267 ASN A OD1 1 
ATOM   1920  N ND2 . ASN A 1 267 ? 13.194  12.299  196.056 1.00 98.80  ? 267 ASN A ND2 1 
ATOM   1921  N N   . GLY A 1 268 ? 11.552  17.505  194.952 1.00 77.46  ? 268 GLY A N   1 
ATOM   1922  C CA  . GLY A 1 268 ? 10.564  18.547  194.754 1.00 71.11  ? 268 GLY A CA  1 
ATOM   1923  C C   . GLY A 1 268 ? 9.262   18.033  195.240 1.00 62.27  ? 268 GLY A C   1 
ATOM   1924  O O   . GLY A 1 268 ? 8.224   18.172  194.608 1.00 64.63  ? 268 GLY A O   1 
ATOM   1925  N N   . VAL A 1 269 ? 9.307   17.581  196.460 1.00 52.81  ? 269 VAL A N   1 
ATOM   1926  C CA  . VAL A 1 269 ? 8.151   16.983  196.998 1.00 52.26  ? 269 VAL A CA  1 
ATOM   1927  C C   . VAL A 1 269 ? 7.743   17.619  198.271 1.00 48.53  ? 269 VAL A C   1 
ATOM   1928  O O   . VAL A 1 269 ? 6.557   17.773  198.534 1.00 50.91  ? 269 VAL A O   1 
ATOM   1929  C CB  . VAL A 1 269 ? 8.443   15.531  197.204 1.00 57.88  ? 269 VAL A CB  1 
ATOM   1930  C CG1 . VAL A 1 269 ? 7.353   14.845  198.027 1.00 65.46  ? 269 VAL A CG1 1 
ATOM   1931  C CG2 . VAL A 1 269 ? 8.671   14.887  195.849 1.00 62.07  ? 269 VAL A CG2 1 
ATOM   1932  N N   . GLY A 1 270 ? 8.713   17.966  199.098 1.00 43.90  ? 270 GLY A N   1 
ATOM   1933  C CA  . GLY A 1 270 ? 8.324   18.570  200.350 1.00 40.39  ? 270 GLY A CA  1 
ATOM   1934  C C   . GLY A 1 270 ? 7.371   17.649  201.091 1.00 38.23  ? 270 GLY A C   1 
ATOM   1935  O O   . GLY A 1 270 ? 7.253   16.445  200.783 1.00 37.65  ? 270 GLY A O   1 
ATOM   1936  N N   . PRO A 1 271 ? 6.686   18.172  202.099 1.00 35.08  ? 271 PRO A N   1 
ATOM   1937  C CA  . PRO A 1 271 ? 5.806   17.225  202.764 1.00 31.81  ? 271 PRO A CA  1 
ATOM   1938  C C   . PRO A 1 271 ? 4.489   17.120  202.075 1.00 33.21  ? 271 PRO A C   1 
ATOM   1939  O O   . PRO A 1 271 ? 4.121   17.966  201.255 1.00 32.32  ? 271 PRO A O   1 
ATOM   1940  C CB  . PRO A 1 271 ? 5.659   17.813  204.167 1.00 27.10  ? 271 PRO A CB  1 
ATOM   1941  C CG  . PRO A 1 271 ? 6.879   18.660  204.319 1.00 32.16  ? 271 PRO A CG  1 
ATOM   1942  C CD  . PRO A 1 271 ? 6.960   19.317  202.967 1.00 32.57  ? 271 PRO A CD  1 
ATOM   1943  N N   . LEU A 1 272 ? 3.773   16.075  202.460 1.00 36.01  ? 272 LEU A N   1 
ATOM   1944  C CA  . LEU A 1 272 ? 2.456   15.793  201.941 1.00 40.63  ? 272 LEU A CA  1 
ATOM   1945  C C   . LEU A 1 272 ? 1.580   15.536  203.130 1.00 42.76  ? 272 LEU A C   1 
ATOM   1946  O O   . LEU A 1 272 ? 1.828   14.611  203.883 1.00 39.58  ? 272 LEU A O   1 
ATOM   1947  C CB  . LEU A 1 272 ? 2.524   14.548  201.101 1.00 41.15  ? 272 LEU A CB  1 
ATOM   1948  C CG  . LEU A 1 272 ? 3.699   14.768  200.175 1.00 43.68  ? 272 LEU A CG  1 
ATOM   1949  C CD1 . LEU A 1 272 ? 4.257   13.457  199.772 1.00 54.21  ? 272 LEU A CD1 1 
ATOM   1950  C CD2 . LEU A 1 272 ? 3.257   15.585  198.999 1.00 44.54  ? 272 LEU A CD2 1 
ATOM   1951  N N   . CYS A 1 273 ? 0.586   16.380  203.329 1.00 47.87  ? 273 CYS A N   1 
ATOM   1952  C CA  . CYS A 1 273 ? -0.305  16.196  204.445 1.00 55.68  ? 273 CYS A CA  1 
ATOM   1953  C C   . CYS A 1 273 ? -1.134  14.968  204.203 1.00 62.06  ? 273 CYS A C   1 
ATOM   1954  O O   . CYS A 1 273 ? -2.231  15.044  203.648 1.00 62.90  ? 273 CYS A O   1 
ATOM   1955  C CB  . CYS A 1 273 ? -1.202  17.397  204.585 1.00 56.64  ? 273 CYS A CB  1 
ATOM   1956  S SG  . CYS A 1 273 ? -0.260  18.906  204.734 1.00 63.29  ? 273 CYS A SG  1 
ATOM   1957  N N   . LYS A 1 274 ? -0.527  13.820  204.476 1.00 70.58  ? 274 LYS A N   1 
ATOM   1958  C CA  . LYS A 1 274 ? -1.204  12.530  204.341 1.00 76.53  ? 274 LYS A CA  1 
ATOM   1959  C C   . LYS A 1 274 ? -2.145  12.653  205.517 1.00 77.18  ? 274 LYS A C   1 
ATOM   1960  O O   . LYS A 1 274 ? -1.702  12.820  206.669 1.00 74.37  ? 274 LYS A O   1 
ATOM   1961  C CB  . LYS A 1 274 ? -0.219  11.367  204.534 1.00 79.52  ? 274 LYS A CB  1 
ATOM   1962  C CG  . LYS A 1 274 ? 0.702   11.507  205.757 1.00 84.86  ? 274 LYS A CG  1 
ATOM   1963  C CD  . LYS A 1 274 ? 1.806   10.495  205.725 1.00 86.40  ? 274 LYS A CD  1 
ATOM   1964  C CE  . LYS A 1 274 ? 2.412   10.406  204.330 1.00 86.59  ? 274 LYS A CE  1 
ATOM   1965  N NZ  . LYS A 1 274 ? 3.690   9.662   204.375 1.00 88.15  ? 274 LYS A NZ  1 
ATOM   1966  N N   . GLY A 1 275 ? -3.441  12.624  205.230 1.00 77.63  ? 275 GLY A N   1 
ATOM   1967  C CA  . GLY A 1 275 ? -4.391  12.868  206.293 1.00 78.70  ? 275 GLY A CA  1 
ATOM   1968  C C   . GLY A 1 275 ? -4.164  14.358  206.234 1.00 78.16  ? 275 GLY A C   1 
ATOM   1969  O O   . GLY A 1 275 ? -3.084  14.841  206.598 1.00 79.36  ? 275 GLY A O   1 
ATOM   1970  N N   . GLU A 1 276 ? -5.132  15.051  205.652 1.00 77.58  ? 276 GLU A N   1 
ATOM   1971  C CA  . GLU A 1 276 ? -5.073  16.489  205.394 1.00 76.69  ? 276 GLU A CA  1 
ATOM   1972  C C   . GLU A 1 276 ? -4.471  17.436  206.426 1.00 72.69  ? 276 GLU A C   1 
ATOM   1973  O O   . GLU A 1 276 ? -4.691  18.663  206.379 1.00 70.70  ? 276 GLU A O   1 
ATOM   1974  C CB  . GLU A 1 276 ? -6.436  16.991  204.907 1.00 80.54  ? 276 GLU A CB  1 
ATOM   1975  C CG  . GLU A 1 276 ? -7.213  15.979  204.025 1.00 92.40  ? 276 GLU A CG  1 
ATOM   1976  C CD  . GLU A 1 276 ? -6.368  15.241  202.937 1.00 100.66 ? 276 GLU A CD  1 
ATOM   1977  O OE1 . GLU A 1 276 ? -5.205  15.632  202.624 1.00 105.12 ? 276 GLU A OE1 1 
ATOM   1978  O OE2 . GLU A 1 276 ? -6.895  14.238  202.388 1.00 103.82 ? 276 GLU A OE2 1 
ATOM   1979  N N   . GLY A 1 277 ? -3.752  16.856  207.384 1.00 68.04  ? 277 GLY A N   1 
ATOM   1980  C CA  . GLY A 1 277 ? -3.096  17.616  208.414 1.00 60.94  ? 277 GLY A CA  1 
ATOM   1981  C C   . GLY A 1 277 ? -1.702  18.093  208.103 1.00 55.63  ? 277 GLY A C   1 
ATOM   1982  O O   . GLY A 1 277 ? -0.865  17.404  207.517 1.00 56.86  ? 277 GLY A O   1 
ATOM   1983  N N   . LEU A 1 278 ? -1.468  19.299  208.572 1.00 48.47  ? 278 LEU A N   1 
ATOM   1984  C CA  . LEU A 1 278 ? -0.215  19.945  208.424 1.00 44.60  ? 278 LEU A CA  1 
ATOM   1985  C C   . LEU A 1 278 ? 0.299   19.961  209.860 1.00 45.72  ? 278 LEU A C   1 
ATOM   1986  O O   . LEU A 1 278 ? -0.411  20.411  210.762 1.00 48.75  ? 278 LEU A O   1 
ATOM   1987  C CB  . LEU A 1 278 ? -0.501  21.335  207.942 1.00 44.75  ? 278 LEU A CB  1 
ATOM   1988  C CG  . LEU A 1 278 ? 0.678   21.949  207.237 1.00 47.05  ? 278 LEU A CG  1 
ATOM   1989  C CD1 . LEU A 1 278 ? 0.603   23.467  207.381 1.00 53.94  ? 278 LEU A CD1 1 
ATOM   1990  C CD2 . LEU A 1 278 ? 1.956   21.417  207.871 1.00 48.50  ? 278 LEU A CD2 1 
ATOM   1991  N N   . TYR A 1 279 ? 1.531   19.506  210.068 1.00 45.61  ? 279 TYR A N   1 
ATOM   1992  C CA  . TYR A 1 279 ? 2.104   19.416  211.415 1.00 44.38  ? 279 TYR A CA  1 
ATOM   1993  C C   . TYR A 1 279 ? 3.334   20.261  211.716 1.00 38.62  ? 279 TYR A C   1 
ATOM   1994  O O   . TYR A 1 279 ? 4.504   19.893  211.452 1.00 34.30  ? 279 TYR A O   1 
ATOM   1995  C CB  . TYR A 1 279 ? 2.436   17.955  211.767 1.00 56.05  ? 279 TYR A CB  1 
ATOM   1996  C CG  . TYR A 1 279 ? 1.289   16.951  211.700 1.00 58.77  ? 279 TYR A CG  1 
ATOM   1997  C CD1 . TYR A 1 279 ? 0.919   16.366  210.484 1.00 61.04  ? 279 TYR A CD1 1 
ATOM   1998  C CD2 . TYR A 1 279 ? 0.620   16.539  212.862 1.00 61.92  ? 279 TYR A CD2 1 
ATOM   1999  C CE1 . TYR A 1 279 ? -0.090  15.386  210.417 1.00 67.95  ? 279 TYR A CE1 1 
ATOM   2000  C CE2 . TYR A 1 279 ? -0.392  15.557  212.816 1.00 67.54  ? 279 TYR A CE2 1 
ATOM   2001  C CZ  . TYR A 1 279 ? -0.746  14.980  211.584 1.00 71.39  ? 279 TYR A CZ  1 
ATOM   2002  O OH  . TYR A 1 279 ? -1.757  14.021  211.510 1.00 75.14  ? 279 TYR A OH  1 
ATOM   2003  N N   . LEU A 1 280 ? 3.064   21.349  212.400 1.00 32.37  ? 280 LEU A N   1 
ATOM   2004  C CA  . LEU A 1 280 ? 4.131   22.247  212.778 1.00 35.79  ? 280 LEU A CA  1 
ATOM   2005  C C   . LEU A 1 280 ? 4.552   21.878  214.195 1.00 34.53  ? 280 LEU A C   1 
ATOM   2006  O O   . LEU A 1 280 ? 3.719   21.489  215.016 1.00 37.33  ? 280 LEU A O   1 
ATOM   2007  C CB  . LEU A 1 280 ? 3.660   23.692  212.690 1.00 36.78  ? 280 LEU A CB  1 
ATOM   2008  C CG  . LEU A 1 280 ? 2.666   23.995  211.555 1.00 38.46  ? 280 LEU A CG  1 
ATOM   2009  C CD1 . LEU A 1 280 ? 2.658   25.482  211.385 1.00 37.80  ? 280 LEU A CD1 1 
ATOM   2010  C CD2 . LEU A 1 280 ? 3.008   23.335  210.233 1.00 37.23  ? 280 LEU A CD2 1 
ATOM   2011  N N   . SER A 1 281 ? 5.832   22.047  214.495 1.00 33.44  ? 281 SER A N   1 
ATOM   2012  C CA  . SER A 1 281 ? 6.363   21.652  215.787 1.00 28.94  ? 281 SER A CA  1 
ATOM   2013  C C   . SER A 1 281 ? 7.657   22.421  215.999 1.00 27.53  ? 281 SER A C   1 
ATOM   2014  O O   . SER A 1 281 ? 8.374   22.695  215.030 1.00 26.99  ? 281 SER A O   1 
ATOM   2015  C CB  . SER A 1 281 ? 6.613   20.147  215.704 1.00 28.52  ? 281 SER A CB  1 
ATOM   2016  O OG  . SER A 1 281 ? 6.478   19.680  214.342 1.00 32.85  ? 281 SER A OG  1 
ATOM   2017  N N   . CYS A 1 282 ? 7.963   22.778  217.240 1.00 25.57  ? 282 CYS A N   1 
ATOM   2018  C CA  . CYS A 1 282 ? 9.176   23.547  217.500 1.00 30.35  ? 282 CYS A CA  1 
ATOM   2019  C C   . CYS A 1 282 ? 9.503   23.691  218.975 1.00 28.12  ? 282 CYS A C   1 
ATOM   2020  O O   . CYS A 1 282 ? 8.718   23.271  219.801 1.00 30.28  ? 282 CYS A O   1 
ATOM   2021  C CB  . CYS A 1 282 ? 8.977   24.939  216.964 1.00 38.88  ? 282 CYS A CB  1 
ATOM   2022  S SG  . CYS A 1 282 ? 7.876   25.852  218.020 1.00 52.98  ? 282 CYS A SG  1 
ATOM   2023  N N   . VAL A 1 283 ? 10.586  24.397  219.306 1.00 29.34  ? 283 VAL A N   1 
ATOM   2024  C CA  . VAL A 1 283 ? 11.002  24.581  220.711 1.00 32.07  ? 283 VAL A CA  1 
ATOM   2025  C C   . VAL A 1 283 ? 11.981  25.684  220.882 1.00 29.67  ? 283 VAL A C   1 
ATOM   2026  O O   . VAL A 1 283 ? 13.150  25.518  220.520 1.00 24.27  ? 283 VAL A O   1 
ATOM   2027  C CB  . VAL A 1 283 ? 11.764  23.417  221.189 1.00 36.99  ? 283 VAL A CB  1 
ATOM   2028  C CG1 . VAL A 1 283 ? 10.806  22.421  221.743 1.00 45.92  ? 283 VAL A CG1 1 
ATOM   2029  C CG2 . VAL A 1 283 ? 12.601  22.846  220.027 1.00 36.33  ? 283 VAL A CG2 1 
ATOM   2030  N N   . ASP A 1 284 ? 11.607  26.711  221.628 1.00 31.36  ? 284 ASP A N   1 
ATOM   2031  C CA  . ASP A 1 284 ? 12.532  27.825  221.692 1.00 34.52  ? 284 ASP A CA  1 
ATOM   2032  C C   . ASP A 1 284 ? 13.052  28.385  222.986 1.00 33.36  ? 284 ASP A C   1 
ATOM   2033  O O   . ASP A 1 284 ? 12.800  29.529  223.377 1.00 30.02  ? 284 ASP A O   1 
ATOM   2034  C CB  . ASP A 1 284 ? 12.015  28.880  220.753 1.00 40.71  ? 284 ASP A CB  1 
ATOM   2035  C CG  . ASP A 1 284 ? 11.818  28.318  219.352 1.00 47.77  ? 284 ASP A CG  1 
ATOM   2036  O OD1 . ASP A 1 284 ? 12.852  28.184  218.626 1.00 39.43  ? 284 ASP A OD1 1 
ATOM   2037  O OD2 . ASP A 1 284 ? 10.655  27.929  219.028 1.00 49.83  ? 284 ASP A OD2 1 
ATOM   2038  N N   . ILE A 1 285 ? 13.962  27.605  223.530 1.00 35.47  ? 285 ILE A N   1 
ATOM   2039  C CA  . ILE A 1 285 ? 14.581  27.896  224.792 1.00 37.04  ? 285 ILE A CA  1 
ATOM   2040  C C   . ILE A 1 285 ? 15.544  29.010  224.640 1.00 35.52  ? 285 ILE A C   1 
ATOM   2041  O O   . ILE A 1 285 ? 16.421  28.969  223.794 1.00 33.84  ? 285 ILE A O   1 
ATOM   2042  C CB  . ILE A 1 285 ? 15.349  26.708  225.279 1.00 40.87  ? 285 ILE A CB  1 
ATOM   2043  C CG1 . ILE A 1 285 ? 14.391  25.533  225.574 1.00 42.26  ? 285 ILE A CG1 1 
ATOM   2044  C CG2 . ILE A 1 285 ? 16.207  27.135  226.450 1.00 39.88  ? 285 ILE A CG2 1 
ATOM   2045  C CD1 . ILE A 1 285 ? 13.721  24.851  224.324 1.00 41.65  ? 285 ILE A CD1 1 
ATOM   2046  N N   . MET A 1 286 ? 15.498  29.924  225.570 1.00 36.27  ? 286 MET A N   1 
ATOM   2047  C CA  . MET A 1 286 ? 16.373  31.035  225.444 1.00 45.15  ? 286 MET A CA  1 
ATOM   2048  C C   . MET A 1 286 ? 17.424  31.092  226.487 1.00 52.07  ? 286 MET A C   1 
ATOM   2049  O O   . MET A 1 286 ? 18.446  31.746  226.294 1.00 56.74  ? 286 MET A O   1 
ATOM   2050  C CB  . MET A 1 286 ? 15.548  32.290  225.460 1.00 47.02  ? 286 MET A CB  1 
ATOM   2051  C CG  . MET A 1 286 ? 14.613  32.328  224.296 1.00 47.63  ? 286 MET A CG  1 
ATOM   2052  S SD  . MET A 1 286 ? 15.337  33.322  223.017 1.00 48.41  ? 286 MET A SD  1 
ATOM   2053  C CE  . MET A 1 286 ? 17.033  32.608  222.783 1.00 49.94  ? 286 MET A CE  1 
ATOM   2054  N N   . GLY A 1 287 ? 17.167  30.420  227.601 1.00 59.15  ? 287 GLY A N   1 
ATOM   2055  C CA  . GLY A 1 287 ? 18.116  30.429  228.702 1.00 62.44  ? 287 GLY A CA  1 
ATOM   2056  C C   . GLY A 1 287 ? 17.452  30.694  230.048 1.00 65.12  ? 287 GLY A C   1 
ATOM   2057  O O   . GLY A 1 287 ? 16.260  30.994  230.128 1.00 65.55  ? 287 GLY A O   1 
ATOM   2058  N N   . TRP A 1 288 ? 18.225  30.624  231.115 1.00 65.06  ? 288 TRP A N   1 
ATOM   2059  C CA  . TRP A 1 288 ? 17.669  30.827  232.426 1.00 67.44  ? 288 TRP A CA  1 
ATOM   2060  C C   . TRP A 1 288 ? 17.565  32.257  232.885 1.00 73.61  ? 288 TRP A C   1 
ATOM   2061  O O   . TRP A 1 288 ? 18.494  33.070  232.753 1.00 73.30  ? 288 TRP A O   1 
ATOM   2062  C CB  . TRP A 1 288 ? 18.456  30.068  233.491 1.00 64.44  ? 288 TRP A CB  1 
ATOM   2063  C CG  . TRP A 1 288 ? 19.424  29.114  232.971 1.00 61.97  ? 288 TRP A CG  1 
ATOM   2064  C CD1 . TRP A 1 288 ? 20.768  29.310  232.796 1.00 62.49  ? 288 TRP A CD1 1 
ATOM   2065  C CD2 . TRP A 1 288 ? 19.124  27.857  232.409 1.00 63.32  ? 288 TRP A CD2 1 
ATOM   2066  N NE1 . TRP A 1 288 ? 21.315  28.247  232.122 1.00 63.12  ? 288 TRP A NE1 1 
ATOM   2067  C CE2 . TRP A 1 288 ? 20.317  27.343  231.867 1.00 66.67  ? 288 TRP A CE2 1 
ATOM   2068  C CE3 . TRP A 1 288 ? 17.954  27.111  232.291 1.00 64.30  ? 288 TRP A CE3 1 
ATOM   2069  C CZ2 . TRP A 1 288 ? 20.362  26.122  231.209 1.00 74.48  ? 288 TRP A CZ2 1 
ATOM   2070  C CZ3 . TRP A 1 288 ? 17.999  25.895  231.638 1.00 63.67  ? 288 TRP A CZ3 1 
ATOM   2071  C CH2 . TRP A 1 288 ? 19.183  25.412  231.102 1.00 72.78  ? 288 TRP A CH2 1 
ATOM   2072  N N   . ARG A 1 289 ? 16.391  32.560  233.421 1.00 79.57  ? 289 ARG A N   1 
ATOM   2073  C CA  . ARG A 1 289 ? 16.122  33.818  234.058 1.00 85.07  ? 289 ARG A CA  1 
ATOM   2074  C C   . ARG A 1 289 ? 16.448  33.351  235.475 1.00 86.40  ? 289 ARG A C   1 
ATOM   2075  O O   . ARG A 1 289 ? 15.881  32.296  235.895 1.00 86.31  ? 289 ARG A O   1 
ATOM   2076  C CB  . ARG A 1 289 ? 14.628  34.174  233.963 1.00 90.94  ? 289 ARG A CB  1 
ATOM   2077  C CG  . ARG A 1 289 ? 14.237  35.155  235.048 1.00 93.05  ? 289 ARG A CG  1 
ATOM   2078  C CD  . ARG A 1 289 ? 12.753  35.281  235.280 1.00 97.96  ? 289 ARG A CD  1 
ATOM   2079  N NE  . ARG A 1 289 ? 12.498  35.617  236.683 1.00 101.92 ? 289 ARG A NE  1 
ATOM   2080  C CZ  . ARG A 1 289 ? 11.287  35.790  237.216 1.00 108.27 ? 289 ARG A CZ  1 
ATOM   2081  N NH1 . ARG A 1 289 ? 10.195  35.670  236.456 1.00 109.60 ? 289 ARG A NH1 1 
ATOM   2082  N NH2 . ARG A 1 289 ? 11.166  36.036  238.525 1.00 110.01 ? 289 ARG A NH2 1 
ATOM   2083  N N   . VAL A 1 290 ? 17.361  34.062  236.151 1.00 89.19  ? 290 VAL A N   1 
ATOM   2084  C CA  . VAL A 1 290 ? 17.716  33.743  237.514 1.00 95.49  ? 290 VAL A CA  1 
ATOM   2085  C C   . VAL A 1 290 ? 17.200  34.650  238.556 1.00 100.85 ? 290 VAL A C   1 
ATOM   2086  O O   . VAL A 1 290 ? 17.630  35.741  238.619 1.00 100.93 ? 290 VAL A O   1 
ATOM   2087  C CB  . VAL A 1 290 ? 19.190  33.629  237.705 1.00 94.93  ? 290 VAL A CB  1 
ATOM   2088  C CG1 . VAL A 1 290 ? 19.424  32.728  238.939 1.00 97.16  ? 290 VAL A CG1 1 
ATOM   2089  C CG2 . VAL A 1 290 ? 19.802  33.128  236.444 1.00 96.29  ? 290 VAL A CG2 1 
ATOM   2090  N N   . THR A 1 291 ? 16.344  34.168  239.444 1.00 106.09 ? 291 THR A N   1 
ATOM   2091  C CA  . THR A 1 291 ? 15.728  35.059  240.458 1.00 109.42 ? 291 THR A CA  1 
ATOM   2092  C C   . THR A 1 291 ? 16.671  35.710  241.452 1.00 115.79 ? 291 THR A C   1 
ATOM   2093  O O   . THR A 1 291 ? 17.520  35.048  242.064 1.00 113.08 ? 291 THR A O   1 
ATOM   2094  C CB  . THR A 1 291 ? 14.733  34.346  241.309 1.00 104.83 ? 291 THR A CB  1 
ATOM   2095  O OG1 . THR A 1 291 ? 15.345  33.149  241.795 1.00 98.37  ? 291 THR A OG1 1 
ATOM   2096  C CG2 . THR A 1 291 ? 13.520  34.036  240.490 1.00 104.14 ? 291 THR A CG2 1 
ATOM   2097  N N   . ARG A 1 292 ? 16.471  37.025  241.652 1.00 126.26 ? 292 ARG A N   1 
ATOM   2098  C CA  . ARG A 1 292 ? 17.227  37.797  242.620 1.00 137.35 ? 292 ARG A CA  1 
ATOM   2099  C C   . ARG A 1 292 ? 16.687  37.175  243.873 1.00 138.32 ? 292 ARG A C   1 
ATOM   2100  O O   . ARG A 1 292 ? 15.644  37.608  244.370 1.00 139.57 ? 292 ARG A O   1 
ATOM   2101  C CB  . ARG A 1 292 ? 16.800  39.267  242.580 1.00 145.69 ? 292 ARG A CB  1 
ATOM   2102  C CG  . ARG A 1 292 ? 17.725  40.217  243.312 1.00 158.62 ? 292 ARG A CG  1 
ATOM   2103  C CD  . ARG A 1 292 ? 17.771  39.928  244.796 1.00 172.00 ? 292 ARG A CD  1 
ATOM   2104  N NE  . ARG A 1 292 ? 18.196  41.080  245.596 1.00 188.28 ? 292 ARG A NE  1 
ATOM   2105  C CZ  . ARG A 1 292 ? 17.391  41.769  246.413 1.00 196.52 ? 292 ARG A CZ  1 
ATOM   2106  N NH1 . ARG A 1 292 ? 16.113  41.421  246.535 1.00 202.16 ? 292 ARG A NH1 1 
ATOM   2107  N NH2 . ARG A 1 292 ? 17.862  42.786  247.145 1.00 200.98 ? 292 ARG A NH2 1 
ATOM   2108  N N   . ASN A 1 293 ? 17.353  36.132  244.339 1.00 140.29 ? 293 ASN A N   1 
ATOM   2109  C CA  . ASN A 1 293 ? 16.890  35.431  245.507 1.00 144.65 ? 293 ASN A CA  1 
ATOM   2110  C C   . ASN A 1 293 ? 17.985  34.429  245.764 1.00 143.34 ? 293 ASN A C   1 
ATOM   2111  O O   . ASN A 1 293 ? 19.108  34.786  246.152 1.00 144.23 ? 293 ASN A O   1 
ATOM   2112  C CB  . ASN A 1 293 ? 15.567  34.716  245.135 1.00 149.56 ? 293 ASN A CB  1 
ATOM   2113  C CG  . ASN A 1 293 ? 15.030  33.805  246.244 1.00 153.43 ? 293 ASN A CG  1 
ATOM   2114  O OD1 . ASN A 1 293 ? 15.585  32.748  246.515 1.00 153.93 ? 293 ASN A OD1 1 
ATOM   2115  N ND2 . ASN A 1 293 ? 13.906  34.184  246.835 1.00 157.27 ? 293 ASN A ND2 1 
ATOM   2116  N N   . TYR A 1 294 ? 17.656  33.187  245.436 1.00 142.97 ? 294 TYR A N   1 
ATOM   2117  C CA  . TYR A 1 294 ? 18.516  32.046  245.565 1.00 140.72 ? 294 TYR A CA  1 
ATOM   2118  C C   . TYR A 1 294 ? 18.925  31.840  244.144 1.00 131.70 ? 294 TYR A C   1 
ATOM   2119  O O   . TYR A 1 294 ? 19.000  32.786  243.358 1.00 131.47 ? 294 TYR A O   1 
ATOM   2120  C CB  . TYR A 1 294 ? 17.702  30.841  246.020 1.00 152.57 ? 294 TYR A CB  1 
ATOM   2121  C CG  . TYR A 1 294 ? 18.280  30.189  247.242 1.00 170.06 ? 294 TYR A CG  1 
ATOM   2122  C CD1 . TYR A 1 294 ? 19.626  29.818  247.279 1.00 175.93 ? 294 TYR A CD1 1 
ATOM   2123  C CD2 . TYR A 1 294 ? 17.498  29.973  248.387 1.00 176.33 ? 294 TYR A CD2 1 
ATOM   2124  C CE1 . TYR A 1 294 ? 20.191  29.245  248.433 1.00 183.96 ? 294 TYR A CE1 1 
ATOM   2125  C CE2 . TYR A 1 294 ? 18.050  29.400  249.555 1.00 183.34 ? 294 TYR A CE2 1 
ATOM   2126  C CZ  . TYR A 1 294 ? 19.400  29.038  249.571 1.00 186.10 ? 294 TYR A CZ  1 
ATOM   2127  O OH  . TYR A 1 294 ? 19.961  28.469  250.706 1.00 189.12 ? 294 TYR A OH  1 
ATOM   2128  N N   . ASP A 1 295 ? 19.135  30.601  243.775 1.00 118.17 ? 295 ASP A N   1 
ATOM   2129  C CA  . ASP A 1 295 ? 19.501  30.424  242.427 1.00 110.22 ? 295 ASP A CA  1 
ATOM   2130  C C   . ASP A 1 295 ? 18.490  29.616  241.714 1.00 103.33 ? 295 ASP A C   1 
ATOM   2131  O O   . ASP A 1 295 ? 18.720  28.514  241.239 1.00 100.15 ? 295 ASP A O   1 
ATOM   2132  C CB  . ASP A 1 295 ? 20.926  29.957  242.316 1.00 116.29 ? 295 ASP A CB  1 
ATOM   2133  C CG  . ASP A 1 295 ? 21.904  31.101  242.487 1.00 121.14 ? 295 ASP A CG  1 
ATOM   2134  O OD1 . ASP A 1 295 ? 21.783  31.867  243.476 1.00 121.80 ? 295 ASP A OD1 1 
ATOM   2135  O OD2 . ASP A 1 295 ? 22.779  31.267  241.607 1.00 123.67 ? 295 ASP A OD2 1 
ATOM   2136  N N   . VAL A 1 296 ? 17.313  30.201  241.680 1.00 100.77 ? 296 VAL A N   1 
ATOM   2137  C CA  . VAL A 1 296 ? 16.201  29.587  241.006 1.00 100.60 ? 296 VAL A CA  1 
ATOM   2138  C C   . VAL A 1 296 ? 16.382  29.982  239.556 1.00 94.02  ? 296 VAL A C   1 
ATOM   2139  O O   . VAL A 1 296 ? 15.990  31.053  239.099 1.00 93.48  ? 296 VAL A O   1 
ATOM   2140  C CB  . VAL A 1 296 ? 14.861  30.108  241.522 1.00 108.08 ? 296 VAL A CB  1 
ATOM   2141  C CG1 . VAL A 1 296 ? 13.763  29.138  241.101 1.00 112.59 ? 296 VAL A CG1 1 
ATOM   2142  C CG2 . VAL A 1 296 ? 14.897  30.317  243.056 1.00 110.29 ? 296 VAL A CG2 1 
ATOM   2143  N N   . HIS A 1 297 ? 17.017  29.104  238.833 1.00 85.40  ? 297 HIS A N   1 
ATOM   2144  C CA  . HIS A 1 297 ? 17.296  29.380  237.469 1.00 83.08  ? 297 HIS A CA  1 
ATOM   2145  C C   . HIS A 1 297 ? 16.175  29.197  236.501 1.00 80.72  ? 297 HIS A C   1 
ATOM   2146  O O   . HIS A 1 297 ? 16.461  28.945  235.347 1.00 85.86  ? 297 HIS A O   1 
ATOM   2147  C CB  . HIS A 1 297 ? 18.378  28.435  237.039 1.00 86.12  ? 297 HIS A CB  1 
ATOM   2148  C CG  . HIS A 1 297 ? 19.727  29.033  237.062 1.00 89.52  ? 297 HIS A CG  1 
ATOM   2149  N ND1 . HIS A 1 297 ? 20.656  28.711  238.018 1.00 92.20  ? 297 HIS A ND1 1 
ATOM   2150  C CD2 . HIS A 1 297 ? 20.310  29.938  236.245 1.00 95.04  ? 297 HIS A CD2 1 
ATOM   2151  C CE1 . HIS A 1 297 ? 21.762  29.395  237.788 1.00 99.54  ? 297 HIS A CE1 1 
ATOM   2152  N NE2 . HIS A 1 297 ? 21.578  30.145  236.718 1.00 99.84  ? 297 HIS A NE2 1 
ATOM   2153  N N   . HIS A 1 298 ? 14.919  29.359  236.858 1.00 77.32  ? 298 HIS A N   1 
ATOM   2154  C CA  . HIS A 1 298 ? 13.941  29.037  235.814 1.00 79.18  ? 298 HIS A CA  1 
ATOM   2155  C C   . HIS A 1 298 ? 13.980  29.737  234.442 1.00 71.85  ? 298 HIS A C   1 
ATOM   2156  O O   . HIS A 1 298 ? 13.846  30.952  234.334 1.00 65.69  ? 298 HIS A O   1 
ATOM   2157  C CB  . HIS A 1 298 ? 12.563  28.918  236.376 1.00 91.46  ? 298 HIS A CB  1 
ATOM   2158  C CG  . HIS A 1 298 ? 12.121  30.118  237.120 1.00 99.58  ? 298 HIS A CG  1 
ATOM   2159  N ND1 . HIS A 1 298 ? 11.147  30.965  236.640 1.00 102.24 ? 298 HIS A ND1 1 
ATOM   2160  C CD2 . HIS A 1 298 ? 12.455  30.577  238.345 1.00 102.39 ? 298 HIS A CD2 1 
ATOM   2161  C CE1 . HIS A 1 298 ? 10.896  31.893  237.542 1.00 105.09 ? 298 HIS A CE1 1 
ATOM   2162  N NE2 . HIS A 1 298 ? 11.677  31.680  238.588 1.00 106.25 ? 298 HIS A NE2 1 
ATOM   2163  N N   . TRP A 1 299 ? 14.075  28.904  233.401 1.00 67.43  ? 299 TRP A N   1 
ATOM   2164  C CA  . TRP A 1 299 ? 14.261  29.347  232.030 1.00 62.71  ? 299 TRP A CA  1 
ATOM   2165  C C   . TRP A 1 299 ? 13.167  29.700  231.054 1.00 54.51  ? 299 TRP A C   1 
ATOM   2166  O O   . TRP A 1 299 ? 12.173  29.004  230.976 1.00 49.31  ? 299 TRP A O   1 
ATOM   2167  C CB  . TRP A 1 299 ? 15.385  28.534  231.363 1.00 74.87  ? 299 TRP A CB  1 
ATOM   2168  C CG  . TRP A 1 299 ? 15.282  27.045  230.849 1.00 86.77  ? 299 TRP A CG  1 
ATOM   2169  C CD1 . TRP A 1 299 ? 15.823  26.610  229.668 1.00 96.40  ? 299 TRP A CD1 1 
ATOM   2170  C CD2 . TRP A 1 299 ? 15.005  25.838  231.588 1.00 89.83  ? 299 TRP A CD2 1 
ATOM   2171  N NE1 . TRP A 1 299 ? 15.952  25.253  229.645 1.00 98.02  ? 299 TRP A NE1 1 
ATOM   2172  C CE2 . TRP A 1 299 ? 15.452  24.749  230.800 1.00 91.41  ? 299 TRP A CE2 1 
ATOM   2173  C CE3 . TRP A 1 299 ? 14.454  25.575  232.828 1.00 99.24  ? 299 TRP A CE3 1 
ATOM   2174  C CZ2 . TRP A 1 299 ? 15.367  23.435  231.217 1.00 97.34  ? 299 TRP A CZ2 1 
ATOM   2175  C CZ3 . TRP A 1 299 ? 14.366  24.254  233.246 1.00 108.36 ? 299 TRP A CZ3 1 
ATOM   2176  C CH2 . TRP A 1 299 ? 14.822  23.200  232.437 1.00 104.85 ? 299 TRP A CH2 1 
ATOM   2177  N N   . ARG A 1 300 ? 13.425  30.773  230.281 1.00 48.47  ? 300 ARG A N   1 
ATOM   2178  C CA  . ARG A 1 300 ? 12.513  31.385  229.280 1.00 41.76  ? 300 ARG A CA  1 
ATOM   2179  C C   . ARG A 1 300 ? 12.456  30.850  227.876 1.00 39.85  ? 300 ARG A C   1 
ATOM   2180  O O   . ARG A 1 300 ? 13.468  30.430  227.290 1.00 40.47  ? 300 ARG A O   1 
ATOM   2181  C CB  . ARG A 1 300 ? 12.729  32.904  229.165 1.00 35.50  ? 300 ARG A CB  1 
ATOM   2182  C CG  . ARG A 1 300 ? 11.818  33.581  228.149 1.00 32.27  ? 300 ARG A CG  1 
ATOM   2183  C CD  . ARG A 1 300 ? 11.374  34.935  228.671 1.00 42.08  ? 300 ARG A CD  1 
ATOM   2184  N NE  . ARG A 1 300 ? 10.254  35.565  227.960 1.00 44.18  ? 300 ARG A NE  1 
ATOM   2185  C CZ  . ARG A 1 300 ? 9.048   35.018  227.811 1.00 51.79  ? 300 ARG A CZ  1 
ATOM   2186  N NH1 . ARG A 1 300 ? 8.796   33.811  228.306 1.00 57.30  ? 300 ARG A NH1 1 
ATOM   2187  N NH2 . ARG A 1 300 ? 8.064   35.711  227.250 1.00 51.19  ? 300 ARG A NH2 1 
ATOM   2188  N N   . GLY A 1 301 ? 11.253  30.965  227.325 1.00 37.81  ? 301 GLY A N   1 
ATOM   2189  C CA  . GLY A 1 301 ? 10.991  30.520  225.981 1.00 35.33  ? 301 GLY A CA  1 
ATOM   2190  C C   . GLY A 1 301 ? 10.272  31.636  225.272 1.00 34.54  ? 301 GLY A C   1 
ATOM   2191  O O   . GLY A 1 301 ? 9.773   32.565  225.915 1.00 32.76  ? 301 GLY A O   1 
ATOM   2192  N N   . LEU A 1 302 ? 10.255  31.538  223.945 1.00 34.42  ? 302 LEU A N   1 
ATOM   2193  C CA  . LEU A 1 302 ? 9.616   32.489  223.039 1.00 30.25  ? 302 LEU A CA  1 
ATOM   2194  C C   . LEU A 1 302 ? 8.792   31.721  222.024 1.00 27.46  ? 302 LEU A C   1 
ATOM   2195  O O   . LEU A 1 302 ? 9.029   30.529  221.767 1.00 32.12  ? 302 LEU A O   1 
ATOM   2196  C CB  . LEU A 1 302 ? 10.671  33.291  222.301 1.00 29.87  ? 302 LEU A CB  1 
ATOM   2197  C CG  . LEU A 1 302 ? 11.157  34.383  223.211 1.00 35.39  ? 302 LEU A CG  1 
ATOM   2198  C CD1 . LEU A 1 302 ? 12.311  35.170  222.608 1.00 35.75  ? 302 LEU A CD1 1 
ATOM   2199  C CD2 . LEU A 1 302 ? 9.936   35.246  223.438 1.00 41.34  ? 302 LEU A CD2 1 
ATOM   2200  N N   . PRO A 1 303 ? 7.848   32.400  221.388 1.00 23.19  ? 303 PRO A N   1 
ATOM   2201  C CA  . PRO A 1 303 ? 6.933   31.849  220.374 1.00 25.42  ? 303 PRO A CA  1 
ATOM   2202  C C   . PRO A 1 303 ? 7.467   31.891  218.939 1.00 27.39  ? 303 PRO A C   1 
ATOM   2203  O O   . PRO A 1 303 ? 8.410   32.640  218.629 1.00 29.11  ? 303 PRO A O   1 
ATOM   2204  C CB  . PRO A 1 303 ? 5.738   32.755  220.513 1.00 22.58  ? 303 PRO A CB  1 
ATOM   2205  C CG  . PRO A 1 303 ? 6.455   34.105  220.682 1.00 29.50  ? 303 PRO A CG  1 
ATOM   2206  C CD  . PRO A 1 303 ? 7.593   33.825  221.633 1.00 21.39  ? 303 PRO A CD  1 
ATOM   2207  N N   . ARG A 1 304 ? 6.762   31.225  218.031 1.00 26.81  ? 304 ARG A N   1 
ATOM   2208  C CA  . ARG A 1 304 ? 7.217   31.191  216.650 1.00 25.43  ? 304 ARG A CA  1 
ATOM   2209  C C   . ARG A 1 304 ? 6.165   31.270  215.525 1.00 22.31  ? 304 ARG A C   1 
ATOM   2210  O O   . ARG A 1 304 ? 5.168   30.536  215.508 1.00 19.47  ? 304 ARG A O   1 
ATOM   2211  C CB  . ARG A 1 304 ? 8.080   29.967  216.503 1.00 31.42  ? 304 ARG A CB  1 
ATOM   2212  C CG  . ARG A 1 304 ? 8.371   29.611  215.101 1.00 43.38  ? 304 ARG A CG  1 
ATOM   2213  C CD  . ARG A 1 304 ? 9.087   28.270  215.048 1.00 50.58  ? 304 ARG A CD  1 
ATOM   2214  N NE  . ARG A 1 304 ? 10.400  28.437  214.439 1.00 56.91  ? 304 ARG A NE  1 
ATOM   2215  C CZ  . ARG A 1 304 ? 11.546  28.364  215.102 1.00 60.22  ? 304 ARG A CZ  1 
ATOM   2216  N NH1 . ARG A 1 304 ? 11.549  28.098  216.407 1.00 60.44  ? 304 ARG A NH1 1 
ATOM   2217  N NH2 . ARG A 1 304 ? 12.673  28.687  214.470 1.00 66.97  ? 304 ARG A NH2 1 
ATOM   2218  N N   . TYR A 1 305 ? 6.425   32.161  214.576 1.00 21.87  ? 305 TYR A N   1 
ATOM   2219  C CA  . TYR A 1 305 ? 5.537   32.401  213.442 1.00 24.21  ? 305 TYR A CA  1 
ATOM   2220  C C   . TYR A 1 305 ? 5.793   31.431  212.360 1.00 25.94  ? 305 TYR A C   1 
ATOM   2221  O O   . TYR A 1 305 ? 6.934   31.062  212.131 1.00 28.51  ? 305 TYR A O   1 
ATOM   2222  C CB  . TYR A 1 305 ? 5.821   33.744  212.834 1.00 27.20  ? 305 TYR A CB  1 
ATOM   2223  C CG  . TYR A 1 305 ? 5.158   33.984  211.501 1.00 32.39  ? 305 TYR A CG  1 
ATOM   2224  C CD1 . TYR A 1 305 ? 3.909   34.553  211.450 1.00 44.43  ? 305 TYR A CD1 1 
ATOM   2225  C CD2 . TYR A 1 305 ? 5.850   33.859  210.307 1.00 40.33  ? 305 TYR A CD2 1 
ATOM   2226  C CE1 . TYR A 1 305 ? 3.350   35.042  210.247 1.00 52.94  ? 305 TYR A CE1 1 
ATOM   2227  C CE2 . TYR A 1 305 ? 5.301   34.347  209.089 1.00 51.11  ? 305 TYR A CE2 1 
ATOM   2228  C CZ  . TYR A 1 305 ? 4.043   34.958  209.077 1.00 52.49  ? 305 TYR A CZ  1 
ATOM   2229  O OH  . TYR A 1 305 ? 3.502   35.599  207.970 1.00 52.33  ? 305 TYR A OH  1 
ATOM   2230  N N   . PHE A 1 306 ? 4.773   31.191  211.556 1.00 26.95  ? 306 PHE A N   1 
ATOM   2231  C CA  . PHE A 1 306 ? 4.902   30.243  210.471 1.00 27.83  ? 306 PHE A CA  1 
ATOM   2232  C C   . PHE A 1 306 ? 4.121   30.691  209.286 1.00 27.74  ? 306 PHE A C   1 
ATOM   2233  O O   . PHE A 1 306 ? 2.958   31.045  209.394 1.00 27.16  ? 306 PHE A O   1 
ATOM   2234  C CB  . PHE A 1 306 ? 4.318   28.901  210.878 1.00 27.89  ? 306 PHE A CB  1 
ATOM   2235  C CG  . PHE A 1 306 ? 5.135   28.153  211.860 1.00 32.45  ? 306 PHE A CG  1 
ATOM   2236  C CD1 . PHE A 1 306 ? 5.261   28.604  213.162 1.00 34.67  ? 306 PHE A CD1 1 
ATOM   2237  C CD2 . PHE A 1 306 ? 5.769   26.975  211.485 1.00 34.28  ? 306 PHE A CD2 1 
ATOM   2238  C CE1 . PHE A 1 306 ? 6.008   27.894  214.078 1.00 38.65  ? 306 PHE A CE1 1 
ATOM   2239  C CE2 . PHE A 1 306 ? 6.525   26.244  212.393 1.00 38.62  ? 306 PHE A CE2 1 
ATOM   2240  C CZ  . PHE A 1 306 ? 6.648   26.701  213.694 1.00 40.92  ? 306 PHE A CZ  1 
ATOM   2241  N N   . LYS A 1 307 ? 4.743   30.665  208.138 1.00 28.89  ? 307 LYS A N   1 
ATOM   2242  C CA  . LYS A 1 307 ? 4.001   31.019  206.973 1.00 33.10  ? 307 LYS A CA  1 
ATOM   2243  C C   . LYS A 1 307 ? 4.245   29.828  206.092 1.00 34.78  ? 307 LYS A C   1 
ATOM   2244  O O   . LYS A 1 307 ? 5.329   29.662  205.513 1.00 37.48  ? 307 LYS A O   1 
ATOM   2245  C CB  . LYS A 1 307 ? 4.534   32.285  206.350 1.00 39.61  ? 307 LYS A CB  1 
ATOM   2246  C CG  . LYS A 1 307 ? 3.651   32.835  205.207 1.00 55.17  ? 307 LYS A CG  1 
ATOM   2247  C CD  . LYS A 1 307 ? 4.334   34.046  204.452 1.00 69.53  ? 307 LYS A CD  1 
ATOM   2248  C CE  . LYS A 1 307 ? 3.459   34.734  203.359 1.00 71.97  ? 307 LYS A CE  1 
ATOM   2249  N NZ  . LYS A 1 307 ? 4.080   35.907  202.630 1.00 72.38  ? 307 LYS A NZ  1 
ATOM   2250  N N   . ILE A 1 308 ? 3.273   28.937  206.077 1.00 33.48  ? 308 ILE A N   1 
ATOM   2251  C CA  . ILE A 1 308 ? 3.403   27.750  205.274 1.00 33.61  ? 308 ILE A CA  1 
ATOM   2252  C C   . ILE A 1 308 ? 2.797   27.982  203.918 1.00 36.21  ? 308 ILE A C   1 
ATOM   2253  O O   . ILE A 1 308 ? 1.625   28.341  203.771 1.00 34.50  ? 308 ILE A O   1 
ATOM   2254  C CB  . ILE A 1 308 ? 2.760   26.557  205.934 1.00 35.25  ? 308 ILE A CB  1 
ATOM   2255  C CG1 . ILE A 1 308 ? 3.562   26.181  207.169 1.00 30.39  ? 308 ILE A CG1 1 
ATOM   2256  C CG2 . ILE A 1 308 ? 2.671   25.403  204.949 1.00 35.60  ? 308 ILE A CG2 1 
ATOM   2257  C CD1 . ILE A 1 308 ? 3.582   27.260  208.194 1.00 34.43  ? 308 ILE A CD1 1 
ATOM   2258  N N   . THR A 1 309 ? 3.638   27.777  202.931 1.00 38.10  ? 309 THR A N   1 
ATOM   2259  C CA  . THR A 1 309 ? 3.286   27.957  201.549 1.00 42.88  ? 309 THR A CA  1 
ATOM   2260  C C   . THR A 1 309 ? 3.022   26.561  201.044 1.00 43.49  ? 309 THR A C   1 
ATOM   2261  O O   . THR A 1 309 ? 3.932   25.721  201.090 1.00 46.65  ? 309 THR A O   1 
ATOM   2262  C CB  . THR A 1 309 ? 4.527   28.464  200.808 1.00 49.23  ? 309 THR A CB  1 
ATOM   2263  O OG1 . THR A 1 309 ? 5.374   29.202  201.716 1.00 56.09  ? 309 THR A OG1 1 
ATOM   2264  C CG2 . THR A 1 309 ? 4.137   29.331  199.633 1.00 54.33  ? 309 THR A CG2 1 
ATOM   2265  N N   . LEU A 1 310 ? 1.818   26.273  200.571 1.00 42.92  ? 310 LEU A N   1 
ATOM   2266  C CA  . LEU A 1 310 ? 1.590   24.922  200.078 1.00 44.55  ? 310 LEU A CA  1 
ATOM   2267  C C   . LEU A 1 310 ? 0.622   24.794  198.926 1.00 45.04  ? 310 LEU A C   1 
ATOM   2268  O O   . LEU A 1 310 ? -0.352  25.552  198.831 1.00 46.31  ? 310 LEU A O   1 
ATOM   2269  C CB  . LEU A 1 310 ? 1.279   23.955  201.225 1.00 45.61  ? 310 LEU A CB  1 
ATOM   2270  C CG  . LEU A 1 310 ? 0.101   24.103  202.174 1.00 47.09  ? 310 LEU A CG  1 
ATOM   2271  C CD1 . LEU A 1 310 ? -0.064  25.548  202.618 1.00 47.72  ? 310 LEU A CD1 1 
ATOM   2272  C CD2 . LEU A 1 310 ? -1.127  23.597  201.470 1.00 51.60  ? 310 LEU A CD2 1 
ATOM   2273  N N   . ARG A 1 311 ? 0.926   23.836  198.050 1.00 47.04  ? 311 ARG A N   1 
ATOM   2274  C CA  . ARG A 1 311 ? 0.167   23.578  196.828 1.00 53.77  ? 311 ARG A CA  1 
ATOM   2275  C C   . ARG A 1 311 ? -0.512  22.228  196.788 1.00 54.94  ? 311 ARG A C   1 
ATOM   2276  O O   . ARG A 1 311 ? -0.351  21.375  197.676 1.00 51.45  ? 311 ARG A O   1 
ATOM   2277  C CB  . ARG A 1 311 ? 1.101   23.612  195.628 1.00 61.12  ? 311 ARG A CB  1 
ATOM   2278  C CG  . ARG A 1 311 ? 2.109   22.451  195.700 1.00 80.20  ? 311 ARG A CG  1 
ATOM   2279  C CD  . ARG A 1 311 ? 3.175   22.416  194.590 1.00 93.89  ? 311 ARG A CD  1 
ATOM   2280  N NE  . ARG A 1 311 ? 4.030   21.217  194.691 1.00 103.25 ? 311 ARG A NE  1 
ATOM   2281  C CZ  . ARG A 1 311 ? 5.203   21.050  194.069 1.00 107.96 ? 311 ARG A CZ  1 
ATOM   2282  N NH1 . ARG A 1 311 ? 5.691   22.011  193.284 1.00 112.45 ? 311 ARG A NH1 1 
ATOM   2283  N NH2 . ARG A 1 311 ? 5.917   19.941  194.266 1.00 109.55 ? 311 ARG A NH2 1 
ATOM   2284  N N   . LYS A 1 312 ? -1.148  21.996  195.651 1.00 59.29  ? 312 LYS A N   1 
ATOM   2285  C CA  . LYS A 1 312 ? -1.871  20.767  195.426 1.00 67.32  ? 312 LYS A CA  1 
ATOM   2286  C C   . LYS A 1 312 ? -1.083  19.800  194.577 1.00 69.91  ? 312 LYS A C   1 
ATOM   2287  O O   . LYS A 1 312 ? -0.755  20.094  193.417 1.00 69.14  ? 312 LYS A O   1 
ATOM   2288  C CB  . LYS A 1 312 ? -3.200  21.061  194.719 1.00 73.10  ? 312 LYS A CB  1 
ATOM   2289  C CG  . LYS A 1 312 ? -4.168  21.984  195.476 1.00 76.55  ? 312 LYS A CG  1 
ATOM   2290  C CD  . LYS A 1 312 ? -5.612  21.879  194.953 1.00 80.23  ? 312 LYS A CD  1 
ATOM   2291  C CE  . LYS A 1 312 ? -6.558  22.777  195.744 1.00 85.47  ? 312 LYS A CE  1 
ATOM   2292  N NZ  . LYS A 1 312 ? -8.021  22.491  195.524 1.00 91.01  ? 312 LYS A NZ  1 
ATOM   2293  N N   . ARG A 1 313 ? -0.755  18.649  195.140 1.00 75.41  ? 313 ARG A N   1 
ATOM   2294  C CA  . ARG A 1 313 ? -0.042  17.694  194.326 1.00 82.59  ? 313 ARG A CA  1 
ATOM   2295  C C   . ARG A 1 313 ? -0.902  16.488  193.976 1.00 84.66  ? 313 ARG A C   1 
ATOM   2296  O O   . ARG A 1 313 ? -1.832  16.122  194.715 1.00 81.15  ? 313 ARG A O   1 
ATOM   2297  C CB  . ARG A 1 313 ? 1.282   17.274  194.953 1.00 87.79  ? 313 ARG A CB  1 
ATOM   2298  C CG  . ARG A 1 313 ? 2.162   16.490  193.978 1.00 91.66  ? 313 ARG A CG  1 
ATOM   2299  C CD  . ARG A 1 313 ? 3.462   16.061  194.608 1.00 94.37  ? 313 ARG A CD  1 
ATOM   2300  N NE  . ARG A 1 313 ? 4.586   16.747  193.990 1.00 99.98  ? 313 ARG A NE  1 
ATOM   2301  C CZ  . ARG A 1 313 ? 5.696   16.135  193.593 1.00 105.48 ? 313 ARG A CZ  1 
ATOM   2302  N NH1 . ARG A 1 313 ? 5.821   14.823  193.772 1.00 105.85 ? 313 ARG A NH1 1 
ATOM   2303  N NH2 . ARG A 1 313 ? 6.653   16.816  192.964 1.00 110.09 ? 313 ARG A NH2 1 
ATOM   2304  N N   . TRP A 1 314 ? -0.571  15.900  192.829 1.00 87.64  ? 314 TRP A N   1 
ATOM   2305  C CA  . TRP A 1 314 ? -1.252  14.748  192.256 1.00 91.61  ? 314 TRP A CA  1 
ATOM   2306  C C   . TRP A 1 314 ? -0.627  13.413  192.599 1.00 92.20  ? 314 TRP A C   1 
ATOM   2307  O O   . TRP A 1 314 ? 0.592   13.303  192.651 1.00 93.31  ? 314 TRP A O   1 
ATOM   2308  C CB  . TRP A 1 314 ? -1.243  14.903  190.745 1.00 98.33  ? 314 TRP A CB  1 
ATOM   2309  C CG  . TRP A 1 314 ? -2.266  15.862  190.251 1.00 106.94 ? 314 TRP A CG  1 
ATOM   2310  C CD1 . TRP A 1 314 ? -2.055  17.017  189.536 1.00 112.53 ? 314 TRP A CD1 1 
ATOM   2311  C CD2 . TRP A 1 314 ? -3.682  15.730  190.397 1.00 108.08 ? 314 TRP A CD2 1 
ATOM   2312  N NE1 . TRP A 1 314 ? -3.263  17.602  189.225 1.00 112.52 ? 314 TRP A NE1 1 
ATOM   2313  C CE2 . TRP A 1 314 ? -4.273  16.831  189.741 1.00 109.58 ? 314 TRP A CE2 1 
ATOM   2314  C CE3 . TRP A 1 314 ? -4.508  14.782  191.017 1.00 107.31 ? 314 TRP A CE3 1 
ATOM   2315  C CZ2 . TRP A 1 314 ? -5.651  17.004  189.692 1.00 111.02 ? 314 TRP A CZ2 1 
ATOM   2316  C CZ3 . TRP A 1 314 ? -5.872  14.955  190.968 1.00 106.89 ? 314 TRP A CZ3 1 
ATOM   2317  C CH2 . TRP A 1 314 ? -6.433  16.056  190.310 1.00 110.82 ? 314 TRP A CH2 1 
ATOM   2318  N N   . VAL A 1 315 ? -1.445  12.379  192.758 1.00 94.13  ? 315 VAL A N   1 
ATOM   2319  C CA  . VAL A 1 315 ? -0.916  11.057  193.084 1.00 100.33 ? 315 VAL A CA  1 
ATOM   2320  C C   . VAL A 1 315 ? -1.748  9.905   192.549 1.00 103.08 ? 315 VAL A C   1 
ATOM   2321  O O   . VAL A 1 315 ? -2.817  10.112  191.971 1.00 103.96 ? 315 VAL A O   1 
ATOM   2322  C CB  . VAL A 1 315 ? -0.806  10.810  194.599 1.00 102.65 ? 315 VAL A CB  1 
ATOM   2323  C CG1 . VAL A 1 315 ? 0.565   10.211  194.914 1.00 106.73 ? 315 VAL A CG1 1 
ATOM   2324  C CG2 . VAL A 1 315 ? -1.130  12.073  195.413 1.00 103.90 ? 315 VAL A CG2 1 
ATOM   2325  N N   . LYS A 1 316 ? -1.279  8.685   192.825 1.00 103.41 ? 316 LYS A N   1 
ATOM   2326  C CA  . LYS A 1 316 ? -1.955  7.465   192.396 1.00 102.20 ? 316 LYS A CA  1 
ATOM   2327  C C   . LYS A 1 316 ? -2.787  6.801   193.511 1.00 98.05  ? 316 LYS A C   1 
ATOM   2328  O O   . LYS A 1 316 ? -2.294  6.603   194.629 1.00 95.53  ? 316 LYS A O   1 
ATOM   2329  C CB  . LYS A 1 316 ? -0.929  6.462   191.866 1.00 107.18 ? 316 LYS A CB  1 
ATOM   2330  C CG  . LYS A 1 316 ? -1.581  5.175   191.387 1.00 115.59 ? 316 LYS A CG  1 
ATOM   2331  C CD  . LYS A 1 316 ? -0.707  3.946   191.644 1.00 122.74 ? 316 LYS A CD  1 
ATOM   2332  C CE  . LYS A 1 316 ? -1.442  2.849   192.460 1.00 123.01 ? 316 LYS A CE  1 
ATOM   2333  N NZ  . LYS A 1 316 ? -2.775  2.439   191.903 1.00 125.45 ? 316 LYS A NZ  1 
ATOM   2334  N N   . ASN A 1 317 ? -4.019  6.409   193.176 1.00 94.84  ? 317 ASN A N   1 
ATOM   2335  C CA  . ASN A 1 317 ? -4.924  5.752   194.120 1.00 93.66  ? 317 ASN A CA  1 
ATOM   2336  C C   . ASN A 1 317 ? -4.239  4.520   194.696 1.00 93.19  ? 317 ASN A C   1 
ATOM   2337  O O   . ASN A 1 317 ? -3.830  3.623   193.964 1.00 88.07  ? 317 ASN A O   1 
ATOM   2338  C CB  . ASN A 1 317 ? -6.243  5.348   193.426 1.00 93.96  ? 317 ASN A CB  1 
ATOM   2339  C CG  . ASN A 1 317 ? -7.287  4.753   194.396 1.00 95.28  ? 317 ASN A CG  1 
ATOM   2340  O OD1 . ASN A 1 317 ? -7.209  4.941   195.617 1.00 93.99  ? 317 ASN A OD1 1 
ATOM   2341  N ND2 . ASN A 1 317 ? -8.258  4.017   193.845 1.00 91.33  ? 317 ASN A ND2 1 
ATOM   2342  N N   . PRO A 1 318 ? -4.052  4.495   196.016 1.00 96.53  ? 318 PRO A N   1 
ATOM   2343  C CA  . PRO A 1 318 ? -3.418  3.411   196.768 1.00 102.20 ? 318 PRO A CA  1 
ATOM   2344  C C   . PRO A 1 318 ? -4.372  2.239   197.029 1.00 108.38 ? 318 PRO A C   1 
ATOM   2345  O O   . PRO A 1 318 ? -3.954  1.077   196.988 1.00 110.50 ? 318 PRO A O   1 
ATOM   2346  C CB  . PRO A 1 318 ? -3.034  4.093   198.080 1.00 101.91 ? 318 PRO A CB  1 
ATOM   2347  C CG  . PRO A 1 318 ? -2.973  5.545   197.715 1.00 100.78 ? 318 PRO A CG  1 
ATOM   2348  C CD  . PRO A 1 318 ? -4.183  5.683   196.863 1.00 97.03  ? 318 PRO A CD  1 
ATOM   2349  N N   . TYR A 1 319 ? -5.652  2.548   197.269 1.00 112.72 ? 319 TYR A N   1 
ATOM   2350  C CA  . TYR A 1 319 ? -6.691  1.536   197.527 1.00 115.52 ? 319 TYR A CA  1 
ATOM   2351  C C   . TYR A 1 319 ? -6.827  0.402   196.527 1.00 119.13 ? 319 TYR A C   1 
ATOM   2352  O O   . TYR A 1 319 ? -7.458  -0.600  196.849 1.00 120.43 ? 319 TYR A O   1 
ATOM   2353  C CB  . TYR A 1 319 ? -8.050  2.179   197.666 1.00 112.91 ? 319 TYR A CB  1 
ATOM   2354  C CG  . TYR A 1 319 ? -8.032  3.212   198.707 1.00 112.93 ? 319 TYR A CG  1 
ATOM   2355  C CD1 . TYR A 1 319 ? -8.230  2.878   200.041 1.00 113.90 ? 319 TYR A CD1 1 
ATOM   2356  C CD2 . TYR A 1 319 ? -7.776  4.532   198.370 1.00 113.57 ? 319 TYR A CD2 1 
ATOM   2357  C CE1 . TYR A 1 319 ? -8.171  3.851   201.034 1.00 120.13 ? 319 TYR A CE1 1 
ATOM   2358  C CE2 . TYR A 1 319 ? -7.710  5.519   199.334 1.00 120.27 ? 319 TYR A CE2 1 
ATOM   2359  C CZ  . TYR A 1 319 ? -7.908  5.188   200.676 1.00 122.85 ? 319 TYR A CZ  1 
ATOM   2360  O OH  . TYR A 1 319 ? -7.854  6.199   201.639 1.00 124.26 ? 319 TYR A OH  1 
ATOM   2361  N N   . PRO A 1 320 ? -6.403  0.602   195.258 1.00 122.33 ? 320 PRO A N   1 
ATOM   2362  C CA  . PRO A 1 320 ? -6.514  -0.491  194.293 1.00 124.98 ? 320 PRO A CA  1 
ATOM   2363  C C   . PRO A 1 320 ? -5.650  -1.721  194.628 1.00 129.39 ? 320 PRO A C   1 
ATOM   2364  O O   . PRO A 1 320 ? -5.625  -2.690  193.853 1.00 131.36 ? 320 PRO A O   1 
ATOM   2365  C CB  . PRO A 1 320 ? -6.099  0.173   192.976 1.00 123.62 ? 320 PRO A CB  1 
ATOM   2366  C CG  . PRO A 1 320 ? -5.307  1.345   193.394 1.00 120.32 ? 320 PRO A CG  1 
ATOM   2367  C CD  . PRO A 1 320 ? -6.132  1.846   194.527 1.00 121.94 ? 320 PRO A CD  1 
ATOM   2368  N N   . MET A 1 321 ? -4.918  -1.663  195.748 1.00 132.48 ? 321 MET A N   1 
ATOM   2369  C CA  . MET A 1 321 ? -4.115  -2.803  196.211 1.00 135.39 ? 321 MET A CA  1 
ATOM   2370  C C   . MET A 1 321 ? -5.101  -3.688  197.037 1.00 140.39 ? 321 MET A C   1 
ATOM   2371  O O   . MET A 1 321 ? -5.152  -3.564  198.271 1.00 141.10 ? 321 MET A O   1 
ATOM   2372  C CB  . MET A 1 321 ? -2.916  -2.342  197.074 1.00 129.15 ? 321 MET A CB  1 
ATOM   2373  C CG  . MET A 1 321 ? -2.048  -1.263  196.439 1.00 125.13 ? 321 MET A CG  1 
ATOM   2374  S SD  . MET A 1 321 ? -1.725  -1.493  194.665 1.00 120.86 ? 321 MET A SD  1 
ATOM   2375  C CE  . MET A 1 321 ? -0.300  -2.561  194.727 1.00 118.20 ? 321 MET A CE  1 
ATOM   2376  N N   . ALA A 1 322 ? -5.884  -4.532  196.324 1.00 143.87 ? 322 ALA A N   1 
ATOM   2377  C CA  . ALA A 1 322 ? -6.942  -5.456  196.837 1.00 144.72 ? 322 ALA A CA  1 
ATOM   2378  C C   . ALA A 1 322 ? -6.924  -6.048  198.265 1.00 146.60 ? 322 ALA A C   1 
ATOM   2379  O O   . ALA A 1 322 ? -5.855  -6.217  198.874 1.00 145.96 ? 322 ALA A O   1 
ATOM   2380  C CB  . ALA A 1 322 ? -7.203  -6.569  195.812 1.00 141.06 ? 322 ALA A CB  1 
ATOM   2381  N N   . SER A 1 323 ? -8.103  -6.556  198.657 1.00 148.23 ? 323 SER A N   1 
ATOM   2382  C CA  . SER A 1 323 ? -8.389  -7.111  199.996 1.00 147.34 ? 323 SER A CA  1 
ATOM   2383  C C   . SER A 1 323 ? -7.223  -7.406  200.985 1.00 144.60 ? 323 SER A C   1 
ATOM   2384  O O   . SER A 1 323 ? -6.799  -6.541  201.761 1.00 141.79 ? 323 SER A O   1 
ATOM   2385  C CB  . SER A 1 323 ? -9.343  -8.341  199.885 1.00 148.15 ? 323 SER A CB  1 
ATOM   2386  O OG  . SER A 1 323 ? -9.615  -8.724  198.533 1.00 148.12 ? 323 SER A OG  1 
ATOM   2387  N N   . LEU A 1 324 ? -6.667  -8.606  200.845 1.00 142.79 ? 324 LEU A N   1 
ATOM   2388  C CA  . LEU A 1 324 ? -5.608  -9.170  201.684 1.00 139.27 ? 324 LEU A CA  1 
ATOM   2389  C C   . LEU A 1 324 ? -4.209  -8.981  201.076 1.00 135.64 ? 324 LEU A C   1 
ATOM   2390  O O   . LEU A 1 324 ? -3.187  -9.159  201.744 1.00 130.60 ? 324 LEU A O   1 
ATOM   2391  C CB  . LEU A 1 324 ? -5.939  -10.674 201.874 1.00 143.81 ? 324 LEU A CB  1 
ATOM   2392  C CG  . LEU A 1 324 ? -7.463  -11.026 201.817 1.00 146.55 ? 324 LEU A CG  1 
ATOM   2393  C CD1 . LEU A 1 324 ? -7.775  -12.447 201.291 1.00 144.62 ? 324 LEU A CD1 1 
ATOM   2394  C CD2 . LEU A 1 324 ? -8.147  -10.791 203.165 1.00 145.50 ? 324 LEU A CD2 1 
ATOM   2395  N N   . ILE A 1 325 ? -4.189  -8.591  199.807 1.00 135.35 ? 325 ILE A N   1 
ATOM   2396  C CA  . ILE A 1 325 ? -2.955  -8.358  199.048 1.00 135.95 ? 325 ILE A CA  1 
ATOM   2397  C C   . ILE A 1 325 ? -2.127  -7.195  199.659 1.00 135.94 ? 325 ILE A C   1 
ATOM   2398  O O   . ILE A 1 325 ? -0.921  -7.043  199.394 1.00 131.10 ? 325 ILE A O   1 
ATOM   2399  C CB  . ILE A 1 325 ? -3.312  -8.095  197.518 1.00 134.95 ? 325 ILE A CB  1 
ATOM   2400  C CG1 . ILE A 1 325 ? -4.173  -9.262  196.974 1.00 130.72 ? 325 ILE A CG1 1 
ATOM   2401  C CG2 . ILE A 1 325 ? -2.032  -7.808  196.676 1.00 134.03 ? 325 ILE A CG2 1 
ATOM   2402  C CD1 . ILE A 1 325 ? -4.336  -9.331  195.441 1.00 124.03 ? 325 ILE A CD1 1 
ATOM   2403  N N   . SER A 1 326 ? -2.792  -6.421  200.519 1.00 136.66 ? 326 SER A N   1 
ATOM   2404  C CA  . SER A 1 326 ? -2.190  -5.277  201.203 1.00 137.84 ? 326 SER A CA  1 
ATOM   2405  C C   . SER A 1 326 ? -2.575  -5.238  202.686 1.00 139.20 ? 326 SER A C   1 
ATOM   2406  O O   . SER A 1 326 ? -1.773  -4.804  203.532 1.00 136.98 ? 326 SER A O   1 
ATOM   2407  C CB  . SER A 1 326 ? -2.624  -3.977  200.507 1.00 137.34 ? 326 SER A CB  1 
ATOM   2408  O OG  . SER A 1 326 ? -4.036  -3.821  200.565 1.00 133.87 ? 326 SER A OG  1 
ATOM   2409  N N   . SER A 1 327 ? -3.808  -5.691  202.953 1.00 142.15 ? 327 SER A N   1 
ATOM   2410  C CA  . SER A 1 327 ? -4.454  -5.761  204.276 1.00 145.95 ? 327 SER A CA  1 
ATOM   2411  C C   . SER A 1 327 ? -3.437  -5.755  205.364 1.00 152.67 ? 327 SER A C   1 
ATOM   2412  O O   . SER A 1 327 ? -3.075  -4.682  205.890 1.00 155.39 ? 327 SER A O   1 
ATOM   2413  C CB  . SER A 1 327 ? -5.416  -6.966  204.292 1.00 142.20 ? 327 SER A CB  1 
ATOM   2414  O OG  . SER A 1 327 ? -6.534  -6.684  205.121 1.00 138.24 ? 327 SER A OG  1 
ATOM   2415  N N   . LEU A 1 328 ? -3.085  -6.935  205.627 1.00 156.75 ? 328 LEU A N   1 
ATOM   2416  C CA  . LEU A 1 328 ? -2.070  -7.279  206.546 1.00 158.23 ? 328 LEU A CA  1 
ATOM   2417  C C   . LEU A 1 328 ? -0.994  -7.793  205.730 1.00 160.39 ? 328 LEU A C   1 
ATOM   2418  O O   . LEU A 1 328 ? -0.994  -8.978  205.380 1.00 158.72 ? 328 LEU A O   1 
ATOM   2419  C CB  . LEU A 1 328 ? -2.545  -8.416  207.378 1.00 154.63 ? 328 LEU A CB  1 
ATOM   2420  C CG  . LEU A 1 328 ? -1.635  -8.695  208.539 1.00 151.92 ? 328 LEU A CG  1 
ATOM   2421  C CD1 . LEU A 1 328 ? -2.258  -8.192  209.829 1.00 149.70 ? 328 LEU A CD1 1 
ATOM   2422  C CD2 . LEU A 1 328 ? -1.355  -10.181 208.724 1.00 148.50 ? 328 LEU A CD2 1 
ATOM   2423  N N   . PHE A 1 329 ? -0.140  -6.940  205.416 1.00 162.68 ? 329 PHE A N   1 
ATOM   2424  C CA  . PHE A 1 329 ? 0.855   -7.361  204.559 1.00 163.90 ? 329 PHE A CA  1 
ATOM   2425  C C   . PHE A 1 329 ? 2.286   -7.111  205.098 1.00 168.48 ? 329 PHE A C   1 
ATOM   2426  O O   . PHE A 1 329 ? 3.146   -8.009  205.079 1.00 169.09 ? 329 PHE A O   1 
ATOM   2427  C CB  . PHE A 1 329 ? 0.779   -6.615  203.225 1.00 158.75 ? 329 PHE A CB  1 
ATOM   2428  C CG  . PHE A 1 329 ? 1.860   -7.072  202.243 1.00 157.19 ? 329 PHE A CG  1 
ATOM   2429  C CD1 . PHE A 1 329 ? 2.388   -8.363  202.349 1.00 157.95 ? 329 PHE A CD1 1 
ATOM   2430  C CD2 . PHE A 1 329 ? 2.324   -6.207  201.243 1.00 156.57 ? 329 PHE A CD2 1 
ATOM   2431  C CE1 . PHE A 1 329 ? 3.372   -8.794  201.453 1.00 157.24 ? 329 PHE A CE1 1 
ATOM   2432  C CE2 . PHE A 1 329 ? 3.307   -6.640  200.344 1.00 157.48 ? 329 PHE A CE2 1 
ATOM   2433  C CZ  . PHE A 1 329 ? 3.830   -7.934  200.450 1.00 156.59 ? 329 PHE A CZ  1 
ATOM   2434  N N   . ASN A 1 330 ? 2.513   -5.920  205.648 1.00 173.63 ? 330 ASN A N   1 
ATOM   2435  C CA  . ASN A 1 330 ? 3.850   -5.540  206.152 1.00 177.32 ? 330 ASN A CA  1 
ATOM   2436  C C   . ASN A 1 330 ? 4.227   -5.709  207.639 1.00 178.66 ? 330 ASN A C   1 
ATOM   2437  O O   . ASN A 1 330 ? 4.014   -6.782  208.244 1.00 177.06 ? 330 ASN A O   1 
ATOM   2438  C CB  . ASN A 1 330 ? 4.192   -4.107  205.681 1.00 177.27 ? 330 ASN A CB  1 
ATOM   2439  C CG  . ASN A 1 330 ? 4.948   -4.089  204.352 1.00 179.10 ? 330 ASN A CG  1 
ATOM   2440  O OD1 . ASN A 1 330 ? 4.442   -3.582  203.342 1.00 179.64 ? 330 ASN A OD1 1 
ATOM   2441  N ND2 . ASN A 1 330 ? 6.156   -4.657  204.345 1.00 179.00 ? 330 ASN A ND2 1 
ATOM   2442  N N   . ASN A 1 331 ? 4.958   -4.704  208.147 1.00 180.27 ? 331 ASN A N   1 
ATOM   2443  C CA  . ASN A 1 331 ? 5.393   -4.641  209.543 1.00 179.72 ? 331 ASN A CA  1 
ATOM   2444  C C   . ASN A 1 331 ? 4.100   -4.201  210.222 1.00 177.56 ? 331 ASN A C   1 
ATOM   2445  O O   . ASN A 1 331 ? 3.719   -3.020  210.207 1.00 178.48 ? 331 ASN A O   1 
ATOM   2446  C CB  . ASN A 1 331 ? 6.515   -3.593  209.741 1.00 182.28 ? 331 ASN A CB  1 
ATOM   2447  C CG  . ASN A 1 331 ? 7.853   -4.013  209.105 1.00 184.28 ? 331 ASN A CG  1 
ATOM   2448  O OD1 . ASN A 1 331 ? 8.456   -3.257  208.326 1.00 185.70 ? 331 ASN A OD1 1 
ATOM   2449  N ND2 . ASN A 1 331 ? 8.320   -5.217  209.440 1.00 185.21 ? 331 ASN A ND2 1 
ATOM   2450  N N   . MET A 1 332 ? 3.358   -5.214  210.646 1.00 173.77 ? 332 MET A N   1 
ATOM   2451  C CA  . MET A 1 332 ? 2.060   -5.063  211.283 1.00 168.70 ? 332 MET A CA  1 
ATOM   2452  C C   . MET A 1 332 ? 2.004   -6.333  212.130 1.00 163.28 ? 332 MET A C   1 
ATOM   2453  O O   . MET A 1 332 ? 1.906   -6.278  213.363 1.00 163.76 ? 332 MET A O   1 
ATOM   2454  C CB  . MET A 1 332 ? 0.957   -5.069  210.188 1.00 170.80 ? 332 MET A CB  1 
ATOM   2455  C CG  . MET A 1 332 ? -0.461  -4.686  210.632 1.00 170.66 ? 332 MET A CG  1 
ATOM   2456  S SD  . MET A 1 332 ? -1.206  -5.828  211.842 1.00 173.54 ? 332 MET A SD  1 
ATOM   2457  C CE  . MET A 1 332 ? -2.070  -6.899  210.817 1.00 166.79 ? 332 MET A CE  1 
ATOM   2458  N N   . LEU A 1 333 ? 2.223   -7.461  211.452 1.00 154.41 ? 333 LEU A N   1 
ATOM   2459  C CA  . LEU A 1 333 ? 2.197   -8.766  212.078 1.00 143.50 ? 333 LEU A CA  1 
ATOM   2460  C C   . LEU A 1 333 ? 3.085   -8.777  213.308 1.00 137.02 ? 333 LEU A C   1 
ATOM   2461  O O   . LEU A 1 333 ? 4.307   -8.568  213.223 1.00 132.72 ? 333 LEU A O   1 
ATOM   2462  C CB  . LEU A 1 333 ? 2.537   -9.848  211.055 1.00 142.28 ? 333 LEU A CB  1 
ATOM   2463  C CG  . LEU A 1 333 ? 1.486   -9.774  209.928 1.00 139.83 ? 333 LEU A CG  1 
ATOM   2464  C CD1 . LEU A 1 333 ? 1.710   -10.872 208.898 1.00 138.66 ? 333 LEU A CD1 1 
ATOM   2465  C CD2 . LEU A 1 333 ? 0.060   -9.845  210.513 1.00 138.17 ? 333 LEU A CD2 1 
ATOM   2466  N N   . PRO A 1 334 ? 2.420   -8.846  214.480 1.00 132.51 ? 334 PRO A N   1 
ATOM   2467  C CA  . PRO A 1 334 ? 2.887   -8.872  215.871 1.00 130.91 ? 334 PRO A CA  1 
ATOM   2468  C C   . PRO A 1 334 ? 3.717   -10.118 216.110 1.00 128.13 ? 334 PRO A C   1 
ATOM   2469  O O   . PRO A 1 334 ? 4.746   -10.304 215.455 1.00 127.84 ? 334 PRO A O   1 
ATOM   2470  C CB  . PRO A 1 334 ? 1.575   -8.914  216.678 1.00 130.89 ? 334 PRO A CB  1 
ATOM   2471  C CG  . PRO A 1 334 ? 0.534   -8.401  215.719 1.00 130.18 ? 334 PRO A CG  1 
ATOM   2472  C CD  . PRO A 1 334 ? 0.959   -9.038  214.440 1.00 129.41 ? 334 PRO A CD  1 
ATOM   2473  N N   . GLN A 1 335 ? 3.274   -10.984 217.024 1.00 124.53 ? 335 GLN A N   1 
ATOM   2474  C CA  . GLN A 1 335 ? 4.029   -12.191 217.264 1.00 119.97 ? 335 GLN A CA  1 
ATOM   2475  C C   . GLN A 1 335 ? 3.325   -13.532 217.342 1.00 113.22 ? 335 GLN A C   1 
ATOM   2476  O O   . GLN A 1 335 ? 2.329   -13.772 216.671 1.00 109.79 ? 335 GLN A O   1 
ATOM   2477  C CB  . GLN A 1 335 ? 4.972   -12.003 218.442 1.00 127.10 ? 335 GLN A CB  1 
ATOM   2478  C CG  . GLN A 1 335 ? 6.425   -12.007 217.963 1.00 141.52 ? 335 GLN A CG  1 
ATOM   2479  C CD  . GLN A 1 335 ? 6.620   -12.769 216.624 1.00 150.57 ? 335 GLN A CD  1 
ATOM   2480  O OE1 . GLN A 1 335 ? 6.970   -12.175 215.601 1.00 156.67 ? 335 GLN A OE1 1 
ATOM   2481  N NE2 . GLN A 1 335 ? 6.390   -14.084 216.640 1.00 153.94 ? 335 GLN A NE2 1 
ATOM   2482  N N   . VAL A 1 336 ? 3.974   -14.465 218.018 1.00 107.82 ? 336 VAL A N   1 
ATOM   2483  C CA  . VAL A 1 336 ? 3.414   -15.781 218.204 1.00 106.63 ? 336 VAL A CA  1 
ATOM   2484  C C   . VAL A 1 336 ? 2.451   -15.639 219.382 1.00 106.54 ? 336 VAL A C   1 
ATOM   2485  O O   . VAL A 1 336 ? 1.990   -14.526 219.681 1.00 108.61 ? 336 VAL A O   1 
ATOM   2486  C CB  . VAL A 1 336 ? 4.516   -16.857 218.484 1.00 105.54 ? 336 VAL A CB  1 
ATOM   2487  C CG1 . VAL A 1 336 ? 5.086   -17.388 217.184 1.00 105.70 ? 336 VAL A CG1 1 
ATOM   2488  C CG2 . VAL A 1 336 ? 5.650   -16.271 219.290 1.00 107.93 ? 336 VAL A CG2 1 
ATOM   2489  N N   . GLN A 1 337 ? 3.218   -15.669 220.307 1.00 108.35 ? 337 GLN A N   1 
ATOM   2490  C CA  . GLN A 1 337 ? 3.721   -16.780 221.115 1.00 107.86 ? 337 GLN A CA  1 
ATOM   2491  C C   . GLN A 1 337 ? 2.700   -17.884 221.159 1.00 100.19 ? 337 GLN A C   1 
ATOM   2492  O O   . GLN A 1 337 ? 1.763   -17.861 221.962 1.00 96.96  ? 337 GLN A O   1 
ATOM   2493  C CB  . GLN A 1 337 ? 4.047   -16.328 222.543 1.00 121.09 ? 337 GLN A CB  1 
ATOM   2494  C CG  . GLN A 1 337 ? 5.206   -15.320 222.644 1.00 139.59 ? 337 GLN A CG  1 
ATOM   2495  C CD  . GLN A 1 337 ? 5.648   -15.030 224.085 1.00 149.90 ? 337 GLN A CD  1 
ATOM   2496  O OE1 . GLN A 1 337 ? 6.698   -14.410 224.310 1.00 157.27 ? 337 GLN A OE1 1 
ATOM   2497  N NE2 . GLN A 1 337 ? 4.849   -15.472 225.062 1.00 156.19 ? 337 GLN A NE2 1 
ATOM   2498  N N   . GLY A 1 338 ? 2.915   -18.879 220.321 1.00 94.59  ? 338 GLY A N   1 
ATOM   2499  C CA  . GLY A 1 338 ? 1.965   -19.952 220.273 1.00 89.97  ? 338 GLY A CA  1 
ATOM   2500  C C   . GLY A 1 338 ? 2.559   -21.278 219.936 1.00 83.87  ? 338 GLY A C   1 
ATOM   2501  O O   . GLY A 1 338 ? 3.573   -21.343 219.227 1.00 87.90  ? 338 GLY A O   1 
ATOM   2502  N N   . GLN A 1 339 ? 1.846   -22.311 220.394 1.00 78.48  ? 339 GLN A N   1 
ATOM   2503  C CA  . GLN A 1 339 ? 2.192   -23.708 220.234 1.00 72.55  ? 339 GLN A CA  1 
ATOM   2504  C C   . GLN A 1 339 ? 3.251   -23.985 219.144 1.00 69.28  ? 339 GLN A C   1 
ATOM   2505  O O   . GLN A 1 339 ? 3.185   -23.491 218.011 1.00 70.50  ? 339 GLN A O   1 
ATOM   2506  C CB  . GLN A 1 339 ? 0.920   -24.555 220.084 1.00 77.35  ? 339 GLN A CB  1 
ATOM   2507  C CG  . GLN A 1 339 ? 1.147   -26.070 220.199 1.00 88.03  ? 339 GLN A CG  1 
ATOM   2508  C CD  . GLN A 1 339 ? -0.123  -26.897 220.458 1.00 93.16  ? 339 GLN A CD  1 
ATOM   2509  O OE1 . GLN A 1 339 ? -0.077  -27.930 221.138 1.00 94.03  ? 339 GLN A OE1 1 
ATOM   2510  N NE2 . GLN A 1 339 ? -1.260  -26.429 219.949 1.00 94.88  ? 339 GLN A NE2 1 
ATOM   2511  N N   . PRO A 1 340 ? 4.299   -24.708 219.534 1.00 64.08  ? 340 PRO A N   1 
ATOM   2512  C CA  . PRO A 1 340 ? 5.480   -25.151 218.801 1.00 60.93  ? 340 PRO A CA  1 
ATOM   2513  C C   . PRO A 1 340 ? 5.328   -25.690 217.423 1.00 60.49  ? 340 PRO A C   1 
ATOM   2514  O O   . PRO A 1 340 ? 4.931   -26.812 217.229 1.00 54.59  ? 340 PRO A O   1 
ATOM   2515  C CB  . PRO A 1 340 ? 6.075   -26.212 219.719 1.00 64.11  ? 340 PRO A CB  1 
ATOM   2516  C CG  . PRO A 1 340 ? 4.981   -26.535 220.726 1.00 63.97  ? 340 PRO A CG  1 
ATOM   2517  C CD  . PRO A 1 340 ? 4.329   -25.227 220.910 1.00 62.69  ? 340 PRO A CD  1 
ATOM   2518  N N   . MET A 1 341 ? 5.686   -24.894 216.449 1.00 69.08  ? 341 MET A N   1 
ATOM   2519  C CA  . MET A 1 341 ? 5.599   -25.389 215.094 1.00 84.20  ? 341 MET A CA  1 
ATOM   2520  C C   . MET A 1 341 ? 6.985   -25.501 214.478 1.00 95.04  ? 341 MET A C   1 
ATOM   2521  O O   . MET A 1 341 ? 7.166   -25.618 213.264 1.00 97.32  ? 341 MET A O   1 
ATOM   2522  C CB  . MET A 1 341 ? 4.614   -24.566 214.254 1.00 81.47  ? 341 MET A CB  1 
ATOM   2523  C CG  . MET A 1 341 ? 3.153   -24.833 214.635 1.00 71.15  ? 341 MET A CG  1 
ATOM   2524  S SD  . MET A 1 341 ? 2.747   -26.613 214.591 1.00 60.10  ? 341 MET A SD  1 
ATOM   2525  C CE  . MET A 1 341 ? 1.345   -26.723 215.612 1.00 63.48  ? 341 MET A CE  1 
ATOM   2526  N N   . GLU A 1 342 ? 7.968   -25.377 215.350 1.00 106.76 ? 342 GLU A N   1 
ATOM   2527  C CA  . GLU A 1 342 ? 9.358   -25.508 214.961 1.00 120.57 ? 342 GLU A CA  1 
ATOM   2528  C C   . GLU A 1 342 ? 10.022  -25.894 216.269 1.00 122.24 ? 342 GLU A C   1 
ATOM   2529  O O   . GLU A 1 342 ? 9.542   -25.521 217.344 1.00 125.53 ? 342 GLU A O   1 
ATOM   2530  C CB  . GLU A 1 342 ? 9.931   -24.186 214.393 1.00 131.86 ? 342 GLU A CB  1 
ATOM   2531  C CG  . GLU A 1 342 ? 10.088  -23.023 215.390 1.00 150.50 ? 342 GLU A CG  1 
ATOM   2532  C CD  . GLU A 1 342 ? 11.064  -21.954 214.907 1.00 160.58 ? 342 GLU A CD  1 
ATOM   2533  O OE1 . GLU A 1 342 ? 10.700  -21.187 213.964 1.00 167.52 ? 342 GLU A OE1 1 
ATOM   2534  O OE2 . GLU A 1 342 ? 12.195  -21.885 215.481 1.00 164.93 ? 342 GLU A OE2 1 
ATOM   2535  N N   . GLY A 1 343 ? 11.020  -26.757 216.207 1.00 121.33 ? 343 GLY A N   1 
ATOM   2536  C CA  . GLY A 1 343 ? 11.673  -27.128 217.439 1.00 120.02 ? 343 GLY A CA  1 
ATOM   2537  C C   . GLY A 1 343 ? 11.615  -28.610 217.637 1.00 118.35 ? 343 GLY A C   1 
ATOM   2538  O O   . GLY A 1 343 ? 11.018  -29.329 216.846 1.00 119.31 ? 343 GLY A O   1 
ATOM   2539  N N   . GLU A 1 344 ? 12.160  -29.056 218.749 1.00 117.85 ? 344 GLU A N   1 
ATOM   2540  C CA  . GLU A 1 344 ? 12.201  -30.464 219.042 1.00 118.06 ? 344 GLU A CA  1 
ATOM   2541  C C   . GLU A 1 344 ? 10.893  -30.908 219.652 1.00 111.24 ? 344 GLU A C   1 
ATOM   2542  O O   . GLU A 1 344 ? 10.791  -31.997 220.206 1.00 109.19 ? 344 GLU A O   1 
ATOM   2543  C CB  . GLU A 1 344 ? 13.387  -30.772 219.966 1.00 131.35 ? 344 GLU A CB  1 
ATOM   2544  C CG  . GLU A 1 344 ? 13.444  -29.945 221.285 1.00 152.04 ? 344 GLU A CG  1 
ATOM   2545  C CD  . GLU A 1 344 ? 14.713  -30.220 222.137 1.00 162.35 ? 344 GLU A CD  1 
ATOM   2546  O OE1 . GLU A 1 344 ? 15.826  -30.324 221.553 1.00 168.66 ? 344 GLU A OE1 1 
ATOM   2547  O OE2 . GLU A 1 344 ? 14.599  -30.328 223.388 1.00 168.88 ? 344 GLU A OE2 1 
ATOM   2548  N N   . ASN A 1 345 ? 9.872   -30.078 219.515 1.00 106.73 ? 345 ASN A N   1 
ATOM   2549  C CA  . ASN A 1 345 ? 8.585   -30.422 220.071 1.00 106.71 ? 345 ASN A CA  1 
ATOM   2550  C C   . ASN A 1 345 ? 7.421   -30.011 219.188 1.00 100.65 ? 345 ASN A C   1 
ATOM   2551  O O   . ASN A 1 345 ? 6.265   -30.027 219.628 1.00 102.61 ? 345 ASN A O   1 
ATOM   2552  C CB  . ASN A 1 345 ? 8.434   -29.813 221.468 1.00 116.87 ? 345 ASN A CB  1 
ATOM   2553  C CG  . ASN A 1 345 ? 8.689   -30.827 222.588 1.00 126.33 ? 345 ASN A CG  1 
ATOM   2554  O OD1 . ASN A 1 345 ? 9.265   -30.487 223.628 1.00 131.85 ? 345 ASN A OD1 1 
ATOM   2555  N ND2 . ASN A 1 345 ? 8.233   -32.068 222.393 1.00 132.18 ? 345 ASN A ND2 1 
ATOM   2556  N N   . THR A 1 346 ? 7.721   -29.734 217.925 1.00 90.59  ? 346 THR A N   1 
ATOM   2557  C CA  . THR A 1 346 ? 6.716   -29.298 216.958 1.00 82.56  ? 346 THR A CA  1 
ATOM   2558  C C   . THR A 1 346 ? 5.466   -30.211 216.804 1.00 78.59  ? 346 THR A C   1 
ATOM   2559  O O   . THR A 1 346 ? 5.569   -31.433 216.903 1.00 80.02  ? 346 THR A O   1 
ATOM   2560  C CB  . THR A 1 346 ? 7.400   -29.064 215.600 1.00 80.45  ? 346 THR A CB  1 
ATOM   2561  O OG1 . THR A 1 346 ? 6.420   -28.877 214.578 1.00 79.04  ? 346 THR A OG1 1 
ATOM   2562  C CG2 . THR A 1 346 ? 8.265   -30.235 215.243 1.00 79.78  ? 346 THR A CG2 1 
ATOM   2563  N N   . GLN A 1 347 ? 4.288   -29.605 216.609 1.00 71.36  ? 347 GLN A N   1 
ATOM   2564  C CA  . GLN A 1 347 ? 3.040   -30.353 216.428 1.00 63.82  ? 347 GLN A CA  1 
ATOM   2565  C C   . GLN A 1 347 ? 2.769   -30.562 214.953 1.00 60.34  ? 347 GLN A C   1 
ATOM   2566  O O   . GLN A 1 347 ? 1.608   -30.565 214.530 1.00 58.32  ? 347 GLN A O   1 
ATOM   2567  C CB  . GLN A 1 347 ? 1.836   -29.628 217.019 1.00 63.94  ? 347 GLN A CB  1 
ATOM   2568  C CG  . GLN A 1 347 ? 1.593   -29.834 218.495 1.00 66.67  ? 347 GLN A CG  1 
ATOM   2569  C CD  . GLN A 1 347 ? 2.511   -29.023 219.355 1.00 68.28  ? 347 GLN A CD  1 
ATOM   2570  O OE1 . GLN A 1 347 ? 2.746   -29.332 220.538 1.00 68.13  ? 347 GLN A OE1 1 
ATOM   2571  N NE2 . GLN A 1 347 ? 3.018   -27.940 218.783 1.00 72.89  ? 347 GLN A NE2 1 
ATOM   2572  N N   . VAL A 1 348 ? 3.850   -30.657 214.180 1.00 56.89  ? 348 VAL A N   1 
ATOM   2573  C CA  . VAL A 1 348 ? 3.813   -30.895 212.742 1.00 53.63  ? 348 VAL A CA  1 
ATOM   2574  C C   . VAL A 1 348 ? 4.171   -32.352 212.526 1.00 54.50  ? 348 VAL A C   1 
ATOM   2575  O O   . VAL A 1 348 ? 5.350   -32.700 212.521 1.00 55.91  ? 348 VAL A O   1 
ATOM   2576  C CB  . VAL A 1 348 ? 4.861   -30.064 212.018 1.00 50.56  ? 348 VAL A CB  1 
ATOM   2577  C CG1 . VAL A 1 348 ? 4.997   -30.513 210.576 1.00 49.44  ? 348 VAL A CG1 1 
ATOM   2578  C CG2 . VAL A 1 348 ? 4.473   -28.643 212.068 1.00 52.53  ? 348 VAL A CG2 1 
ATOM   2579  N N   . GLU A 1 349 ? 3.163   -33.196 212.328 1.00 54.24  ? 349 GLU A N   1 
ATOM   2580  C CA  . GLU A 1 349 ? 3.397   -34.621 212.141 1.00 55.29  ? 349 GLU A CA  1 
ATOM   2581  C C   . GLU A 1 349 ? 4.016   -34.998 210.787 1.00 51.37  ? 349 GLU A C   1 
ATOM   2582  O O   . GLU A 1 349 ? 4.672   -36.049 210.640 1.00 49.14  ? 349 GLU A O   1 
ATOM   2583  C CB  . GLU A 1 349 ? 2.111   -35.393 212.379 1.00 60.65  ? 349 GLU A CB  1 
ATOM   2584  C CG  . GLU A 1 349 ? 1.658   -35.460 213.824 1.00 75.44  ? 349 GLU A CG  1 
ATOM   2585  C CD  . GLU A 1 349 ? 0.962   -36.787 214.145 1.00 87.05  ? 349 GLU A CD  1 
ATOM   2586  O OE1 . GLU A 1 349 ? 1.573   -37.858 213.867 1.00 91.94  ? 349 GLU A OE1 1 
ATOM   2587  O OE2 . GLU A 1 349 ? -0.183  -36.765 214.680 1.00 92.14  ? 349 GLU A OE2 1 
ATOM   2588  N N   . GLU A 1 350 ? 3.759   -34.184 209.782 1.00 46.58  ? 350 GLU A N   1 
ATOM   2589  C CA  . GLU A 1 350 ? 4.334   -34.443 208.496 1.00 44.86  ? 350 GLU A CA  1 
ATOM   2590  C C   . GLU A 1 350 ? 3.997   -33.343 207.562 1.00 42.10  ? 350 GLU A C   1 
ATOM   2591  O O   . GLU A 1 350 ? 3.095   -32.529 207.790 1.00 43.28  ? 350 GLU A O   1 
ATOM   2592  C CB  . GLU A 1 350 ? 3.892   -35.765 207.884 1.00 57.59  ? 350 GLU A CB  1 
ATOM   2593  C CG  . GLU A 1 350 ? 3.413   -35.594 206.439 1.00 72.57  ? 350 GLU A CG  1 
ATOM   2594  C CD  . GLU A 1 350 ? 3.277   -36.853 205.642 1.00 83.53  ? 350 GLU A CD  1 
ATOM   2595  O OE1 . GLU A 1 350 ? 4.232   -37.657 205.572 1.00 92.77  ? 350 GLU A OE1 1 
ATOM   2596  O OE2 . GLU A 1 350 ? 2.185   -37.054 205.082 1.00 85.94  ? 350 GLU A OE2 1 
ATOM   2597  N N   . VAL A 1 351 ? 4.738   -33.381 206.474 1.00 34.93  ? 351 VAL A N   1 
ATOM   2598  C CA  . VAL A 1 351 ? 4.651   -32.439 205.418 1.00 31.32  ? 351 VAL A CA  1 
ATOM   2599  C C   . VAL A 1 351 ? 5.128   -33.152 204.192 1.00 27.87  ? 351 VAL A C   1 
ATOM   2600  O O   . VAL A 1 351 ? 6.036   -33.958 204.270 1.00 27.72  ? 351 VAL A O   1 
ATOM   2601  C CB  . VAL A 1 351 ? 5.641   -31.333 205.696 1.00 29.47  ? 351 VAL A CB  1 
ATOM   2602  C CG1 . VAL A 1 351 ? 6.112   -30.723 204.420 1.00 28.43  ? 351 VAL A CG1 1 
ATOM   2603  C CG2 . VAL A 1 351 ? 5.006   -30.299 206.597 1.00 31.35  ? 351 VAL A CG2 1 
ATOM   2604  N N   . ARG A 1 352 ? 4.582   -32.785 203.050 1.00 29.42  ? 352 ARG A N   1 
ATOM   2605  C CA  . ARG A 1 352 ? 5.014   -33.354 201.801 1.00 30.60  ? 352 ARG A CA  1 
ATOM   2606  C C   . ARG A 1 352 ? 4.748   -32.374 200.685 1.00 31.48  ? 352 ARG A C   1 
ATOM   2607  O O   . ARG A 1 352 ? 3.943   -31.438 200.794 1.00 29.69  ? 352 ARG A O   1 
ATOM   2608  C CB  . ARG A 1 352 ? 4.290   -34.627 201.556 1.00 31.97  ? 352 ARG A CB  1 
ATOM   2609  C CG  . ARG A 1 352 ? 2.883   -34.441 201.915 1.00 45.57  ? 352 ARG A CG  1 
ATOM   2610  C CD  . ARG A 1 352 ? 2.425   -35.596 202.685 1.00 57.37  ? 352 ARG A CD  1 
ATOM   2611  N NE  . ARG A 1 352 ? 2.826   -36.857 202.048 1.00 66.08  ? 352 ARG A NE  1 
ATOM   2612  C CZ  . ARG A 1 352 ? 2.098   -37.968 202.082 1.00 68.57  ? 352 ARG A CZ  1 
ATOM   2613  N NH1 . ARG A 1 352 ? 0.928   -37.964 202.729 1.00 71.70  ? 352 ARG A NH1 1 
ATOM   2614  N NH2 . ARG A 1 352 ? 2.555   -39.081 201.497 1.00 69.39  ? 352 ARG A NH2 1 
ATOM   2615  N N   . VAL A 1 353 ? 5.461   -32.571 199.605 1.00 33.01  ? 353 VAL A N   1 
ATOM   2616  C CA  . VAL A 1 353 ? 5.300   -31.694 198.500 1.00 36.56  ? 353 VAL A CA  1 
ATOM   2617  C C   . VAL A 1 353 ? 5.197   -32.540 197.290 1.00 39.79  ? 353 VAL A C   1 
ATOM   2618  O O   . VAL A 1 353 ? 5.914   -33.535 197.165 1.00 37.14  ? 353 VAL A O   1 
ATOM   2619  C CB  . VAL A 1 353 ? 6.488   -30.808 198.371 1.00 38.86  ? 353 VAL A CB  1 
ATOM   2620  C CG1 . VAL A 1 353 ? 6.390   -30.005 197.101 1.00 44.70  ? 353 VAL A CG1 1 
ATOM   2621  C CG2 . VAL A 1 353 ? 6.568   -29.896 199.573 1.00 41.17  ? 353 VAL A CG2 1 
ATOM   2622  N N   . TYR A 1 354 ? 4.286   -32.148 196.413 1.00 44.33  ? 354 TYR A N   1 
ATOM   2623  C CA  . TYR A 1 354 ? 4.046   -32.850 195.172 1.00 52.63  ? 354 TYR A CA  1 
ATOM   2624  C C   . TYR A 1 354 ? 4.138   -31.847 194.069 1.00 56.17  ? 354 TYR A C   1 
ATOM   2625  O O   . TYR A 1 354 ? 3.967   -30.657 194.328 1.00 53.70  ? 354 TYR A O   1 
ATOM   2626  C CB  . TYR A 1 354 ? 2.623   -33.333 195.140 1.00 56.86  ? 354 TYR A CB  1 
ATOM   2627  C CG  . TYR A 1 354 ? 2.268   -34.322 196.189 1.00 63.65  ? 354 TYR A CG  1 
ATOM   2628  C CD1 . TYR A 1 354 ? 2.253   -33.976 197.531 1.00 66.91  ? 354 TYR A CD1 1 
ATOM   2629  C CD2 . TYR A 1 354 ? 1.889   -35.605 195.831 1.00 69.09  ? 354 TYR A CD2 1 
ATOM   2630  C CE1 . TYR A 1 354 ? 1.857   -34.897 198.501 1.00 73.43  ? 354 TYR A CE1 1 
ATOM   2631  C CE2 . TYR A 1 354 ? 1.489   -36.532 196.781 1.00 76.04  ? 354 TYR A CE2 1 
ATOM   2632  C CZ  . TYR A 1 354 ? 1.471   -36.180 198.120 1.00 76.07  ? 354 TYR A CZ  1 
ATOM   2633  O OH  . TYR A 1 354 ? 1.056   -37.130 199.044 1.00 79.24  ? 354 TYR A OH  1 
ATOM   2634  N N   . ASP A 1 355 ? 4.394   -32.307 192.848 1.00 62.45  ? 355 ASP A N   1 
ATOM   2635  C CA  . ASP A 1 355 ? 4.404   -31.381 191.718 1.00 73.99  ? 355 ASP A CA  1 
ATOM   2636  C C   . ASP A 1 355 ? 3.988   -32.050 190.437 1.00 76.26  ? 355 ASP A C   1 
ATOM   2637  O O   . ASP A 1 355 ? 3.070   -31.600 189.735 1.00 77.71  ? 355 ASP A O   1 
ATOM   2638  C CB  . ASP A 1 355 ? 5.750   -30.689 191.499 1.00 83.81  ? 355 ASP A CB  1 
ATOM   2639  C CG  . ASP A 1 355 ? 5.687   -29.597 190.398 1.00 94.36  ? 355 ASP A CG  1 
ATOM   2640  O OD1 . ASP A 1 355 ? 5.826   -29.951 189.200 1.00 101.38 ? 355 ASP A OD1 1 
ATOM   2641  O OD2 . ASP A 1 355 ? 5.509   -28.389 190.725 1.00 98.62  ? 355 ASP A OD2 1 
ATOM   2642  N N   . GLY A 1 356 ? 4.648   -33.149 190.130 1.00 78.56  ? 356 GLY A N   1 
ATOM   2643  C CA  . GLY A 1 356 ? 4.321   -33.826 188.892 1.00 82.06  ? 356 GLY A CA  1 
ATOM   2644  C C   . GLY A 1 356 ? 3.095   -34.720 188.879 1.00 79.81  ? 356 GLY A C   1 
ATOM   2645  O O   . GLY A 1 356 ? 2.100   -34.512 189.585 1.00 75.56  ? 356 GLY A O   1 
ATOM   2646  N N   . THR A 1 357 ? 3.227   -35.784 188.105 1.00 77.68  ? 357 THR A N   1 
ATOM   2647  C CA  . THR A 1 357 ? 2.158   -36.719 187.953 1.00 76.97  ? 357 THR A CA  1 
ATOM   2648  C C   . THR A 1 357 ? 2.636   -38.076 187.528 1.00 76.55  ? 357 THR A C   1 
ATOM   2649  O O   . THR A 1 357 ? 2.624   -38.421 186.341 1.00 78.93  ? 357 THR A O   1 
ATOM   2650  C CB  . THR A 1 357 ? 1.212   -36.212 186.928 1.00 77.48  ? 357 THR A CB  1 
ATOM   2651  O OG1 . THR A 1 357 ? 1.876   -35.211 186.140 1.00 82.54  ? 357 THR A OG1 1 
ATOM   2652  C CG2 . THR A 1 357 ? 0.023   -35.635 187.608 1.00 82.87  ? 357 THR A CG2 1 
ATOM   2653  N N   . GLU A 1 358 ? 3.080   -38.854 188.499 1.00 74.29  ? 358 GLU A N   1 
ATOM   2654  C CA  . GLU A 1 358 ? 3.530   -40.190 188.177 1.00 72.52  ? 358 GLU A CA  1 
ATOM   2655  C C   . GLU A 1 358 ? 2.320   -41.109 188.168 1.00 66.62  ? 358 GLU A C   1 
ATOM   2656  O O   . GLU A 1 358 ? 1.177   -40.673 188.342 1.00 67.24  ? 358 GLU A O   1 
ATOM   2657  C CB  . GLU A 1 358 ? 4.582   -40.688 189.184 1.00 78.21  ? 358 GLU A CB  1 
ATOM   2658  C CG  . GLU A 1 358 ? 4.070   -41.092 190.563 1.00 79.99  ? 358 GLU A CG  1 
ATOM   2659  C CD  . GLU A 1 358 ? 5.176   -41.064 191.599 1.00 81.37  ? 358 GLU A CD  1 
ATOM   2660  O OE1 . GLU A 1 358 ? 6.211   -41.754 191.408 1.00 84.78  ? 358 GLU A OE1 1 
ATOM   2661  O OE2 . GLU A 1 358 ? 5.033   -40.305 192.588 1.00 80.10  ? 358 GLU A OE2 1 
ATOM   2662  N N   . PRO A 1 359 ? 2.529   -42.349 187.761 1.00 59.52  ? 359 PRO A N   1 
ATOM   2663  C CA  . PRO A 1 359 ? 1.318   -43.148 187.807 1.00 50.31  ? 359 PRO A CA  1 
ATOM   2664  C C   . PRO A 1 359 ? 1.290   -43.880 189.119 1.00 41.50  ? 359 PRO A C   1 
ATOM   2665  O O   . PRO A 1 359 ? 2.338   -44.220 189.696 1.00 33.68  ? 359 PRO A O   1 
ATOM   2666  C CB  . PRO A 1 359 ? 1.485   -44.076 186.620 1.00 57.77  ? 359 PRO A CB  1 
ATOM   2667  C CG  . PRO A 1 359 ? 2.368   -43.252 185.681 1.00 60.38  ? 359 PRO A CG  1 
ATOM   2668  C CD  . PRO A 1 359 ? 3.394   -42.795 186.664 1.00 59.78  ? 359 PRO A CD  1 
ATOM   2669  N N   . VAL A 1 360 ? 0.082   -43.940 189.645 1.00 34.98  ? 360 VAL A N   1 
ATOM   2670  C CA  . VAL A 1 360 ? -0.223  -44.598 190.880 1.00 38.00  ? 360 VAL A CA  1 
ATOM   2671  C C   . VAL A 1 360 ? 0.741   -45.656 191.187 1.00 37.38  ? 360 VAL A C   1 
ATOM   2672  O O   . VAL A 1 360 ? 0.761   -46.706 190.562 1.00 39.52  ? 360 VAL A O   1 
ATOM   2673  C CB  . VAL A 1 360 ? -1.527  -45.294 190.818 1.00 42.40  ? 360 VAL A CB  1 
ATOM   2674  C CG1 . VAL A 1 360 ? -2.595  -44.357 191.188 1.00 53.18  ? 360 VAL A CG1 1 
ATOM   2675  C CG2 . VAL A 1 360 ? -1.772  -45.840 189.419 1.00 47.51  ? 360 VAL A CG2 1 
ATOM   2676  N N   . PRO A 1 361 ? 1.615   -45.370 192.113 1.00 39.44  ? 361 PRO A N   1 
ATOM   2677  C CA  . PRO A 1 361 ? 2.618   -46.340 192.504 1.00 42.52  ? 361 PRO A CA  1 
ATOM   2678  C C   . PRO A 1 361 ? 2.043   -47.293 193.521 1.00 43.55  ? 361 PRO A C   1 
ATOM   2679  O O   . PRO A 1 361 ? 1.117   -46.942 194.279 1.00 39.79  ? 361 PRO A O   1 
ATOM   2680  C CB  . PRO A 1 361 ? 3.709   -45.463 193.072 1.00 44.85  ? 361 PRO A CB  1 
ATOM   2681  C CG  . PRO A 1 361 ? 2.901   -44.347 193.702 1.00 45.77  ? 361 PRO A CG  1 
ATOM   2682  C CD  . PRO A 1 361 ? 1.906   -44.037 192.648 1.00 40.34  ? 361 PRO A CD  1 
ATOM   2683  N N   . GLY A 1 362 ? 2.622   -48.491 193.501 1.00 47.68  ? 362 GLY A N   1 
ATOM   2684  C CA  . GLY A 1 362 ? 2.243   -49.590 194.370 1.00 58.01  ? 362 GLY A CA  1 
ATOM   2685  C C   . GLY A 1 362 ? 2.110   -49.302 195.857 1.00 62.36  ? 362 GLY A C   1 
ATOM   2686  O O   . GLY A 1 362 ? 1.052   -49.536 196.427 1.00 67.53  ? 362 GLY A O   1 
ATOM   2687  N N   . ASP A 1 363 ? 3.179   -48.909 196.534 1.00 61.63  ? 363 ASP A N   1 
ATOM   2688  C CA  . ASP A 1 363 ? 3.011   -48.612 197.933 1.00 59.72  ? 363 ASP A CA  1 
ATOM   2689  C C   . ASP A 1 363 ? 2.610   -47.175 197.949 1.00 59.97  ? 363 ASP A C   1 
ATOM   2690  O O   . ASP A 1 363 ? 3.046   -46.395 197.126 1.00 58.83  ? 363 ASP A O   1 
ATOM   2691  C CB  . ASP A 1 363 ? 4.275   -48.802 198.735 1.00 63.53  ? 363 ASP A CB  1 
ATOM   2692  C CG  . ASP A 1 363 ? 4.040   -48.615 200.213 1.00 69.38  ? 363 ASP A CG  1 
ATOM   2693  O OD1 . ASP A 1 363 ? 4.083   -47.469 200.663 1.00 68.86  ? 363 ASP A OD1 1 
ATOM   2694  O OD2 . ASP A 1 363 ? 3.770   -49.602 200.930 1.00 77.75  ? 363 ASP A OD2 1 
ATOM   2695  N N   . PRO A 1 364 ? 1.682   -46.835 198.820 1.00 63.17  ? 364 PRO A N   1 
ATOM   2696  C CA  . PRO A 1 364 ? 1.159   -45.483 198.981 1.00 68.70  ? 364 PRO A CA  1 
ATOM   2697  C C   . PRO A 1 364 ? 1.835   -44.786 200.176 1.00 74.29  ? 364 PRO A C   1 
ATOM   2698  O O   . PRO A 1 364 ? 1.968   -43.543 200.232 1.00 74.48  ? 364 PRO A O   1 
ATOM   2699  C CB  . PRO A 1 364 ? -0.298  -45.765 199.249 1.00 67.83  ? 364 PRO A CB  1 
ATOM   2700  C CG  . PRO A 1 364 ? -0.202  -46.988 200.175 1.00 65.51  ? 364 PRO A CG  1 
ATOM   2701  C CD  . PRO A 1 364 ? 0.873   -47.823 199.557 1.00 63.16  ? 364 PRO A CD  1 
ATOM   2702  N N   . ASP A 1 365 ? 2.256   -45.620 201.125 1.00 80.16  ? 365 ASP A N   1 
ATOM   2703  C CA  . ASP A 1 365 ? 2.923   -45.188 202.337 1.00 86.30  ? 365 ASP A CA  1 
ATOM   2704  C C   . ASP A 1 365 ? 4.262   -44.616 201.894 1.00 82.64  ? 365 ASP A C   1 
ATOM   2705  O O   . ASP A 1 365 ? 4.904   -43.847 202.623 1.00 84.73  ? 365 ASP A O   1 
ATOM   2706  C CB  . ASP A 1 365 ? 3.155   -46.411 203.230 1.00 100.75 ? 365 ASP A CB  1 
ATOM   2707  C CG  . ASP A 1 365 ? 2.785   -46.168 204.688 1.00 118.26 ? 365 ASP A CG  1 
ATOM   2708  O OD1 . ASP A 1 365 ? 2.835   -45.002 205.165 1.00 125.59 ? 365 ASP A OD1 1 
ATOM   2709  O OD2 . ASP A 1 365 ? 2.462   -47.179 205.362 1.00 125.86 ? 365 ASP A OD2 1 
ATOM   2710  N N   . MET A 1 366 ? 4.647   -44.991 200.674 1.00 76.56  ? 366 MET A N   1 
ATOM   2711  C CA  . MET A 1 366 ? 5.886   -44.598 200.031 1.00 70.98  ? 366 MET A CA  1 
ATOM   2712  C C   . MET A 1 366 ? 6.478   -43.295 200.514 1.00 68.89  ? 366 MET A C   1 
ATOM   2713  O O   . MET A 1 366 ? 5.775   -42.291 200.686 1.00 66.74  ? 366 MET A O   1 
ATOM   2714  C CB  . MET A 1 366 ? 5.697   -44.530 198.528 1.00 70.58  ? 366 MET A CB  1 
ATOM   2715  C CG  . MET A 1 366 ? 6.919   -43.997 197.814 1.00 76.80  ? 366 MET A CG  1 
ATOM   2716  S SD  . MET A 1 366 ? 6.531   -42.843 196.465 1.00 84.01  ? 366 MET A SD  1 
ATOM   2717  C CE  . MET A 1 366 ? 7.049   -43.785 195.007 1.00 81.94  ? 366 MET A CE  1 
ATOM   2718  N N   . THR A 1 367 ? 7.772   -43.344 200.800 1.00 68.22  ? 367 THR A N   1 
ATOM   2719  C CA  . THR A 1 367 ? 8.490   -42.168 201.245 1.00 66.83  ? 367 THR A CA  1 
ATOM   2720  C C   . THR A 1 367 ? 9.403   -41.790 200.109 1.00 63.94  ? 367 THR A C   1 
ATOM   2721  O O   . THR A 1 367 ? 9.730   -42.620 199.244 1.00 68.81  ? 367 THR A O   1 
ATOM   2722  C CB  . THR A 1 367 ? 9.355   -42.428 202.478 1.00 68.18  ? 367 THR A CB  1 
ATOM   2723  O OG1 . THR A 1 367 ? 8.679   -43.321 203.377 1.00 75.34  ? 367 THR A OG1 1 
ATOM   2724  C CG2 . THR A 1 367 ? 9.640   -41.103 203.189 1.00 67.11  ? 367 THR A CG2 1 
ATOM   2725  N N   . ARG A 1 368 ? 9.860   -40.555 200.133 1.00 59.02  ? 368 ARG A N   1 
ATOM   2726  C CA  . ARG A 1 368 ? 10.709  -40.102 199.077 1.00 58.25  ? 368 ARG A CA  1 
ATOM   2727  C C   . ARG A 1 368 ? 11.204  -38.718 199.398 1.00 60.44  ? 368 ARG A C   1 
ATOM   2728  O O   . ARG A 1 368 ? 10.568  -37.965 200.137 1.00 57.19  ? 368 ARG A O   1 
ATOM   2729  C CB  . ARG A 1 368 ? 9.930   -40.165 197.771 1.00 55.51  ? 368 ARG A CB  1 
ATOM   2730  C CG  . ARG A 1 368 ? 10.251  -39.112 196.790 1.00 56.23  ? 368 ARG A CG  1 
ATOM   2731  C CD  . ARG A 1 368 ? 9.261   -39.172 195.692 1.00 58.59  ? 368 ARG A CD  1 
ATOM   2732  N NE  . ARG A 1 368 ? 9.365   -40.395 194.894 1.00 63.38  ? 368 ARG A NE  1 
ATOM   2733  C CZ  . ARG A 1 368 ? 8.482   -40.722 193.949 1.00 67.82  ? 368 ARG A CZ  1 
ATOM   2734  N NH1 . ARG A 1 368 ? 7.438   -39.930 193.720 1.00 71.30  ? 368 ARG A NH1 1 
ATOM   2735  N NH2 . ARG A 1 368 ? 8.700   -41.748 193.137 1.00 69.13  ? 368 ARG A NH2 1 
ATOM   2736  N N   . TYR A 1 369 ? 12.347  -38.390 198.819 1.00 67.45  ? 369 TYR A N   1 
ATOM   2737  C CA  . TYR A 1 369 ? 12.998  -37.121 199.066 1.00 76.47  ? 369 TYR A CA  1 
ATOM   2738  C C   . TYR A 1 369 ? 14.179  -36.920 198.101 1.00 76.41  ? 369 TYR A C   1 
ATOM   2739  O O   . TYR A 1 369 ? 14.438  -37.723 197.197 1.00 73.32  ? 369 TYR A O   1 
ATOM   2740  C CB  . TYR A 1 369 ? 13.566  -37.160 200.474 1.00 86.56  ? 369 TYR A CB  1 
ATOM   2741  C CG  . TYR A 1 369 ? 14.686  -38.152 200.509 1.00 99.70  ? 369 TYR A CG  1 
ATOM   2742  C CD1 . TYR A 1 369 ? 14.480  -39.471 200.098 1.00 104.77 ? 369 TYR A CD1 1 
ATOM   2743  C CD2 . TYR A 1 369 ? 15.975  -37.757 200.818 1.00 108.21 ? 369 TYR A CD2 1 
ATOM   2744  C CE1 . TYR A 1 369 ? 15.537  -40.377 199.980 1.00 114.16 ? 369 TYR A CE1 1 
ATOM   2745  C CE2 . TYR A 1 369 ? 17.054  -38.656 200.709 1.00 116.88 ? 369 TYR A CE2 1 
ATOM   2746  C CZ  . TYR A 1 369 ? 16.834  -39.972 200.287 1.00 117.31 ? 369 TYR A CZ  1 
ATOM   2747  O OH  . TYR A 1 369 ? 17.901  -40.871 200.181 1.00 118.47 ? 369 TYR A OH  1 
ATOM   2748  N N   . VAL A 1 370 ? 14.968  -35.901 198.403 1.00 76.75  ? 370 VAL A N   1 
ATOM   2749  C CA  . VAL A 1 370 ? 16.121  -35.567 197.602 1.00 77.80  ? 370 VAL A CA  1 
ATOM   2750  C C   . VAL A 1 370 ? 17.383  -35.683 198.399 1.00 78.86  ? 370 VAL A C   1 
ATOM   2751  O O   . VAL A 1 370 ? 17.495  -35.127 199.497 1.00 80.10  ? 370 VAL A O   1 
ATOM   2752  C CB  . VAL A 1 370 ? 16.025  -34.154 197.086 1.00 79.16  ? 370 VAL A CB  1 
ATOM   2753  C CG1 . VAL A 1 370 ? 17.321  -33.747 196.351 1.00 80.61  ? 370 VAL A CG1 1 
ATOM   2754  C CG2 . VAL A 1 370 ? 14.832  -34.052 196.185 1.00 80.11  ? 370 VAL A CG2 1 
ATOM   2755  N N   . ASP A 1 371 ? 18.346  -36.384 197.820 1.00 80.70  ? 371 ASP A N   1 
ATOM   2756  C CA  . ASP A 1 371 ? 19.629  -36.592 198.460 1.00 81.92  ? 371 ASP A CA  1 
ATOM   2757  C C   . ASP A 1 371 ? 20.428  -35.382 198.104 1.00 79.96  ? 371 ASP A C   1 
ATOM   2758  O O   . ASP A 1 371 ? 19.984  -34.539 197.310 1.00 79.17  ? 371 ASP A O   1 
ATOM   2759  C CB  . ASP A 1 371 ? 20.326  -37.845 197.892 1.00 86.83  ? 371 ASP A CB  1 
ATOM   2760  C CG  . ASP A 1 371 ? 20.779  -37.664 196.442 1.00 88.59  ? 371 ASP A CG  1 
ATOM   2761  O OD1 . ASP A 1 371 ? 21.776  -36.963 196.249 1.00 91.77  ? 371 ASP A OD1 1 
ATOM   2762  O OD2 . ASP A 1 371 ? 20.173  -38.209 195.495 1.00 90.96  ? 371 ASP A OD2 1 
ATOM   2763  N N   . ARG A 1 372 ? 21.646  -35.364 198.621 1.00 75.62  ? 372 ARG A N   1 
ATOM   2764  C CA  . ARG A 1 372 ? 22.589  -34.298 198.368 1.00 72.34  ? 372 ARG A CA  1 
ATOM   2765  C C   . ARG A 1 372 ? 22.445  -33.656 197.007 1.00 67.71  ? 372 ARG A C   1 
ATOM   2766  O O   . ARG A 1 372 ? 22.808  -32.517 196.849 1.00 70.21  ? 372 ARG A O   1 
ATOM   2767  C CB  . ARG A 1 372 ? 23.990  -34.845 198.463 1.00 76.85  ? 372 ARG A CB  1 
ATOM   2768  C CG  . ARG A 1 372 ? 24.917  -33.975 199.232 1.00 90.95  ? 372 ARG A CG  1 
ATOM   2769  C CD  . ARG A 1 372 ? 25.959  -34.844 199.918 1.00 104.12 ? 372 ARG A CD  1 
ATOM   2770  N NE  . ARG A 1 372 ? 25.636  -35.244 201.300 1.00 117.06 ? 372 ARG A NE  1 
ATOM   2771  C CZ  . ARG A 1 372 ? 24.635  -36.050 201.689 1.00 124.66 ? 372 ARG A CZ  1 
ATOM   2772  N NH1 . ARG A 1 372 ? 23.767  -36.589 200.819 1.00 127.43 ? 372 ARG A NH1 1 
ATOM   2773  N NH2 . ARG A 1 372 ? 24.562  -36.409 202.971 1.00 129.44 ? 372 ARG A NH2 1 
ATOM   2774  N N   . PHE A 1 373 ? 21.917  -34.372 196.024 1.00 59.88  ? 373 PHE A N   1 
ATOM   2775  C CA  . PHE A 1 373 ? 21.784  -33.821 194.694 1.00 62.27  ? 373 PHE A CA  1 
ATOM   2776  C C   . PHE A 1 373 ? 20.626  -34.321 193.786 1.00 70.16  ? 373 PHE A C   1 
ATOM   2777  O O   . PHE A 1 373 ? 20.440  -33.762 192.712 1.00 76.19  ? 373 PHE A O   1 
ATOM   2778  C CB  . PHE A 1 373 ? 23.122  -33.958 193.904 1.00 57.94  ? 373 PHE A CB  1 
ATOM   2779  C CG  . PHE A 1 373 ? 24.313  -34.548 194.703 1.00 61.61  ? 373 PHE A CG  1 
ATOM   2780  C CD1 . PHE A 1 373 ? 25.066  -33.766 195.574 1.00 65.36  ? 373 PHE A CD1 1 
ATOM   2781  C CD2 . PHE A 1 373 ? 24.738  -35.862 194.511 1.00 64.70  ? 373 PHE A CD2 1 
ATOM   2782  C CE1 . PHE A 1 373 ? 26.217  -34.280 196.229 1.00 62.67  ? 373 PHE A CE1 1 
ATOM   2783  C CE2 . PHE A 1 373 ? 25.901  -36.374 195.177 1.00 59.94  ? 373 PHE A CE2 1 
ATOM   2784  C CZ  . PHE A 1 373 ? 26.625  -35.577 196.027 1.00 54.85  ? 373 PHE A CZ  1 
ATOM   2785  N N   . GLY A 1 374 ? 19.819  -35.312 194.173 1.00 75.77  ? 374 GLY A N   1 
ATOM   2786  C CA  . GLY A 1 374 ? 18.798  -35.812 193.237 1.00 80.94  ? 374 GLY A CA  1 
ATOM   2787  C C   . GLY A 1 374 ? 17.553  -36.360 193.903 1.00 85.89  ? 374 GLY A C   1 
ATOM   2788  O O   . GLY A 1 374 ? 17.397  -36.134 195.091 1.00 88.52  ? 374 GLY A O   1 
ATOM   2789  N N   . LYS A 1 375 ? 16.711  -37.137 193.210 1.00 88.32  ? 375 LYS A N   1 
ATOM   2790  C CA  . LYS A 1 375 ? 15.446  -37.634 193.817 1.00 89.93  ? 375 LYS A CA  1 
ATOM   2791  C C   . LYS A 1 375 ? 15.360  -39.116 194.152 1.00 89.03  ? 375 LYS A C   1 
ATOM   2792  O O   . LYS A 1 375 ? 15.638  -39.924 193.285 1.00 92.37  ? 375 LYS A O   1 
ATOM   2793  C CB  . LYS A 1 375 ? 14.294  -37.320 192.880 1.00 93.88  ? 375 LYS A CB  1 
ATOM   2794  C CG  . LYS A 1 375 ? 12.971  -37.180 193.589 1.00 100.15 ? 375 LYS A CG  1 
ATOM   2795  C CD  . LYS A 1 375 ? 12.298  -35.883 193.167 1.00 108.47 ? 375 LYS A CD  1 
ATOM   2796  C CE  . LYS A 1 375 ? 13.294  -34.700 193.241 1.00 115.23 ? 375 LYS A CE  1 
ATOM   2797  N NZ  . LYS A 1 375 ? 12.828  -33.367 192.698 1.00 117.36 ? 375 LYS A NZ  1 
ATOM   2798  N N   . THR A 1 376 ? 14.774  -39.487 195.293 1.00 88.43  ? 376 THR A N   1 
ATOM   2799  C CA  . THR A 1 376 ? 14.719  -40.917 195.665 1.00 93.09  ? 376 THR A CA  1 
ATOM   2800  C C   . THR A 1 376 ? 13.508  -41.577 196.364 1.00 92.07  ? 376 THR A C   1 
ATOM   2801  O O   . THR A 1 376 ? 12.960  -41.034 197.321 1.00 94.65  ? 376 THR A O   1 
ATOM   2802  C CB  . THR A 1 376 ? 15.920  -41.250 196.549 1.00 96.40  ? 376 THR A CB  1 
ATOM   2803  O OG1 . THR A 1 376 ? 17.120  -40.868 195.879 1.00 103.76 ? 376 THR A OG1 1 
ATOM   2804  C CG2 . THR A 1 376 ? 15.977  -42.743 196.864 1.00 101.75 ? 376 THR A CG2 1 
ATOM   2805  N N   . LYS A 1 377 ? 13.134  -42.781 195.928 1.00 90.65  ? 377 LYS A N   1 
ATOM   2806  C CA  . LYS A 1 377 ? 12.056  -43.500 196.588 1.00 90.22  ? 377 LYS A CA  1 
ATOM   2807  C C   . LYS A 1 377 ? 12.788  -44.320 197.614 1.00 88.57  ? 377 LYS A C   1 
ATOM   2808  O O   . LYS A 1 377 ? 13.666  -45.110 197.277 1.00 85.06  ? 377 LYS A O   1 
ATOM   2809  C CB  . LYS A 1 377 ? 11.374  -44.486 195.669 1.00 98.28  ? 377 LYS A CB  1 
ATOM   2810  C CG  . LYS A 1 377 ? 11.073  -44.011 194.269 1.00 112.08 ? 377 LYS A CG  1 
ATOM   2811  C CD  . LYS A 1 377 ? 10.358  -45.157 193.498 1.00 122.28 ? 377 LYS A CD  1 
ATOM   2812  C CE  . LYS A 1 377 ? 10.124  -44.886 191.980 1.00 128.39 ? 377 LYS A CE  1 
ATOM   2813  N NZ  . LYS A 1 377 ? 9.375   -46.007 191.278 1.00 130.95 ? 377 LYS A NZ  1 
ATOM   2814  N N   . THR A 1 378 ? 12.460  -44.106 198.869 1.00 93.04  ? 378 THR A N   1 
ATOM   2815  C CA  . THR A 1 378 ? 13.087  -44.839 199.946 1.00 102.72 ? 378 THR A CA  1 
ATOM   2816  C C   . THR A 1 378 ? 12.778  -46.268 199.730 1.00 112.01 ? 378 THR A C   1 
ATOM   2817  O O   . THR A 1 378 ? 11.614  -46.581 199.459 1.00 114.24 ? 378 THR A O   1 
ATOM   2818  C CB  . THR A 1 378 ? 12.356  -44.616 201.221 1.00 102.64 ? 378 THR A CB  1 
ATOM   2819  O OG1 . THR A 1 378 ? 12.143  -43.220 201.392 1.00 109.94 ? 378 THR A OG1 1 
ATOM   2820  C CG2 . THR A 1 378 ? 13.115  -45.214 202.387 1.00 100.93 ? 378 THR A CG2 1 
ATOM   2821  N N   . VAL A 1 379 ? 13.769  -47.142 199.919 1.00 122.84 ? 379 VAL A N   1 
ATOM   2822  C CA  . VAL A 1 379 ? 13.518  -48.589 199.808 1.00 132.73 ? 379 VAL A CA  1 
ATOM   2823  C C   . VAL A 1 379 ? 12.551  -48.767 200.962 1.00 136.13 ? 379 VAL A C   1 
ATOM   2824  O O   . VAL A 1 379 ? 12.737  -48.146 202.021 1.00 133.43 ? 379 VAL A O   1 
ATOM   2825  C CB  . VAL A 1 379 ? 14.771  -49.471 200.086 1.00 134.98 ? 379 VAL A CB  1 
ATOM   2826  C CG1 . VAL A 1 379 ? 14.369  -50.958 200.125 1.00 134.03 ? 379 VAL A CG1 1 
ATOM   2827  C CG2 . VAL A 1 379 ? 15.841  -49.239 199.016 1.00 137.19 ? 379 VAL A CG2 1 
ATOM   2828  N N   . PHE A 1 380 ? 11.516  -49.574 200.796 1.00 142.61 ? 380 PHE A N   1 
ATOM   2829  C CA  . PHE A 1 380 ? 10.634  -49.618 201.914 1.00 152.43 ? 380 PHE A CA  1 
ATOM   2830  C C   . PHE A 1 380 ? 11.153  -50.148 203.210 1.00 161.26 ? 380 PHE A C   1 
ATOM   2831  O O   . PHE A 1 380 ? 11.485  -51.331 203.323 1.00 162.26 ? 380 PHE A O   1 
ATOM   2832  C CB  . PHE A 1 380 ? 9.189   -49.874 201.575 1.00 152.14 ? 380 PHE A CB  1 
ATOM   2833  C CG  . PHE A 1 380 ? 8.373   -48.636 201.777 1.00 156.99 ? 380 PHE A CG  1 
ATOM   2834  C CD1 . PHE A 1 380 ? 8.955   -47.387 201.479 1.00 157.32 ? 380 PHE A CD1 1 
ATOM   2835  C CD2 . PHE A 1 380 ? 7.148   -48.664 202.443 1.00 158.94 ? 380 PHE A CD2 1 
ATOM   2836  C CE1 . PHE A 1 380 ? 8.350   -46.204 201.855 1.00 157.83 ? 380 PHE A CE1 1 
ATOM   2837  C CE2 . PHE A 1 380 ? 6.524   -47.470 202.829 1.00 160.59 ? 380 PHE A CE2 1 
ATOM   2838  C CZ  . PHE A 1 380 ? 7.132   -46.239 202.536 1.00 160.20 ? 380 PHE A CZ  1 
ATOM   2839  N N   . PRO A 1 381 ? 11.209  -49.246 204.222 1.00 170.57 ? 381 PRO A N   1 
ATOM   2840  C CA  . PRO A 1 381 ? 11.651  -49.393 205.600 1.00 177.88 ? 381 PRO A CA  1 
ATOM   2841  C C   . PRO A 1 381 ? 12.988  -50.113 205.859 1.00 183.20 ? 381 PRO A C   1 
ATOM   2842  O O   . PRO A 1 381 ? 13.119  -50.990 206.734 1.00 185.05 ? 381 PRO A O   1 
ATOM   2843  C CB  . PRO A 1 381 ? 10.395  -49.882 206.294 1.00 178.04 ? 381 PRO A CB  1 
ATOM   2844  C CG  . PRO A 1 381 ? 9.321   -48.846 205.610 1.00 175.86 ? 381 PRO A CG  1 
ATOM   2845  C CD  . PRO A 1 381 ? 10.054  -48.322 204.310 1.00 171.87 ? 381 PRO A CD  1 
ATOM   2846  N N   . GLY A 1 382 ? 13.994  -49.574 205.168 1.00 186.80 ? 382 GLY A N   1 
ATOM   2847  C CA  . GLY A 1 382 ? 15.365  -50.046 205.230 1.00 187.74 ? 382 GLY A CA  1 
ATOM   2848  C C   . GLY A 1 382 ? 16.268  -49.053 204.510 1.00 187.90 ? 382 GLY A C   1 
ATOM   2849  O O   . GLY A 1 382 ? 15.798  -48.091 203.884 1.00 188.27 ? 382 GLY A O   1 
ATOM   2850  N N   . LYS B 1 17  ? 36.957  67.182  168.414 1.00 205.42 ? 17  LYS B N   1 
ATOM   2851  C CA  . LYS B 1 17  ? 36.052  66.420  167.542 1.00 204.64 ? 17  LYS B CA  1 
ATOM   2852  C C   . LYS B 1 17  ? 35.534  65.132  168.247 1.00 200.89 ? 17  LYS B C   1 
ATOM   2853  O O   . LYS B 1 17  ? 34.879  65.211  169.308 1.00 201.72 ? 17  LYS B O   1 
ATOM   2854  C CB  . LYS B 1 17  ? 36.757  66.099  166.193 1.00 208.32 ? 17  LYS B CB  1 
ATOM   2855  C CG  . LYS B 1 17  ? 35.833  65.645  165.011 1.00 210.06 ? 17  LYS B CG  1 
ATOM   2856  C CD  . LYS B 1 17  ? 36.633  65.272  163.727 1.00 210.40 ? 17  LYS B CD  1 
ATOM   2857  C CE  . LYS B 1 17  ? 35.727  64.822  162.555 1.00 210.54 ? 17  LYS B CE  1 
ATOM   2858  N NZ  . LYS B 1 17  ? 36.495  64.447  161.312 1.00 210.83 ? 17  LYS B NZ  1 
ATOM   2859  N N   . ALA B 1 18  ? 35.831  63.964  167.665 1.00 195.32 ? 18  ALA B N   1 
ATOM   2860  C CA  . ALA B 1 18  ? 35.408  62.678  168.212 1.00 186.66 ? 18  ALA B CA  1 
ATOM   2861  C C   . ALA B 1 18  ? 36.332  62.241  169.344 1.00 180.77 ? 18  ALA B C   1 
ATOM   2862  O O   . ALA B 1 18  ? 36.959  61.176  169.264 1.00 180.24 ? 18  ALA B O   1 
ATOM   2863  C CB  . ALA B 1 18  ? 35.347  61.596  167.102 1.00 186.64 ? 18  ALA B CB  1 
ATOM   2864  N N   . CYS B 1 19  ? 36.497  63.121  170.339 1.00 172.66 ? 19  CYS B N   1 
ATOM   2865  C CA  . CYS B 1 19  ? 37.291  62.808  171.523 1.00 165.77 ? 19  CYS B CA  1 
ATOM   2866  C C   . CYS B 1 19  ? 36.405  61.667  172.046 1.00 162.45 ? 19  CYS B C   1 
ATOM   2867  O O   . CYS B 1 19  ? 35.189  61.854  172.177 1.00 163.97 ? 19  CYS B O   1 
ATOM   2868  C CB  . CYS B 1 19  ? 37.310  64.004  172.504 1.00 162.02 ? 19  CYS B CB  1 
ATOM   2869  S SG  . CYS B 1 19  ? 38.112  65.525  171.872 1.00 157.97 ? 19  CYS B SG  1 
ATOM   2870  N N   . PRO B 1 20  ? 36.974  60.452  172.237 1.00 157.28 ? 20  PRO B N   1 
ATOM   2871  C CA  . PRO B 1 20  ? 36.252  59.255  172.717 1.00 150.40 ? 20  PRO B CA  1 
ATOM   2872  C C   . PRO B 1 20  ? 35.158  59.567  173.737 1.00 143.75 ? 20  PRO B C   1 
ATOM   2873  O O   . PRO B 1 20  ? 35.365  60.377  174.636 1.00 143.28 ? 20  PRO B O   1 
ATOM   2874  C CB  . PRO B 1 20  ? 37.374  58.375  173.289 1.00 152.23 ? 20  PRO B CB  1 
ATOM   2875  C CG  . PRO B 1 20  ? 38.516  59.352  173.545 1.00 153.68 ? 20  PRO B CG  1 
ATOM   2876  C CD  . PRO B 1 20  ? 38.429  60.246  172.343 1.00 156.22 ? 20  PRO B CD  1 
ATOM   2877  N N   . ARG B 1 21  ? 33.991  58.943  173.591 1.00 136.09 ? 21  ARG B N   1 
ATOM   2878  C CA  . ARG B 1 21  ? 32.879  59.237  174.499 1.00 128.69 ? 21  ARG B CA  1 
ATOM   2879  C C   . ARG B 1 21  ? 32.872  58.426  175.801 1.00 114.68 ? 21  ARG B C   1 
ATOM   2880  O O   . ARG B 1 21  ? 32.735  57.193  175.784 1.00 111.22 ? 21  ARG B O   1 
ATOM   2881  C CB  . ARG B 1 21  ? 31.535  59.178  173.737 1.00 141.74 ? 21  ARG B CB  1 
ATOM   2882  C CG  . ARG B 1 21  ? 31.405  60.222  172.550 1.00 156.29 ? 21  ARG B CG  1 
ATOM   2883  C CD  . ARG B 1 21  ? 31.139  61.705  173.003 1.00 167.96 ? 21  ARG B CD  1 
ATOM   2884  N NE  . ARG B 1 21  ? 31.778  62.733  172.149 1.00 176.76 ? 21  ARG B NE  1 
ATOM   2885  C CZ  . ARG B 1 21  ? 31.859  64.040  172.449 1.00 179.58 ? 21  ARG B CZ  1 
ATOM   2886  N NH1 . ARG B 1 21  ? 31.326  64.506  173.584 1.00 181.28 ? 21  ARG B NH1 1 
ATOM   2887  N NH2 . ARG B 1 21  ? 32.555  64.873  171.664 1.00 178.91 ? 21  ARG B NH2 1 
ATOM   2888  N N   . PRO B 1 22  ? 33.000  59.126  176.953 1.00 102.25 ? 22  PRO B N   1 
ATOM   2889  C CA  . PRO B 1 22  ? 33.022  58.485  178.259 1.00 93.86  ? 22  PRO B CA  1 
ATOM   2890  C C   . PRO B 1 22  ? 31.875  57.562  178.463 1.00 88.06  ? 22  PRO B C   1 
ATOM   2891  O O   . PRO B 1 22  ? 30.897  57.573  177.723 1.00 83.79  ? 22  PRO B O   1 
ATOM   2892  C CB  . PRO B 1 22  ? 32.995  59.663  179.235 1.00 92.57  ? 22  PRO B CB  1 
ATOM   2893  C CG  . PRO B 1 22  ? 32.372  60.736  178.484 1.00 93.72  ? 22  PRO B CG  1 
ATOM   2894  C CD  . PRO B 1 22  ? 32.972  60.589  177.119 1.00 98.48  ? 22  PRO B CD  1 
ATOM   2895  N N   . ALA B 1 23  ? 32.032  56.724  179.468 1.00 85.88  ? 23  ALA B N   1 
ATOM   2896  C CA  . ALA B 1 23  ? 31.013  55.757  179.801 1.00 83.91  ? 23  ALA B CA  1 
ATOM   2897  C C   . ALA B 1 23  ? 29.687  56.448  180.097 1.00 78.27  ? 23  ALA B C   1 
ATOM   2898  O O   . ALA B 1 23  ? 29.642  57.619  180.424 1.00 76.78  ? 23  ALA B O   1 
ATOM   2899  C CB  . ALA B 1 23  ? 31.467  54.916  180.992 1.00 89.09  ? 23  ALA B CB  1 
ATOM   2900  N N   . PRO B 1 24  ? 28.586  55.732  179.918 1.00 74.12  ? 24  PRO B N   1 
ATOM   2901  C CA  . PRO B 1 24  ? 27.247  56.249  180.159 1.00 70.13  ? 24  PRO B CA  1 
ATOM   2902  C C   . PRO B 1 24  ? 26.853  55.836  181.544 1.00 64.52  ? 24  PRO B C   1 
ATOM   2903  O O   . PRO B 1 24  ? 26.761  54.654  181.901 1.00 63.77  ? 24  PRO B O   1 
ATOM   2904  C CB  . PRO B 1 24  ? 26.398  55.529  179.125 1.00 75.50  ? 24  PRO B CB  1 
ATOM   2905  C CG  . PRO B 1 24  ? 27.410  54.731  178.287 1.00 81.25  ? 24  PRO B CG  1 
ATOM   2906  C CD  . PRO B 1 24  ? 28.510  54.443  179.236 1.00 77.68  ? 24  PRO B CD  1 
ATOM   2907  N N   . VAL B 1 25  ? 26.597  56.864  182.307 1.00 59.75  ? 25  VAL B N   1 
ATOM   2908  C CA  . VAL B 1 25  ? 26.237  56.762  183.676 1.00 55.79  ? 25  VAL B CA  1 
ATOM   2909  C C   . VAL B 1 25  ? 24.882  57.423  183.681 1.00 54.84  ? 25  VAL B C   1 
ATOM   2910  O O   . VAL B 1 25  ? 24.517  58.106  182.732 1.00 55.92  ? 25  VAL B O   1 
ATOM   2911  C CB  . VAL B 1 25  ? 27.215  57.648  184.438 1.00 57.41  ? 25  VAL B CB  1 
ATOM   2912  C CG1 . VAL B 1 25  ? 27.232  57.339  185.921 1.00 63.86  ? 25  VAL B CG1 1 
ATOM   2913  C CG2 . VAL B 1 25  ? 28.597  57.525  183.820 1.00 55.99  ? 25  VAL B CG2 1 
ATOM   2914  N N   . PRO B 1 26  ? 24.066  57.137  184.681 1.00 55.03  ? 26  PRO B N   1 
ATOM   2915  C CA  . PRO B 1 26  ? 22.756  57.766  184.738 1.00 56.35  ? 26  PRO B CA  1 
ATOM   2916  C C   . PRO B 1 26  ? 22.990  59.228  185.084 1.00 58.54  ? 26  PRO B C   1 
ATOM   2917  O O   . PRO B 1 26  ? 23.829  59.574  185.944 1.00 55.99  ? 26  PRO B O   1 
ATOM   2918  C CB  . PRO B 1 26  ? 22.091  57.031  185.882 1.00 59.62  ? 26  PRO B CB  1 
ATOM   2919  C CG  . PRO B 1 26  ? 23.272  56.721  186.789 1.00 59.30  ? 26  PRO B CG  1 
ATOM   2920  C CD  . PRO B 1 26  ? 24.207  56.158  185.757 1.00 58.43  ? 26  PRO B CD  1 
ATOM   2921  N N   . LYS B 1 27  ? 22.212  60.070  184.423 1.00 61.53  ? 27  LYS B N   1 
ATOM   2922  C CA  . LYS B 1 27  ? 22.303  61.508  184.552 1.00 63.86  ? 27  LYS B CA  1 
ATOM   2923  C C   . LYS B 1 27  ? 21.488  62.080  185.669 1.00 57.56  ? 27  LYS B C   1 
ATOM   2924  O O   . LYS B 1 27  ? 20.255  61.981  185.672 1.00 56.03  ? 27  LYS B O   1 
ATOM   2925  C CB  . LYS B 1 27  ? 21.853  62.124  183.246 1.00 77.24  ? 27  LYS B CB  1 
ATOM   2926  C CG  . LYS B 1 27  ? 21.918  63.630  183.142 1.00 96.46  ? 27  LYS B CG  1 
ATOM   2927  C CD  . LYS B 1 27  ? 21.345  64.044  181.769 1.00 115.24 ? 27  LYS B CD  1 
ATOM   2928  C CE  . LYS B 1 27  ? 21.405  65.553  181.505 1.00 128.32 ? 27  LYS B CE  1 
ATOM   2929  N NZ  . LYS B 1 27  ? 20.762  65.902  180.185 1.00 138.90 ? 27  LYS B NZ  1 
ATOM   2930  N N   . LEU B 1 28  ? 22.184  62.727  186.587 1.00 53.12  ? 28  LEU B N   1 
ATOM   2931  C CA  . LEU B 1 28  ? 21.533  63.349  187.710 1.00 52.86  ? 28  LEU B CA  1 
ATOM   2932  C C   . LEU B 1 28  ? 20.895  64.631  187.257 1.00 54.14  ? 28  LEU B C   1 
ATOM   2933  O O   . LEU B 1 28  ? 21.586  65.504  186.714 1.00 60.82  ? 28  LEU B O   1 
ATOM   2934  C CB  . LEU B 1 28  ? 22.536  63.700  188.784 1.00 52.42  ? 28  LEU B CB  1 
ATOM   2935  C CG  . LEU B 1 28  ? 21.881  64.696  189.739 1.00 50.06  ? 28  LEU B CG  1 
ATOM   2936  C CD1 . LEU B 1 28  ? 20.900  64.013  190.691 1.00 52.57  ? 28  LEU B CD1 1 
ATOM   2937  C CD2 . LEU B 1 28  ? 22.955  65.430  190.482 1.00 54.94  ? 28  LEU B CD2 1 
ATOM   2938  N N   . LEU B 1 29  ? 19.603  64.773  187.532 1.00 49.87  ? 29  LEU B N   1 
ATOM   2939  C CA  . LEU B 1 29  ? 18.885  65.978  187.167 1.00 45.15  ? 29  LEU B CA  1 
ATOM   2940  C C   . LEU B 1 29  ? 19.226  67.092  188.078 1.00 42.80  ? 29  LEU B C   1 
ATOM   2941  O O   . LEU B 1 29  ? 19.692  68.172  187.663 1.00 43.67  ? 29  LEU B O   1 
ATOM   2942  C CB  . LEU B 1 29  ? 17.404  65.768  187.286 1.00 44.93  ? 29  LEU B CB  1 
ATOM   2943  C CG  . LEU B 1 29  ? 16.882  65.123  186.031 1.00 54.65  ? 29  LEU B CG  1 
ATOM   2944  C CD1 . LEU B 1 29  ? 15.575  65.799  185.712 1.00 64.34  ? 29  LEU B CD1 1 
ATOM   2945  C CD2 . LEU B 1 29  ? 17.846  65.331  184.881 1.00 61.93  ? 29  LEU B CD2 1 
ATOM   2946  N N   . ILE B 1 30  ? 19.013  66.801  189.347 1.00 36.83  ? 30  ILE B N   1 
ATOM   2947  C CA  . ILE B 1 30  ? 19.246  67.787  190.334 1.00 33.11  ? 30  ILE B CA  1 
ATOM   2948  C C   . ILE B 1 30  ? 19.309  67.094  191.638 1.00 33.76  ? 30  ILE B C   1 
ATOM   2949  O O   . ILE B 1 30  ? 18.702  66.049  191.835 1.00 33.88  ? 30  ILE B O   1 
ATOM   2950  C CB  . ILE B 1 30  ? 18.074  68.722  190.348 1.00 33.42  ? 30  ILE B CB  1 
ATOM   2951  C CG1 . ILE B 1 30  ? 18.063  69.503  191.642 1.00 39.99  ? 30  ILE B CG1 1 
ATOM   2952  C CG2 . ILE B 1 30  ? 16.774  67.960  190.126 1.00 25.53  ? 30  ILE B CG2 1 
ATOM   2953  C CD1 . ILE B 1 30  ? 16.727  70.096  191.946 1.00 47.10  ? 30  ILE B CD1 1 
ATOM   2954  N N   . LYS B 1 31  ? 20.085  67.665  192.526 1.00 33.61  ? 31  LYS B N   1 
ATOM   2955  C CA  . LYS B 1 31  ? 20.189  67.106  193.833 1.00 38.82  ? 31  LYS B CA  1 
ATOM   2956  C C   . LYS B 1 31  ? 19.853  68.247  194.727 1.00 42.76  ? 31  LYS B C   1 
ATOM   2957  O O   . LYS B 1 31  ? 19.833  69.409  194.304 1.00 45.47  ? 31  LYS B O   1 
ATOM   2958  C CB  . LYS B 1 31  ? 21.606  66.704  194.121 1.00 46.56  ? 31  LYS B CB  1 
ATOM   2959  C CG  . LYS B 1 31  ? 22.535  67.900  194.212 1.00 64.46  ? 31  LYS B CG  1 
ATOM   2960  C CD  . LYS B 1 31  ? 23.781  67.573  195.028 1.00 77.98  ? 31  LYS B CD  1 
ATOM   2961  C CE  . LYS B 1 31  ? 24.256  68.791  195.846 1.00 87.39  ? 31  LYS B CE  1 
ATOM   2962  N NZ  . LYS B 1 31  ? 25.303  68.456  196.895 1.00 97.02  ? 31  LYS B NZ  1 
ATOM   2963  N N   . GLY B 1 32  ? 19.708  67.920  195.993 1.00 48.53  ? 32  GLY B N   1 
ATOM   2964  C CA  . GLY B 1 32  ? 19.380  68.905  196.998 1.00 58.35  ? 32  GLY B CA  1 
ATOM   2965  C C   . GLY B 1 32  ? 18.448  68.197  197.959 1.00 63.92  ? 32  GLY B C   1 
ATOM   2966  O O   . GLY B 1 32  ? 18.351  66.957  197.929 1.00 64.23  ? 32  GLY B O   1 
ATOM   2967  N N   . GLY B 1 33  ? 17.743  68.972  198.781 1.00 69.53  ? 33  GLY B N   1 
ATOM   2968  C CA  . GLY B 1 33  ? 16.803  68.407  199.749 1.00 73.07  ? 33  GLY B CA  1 
ATOM   2969  C C   . GLY B 1 33  ? 15.514  67.799  199.177 1.00 70.90  ? 33  GLY B C   1 
ATOM   2970  O O   . GLY B 1 33  ? 15.427  67.480  197.976 1.00 71.12  ? 33  GLY B O   1 
ATOM   2971  N N   . MET B 1 34  ? 14.491  67.666  200.020 1.00 66.13  ? 34  MET B N   1 
ATOM   2972  C CA  . MET B 1 34  ? 13.250  67.061  199.562 1.00 63.13  ? 34  MET B CA  1 
ATOM   2973  C C   . MET B 1 34  ? 12.587  67.765  198.388 1.00 61.99  ? 34  MET B C   1 
ATOM   2974  O O   . MET B 1 34  ? 12.043  67.125  197.492 1.00 60.92  ? 34  MET B O   1 
ATOM   2975  C CB  . MET B 1 34  ? 12.275  66.885  200.721 1.00 62.62  ? 34  MET B CB  1 
ATOM   2976  C CG  . MET B 1 34  ? 12.600  65.686  201.604 1.00 62.27  ? 34  MET B CG  1 
ATOM   2977  S SD  . MET B 1 34  ? 12.431  64.076  200.758 1.00 61.59  ? 34  MET B SD  1 
ATOM   2978  C CE  . MET B 1 34  ? 10.793  63.557  201.297 1.00 65.34  ? 34  MET B CE  1 
ATOM   2979  N N   . GLU B 1 35  ? 12.664  69.080  198.375 1.00 61.11  ? 35  GLU B N   1 
ATOM   2980  C CA  . GLU B 1 35  ? 12.056  69.840  197.303 1.00 65.25  ? 35  GLU B CA  1 
ATOM   2981  C C   . GLU B 1 35  ? 12.487  69.399  195.918 1.00 58.58  ? 35  GLU B C   1 
ATOM   2982  O O   . GLU B 1 35  ? 11.711  69.462  194.984 1.00 57.97  ? 35  GLU B O   1 
ATOM   2983  C CB  . GLU B 1 35  ? 12.315  71.328  197.475 1.00 78.57  ? 35  GLU B CB  1 
ATOM   2984  C CG  . GLU B 1 35  ? 13.755  71.722  197.290 1.00 95.30  ? 35  GLU B CG  1 
ATOM   2985  C CD  . GLU B 1 35  ? 14.676  71.068  198.304 1.00 104.65 ? 35  GLU B CD  1 
ATOM   2986  O OE1 . GLU B 1 35  ? 14.259  70.860  199.480 1.00 105.99 ? 35  GLU B OE1 1 
ATOM   2987  O OE2 . GLU B 1 35  ? 15.825  70.761  197.910 1.00 112.23 ? 35  GLU B OE2 1 
ATOM   2988  N N   . VAL B 1 36  ? 13.720  68.963  195.763 1.00 51.97  ? 36  VAL B N   1 
ATOM   2989  C CA  . VAL B 1 36  ? 14.154  68.509  194.461 1.00 50.58  ? 36  VAL B CA  1 
ATOM   2990  C C   . VAL B 1 36  ? 13.057  67.615  193.888 1.00 54.77  ? 36  VAL B C   1 
ATOM   2991  O O   . VAL B 1 36  ? 12.710  67.708  192.712 1.00 53.33  ? 36  VAL B O   1 
ATOM   2992  C CB  . VAL B 1 36  ? 15.433  67.727  194.604 1.00 48.35  ? 36  VAL B CB  1 
ATOM   2993  C CG1 . VAL B 1 36  ? 15.845  67.118  193.290 1.00 48.01  ? 36  VAL B CG1 1 
ATOM   2994  C CG2 . VAL B 1 36  ? 16.499  68.640  195.126 1.00 48.34  ? 36  VAL B CG2 1 
ATOM   2995  N N   . LEU B 1 37  ? 12.429  66.845  194.774 1.00 61.35  ? 37  LEU B N   1 
ATOM   2996  C CA  . LEU B 1 37  ? 11.348  65.928  194.411 1.00 67.18  ? 37  LEU B CA  1 
ATOM   2997  C C   . LEU B 1 37  ? 10.234  66.649  193.697 1.00 71.12  ? 37  LEU B C   1 
ATOM   2998  O O   . LEU B 1 37  ? 9.661   66.114  192.746 1.00 73.93  ? 37  LEU B O   1 
ATOM   2999  C CB  . LEU B 1 37  ? 10.741  65.290  195.658 1.00 68.38  ? 37  LEU B CB  1 
ATOM   3000  C CG  . LEU B 1 37  ? 11.229  63.964  196.228 1.00 65.85  ? 37  LEU B CG  1 
ATOM   3001  C CD1 . LEU B 1 37  ? 12.722  63.981  196.432 1.00 66.52  ? 37  LEU B CD1 1 
ATOM   3002  C CD2 . LEU B 1 37  ? 10.518  63.740  197.551 1.00 65.76  ? 37  LEU B CD2 1 
ATOM   3003  N N   . ASP B 1 38  ? 9.878   67.807  194.250 1.00 72.36  ? 38  ASP B N   1 
ATOM   3004  C CA  . ASP B 1 38  ? 8.821   68.678  193.745 1.00 77.96  ? 38  ASP B CA  1 
ATOM   3005  C C   . ASP B 1 38  ? 8.798   68.717  192.261 1.00 77.33  ? 38  ASP B C   1 
ATOM   3006  O O   . ASP B 1 38  ? 7.736   68.749  191.640 1.00 80.88  ? 38  ASP B O   1 
ATOM   3007  C CB  . ASP B 1 38  ? 9.050   70.112  194.194 1.00 90.30  ? 38  ASP B CB  1 
ATOM   3008  C CG  . ASP B 1 38  ? 8.335   70.449  195.485 1.00 103.28 ? 38  ASP B CG  1 
ATOM   3009  O OD1 . ASP B 1 38  ? 8.049   69.516  196.285 1.00 109.95 ? 38  ASP B OD1 1 
ATOM   3010  O OD2 . ASP B 1 38  ? 8.062   71.665  195.693 1.00 108.72 ? 38  ASP B OD2 1 
ATOM   3011  N N   . LEU B 1 39  ? 9.992   68.842  191.710 1.00 76.08  ? 39  LEU B N   1 
ATOM   3012  C CA  . LEU B 1 39  ? 10.182  68.896  190.284 1.00 75.55  ? 39  LEU B CA  1 
ATOM   3013  C C   . LEU B 1 39  ? 9.608   67.671  189.580 1.00 76.97  ? 39  LEU B C   1 
ATOM   3014  O O   . LEU B 1 39  ? 9.768   66.541  190.057 1.00 81.25  ? 39  LEU B O   1 
ATOM   3015  C CB  . LEU B 1 39  ? 11.675  68.976  190.003 1.00 74.57  ? 39  LEU B CB  1 
ATOM   3016  C CG  . LEU B 1 39  ? 12.133  68.710  188.574 1.00 73.61  ? 39  LEU B CG  1 
ATOM   3017  C CD1 . LEU B 1 39  ? 11.430  69.661  187.634 1.00 72.47  ? 39  LEU B CD1 1 
ATOM   3018  C CD2 . LEU B 1 39  ? 13.643  68.857  188.477 1.00 77.56  ? 39  LEU B CD2 1 
ATOM   3019  N N   . VAL B 1 40  ? 8.918   67.901  188.463 1.00 75.30  ? 40  VAL B N   1 
ATOM   3020  C CA  . VAL B 1 40  ? 8.385   66.810  187.657 1.00 78.19  ? 40  VAL B CA  1 
ATOM   3021  C C   . VAL B 1 40  ? 9.575   65.955  187.401 1.00 79.06  ? 40  VAL B C   1 
ATOM   3022  O O   . VAL B 1 40  ? 10.641  66.453  187.049 1.00 83.02  ? 40  VAL B O   1 
ATOM   3023  C CB  . VAL B 1 40  ? 8.047   67.237  186.264 1.00 83.22  ? 40  VAL B CB  1 
ATOM   3024  C CG1 . VAL B 1 40  ? 7.786   65.984  185.357 1.00 87.03  ? 40  VAL B CG1 1 
ATOM   3025  C CG2 . VAL B 1 40  ? 6.909   68.199  186.299 1.00 90.00  ? 40  VAL B CG2 1 
ATOM   3026  N N   . THR B 1 41  ? 9.351   64.667  187.359 1.00 76.79  ? 41  THR B N   1 
ATOM   3027  C CA  . THR B 1 41  ? 10.472  63.818  187.177 1.00 73.85  ? 41  THR B CA  1 
ATOM   3028  C C   . THR B 1 41  ? 10.436  63.202  185.823 1.00 67.06  ? 41  THR B C   1 
ATOM   3029  O O   . THR B 1 41  ? 11.284  63.479  184.999 1.00 65.97  ? 41  THR B O   1 
ATOM   3030  C CB  . THR B 1 41  ? 10.485  62.793  188.306 1.00 81.89  ? 41  THR B CB  1 
ATOM   3031  O OG1 . THR B 1 41  ? 9.224   62.873  189.002 1.00 89.05  ? 41  THR B OG1 1 
ATOM   3032  C CG2 . THR B 1 41  ? 11.620  63.106  189.311 1.00 85.05  ? 41  THR B CG2 1 
ATOM   3033  N N   . GLY B 1 42  ? 9.340   62.548  185.522 1.00 62.06  ? 42  GLY B N   1 
ATOM   3034  C CA  . GLY B 1 42  ? 9.277   61.855  184.262 1.00 66.53  ? 42  GLY B CA  1 
ATOM   3035  C C   . GLY B 1 42  ? 8.704   60.532  184.700 1.00 68.01  ? 42  GLY B C   1 
ATOM   3036  O O   . GLY B 1 42  ? 7.776   60.585  185.508 1.00 75.10  ? 42  GLY B O   1 
ATOM   3037  N N   . PRO B 1 43  ? 9.203   59.354  184.260 1.00 64.99  ? 43  PRO B N   1 
ATOM   3038  C CA  . PRO B 1 43  ? 8.587   58.102  184.727 1.00 64.85  ? 43  PRO B CA  1 
ATOM   3039  C C   . PRO B 1 43  ? 9.549   56.973  185.107 1.00 66.64  ? 43  PRO B C   1 
ATOM   3040  O O   . PRO B 1 43  ? 9.121   55.938  185.619 1.00 69.22  ? 43  PRO B O   1 
ATOM   3041  C CB  . PRO B 1 43  ? 7.795   57.688  183.511 1.00 61.53  ? 43  PRO B CB  1 
ATOM   3042  C CG  . PRO B 1 43  ? 8.853   57.934  182.433 1.00 66.49  ? 43  PRO B CG  1 
ATOM   3043  C CD  . PRO B 1 43  ? 9.722   59.141  182.907 1.00 63.69  ? 43  PRO B CD  1 
ATOM   3044  N N   . ASP B 1 44  ? 10.832  57.154  184.818 1.00 67.50  ? 44  ASP B N   1 
ATOM   3045  C CA  . ASP B 1 44  ? 11.844  56.151  185.126 1.00 68.48  ? 44  ASP B CA  1 
ATOM   3046  C C   . ASP B 1 44  ? 12.729  56.807  186.164 1.00 62.10  ? 44  ASP B C   1 
ATOM   3047  O O   . ASP B 1 44  ? 13.264  56.193  187.071 1.00 60.92  ? 44  ASP B O   1 
ATOM   3048  C CB  . ASP B 1 44  ? 12.570  55.804  183.832 1.00 78.97  ? 44  ASP B CB  1 
ATOM   3049  C CG  . ASP B 1 44  ? 11.588  55.346  182.713 1.00 87.28  ? 44  ASP B CG  1 
ATOM   3050  O OD1 . ASP B 1 44  ? 10.640  54.570  183.004 1.00 92.76  ? 44  ASP B OD1 1 
ATOM   3051  O OD2 . ASP B 1 44  ? 11.747  55.774  181.542 1.00 88.23  ? 44  ASP B OD2 1 
ATOM   3052  N N   . SER B 1 45  ? 12.721  58.115  186.075 1.00 59.13  ? 45  SER B N   1 
ATOM   3053  C CA  . SER B 1 45  ? 13.407  58.995  186.985 1.00 56.28  ? 45  SER B CA  1 
ATOM   3054  C C   . SER B 1 45  ? 13.415  58.589  188.455 1.00 50.22  ? 45  SER B C   1 
ATOM   3055  O O   . SER B 1 45  ? 12.466  58.805  189.223 1.00 46.77  ? 45  SER B O   1 
ATOM   3056  C CB  . SER B 1 45  ? 12.804  60.399  186.855 1.00 65.46  ? 45  SER B CB  1 
ATOM   3057  O OG  . SER B 1 45  ? 11.385  60.361  186.664 1.00 74.55  ? 45  SER B OG  1 
ATOM   3058  N N   . VAL B 1 46  ? 14.577  58.140  188.868 1.00 44.84  ? 46  VAL B N   1 
ATOM   3059  C CA  . VAL B 1 46  ? 14.747  57.731  190.227 1.00 40.82  ? 46  VAL B CA  1 
ATOM   3060  C C   . VAL B 1 46  ? 15.196  58.794  191.182 1.00 38.94  ? 46  VAL B C   1 
ATOM   3061  O O   . VAL B 1 46  ? 15.978  59.699  190.858 1.00 37.89  ? 46  VAL B O   1 
ATOM   3062  C CB  . VAL B 1 46  ? 15.737  56.682  190.355 1.00 38.28  ? 46  VAL B CB  1 
ATOM   3063  C CG1 . VAL B 1 46  ? 15.334  55.815  191.518 1.00 41.03  ? 46  VAL B CG1 1 
ATOM   3064  C CG2 . VAL B 1 46  ? 15.862  55.949  189.068 1.00 42.19  ? 46  VAL B CG2 1 
ATOM   3065  N N   . THR B 1 47  ? 14.892  58.496  192.425 1.00 35.52  ? 47  THR B N   1 
ATOM   3066  C CA  . THR B 1 47  ? 15.187  59.386  193.483 1.00 33.00  ? 47  THR B CA  1 
ATOM   3067  C C   . THR B 1 47  ? 15.980  58.686  194.532 1.00 30.93  ? 47  THR B C   1 
ATOM   3068  O O   . THR B 1 47  ? 15.698  57.542  194.878 1.00 30.79  ? 47  THR B O   1 
ATOM   3069  C CB  . THR B 1 47  ? 13.877  59.828  194.075 1.00 38.42  ? 47  THR B CB  1 
ATOM   3070  O OG1 . THR B 1 47  ? 12.969  60.214  193.007 1.00 37.57  ? 47  THR B OG1 1 
ATOM   3071  C CG2 . THR B 1 47  ? 14.117  60.950  195.099 1.00 37.46  ? 47  THR B CG2 1 
ATOM   3072  N N   . GLU B 1 48  ? 17.001  59.365  195.009 1.00 31.58  ? 48  GLU B N   1 
ATOM   3073  C CA  . GLU B 1 48  ? 17.836  58.824  196.057 1.00 35.31  ? 48  GLU B CA  1 
ATOM   3074  C C   . GLU B 1 48  ? 17.675  59.727  197.258 1.00 30.93  ? 48  GLU B C   1 
ATOM   3075  O O   . GLU B 1 48  ? 17.898  60.943  197.185 1.00 26.59  ? 48  GLU B O   1 
ATOM   3076  C CB  . GLU B 1 48  ? 19.315  58.762  195.646 1.00 41.82  ? 48  GLU B CB  1 
ATOM   3077  C CG  . GLU B 1 48  ? 19.793  57.424  194.998 1.00 51.37  ? 48  GLU B CG  1 
ATOM   3078  C CD  . GLU B 1 48  ? 21.314  57.401  194.648 1.00 58.16  ? 48  GLU B CD  1 
ATOM   3079  O OE1 . GLU B 1 48  ? 22.090  58.179  195.278 1.00 56.74  ? 48  GLU B OE1 1 
ATOM   3080  O OE2 . GLU B 1 48  ? 21.733  56.597  193.757 1.00 63.09  ? 48  GLU B OE2 1 
ATOM   3081  N N   . ILE B 1 49  ? 17.265  59.123  198.360 1.00 27.20  ? 49  ILE B N   1 
ATOM   3082  C CA  . ILE B 1 49  ? 17.060  59.875  199.570 1.00 25.59  ? 49  ILE B CA  1 
ATOM   3083  C C   . ILE B 1 49  ? 17.877  59.347  200.699 1.00 24.07  ? 49  ILE B C   1 
ATOM   3084  O O   . ILE B 1 49  ? 17.654  58.224  201.182 1.00 24.76  ? 49  ILE B O   1 
ATOM   3085  C CB  . ILE B 1 49  ? 15.614  59.824  200.029 1.00 31.10  ? 49  ILE B CB  1 
ATOM   3086  C CG1 . ILE B 1 49  ? 14.680  60.182  198.861 1.00 34.92  ? 49  ILE B CG1 1 
ATOM   3087  C CG2 . ILE B 1 49  ? 15.440  60.723  201.283 1.00 27.39  ? 49  ILE B CG2 1 
ATOM   3088  C CD1 . ILE B 1 49  ? 13.206  60.112  199.222 1.00 41.76  ? 49  ILE B CD1 1 
ATOM   3089  N N   . GLU B 1 50  ? 18.863  60.144  201.070 1.00 22.96  ? 50  GLU B N   1 
ATOM   3090  C CA  . GLU B 1 50  ? 19.708  59.812  202.186 1.00 25.38  ? 50  GLU B CA  1 
ATOM   3091  C C   . GLU B 1 50  ? 19.027  60.566  203.313 1.00 22.45  ? 50  GLU B C   1 
ATOM   3092  O O   . GLU B 1 50  ? 18.438  61.617  203.089 1.00 20.66  ? 50  GLU B O   1 
ATOM   3093  C CB  . GLU B 1 50  ? 21.154  60.303  201.990 1.00 30.07  ? 50  GLU B CB  1 
ATOM   3094  C CG  . GLU B 1 50  ? 22.009  59.571  200.933 1.00 36.81  ? 50  GLU B CG  1 
ATOM   3095  C CD  . GLU B 1 50  ? 22.063  60.274  199.556 1.00 50.81  ? 50  GLU B CD  1 
ATOM   3096  O OE1 . GLU B 1 50  ? 21.256  61.205  199.273 1.00 61.15  ? 50  GLU B OE1 1 
ATOM   3097  O OE2 . GLU B 1 50  ? 22.951  59.920  198.747 1.00 49.69  ? 50  GLU B OE2 1 
ATOM   3098  N N   . ALA B 1 51  ? 19.060  59.997  204.505 1.00 21.67  ? 51  ALA B N   1 
ATOM   3099  C CA  . ALA B 1 51  ? 18.446  60.583  205.679 1.00 19.53  ? 51  ALA B CA  1 
ATOM   3100  C C   . ALA B 1 51  ? 18.896  59.700  206.764 1.00 20.00  ? 51  ALA B C   1 
ATOM   3101  O O   . ALA B 1 51  ? 19.675  58.782  206.536 1.00 21.43  ? 51  ALA B O   1 
ATOM   3102  C CB  . ALA B 1 51  ? 16.962  60.497  205.596 1.00 20.25  ? 51  ALA B CB  1 
ATOM   3103  N N   . PHE B 1 52  ? 18.284  59.849  207.915 1.00 19.85  ? 52  PHE B N   1 
ATOM   3104  C CA  . PHE B 1 52  ? 18.717  59.027  209.012 1.00 25.50  ? 52  PHE B CA  1 
ATOM   3105  C C   . PHE B 1 52  ? 17.836  59.297  210.159 1.00 27.90  ? 52  PHE B C   1 
ATOM   3106  O O   . PHE B 1 52  ? 17.258  60.369  210.248 1.00 28.15  ? 52  PHE B O   1 
ATOM   3107  C CB  . PHE B 1 52  ? 20.064  59.498  209.449 1.00 28.83  ? 52  PHE B CB  1 
ATOM   3108  C CG  . PHE B 1 52  ? 20.049  60.909  209.863 1.00 32.63  ? 52  PHE B CG  1 
ATOM   3109  C CD1 . PHE B 1 52  ? 20.228  61.918  208.924 1.00 36.02  ? 52  PHE B CD1 1 
ATOM   3110  C CD2 . PHE B 1 52  ? 19.823  61.251  211.195 1.00 33.68  ? 52  PHE B CD2 1 
ATOM   3111  C CE1 . PHE B 1 52  ? 20.188  63.273  209.314 1.00 36.55  ? 52  PHE B CE1 1 
ATOM   3112  C CE2 . PHE B 1 52  ? 19.780  62.603  211.599 1.00 34.15  ? 52  PHE B CE2 1 
ATOM   3113  C CZ  . PHE B 1 52  ? 19.967  63.613  210.657 1.00 32.37  ? 52  PHE B CZ  1 
ATOM   3114  N N   . LEU B 1 53  ? 17.918  58.414  211.134 1.00 31.71  ? 53  LEU B N   1 
ATOM   3115  C CA  . LEU B 1 53  ? 17.129  58.529  212.333 1.00 38.71  ? 53  LEU B CA  1 
ATOM   3116  C C   . LEU B 1 53  ? 18.147  58.600  213.426 1.00 43.83  ? 53  LEU B C   1 
ATOM   3117  O O   . LEU B 1 53  ? 19.234  58.031  213.280 1.00 44.90  ? 53  LEU B O   1 
ATOM   3118  C CB  . LEU B 1 53  ? 16.277  57.274  212.515 1.00 40.13  ? 53  LEU B CB  1 
ATOM   3119  C CG  . LEU B 1 53  ? 14.972  57.067  211.714 1.00 45.96  ? 53  LEU B CG  1 
ATOM   3120  C CD1 . LEU B 1 53  ? 14.838  58.073  210.613 1.00 41.33  ? 53  LEU B CD1 1 
ATOM   3121  C CD2 . LEU B 1 53  ? 14.828  55.638  211.161 1.00 43.09  ? 53  LEU B CD2 1 
ATOM   3122  N N   . ASN B 1 54  ? 17.872  59.410  214.446 1.00 50.25  ? 54  ASN B N   1 
ATOM   3123  C CA  . ASN B 1 54  ? 18.777  59.508  215.598 1.00 57.72  ? 54  ASN B CA  1 
ATOM   3124  C C   . ASN B 1 54  ? 18.147  58.491  216.554 1.00 59.08  ? 54  ASN B C   1 
ATOM   3125  O O   . ASN B 1 54  ? 16.936  58.299  216.531 1.00 56.45  ? 54  ASN B O   1 
ATOM   3126  C CB  . ASN B 1 54  ? 18.868  60.942  216.174 1.00 62.44  ? 54  ASN B CB  1 
ATOM   3127  C CG  . ASN B 1 54  ? 20.274  61.614  215.939 1.00 65.36  ? 54  ASN B CG  1 
ATOM   3128  O OD1 . ASN B 1 54  ? 20.369  62.761  215.463 1.00 64.04  ? 54  ASN B OD1 1 
ATOM   3129  N ND2 . ASN B 1 54  ? 21.345  60.914  216.316 1.00 63.58  ? 54  ASN B ND2 1 
ATOM   3130  N N   . PRO B 1 55  ? 18.961  57.810  217.374 1.00 63.34  ? 55  PRO B N   1 
ATOM   3131  C CA  . PRO B 1 55  ? 18.556  56.775  218.336 1.00 67.29  ? 55  PRO B CA  1 
ATOM   3132  C C   . PRO B 1 55  ? 17.830  57.272  219.535 1.00 68.55  ? 55  PRO B C   1 
ATOM   3133  O O   . PRO B 1 55  ? 18.434  57.570  220.551 1.00 72.44  ? 55  PRO B O   1 
ATOM   3134  C CB  . PRO B 1 55  ? 19.888  56.168  218.744 1.00 70.65  ? 55  PRO B CB  1 
ATOM   3135  C CG  . PRO B 1 55  ? 20.770  57.410  218.839 1.00 69.59  ? 55  PRO B CG  1 
ATOM   3136  C CD  . PRO B 1 55  ? 20.354  58.235  217.625 1.00 65.79  ? 55  PRO B CD  1 
ATOM   3137  N N   . ARG B 1 56  ? 16.524  57.299  219.484 1.00 71.57  ? 56  ARG B N   1 
ATOM   3138  C CA  . ARG B 1 56  ? 15.876  57.809  220.657 1.00 79.89  ? 56  ARG B CA  1 
ATOM   3139  C C   . ARG B 1 56  ? 15.395  56.740  221.631 1.00 84.35  ? 56  ARG B C   1 
ATOM   3140  O O   . ARG B 1 56  ? 14.353  56.103  221.446 1.00 86.32  ? 56  ARG B O   1 
ATOM   3141  C CB  . ARG B 1 56  ? 14.866  58.901  220.286 1.00 83.13  ? 56  ARG B CB  1 
ATOM   3142  C CG  . ARG B 1 56  ? 15.585  60.223  219.791 1.00 86.49  ? 56  ARG B CG  1 
ATOM   3143  C CD  . ARG B 1 56  ? 14.703  61.201  219.003 1.00 86.10  ? 56  ARG B CD  1 
ATOM   3144  N NE  . ARG B 1 56  ? 14.235  60.529  217.807 1.00 96.10  ? 56  ARG B NE  1 
ATOM   3145  C CZ  . ARG B 1 56  ? 13.159  59.741  217.745 1.00 100.74 ? 56  ARG B CZ  1 
ATOM   3146  N NH1 . ARG B 1 56  ? 12.391  59.540  218.816 1.00 101.80 ? 56  ARG B NH1 1 
ATOM   3147  N NH2 . ARG B 1 56  ? 12.969  58.992  216.664 1.00 102.87 ? 56  ARG B NH2 1 
ATOM   3148  N N   . MET B 1 57  ? 16.244  56.520  222.636 1.00 87.90  ? 57  MET B N   1 
ATOM   3149  C CA  . MET B 1 57  ? 16.041  55.547  223.705 1.00 88.33  ? 57  MET B CA  1 
ATOM   3150  C C   . MET B 1 57  ? 16.248  56.240  225.052 1.00 89.19  ? 57  MET B C   1 
ATOM   3151  O O   . MET B 1 57  ? 17.387  56.502  225.457 1.00 86.11  ? 57  MET B O   1 
ATOM   3152  C CB  . MET B 1 57  ? 17.065  54.435  223.549 1.00 89.11  ? 57  MET B CB  1 
ATOM   3153  C CG  . MET B 1 57  ? 18.499  54.945  223.476 1.00 91.80  ? 57  MET B CG  1 
ATOM   3154  S SD  . MET B 1 57  ? 19.612  53.753  222.730 1.00 91.75  ? 57  MET B SD  1 
ATOM   3155  C CE  . MET B 1 57  ? 19.474  52.382  223.860 1.00 94.76  ? 57  MET B CE  1 
ATOM   3156  N N   . GLY B 1 58  ? 15.136  56.607  225.695 1.00 93.11  ? 58  GLY B N   1 
ATOM   3157  C CA  . GLY B 1 58  ? 15.166  57.276  226.999 1.00 94.10  ? 58  GLY B CA  1 
ATOM   3158  C C   . GLY B 1 58  ? 15.175  58.808  227.091 1.00 91.74  ? 58  GLY B C   1 
ATOM   3159  O O   . GLY B 1 58  ? 14.141  59.479  226.944 1.00 91.26  ? 58  GLY B O   1 
ATOM   3160  N N   . GLN B 1 59  ? 16.344  59.345  227.433 1.00 87.43  ? 59  GLN B N   1 
ATOM   3161  C CA  . GLN B 1 59  ? 16.543  60.783  227.558 1.00 81.39  ? 59  GLN B CA  1 
ATOM   3162  C C   . GLN B 1 59  ? 16.347  61.396  226.207 1.00 77.42  ? 59  GLN B C   1 
ATOM   3163  O O   . GLN B 1 59  ? 17.065  61.070  225.258 1.00 78.79  ? 59  GLN B O   1 
ATOM   3164  C CB  . GLN B 1 59  ? 17.966  61.109  228.000 1.00 83.84  ? 59  GLN B CB  1 
ATOM   3165  C CG  . GLN B 1 59  ? 18.363  62.577  227.818 1.00 83.96  ? 59  GLN B CG  1 
ATOM   3166  C CD  . GLN B 1 59  ? 17.945  63.434  228.976 1.00 84.25  ? 59  GLN B CD  1 
ATOM   3167  O OE1 . GLN B 1 59  ? 17.020  63.094  229.713 1.00 83.99  ? 59  GLN B OE1 1 
ATOM   3168  N NE2 . GLN B 1 59  ? 18.668  64.520  229.191 1.00 85.31  ? 59  GLN B NE2 1 
ATOM   3169  N N   . PRO B 1 60  ? 15.416  62.338  226.120 1.00 73.92  ? 60  PRO B N   1 
ATOM   3170  C CA  . PRO B 1 60  ? 15.057  63.071  224.918 1.00 71.02  ? 60  PRO B CA  1 
ATOM   3171  C C   . PRO B 1 60  ? 16.058  64.174  224.712 1.00 69.69  ? 60  PRO B C   1 
ATOM   3172  O O   . PRO B 1 60  ? 16.809  64.551  225.616 1.00 67.49  ? 60  PRO B O   1 
ATOM   3173  C CB  . PRO B 1 60  ? 13.724  63.665  225.290 1.00 73.54  ? 60  PRO B CB  1 
ATOM   3174  C CG  . PRO B 1 60  ? 13.990  64.074  226.694 1.00 76.01  ? 60  PRO B CG  1 
ATOM   3175  C CD  . PRO B 1 60  ? 14.653  62.836  227.271 1.00 75.00  ? 60  PRO B CD  1 
ATOM   3176  N N   . PRO B 1 61  ? 16.014  64.764  223.534 1.00 70.34  ? 61  PRO B N   1 
ATOM   3177  C CA  . PRO B 1 61  ? 16.853  65.856  223.042 1.00 77.24  ? 61  PRO B CA  1 
ATOM   3178  C C   . PRO B 1 61  ? 16.812  67.150  223.849 1.00 82.31  ? 61  PRO B C   1 
ATOM   3179  O O   . PRO B 1 61  ? 17.851  67.649  224.285 1.00 83.54  ? 61  PRO B O   1 
ATOM   3180  C CB  . PRO B 1 61  ? 16.289  66.095  221.649 1.00 80.02  ? 61  PRO B CB  1 
ATOM   3181  C CG  . PRO B 1 61  ? 14.836  65.634  221.799 1.00 78.63  ? 61  PRO B CG  1 
ATOM   3182  C CD  . PRO B 1 61  ? 15.002  64.380  222.544 1.00 68.75  ? 61  PRO B CD  1 
ATOM   3183  N N   . THR B 1 62  ? 15.594  67.662  224.030 1.00 87.84  ? 62  THR B N   1 
ATOM   3184  C CA  . THR B 1 62  ? 15.276  68.918  224.715 1.00 91.93  ? 62  THR B CA  1 
ATOM   3185  C C   . THR B 1 62  ? 16.080  69.439  225.894 1.00 94.15  ? 62  THR B C   1 
ATOM   3186  O O   . THR B 1 62  ? 16.196  70.655  226.059 1.00 97.69  ? 62  THR B O   1 
ATOM   3187  C CB  . THR B 1 62  ? 13.824  68.953  225.099 1.00 93.81  ? 62  THR B CB  1 
ATOM   3188  O OG1 . THR B 1 62  ? 13.522  67.800  225.899 1.00 95.96  ? 62  THR B OG1 1 
ATOM   3189  C CG2 . THR B 1 62  ? 12.973  68.968  223.839 1.00 94.83  ? 62  THR B CG2 1 
ATOM   3190  N N   . PRO B 1 63  ? 16.467  68.576  226.836 1.00 93.87  ? 63  PRO B N   1 
ATOM   3191  C CA  . PRO B 1 63  ? 17.245  69.234  227.884 1.00 95.80  ? 63  PRO B CA  1 
ATOM   3192  C C   . PRO B 1 63  ? 18.620  69.522  227.245 1.00 98.11  ? 63  PRO B C   1 
ATOM   3193  O O   . PRO B 1 63  ? 19.622  68.881  227.554 1.00 101.68 ? 63  PRO B O   1 
ATOM   3194  C CB  . PRO B 1 63  ? 17.298  68.161  228.965 1.00 95.90  ? 63  PRO B CB  1 
ATOM   3195  C CG  . PRO B 1 63  ? 16.012  67.421  228.749 1.00 94.80  ? 63  PRO B CG  1 
ATOM   3196  C CD  . PRO B 1 63  ? 16.025  67.245  227.274 1.00 92.64  ? 63  PRO B CD  1 
ATOM   3197  N N   . GLU B 1 64  ? 18.651  70.506  226.356 1.00 97.80  ? 64  GLU B N   1 
ATOM   3198  C CA  . GLU B 1 64  ? 19.840  70.846  225.626 1.00 100.13 ? 64  GLU B CA  1 
ATOM   3199  C C   . GLU B 1 64  ? 21.034  71.061  226.486 1.00 100.46 ? 64  GLU B C   1 
ATOM   3200  O O   . GLU B 1 64  ? 22.142  70.758  226.075 1.00 101.97 ? 64  GLU B O   1 
ATOM   3201  C CB  . GLU B 1 64  ? 19.609  72.089  224.799 1.00 106.46 ? 64  GLU B CB  1 
ATOM   3202  C CG  . GLU B 1 64  ? 19.873  71.892  223.321 1.00 122.45 ? 64  GLU B CG  1 
ATOM   3203  C CD  . GLU B 1 64  ? 18.631  72.142  222.456 1.00 134.34 ? 64  GLU B CD  1 
ATOM   3204  O OE1 . GLU B 1 64  ? 17.638  72.715  222.972 1.00 141.57 ? 64  GLU B OE1 1 
ATOM   3205  O OE2 . GLU B 1 64  ? 18.644  71.767  221.255 1.00 141.39 ? 64  GLU B OE2 1 
ATOM   3206  N N   . SER B 1 65  ? 20.850  71.625  227.667 1.00 103.14 ? 65  SER B N   1 
ATOM   3207  C CA  . SER B 1 65  ? 22.023  71.837  228.473 1.00 107.55 ? 65  SER B CA  1 
ATOM   3208  C C   . SER B 1 65  ? 22.520  70.552  229.030 1.00 107.30 ? 65  SER B C   1 
ATOM   3209  O O   . SER B 1 65  ? 21.832  69.828  229.743 1.00 103.50 ? 65  SER B O   1 
ATOM   3210  C CB  . SER B 1 65  ? 21.838  72.854  229.579 1.00 113.79 ? 65  SER B CB  1 
ATOM   3211  O OG  . SER B 1 65  ? 23.126  73.262  230.031 1.00 121.09 ? 65  SER B OG  1 
ATOM   3212  N N   . LEU B 1 66  ? 23.802  70.380  228.821 1.00 113.55 ? 66  LEU B N   1 
ATOM   3213  C CA  . LEU B 1 66  ? 24.503  69.192  229.236 1.00 123.79 ? 66  LEU B CA  1 
ATOM   3214  C C   . LEU B 1 66  ? 24.613  69.095  230.751 1.00 127.80 ? 66  LEU B C   1 
ATOM   3215  O O   . LEU B 1 66  ? 25.353  68.269  231.292 1.00 128.60 ? 66  LEU B O   1 
ATOM   3216  C CB  . LEU B 1 66  ? 25.886  69.195  228.600 1.00 128.01 ? 66  LEU B CB  1 
ATOM   3217  C CG  . LEU B 1 66  ? 26.137  70.221  227.488 1.00 130.66 ? 66  LEU B CG  1 
ATOM   3218  C CD1 . LEU B 1 66  ? 27.544  70.006  226.975 1.00 136.72 ? 66  LEU B CD1 1 
ATOM   3219  C CD2 . LEU B 1 66  ? 25.137  70.092  226.338 1.00 131.63 ? 66  LEU B CD2 1 
ATOM   3220  N N   . THR B 1 67  ? 23.892  69.958  231.442 1.00 131.34 ? 67  THR B N   1 
ATOM   3221  C CA  . THR B 1 67  ? 23.924  69.951  232.884 1.00 134.64 ? 67  THR B CA  1 
ATOM   3222  C C   . THR B 1 67  ? 22.572  69.479  233.367 1.00 136.70 ? 67  THR B C   1 
ATOM   3223  O O   . THR B 1 67  ? 22.470  68.487  234.090 1.00 138.50 ? 67  THR B O   1 
ATOM   3224  C CB  . THR B 1 67  ? 24.189  71.357  233.393 1.00 134.97 ? 67  THR B CB  1 
ATOM   3225  O OG1 . THR B 1 67  ? 23.287  72.264  232.743 1.00 135.66 ? 67  THR B OG1 1 
ATOM   3226  C CG2 . THR B 1 67  ? 25.622  71.759  233.076 1.00 136.76 ? 67  THR B CG2 1 
ATOM   3227  N N   . GLU B 1 68  ? 21.535  70.136  232.856 1.00 136.79 ? 68  GLU B N   1 
ATOM   3228  C CA  . GLU B 1 68  ? 20.153  69.851  233.226 1.00 137.66 ? 68  GLU B CA  1 
ATOM   3229  C C   . GLU B 1 68  ? 19.682  68.495  232.722 1.00 132.46 ? 68  GLU B C   1 
ATOM   3230  O O   . GLU B 1 68  ? 18.861  67.817  233.347 1.00 133.01 ? 68  GLU B O   1 
ATOM   3231  C CB  . GLU B 1 68  ? 19.249  70.968  232.717 1.00 145.00 ? 68  GLU B CB  1 
ATOM   3232  C CG  . GLU B 1 68  ? 19.718  72.358  233.149 1.00 156.14 ? 68  GLU B CG  1 
ATOM   3233  C CD  . GLU B 1 68  ? 18.646  73.427  232.982 1.00 163.00 ? 68  GLU B CD  1 
ATOM   3234  O OE1 . GLU B 1 68  ? 18.111  73.572  231.854 1.00 166.83 ? 68  GLU B OE1 1 
ATOM   3235  O OE2 . GLU B 1 68  ? 18.340  74.116  233.986 1.00 167.73 ? 68  GLU B OE2 1 
ATOM   3236  N N   . GLY B 1 69  ? 20.162  68.125  231.553 1.00 126.12 ? 69  GLY B N   1 
ATOM   3237  C CA  . GLY B 1 69  ? 19.795  66.833  231.040 1.00 120.71 ? 69  GLY B CA  1 
ATOM   3238  C C   . GLY B 1 69  ? 21.044  65.993  231.157 1.00 118.06 ? 69  GLY B C   1 
ATOM   3239  O O   . GLY B 1 69  ? 21.095  64.854  230.630 1.00 118.61 ? 69  GLY B O   1 
ATOM   3240  N N   . GLY B 1 70  ? 22.084  66.604  231.749 1.00 114.47 ? 70  GLY B N   1 
ATOM   3241  C CA  . GLY B 1 70  ? 23.387  65.974  231.947 1.00 105.27 ? 70  GLY B CA  1 
ATOM   3242  C C   . GLY B 1 70  ? 23.918  65.455  230.626 1.00 97.55  ? 70  GLY B C   1 
ATOM   3243  O O   . GLY B 1 70  ? 25.047  65.007  230.512 1.00 99.60  ? 70  GLY B O   1 
ATOM   3244  N N   . GLN B 1 71  ? 23.093  65.608  229.603 1.00 87.55  ? 71  GLN B N   1 
ATOM   3245  C CA  . GLN B 1 71  ? 23.334  65.128  228.295 1.00 74.21  ? 71  GLN B CA  1 
ATOM   3246  C C   . GLN B 1 71  ? 23.759  63.748  228.131 1.00 69.28  ? 71  GLN B C   1 
ATOM   3247  O O   . GLN B 1 71  ? 24.900  63.333  228.266 1.00 64.23  ? 71  GLN B O   1 
ATOM   3248  C CB  . GLN B 1 71  ? 23.729  66.156  227.281 1.00 72.21  ? 71  GLN B CB  1 
ATOM   3249  C CG  . GLN B 1 71  ? 22.448  66.739  226.731 1.00 70.71  ? 71  GLN B CG  1 
ATOM   3250  C CD  . GLN B 1 71  ? 21.201  66.233  227.468 1.00 72.69  ? 71  GLN B CD  1 
ATOM   3251  O OE1 . GLN B 1 71  ? 20.916  66.665  228.567 1.00 70.35  ? 71  GLN B OE1 1 
ATOM   3252  N NE2 . GLN B 1 71  ? 20.495  65.280  226.887 1.00 75.30  ? 71  GLN B NE2 1 
ATOM   3253  N N   . TYR B 1 72  ? 22.662  63.108  228.437 1.00 66.76  ? 72  TYR B N   1 
ATOM   3254  C CA  . TYR B 1 72  ? 22.510  61.718  228.425 1.00 71.37  ? 72  TYR B CA  1 
ATOM   3255  C C   . TYR B 1 72  ? 21.835  61.547  227.101 1.00 69.21  ? 72  TYR B C   1 
ATOM   3256  O O   . TYR B 1 72  ? 21.314  60.486  226.792 1.00 73.03  ? 72  TYR B O   1 
ATOM   3257  C CB  . TYR B 1 72  ? 21.584  61.381  229.577 1.00 80.18  ? 72  TYR B CB  1 
ATOM   3258  C CG  . TYR B 1 72  ? 22.177  61.722  230.926 1.00 92.26  ? 72  TYR B CG  1 
ATOM   3259  C CD1 . TYR B 1 72  ? 23.562  61.661  231.134 1.00 99.53  ? 72  TYR B CD1 1 
ATOM   3260  C CD2 . TYR B 1 72  ? 21.364  62.055  232.010 1.00 95.08  ? 72  TYR B CD2 1 
ATOM   3261  C CE1 . TYR B 1 72  ? 24.132  61.921  232.399 1.00 105.13 ? 72  TYR B CE1 1 
ATOM   3262  C CE2 . TYR B 1 72  ? 21.919  62.316  233.285 1.00 103.44 ? 72  TYR B CE2 1 
ATOM   3263  C CZ  . TYR B 1 72  ? 23.306  62.246  233.469 1.00 107.77 ? 72  TYR B CZ  1 
ATOM   3264  O OH  . TYR B 1 72  ? 23.875  62.491  234.704 1.00 110.25 ? 72  TYR B OH  1 
ATOM   3265  N N   . TYR B 1 73  ? 21.821  62.610  226.309 1.00 64.97  ? 73  TYR B N   1 
ATOM   3266  C CA  . TYR B 1 73  ? 21.178  62.495  225.034 1.00 63.86  ? 73  TYR B CA  1 
ATOM   3267  C C   . TYR B 1 73  ? 21.718  61.269  224.348 1.00 65.82  ? 73  TYR B C   1 
ATOM   3268  O O   . TYR B 1 73  ? 22.939  61.109  224.201 1.00 65.26  ? 73  TYR B O   1 
ATOM   3269  C CB  . TYR B 1 73  ? 21.413  63.704  224.160 1.00 62.42  ? 73  TYR B CB  1 
ATOM   3270  C CG  . TYR B 1 73  ? 20.499  63.708  222.957 1.00 64.57  ? 73  TYR B CG  1 
ATOM   3271  C CD1 . TYR B 1 73  ? 19.381  62.874  222.894 1.00 63.45  ? 73  TYR B CD1 1 
ATOM   3272  C CD2 . TYR B 1 73  ? 20.761  64.525  221.869 1.00 67.81  ? 73  TYR B CD2 1 
ATOM   3273  C CE1 . TYR B 1 73  ? 18.548  62.851  221.762 1.00 64.03  ? 73  TYR B CE1 1 
ATOM   3274  C CE2 . TYR B 1 73  ? 19.935  64.514  220.726 1.00 68.88  ? 73  TYR B CE2 1 
ATOM   3275  C CZ  . TYR B 1 73  ? 18.831  63.675  220.669 1.00 66.47  ? 73  TYR B CZ  1 
ATOM   3276  O OH  . TYR B 1 73  ? 18.051  63.666  219.505 1.00 65.32  ? 73  TYR B OH  1 
ATOM   3277  N N   . GLY B 1 74  ? 20.793  60.365  224.026 1.00 67.27  ? 74  GLY B N   1 
ATOM   3278  C CA  . GLY B 1 74  ? 21.158  59.130  223.351 1.00 70.26  ? 74  GLY B CA  1 
ATOM   3279  C C   . GLY B 1 74  ? 21.744  58.181  224.355 1.00 69.99  ? 74  GLY B C   1 
ATOM   3280  O O   . GLY B 1 74  ? 22.780  57.533  224.156 1.00 65.59  ? 74  GLY B O   1 
ATOM   3281  N N   . TRP B 1 75  ? 21.049  58.123  225.468 1.00 71.54  ? 75  TRP B N   1 
ATOM   3282  C CA  . TRP B 1 75  ? 21.462  57.289  226.545 1.00 75.75  ? 75  TRP B CA  1 
ATOM   3283  C C   . TRP B 1 75  ? 20.243  57.058  227.396 1.00 81.56  ? 75  TRP B C   1 
ATOM   3284  O O   . TRP B 1 75  ? 19.345  57.902  227.450 1.00 82.15  ? 75  TRP B O   1 
ATOM   3285  C CB  . TRP B 1 75  ? 22.554  57.989  227.330 1.00 72.34  ? 75  TRP B CB  1 
ATOM   3286  C CG  . TRP B 1 75  ? 23.871  57.388  227.125 1.00 74.31  ? 75  TRP B CG  1 
ATOM   3287  C CD1 . TRP B 1 75  ? 24.225  56.093  227.373 1.00 81.78  ? 75  TRP B CD1 1 
ATOM   3288  C CD2 . TRP B 1 75  ? 25.045  58.042  226.681 1.00 73.12  ? 75  TRP B CD2 1 
ATOM   3289  N NE1 . TRP B 1 75  ? 25.567  55.897  227.118 1.00 78.13  ? 75  TRP B NE1 1 
ATOM   3290  C CE2 . TRP B 1 75  ? 26.096  57.078  226.690 1.00 74.08  ? 75  TRP B CE2 1 
ATOM   3291  C CE3 . TRP B 1 75  ? 25.323  59.339  226.286 1.00 73.97  ? 75  TRP B CE3 1 
ATOM   3292  C CZ2 . TRP B 1 75  ? 27.394  57.376  226.318 1.00 75.19  ? 75  TRP B CZ2 1 
ATOM   3293  C CZ3 . TRP B 1 75  ? 26.620  59.640  225.917 1.00 81.40  ? 75  TRP B CZ3 1 
ATOM   3294  C CH2 . TRP B 1 75  ? 27.646  58.656  225.934 1.00 80.43  ? 75  TRP B CH2 1 
ATOM   3295  N N   . SER B 1 76  ? 20.157  55.849  227.940 1.00 90.13  ? 76  SER B N   1 
ATOM   3296  C CA  . SER B 1 76  ? 19.056  55.466  228.801 1.00 94.11  ? 76  SER B CA  1 
ATOM   3297  C C   . SER B 1 76  ? 19.465  56.216  230.022 1.00 95.18  ? 76  SER B C   1 
ATOM   3298  O O   . SER B 1 76  ? 20.635  56.185  230.382 1.00 96.04  ? 76  SER B O   1 
ATOM   3299  C CB  . SER B 1 76  ? 19.079  53.963  229.072 1.00 95.02  ? 76  SER B CB  1 
ATOM   3300  O OG  . SER B 1 76  ? 18.718  53.202  227.921 1.00 94.97  ? 76  SER B OG  1 
ATOM   3301  N N   . ARG B 1 77  ? 18.530  56.947  230.603 1.00 95.79  ? 77  ARG B N   1 
ATOM   3302  C CA  . ARG B 1 77  ? 18.824  57.745  231.767 1.00 98.48  ? 77  ARG B CA  1 
ATOM   3303  C C   . ARG B 1 77  ? 19.587  56.918  232.792 1.00 97.02  ? 77  ARG B C   1 
ATOM   3304  O O   . ARG B 1 77  ? 20.791  56.803  232.700 1.00 99.86  ? 77  ARG B O   1 
ATOM   3305  C CB  . ARG B 1 77  ? 17.540  58.329  232.325 1.00 100.66 ? 77  ARG B CB  1 
ATOM   3306  C CG  . ARG B 1 77  ? 17.742  59.527  233.222 1.00 110.82 ? 77  ARG B CG  1 
ATOM   3307  C CD  . ARG B 1 77  ? 18.342  60.732  232.520 1.00 118.72 ? 77  ARG B CD  1 
ATOM   3308  N NE  . ARG B 1 77  ? 18.697  61.719  233.531 1.00 131.05 ? 77  ARG B NE  1 
ATOM   3309  C CZ  . ARG B 1 77  ? 18.129  62.914  233.653 1.00 139.34 ? 77  ARG B CZ  1 
ATOM   3310  N NH1 . ARG B 1 77  ? 17.185  63.292  232.795 1.00 144.71 ? 77  ARG B NH1 1 
ATOM   3311  N NH2 . ARG B 1 77  ? 18.417  63.681  234.703 1.00 144.59 ? 77  ARG B NH2 1 
ATOM   3312  N N   . GLY B 1 78  ? 18.926  56.359  233.780 1.00 94.16  ? 78  GLY B N   1 
ATOM   3313  C CA  . GLY B 1 78  ? 19.657  55.548  234.721 1.00 96.46  ? 78  GLY B CA  1 
ATOM   3314  C C   . GLY B 1 78  ? 18.857  54.298  234.629 1.00 99.72  ? 78  GLY B C   1 
ATOM   3315  O O   . GLY B 1 78  ? 17.928  54.234  233.831 1.00 107.88 ? 78  GLY B O   1 
ATOM   3316  N N   . ILE B 1 79  ? 19.201  53.275  235.378 1.00 100.53 ? 79  ILE B N   1 
ATOM   3317  C CA  . ILE B 1 79  ? 18.362  52.115  235.278 1.00 106.81 ? 79  ILE B CA  1 
ATOM   3318  C C   . ILE B 1 79  ? 17.553  51.916  236.526 1.00 111.04 ? 79  ILE B C   1 
ATOM   3319  O O   . ILE B 1 79  ? 18.063  51.640  237.611 1.00 115.70 ? 79  ILE B O   1 
ATOM   3320  C CB  . ILE B 1 79  ? 19.107  50.893  234.880 1.00 109.39 ? 79  ILE B CB  1 
ATOM   3321  C CG1 . ILE B 1 79  ? 20.082  51.270  233.787 1.00 113.60 ? 79  ILE B CG1 1 
ATOM   3322  C CG2 . ILE B 1 79  ? 18.130  49.907  234.253 1.00 115.80 ? 79  ILE B CG2 1 
ATOM   3323  C CD1 . ILE B 1 79  ? 19.383  51.879  232.608 1.00 114.77 ? 79  ILE B CD1 1 
ATOM   3324  N N   . ASN B 1 80  ? 16.273  52.186  236.355 1.00 114.32 ? 80  ASN B N   1 
ATOM   3325  C CA  . ASN B 1 80  ? 15.287  52.090  237.403 1.00 114.72 ? 80  ASN B CA  1 
ATOM   3326  C C   . ASN B 1 80  ? 14.944  50.636  237.601 1.00 111.09 ? 80  ASN B C   1 
ATOM   3327  O O   . ASN B 1 80  ? 14.367  50.015  236.703 1.00 109.31 ? 80  ASN B O   1 
ATOM   3328  C CB  . ASN B 1 80  ? 14.039  52.833  236.961 1.00 124.62 ? 80  ASN B CB  1 
ATOM   3329  C CG  . ASN B 1 80  ? 13.089  53.054  238.083 1.00 134.00 ? 80  ASN B CG  1 
ATOM   3330  O OD1 . ASN B 1 80  ? 11.996  52.493  238.108 1.00 140.52 ? 80  ASN B OD1 1 
ATOM   3331  N ND2 . ASN B 1 80  ? 13.496  53.887  239.036 1.00 139.71 ? 80  ASN B ND2 1 
ATOM   3332  N N   . LEU B 1 81  ? 15.295  50.095  238.764 1.00 109.32 ? 81  LEU B N   1 
ATOM   3333  C CA  . LEU B 1 81  ? 15.027  48.695  239.056 1.00 111.02 ? 81  LEU B CA  1 
ATOM   3334  C C   . LEU B 1 81  ? 13.602  48.362  239.457 1.00 110.47 ? 81  LEU B C   1 
ATOM   3335  O O   . LEU B 1 81  ? 12.639  48.904  238.930 1.00 111.26 ? 81  LEU B O   1 
ATOM   3336  C CB  . LEU B 1 81  ? 15.992  48.180  240.113 1.00 113.62 ? 81  LEU B CB  1 
ATOM   3337  C CG  . LEU B 1 81  ? 16.980  47.171  239.529 1.00 118.46 ? 81  LEU B CG  1 
ATOM   3338  C CD1 . LEU B 1 81  ? 18.257  47.892  239.113 1.00 120.72 ? 81  LEU B CD1 1 
ATOM   3339  C CD2 . LEU B 1 81  ? 17.293  46.083  240.544 1.00 123.70 ? 81  LEU B CD2 1 
ATOM   3340  N N   . ALA B 1 82  ? 13.469  47.412  240.361 1.00 109.86 ? 82  ALA B N   1 
ATOM   3341  C CA  . ALA B 1 82  ? 12.163  47.027  240.822 1.00 112.65 ? 82  ALA B CA  1 
ATOM   3342  C C   . ALA B 1 82  ? 12.222  46.727  242.316 1.00 115.51 ? 82  ALA B C   1 
ATOM   3343  O O   . ALA B 1 82  ? 13.284  46.409  242.867 1.00 117.74 ? 82  ALA B O   1 
ATOM   3344  C CB  . ALA B 1 82  ? 11.686  45.836  240.058 1.00 110.52 ? 82  ALA B CB  1 
ATOM   3345  N N   . THR B 1 83  ? 11.078  46.903  242.968 1.00 116.34 ? 83  THR B N   1 
ATOM   3346  C CA  . THR B 1 83  ? 10.903  46.669  244.394 1.00 113.62 ? 83  THR B CA  1 
ATOM   3347  C C   . THR B 1 83  ? 11.250  45.239  244.704 1.00 111.69 ? 83  THR B C   1 
ATOM   3348  O O   . THR B 1 83  ? 12.030  44.945  245.613 1.00 110.85 ? 83  THR B O   1 
ATOM   3349  C CB  . THR B 1 83  ? 9.439   46.892  244.745 1.00 115.26 ? 83  THR B CB  1 
ATOM   3350  O OG1 . THR B 1 83  ? 9.217   48.294  244.960 1.00 117.98 ? 83  THR B OG1 1 
ATOM   3351  C CG2 . THR B 1 83  ? 9.005   46.041  245.950 1.00 118.09 ? 83  THR B CG2 1 
ATOM   3352  N N   . SER B 1 84  ? 10.582  44.366  243.964 1.00 110.65 ? 84  SER B N   1 
ATOM   3353  C CA  . SER B 1 84  ? 10.749  42.946  244.059 1.00 111.48 ? 84  SER B CA  1 
ATOM   3354  C C   . SER B 1 84  ? 9.578   42.409  243.316 1.00 108.18 ? 84  SER B C   1 
ATOM   3355  O O   . SER B 1 84  ? 8.562   43.069  243.266 1.00 101.23 ? 84  SER B O   1 
ATOM   3356  C CB  . SER B 1 84  ? 10.670  42.476  245.497 1.00 118.64 ? 84  SER B CB  1 
ATOM   3357  O OG  . SER B 1 84  ? 11.115  41.134  245.565 1.00 131.19 ? 84  SER B OG  1 
ATOM   3358  N N   . ASP B 1 85  ? 9.735   41.192  242.803 1.00 110.01 ? 85  ASP B N   1 
ATOM   3359  C CA  . ASP B 1 85  ? 8.745   40.443  242.019 1.00 114.43 ? 85  ASP B CA  1 
ATOM   3360  C C   . ASP B 1 85  ? 7.379   41.097  241.928 1.00 115.97 ? 85  ASP B C   1 
ATOM   3361  O O   . ASP B 1 85  ? 6.799   41.219  240.850 1.00 117.10 ? 85  ASP B O   1 
ATOM   3362  C CB  . ASP B 1 85  ? 8.611   39.014  242.576 1.00 116.44 ? 85  ASP B CB  1 
ATOM   3363  C CG  . ASP B 1 85  ? 8.071   38.009  241.544 1.00 119.04 ? 85  ASP B CG  1 
ATOM   3364  O OD1 . ASP B 1 85  ? 8.859   37.454  240.734 1.00 121.74 ? 85  ASP B OD1 1 
ATOM   3365  O OD2 . ASP B 1 85  ? 6.857   37.729  241.573 1.00 119.68 ? 85  ASP B OD2 1 
ATOM   3366  N N   . THR B 1 86  ? 6.877   41.520  243.073 1.00 118.04 ? 86  THR B N   1 
ATOM   3367  C CA  . THR B 1 86  ? 5.592   42.194  243.166 1.00 122.31 ? 86  THR B CA  1 
ATOM   3368  C C   . THR B 1 86  ? 5.495   43.506  242.397 1.00 122.61 ? 86  THR B C   1 
ATOM   3369  O O   . THR B 1 86  ? 4.500   43.792  241.735 1.00 122.23 ? 86  THR B O   1 
ATOM   3370  C CB  . THR B 1 86  ? 5.297   42.545  244.629 1.00 125.25 ? 86  THR B CB  1 
ATOM   3371  O OG1 . THR B 1 86  ? 4.164   43.429  244.675 1.00 129.55 ? 86  THR B OG1 1 
ATOM   3372  C CG2 . THR B 1 86  ? 6.533   43.228  245.296 1.00 124.81 ? 86  THR B CG2 1 
ATOM   3373  N N   . GLU B 1 87  ? 6.512   44.335  242.588 1.00 122.55 ? 87  GLU B N   1 
ATOM   3374  C CA  . GLU B 1 87  ? 6.545   45.661  242.006 1.00 126.67 ? 87  GLU B CA  1 
ATOM   3375  C C   . GLU B 1 87  ? 7.738   45.872  241.103 1.00 123.58 ? 87  GLU B C   1 
ATOM   3376  O O   . GLU B 1 87  ? 8.894   45.835  241.551 1.00 110.63 ? 87  GLU B O   1 
ATOM   3377  C CB  . GLU B 1 87  ? 6.562   46.699  243.099 1.00 123.14 ? 87  GLU B CB  1 
ATOM   3378  C CG  . GLU B 1 87  ? 6.608   48.112  242.582 1.00 129.49 ? 87  GLU B CG  1 
ATOM   3379  C CD  . GLU B 1 87  ? 5.511   48.974  243.208 1.00 137.50 ? 87  GLU B CD  1 
ATOM   3380  O OE1 . GLU B 1 87  ? 4.705   48.435  244.024 1.00 134.53 ? 87  GLU B OE1 1 
ATOM   3381  O OE2 . GLU B 1 87  ? 5.441   50.181  242.869 1.00 153.37 ? 87  GLU B OE2 1 
ATOM   3382  N N   . ASP B 1 88  ? 7.429   46.130  239.837 1.00 115.32 ? 88  ASP B N   1 
ATOM   3383  C CA  . ASP B 1 88  ? 8.430   46.460  238.850 1.00 107.22 ? 88  ASP B CA  1 
ATOM   3384  C C   . ASP B 1 88  ? 7.905   47.592  238.032 1.00 99.63  ? 88  ASP B C   1 
ATOM   3385  O O   . ASP B 1 88  ? 7.046   47.430  237.158 1.00 92.23  ? 88  ASP B O   1 
ATOM   3386  C CB  . ASP B 1 88  ? 8.751   45.338  237.864 1.00 112.19 ? 88  ASP B CB  1 
ATOM   3387  C CG  . ASP B 1 88  ? 9.656   45.824  236.710 1.00 113.53 ? 88  ASP B CG  1 
ATOM   3388  O OD1 . ASP B 1 88  ? 10.408  46.813  236.925 1.00 113.75 ? 88  ASP B OD1 1 
ATOM   3389  O OD2 . ASP B 1 88  ? 9.626   45.245  235.606 1.00 113.44 ? 88  ASP B OD2 1 
ATOM   3390  N N   . SER B 1 89  ? 8.376   48.755  238.348 1.00 93.61  ? 89  SER B N   1 
ATOM   3391  C CA  . SER B 1 89  ? 7.984   49.870  237.574 1.00 92.58  ? 89  SER B CA  1 
ATOM   3392  C C   . SER B 1 89  ? 9.307   50.341  237.076 1.00 93.27  ? 89  SER B C   1 
ATOM   3393  O O   . SER B 1 89  ? 10.256  50.430  237.852 1.00 94.63  ? 89  SER B O   1 
ATOM   3394  C CB  . SER B 1 89  ? 7.365   50.942  238.426 1.00 93.68  ? 89  SER B CB  1 
ATOM   3395  O OG  . SER B 1 89  ? 7.207   52.095  237.623 1.00 97.39  ? 89  SER B OG  1 
ATOM   3396  N N   . PRO B 1 90  ? 9.424   50.531  235.756 1.00 92.15  ? 90  PRO B N   1 
ATOM   3397  C CA  . PRO B 1 90  ? 10.660  51.002  235.133 1.00 89.69  ? 90  PRO B CA  1 
ATOM   3398  C C   . PRO B 1 90  ? 10.565  52.507  235.205 1.00 86.02  ? 90  PRO B C   1 
ATOM   3399  O O   . PRO B 1 90  ? 9.763   53.039  235.957 1.00 86.69  ? 90  PRO B O   1 
ATOM   3400  C CB  . PRO B 1 90  ? 10.503  50.549  233.684 1.00 93.14  ? 90  PRO B CB  1 
ATOM   3401  C CG  . PRO B 1 90  ? 9.397   49.527  233.719 1.00 93.15  ? 90  PRO B CG  1 
ATOM   3402  C CD  . PRO B 1 90  ? 8.474   50.070  234.736 1.00 92.54  ? 90  PRO B CD  1 
ATOM   3403  N N   . GLY B 1 91  ? 11.240  53.192  234.303 1.00 83.67  ? 91  GLY B N   1 
ATOM   3404  C CA  . GLY B 1 91  ? 11.184  54.641  234.298 1.00 81.26  ? 91  GLY B CA  1 
ATOM   3405  C C   . GLY B 1 91  ? 10.983  55.041  232.864 1.00 79.79  ? 91  GLY B C   1 
ATOM   3406  O O   . GLY B 1 91  ? 11.333  54.284  231.966 1.00 80.99  ? 91  GLY B O   1 
ATOM   3407  N N   . ASN B 1 92  ? 10.475  56.226  232.606 1.00 77.57  ? 92  ASN B N   1 
ATOM   3408  C CA  . ASN B 1 92  ? 10.290  56.546  231.215 1.00 80.83  ? 92  ASN B CA  1 
ATOM   3409  C C   . ASN B 1 92  ? 11.560  56.936  230.456 1.00 82.48  ? 92  ASN B C   1 
ATOM   3410  O O   . ASN B 1 92  ? 11.532  57.354  229.297 1.00 83.86  ? 92  ASN B O   1 
ATOM   3411  C CB  . ASN B 1 92  ? 9.117   57.500  231.027 1.00 81.16  ? 92  ASN B CB  1 
ATOM   3412  C CG  . ASN B 1 92  ? 7.812   56.747  230.737 1.00 80.95  ? 92  ASN B CG  1 
ATOM   3413  O OD1 . ASN B 1 92  ? 7.787   55.505  230.714 1.00 76.05  ? 92  ASN B OD1 1 
ATOM   3414  N ND2 . ASN B 1 92  ? 6.733   57.488  230.512 1.00 77.68  ? 92  ASN B ND2 1 
ATOM   3415  N N   . ASN B 1 93  ? 12.694  56.690  231.090 1.00 84.11  ? 93  ASN B N   1 
ATOM   3416  C CA  . ASN B 1 93  ? 13.982  56.984  230.484 1.00 85.17  ? 93  ASN B CA  1 
ATOM   3417  C C   . ASN B 1 93  ? 14.901  55.834  230.846 1.00 81.51  ? 93  ASN B C   1 
ATOM   3418  O O   . ASN B 1 93  ? 16.118  55.885  230.709 1.00 80.31  ? 93  ASN B O   1 
ATOM   3419  C CB  . ASN B 1 93  ? 14.511  58.334  230.946 1.00 93.93  ? 93  ASN B CB  1 
ATOM   3420  C CG  . ASN B 1 93  ? 13.906  58.764  232.254 1.00 103.13 ? 93  ASN B CG  1 
ATOM   3421  O OD1 . ASN B 1 93  ? 12.843  59.385  232.283 1.00 109.95 ? 93  ASN B OD1 1 
ATOM   3422  N ND2 . ASN B 1 93  ? 14.546  58.395  233.350 1.00 106.95 ? 93  ASN B ND2 1 
ATOM   3423  N N   . THR B 1 94  ? 14.268  54.794  231.351 1.00 76.41  ? 94  THR B N   1 
ATOM   3424  C CA  . THR B 1 94  ? 14.922  53.551  231.678 1.00 72.13  ? 94  THR B CA  1 
ATOM   3425  C C   . THR B 1 94  ? 14.317  52.733  230.580 1.00 66.64  ? 94  THR B C   1 
ATOM   3426  O O   . THR B 1 94  ? 14.217  51.510  230.663 1.00 66.85  ? 94  THR B O   1 
ATOM   3427  C CB  . THR B 1 94  ? 14.362  52.986  232.966 1.00 76.28  ? 94  THR B CB  1 
ATOM   3428  O OG1 . THR B 1 94  ? 14.519  53.962  234.001 1.00 86.38  ? 94  THR B OG1 1 
ATOM   3429  C CG2 . THR B 1 94  ? 15.049  51.658  233.344 1.00 77.17  ? 94  THR B CG2 1 
ATOM   3430  N N   . LEU B 1 95  ? 13.830  53.433  229.573 1.00 61.78  ? 95  LEU B N   1 
ATOM   3431  C CA  . LEU B 1 95  ? 13.183  52.753  228.522 1.00 61.75  ? 95  LEU B CA  1 
ATOM   3432  C C   . LEU B 1 95  ? 13.426  53.170  227.103 1.00 60.75  ? 95  LEU B C   1 
ATOM   3433  O O   . LEU B 1 95  ? 12.990  54.217  226.631 1.00 64.35  ? 95  LEU B O   1 
ATOM   3434  C CB  . LEU B 1 95  ? 11.704  52.639  228.838 1.00 63.08  ? 95  LEU B CB  1 
ATOM   3435  C CG  . LEU B 1 95  ? 11.540  51.251  229.446 1.00 63.95  ? 95  LEU B CG  1 
ATOM   3436  C CD1 . LEU B 1 95  ? 10.202  51.088  230.121 1.00 64.15  ? 95  LEU B CD1 1 
ATOM   3437  C CD2 . LEU B 1 95  ? 11.755  50.218  228.332 1.00 68.66  ? 95  LEU B CD2 1 
ATOM   3438  N N   . PRO B 1 96  ? 14.264  52.403  226.441 1.00 57.29  ? 96  PRO B N   1 
ATOM   3439  C CA  . PRO B 1 96  ? 14.640  52.587  225.058 1.00 53.94  ? 96  PRO B CA  1 
ATOM   3440  C C   . PRO B 1 96  ? 13.400  52.221  224.246 1.00 51.70  ? 96  PRO B C   1 
ATOM   3441  O O   . PRO B 1 96  ? 12.757  51.143  224.435 1.00 45.87  ? 96  PRO B O   1 
ATOM   3442  C CB  . PRO B 1 96  ? 15.773  51.593  224.904 1.00 57.25  ? 96  PRO B CB  1 
ATOM   3443  C CG  . PRO B 1 96  ? 15.463  50.581  225.946 1.00 58.60  ? 96  PRO B CG  1 
ATOM   3444  C CD  . PRO B 1 96  ? 15.142  51.428  227.083 1.00 56.41  ? 96  PRO B CD  1 
ATOM   3445  N N   . THR B 1 97  ? 13.116  53.139  223.331 1.00 49.31  ? 97  THR B N   1 
ATOM   3446  C CA  . THR B 1 97  ? 11.960  53.122  222.464 1.00 52.41  ? 97  THR B CA  1 
ATOM   3447  C C   . THR B 1 97  ? 12.208  53.101  220.971 1.00 52.66  ? 97  THR B C   1 
ATOM   3448  O O   . THR B 1 97  ? 13.137  53.715  220.478 1.00 52.59  ? 97  THR B O   1 
ATOM   3449  C CB  . THR B 1 97  ? 11.181  54.369  222.739 1.00 56.60  ? 97  THR B CB  1 
ATOM   3450  O OG1 . THR B 1 97  ? 12.047  55.323  223.380 1.00 60.25  ? 97  THR B OG1 1 
ATOM   3451  C CG2 . THR B 1 97  ? 10.031  54.069  223.643 1.00 61.81  ? 97  THR B CG2 1 
ATOM   3452  N N   . TRP B 1 98  ? 11.291  52.472  220.251 1.00 55.73  ? 98  TRP B N   1 
ATOM   3453  C CA  . TRP B 1 98  ? 11.360  52.359  218.796 1.00 58.31  ? 98  TRP B CA  1 
ATOM   3454  C C   . TRP B 1 98  ? 11.462  53.706  218.118 1.00 59.48  ? 98  TRP B C   1 
ATOM   3455  O O   . TRP B 1 98  ? 10.477  54.457  218.131 1.00 65.77  ? 98  TRP B O   1 
ATOM   3456  C CB  . TRP B 1 98  ? 10.101  51.675  218.254 1.00 59.05  ? 98  TRP B CB  1 
ATOM   3457  C CG  . TRP B 1 98  ? 10.284  50.224  217.954 1.00 62.25  ? 98  TRP B CG  1 
ATOM   3458  C CD1 . TRP B 1 98  ? 9.861   49.153  218.708 1.00 62.52  ? 98  TRP B CD1 1 
ATOM   3459  C CD2 . TRP B 1 98  ? 10.944  49.679  216.821 1.00 65.17  ? 98  TRP B CD2 1 
ATOM   3460  N NE1 . TRP B 1 98  ? 10.222  47.977  218.104 1.00 64.24  ? 98  TRP B NE1 1 
ATOM   3461  C CE2 . TRP B 1 98  ? 10.889  48.268  216.943 1.00 67.15  ? 98  TRP B CE2 1 
ATOM   3462  C CE3 . TRP B 1 98  ? 11.593  50.242  215.716 1.00 67.24  ? 98  TRP B CE3 1 
ATOM   3463  C CZ2 . TRP B 1 98  ? 11.461  47.415  215.997 1.00 69.30  ? 98  TRP B CZ2 1 
ATOM   3464  C CZ3 . TRP B 1 98  ? 12.166  49.395  214.780 1.00 71.11  ? 98  TRP B CZ3 1 
ATOM   3465  C CH2 . TRP B 1 98  ? 12.095  47.995  214.928 1.00 70.89  ? 98  TRP B CH2 1 
ATOM   3466  N N   . SER B 1 99  ? 12.614  53.971  217.488 1.00 56.76  ? 99  SER B N   1 
ATOM   3467  C CA  . SER B 1 99  ? 12.898  55.217  216.751 1.00 54.16  ? 99  SER B CA  1 
ATOM   3468  C C   . SER B 1 99  ? 12.363  55.116  215.299 1.00 53.51  ? 99  SER B C   1 
ATOM   3469  O O   . SER B 1 99  ? 12.528  54.065  214.646 1.00 53.04  ? 99  SER B O   1 
ATOM   3470  C CB  . SER B 1 99  ? 14.415  55.469  216.719 1.00 52.90  ? 99  SER B CB  1 
ATOM   3471  O OG  . SER B 1 99  ? 15.014  55.373  218.008 1.00 55.73  ? 99  SER B OG  1 
ATOM   3472  N N   . MET B 1 100 ? 11.740  56.190  214.788 1.00 53.02  ? 100 MET B N   1 
ATOM   3473  C CA  . MET B 1 100 ? 11.180  56.179  213.418 1.00 52.91  ? 100 MET B CA  1 
ATOM   3474  C C   . MET B 1 100 ? 10.789  57.543  212.809 1.00 51.70  ? 100 MET B C   1 
ATOM   3475  O O   . MET B 1 100 ? 10.857  58.567  213.489 1.00 54.30  ? 100 MET B O   1 
ATOM   3476  C CB  . MET B 1 100 ? 9.927   55.332  213.425 1.00 55.50  ? 100 MET B CB  1 
ATOM   3477  C CG  . MET B 1 100 ? 8.744   56.082  214.023 1.00 58.28  ? 100 MET B CG  1 
ATOM   3478  S SD  . MET B 1 100 ? 7.960   57.165  212.808 1.00 55.47  ? 100 MET B SD  1 
ATOM   3479  C CE  . MET B 1 100 ? 6.886   55.954  211.991 1.00 62.51  ? 100 MET B CE  1 
ATOM   3480  N N   . ALA B 1 101 ? 10.330  57.529  211.549 1.00 49.05  ? 101 ALA B N   1 
ATOM   3481  C CA  . ALA B 1 101 ? 9.865   58.731  210.834 1.00 46.49  ? 101 ALA B CA  1 
ATOM   3482  C C   . ALA B 1 101 ? 9.246   58.395  209.492 1.00 44.92  ? 101 ALA B C   1 
ATOM   3483  O O   . ALA B 1 101 ? 9.291   57.242  209.033 1.00 40.68  ? 101 ALA B O   1 
ATOM   3484  C CB  . ALA B 1 101 ? 10.984  59.706  210.630 1.00 47.76  ? 101 ALA B CB  1 
ATOM   3485  N N   . LYS B 1 102 ? 8.662   59.410  208.867 1.00 46.09  ? 102 LYS B N   1 
ATOM   3486  C CA  . LYS B 1 102 ? 8.042   59.230  207.558 1.00 50.23  ? 102 LYS B CA  1 
ATOM   3487  C C   . LYS B 1 102 ? 8.440   60.348  206.624 1.00 47.99  ? 102 LYS B C   1 
ATOM   3488  O O   . LYS B 1 102 ? 8.370   61.525  206.972 1.00 49.24  ? 102 LYS B O   1 
ATOM   3489  C CB  . LYS B 1 102 ? 6.518   59.142  207.652 1.00 52.32  ? 102 LYS B CB  1 
ATOM   3490  C CG  . LYS B 1 102 ? 5.785   59.454  206.351 1.00 60.07  ? 102 LYS B CG  1 
ATOM   3491  C CD  . LYS B 1 102 ? 4.266   59.271  206.511 1.00 75.95  ? 102 LYS B CD  1 
ATOM   3492  C CE  . LYS B 1 102 ? 3.440   60.554  206.240 1.00 84.47  ? 102 LYS B CE  1 
ATOM   3493  N NZ  . LYS B 1 102 ? 1.953   60.287  206.119 1.00 90.93  ? 102 LYS B NZ  1 
ATOM   3494  N N   . LEU B 1 103 ? 8.868   59.958  205.437 1.00 45.26  ? 103 LEU B N   1 
ATOM   3495  C CA  . LEU B 1 103 ? 9.301   60.891  204.426 1.00 43.44  ? 103 LEU B CA  1 
ATOM   3496  C C   . LEU B 1 103 ? 8.094   61.191  203.594 1.00 41.50  ? 103 LEU B C   1 
ATOM   3497  O O   . LEU B 1 103 ? 7.420   60.266  203.141 1.00 34.33  ? 103 LEU B O   1 
ATOM   3498  C CB  . LEU B 1 103 ? 10.362  60.240  203.538 1.00 46.86  ? 103 LEU B CB  1 
ATOM   3499  C CG  . LEU B 1 103 ? 11.777  60.028  204.076 1.00 44.74  ? 103 LEU B CG  1 
ATOM   3500  C CD1 . LEU B 1 103 ? 12.559  61.317  204.075 1.00 42.27  ? 103 LEU B CD1 1 
ATOM   3501  C CD2 . LEU B 1 103 ? 11.711  59.452  205.457 1.00 43.79  ? 103 LEU B CD2 1 
ATOM   3502  N N   . GLN B 1 104 ? 7.822   62.466  203.362 1.00 41.59  ? 104 GLN B N   1 
ATOM   3503  C CA  . GLN B 1 104 ? 6.661   62.760  202.564 1.00 44.44  ? 104 GLN B CA  1 
ATOM   3504  C C   . GLN B 1 104 ? 7.005   63.044  201.139 1.00 40.44  ? 104 GLN B C   1 
ATOM   3505  O O   . GLN B 1 104 ? 7.682   64.009  200.856 1.00 41.64  ? 104 GLN B O   1 
ATOM   3506  C CB  . GLN B 1 104 ? 5.874   63.901  203.171 1.00 54.58  ? 104 GLN B CB  1 
ATOM   3507  C CG  . GLN B 1 104 ? 4.480   64.121  202.524 1.00 65.09  ? 104 GLN B CG  1 
ATOM   3508  C CD  . GLN B 1 104 ? 3.729   62.840  202.110 1.00 66.58  ? 104 GLN B CD  1 
ATOM   3509  O OE1 . GLN B 1 104 ? 2.918   62.267  202.869 1.00 67.01  ? 104 GLN B OE1 1 
ATOM   3510  N NE2 . GLN B 1 104 ? 3.952   62.429  200.871 1.00 70.17  ? 104 GLN B NE2 1 
ATOM   3511  N N   . LEU B 1 105 ? 6.494   62.223  200.244 1.00 35.28  ? 105 LEU B N   1 
ATOM   3512  C CA  . LEU B 1 105 ? 6.775   62.369  198.833 1.00 38.63  ? 105 LEU B CA  1 
ATOM   3513  C C   . LEU B 1 105 ? 5.689   62.968  197.979 1.00 41.11  ? 105 LEU B C   1 
ATOM   3514  O O   . LEU B 1 105 ? 4.545   63.043  198.386 1.00 44.29  ? 105 LEU B O   1 
ATOM   3515  C CB  . LEU B 1 105 ? 7.114   61.025  198.253 1.00 36.06  ? 105 LEU B CB  1 
ATOM   3516  C CG  . LEU B 1 105 ? 8.509   60.596  198.597 1.00 39.82  ? 105 LEU B CG  1 
ATOM   3517  C CD1 . LEU B 1 105 ? 8.636   60.434  200.099 1.00 38.96  ? 105 LEU B CD1 1 
ATOM   3518  C CD2 . LEU B 1 105 ? 8.798   59.322  197.855 1.00 40.78  ? 105 LEU B CD2 1 
ATOM   3519  N N   . PRO B 1 106 ? 6.036   63.369  196.747 1.00 43.57  ? 106 PRO B N   1 
ATOM   3520  C CA  . PRO B 1 106 ? 5.101   63.965  195.788 1.00 44.01  ? 106 PRO B CA  1 
ATOM   3521  C C   . PRO B 1 106 ? 4.087   62.953  195.400 1.00 44.30  ? 106 PRO B C   1 
ATOM   3522  O O   . PRO B 1 106 ? 4.276   61.785  195.643 1.00 43.42  ? 106 PRO B O   1 
ATOM   3523  C CB  . PRO B 1 106 ? 5.974   64.233  194.557 1.00 43.91  ? 106 PRO B CB  1 
ATOM   3524  C CG  . PRO B 1 106 ? 7.317   64.433  195.126 1.00 48.17  ? 106 PRO B CG  1 
ATOM   3525  C CD  . PRO B 1 106 ? 7.402   63.374  196.202 1.00 45.21  ? 106 PRO B CD  1 
ATOM   3526  N N   . MET B 1 107 ? 3.030   63.413  194.760 1.00 49.42  ? 107 MET B N   1 
ATOM   3527  C CA  . MET B 1 107 ? 1.996   62.535  194.257 1.00 58.18  ? 107 MET B CA  1 
ATOM   3528  C C   . MET B 1 107 ? 2.368   62.387  192.807 1.00 57.71  ? 107 MET B C   1 
ATOM   3529  O O   . MET B 1 107 ? 2.986   63.266  192.194 1.00 55.89  ? 107 MET B O   1 
ATOM   3530  C CB  . MET B 1 107 ? 0.621   63.165  194.369 1.00 71.40  ? 107 MET B CB  1 
ATOM   3531  C CG  . MET B 1 107 ? 0.259   63.588  195.781 1.00 87.71  ? 107 MET B CG  1 
ATOM   3532  S SD  . MET B 1 107 ? -1.008  64.884  195.747 1.00 106.78 ? 107 MET B SD  1 
ATOM   3533  C CE  . MET B 1 107 ? -2.459  63.899  195.259 1.00 103.97 ? 107 MET B CE  1 
ATOM   3534  N N   . LEU B 1 108 ? 2.039   61.245  192.259 1.00 60.18  ? 108 LEU B N   1 
ATOM   3535  C CA  . LEU B 1 108 ? 2.407   61.010  190.903 1.00 67.57  ? 108 LEU B CA  1 
ATOM   3536  C C   . LEU B 1 108 ? 1.133   61.027  190.114 1.00 74.89  ? 108 LEU B C   1 
ATOM   3537  O O   . LEU B 1 108 ? 0.115   61.493  190.612 1.00 76.46  ? 108 LEU B O   1 
ATOM   3538  C CB  . LEU B 1 108 ? 3.202   59.703  190.813 1.00 64.76  ? 108 LEU B CB  1 
ATOM   3539  C CG  . LEU B 1 108 ? 4.651   59.731  191.391 1.00 64.32  ? 108 LEU B CG  1 
ATOM   3540  C CD1 . LEU B 1 108 ? 4.741   60.301  192.788 1.00 61.28  ? 108 LEU B CD1 1 
ATOM   3541  C CD2 . LEU B 1 108 ? 5.279   58.353  191.415 1.00 64.21  ? 108 LEU B CD2 1 
ATOM   3542  N N   . ASN B 1 109 ? 1.173   60.490  188.907 1.00 84.99  ? 109 ASN B N   1 
ATOM   3543  C CA  . ASN B 1 109 ? 0.017   60.513  188.024 1.00 95.08  ? 109 ASN B CA  1 
ATOM   3544  C C   . ASN B 1 109 ? -0.989  59.382  188.107 1.00 99.11  ? 109 ASN B C   1 
ATOM   3545  O O   . ASN B 1 109 ? -0.716  58.316  188.679 1.00 98.27  ? 109 ASN B O   1 
ATOM   3546  C CB  . ASN B 1 109 ? 0.470   60.640  186.573 1.00 101.25 ? 109 ASN B CB  1 
ATOM   3547  C CG  . ASN B 1 109 ? 1.381   61.818  186.351 1.00 109.84 ? 109 ASN B CG  1 
ATOM   3548  O OD1 . ASN B 1 109 ? 1.834   62.480  187.304 1.00 115.68 ? 109 ASN B OD1 1 
ATOM   3549  N ND2 . ASN B 1 109 ? 1.680   62.084  185.087 1.00 114.23 ? 109 ASN B ND2 1 
ATOM   3550  N N   . GLU B 1 110 ? -2.112  59.629  187.417 1.00 104.45 ? 110 GLU B N   1 
ATOM   3551  C CA  . GLU B 1 110 ? -3.284  58.743  187.292 1.00 106.97 ? 110 GLU B CA  1 
ATOM   3552  C C   . GLU B 1 110 ? -3.629  58.499  185.842 1.00 105.13 ? 110 GLU B C   1 
ATOM   3553  O O   . GLU B 1 110 ? -3.112  59.157  184.925 1.00 106.35 ? 110 GLU B O   1 
ATOM   3554  C CB  . GLU B 1 110 ? -4.543  59.397  187.862 1.00 110.67 ? 110 GLU B CB  1 
ATOM   3555  C CG  . GLU B 1 110 ? -4.894  59.078  189.283 1.00 115.98 ? 110 GLU B CG  1 
ATOM   3556  C CD  . GLU B 1 110 ? -5.606  60.242  189.916 1.00 118.84 ? 110 GLU B CD  1 
ATOM   3557  O OE1 . GLU B 1 110 ? -6.520  60.789  189.246 1.00 118.99 ? 110 GLU B OE1 1 
ATOM   3558  O OE2 . GLU B 1 110 ? -5.245  60.621  191.062 1.00 119.57 ? 110 GLU B OE2 1 
ATOM   3559  N N   . ASP B 1 111 ? -4.677  57.706  185.693 1.00 102.74 ? 111 ASP B N   1 
ATOM   3560  C CA  . ASP B 1 111 ? -5.183  57.339  184.405 1.00 100.80 ? 111 ASP B CA  1 
ATOM   3561  C C   . ASP B 1 111 ? -6.489  56.660  184.729 1.00 101.99 ? 111 ASP B C   1 
ATOM   3562  O O   . ASP B 1 111 ? -6.607  55.444  184.634 1.00 101.96 ? 111 ASP B O   1 
ATOM   3563  C CB  . ASP B 1 111 ? -4.216  56.368  183.751 1.00 96.40  ? 111 ASP B CB  1 
ATOM   3564  C CG  . ASP B 1 111 ? -4.451  56.226  182.291 1.00 95.29  ? 111 ASP B CG  1 
ATOM   3565  O OD1 . ASP B 1 111 ? -4.097  57.144  181.520 1.00 97.23  ? 111 ASP B OD1 1 
ATOM   3566  O OD2 . ASP B 1 111 ? -5.003  55.187  181.920 1.00 94.90  ? 111 ASP B OD2 1 
ATOM   3567  N N   . LEU B 1 112 ? -7.459  57.463  185.163 1.00 105.37 ? 112 LEU B N   1 
ATOM   3568  C CA  . LEU B 1 112 ? -8.800  56.985  185.515 1.00 107.89 ? 112 LEU B CA  1 
ATOM   3569  C C   . LEU B 1 112 ? -9.349  56.287  184.290 1.00 109.24 ? 112 LEU B C   1 
ATOM   3570  O O   . LEU B 1 112 ? -10.347 55.571  184.342 1.00 109.15 ? 112 LEU B O   1 
ATOM   3571  C CB  . LEU B 1 112 ? -9.675  58.172  185.879 1.00 111.72 ? 112 LEU B CB  1 
ATOM   3572  C CG  . LEU B 1 112 ? -8.979  59.093  186.889 1.00 115.42 ? 112 LEU B CG  1 
ATOM   3573  C CD1 . LEU B 1 112 ? -9.045  60.546  186.416 1.00 117.04 ? 112 LEU B CD1 1 
ATOM   3574  C CD2 . LEU B 1 112 ? -9.558  58.915  188.291 1.00 116.13 ? 112 LEU B CD2 1 
ATOM   3575  N N   . THR B 1 113 ? -8.661  56.558  183.189 1.00 110.81 ? 113 THR B N   1 
ATOM   3576  C CA  . THR B 1 113 ? -8.879  56.013  181.860 1.00 113.52 ? 113 THR B CA  1 
ATOM   3577  C C   . THR B 1 113 ? -8.734  54.475  181.897 1.00 111.57 ? 113 THR B C   1 
ATOM   3578  O O   . THR B 1 113 ? -9.691  53.752  181.617 1.00 110.98 ? 113 THR B O   1 
ATOM   3579  C CB  . THR B 1 113 ? -7.779  56.601  180.923 1.00 116.96 ? 113 THR B CB  1 
ATOM   3580  O OG1 . THR B 1 113 ? -7.537  57.978  181.281 1.00 118.57 ? 113 THR B OG1 1 
ATOM   3581  C CG2 . THR B 1 113 ? -8.155  56.470  179.431 1.00 117.50 ? 113 THR B CG2 1 
ATOM   3582  N N   . CYS B 1 114 ? -7.528  54.002  182.234 1.00 108.14 ? 114 CYS B N   1 
ATOM   3583  C CA  . CYS B 1 114 ? -7.202  52.575  182.331 1.00 104.66 ? 114 CYS B CA  1 
ATOM   3584  C C   . CYS B 1 114 ? -7.201  52.180  183.783 1.00 100.62 ? 114 CYS B C   1 
ATOM   3585  O O   . CYS B 1 114 ? -6.608  51.161  184.147 1.00 99.01  ? 114 CYS B O   1 
ATOM   3586  C CB  . CYS B 1 114 ? -5.795  52.329  181.834 1.00 108.57 ? 114 CYS B CB  1 
ATOM   3587  S SG  . CYS B 1 114 ? -5.417  53.178  180.288 1.00 115.67 ? 114 CYS B SG  1 
ATOM   3588  N N   . ASP B 1 115 ? -7.810  53.032  184.602 1.00 97.43  ? 115 ASP B N   1 
ATOM   3589  C CA  . ASP B 1 115 ? -7.895  52.871  186.044 1.00 93.16  ? 115 ASP B CA  1 
ATOM   3590  C C   . ASP B 1 115 ? -6.588  52.340  186.597 1.00 84.24  ? 115 ASP B C   1 
ATOM   3591  O O   . ASP B 1 115 ? -6.526  51.282  187.220 1.00 85.05  ? 115 ASP B O   1 
ATOM   3592  C CB  . ASP B 1 115 ? -9.050  51.959  186.448 1.00 104.25 ? 115 ASP B CB  1 
ATOM   3593  C CG  . ASP B 1 115 ? -9.310  51.997  187.954 1.00 116.40 ? 115 ASP B CG  1 
ATOM   3594  O OD1 . ASP B 1 115 ? -9.068  53.080  188.556 1.00 123.27 ? 115 ASP B OD1 1 
ATOM   3595  O OD2 . ASP B 1 115 ? -9.733  50.961  188.538 1.00 121.45 ? 115 ASP B OD2 1 
ATOM   3596  N N   . THR B 1 116 ? -5.520  53.073  186.360 1.00 74.12  ? 116 THR B N   1 
ATOM   3597  C CA  . THR B 1 116 ? -4.239  52.615  186.813 1.00 61.63  ? 116 THR B CA  1 
ATOM   3598  C C   . THR B 1 116 ? -3.463  53.792  187.319 1.00 55.29  ? 116 THR B C   1 
ATOM   3599  O O   . THR B 1 116 ? -3.579  54.877  186.781 1.00 55.36  ? 116 THR B O   1 
ATOM   3600  C CB  . THR B 1 116 ? -3.516  51.939  185.652 1.00 59.51  ? 116 THR B CB  1 
ATOM   3601  O OG1 . THR B 1 116 ? -2.394  51.225  186.156 1.00 67.74  ? 116 THR B OG1 1 
ATOM   3602  C CG2 . THR B 1 116 ? -3.069  52.940  184.622 1.00 54.93  ? 116 THR B CG2 1 
ATOM   3603  N N   . LEU B 1 117 ? -2.713  53.609  188.385 1.00 49.07  ? 117 LEU B N   1 
ATOM   3604  C CA  . LEU B 1 117 ? -1.937  54.716  188.896 1.00 50.71  ? 117 LEU B CA  1 
ATOM   3605  C C   . LEU B 1 117 ? -0.550  54.292  189.250 1.00 51.36  ? 117 LEU B C   1 
ATOM   3606  O O   . LEU B 1 117 ? -0.281  53.099  189.371 1.00 50.79  ? 117 LEU B O   1 
ATOM   3607  C CB  . LEU B 1 117 ? -2.588  55.349  190.103 1.00 55.02  ? 117 LEU B CB  1 
ATOM   3608  C CG  . LEU B 1 117 ? -3.310  54.440  191.084 1.00 62.59  ? 117 LEU B CG  1 
ATOM   3609  C CD1 . LEU B 1 117 ? -2.564  53.144  191.284 1.00 67.93  ? 117 LEU B CD1 1 
ATOM   3610  C CD2 . LEU B 1 117 ? -3.487  55.187  192.416 1.00 66.56  ? 117 LEU B CD2 1 
ATOM   3611  N N   . GLN B 1 118 ? 0.347   55.264  189.355 1.00 51.80  ? 118 GLN B N   1 
ATOM   3612  C CA  . GLN B 1 118 ? 1.726   54.965  189.703 1.00 50.92  ? 118 GLN B CA  1 
ATOM   3613  C C   . GLN B 1 118 ? 1.995   55.372  191.149 1.00 46.81  ? 118 GLN B C   1 
ATOM   3614  O O   . GLN B 1 118 ? 1.373   56.321  191.639 1.00 44.08  ? 118 GLN B O   1 
ATOM   3615  C CB  . GLN B 1 118 ? 2.700   55.640  188.721 1.00 53.60  ? 118 GLN B CB  1 
ATOM   3616  C CG  . GLN B 1 118 ? 2.643   57.171  188.624 1.00 60.65  ? 118 GLN B CG  1 
ATOM   3617  C CD  . GLN B 1 118 ? 3.654   57.750  187.599 1.00 66.88  ? 118 GLN B CD  1 
ATOM   3618  O OE1 . GLN B 1 118 ? 4.224   57.017  186.777 1.00 69.06  ? 118 GLN B OE1 1 
ATOM   3619  N NE2 . GLN B 1 118 ? 3.871   59.071  187.648 1.00 67.83  ? 118 GLN B NE2 1 
ATOM   3620  N N   . MET B 1 119 ? 2.846   54.609  191.845 1.00 43.82  ? 119 MET B N   1 
ATOM   3621  C CA  . MET B 1 119 ? 3.195   54.905  193.239 1.00 44.37  ? 119 MET B CA  1 
ATOM   3622  C C   . MET B 1 119 ? 4.697   54.925  193.475 1.00 43.91  ? 119 MET B C   1 
ATOM   3623  O O   . MET B 1 119 ? 5.505   54.518  192.602 1.00 37.56  ? 119 MET B O   1 
ATOM   3624  C CB  . MET B 1 119 ? 2.570   53.898  194.198 1.00 47.22  ? 119 MET B CB  1 
ATOM   3625  C CG  . MET B 1 119 ? 1.142   53.558  193.846 1.00 57.22  ? 119 MET B CG  1 
ATOM   3626  S SD  . MET B 1 119 ? 0.389   52.286  194.893 1.00 64.01  ? 119 MET B SD  1 
ATOM   3627  C CE  . MET B 1 119 ? -0.060  53.248  196.406 1.00 67.48  ? 119 MET B CE  1 
ATOM   3628  N N   . TRP B 1 120 ? 5.059   55.416  194.661 1.00 43.61  ? 120 TRP B N   1 
ATOM   3629  C CA  . TRP B 1 120 ? 6.457   55.506  195.060 1.00 44.77  ? 120 TRP B CA  1 
ATOM   3630  C C   . TRP B 1 120 ? 6.872   54.167  195.641 1.00 42.58  ? 120 TRP B C   1 
ATOM   3631  O O   . TRP B 1 120 ? 6.484   53.797  196.757 1.00 41.06  ? 120 TRP B O   1 
ATOM   3632  C CB  . TRP B 1 120 ? 6.669   56.632  196.067 1.00 49.41  ? 120 TRP B CB  1 
ATOM   3633  C CG  . TRP B 1 120 ? 6.832   58.025  195.451 1.00 54.58  ? 120 TRP B CG  1 
ATOM   3634  C CD1 . TRP B 1 120 ? 6.228   59.186  195.855 1.00 55.12  ? 120 TRP B CD1 1 
ATOM   3635  C CD2 . TRP B 1 120 ? 7.719   58.391  194.407 1.00 55.26  ? 120 TRP B CD2 1 
ATOM   3636  N NE1 . TRP B 1 120 ? 6.697   60.245  195.137 1.00 49.62  ? 120 TRP B NE1 1 
ATOM   3637  C CE2 . TRP B 1 120 ? 7.614   59.786  194.239 1.00 52.68  ? 120 TRP B CE2 1 
ATOM   3638  C CE3 . TRP B 1 120 ? 8.601   57.679  193.601 1.00 60.63  ? 120 TRP B CE3 1 
ATOM   3639  C CZ2 . TRP B 1 120 ? 8.360   60.477  193.306 1.00 58.77  ? 120 TRP B CZ2 1 
ATOM   3640  C CZ3 . TRP B 1 120 ? 9.349   58.373  192.666 1.00 64.34  ? 120 TRP B CZ3 1 
ATOM   3641  C CH2 . TRP B 1 120 ? 9.223   59.759  192.526 1.00 63.03  ? 120 TRP B CH2 1 
ATOM   3642  N N   . GLU B 1 121 ? 7.665   53.449  194.855 1.00 38.89  ? 121 GLU B N   1 
ATOM   3643  C CA  . GLU B 1 121 ? 8.104   52.119  195.203 1.00 29.98  ? 121 GLU B CA  1 
ATOM   3644  C C   . GLU B 1 121 ? 9.558   52.069  195.515 1.00 25.96  ? 121 GLU B C   1 
ATOM   3645  O O   . GLU B 1 121 ? 10.389  52.362  194.654 1.00 21.37  ? 121 GLU B O   1 
ATOM   3646  C CB  . GLU B 1 121 ? 7.823   51.207  194.037 1.00 29.81  ? 121 GLU B CB  1 
ATOM   3647  C CG  . GLU B 1 121 ? 7.955   49.781  194.357 1.00 36.71  ? 121 GLU B CG  1 
ATOM   3648  C CD  . GLU B 1 121 ? 8.651   49.046  193.254 1.00 43.24  ? 121 GLU B CD  1 
ATOM   3649  O OE1 . GLU B 1 121 ? 8.063   48.830  192.165 1.00 40.18  ? 121 GLU B OE1 1 
ATOM   3650  O OE2 . GLU B 1 121 ? 9.817   48.681  193.469 1.00 46.65  ? 121 GLU B OE2 1 
ATOM   3651  N N   . ALA B 1 122 ? 9.849   51.746  196.769 1.00 24.52  ? 122 ALA B N   1 
ATOM   3652  C CA  . ALA B 1 122 ? 11.218  51.631  197.226 1.00 21.43  ? 122 ALA B CA  1 
ATOM   3653  C C   . ALA B 1 122 ? 11.724  50.312  196.738 1.00 20.12  ? 122 ALA B C   1 
ATOM   3654  O O   . ALA B 1 122 ? 11.013  49.284  196.708 1.00 16.40  ? 122 ALA B O   1 
ATOM   3655  C CB  . ALA B 1 122 ? 11.323  51.697  198.702 1.00 19.46  ? 122 ALA B CB  1 
ATOM   3656  N N   . VAL B 1 123 ? 13.016  50.337  196.497 1.00 16.06  ? 123 VAL B N   1 
ATOM   3657  C CA  . VAL B 1 123 ? 13.695  49.208  195.937 1.00 16.21  ? 123 VAL B CA  1 
ATOM   3658  C C   . VAL B 1 123 ? 14.802  48.633  196.789 1.00 19.06  ? 123 VAL B C   1 
ATOM   3659  O O   . VAL B 1 123 ? 14.829  47.448  197.130 1.00 19.78  ? 123 VAL B O   1 
ATOM   3660  C CB  . VAL B 1 123 ? 14.340  49.655  194.675 1.00 13.82  ? 123 VAL B CB  1 
ATOM   3661  C CG1 . VAL B 1 123 ? 15.102  48.507  194.059 1.00 15.85  ? 123 VAL B CG1 1 
ATOM   3662  C CG2 . VAL B 1 123 ? 13.298  50.244  193.765 1.00 13.32  ? 123 VAL B CG2 1 
ATOM   3663  N N   . SER B 1 124 ? 15.778  49.473  197.036 1.00 19.33  ? 124 SER B N   1 
ATOM   3664  C CA  . SER B 1 124 ? 16.907  49.073  197.796 1.00 18.88  ? 124 SER B CA  1 
ATOM   3665  C C   . SER B 1 124 ? 17.162  50.139  198.808 1.00 19.29  ? 124 SER B C   1 
ATOM   3666  O O   . SER B 1 124 ? 16.535  51.205  198.821 1.00 20.62  ? 124 SER B O   1 
ATOM   3667  C CB  . SER B 1 124 ? 18.080  48.971  196.864 1.00 23.46  ? 124 SER B CB  1 
ATOM   3668  O OG  . SER B 1 124 ? 18.030  50.054  195.947 1.00 34.10  ? 124 SER B OG  1 
ATOM   3669  N N   . VAL B 1 125 ? 18.150  49.897  199.623 1.00 18.92  ? 125 VAL B N   1 
ATOM   3670  C CA  . VAL B 1 125 ? 18.418  50.860  200.622 1.00 21.01  ? 125 VAL B CA  1 
ATOM   3671  C C   . VAL B 1 125 ? 19.702  50.476  201.249 1.00 23.44  ? 125 VAL B C   1 
ATOM   3672  O O   . VAL B 1 125 ? 19.952  49.294  201.495 1.00 24.31  ? 125 VAL B O   1 
ATOM   3673  C CB  . VAL B 1 125 ? 17.361  50.764  201.718 1.00 17.00  ? 125 VAL B CB  1 
ATOM   3674  C CG1 . VAL B 1 125 ? 17.253  49.341  202.179 1.00 3.07   ? 125 VAL B CG1 1 
ATOM   3675  C CG2 . VAL B 1 125 ? 17.746  51.622  202.900 1.00 19.68  ? 125 VAL B CG2 1 
ATOM   3676  N N   . LYS B 1 126 ? 20.575  51.447  201.400 1.00 26.45  ? 126 LYS B N   1 
ATOM   3677  C CA  . LYS B 1 126 ? 21.779  51.154  202.115 1.00 29.28  ? 126 LYS B CA  1 
ATOM   3678  C C   . LYS B 1 126 ? 21.453  51.803  203.424 1.00 31.48  ? 126 LYS B C   1 
ATOM   3679  O O   . LYS B 1 126 ? 20.662  52.758  203.493 1.00 27.02  ? 126 LYS B O   1 
ATOM   3680  C CB  . LYS B 1 126 ? 22.992  51.894  201.573 1.00 32.48  ? 126 LYS B CB  1 
ATOM   3681  C CG  . LYS B 1 126 ? 23.335  51.667  200.143 1.00 44.57  ? 126 LYS B CG  1 
ATOM   3682  C CD  . LYS B 1 126 ? 24.812  52.026  199.898 1.00 56.51  ? 126 LYS B CD  1 
ATOM   3683  C CE  . LYS B 1 126 ? 25.162  52.009  198.384 1.00 68.10  ? 126 LYS B CE  1 
ATOM   3684  N NZ  . LYS B 1 126 ? 26.628  52.170  197.997 1.00 76.89  ? 126 LYS B NZ  1 
ATOM   3685  N N   . THR B 1 127 ? 22.015  51.255  204.478 1.00 35.54  ? 127 THR B N   1 
ATOM   3686  C CA  . THR B 1 127 ? 21.876  51.875  205.779 1.00 40.29  ? 127 THR B CA  1 
ATOM   3687  C C   . THR B 1 127 ? 23.167  51.596  206.503 1.00 40.52  ? 127 THR B C   1 
ATOM   3688  O O   . THR B 1 127 ? 23.962  50.735  206.061 1.00 46.03  ? 127 THR B O   1 
ATOM   3689  C CB  . THR B 1 127 ? 20.734  51.347  206.611 1.00 42.60  ? 127 THR B CB  1 
ATOM   3690  O OG1 . THR B 1 127 ? 20.894  51.836  207.950 1.00 46.31  ? 127 THR B OG1 1 
ATOM   3691  C CG2 . THR B 1 127 ? 20.735  49.844  206.637 1.00 45.90  ? 127 THR B CG2 1 
ATOM   3692  N N   . GLU B 1 128 ? 23.369  52.309  207.606 1.00 40.07  ? 128 GLU B N   1 
ATOM   3693  C CA  . GLU B 1 128 ? 24.575  52.138  208.389 1.00 41.65  ? 128 GLU B CA  1 
ATOM   3694  C C   . GLU B 1 128 ? 24.466  52.860  209.716 1.00 41.46  ? 128 GLU B C   1 
ATOM   3695  O O   . GLU B 1 128 ? 23.914  53.968  209.815 1.00 41.36  ? 128 GLU B O   1 
ATOM   3696  C CB  . GLU B 1 128 ? 25.749  52.659  207.593 1.00 45.88  ? 128 GLU B CB  1 
ATOM   3697  C CG  . GLU B 1 128 ? 27.102  52.349  208.131 1.00 53.80  ? 128 GLU B CG  1 
ATOM   3698  C CD  . GLU B 1 128 ? 28.124  53.106  207.343 1.00 58.48  ? 128 GLU B CD  1 
ATOM   3699  O OE1 . GLU B 1 128 ? 27.905  53.271  206.116 1.00 59.97  ? 128 GLU B OE1 1 
ATOM   3700  O OE2 . GLU B 1 128 ? 29.116  53.575  207.943 1.00 63.10  ? 128 GLU B OE2 1 
ATOM   3701  N N   . VAL B 1 129 ? 24.945  52.207  210.758 1.00 39.92  ? 129 VAL B N   1 
ATOM   3702  C CA  . VAL B 1 129 ? 24.866  52.821  212.052 1.00 40.91  ? 129 VAL B CA  1 
ATOM   3703  C C   . VAL B 1 129 ? 26.146  53.481  212.290 1.00 37.02  ? 129 VAL B C   1 
ATOM   3704  O O   . VAL B 1 129 ? 27.199  52.837  212.296 1.00 37.21  ? 129 VAL B O   1 
ATOM   3705  C CB  . VAL B 1 129 ? 24.694  51.846  213.136 1.00 47.37  ? 129 VAL B CB  1 
ATOM   3706  C CG1 . VAL B 1 129 ? 24.864  52.581  214.465 1.00 49.92  ? 129 VAL B CG1 1 
ATOM   3707  C CG2 . VAL B 1 129 ? 23.319  51.190  213.013 1.00 51.63  ? 129 VAL B CG2 1 
ATOM   3708  N N   . VAL B 1 130 ? 26.065  54.731  212.669 1.00 32.69  ? 130 VAL B N   1 
ATOM   3709  C CA  . VAL B 1 130 ? 27.308  55.362  212.811 1.00 33.13  ? 130 VAL B CA  1 
ATOM   3710  C C   . VAL B 1 130 ? 27.699  55.794  214.112 1.00 33.71  ? 130 VAL B C   1 
ATOM   3711  O O   . VAL B 1 130 ? 26.874  56.239  214.899 1.00 32.02  ? 130 VAL B O   1 
ATOM   3712  C CB  . VAL B 1 130 ? 27.457  56.485  211.882 1.00 33.09  ? 130 VAL B CB  1 
ATOM   3713  C CG1 . VAL B 1 130 ? 28.630  56.148  210.935 1.00 39.72  ? 130 VAL B CG1 1 
ATOM   3714  C CG2 . VAL B 1 130 ? 26.152  56.717  211.146 1.00 21.49  ? 130 VAL B CG2 1 
ATOM   3715  N N   . GLY B 1 131 ? 28.996  55.637  214.331 1.00 32.84  ? 131 GLY B N   1 
ATOM   3716  C CA  . GLY B 1 131 ? 29.548  56.083  215.580 1.00 34.96  ? 131 GLY B CA  1 
ATOM   3717  C C   . GLY B 1 131 ? 30.177  55.010  216.394 1.00 33.32  ? 131 GLY B C   1 
ATOM   3718  O O   . GLY B 1 131 ? 30.587  55.223  217.528 1.00 28.78  ? 131 GLY B O   1 
ATOM   3719  N N   . SER B 1 132 ? 30.359  53.879  215.761 1.00 34.82  ? 132 SER B N   1 
ATOM   3720  C CA  . SER B 1 132 ? 30.947  52.759  216.447 1.00 40.49  ? 132 SER B CA  1 
ATOM   3721  C C   . SER B 1 132 ? 32.274  53.174  217.016 1.00 41.57  ? 132 SER B C   1 
ATOM   3722  O O   . SER B 1 132 ? 32.713  52.628  218.019 1.00 41.15  ? 132 SER B O   1 
ATOM   3723  C CB  . SER B 1 132 ? 31.087  51.645  215.458 1.00 43.48  ? 132 SER B CB  1 
ATOM   3724  O OG  . SER B 1 132 ? 30.057  51.852  214.494 1.00 49.30  ? 132 SER B OG  1 
ATOM   3725  N N   . GLY B 1 133 ? 32.871  54.192  216.400 1.00 42.55  ? 133 GLY B N   1 
ATOM   3726  C CA  . GLY B 1 133 ? 34.143  54.709  216.882 1.00 47.10  ? 133 GLY B CA  1 
ATOM   3727  C C   . GLY B 1 133 ? 34.026  55.303  218.283 1.00 47.37  ? 133 GLY B C   1 
ATOM   3728  O O   . GLY B 1 133 ? 34.897  55.149  219.136 1.00 45.66  ? 133 GLY B O   1 
ATOM   3729  N N   . SER B 1 134 ? 32.914  55.968  218.521 1.00 47.84  ? 134 SER B N   1 
ATOM   3730  C CA  . SER B 1 134 ? 32.661  56.575  219.796 1.00 53.83  ? 134 SER B CA  1 
ATOM   3731  C C   . SER B 1 134 ? 32.932  55.615  220.961 1.00 55.68  ? 134 SER B C   1 
ATOM   3732  O O   . SER B 1 134 ? 33.337  56.024  222.045 1.00 62.04  ? 134 SER B O   1 
ATOM   3733  C CB  . SER B 1 134 ? 31.202  57.030  219.819 1.00 59.25  ? 134 SER B CB  1 
ATOM   3734  O OG  . SER B 1 134 ? 30.626  56.992  221.123 1.00 68.75  ? 134 SER B OG  1 
ATOM   3735  N N   . LEU B 1 135 ? 32.806  54.325  220.732 1.00 52.57  ? 135 LEU B N   1 
ATOM   3736  C CA  . LEU B 1 135 ? 32.983  53.397  221.831 1.00 52.29  ? 135 LEU B CA  1 
ATOM   3737  C C   . LEU B 1 135 ? 34.436  53.005  222.046 1.00 54.88  ? 135 LEU B C   1 
ATOM   3738  O O   . LEU B 1 135 ? 34.762  51.864  222.406 1.00 51.96  ? 135 LEU B O   1 
ATOM   3739  C CB  . LEU B 1 135 ? 32.090  52.196  221.603 1.00 51.13  ? 135 LEU B CB  1 
ATOM   3740  C CG  . LEU B 1 135 ? 30.598  52.509  221.423 1.00 48.20  ? 135 LEU B CG  1 
ATOM   3741  C CD1 . LEU B 1 135 ? 30.332  53.497  220.312 1.00 47.71  ? 135 LEU B CD1 1 
ATOM   3742  C CD2 . LEU B 1 135 ? 29.865  51.229  221.097 1.00 49.67  ? 135 LEU B CD2 1 
ATOM   3743  N N   . LEU B 1 136 ? 35.306  53.969  221.771 1.00 57.99  ? 136 LEU B N   1 
ATOM   3744  C CA  . LEU B 1 136 ? 36.745  53.817  221.938 1.00 61.97  ? 136 LEU B CA  1 
ATOM   3745  C C   . LEU B 1 136 ? 37.232  54.857  222.940 1.00 64.32  ? 136 LEU B C   1 
ATOM   3746  O O   . LEU B 1 136 ? 38.446  55.020  223.189 1.00 59.71  ? 136 LEU B O   1 
ATOM   3747  C CB  . LEU B 1 136 ? 37.459  53.960  220.600 1.00 62.64  ? 136 LEU B CB  1 
ATOM   3748  C CG  . LEU B 1 136 ? 37.241  52.752  219.697 1.00 62.35  ? 136 LEU B CG  1 
ATOM   3749  C CD1 . LEU B 1 136 ? 37.934  52.950  218.343 1.00 58.36  ? 136 LEU B CD1 1 
ATOM   3750  C CD2 . LEU B 1 136 ? 37.761  51.516  220.443 1.00 63.18  ? 136 LEU B CD2 1 
ATOM   3751  N N   . ASP B 1 137 ? 36.261  55.594  223.471 1.00 68.79  ? 137 ASP B N   1 
ATOM   3752  C CA  . ASP B 1 137 ? 36.554  56.570  224.486 1.00 73.39  ? 137 ASP B CA  1 
ATOM   3753  C C   . ASP B 1 137 ? 36.606  55.686  225.673 1.00 75.20  ? 137 ASP B C   1 
ATOM   3754  O O   . ASP B 1 137 ? 35.643  54.958  225.950 1.00 75.61  ? 137 ASP B O   1 
ATOM   3755  C CB  . ASP B 1 137 ? 35.427  57.554  224.733 1.00 74.67  ? 137 ASP B CB  1 
ATOM   3756  C CG  . ASP B 1 137 ? 35.668  58.392  225.982 1.00 74.87  ? 137 ASP B CG  1 
ATOM   3757  O OD1 . ASP B 1 137 ? 36.790  58.379  226.549 1.00 72.76  ? 137 ASP B OD1 1 
ATOM   3758  O OD2 . ASP B 1 137 ? 34.727  59.065  226.417 1.00 83.11  ? 137 ASP B OD2 1 
ATOM   3759  N N   . VAL B 1 138 ? 37.724  55.758  226.374 1.00 76.34  ? 138 VAL B N   1 
ATOM   3760  C CA  . VAL B 1 138 ? 37.905  54.939  227.536 1.00 76.47  ? 138 VAL B CA  1 
ATOM   3761  C C   . VAL B 1 138 ? 38.378  55.646  228.775 1.00 80.71  ? 138 VAL B C   1 
ATOM   3762  O O   . VAL B 1 138 ? 38.886  54.997  229.689 1.00 80.75  ? 138 VAL B O   1 
ATOM   3763  C CB  . VAL B 1 138 ? 38.740  53.747  227.210 1.00 73.04  ? 138 VAL B CB  1 
ATOM   3764  C CG1 . VAL B 1 138 ? 37.819  52.596  226.864 1.00 67.06  ? 138 VAL B CG1 1 
ATOM   3765  C CG2 . VAL B 1 138 ? 39.648  54.074  226.034 1.00 71.82  ? 138 VAL B CG2 1 
ATOM   3766  N N   . HIS B 1 139 ? 38.327  56.980  228.746 1.00 84.32  ? 139 HIS B N   1 
ATOM   3767  C CA  . HIS B 1 139 ? 38.622  57.783  229.931 1.00 87.85  ? 139 HIS B CA  1 
ATOM   3768  C C   . HIS B 1 139 ? 37.195  58.080  230.389 1.00 92.93  ? 139 HIS B C   1 
ATOM   3769  O O   . HIS B 1 139 ? 36.297  57.265  230.151 1.00 94.36  ? 139 HIS B O   1 
ATOM   3770  C CB  . HIS B 1 139 ? 39.400  59.067  229.635 1.00 82.60  ? 139 HIS B CB  1 
ATOM   3771  C CG  . HIS B 1 139 ? 39.214  59.572  228.254 1.00 85.55  ? 139 HIS B CG  1 
ATOM   3772  N ND1 . HIS B 1 139 ? 39.814  58.978  227.166 1.00 86.26  ? 139 HIS B ND1 1 
ATOM   3773  C CD2 . HIS B 1 139 ? 38.458  60.577  227.764 1.00 84.71  ? 139 HIS B CD2 1 
ATOM   3774  C CE1 . HIS B 1 139 ? 39.428  59.595  226.067 1.00 86.95  ? 139 HIS B CE1 1 
ATOM   3775  N NE2 . HIS B 1 139 ? 38.603  60.570  226.403 1.00 83.83  ? 139 HIS B NE2 1 
ATOM   3776  N N   . GLY B 1 140 ? 36.952  59.230  231.004 1.00 98.79  ? 140 GLY B N   1 
ATOM   3777  C CA  . GLY B 1 140 ? 35.596  59.518  231.480 1.00 103.49 ? 140 GLY B CA  1 
ATOM   3778  C C   . GLY B 1 140 ? 35.285  58.696  232.728 1.00 102.05 ? 140 GLY B C   1 
ATOM   3779  O O   . GLY B 1 140 ? 36.065  57.803  233.036 1.00 100.04 ? 140 GLY B O   1 
ATOM   3780  N N   . PHE B 1 141 ? 34.226  58.988  233.491 1.00 99.94  ? 141 PHE B N   1 
ATOM   3781  C CA  . PHE B 1 141 ? 34.012  58.145  234.668 1.00 95.82  ? 141 PHE B CA  1 
ATOM   3782  C C   . PHE B 1 141 ? 32.983  57.038  234.661 1.00 87.87  ? 141 PHE B C   1 
ATOM   3783  O O   . PHE B 1 141 ? 31.827  57.202  235.085 1.00 90.55  ? 141 PHE B O   1 
ATOM   3784  C CB  . PHE B 1 141 ? 33.991  58.886  236.030 1.00 100.68 ? 141 PHE B CB  1 
ATOM   3785  C CG  . PHE B 1 141 ? 34.854  58.197  237.089 1.00 104.79 ? 141 PHE B CG  1 
ATOM   3786  C CD1 . PHE B 1 141 ? 34.919  56.784  237.171 1.00 104.77 ? 141 PHE B CD1 1 
ATOM   3787  C CD2 . PHE B 1 141 ? 35.736  58.936  237.860 1.00 106.70 ? 141 PHE B CD2 1 
ATOM   3788  C CE1 . PHE B 1 141 ? 35.850  56.135  237.988 1.00 100.38 ? 141 PHE B CE1 1 
ATOM   3789  C CE2 . PHE B 1 141 ? 36.676  58.289  238.684 1.00 108.76 ? 141 PHE B CE2 1 
ATOM   3790  C CZ  . PHE B 1 141 ? 36.736  56.887  238.737 1.00 102.85 ? 141 PHE B CZ  1 
ATOM   3791  N N   . ASN B 1 142 ? 33.452  55.891  234.202 1.00 74.07  ? 142 ASN B N   1 
ATOM   3792  C CA  . ASN B 1 142 ? 32.676  54.689  234.193 1.00 64.51  ? 142 ASN B CA  1 
ATOM   3793  C C   . ASN B 1 142 ? 33.422  53.896  235.241 1.00 59.49  ? 142 ASN B C   1 
ATOM   3794  O O   . ASN B 1 142 ? 34.384  54.380  235.851 1.00 52.95  ? 142 ASN B O   1 
ATOM   3795  C CB  . ASN B 1 142 ? 32.765  53.991  232.833 1.00 68.43  ? 142 ASN B CB  1 
ATOM   3796  C CG  . ASN B 1 142 ? 32.189  54.836  231.695 1.00 72.31  ? 142 ASN B CG  1 
ATOM   3797  O OD1 . ASN B 1 142 ? 32.931  55.433  230.907 1.00 75.73  ? 142 ASN B OD1 1 
ATOM   3798  N ND2 . ASN B 1 142 ? 30.859  54.886  231.606 1.00 69.48  ? 142 ASN B ND2 1 
ATOM   3799  N N   . LYS B 1 143 ? 32.918  52.717  235.535 1.00 58.87  ? 143 LYS B N   1 
ATOM   3800  C CA  . LYS B 1 143 ? 33.583  51.874  236.486 1.00 64.84  ? 143 LYS B CA  1 
ATOM   3801  C C   . LYS B 1 143 ? 34.936  51.639  235.867 1.00 66.40  ? 143 LYS B C   1 
ATOM   3802  O O   . LYS B 1 143 ? 35.053  51.503  234.661 1.00 68.19  ? 143 LYS B O   1 
ATOM   3803  C CB  . LYS B 1 143 ? 32.848  50.548  236.615 1.00 70.77  ? 143 LYS B CB  1 
ATOM   3804  C CG  . LYS B 1 143 ? 32.508  50.154  238.056 1.00 88.55  ? 143 LYS B CG  1 
ATOM   3805  C CD  . LYS B 1 143 ? 31.709  48.803  238.171 1.00 104.44 ? 143 LYS B CD  1 
ATOM   3806  C CE  . LYS B 1 143 ? 31.152  48.529  239.622 1.00 112.44 ? 143 LYS B CE  1 
ATOM   3807  N NZ  . LYS B 1 143 ? 30.354  47.252  239.821 1.00 114.91 ? 143 LYS B NZ  1 
ATOM   3808  N N   . PRO B 1 144 ? 35.989  51.793  236.650 1.00 69.30  ? 144 PRO B N   1 
ATOM   3809  C CA  . PRO B 1 144 ? 37.317  51.566  236.088 1.00 72.47  ? 144 PRO B CA  1 
ATOM   3810  C C   . PRO B 1 144 ? 37.552  50.091  235.911 1.00 76.69  ? 144 PRO B C   1 
ATOM   3811  O O   . PRO B 1 144 ? 36.795  49.266  236.418 1.00 78.24  ? 144 PRO B O   1 
ATOM   3812  C CB  . PRO B 1 144 ? 38.226  52.112  237.168 1.00 71.76  ? 144 PRO B CB  1 
ATOM   3813  C CG  . PRO B 1 144 ? 37.407  53.253  237.709 1.00 73.78  ? 144 PRO B CG  1 
ATOM   3814  C CD  . PRO B 1 144 ? 36.068  52.599  237.874 1.00 71.28  ? 144 PRO B CD  1 
ATOM   3815  N N   . THR B 1 145 ? 38.598  49.762  235.175 1.00 80.53  ? 145 THR B N   1 
ATOM   3816  C CA  . THR B 1 145 ? 38.962  48.381  234.956 1.00 86.10  ? 145 THR B CA  1 
ATOM   3817  C C   . THR B 1 145 ? 39.231  47.798  236.331 1.00 93.75  ? 145 THR B C   1 
ATOM   3818  O O   . THR B 1 145 ? 38.538  46.882  236.789 1.00 95.34  ? 145 THR B O   1 
ATOM   3819  C CB  . THR B 1 145 ? 40.254  48.318  234.184 1.00 82.20  ? 145 THR B CB  1 
ATOM   3820  O OG1 . THR B 1 145 ? 40.131  49.135  233.018 1.00 80.01  ? 145 THR B OG1 1 
ATOM   3821  C CG2 . THR B 1 145 ? 40.585  46.887  233.798 1.00 85.70  ? 145 THR B CG2 1 
ATOM   3822  N N   . ASP B 1 146 ? 40.267  48.338  236.970 1.00 101.38 ? 146 ASP B N   1 
ATOM   3823  C CA  . ASP B 1 146 ? 40.667  47.929  238.303 1.00 105.90 ? 146 ASP B CA  1 
ATOM   3824  C C   . ASP B 1 146 ? 39.969  48.832  239.278 1.00 106.53 ? 146 ASP B C   1 
ATOM   3825  O O   . ASP B 1 146 ? 40.367  49.968  239.511 1.00 100.93 ? 146 ASP B O   1 
ATOM   3826  C CB  . ASP B 1 146 ? 42.161  48.081  238.511 1.00 111.63 ? 146 ASP B CB  1 
ATOM   3827  C CG  . ASP B 1 146 ? 42.538  48.052  239.971 1.00 114.94 ? 146 ASP B CG  1 
ATOM   3828  O OD1 . ASP B 1 146 ? 42.732  46.939  240.503 1.00 119.72 ? 146 ASP B OD1 1 
ATOM   3829  O OD2 . ASP B 1 146 ? 42.613  49.141  240.584 1.00 114.26 ? 146 ASP B OD2 1 
ATOM   3830  N N   . THR B 1 147 ? 38.881  48.322  239.807 1.00 112.19 ? 147 THR B N   1 
ATOM   3831  C CA  . THR B 1 147 ? 38.084  49.040  240.775 1.00 118.69 ? 147 THR B CA  1 
ATOM   3832  C C   . THR B 1 147 ? 38.911  49.370  241.995 1.00 121.57 ? 147 THR B C   1 
ATOM   3833  O O   . THR B 1 147 ? 38.886  50.490  242.505 1.00 123.97 ? 147 THR B O   1 
ATOM   3834  C CB  . THR B 1 147 ? 36.980  48.136  241.247 1.00 120.01 ? 147 THR B CB  1 
ATOM   3835  O OG1 . THR B 1 147 ? 37.506  46.798  241.371 1.00 119.88 ? 147 THR B OG1 1 
ATOM   3836  C CG2 . THR B 1 147 ? 35.839  48.169  240.257 1.00 122.44 ? 147 THR B CG2 1 
ATOM   3837  N N   . VAL B 1 148 ? 39.614  48.342  242.450 1.00 123.00 ? 148 VAL B N   1 
ATOM   3838  C CA  . VAL B 1 148 ? 40.460  48.363  243.630 1.00 124.74 ? 148 VAL B CA  1 
ATOM   3839  C C   . VAL B 1 148 ? 41.261  49.642  243.864 1.00 125.89 ? 148 VAL B C   1 
ATOM   3840  O O   . VAL B 1 148 ? 40.940  50.434  244.749 1.00 128.77 ? 148 VAL B O   1 
ATOM   3841  C CB  . VAL B 1 148 ? 41.401  47.169  243.585 1.00 126.12 ? 148 VAL B CB  1 
ATOM   3842  C CG1 . VAL B 1 148 ? 42.101  46.989  244.917 1.00 128.66 ? 148 VAL B CG1 1 
ATOM   3843  C CG2 . VAL B 1 148 ? 40.620  45.925  243.183 1.00 128.42 ? 148 VAL B CG2 1 
ATOM   3844  N N   . ASN B 1 149 ? 42.317  49.832  243.093 1.00 123.72 ? 149 ASN B N   1 
ATOM   3845  C CA  . ASN B 1 149 ? 43.142  51.017  243.228 1.00 122.85 ? 149 ASN B CA  1 
ATOM   3846  C C   . ASN B 1 149 ? 42.490  52.113  242.418 1.00 120.15 ? 149 ASN B C   1 
ATOM   3847  O O   . ASN B 1 149 ? 43.070  53.182  242.202 1.00 121.09 ? 149 ASN B O   1 
ATOM   3848  C CB  . ASN B 1 149 ? 44.515  50.712  242.683 1.00 129.63 ? 149 ASN B CB  1 
ATOM   3849  C CG  . ASN B 1 149 ? 44.958  49.310  243.018 1.00 137.98 ? 149 ASN B CG  1 
ATOM   3850  O OD1 . ASN B 1 149 ? 45.105  48.963  244.187 1.00 145.33 ? 149 ASN B OD1 1 
ATOM   3851  N ND2 . ASN B 1 149 ? 45.125  48.478  241.997 1.00 142.35 ? 149 ASN B ND2 1 
ATOM   3852  N N   . THR B 1 150 ? 41.276  51.812  241.964 1.00 115.85 ? 150 THR B N   1 
ATOM   3853  C CA  . THR B 1 150 ? 40.462  52.701  241.163 1.00 112.35 ? 150 THR B CA  1 
ATOM   3854  C C   . THR B 1 150 ? 41.328  53.165  240.044 1.00 110.51 ? 150 THR B C   1 
ATOM   3855  O O   . THR B 1 150 ? 41.766  54.312  240.005 1.00 107.38 ? 150 THR B O   1 
ATOM   3856  C CB  . THR B 1 150 ? 39.904  53.888  241.972 1.00 111.49 ? 150 THR B CB  1 
ATOM   3857  O OG1 . THR B 1 150 ? 38.859  53.415  242.835 1.00 112.17 ? 150 THR B OG1 1 
ATOM   3858  C CG2 . THR B 1 150 ? 39.331  54.972  241.036 1.00 109.46 ? 150 THR B CG2 1 
ATOM   3859  N N   . LYS B 1 151 ? 41.624  52.228  239.162 1.00 110.47 ? 151 LYS B N   1 
ATOM   3860  C CA  . LYS B 1 151 ? 42.455  52.513  238.031 1.00 110.00 ? 151 LYS B CA  1 
ATOM   3861  C C   . LYS B 1 151 ? 42.085  51.680  236.815 1.00 102.90 ? 151 LYS B C   1 
ATOM   3862  O O   . LYS B 1 151 ? 41.110  50.918  236.831 1.00 100.82 ? 151 LYS B O   1 
ATOM   3863  C CB  . LYS B 1 151 ? 43.918  52.324  238.427 1.00 118.02 ? 151 LYS B CB  1 
ATOM   3864  C CG  . LYS B 1 151 ? 44.781  53.549  238.139 1.00 134.07 ? 151 LYS B CG  1 
ATOM   3865  C CD  . LYS B 1 151 ? 44.033  54.885  238.401 1.00 146.33 ? 151 LYS B CD  1 
ATOM   3866  C CE  . LYS B 1 151 ? 44.238  55.491  239.808 1.00 152.84 ? 151 LYS B CE  1 
ATOM   3867  N NZ  . LYS B 1 151 ? 43.198  56.546  240.122 1.00 157.71 ? 151 LYS B NZ  1 
ATOM   3868  N N   . GLY B 1 152 ? 42.801  51.931  235.725 1.00 97.29  ? 152 GLY B N   1 
ATOM   3869  C CA  . GLY B 1 152 ? 42.567  51.206  234.499 1.00 89.03  ? 152 GLY B CA  1 
ATOM   3870  C C   . GLY B 1 152 ? 42.047  52.037  233.352 1.00 83.65  ? 152 GLY B C   1 
ATOM   3871  O O   . GLY B 1 152 ? 42.679  52.985  232.893 1.00 79.30  ? 152 GLY B O   1 
ATOM   3872  N N   . ILE B 1 153 ? 40.872  51.637  232.898 1.00 80.27  ? 153 ILE B N   1 
ATOM   3873  C CA  . ILE B 1 153 ? 40.173  52.240  231.786 1.00 75.44  ? 153 ILE B CA  1 
ATOM   3874  C C   . ILE B 1 153 ? 38.778  52.461  232.263 1.00 71.96  ? 153 ILE B C   1 
ATOM   3875  O O   . ILE B 1 153 ? 38.250  51.655  233.035 1.00 72.92  ? 153 ILE B O   1 
ATOM   3876  C CB  . ILE B 1 153 ? 39.975  51.216  230.676 1.00 78.61  ? 153 ILE B CB  1 
ATOM   3877  C CG1 . ILE B 1 153 ? 41.304  50.729  230.136 1.00 79.26  ? 153 ILE B CG1 1 
ATOM   3878  C CG2 . ILE B 1 153 ? 39.049  51.741  229.641 1.00 77.27  ? 153 ILE B CG2 1 
ATOM   3879  C CD1 . ILE B 1 153 ? 42.310  51.803  230.039 1.00 86.97  ? 153 ILE B CD1 1 
ATOM   3880  N N   . SER B 1 154 ? 38.154  53.530  231.814 1.00 67.58  ? 154 SER B N   1 
ATOM   3881  C CA  . SER B 1 154 ? 36.782  53.684  232.209 1.00 66.31  ? 154 SER B CA  1 
ATOM   3882  C C   . SER B 1 154 ? 36.010  52.905  231.176 1.00 63.38  ? 154 SER B C   1 
ATOM   3883  O O   . SER B 1 154 ? 35.910  53.262  229.997 1.00 56.06  ? 154 SER B O   1 
ATOM   3884  C CB  . SER B 1 154 ? 36.317  55.126  232.364 1.00 69.74  ? 154 SER B CB  1 
ATOM   3885  O OG  . SER B 1 154 ? 35.955  55.352  233.730 1.00 65.31  ? 154 SER B OG  1 
ATOM   3886  N N   . THR B 1 155 ? 35.761  51.693  231.643 1.00 63.47  ? 155 THR B N   1 
ATOM   3887  C CA  . THR B 1 155 ? 35.050  50.627  230.991 1.00 63.60  ? 155 THR B CA  1 
ATOM   3888  C C   . THR B 1 155 ? 34.050  50.977  229.925 1.00 62.65  ? 155 THR B C   1 
ATOM   3889  O O   . THR B 1 155 ? 32.982  51.506  230.252 1.00 59.78  ? 155 THR B O   1 
ATOM   3890  C CB  . THR B 1 155 ? 34.344  49.825  232.044 1.00 63.61  ? 155 THR B CB  1 
ATOM   3891  O OG1 . THR B 1 155 ? 35.334  49.169  232.862 1.00 66.99  ? 155 THR B OG1 1 
ATOM   3892  C CG2 . THR B 1 155 ? 33.346  48.832  231.400 1.00 67.01  ? 155 THR B CG2 1 
ATOM   3893  N N   . PRO B 1 156 ? 34.295  50.477  228.683 1.00 62.84  ? 156 PRO B N   1 
ATOM   3894  C CA  . PRO B 1 156 ? 33.497  50.665  227.469 1.00 59.58  ? 156 PRO B CA  1 
ATOM   3895  C C   . PRO B 1 156 ? 32.117  50.092  227.574 1.00 56.54  ? 156 PRO B C   1 
ATOM   3896  O O   . PRO B 1 156 ? 31.766  49.343  228.507 1.00 58.20  ? 156 PRO B O   1 
ATOM   3897  C CB  . PRO B 1 156 ? 34.285  49.894  226.423 1.00 62.08  ? 156 PRO B CB  1 
ATOM   3898  C CG  . PRO B 1 156 ? 34.793  48.741  227.214 1.00 60.66  ? 156 PRO B CG  1 
ATOM   3899  C CD  . PRO B 1 156 ? 35.348  49.478  228.415 1.00 62.16  ? 156 PRO B CD  1 
ATOM   3900  N N   . VAL B 1 157 ? 31.328  50.462  226.591 1.00 49.83  ? 157 VAL B N   1 
ATOM   3901  C CA  . VAL B 1 157 ? 29.994  49.974  226.556 1.00 49.66  ? 157 VAL B CA  1 
ATOM   3902  C C   . VAL B 1 157 ? 30.144  48.511  226.360 1.00 55.22  ? 157 VAL B C   1 
ATOM   3903  O O   . VAL B 1 157 ? 31.024  48.067  225.619 1.00 57.84  ? 157 VAL B O   1 
ATOM   3904  C CB  . VAL B 1 157 ? 29.322  50.429  225.353 1.00 48.45  ? 157 VAL B CB  1 
ATOM   3905  C CG1 . VAL B 1 157 ? 27.854  50.110  225.439 1.00 45.78  ? 157 VAL B CG1 1 
ATOM   3906  C CG2 . VAL B 1 157 ? 29.626  51.869  225.148 1.00 52.00  ? 157 VAL B CG2 1 
ATOM   3907  N N   . GLU B 1 158 ? 29.278  47.764  227.011 1.00 59.74  ? 158 GLU B N   1 
ATOM   3908  C CA  . GLU B 1 158 ? 29.275  46.322  226.892 1.00 65.33  ? 158 GLU B CA  1 
ATOM   3909  C C   . GLU B 1 158 ? 27.810  45.971  227.106 1.00 63.10  ? 158 GLU B C   1 
ATOM   3910  O O   . GLU B 1 158 ? 26.972  46.871  227.173 1.00 60.23  ? 158 GLU B O   1 
ATOM   3911  C CB  . GLU B 1 158 ? 30.182  45.691  227.975 1.00 74.08  ? 158 GLU B CB  1 
ATOM   3912  C CG  . GLU B 1 158 ? 31.710  45.862  227.738 1.00 85.68  ? 158 GLU B CG  1 
ATOM   3913  C CD  . GLU B 1 158 ? 32.590  44.926  228.586 1.00 93.20  ? 158 GLU B CD  1 
ATOM   3914  O OE1 . GLU B 1 158 ? 32.519  45.021  229.833 1.00 98.67  ? 158 GLU B OE1 1 
ATOM   3915  O OE2 . GLU B 1 158 ? 33.369  44.112  228.011 1.00 98.01  ? 158 GLU B OE2 1 
ATOM   3916  N N   . GLY B 1 159 ? 27.493  44.682  227.141 1.00 60.87  ? 159 GLY B N   1 
ATOM   3917  C CA  . GLY B 1 159 ? 26.127  44.252  227.401 1.00 57.26  ? 159 GLY B CA  1 
ATOM   3918  C C   . GLY B 1 159 ? 25.327  43.863  226.184 1.00 55.09  ? 159 GLY B C   1 
ATOM   3919  O O   . GLY B 1 159 ? 25.873  43.809  225.082 1.00 58.82  ? 159 GLY B O   1 
ATOM   3920  N N   . SER B 1 160 ? 24.043  43.564  226.380 1.00 48.82  ? 160 SER B N   1 
ATOM   3921  C CA  . SER B 1 160 ? 23.172  43.184  225.269 1.00 42.40  ? 160 SER B CA  1 
ATOM   3922  C C   . SER B 1 160 ? 23.075  44.289  224.204 1.00 39.31  ? 160 SER B C   1 
ATOM   3923  O O   . SER B 1 160 ? 23.217  45.481  224.478 1.00 35.99  ? 160 SER B O   1 
ATOM   3924  C CB  . SER B 1 160 ? 21.768  42.878  225.790 1.00 40.16  ? 160 SER B CB  1 
ATOM   3925  O OG  . SER B 1 160 ? 21.787  41.971  226.875 1.00 34.73  ? 160 SER B OG  1 
ATOM   3926  N N   . GLN B 1 161 ? 22.841  43.901  222.973 1.00 34.78  ? 161 GLN B N   1 
ATOM   3927  C CA  . GLN B 1 161 ? 22.704  44.905  221.952 1.00 33.89  ? 161 GLN B CA  1 
ATOM   3928  C C   . GLN B 1 161 ? 21.578  44.447  221.035 1.00 34.88  ? 161 GLN B C   1 
ATOM   3929  O O   . GLN B 1 161 ? 21.126  43.275  221.094 1.00 34.00  ? 161 GLN B O   1 
ATOM   3930  C CB  . GLN B 1 161 ? 24.045  45.170  221.254 1.00 39.28  ? 161 GLN B CB  1 
ATOM   3931  C CG  . GLN B 1 161 ? 24.926  43.920  221.040 1.00 46.93  ? 161 GLN B CG  1 
ATOM   3932  C CD  . GLN B 1 161 ? 26.426  44.219  220.845 1.00 50.01  ? 161 GLN B CD  1 
ATOM   3933  O OE1 . GLN B 1 161 ? 26.909  44.474  219.716 1.00 52.04  ? 161 GLN B OE1 1 
ATOM   3934  N NE2 . GLN B 1 161 ? 27.168  44.167  221.948 1.00 46.05  ? 161 GLN B NE2 1 
ATOM   3935  N N   . TYR B 1 162 ? 21.074  45.381  220.241 1.00 33.64  ? 162 TYR B N   1 
ATOM   3936  C CA  . TYR B 1 162 ? 19.954  45.095  219.363 1.00 34.74  ? 162 TYR B CA  1 
ATOM   3937  C C   . TYR B 1 162 ? 19.905  46.194  218.343 1.00 35.68  ? 162 TYR B C   1 
ATOM   3938  O O   . TYR B 1 162 ? 20.052  47.389  218.656 1.00 33.37  ? 162 TYR B O   1 
ATOM   3939  C CB  . TYR B 1 162 ? 18.696  45.145  220.206 1.00 38.70  ? 162 TYR B CB  1 
ATOM   3940  C CG  . TYR B 1 162 ? 17.355  44.837  219.592 1.00 39.77  ? 162 TYR B CG  1 
ATOM   3941  C CD1 . TYR B 1 162 ? 16.573  45.837  219.020 1.00 41.07  ? 162 TYR B CD1 1 
ATOM   3942  C CD2 . TYR B 1 162 ? 16.741  43.621  219.862 1.00 45.30  ? 162 TYR B CD2 1 
ATOM   3943  C CE1 . TYR B 1 162 ? 15.189  45.634  218.772 1.00 45.18  ? 162 TYR B CE1 1 
ATOM   3944  C CE2 . TYR B 1 162 ? 15.366  43.403  219.623 1.00 46.28  ? 162 TYR B CE2 1 
ATOM   3945  C CZ  . TYR B 1 162 ? 14.577  44.407  219.094 1.00 45.48  ? 162 TYR B CZ  1 
ATOM   3946  O OH  . TYR B 1 162 ? 13.188  44.184  219.019 1.00 37.09  ? 162 TYR B OH  1 
ATOM   3947  N N   . HIS B 1 163 ? 19.773  45.767  217.104 1.00 35.04  ? 163 HIS B N   1 
ATOM   3948  C CA  . HIS B 1 163 ? 19.690  46.675  215.981 1.00 33.46  ? 163 HIS B CA  1 
ATOM   3949  C C   . HIS B 1 163 ? 18.622  46.023  215.146 1.00 30.55  ? 163 HIS B C   1 
ATOM   3950  O O   . HIS B 1 163 ? 18.641  44.810  214.969 1.00 27.42  ? 163 HIS B O   1 
ATOM   3951  C CB  . HIS B 1 163 ? 20.998  46.699  215.185 1.00 36.19  ? 163 HIS B CB  1 
ATOM   3952  C CG  . HIS B 1 163 ? 22.210  46.929  216.019 1.00 38.85  ? 163 HIS B CG  1 
ATOM   3953  N ND1 . HIS B 1 163 ? 22.485  48.143  216.604 1.00 43.55  ? 163 HIS B ND1 1 
ATOM   3954  C CD2 . HIS B 1 163 ? 23.194  46.085  216.415 1.00 42.18  ? 163 HIS B CD2 1 
ATOM   3955  C CE1 . HIS B 1 163 ? 23.584  48.036  217.331 1.00 50.90  ? 163 HIS B CE1 1 
ATOM   3956  N NE2 . HIS B 1 163 ? 24.036  46.796  217.234 1.00 46.31  ? 163 HIS B NE2 1 
ATOM   3957  N N   . VAL B 1 164 ? 17.675  46.803  214.666 1.00 26.91  ? 164 VAL B N   1 
ATOM   3958  C CA  . VAL B 1 164 ? 16.614  46.272  213.846 1.00 23.68  ? 164 VAL B CA  1 
ATOM   3959  C C   . VAL B 1 164 ? 16.140  47.465  213.130 1.00 22.93  ? 164 VAL B C   1 
ATOM   3960  O O   . VAL B 1 164 ? 16.213  48.573  213.666 1.00 23.82  ? 164 VAL B O   1 
ATOM   3961  C CB  . VAL B 1 164 ? 15.401  45.800  214.689 1.00 25.66  ? 164 VAL B CB  1 
ATOM   3962  C CG1 . VAL B 1 164 ? 14.141  45.782  213.853 1.00 24.89  ? 164 VAL B CG1 1 
ATOM   3963  C CG2 . VAL B 1 164 ? 15.627  44.409  215.230 1.00 31.68  ? 164 VAL B CG2 1 
ATOM   3964  N N   . PHE B 1 165 ? 15.637  47.257  211.930 1.00 19.88  ? 165 PHE B N   1 
ATOM   3965  C CA  . PHE B 1 165 ? 15.079  48.363  211.216 1.00 20.44  ? 165 PHE B CA  1 
ATOM   3966  C C   . PHE B 1 165 ? 14.194  47.839  210.129 1.00 16.85  ? 165 PHE B C   1 
ATOM   3967  O O   . PHE B 1 165 ? 14.367  46.722  209.619 1.00 16.04  ? 165 PHE B O   1 
ATOM   3968  C CB  . PHE B 1 165 ? 16.153  49.188  210.601 1.00 21.84  ? 165 PHE B CB  1 
ATOM   3969  C CG  . PHE B 1 165 ? 16.688  48.575  209.417 1.00 29.85  ? 165 PHE B CG  1 
ATOM   3970  C CD1 . PHE B 1 165 ? 16.055  48.738  208.197 1.00 35.37  ? 165 PHE B CD1 1 
ATOM   3971  C CD2 . PHE B 1 165 ? 17.785  47.774  209.496 1.00 33.94  ? 165 PHE B CD2 1 
ATOM   3972  C CE1 . PHE B 1 165 ? 16.530  48.107  207.070 1.00 34.54  ? 165 PHE B CE1 1 
ATOM   3973  C CE2 . PHE B 1 165 ? 18.268  47.137  208.360 1.00 36.98  ? 165 PHE B CE2 1 
ATOM   3974  C CZ  . PHE B 1 165 ? 17.642  47.303  207.153 1.00 30.66  ? 165 PHE B CZ  1 
ATOM   3975  N N   . ALA B 1 166 ? 13.423  48.764  209.616 1.00 13.69  ? 166 ALA B N   1 
ATOM   3976  C CA  . ALA B 1 166 ? 12.508  48.437  208.595 1.00 16.68  ? 166 ALA B CA  1 
ATOM   3977  C C   . ALA B 1 166 ? 12.346  49.624  207.708 1.00 19.09  ? 166 ALA B C   1 
ATOM   3978  O O   . ALA B 1 166 ? 12.616  50.779  208.092 1.00 16.52  ? 166 ALA B O   1 
ATOM   3979  C CB  . ALA B 1 166 ? 11.204  48.089  209.206 1.00 17.14  ? 166 ALA B CB  1 
ATOM   3980  N N   . VAL B 1 167 ? 11.786  49.323  206.551 1.00 21.34  ? 167 VAL B N   1 
ATOM   3981  C CA  . VAL B 1 167 ? 11.518  50.296  205.523 1.00 25.73  ? 167 VAL B CA  1 
ATOM   3982  C C   . VAL B 1 167 ? 10.171  49.960  204.917 1.00 31.35  ? 167 VAL B C   1 
ATOM   3983  O O   . VAL B 1 167 ? 10.021  48.885  204.330 1.00 32.19  ? 167 VAL B O   1 
ATOM   3984  C CB  . VAL B 1 167 ? 12.534  50.152  204.440 1.00 18.54  ? 167 VAL B CB  1 
ATOM   3985  C CG1 . VAL B 1 167 ? 12.122  50.941  203.251 1.00 19.16  ? 167 VAL B CG1 1 
ATOM   3986  C CG2 . VAL B 1 167 ? 13.836  50.625  204.940 1.00 23.64  ? 167 VAL B CG2 1 
ATOM   3987  N N   . GLY B 1 168 ? 9.198   50.863  205.024 1.00 36.80  ? 168 GLY B N   1 
ATOM   3988  C CA  . GLY B 1 168 ? 7.893   50.558  204.454 1.00 41.99  ? 168 GLY B CA  1 
ATOM   3989  C C   . GLY B 1 168 ? 7.028   51.613  203.781 1.00 44.92  ? 168 GLY B C   1 
ATOM   3990  O O   . GLY B 1 168 ? 7.208   52.832  203.954 1.00 42.49  ? 168 GLY B O   1 
ATOM   3991  N N   . GLY B 1 169 ? 6.051   51.109  203.024 1.00 49.29  ? 169 GLY B N   1 
ATOM   3992  C CA  . GLY B 1 169 ? 5.100   51.951  202.306 1.00 52.48  ? 169 GLY B CA  1 
ATOM   3993  C C   . GLY B 1 169 ? 3.869   52.283  203.135 1.00 52.99  ? 169 GLY B C   1 
ATOM   3994  O O   . GLY B 1 169 ? 2.824   52.687  202.614 1.00 53.45  ? 169 GLY B O   1 
ATOM   3995  N N   . GLU B 1 170 ? 3.999   52.020  204.428 1.00 52.91  ? 170 GLU B N   1 
ATOM   3996  C CA  . GLU B 1 170 ? 2.996   52.273  205.442 1.00 51.24  ? 170 GLU B CA  1 
ATOM   3997  C C   . GLU B 1 170 ? 3.784   52.035  206.703 1.00 50.32  ? 170 GLU B C   1 
ATOM   3998  O O   . GLU B 1 170 ? 4.880   51.471  206.653 1.00 52.03  ? 170 GLU B O   1 
ATOM   3999  C CB  . GLU B 1 170 ? 1.819   51.333  205.329 1.00 51.52  ? 170 GLU B CB  1 
ATOM   4000  C CG  . GLU B 1 170 ? 2.117   49.928  205.570 1.00 59.80  ? 170 GLU B CG  1 
ATOM   4001  C CD  . GLU B 1 170 ? 0.940   49.123  205.190 1.00 69.18  ? 170 GLU B CD  1 
ATOM   4002  O OE1 . GLU B 1 170 ? -0.011  49.111  205.990 1.00 79.53  ? 170 GLU B OE1 1 
ATOM   4003  O OE2 . GLU B 1 170 ? 0.915   48.594  204.057 1.00 69.22  ? 170 GLU B OE2 1 
ATOM   4004  N N   . PRO B 1 171 ? 3.257   52.453  207.851 1.00 48.89  ? 171 PRO B N   1 
ATOM   4005  C CA  . PRO B 1 171 ? 3.988   52.265  209.110 1.00 50.25  ? 171 PRO B CA  1 
ATOM   4006  C C   . PRO B 1 171 ? 4.248   50.810  209.401 1.00 49.65  ? 171 PRO B C   1 
ATOM   4007  O O   . PRO B 1 171 ? 3.642   49.916  208.786 1.00 47.09  ? 171 PRO B O   1 
ATOM   4008  C CB  . PRO B 1 171 ? 3.047   52.845  210.128 1.00 48.82  ? 171 PRO B CB  1 
ATOM   4009  C CG  . PRO B 1 171 ? 1.747   52.337  209.571 1.00 54.34  ? 171 PRO B CG  1 
ATOM   4010  C CD  . PRO B 1 171 ? 1.834   52.678  208.115 1.00 48.42  ? 171 PRO B CD  1 
ATOM   4011  N N   . LEU B 1 172 ? 5.096   50.593  210.394 1.00 48.79  ? 172 LEU B N   1 
ATOM   4012  C CA  . LEU B 1 172 ? 5.467   49.247  210.772 1.00 51.30  ? 172 LEU B CA  1 
ATOM   4013  C C   . LEU B 1 172 ? 4.390   48.582  211.602 1.00 55.99  ? 172 LEU B C   1 
ATOM   4014  O O   . LEU B 1 172 ? 3.967   49.142  212.624 1.00 61.13  ? 172 LEU B O   1 
ATOM   4015  C CB  . LEU B 1 172 ? 6.734   49.295  211.598 1.00 46.92  ? 172 LEU B CB  1 
ATOM   4016  C CG  . LEU B 1 172 ? 7.555   48.012  211.703 1.00 46.70  ? 172 LEU B CG  1 
ATOM   4017  C CD1 . LEU B 1 172 ? 8.232   47.945  213.081 1.00 44.93  ? 172 LEU B CD1 1 
ATOM   4018  C CD2 . LEU B 1 172 ? 6.712   46.751  211.415 1.00 47.04  ? 172 LEU B CD2 1 
ATOM   4019  N N   . ASP B 1 173 ? 3.986   47.377  211.203 1.00 59.85  ? 173 ASP B N   1 
ATOM   4020  C CA  . ASP B 1 173 ? 2.974   46.629  211.943 1.00 62.73  ? 173 ASP B CA  1 
ATOM   4021  C C   . ASP B 1 173 ? 3.739   45.877  213.017 1.00 60.01  ? 173 ASP B C   1 
ATOM   4022  O O   . ASP B 1 173 ? 4.717   45.166  212.724 1.00 59.49  ? 173 ASP B O   1 
ATOM   4023  C CB  . ASP B 1 173 ? 2.238   45.662  211.014 1.00 74.99  ? 173 ASP B CB  1 
ATOM   4024  C CG  . ASP B 1 173 ? 1.601   46.370  209.812 1.00 87.47  ? 173 ASP B CG  1 
ATOM   4025  O OD1 . ASP B 1 173 ? 0.679   47.188  210.048 1.00 94.93  ? 173 ASP B OD1 1 
ATOM   4026  O OD2 . ASP B 1 173 ? 2.002   46.128  208.639 1.00 92.66  ? 173 ASP B OD2 1 
ATOM   4027  N N   . LEU B 1 174 ? 3.340   46.071  214.269 1.00 55.30  ? 174 LEU B N   1 
ATOM   4028  C CA  . LEU B 1 174 ? 4.041   45.416  215.372 1.00 52.28  ? 174 LEU B CA  1 
ATOM   4029  C C   . LEU B 1 174 ? 3.211   44.558  216.316 1.00 49.73  ? 174 LEU B C   1 
ATOM   4030  O O   . LEU B 1 174 ? 1.975   44.496  216.223 1.00 49.75  ? 174 LEU B O   1 
ATOM   4031  C CB  . LEU B 1 174 ? 4.908   46.414  216.139 1.00 48.28  ? 174 LEU B CB  1 
ATOM   4032  C CG  . LEU B 1 174 ? 4.394   47.800  215.825 1.00 48.19  ? 174 LEU B CG  1 
ATOM   4033  C CD1 . LEU B 1 174 ? 3.214   47.990  216.666 1.00 53.19  ? 174 LEU B CD1 1 
ATOM   4034  C CD2 . LEU B 1 174 ? 5.386   48.863  216.106 1.00 49.78  ? 174 LEU B CD2 1 
ATOM   4035  N N   . GLN B 1 175 ? 3.926   43.893  217.220 1.00 47.26  ? 175 GLN B N   1 
ATOM   4036  C CA  . GLN B 1 175 ? 3.345   42.970  218.169 1.00 42.25  ? 175 GLN B CA  1 
ATOM   4037  C C   . GLN B 1 175 ? 4.010   43.034  219.509 1.00 42.27  ? 175 GLN B C   1 
ATOM   4038  O O   . GLN B 1 175 ? 5.246   43.054  219.654 1.00 42.27  ? 175 GLN B O   1 
ATOM   4039  C CB  . GLN B 1 175 ? 3.464   41.550  217.661 1.00 35.28  ? 175 GLN B CB  1 
ATOM   4040  C CG  . GLN B 1 175 ? 2.171   40.838  217.598 1.00 35.85  ? 175 GLN B CG  1 
ATOM   4041  C CD  . GLN B 1 175 ? 1.951   39.937  218.772 1.00 37.95  ? 175 GLN B CD  1 
ATOM   4042  O OE1 . GLN B 1 175 ? 1.686   38.751  218.591 1.00 42.75  ? 175 GLN B OE1 1 
ATOM   4043  N NE2 . GLN B 1 175 ? 2.036   40.481  219.981 1.00 34.89  ? 175 GLN B NE2 1 
ATOM   4044  N N   . GLY B 1 176 ? 3.189   43.049  220.521 1.00 41.54  ? 176 GLY B N   1 
ATOM   4045  C CA  . GLY B 1 176 ? 3.735   43.149  221.843 1.00 42.77  ? 176 GLY B CA  1 
ATOM   4046  C C   . GLY B 1 176 ? 3.750   41.811  222.508 1.00 42.88  ? 176 GLY B C   1 
ATOM   4047  O O   . GLY B 1 176 ? 2.848   40.984  222.262 1.00 38.34  ? 176 GLY B O   1 
ATOM   4048  N N   . LEU B 1 177 ? 4.885   41.563  223.189 1.00 46.23  ? 177 LEU B N   1 
ATOM   4049  C CA  . LEU B 1 177 ? 5.175   40.400  224.081 1.00 52.04  ? 177 LEU B CA  1 
ATOM   4050  C C   . LEU B 1 177 ? 6.108   40.961  225.037 1.00 56.29  ? 177 LEU B C   1 
ATOM   4051  O O   . LEU B 1 177 ? 6.974   41.726  224.666 1.00 58.73  ? 177 LEU B O   1 
ATOM   4052  C CB  . LEU B 1 177 ? 5.992   39.228  223.521 1.00 50.47  ? 177 LEU B CB  1 
ATOM   4053  C CG  . LEU B 1 177 ? 4.983   38.789  222.482 1.00 38.41  ? 177 LEU B CG  1 
ATOM   4054  C CD1 . LEU B 1 177 ? 5.683   37.693  221.611 1.00 39.65  ? 177 LEU B CD1 1 
ATOM   4055  C CD2 . LEU B 1 177 ? 3.456   38.471  222.988 1.00 40.11  ? 177 LEU B CD2 1 
ATOM   4056  N N   . VAL B 1 178 ? 5.962   40.500  226.265 1.00 58.95  ? 178 VAL B N   1 
ATOM   4057  C CA  . VAL B 1 178 ? 6.772   41.052  227.299 1.00 62.87  ? 178 VAL B CA  1 
ATOM   4058  C C   . VAL B 1 178 ? 7.223   39.937  228.200 1.00 66.91  ? 178 VAL B C   1 
ATOM   4059  O O   . VAL B 1 178 ? 6.783   38.796  228.080 1.00 70.43  ? 178 VAL B O   1 
ATOM   4060  C CB  . VAL B 1 178 ? 5.938   41.999  228.089 1.00 62.09  ? 178 VAL B CB  1 
ATOM   4061  C CG1 . VAL B 1 178 ? 4.683   41.254  228.559 1.00 61.51  ? 178 VAL B CG1 1 
ATOM   4062  C CG2 . VAL B 1 178 ? 6.731   42.575  229.262 1.00 62.29  ? 178 VAL B CG2 1 
ATOM   4063  N N   . THR B 1 179 ? 8.151   40.287  229.081 1.00 68.54  ? 179 THR B N   1 
ATOM   4064  C CA  . THR B 1 179 ? 8.657   39.396  230.086 1.00 72.22  ? 179 THR B CA  1 
ATOM   4065  C C   . THR B 1 179 ? 7.563   39.266  231.181 1.00 78.19  ? 179 THR B C   1 
ATOM   4066  O O   . THR B 1 179 ? 6.836   38.276  231.203 1.00 82.28  ? 179 THR B O   1 
ATOM   4067  C CB  . THR B 1 179 ? 9.921   39.998  230.618 1.00 70.17  ? 179 THR B CB  1 
ATOM   4068  O OG1 . THR B 1 179 ? 9.857   41.418  230.416 1.00 64.75  ? 179 THR B OG1 1 
ATOM   4069  C CG2 . THR B 1 179 ? 11.100  39.460  229.847 1.00 70.37  ? 179 THR B CG2 1 
ATOM   4070  N N   . ASP B 1 180 ? 7.355   40.293  232.009 1.00 81.32  ? 180 ASP B N   1 
ATOM   4071  C CA  . ASP B 1 180 ? 6.332   40.215  233.059 1.00 80.15  ? 180 ASP B CA  1 
ATOM   4072  C C   . ASP B 1 180 ? 5.138   41.085  232.869 1.00 76.22  ? 180 ASP B C   1 
ATOM   4073  O O   . ASP B 1 180 ? 5.218   42.279  233.114 1.00 73.11  ? 180 ASP B O   1 
ATOM   4074  C CB  . ASP B 1 180 ? 6.922   40.560  234.394 1.00 90.98  ? 180 ASP B CB  1 
ATOM   4075  C CG  . ASP B 1 180 ? 6.972   39.385  235.279 1.00 105.65 ? 180 ASP B CG  1 
ATOM   4076  O OD1 . ASP B 1 180 ? 5.952   38.647  235.308 1.00 110.43 ? 180 ASP B OD1 1 
ATOM   4077  O OD2 . ASP B 1 180 ? 8.039   39.184  235.906 1.00 114.96 ? 180 ASP B OD2 1 
ATOM   4078  N N   . ALA B 1 181 ? 3.992   40.476  232.602 1.00 73.11  ? 181 ALA B N   1 
ATOM   4079  C CA  . ALA B 1 181 ? 2.762   41.235  232.363 1.00 75.83  ? 181 ALA B CA  1 
ATOM   4080  C C   . ALA B 1 181 ? 2.337   42.135  233.531 1.00 78.31  ? 181 ALA B C   1 
ATOM   4081  O O   . ALA B 1 181 ? 1.332   42.855  233.490 1.00 78.17  ? 181 ALA B O   1 
ATOM   4082  C CB  . ALA B 1 181 ? 1.649   40.286  231.991 1.00 76.27  ? 181 ALA B CB  1 
ATOM   4083  N N   . ARG B 1 182 ? 3.152   42.108  234.563 1.00 82.19  ? 182 ARG B N   1 
ATOM   4084  C CA  . ARG B 1 182 ? 2.908   42.867  235.757 1.00 85.10  ? 182 ARG B CA  1 
ATOM   4085  C C   . ARG B 1 182 ? 3.692   44.174  235.800 1.00 85.63  ? 182 ARG B C   1 
ATOM   4086  O O   . ARG B 1 182 ? 3.465   45.003  236.671 1.00 86.44  ? 182 ARG B O   1 
ATOM   4087  C CB  . ARG B 1 182 ? 3.335   42.003  236.916 1.00 87.97  ? 182 ARG B CB  1 
ATOM   4088  C CG  . ARG B 1 182 ? 4.764   41.551  236.748 1.00 87.82  ? 182 ARG B CG  1 
ATOM   4089  C CD  . ARG B 1 182 ? 5.209   40.769  237.928 1.00 92.14  ? 182 ARG B CD  1 
ATOM   4090  N NE  . ARG B 1 182 ? 4.313   39.650  238.191 1.00 98.90  ? 182 ARG B NE  1 
ATOM   4091  C CZ  . ARG B 1 182 ? 4.664   38.584  238.900 1.00 105.67 ? 182 ARG B CZ  1 
ATOM   4092  N NH1 . ARG B 1 182 ? 5.891   38.504  239.401 1.00 106.72 ? 182 ARG B NH1 1 
ATOM   4093  N NH2 . ARG B 1 182 ? 3.791   37.606  239.118 1.00 111.49 ? 182 ARG B NH2 1 
ATOM   4094  N N   . THR B 1 183 ? 4.644   44.351  234.896 1.00 85.54  ? 183 THR B N   1 
ATOM   4095  C CA  . THR B 1 183 ? 5.428   45.568  234.919 1.00 84.37  ? 183 THR B CA  1 
ATOM   4096  C C   . THR B 1 183 ? 4.557   46.802  234.879 1.00 86.03  ? 183 THR B C   1 
ATOM   4097  O O   . THR B 1 183 ? 3.604   46.940  234.082 1.00 84.59  ? 183 THR B O   1 
ATOM   4098  C CB  . THR B 1 183 ? 6.450   45.620  233.807 1.00 83.97  ? 183 THR B CB  1 
ATOM   4099  O OG1 . THR B 1 183 ? 7.151   44.374  233.756 1.00 86.59  ? 183 THR B OG1 1 
ATOM   4100  C CG2 . THR B 1 183 ? 7.446   46.718  234.084 1.00 84.05  ? 183 THR B CG2 1 
ATOM   4101  N N   . LYS B 1 184 ? 4.867   47.669  235.822 1.00 88.13  ? 184 LYS B N   1 
ATOM   4102  C CA  . LYS B 1 184 ? 4.177   48.915  236.001 1.00 92.72  ? 184 LYS B CA  1 
ATOM   4103  C C   . LYS B 1 184 ? 4.652   49.969  235.035 1.00 88.45  ? 184 LYS B C   1 
ATOM   4104  O O   . LYS B 1 184 ? 5.463   50.832  235.370 1.00 86.18  ? 184 LYS B O   1 
ATOM   4105  C CB  . LYS B 1 184 ? 4.349   49.390  237.435 1.00 104.72 ? 184 LYS B CB  1 
ATOM   4106  C CG  . LYS B 1 184 ? 3.533   48.590  238.471 1.00 122.56 ? 184 LYS B CG  1 
ATOM   4107  C CD  . LYS B 1 184 ? 4.086   47.171  238.752 1.00 133.69 ? 184 LYS B CD  1 
ATOM   4108  C CE  . LYS B 1 184 ? 3.232   46.384  239.802 1.00 139.80 ? 184 LYS B CE  1 
ATOM   4109  N NZ  . LYS B 1 184 ? 3.235   46.923  241.221 1.00 141.75 ? 184 LYS B NZ  1 
ATOM   4110  N N   . TYR B 1 185 ? 4.239   49.822  233.789 1.00 85.73  ? 185 TYR B N   1 
ATOM   4111  C CA  . TYR B 1 185 ? 4.601   50.802  232.789 1.00 85.09  ? 185 TYR B CA  1 
ATOM   4112  C C   . TYR B 1 185 ? 3.685   51.946  233.102 1.00 86.98  ? 185 TYR B C   1 
ATOM   4113  O O   . TYR B 1 185 ? 2.641   51.737  233.690 1.00 86.08  ? 185 TYR B O   1 
ATOM   4114  C CB  . TYR B 1 185 ? 4.365   50.260  231.380 1.00 83.94  ? 185 TYR B CB  1 
ATOM   4115  C CG  . TYR B 1 185 ? 5.388   49.229  230.987 1.00 83.73  ? 185 TYR B CG  1 
ATOM   4116  C CD1 . TYR B 1 185 ? 6.724   49.434  231.291 1.00 86.78  ? 185 TYR B CD1 1 
ATOM   4117  C CD2 . TYR B 1 185 ? 5.030   48.047  230.347 1.00 81.96  ? 185 TYR B CD2 1 
ATOM   4118  C CE1 . TYR B 1 185 ? 7.688   48.493  230.980 1.00 88.82  ? 185 TYR B CE1 1 
ATOM   4119  C CE2 . TYR B 1 185 ? 5.988   47.097  230.024 1.00 84.02  ? 185 TYR B CE2 1 
ATOM   4120  C CZ  . TYR B 1 185 ? 7.327   47.327  230.348 1.00 87.18  ? 185 TYR B CZ  1 
ATOM   4121  O OH  . TYR B 1 185 ? 8.328   46.412  230.067 1.00 88.25  ? 185 TYR B OH  1 
ATOM   4122  N N   . LYS B 1 186 ? 4.075   53.149  232.731 1.00 91.96  ? 186 LYS B N   1 
ATOM   4123  C CA  . LYS B 1 186 ? 3.265   54.302  233.013 1.00 99.07  ? 186 LYS B CA  1 
ATOM   4124  C C   . LYS B 1 186 ? 2.247   54.385  231.920 1.00 101.80 ? 186 LYS B C   1 
ATOM   4125  O O   . LYS B 1 186 ? 2.446   53.897  230.810 1.00 102.69 ? 186 LYS B O   1 
ATOM   4126  C CB  . LYS B 1 186 ? 4.124   55.543  233.073 1.00 102.98 ? 186 LYS B CB  1 
ATOM   4127  C CG  . LYS B 1 186 ? 5.378   55.326  233.902 1.00 116.56 ? 186 LYS B CG  1 
ATOM   4128  C CD  . LYS B 1 186 ? 6.552   54.765  233.061 1.00 127.25 ? 186 LYS B CD  1 
ATOM   4129  C CE  . LYS B 1 186 ? 6.920   53.279  233.283 1.00 130.84 ? 186 LYS B CE  1 
ATOM   4130  N NZ  . LYS B 1 186 ? 7.468   52.973  234.636 1.00 138.11 ? 186 LYS B NZ  1 
ATOM   4131  N N   . GLU B 1 187 ? 1.088   54.876  232.295 1.00 108.35 ? 187 GLU B N   1 
ATOM   4132  C CA  . GLU B 1 187 ? 0.005   55.012  231.352 1.00 116.22 ? 187 GLU B CA  1 
ATOM   4133  C C   . GLU B 1 187 ? 0.384   56.232  230.567 1.00 115.79 ? 187 GLU B C   1 
ATOM   4134  O O   . GLU B 1 187 ? -0.026  56.435  229.419 1.00 115.37 ? 187 GLU B O   1 
ATOM   4135  C CB  . GLU B 1 187 ? -1.283  55.329  232.115 1.00 128.64 ? 187 GLU B CB  1 
ATOM   4136  C CG  . GLU B 1 187 ? -1.569  54.457  233.355 1.00 142.17 ? 187 GLU B CG  1 
ATOM   4137  C CD  . GLU B 1 187 ? -2.286  53.133  233.033 1.00 151.17 ? 187 GLU B CD  1 
ATOM   4138  O OE1 . GLU B 1 187 ? -2.972  53.040  231.980 1.00 157.36 ? 187 GLU B OE1 1 
ATOM   4139  O OE2 . GLU B 1 187 ? -2.164  52.184  233.848 1.00 154.93 ? 187 GLU B OE2 1 
ATOM   4140  N N   . GLU B 1 188 ? 1.189   57.046  231.229 1.00 116.58 ? 188 GLU B N   1 
ATOM   4141  C CA  . GLU B 1 188 ? 1.616   58.303  230.685 1.00 121.81 ? 188 GLU B CA  1 
ATOM   4142  C C   . GLU B 1 188 ? 2.973   58.361  229.990 1.00 115.56 ? 188 GLU B C   1 
ATOM   4143  O O   . GLU B 1 188 ? 3.986   57.953  230.568 1.00 114.07 ? 188 GLU B O   1 
ATOM   4144  C CB  . GLU B 1 188 ? 1.556   59.343  231.806 1.00 137.69 ? 188 GLU B CB  1 
ATOM   4145  C CG  . GLU B 1 188 ? 1.619   60.801  231.338 1.00 163.28 ? 188 GLU B CG  1 
ATOM   4146  C CD  . GLU B 1 188 ? 0.438   61.233  230.436 1.00 177.18 ? 188 GLU B CD  1 
ATOM   4147  O OE1 . GLU B 1 188 ? -0.216  60.365  229.793 1.00 185.14 ? 188 GLU B OE1 1 
ATOM   4148  O OE2 . GLU B 1 188 ? 0.180   62.464  230.360 1.00 185.18 ? 188 GLU B OE2 1 
ATOM   4149  N N   . GLY B 1 189 ? 2.966   58.867  228.748 1.00 108.92 ? 189 GLY B N   1 
ATOM   4150  C CA  . GLY B 1 189 ? 4.179   59.058  227.950 1.00 98.35  ? 189 GLY B CA  1 
ATOM   4151  C C   . GLY B 1 189 ? 4.898   57.900  227.275 1.00 88.54  ? 189 GLY B C   1 
ATOM   4152  O O   . GLY B 1 189 ? 6.092   57.982  226.963 1.00 87.38  ? 189 GLY B O   1 
ATOM   4153  N N   . VAL B 1 190 ? 4.174   56.826  227.021 1.00 78.48  ? 190 VAL B N   1 
ATOM   4154  C CA  . VAL B 1 190 ? 4.756   55.664  226.388 1.00 68.72  ? 190 VAL B CA  1 
ATOM   4155  C C   . VAL B 1 190 ? 3.614   54.761  226.021 1.00 63.18  ? 190 VAL B C   1 
ATOM   4156  O O   . VAL B 1 190 ? 2.619   54.690  226.729 1.00 63.79  ? 190 VAL B O   1 
ATOM   4157  C CB  . VAL B 1 190 ? 5.729   54.917  227.324 1.00 66.30  ? 190 VAL B CB  1 
ATOM   4158  C CG1 . VAL B 1 190 ? 5.334   55.091  228.778 1.00 63.00  ? 190 VAL B CG1 1 
ATOM   4159  C CG2 . VAL B 1 190 ? 5.740   53.440  226.972 1.00 67.80  ? 190 VAL B CG2 1 
ATOM   4160  N N   . VAL B 1 191 ? 3.736   54.086  224.899 1.00 56.82  ? 191 VAL B N   1 
ATOM   4161  C CA  . VAL B 1 191 ? 2.664   53.222  224.511 1.00 53.51  ? 191 VAL B CA  1 
ATOM   4162  C C   . VAL B 1 191 ? 2.876   51.805  224.959 1.00 54.04  ? 191 VAL B C   1 
ATOM   4163  O O   . VAL B 1 191 ? 3.772   51.110  224.499 1.00 57.38  ? 191 VAL B O   1 
ATOM   4164  C CB  . VAL B 1 191 ? 2.472   53.211  223.044 1.00 53.26  ? 191 VAL B CB  1 
ATOM   4165  C CG1 . VAL B 1 191 ? 1.124   52.590  222.745 1.00 56.77  ? 191 VAL B CG1 1 
ATOM   4166  C CG2 . VAL B 1 191 ? 2.607   54.602  222.490 1.00 49.54  ? 191 VAL B CG2 1 
ATOM   4167  N N   . THR B 1 192 ? 2.021   51.360  225.845 1.00 52.60  ? 192 THR B N   1 
ATOM   4168  C CA  . THR B 1 192 ? 2.126   50.018  226.327 1.00 47.76  ? 192 THR B CA  1 
ATOM   4169  C C   . THR B 1 192 ? 0.902   49.283  225.902 1.00 46.03  ? 192 THR B C   1 
ATOM   4170  O O   . THR B 1 192 ? -0.106  49.888  225.540 1.00 44.86  ? 192 THR B O   1 
ATOM   4171  C CB  . THR B 1 192 ? 2.273   49.983  227.839 1.00 48.02  ? 192 THR B CB  1 
ATOM   4172  O OG1 . THR B 1 192 ? 2.037   51.285  228.407 1.00 47.09  ? 192 THR B OG1 1 
ATOM   4173  C CG2 . THR B 1 192 ? 3.650   49.593  228.166 1.00 45.43  ? 192 THR B CG2 1 
ATOM   4174  N N   . ILE B 1 193 ? 1.053   47.976  225.830 1.00 47.77  ? 193 ILE B N   1 
ATOM   4175  C CA  . ILE B 1 193 ? -0.008  47.037  225.476 1.00 53.07  ? 193 ILE B CA  1 
ATOM   4176  C C   . ILE B 1 193 ? -1.364  47.502  225.975 1.00 57.51  ? 193 ILE B C   1 
ATOM   4177  O O   . ILE B 1 193 ? -2.397  47.266  225.353 1.00 52.88  ? 193 ILE B O   1 
ATOM   4178  C CB  . ILE B 1 193 ? 0.277   45.653  226.097 1.00 51.17  ? 193 ILE B CB  1 
ATOM   4179  C CG1 . ILE B 1 193 ? 1.481   45.715  227.073 1.00 51.09  ? 193 ILE B CG1 1 
ATOM   4180  C CG2 . ILE B 1 193 ? 0.559   44.652  224.997 1.00 46.05  ? 193 ILE B CG2 1 
ATOM   4181  C CD1 . ILE B 1 193 ? 1.448   46.781  228.223 1.00 43.88  ? 193 ILE B CD1 1 
ATOM   4182  N N   . LYS B 1 194 ? -1.329  48.131  227.138 1.00 65.05  ? 194 LYS B N   1 
ATOM   4183  C CA  . LYS B 1 194 ? -2.514  48.663  227.782 1.00 74.79  ? 194 LYS B CA  1 
ATOM   4184  C C   . LYS B 1 194 ? -2.940  49.851  226.979 1.00 74.31  ? 194 LYS B C   1 
ATOM   4185  O O   . LYS B 1 194 ? -3.934  49.822  226.277 1.00 74.27  ? 194 LYS B O   1 
ATOM   4186  C CB  . LYS B 1 194 ? -2.164  49.121  229.194 1.00 85.16  ? 194 LYS B CB  1 
ATOM   4187  C CG  . LYS B 1 194 ? -0.672  49.501  229.353 1.00 103.95 ? 194 LYS B CG  1 
ATOM   4188  C CD  . LYS B 1 194 ? -0.301  49.785  230.817 1.00 124.20 ? 194 LYS B CD  1 
ATOM   4189  C CE  . LYS B 1 194 ? 1.123   49.289  231.200 1.00 133.86 ? 194 LYS B CE  1 
ATOM   4190  N NZ  . LYS B 1 194 ? 1.454   49.384  232.678 1.00 140.48 ? 194 LYS B NZ  1 
ATOM   4191  N N   . THR B 1 195 ? -2.105  50.878  227.032 1.00 75.28  ? 195 THR B N   1 
ATOM   4192  C CA  . THR B 1 195 ? -2.334  52.131  226.347 1.00 74.70  ? 195 THR B CA  1 
ATOM   4193  C C   . THR B 1 195 ? -3.037  51.868  225.033 1.00 74.55  ? 195 THR B C   1 
ATOM   4194  O O   . THR B 1 195 ? -3.943  52.592  224.660 1.00 74.09  ? 195 THR B O   1 
ATOM   4195  C CB  . THR B 1 195 ? -1.007  52.886  226.185 1.00 74.18  ? 195 THR B CB  1 
ATOM   4196  O OG1 . THR B 1 195 ? -0.059  52.326  227.102 1.00 77.90  ? 195 THR B OG1 1 
ATOM   4197  C CG2 . THR B 1 195 ? -1.177  54.360  226.590 1.00 79.38  ? 195 THR B CG2 1 
ATOM   4198  N N   . ILE B 1 196 ? -2.700  50.755  224.403 1.00 76.56  ? 196 ILE B N   1 
ATOM   4199  C CA  . ILE B 1 196 ? -3.350  50.379  223.157 1.00 81.13  ? 196 ILE B CA  1 
ATOM   4200  C C   . ILE B 1 196 ? -4.646  49.615  223.419 1.00 80.89  ? 196 ILE B C   1 
ATOM   4201  O O   . ILE B 1 196 ? -5.695  49.935  222.865 1.00 78.38  ? 196 ILE B O   1 
ATOM   4202  C CB  . ILE B 1 196 ? -2.392  49.598  222.235 1.00 84.83  ? 196 ILE B CB  1 
ATOM   4203  C CG1 . ILE B 1 196 ? -3.125  48.491  221.467 1.00 87.26  ? 196 ILE B CG1 1 
ATOM   4204  C CG2 . ILE B 1 196 ? -1.206  49.083  223.031 1.00 84.98  ? 196 ILE B CG2 1 
ATOM   4205  C CD1 . ILE B 1 196 ? -4.126  48.971  220.410 1.00 89.81  ? 196 ILE B CD1 1 
ATOM   4206  N N   . THR B 1 197 ? -4.570  48.543  224.181 1.00 84.80  ? 197 THR B N   1 
ATOM   4207  C CA  . THR B 1 197 ? -5.799  47.857  224.473 1.00 92.34  ? 197 THR B CA  1 
ATOM   4208  C C   . THR B 1 197 ? -6.037  48.226  225.875 1.00 97.97  ? 197 THR B C   1 
ATOM   4209  O O   . THR B 1 197 ? -5.310  47.842  226.772 1.00 97.36  ? 197 THR B O   1 
ATOM   4210  C CB  . THR B 1 197 ? -5.801  46.367  224.295 1.00 93.80  ? 197 THR B CB  1 
ATOM   4211  O OG1 . THR B 1 197 ? -7.181  45.967  224.286 1.00 94.93  ? 197 THR B OG1 1 
ATOM   4212  C CG2 . THR B 1 197 ? -5.004  45.608  225.426 1.00 91.85  ? 197 THR B CG2 1 
ATOM   4213  N N   . LYS B 1 198 ? -6.889  49.209  225.986 1.00 106.77 ? 198 LYS B N   1 
ATOM   4214  C CA  . LYS B 1 198 ? -7.275  49.784  227.246 1.00 118.14 ? 198 LYS B CA  1 
ATOM   4215  C C   . LYS B 1 198 ? -6.931  48.915  228.462 1.00 120.08 ? 198 LYS B C   1 
ATOM   4216  O O   . LYS B 1 198 ? -6.116  49.296  229.315 1.00 125.27 ? 198 LYS B O   1 
ATOM   4217  C CB  . LYS B 1 198 ? -8.763  50.007  227.169 1.00 127.79 ? 198 LYS B CB  1 
ATOM   4218  C CG  . LYS B 1 198 ? -9.245  50.244  225.707 1.00 141.64 ? 198 LYS B CG  1 
ATOM   4219  C CD  . LYS B 1 198 ? -9.224  51.741  225.253 1.00 154.18 ? 198 LYS B CD  1 
ATOM   4220  C CE  . LYS B 1 198 ? -7.822  52.362  225.005 1.00 160.12 ? 198 LYS B CE  1 
ATOM   4221  N NZ  . LYS B 1 198 ? -7.896  53.849  224.687 1.00 165.01 ? 198 LYS B NZ  1 
ATOM   4222  N N   . LYS B 1 199 ? -7.543  47.741  228.522 1.00 120.16 ? 199 LYS B N   1 
ATOM   4223  C CA  . LYS B 1 199 ? -7.364  46.798  229.618 1.00 121.12 ? 199 LYS B CA  1 
ATOM   4224  C C   . LYS B 1 199 ? -5.924  46.407  229.898 1.00 116.25 ? 199 LYS B C   1 
ATOM   4225  O O   . LYS B 1 199 ? -5.054  46.535  229.043 1.00 116.17 ? 199 LYS B O   1 
ATOM   4226  C CB  . LYS B 1 199 ? -8.165  45.542  229.305 1.00 129.97 ? 199 LYS B CB  1 
ATOM   4227  C CG  . LYS B 1 199 ? -9.632  45.787  229.020 1.00 139.90 ? 199 LYS B CG  1 
ATOM   4228  C CD  . LYS B 1 199 ? -10.175 44.883  227.921 1.00 148.06 ? 199 LYS B CD  1 
ATOM   4229  C CE  . LYS B 1 199 ? -9.482  45.136  226.567 1.00 153.22 ? 199 LYS B CE  1 
ATOM   4230  N NZ  . LYS B 1 199 ? -9.896  44.157  225.520 1.00 156.35 ? 199 LYS B NZ  1 
ATOM   4231  N N   . ASP B 1 200 ? -5.715  45.805  231.059 1.00 112.03 ? 200 ASP B N   1 
ATOM   4232  C CA  . ASP B 1 200 ? -4.384  45.391  231.447 1.00 109.53 ? 200 ASP B CA  1 
ATOM   4233  C C   . ASP B 1 200 ? -3.795  44.182  230.743 1.00 106.33 ? 200 ASP B C   1 
ATOM   4234  O O   . ASP B 1 200 ? -4.446  43.549  229.907 1.00 107.88 ? 200 ASP B O   1 
ATOM   4235  C CB  . ASP B 1 200 ? -4.290  45.209  232.949 1.00 115.16 ? 200 ASP B CB  1 
ATOM   4236  C CG  . ASP B 1 200 ? -3.637  46.390  233.623 1.00 119.78 ? 200 ASP B CG  1 
ATOM   4237  O OD1 . ASP B 1 200 ? -4.129  47.533  233.427 1.00 121.01 ? 200 ASP B OD1 1 
ATOM   4238  O OD2 . ASP B 1 200 ? -2.620  46.173  234.328 1.00 122.04 ? 200 ASP B OD2 1 
ATOM   4239  N N   . MET B 1 201 ? -2.555  43.863  231.108 1.00 100.96 ? 201 MET B N   1 
ATOM   4240  C CA  . MET B 1 201 ? -1.827  42.755  230.510 1.00 97.21  ? 201 MET B CA  1 
ATOM   4241  C C   . MET B 1 201 ? -2.267  41.472  231.124 1.00 92.24  ? 201 MET B C   1 
ATOM   4242  O O   . MET B 1 201 ? -2.855  41.471  232.190 1.00 93.63  ? 201 MET B O   1 
ATOM   4243  C CB  . MET B 1 201 ? -0.330  42.909  230.743 1.00 102.23 ? 201 MET B CB  1 
ATOM   4244  C CG  . MET B 1 201 ? 0.259   44.135  230.099 1.00 108.28 ? 201 MET B CG  1 
ATOM   4245  S SD  . MET B 1 201 ? 1.903   44.565  230.687 1.00 108.01 ? 201 MET B SD  1 
ATOM   4246  C CE  . MET B 1 201 ? 2.803   43.889  229.408 1.00 103.21 ? 201 MET B CE  1 
ATOM   4247  N N   . VAL B 1 202 ? -1.963  40.379  230.443 1.00 85.85  ? 202 VAL B N   1 
ATOM   4248  C CA  . VAL B 1 202 ? -2.303  39.048  230.910 1.00 82.98  ? 202 VAL B CA  1 
ATOM   4249  C C   . VAL B 1 202 ? -1.096  38.202  230.609 1.00 81.54  ? 202 VAL B C   1 
ATOM   4250  O O   . VAL B 1 202 ? -0.188  38.655  229.917 1.00 85.58  ? 202 VAL B O   1 
ATOM   4251  C CB  . VAL B 1 202 ? -3.426  38.433  230.098 1.00 81.78  ? 202 VAL B CB  1 
ATOM   4252  C CG1 . VAL B 1 202 ? -4.312  37.604  231.008 1.00 84.41  ? 202 VAL B CG1 1 
ATOM   4253  C CG2 . VAL B 1 202 ? -4.187  39.495  229.327 1.00 82.82  ? 202 VAL B CG2 1 
ATOM   4254  N N   . ASN B 1 203 ? -1.080  36.968  231.095 1.00 76.86  ? 203 ASN B N   1 
ATOM   4255  C CA  . ASN B 1 203 ? 0.036   36.078  230.801 1.00 73.88  ? 203 ASN B CA  1 
ATOM   4256  C C   . ASN B 1 203 ? 0.213   35.968  229.267 1.00 74.04  ? 203 ASN B C   1 
ATOM   4257  O O   . ASN B 1 203 ? 1.334   35.957  228.751 1.00 73.36  ? 203 ASN B O   1 
ATOM   4258  C CB  . ASN B 1 203 ? -0.220  34.705  231.418 1.00 71.02  ? 203 ASN B CB  1 
ATOM   4259  C CG  . ASN B 1 203 ? -1.623  34.237  231.186 1.00 72.95  ? 203 ASN B CG  1 
ATOM   4260  O OD1 . ASN B 1 203 ? -2.402  34.946  230.564 1.00 73.43  ? 203 ASN B OD1 1 
ATOM   4261  N ND2 . ASN B 1 203 ? -1.963  33.049  231.668 1.00 73.26  ? 203 ASN B ND2 1 
ATOM   4262  N N   . LYS B 1 204 ? -0.893  35.998  228.535 1.00 73.61  ? 204 LYS B N   1 
ATOM   4263  C CA  . LYS B 1 204 ? -0.837  35.891  227.084 1.00 76.38  ? 204 LYS B CA  1 
ATOM   4264  C C   . LYS B 1 204 ? 0.065   36.914  226.427 1.00 73.09  ? 204 LYS B C   1 
ATOM   4265  O O   . LYS B 1 204 ? 0.896   36.554  225.600 1.00 72.70  ? 204 LYS B O   1 
ATOM   4266  C CB  . LYS B 1 204 ? -2.242  35.934  226.499 1.00 87.32  ? 204 LYS B CB  1 
ATOM   4267  C CG  . LYS B 1 204 ? -3.044  34.655  226.822 1.00 106.61 ? 204 LYS B CG  1 
ATOM   4268  C CD  . LYS B 1 204 ? -4.597  34.832  226.860 1.00 122.96 ? 204 LYS B CD  1 
ATOM   4269  C CE  . LYS B 1 204 ? -5.333  34.584  225.511 1.00 133.54 ? 204 LYS B CE  1 
ATOM   4270  N NZ  . LYS B 1 204 ? -5.042  35.611  224.436 1.00 143.04 ? 204 LYS B NZ  1 
ATOM   4271  N N   . ASP B 1 205 ? -0.084  38.180  226.808 1.00 72.09  ? 205 ASP B N   1 
ATOM   4272  C CA  . ASP B 1 205 ? 0.743   39.260  226.264 1.00 69.85  ? 205 ASP B CA  1 
ATOM   4273  C C   . ASP B 1 205 ? 2.168   38.784  226.404 1.00 64.79  ? 205 ASP B C   1 
ATOM   4274  O O   . ASP B 1 205 ? 2.900   38.637  225.435 1.00 67.31  ? 205 ASP B O   1 
ATOM   4275  C CB  . ASP B 1 205 ? 0.580   40.544  227.087 1.00 79.07  ? 205 ASP B CB  1 
ATOM   4276  C CG  . ASP B 1 205 ? -0.833  41.109  227.046 1.00 85.83  ? 205 ASP B CG  1 
ATOM   4277  O OD1 . ASP B 1 205 ? -1.800  40.336  227.223 1.00 90.86  ? 205 ASP B OD1 1 
ATOM   4278  O OD2 . ASP B 1 205 ? -0.979  42.341  226.877 1.00 89.50  ? 205 ASP B OD2 1 
ATOM   4279  N N   . GLN B 1 206 ? 2.487   38.413  227.626 1.00 57.29  ? 206 GLN B N   1 
ATOM   4280  C CA  . GLN B 1 206 ? 3.776   37.909  227.990 1.00 54.39  ? 206 GLN B CA  1 
ATOM   4281  C C   . GLN B 1 206 ? 4.335   36.828  227.057 1.00 50.13  ? 206 GLN B C   1 
ATOM   4282  O O   . GLN B 1 206 ? 5.507   36.447  227.160 1.00 49.31  ? 206 GLN B O   1 
ATOM   4283  C CB  . GLN B 1 206 ? 3.672   37.437  229.430 1.00 59.63  ? 206 GLN B CB  1 
ATOM   4284  C CG  . GLN B 1 206 ? 4.658   36.419  229.898 1.00 68.46  ? 206 GLN B CG  1 
ATOM   4285  C CD  . GLN B 1 206 ? 4.489   36.150  231.374 1.00 75.05  ? 206 GLN B CD  1 
ATOM   4286  O OE1 . GLN B 1 206 ? 4.291   35.002  231.787 1.00 81.44  ? 206 GLN B OE1 1 
ATOM   4287  N NE2 . GLN B 1 206 ? 4.540   37.215  232.186 1.00 73.97  ? 206 GLN B NE2 1 
ATOM   4288  N N   . VAL B 1 207 ? 3.520   36.288  226.163 1.00 44.90  ? 207 VAL B N   1 
ATOM   4289  C CA  . VAL B 1 207 ? 4.056   35.306  225.211 1.00 40.10  ? 207 VAL B CA  1 
ATOM   4290  C C   . VAL B 1 207 ? 3.668   35.585  223.767 1.00 42.04  ? 207 VAL B C   1 
ATOM   4291  O O   . VAL B 1 207 ? 4.519   35.804  222.928 1.00 49.71  ? 207 VAL B O   1 
ATOM   4292  C CB  . VAL B 1 207 ? 3.784   33.919  225.569 1.00 31.84  ? 207 VAL B CB  1 
ATOM   4293  C CG1 . VAL B 1 207 ? 4.588   33.584  226.818 1.00 28.36  ? 207 VAL B CG1 1 
ATOM   4294  C CG2 . VAL B 1 207 ? 2.345   33.724  225.718 1.00 26.91  ? 207 VAL B CG2 1 
ATOM   4295  N N   . LEU B 1 208 ? 2.416   35.533  223.409 1.00 38.84  ? 208 LEU B N   1 
ATOM   4296  C CA  . LEU B 1 208 ? 2.100   35.957  222.067 1.00 36.47  ? 208 LEU B CA  1 
ATOM   4297  C C   . LEU B 1 208 ? 0.680   36.424  222.126 1.00 43.37  ? 208 LEU B C   1 
ATOM   4298  O O   . LEU B 1 208 ? -0.263  35.640  221.868 1.00 41.68  ? 208 LEU B O   1 
ATOM   4299  C CB  . LEU B 1 208 ? 2.245   34.851  221.040 1.00 27.44  ? 208 LEU B CB  1 
ATOM   4300  C CG  . LEU B 1 208 ? 2.044   35.534  219.688 1.00 25.11  ? 208 LEU B CG  1 
ATOM   4301  C CD1 . LEU B 1 208 ? 2.943   34.922  218.697 1.00 26.82  ? 208 LEU B CD1 1 
ATOM   4302  C CD2 . LEU B 1 208 ? 0.605   35.503  219.162 1.00 20.76  ? 208 LEU B CD2 1 
ATOM   4303  N N   . ASN B 1 209 ? 0.485   37.675  222.517 1.00 46.97  ? 209 ASN B N   1 
ATOM   4304  C CA  . ASN B 1 209 ? -0.885  38.136  222.553 1.00 48.56  ? 209 ASN B CA  1 
ATOM   4305  C C   . ASN B 1 209 ? -1.345  38.642  221.186 1.00 45.54  ? 209 ASN B C   1 
ATOM   4306  O O   . ASN B 1 209 ? -1.132  39.793  220.812 1.00 45.42  ? 209 ASN B O   1 
ATOM   4307  C CB  . ASN B 1 209 ? -1.115  39.181  223.627 1.00 57.24  ? 209 ASN B CB  1 
ATOM   4308  C CG  . ASN B 1 209 ? -2.566  39.284  223.983 1.00 66.08  ? 209 ASN B CG  1 
ATOM   4309  O OD1 . ASN B 1 209 ? -3.331  38.379  223.636 1.00 68.59  ? 209 ASN B OD1 1 
ATOM   4310  N ND2 . ASN B 1 209 ? -2.977  40.374  224.635 1.00 69.96  ? 209 ASN B ND2 1 
ATOM   4311  N N   . PRO B 1 210 ? -2.092  37.818  220.467 1.00 43.14  ? 210 PRO B N   1 
ATOM   4312  C CA  . PRO B 1 210 ? -2.599  38.154  219.136 1.00 44.83  ? 210 PRO B CA  1 
ATOM   4313  C C   . PRO B 1 210 ? -3.470  39.380  219.182 1.00 47.38  ? 210 PRO B C   1 
ATOM   4314  O O   . PRO B 1 210 ? -4.030  39.805  218.180 1.00 50.86  ? 210 PRO B O   1 
ATOM   4315  C CB  . PRO B 1 210 ? -3.427  36.935  218.761 1.00 43.77  ? 210 PRO B CB  1 
ATOM   4316  C CG  . PRO B 1 210 ? -2.917  35.872  219.692 1.00 48.52  ? 210 PRO B CG  1 
ATOM   4317  C CD  . PRO B 1 210 ? -2.720  36.601  220.964 1.00 43.12  ? 210 PRO B CD  1 
ATOM   4318  N N   . ILE B 1 211 ? -3.676  39.891  220.378 1.00 48.01  ? 211 ILE B N   1 
ATOM   4319  C CA  . ILE B 1 211 ? -4.473  41.071  220.521 1.00 49.59  ? 211 ILE B CA  1 
ATOM   4320  C C   . ILE B 1 211 ? -3.502  42.185  220.609 1.00 44.13  ? 211 ILE B C   1 
ATOM   4321  O O   . ILE B 1 211 ? -3.691  43.214  220.001 1.00 45.62  ? 211 ILE B O   1 
ATOM   4322  C CB  . ILE B 1 211 ? -5.240  41.075  221.812 1.00 55.82  ? 211 ILE B CB  1 
ATOM   4323  C CG1 . ILE B 1 211 ? -6.266  39.945  221.821 1.00 63.73  ? 211 ILE B CG1 1 
ATOM   4324  C CG2 . ILE B 1 211 ? -5.903  42.416  221.990 1.00 60.23  ? 211 ILE B CG2 1 
ATOM   4325  C CD1 . ILE B 1 211 ? -5.677  38.543  221.998 1.00 66.63  ? 211 ILE B CD1 1 
ATOM   4326  N N   . SER B 1 212 ? -2.485  41.981  221.422 1.00 41.58  ? 212 SER B N   1 
ATOM   4327  C CA  . SER B 1 212 ? -1.464  42.978  221.618 1.00 45.87  ? 212 SER B CA  1 
ATOM   4328  C C   . SER B 1 212 ? -0.686  43.221  220.326 1.00 47.88  ? 212 SER B C   1 
ATOM   4329  O O   . SER B 1 212 ? 0.464   42.806  220.168 1.00 47.29  ? 212 SER B O   1 
ATOM   4330  C CB  . SER B 1 212 ? -0.557  42.550  222.766 1.00 47.25  ? 212 SER B CB  1 
ATOM   4331  O OG  . SER B 1 212 ? -1.333  42.283  223.924 1.00 45.66  ? 212 SER B OG  1 
ATOM   4332  N N   . LYS B 1 213 ? -1.341  43.941  219.424 1.00 51.95  ? 213 LYS B N   1 
ATOM   4333  C CA  . LYS B 1 213 ? -0.835  44.303  218.105 1.00 58.00  ? 213 LYS B CA  1 
ATOM   4334  C C   . LYS B 1 213 ? -1.064  45.802  217.940 1.00 58.32  ? 213 LYS B C   1 
ATOM   4335  O O   . LYS B 1 213 ? -2.177  46.285  218.143 1.00 61.91  ? 213 LYS B O   1 
ATOM   4336  C CB  . LYS B 1 213 ? -1.670  43.605  217.010 1.00 59.68  ? 213 LYS B CB  1 
ATOM   4337  C CG  . LYS B 1 213 ? -1.800  42.094  217.091 1.00 61.21  ? 213 LYS B CG  1 
ATOM   4338  C CD  . LYS B 1 213 ? -0.966  41.460  216.003 1.00 62.61  ? 213 LYS B CD  1 
ATOM   4339  C CE  . LYS B 1 213 ? -0.880  39.960  216.166 1.00 63.26  ? 213 LYS B CE  1 
ATOM   4340  N NZ  . LYS B 1 213 ? 0.247   39.368  215.365 1.00 68.48  ? 213 LYS B NZ  1 
ATOM   4341  N N   . ALA B 1 214 ? -0.053  46.547  217.541 1.00 58.32  ? 214 ALA B N   1 
ATOM   4342  C CA  . ALA B 1 214 ? -0.284  47.965  217.342 1.00 59.28  ? 214 ALA B CA  1 
ATOM   4343  C C   . ALA B 1 214 ? 0.292   48.386  216.001 1.00 60.18  ? 214 ALA B C   1 
ATOM   4344  O O   . ALA B 1 214 ? 0.568   47.543  215.132 1.00 62.64  ? 214 ALA B O   1 
ATOM   4345  C CB  . ALA B 1 214 ? 0.347   48.750  218.463 1.00 60.96  ? 214 ALA B CB  1 
ATOM   4346  N N   . LYS B 1 215 ? 0.444   49.687  215.820 1.00 57.04  ? 215 LYS B N   1 
ATOM   4347  C CA  . LYS B 1 215 ? 1.052   50.199  214.616 1.00 56.20  ? 215 LYS B CA  1 
ATOM   4348  C C   . LYS B 1 215 ? 2.104   51.150  215.119 1.00 54.53  ? 215 LYS B C   1 
ATOM   4349  O O   . LYS B 1 215 ? 2.051   51.566  216.269 1.00 55.29  ? 215 LYS B O   1 
ATOM   4350  C CB  . LYS B 1 215 ? 0.025   50.902  213.746 1.00 61.35  ? 215 LYS B CB  1 
ATOM   4351  C CG  . LYS B 1 215 ? -0.746  49.933  212.853 1.00 77.04  ? 215 LYS B CG  1 
ATOM   4352  C CD  . LYS B 1 215 ? -1.582  50.661  211.775 1.00 92.02  ? 215 LYS B CD  1 
ATOM   4353  C CE  . LYS B 1 215 ? -2.143  49.727  210.628 1.00 102.81 ? 215 LYS B CE  1 
ATOM   4354  N NZ  . LYS B 1 215 ? -1.216  49.277  209.489 1.00 108.24 ? 215 LYS B NZ  1 
ATOM   4355  N N   . LEU B 1 216 ? 3.106   51.439  214.309 1.00 53.05  ? 216 LEU B N   1 
ATOM   4356  C CA  . LEU B 1 216 ? 4.138   52.357  214.742 1.00 54.09  ? 216 LEU B CA  1 
ATOM   4357  C C   . LEU B 1 216 ? 3.678   53.800  214.551 1.00 58.25  ? 216 LEU B C   1 
ATOM   4358  O O   . LEU B 1 216 ? 4.426   54.632  214.048 1.00 57.58  ? 216 LEU B O   1 
ATOM   4359  C CB  . LEU B 1 216 ? 5.379   52.137  213.909 1.00 53.16  ? 216 LEU B CB  1 
ATOM   4360  C CG  . LEU B 1 216 ? 6.585   51.935  214.813 1.00 54.25  ? 216 LEU B CG  1 
ATOM   4361  C CD1 . LEU B 1 216 ? 7.839   52.332  214.043 1.00 58.61  ? 216 LEU B CD1 1 
ATOM   4362  C CD2 . LEU B 1 216 ? 6.458   52.746  216.100 1.00 50.90  ? 216 LEU B CD2 1 
ATOM   4363  N N   . ASP B 1 217 ? 2.473   54.126  214.993 1.00 64.65  ? 217 ASP B N   1 
ATOM   4364  C CA  . ASP B 1 217 ? 1.966   55.465  214.756 1.00 67.49  ? 217 ASP B CA  1 
ATOM   4365  C C   . ASP B 1 217 ? 2.685   56.555  215.474 1.00 63.00  ? 217 ASP B C   1 
ATOM   4366  O O   . ASP B 1 217 ? 2.541   57.700  215.128 1.00 68.13  ? 217 ASP B O   1 
ATOM   4367  C CB  . ASP B 1 217 ? 0.424   55.567  214.896 1.00 80.00  ? 217 ASP B CB  1 
ATOM   4368  C CG  . ASP B 1 217 ? -0.130  54.858  216.143 1.00 92.68  ? 217 ASP B CG  1 
ATOM   4369  O OD1 . ASP B 1 217 ? -0.093  55.466  217.235 1.00 99.96  ? 217 ASP B OD1 1 
ATOM   4370  O OD2 . ASP B 1 217 ? -0.641  53.709  216.040 1.00 100.48 ? 217 ASP B OD2 1 
ATOM   4371  N N   . LYS B 1 218 ? 3.490   56.233  216.457 1.00 58.99  ? 218 LYS B N   1 
ATOM   4372  C CA  . LYS B 1 218 ? 4.179   57.313  217.119 1.00 63.81  ? 218 LYS B CA  1 
ATOM   4373  C C   . LYS B 1 218 ? 5.624   57.156  216.966 1.00 60.91  ? 218 LYS B C   1 
ATOM   4374  O O   . LYS B 1 218 ? 6.073   56.384  216.169 1.00 62.45  ? 218 LYS B O   1 
ATOM   4375  C CB  . LYS B 1 218 ? 3.866   57.374  218.600 1.00 74.91  ? 218 LYS B CB  1 
ATOM   4376  C CG  . LYS B 1 218 ? 2.786   58.373  218.980 1.00 88.19  ? 218 LYS B CG  1 
ATOM   4377  C CD  . LYS B 1 218 ? 1.466   57.946  218.379 1.00 100.45 ? 218 LYS B CD  1 
ATOM   4378  C CE  . LYS B 1 218 ? 0.297   58.773  218.864 1.00 108.80 ? 218 LYS B CE  1 
ATOM   4379  N NZ  . LYS B 1 218 ? -0.915  58.251  218.178 1.00 120.81 ? 218 LYS B NZ  1 
ATOM   4380  N N   . ASP B 1 219 ? 6.355   57.795  217.843 1.00 61.56  ? 219 ASP B N   1 
ATOM   4381  C CA  . ASP B 1 219 ? 7.768   57.720  217.760 1.00 67.14  ? 219 ASP B CA  1 
ATOM   4382  C C   . ASP B 1 219 ? 8.403   57.814  219.125 1.00 70.04  ? 219 ASP B C   1 
ATOM   4383  O O   . ASP B 1 219 ? 7.871   58.494  219.987 1.00 75.71  ? 219 ASP B O   1 
ATOM   4384  C CB  . ASP B 1 219 ? 8.242   58.886  216.946 1.00 69.65  ? 219 ASP B CB  1 
ATOM   4385  C CG  . ASP B 1 219 ? 9.681   59.172  217.185 1.00 72.79  ? 219 ASP B CG  1 
ATOM   4386  O OD1 . ASP B 1 219 ? 10.512  58.382  216.688 1.00 72.64  ? 219 ASP B OD1 1 
ATOM   4387  O OD2 . ASP B 1 219 ? 9.981   60.120  217.945 1.00 78.10  ? 219 ASP B OD2 1 
ATOM   4388  N N   . GLY B 1 220 ? 9.584   57.209  219.288 1.00 71.15  ? 220 GLY B N   1 
ATOM   4389  C CA  . GLY B 1 220 ? 10.299  57.227  220.559 1.00 68.40  ? 220 GLY B CA  1 
ATOM   4390  C C   . GLY B 1 220 ? 9.275   56.925  221.620 1.00 68.62  ? 220 GLY B C   1 
ATOM   4391  O O   . GLY B 1 220 ? 9.403   57.328  222.787 1.00 64.89  ? 220 GLY B O   1 
ATOM   4392  N N   . MET B 1 221 ? 8.279   56.139  221.214 1.00 70.98  ? 221 MET B N   1 
ATOM   4393  C CA  . MET B 1 221 ? 7.189   55.858  222.104 1.00 74.91  ? 221 MET B CA  1 
ATOM   4394  C C   . MET B 1 221 ? 6.959   54.447  222.481 1.00 72.45  ? 221 MET B C   1 
ATOM   4395  O O   . MET B 1 221 ? 6.817   54.136  223.664 1.00 75.07  ? 221 MET B O   1 
ATOM   4396  C CB  . MET B 1 221 ? 5.903   56.424  221.553 1.00 82.70  ? 221 MET B CB  1 
ATOM   4397  C CG  . MET B 1 221 ? 5.085   57.048  222.654 1.00 89.92  ? 221 MET B CG  1 
ATOM   4398  S SD  . MET B 1 221 ? 6.048   58.323  223.481 1.00 97.77  ? 221 MET B SD  1 
ATOM   4399  C CE  . MET B 1 221 ? 5.523   59.735  222.456 1.00 95.00  ? 221 MET B CE  1 
ATOM   4400  N N   . TYR B 1 222 ? 6.794   53.588  221.501 1.00 66.50  ? 222 TYR B N   1 
ATOM   4401  C CA  . TYR B 1 222 ? 6.596   52.223  221.908 1.00 62.64  ? 222 TYR B CA  1 
ATOM   4402  C C   . TYR B 1 222 ? 8.024   51.831  222.176 1.00 62.30  ? 222 TYR B C   1 
ATOM   4403  O O   . TYR B 1 222 ? 8.919   52.232  221.431 1.00 62.34  ? 222 TYR B O   1 
ATOM   4404  C CB  . TYR B 1 222 ? 5.981   51.397  220.807 1.00 61.08  ? 222 TYR B CB  1 
ATOM   4405  C CG  . TYR B 1 222 ? 4.859   52.088  220.088 1.00 59.31  ? 222 TYR B CG  1 
ATOM   4406  C CD1 . TYR B 1 222 ? 5.081   53.293  219.404 1.00 61.19  ? 222 TYR B CD1 1 
ATOM   4407  C CD2 . TYR B 1 222 ? 3.589   51.516  220.026 1.00 55.27  ? 222 TYR B CD2 1 
ATOM   4408  C CE1 . TYR B 1 222 ? 4.065   53.899  218.668 1.00 60.21  ? 222 TYR B CE1 1 
ATOM   4409  C CE2 . TYR B 1 222 ? 2.557   52.125  219.292 1.00 53.40  ? 222 TYR B CE2 1 
ATOM   4410  C CZ  . TYR B 1 222 ? 2.806   53.310  218.619 1.00 54.33  ? 222 TYR B CZ  1 
ATOM   4411  O OH  . TYR B 1 222 ? 1.821   53.927  217.906 1.00 46.96  ? 222 TYR B OH  1 
ATOM   4412  N N   . PRO B 1 223 ? 8.282   51.252  223.354 1.00 62.28  ? 223 PRO B N   1 
ATOM   4413  C CA  . PRO B 1 223 ? 9.626   50.827  223.733 1.00 64.08  ? 223 PRO B CA  1 
ATOM   4414  C C   . PRO B 1 223 ? 9.885   49.520  223.038 1.00 66.92  ? 223 PRO B C   1 
ATOM   4415  O O   . PRO B 1 223 ? 8.948   48.769  222.700 1.00 64.34  ? 223 PRO B O   1 
ATOM   4416  C CB  . PRO B 1 223 ? 9.503   50.623  225.227 1.00 63.02  ? 223 PRO B CB  1 
ATOM   4417  C CG  . PRO B 1 223 ? 8.149   50.014  225.315 1.00 63.25  ? 223 PRO B CG  1 
ATOM   4418  C CD  . PRO B 1 223 ? 7.315   50.896  224.401 1.00 62.14  ? 223 PRO B CD  1 
ATOM   4419  N N   . VAL B 1 224 ? 11.154  49.200  222.895 1.00 68.70  ? 224 VAL B N   1 
ATOM   4420  C CA  . VAL B 1 224 ? 11.466  47.981  222.199 1.00 72.07  ? 224 VAL B CA  1 
ATOM   4421  C C   . VAL B 1 224 ? 11.346  46.837  223.122 1.00 70.38  ? 224 VAL B C   1 
ATOM   4422  O O   . VAL B 1 224 ? 11.300  45.684  222.702 1.00 70.25  ? 224 VAL B O   1 
ATOM   4423  C CB  . VAL B 1 224 ? 12.846  47.972  221.691 1.00 76.26  ? 224 VAL B CB  1 
ATOM   4424  C CG1 . VAL B 1 224 ? 12.906  47.024  220.510 1.00 79.39  ? 224 VAL B CG1 1 
ATOM   4425  C CG2 . VAL B 1 224 ? 13.266  49.382  221.345 1.00 79.45  ? 224 VAL B CG2 1 
ATOM   4426  N N   . GLU B 1 225 ? 11.366  47.166  224.398 1.00 69.27  ? 225 GLU B N   1 
ATOM   4427  C CA  . GLU B 1 225 ? 11.243  46.163  225.420 1.00 70.96  ? 225 GLU B CA  1 
ATOM   4428  C C   . GLU B 1 225 ? 9.903   45.386  225.273 1.00 68.46  ? 225 GLU B C   1 
ATOM   4429  O O   . GLU B 1 225 ? 9.795   44.223  225.716 1.00 63.37  ? 225 GLU B O   1 
ATOM   4430  C CB  . GLU B 1 225 ? 11.345  46.874  226.763 1.00 75.54  ? 225 GLU B CB  1 
ATOM   4431  C CG  . GLU B 1 225 ? 11.864  46.031  227.895 1.00 78.75  ? 225 GLU B CG  1 
ATOM   4432  C CD  . GLU B 1 225 ? 12.133  46.864  229.124 1.00 82.82  ? 225 GLU B CD  1 
ATOM   4433  O OE1 . GLU B 1 225 ? 13.268  47.411  229.236 1.00 84.17  ? 225 GLU B OE1 1 
ATOM   4434  O OE2 . GLU B 1 225 ? 11.194  46.990  229.957 1.00 80.94  ? 225 GLU B OE2 1 
ATOM   4435  N N   . ILE B 1 226 ? 8.947   45.987  224.546 1.00 66.93  ? 226 ILE B N   1 
ATOM   4436  C CA  . ILE B 1 226 ? 7.599   45.422  224.332 1.00 67.75  ? 226 ILE B CA  1 
ATOM   4437  C C   . ILE B 1 226 ? 7.191   45.055  222.910 1.00 67.88  ? 226 ILE B C   1 
ATOM   4438  O O   . ILE B 1 226 ? 6.717   43.945  222.596 1.00 66.82  ? 226 ILE B O   1 
ATOM   4439  C CB  . ILE B 1 226 ? 6.542   46.442  224.722 1.00 69.00  ? 226 ILE B CB  1 
ATOM   4440  C CG1 . ILE B 1 226 ? 6.739   46.849  226.172 1.00 73.42  ? 226 ILE B CG1 1 
ATOM   4441  C CG2 . ILE B 1 226 ? 5.133   45.896  224.416 1.00 69.06  ? 226 ILE B CG2 1 
ATOM   4442  C CD1 . ILE B 1 226 ? 5.718   47.806  226.665 1.00 78.51  ? 226 ILE B CD1 1 
ATOM   4443  N N   . TRP B 1 227 ? 7.210   46.095  222.104 1.00 67.88  ? 227 TRP B N   1 
ATOM   4444  C CA  . TRP B 1 227 ? 6.802   46.011  220.736 1.00 65.73  ? 227 TRP B CA  1 
ATOM   4445  C C   . TRP B 1 227 ? 7.816   45.431  219.803 1.00 64.11  ? 227 TRP B C   1 
ATOM   4446  O O   . TRP B 1 227 ? 9.008   45.781  219.830 1.00 63.42  ? 227 TRP B O   1 
ATOM   4447  C CB  . TRP B 1 227 ? 6.380   47.389  220.328 1.00 70.01  ? 227 TRP B CB  1 
ATOM   4448  C CG  . TRP B 1 227 ? 5.284   47.823  221.208 1.00 67.50  ? 227 TRP B CG  1 
ATOM   4449  C CD1 . TRP B 1 227 ? 5.341   48.717  222.236 1.00 63.18  ? 227 TRP B CD1 1 
ATOM   4450  C CD2 . TRP B 1 227 ? 3.937   47.370  221.129 1.00 68.88  ? 227 TRP B CD2 1 
ATOM   4451  N NE1 . TRP B 1 227 ? 4.101   48.858  222.793 1.00 62.83  ? 227 TRP B NE1 1 
ATOM   4452  C CE2 . TRP B 1 227 ? 3.220   48.041  222.133 1.00 67.00  ? 227 TRP B CE2 1 
ATOM   4453  C CE3 . TRP B 1 227 ? 3.264   46.459  220.291 1.00 69.21  ? 227 TRP B CE3 1 
ATOM   4454  C CZ2 . TRP B 1 227 ? 1.851   47.834  222.324 1.00 68.80  ? 227 TRP B CZ2 1 
ATOM   4455  C CZ3 . TRP B 1 227 ? 1.903   46.252  220.477 1.00 64.59  ? 227 TRP B CZ3 1 
ATOM   4456  C CH2 . TRP B 1 227 ? 1.212   46.936  221.485 1.00 66.13  ? 227 TRP B CH2 1 
ATOM   4457  N N   . HIS B 1 228 ? 7.334   44.508  218.988 1.00 60.79  ? 228 HIS B N   1 
ATOM   4458  C CA  . HIS B 1 228 ? 8.198   43.847  218.050 1.00 60.87  ? 228 HIS B CA  1 
ATOM   4459  C C   . HIS B 1 228 ? 7.632   43.833  216.711 1.00 56.45  ? 228 HIS B C   1 
ATOM   4460  O O   . HIS B 1 228 ? 6.443   43.972  216.533 1.00 57.22  ? 228 HIS B O   1 
ATOM   4461  C CB  . HIS B 1 228 ? 8.423   42.413  218.444 1.00 64.08  ? 228 HIS B CB  1 
ATOM   4462  C CG  . HIS B 1 228 ? 8.996   42.286  219.801 1.00 73.39  ? 228 HIS B CG  1 
ATOM   4463  N ND1 . HIS B 1 228 ? 10.352  42.361  220.041 1.00 76.19  ? 228 HIS B ND1 1 
ATOM   4464  C CD2 . HIS B 1 228 ? 8.393   42.188  221.009 1.00 74.01  ? 228 HIS B CD2 1 
ATOM   4465  C CE1 . HIS B 1 228 ? 10.558  42.316  221.345 1.00 79.37  ? 228 HIS B CE1 1 
ATOM   4466  N NE2 . HIS B 1 228 ? 9.389   42.210  221.953 1.00 80.33  ? 228 HIS B NE2 1 
ATOM   4467  N N   . PRO B 1 229 ? 8.507   43.773  215.728 1.00 53.76  ? 229 PRO B N   1 
ATOM   4468  C CA  . PRO B 1 229 ? 8.085   43.731  214.339 1.00 51.83  ? 229 PRO B CA  1 
ATOM   4469  C C   . PRO B 1 229 ? 7.275   42.471  214.353 1.00 46.85  ? 229 PRO B C   1 
ATOM   4470  O O   . PRO B 1 229 ? 7.757   41.430  214.821 1.00 45.52  ? 229 PRO B O   1 
ATOM   4471  C CB  . PRO B 1 229 ? 9.402   43.531  213.595 1.00 57.36  ? 229 PRO B CB  1 
ATOM   4472  C CG  . PRO B 1 229 ? 10.349  42.954  214.667 1.00 59.34  ? 229 PRO B CG  1 
ATOM   4473  C CD  . PRO B 1 229 ? 9.970   43.762  215.850 1.00 53.47  ? 229 PRO B CD  1 
ATOM   4474  N N   . ASP B 1 230 ? 6.004   42.615  214.037 1.00 40.99  ? 230 ASP B N   1 
ATOM   4475  C CA  . ASP B 1 230 ? 5.134   41.473  214.057 1.00 38.50  ? 230 ASP B CA  1 
ATOM   4476  C C   . ASP B 1 230 ? 5.096   40.942  212.691 1.00 35.56  ? 230 ASP B C   1 
ATOM   4477  O O   . ASP B 1 230 ? 4.955   41.726  211.770 1.00 36.81  ? 230 ASP B O   1 
ATOM   4478  C CB  . ASP B 1 230 ? 3.724   41.883  214.461 1.00 41.73  ? 230 ASP B CB  1 
ATOM   4479  C CG  . ASP B 1 230 ? 2.634   41.016  213.826 1.00 49.13  ? 230 ASP B CG  1 
ATOM   4480  O OD1 . ASP B 1 230 ? 2.779   39.771  213.693 1.00 48.93  ? 230 ASP B OD1 1 
ATOM   4481  O OD2 . ASP B 1 230 ? 1.581   41.599  213.489 1.00 55.85  ? 230 ASP B OD2 1 
ATOM   4482  N N   . PRO B 1 231 ? 5.364   39.632  212.522 1.00 33.83  ? 231 PRO B N   1 
ATOM   4483  C CA  . PRO B 1 231 ? 5.312   39.055  211.183 1.00 34.41  ? 231 PRO B CA  1 
ATOM   4484  C C   . PRO B 1 231 ? 3.848   38.865  210.889 1.00 35.91  ? 231 PRO B C   1 
ATOM   4485  O O   . PRO B 1 231 ? 3.329   37.762  210.942 1.00 28.25  ? 231 PRO B O   1 
ATOM   4486  C CB  . PRO B 1 231 ? 6.034   37.727  211.340 1.00 30.77  ? 231 PRO B CB  1 
ATOM   4487  C CG  . PRO B 1 231 ? 5.829   37.401  212.786 1.00 26.24  ? 231 PRO B CG  1 
ATOM   4488  C CD  . PRO B 1 231 ? 6.060   38.718  213.436 1.00 27.79  ? 231 PRO B CD  1 
ATOM   4489  N N   . ALA B 1 232 ? 3.146   39.980  210.717 1.00 43.26  ? 232 ALA B N   1 
ATOM   4490  C CA  . ALA B 1 232 ? 1.749   39.900  210.371 1.00 48.29  ? 232 ALA B CA  1 
ATOM   4491  C C   . ALA B 1 232 ? 1.849   39.066  209.095 1.00 52.79  ? 232 ALA B C   1 
ATOM   4492  O O   . ALA B 1 232 ? 2.888   39.008  208.398 1.00 56.89  ? 232 ALA B O   1 
ATOM   4493  C CB  . ALA B 1 232 ? 1.132   41.328  210.055 1.00 39.93  ? 232 ALA B CB  1 
ATOM   4494  N N   . LYS B 1 233 ? 0.804   38.302  208.892 1.00 53.30  ? 233 LYS B N   1 
ATOM   4495  C CA  . LYS B 1 233 ? 0.625   37.481  207.734 1.00 52.35  ? 233 LYS B CA  1 
ATOM   4496  C C   . LYS B 1 233 ? 0.720   38.365  206.515 1.00 53.83  ? 233 LYS B C   1 
ATOM   4497  O O   . LYS B 1 233 ? 0.583   37.878  205.404 1.00 45.80  ? 233 LYS B O   1 
ATOM   4498  C CB  . LYS B 1 233 ? -0.798  37.082  207.765 1.00 64.52  ? 233 LYS B CB  1 
ATOM   4499  C CG  . LYS B 1 233 ? -1.693  38.308  207.541 1.00 78.80  ? 233 LYS B CG  1 
ATOM   4500  C CD  . LYS B 1 233 ? -2.343  38.882  208.767 1.00 96.12  ? 233 LYS B CD  1 
ATOM   4501  C CE  . LYS B 1 233 ? -3.459  39.850  208.369 1.00 106.91 ? 233 LYS B CE  1 
ATOM   4502  N NZ  . LYS B 1 233 ? -4.504  39.209  207.504 1.00 112.43 ? 233 LYS B NZ  1 
ATOM   4503  N N   . ASN B 1 234 ? 0.632   39.680  206.767 1.00 64.33  ? 234 ASN B N   1 
ATOM   4504  C CA  . ASN B 1 234 ? 0.675   40.768  205.759 1.00 73.84  ? 234 ASN B CA  1 
ATOM   4505  C C   . ASN B 1 234 ? 1.683   41.885  206.127 1.00 71.68  ? 234 ASN B C   1 
ATOM   4506  O O   . ASN B 1 234 ? 1.730   42.306  207.296 1.00 69.71  ? 234 ASN B O   1 
ATOM   4507  C CB  . ASN B 1 234 ? -0.718  41.435  205.615 1.00 82.12  ? 234 ASN B CB  1 
ATOM   4508  C CG  . ASN B 1 234 ? -1.703  40.631  204.735 1.00 86.94  ? 234 ASN B CG  1 
ATOM   4509  O OD1 . ASN B 1 234 ? -2.556  41.205  204.033 1.00 89.09  ? 234 ASN B OD1 1 
ATOM   4510  N ND2 . ASN B 1 234 ? -1.602  39.319  204.782 1.00 83.43  ? 234 ASN B ND2 1 
ATOM   4511  N N   . GLU B 1 235 ? 2.366   42.426  205.101 1.00 69.08  ? 235 GLU B N   1 
ATOM   4512  C CA  . GLU B 1 235 ? 3.374   43.485  205.281 1.00 64.15  ? 235 GLU B CA  1 
ATOM   4513  C C   . GLU B 1 235 ? 3.900   44.156  203.971 1.00 60.42  ? 235 GLU B C   1 
ATOM   4514  O O   . GLU B 1 235 ? 4.080   43.486  202.944 1.00 56.91  ? 235 GLU B O   1 
ATOM   4515  C CB  . GLU B 1 235 ? 4.564   42.913  206.071 1.00 60.61  ? 235 GLU B CB  1 
ATOM   4516  C CG  . GLU B 1 235 ? 5.144   43.867  207.103 1.00 53.24  ? 235 GLU B CG  1 
ATOM   4517  C CD  . GLU B 1 235 ? 4.513   43.744  208.496 1.00 50.44  ? 235 GLU B CD  1 
ATOM   4518  O OE1 . GLU B 1 235 ? 3.646   42.845  208.708 1.00 42.10  ? 235 GLU B OE1 1 
ATOM   4519  O OE2 . GLU B 1 235 ? 4.939   44.548  209.379 1.00 45.80  ? 235 GLU B OE2 1 
ATOM   4520  N N   . ASN B 1 236 ? 4.114   45.481  204.029 1.00 56.89  ? 236 ASN B N   1 
ATOM   4521  C CA  . ASN B 1 236 ? 4.645   46.320  202.918 1.00 55.12  ? 236 ASN B CA  1 
ATOM   4522  C C   . ASN B 1 236 ? 5.899   47.041  203.483 1.00 52.37  ? 236 ASN B C   1 
ATOM   4523  O O   . ASN B 1 236 ? 6.324   48.109  203.009 1.00 50.51  ? 236 ASN B O   1 
ATOM   4524  C CB  . ASN B 1 236 ? 3.581   47.346  202.406 1.00 57.54  ? 236 ASN B CB  1 
ATOM   4525  C CG  . ASN B 1 236 ? 4.005   48.124  201.097 1.00 58.47  ? 236 ASN B CG  1 
ATOM   4526  O OD1 . ASN B 1 236 ? 4.581   47.570  200.144 1.00 55.45  ? 236 ASN B OD1 1 
ATOM   4527  N ND2 . ASN B 1 236 ? 3.646   49.400  201.050 1.00 58.00  ? 236 ASN B ND2 1 
ATOM   4528  N N   . THR B 1 237 ? 6.458   46.452  204.538 1.00 50.40  ? 237 THR B N   1 
ATOM   4529  C CA  . THR B 1 237 ? 7.666   46.961  205.180 1.00 47.69  ? 237 THR B CA  1 
ATOM   4530  C C   . THR B 1 237 ? 8.647   45.797  205.098 1.00 41.52  ? 237 THR B C   1 
ATOM   4531  O O   . THR B 1 237 ? 8.259   44.644  204.875 1.00 41.82  ? 237 THR B O   1 
ATOM   4532  C CB  . THR B 1 237 ? 7.434   47.328  206.687 1.00 51.68  ? 237 THR B CB  1 
ATOM   4533  O OG1 . THR B 1 237 ? 6.022   47.363  206.977 1.00 55.58  ? 237 THR B OG1 1 
ATOM   4534  C CG2 . THR B 1 237 ? 8.076   48.709  207.033 1.00 49.79  ? 237 THR B CG2 1 
ATOM   4535  N N   . ARG B 1 238 ? 9.922   46.103  205.153 1.00 35.69  ? 238 ARG B N   1 
ATOM   4536  C CA  . ARG B 1 238 ? 10.903  45.061  205.108 1.00 30.43  ? 238 ARG B CA  1 
ATOM   4537  C C   . ARG B 1 238 ? 11.628  45.426  206.340 1.00 26.11  ? 238 ARG B C   1 
ATOM   4538  O O   . ARG B 1 238 ? 11.837  46.604  206.639 1.00 20.95  ? 238 ARG B O   1 
ATOM   4539  C CB  . ARG B 1 238 ? 11.793  45.185  203.882 1.00 39.45  ? 238 ARG B CB  1 
ATOM   4540  C CG  . ARG B 1 238 ? 11.035  45.222  202.555 1.00 47.30  ? 238 ARG B CG  1 
ATOM   4541  C CD  . ARG B 1 238 ? 10.816  43.842  201.956 1.00 52.07  ? 238 ARG B CD  1 
ATOM   4542  N NE  . ARG B 1 238 ? 10.011  43.899  200.737 1.00 59.93  ? 238 ARG B NE  1 
ATOM   4543  C CZ  . ARG B 1 238 ? 8.681   43.984  200.720 1.00 69.44  ? 238 ARG B CZ  1 
ATOM   4544  N NH1 . ARG B 1 238 ? 8.011   44.008  201.870 1.00 75.40  ? 238 ARG B NH1 1 
ATOM   4545  N NH2 . ARG B 1 238 ? 8.016   44.078  199.561 1.00 71.89  ? 238 ARG B NH2 1 
ATOM   4546  N N   . TYR B 1 239 ? 11.942  44.433  207.121 1.00 23.67  ? 239 TYR B N   1 
ATOM   4547  C CA  . TYR B 1 239 ? 12.610  44.765  208.327 1.00 28.75  ? 239 TYR B CA  1 
ATOM   4548  C C   . TYR B 1 239 ? 13.413  43.621  208.682 1.00 28.18  ? 239 TYR B C   1 
ATOM   4549  O O   . TYR B 1 239 ? 13.113  42.475  208.298 1.00 26.25  ? 239 TYR B O   1 
ATOM   4550  C CB  . TYR B 1 239 ? 11.636  44.937  209.468 1.00 33.89  ? 239 TYR B CB  1 
ATOM   4551  C CG  . TYR B 1 239 ? 10.960  43.643  209.875 1.00 37.01  ? 239 TYR B CG  1 
ATOM   4552  C CD1 . TYR B 1 239 ? 11.580  42.722  210.702 1.00 39.04  ? 239 TYR B CD1 1 
ATOM   4553  C CD2 . TYR B 1 239 ? 9.692   43.351  209.429 1.00 41.86  ? 239 TYR B CD2 1 
ATOM   4554  C CE1 . TYR B 1 239 ? 10.944  41.546  211.060 1.00 46.85  ? 239 TYR B CE1 1 
ATOM   4555  C CE2 . TYR B 1 239 ? 9.046   42.189  209.787 1.00 44.40  ? 239 TYR B CE2 1 
ATOM   4556  C CZ  . TYR B 1 239 ? 9.663   41.285  210.595 1.00 46.80  ? 239 TYR B CZ  1 
ATOM   4557  O OH  . TYR B 1 239 ? 8.974   40.126  210.904 1.00 53.79  ? 239 TYR B OH  1 
ATOM   4558  N N   . PHE B 1 240 ? 14.311  43.931  209.598 1.00 28.61  ? 240 PHE B N   1 
ATOM   4559  C CA  . PHE B 1 240 ? 15.219  42.974  210.142 1.00 32.37  ? 240 PHE B CA  1 
ATOM   4560  C C   . PHE B 1 240 ? 16.094  43.600  211.151 1.00 36.07  ? 240 PHE B C   1 
ATOM   4561  O O   . PHE B 1 240 ? 16.289  44.834  211.192 1.00 30.15  ? 240 PHE B O   1 
ATOM   4562  C CB  . PHE B 1 240 ? 16.118  42.372  209.088 1.00 37.33  ? 240 PHE B CB  1 
ATOM   4563  C CG  . PHE B 1 240 ? 16.050  43.064  207.780 1.00 39.99  ? 240 PHE B CG  1 
ATOM   4564  C CD1 . PHE B 1 240 ? 16.148  44.439  207.709 1.00 33.90  ? 240 PHE B CD1 1 
ATOM   4565  C CD2 . PHE B 1 240 ? 15.773  42.334  206.626 1.00 37.71  ? 240 PHE B CD2 1 
ATOM   4566  C CE1 . PHE B 1 240 ? 15.960  45.044  206.536 1.00 37.60  ? 240 PHE B CE1 1 
ATOM   4567  C CE2 . PHE B 1 240 ? 15.588  42.948  205.442 1.00 35.33  ? 240 PHE B CE2 1 
ATOM   4568  C CZ  . PHE B 1 240 ? 15.676  44.297  205.386 1.00 39.31  ? 240 PHE B CZ  1 
ATOM   4569  N N   . GLY B 1 241 ? 16.687  42.677  211.896 1.00 42.75  ? 241 GLY B N   1 
ATOM   4570  C CA  . GLY B 1 241 ? 17.595  42.989  212.965 1.00 51.21  ? 241 GLY B CA  1 
ATOM   4571  C C   . GLY B 1 241 ? 17.821  41.740  213.787 1.00 53.30  ? 241 GLY B C   1 
ATOM   4572  O O   . GLY B 1 241 ? 17.381  40.641  213.417 1.00 52.13  ? 241 GLY B O   1 
ATOM   4573  N N   . ASN B 1 242 ? 18.425  41.940  214.953 1.00 55.76  ? 242 ASN B N   1 
ATOM   4574  C CA  . ASN B 1 242 ? 18.752  40.835  215.831 1.00 58.09  ? 242 ASN B CA  1 
ATOM   4575  C C   . ASN B 1 242 ? 19.085  41.170  217.299 1.00 53.96  ? 242 ASN B C   1 
ATOM   4576  O O   . ASN B 1 242 ? 19.603  42.257  217.657 1.00 51.44  ? 242 ASN B O   1 
ATOM   4577  C CB  . ASN B 1 242 ? 19.961  40.142  215.280 1.00 67.45  ? 242 ASN B CB  1 
ATOM   4578  C CG  . ASN B 1 242 ? 21.210  40.846  215.676 1.00 78.27  ? 242 ASN B CG  1 
ATOM   4579  O OD1 . ASN B 1 242 ? 22.025  40.311  216.432 1.00 87.74  ? 242 ASN B OD1 1 
ATOM   4580  N ND2 . ASN B 1 242 ? 21.323  42.110  215.264 1.00 85.24  ? 242 ASN B ND2 1 
ATOM   4581  N N   . TYR B 1 243 ? 18.934  40.139  218.110 1.00 47.49  ? 243 TYR B N   1 
ATOM   4582  C CA  . TYR B 1 243 ? 19.179  40.261  219.501 1.00 41.58  ? 243 TYR B CA  1 
ATOM   4583  C C   . TYR B 1 243 ? 20.489  39.619  219.796 1.00 40.43  ? 243 TYR B C   1 
ATOM   4584  O O   . TYR B 1 243 ? 20.858  38.642  219.158 1.00 38.79  ? 243 TYR B O   1 
ATOM   4585  C CB  . TYR B 1 243 ? 18.092  39.538  220.251 1.00 39.55  ? 243 TYR B CB  1 
ATOM   4586  C CG  . TYR B 1 243 ? 18.366  39.593  221.693 1.00 39.66  ? 243 TYR B CG  1 
ATOM   4587  C CD1 . TYR B 1 243 ? 18.462  40.818  222.340 1.00 40.75  ? 243 TYR B CD1 1 
ATOM   4588  C CD2 . TYR B 1 243 ? 18.594  38.435  222.411 1.00 40.52  ? 243 TYR B CD2 1 
ATOM   4589  C CE1 . TYR B 1 243 ? 18.781  40.894  223.682 1.00 45.93  ? 243 TYR B CE1 1 
ATOM   4590  C CE2 . TYR B 1 243 ? 18.916  38.487  223.751 1.00 43.39  ? 243 TYR B CE2 1 
ATOM   4591  C CZ  . TYR B 1 243 ? 19.009  39.721  224.400 1.00 48.14  ? 243 TYR B CZ  1 
ATOM   4592  O OH  . TYR B 1 243 ? 19.338  39.765  225.763 1.00 49.75  ? 243 TYR B OH  1 
ATOM   4593  N N   . THR B 1 244 ? 21.128  40.105  220.840 1.00 39.02  ? 244 THR B N   1 
ATOM   4594  C CA  . THR B 1 244 ? 22.402  39.578  221.270 1.00 42.24  ? 244 THR B CA  1 
ATOM   4595  C C   . THR B 1 244 ? 22.371  39.931  222.716 1.00 44.82  ? 244 THR B C   1 
ATOM   4596  O O   . THR B 1 244 ? 22.597  41.089  223.091 1.00 42.51  ? 244 THR B O   1 
ATOM   4597  C CB  . THR B 1 244 ? 23.518  40.345  220.649 1.00 42.72  ? 244 THR B CB  1 
ATOM   4598  O OG1 . THR B 1 244 ? 22.946  41.266  219.724 1.00 52.59  ? 244 THR B OG1 1 
ATOM   4599  C CG2 . THR B 1 244 ? 24.473  39.438  219.922 1.00 41.94  ? 244 THR B CG2 1 
ATOM   4600  N N   . GLY B 1 245 ? 21.955  38.950  223.507 1.00 50.69  ? 245 GLY B N   1 
ATOM   4601  C CA  . GLY B 1 245 ? 21.837  39.117  224.944 1.00 56.09  ? 245 GLY B CA  1 
ATOM   4602  C C   . GLY B 1 245 ? 23.109  39.177  225.724 1.00 56.68  ? 245 GLY B C   1 
ATOM   4603  O O   . GLY B 1 245 ? 24.186  39.295  225.148 1.00 55.22  ? 245 GLY B O   1 
ATOM   4604  N N   . GLY B 1 246 ? 22.992  39.159  227.041 1.00 57.69  ? 246 GLY B N   1 
ATOM   4605  C CA  . GLY B 1 246 ? 24.209  39.193  227.813 1.00 62.65  ? 246 GLY B CA  1 
ATOM   4606  C C   . GLY B 1 246 ? 24.510  40.433  228.616 1.00 64.35  ? 246 GLY B C   1 
ATOM   4607  O O   . GLY B 1 246 ? 24.015  41.546  228.385 1.00 67.09  ? 246 GLY B O   1 
ATOM   4608  N N   . THR B 1 247 ? 25.500  40.252  229.457 1.00 64.67  ? 247 THR B N   1 
ATOM   4609  C CA  . THR B 1 247 ? 25.888  41.263  230.388 1.00 67.37  ? 247 THR B CA  1 
ATOM   4610  C C   . THR B 1 247 ? 27.186  42.004  230.131 1.00 68.93  ? 247 THR B C   1 
ATOM   4611  O O   . THR B 1 247 ? 27.288  43.186  230.460 1.00 68.96  ? 247 THR B O   1 
ATOM   4612  C CB  . THR B 1 247 ? 25.957  40.564  231.699 1.00 70.83  ? 247 THR B CB  1 
ATOM   4613  O OG1 . THR B 1 247 ? 26.773  39.396  231.529 1.00 77.87  ? 247 THR B OG1 1 
ATOM   4614  C CG2 . THR B 1 247 ? 24.567  40.085  232.082 1.00 70.39  ? 247 THR B CG2 1 
ATOM   4615  N N   . THR B 1 248 ? 28.191  41.267  229.649 1.00 71.48  ? 248 THR B N   1 
ATOM   4616  C CA  . THR B 1 248 ? 29.555  41.765  229.332 1.00 76.56  ? 248 THR B CA  1 
ATOM   4617  C C   . THR B 1 248 ? 29.771  41.796  227.838 1.00 74.52  ? 248 THR B C   1 
ATOM   4618  O O   . THR B 1 248 ? 30.792  42.275  227.344 1.00 76.77  ? 248 THR B O   1 
ATOM   4619  C CB  . THR B 1 248 ? 30.617  40.781  229.774 1.00 82.15  ? 248 THR B CB  1 
ATOM   4620  O OG1 . THR B 1 248 ? 30.019  39.480  229.901 1.00 90.98  ? 248 THR B OG1 1 
ATOM   4621  C CG2 . THR B 1 248 ? 31.285  41.225  231.051 1.00 88.49  ? 248 THR B CG2 1 
ATOM   4622  N N   . THR B 1 249 ? 28.945  40.987  227.197 1.00 70.38  ? 249 THR B N   1 
ATOM   4623  C CA  . THR B 1 249 ? 28.874  40.821  225.767 1.00 63.03  ? 249 THR B CA  1 
ATOM   4624  C C   . THR B 1 249 ? 29.410  42.028  224.977 1.00 55.54  ? 249 THR B C   1 
ATOM   4625  O O   . THR B 1 249 ? 28.953  43.162  225.182 1.00 55.75  ? 249 THR B O   1 
ATOM   4626  C CB  . THR B 1 249 ? 27.415  40.621  225.457 1.00 66.48  ? 249 THR B CB  1 
ATOM   4627  O OG1 . THR B 1 249 ? 26.909  39.550  226.269 1.00 72.81  ? 249 THR B OG1 1 
ATOM   4628  C CG2 . THR B 1 249 ? 27.213  40.338  224.019 1.00 74.44  ? 249 THR B CG2 1 
ATOM   4629  N N   . PRO B 1 250 ? 30.439  41.810  224.131 1.00 47.87  ? 250 PRO B N   1 
ATOM   4630  C CA  . PRO B 1 250 ? 31.066  42.841  223.307 1.00 41.57  ? 250 PRO B CA  1 
ATOM   4631  C C   . PRO B 1 250 ? 30.271  43.345  222.136 1.00 37.01  ? 250 PRO B C   1 
ATOM   4632  O O   . PRO B 1 250 ? 29.731  42.587  221.342 1.00 34.58  ? 250 PRO B O   1 
ATOM   4633  C CB  . PRO B 1 250 ? 32.355  42.187  222.876 1.00 39.41  ? 250 PRO B CB  1 
ATOM   4634  C CG  . PRO B 1 250 ? 32.709  41.442  224.074 1.00 45.41  ? 250 PRO B CG  1 
ATOM   4635  C CD  . PRO B 1 250 ? 31.401  40.723  224.332 1.00 49.60  ? 250 PRO B CD  1 
ATOM   4636  N N   . PRO B 1 251 ? 30.247  44.661  221.995 1.00 36.01  ? 251 PRO B N   1 
ATOM   4637  C CA  . PRO B 1 251 ? 29.549  45.397  220.956 1.00 35.65  ? 251 PRO B CA  1 
ATOM   4638  C C   . PRO B 1 251 ? 30.237  45.211  219.639 1.00 36.96  ? 251 PRO B C   1 
ATOM   4639  O O   . PRO B 1 251 ? 31.461  45.285  219.552 1.00 35.02  ? 251 PRO B O   1 
ATOM   4640  C CB  . PRO B 1 251 ? 29.673  46.837  221.427 1.00 38.56  ? 251 PRO B CB  1 
ATOM   4641  C CG  . PRO B 1 251 ? 30.268  46.749  222.856 1.00 36.84  ? 251 PRO B CG  1 
ATOM   4642  C CD  . PRO B 1 251 ? 31.094  45.558  222.797 1.00 35.19  ? 251 PRO B CD  1 
ATOM   4643  N N   . VAL B 1 252 ? 29.470  44.949  218.599 1.00 37.77  ? 252 VAL B N   1 
ATOM   4644  C CA  . VAL B 1 252 ? 30.111  44.791  217.311 1.00 41.39  ? 252 VAL B CA  1 
ATOM   4645  C C   . VAL B 1 252 ? 29.366  45.415  216.195 1.00 44.60  ? 252 VAL B C   1 
ATOM   4646  O O   . VAL B 1 252 ? 28.146  45.237  216.076 1.00 45.74  ? 252 VAL B O   1 
ATOM   4647  C CB  . VAL B 1 252 ? 30.387  43.381  216.974 1.00 38.34  ? 252 VAL B CB  1 
ATOM   4648  C CG1 . VAL B 1 252 ? 31.869  43.239  216.789 1.00 38.33  ? 252 VAL B CG1 1 
ATOM   4649  C CG2 . VAL B 1 252 ? 29.860  42.474  218.068 1.00 37.81  ? 252 VAL B CG2 1 
ATOM   4650  N N   . LEU B 1 253 ? 30.128  46.065  215.322 1.00 48.19  ? 253 LEU B N   1 
ATOM   4651  C CA  . LEU B 1 253 ? 29.520  46.787  214.243 1.00 54.18  ? 253 LEU B CA  1 
ATOM   4652  C C   . LEU B 1 253 ? 30.229  46.846  212.921 1.00 58.22  ? 253 LEU B C   1 
ATOM   4653  O O   . LEU B 1 253 ? 31.453  46.723  212.875 1.00 57.46  ? 253 LEU B O   1 
ATOM   4654  C CB  . LEU B 1 253 ? 29.247  48.195  214.706 1.00 60.28  ? 253 LEU B CB  1 
ATOM   4655  C CG  . LEU B 1 253 ? 27.751  48.467  214.681 1.00 66.81  ? 253 LEU B CG  1 
ATOM   4656  C CD1 . LEU B 1 253 ? 27.367  49.097  216.007 1.00 72.79  ? 253 LEU B CD1 1 
ATOM   4657  C CD2 . LEU B 1 253 ? 27.354  49.346  213.478 1.00 71.06  ? 253 LEU B CD2 1 
ATOM   4658  N N   . GLN B 1 254 ? 29.447  47.289  211.919 1.00 63.42  ? 254 GLN B N   1 
ATOM   4659  C CA  . GLN B 1 254 ? 29.801  47.391  210.490 1.00 63.64  ? 254 GLN B CA  1 
ATOM   4660  C C   . GLN B 1 254 ? 29.910  48.672  209.675 1.00 55.09  ? 254 GLN B C   1 
ATOM   4661  O O   . GLN B 1 254 ? 28.990  49.096  208.944 1.00 47.58  ? 254 GLN B O   1 
ATOM   4662  C CB  . GLN B 1 254 ? 28.895  46.446  209.737 1.00 77.67  ? 254 GLN B CB  1 
ATOM   4663  C CG  . GLN B 1 254 ? 29.102  45.041  210.231 1.00 92.19  ? 254 GLN B CG  1 
ATOM   4664  C CD  . GLN B 1 254 ? 30.587  44.704  210.332 1.00 99.73  ? 254 GLN B CD  1 
ATOM   4665  O OE1 . GLN B 1 254 ? 31.430  45.323  209.657 1.00 104.06 ? 254 GLN B OE1 1 
ATOM   4666  N NE2 . GLN B 1 254 ? 30.917  43.737  211.189 1.00 106.39 ? 254 GLN B NE2 1 
ATOM   4667  N N   . PHE B 1 255 ? 31.120  49.160  209.639 1.00 49.01  ? 255 PHE B N   1 
ATOM   4668  C CA  . PHE B 1 255 ? 31.342  50.334  208.898 1.00 48.42  ? 255 PHE B CA  1 
ATOM   4669  C C   . PHE B 1 255 ? 31.426  50.156  207.410 1.00 44.33  ? 255 PHE B C   1 
ATOM   4670  O O   . PHE B 1 255 ? 32.458  49.698  206.909 1.00 46.53  ? 255 PHE B O   1 
ATOM   4671  C CB  . PHE B 1 255 ? 32.565  51.047  209.428 1.00 53.28  ? 255 PHE B CB  1 
ATOM   4672  C CG  . PHE B 1 255 ? 32.236  51.971  210.501 1.00 68.03  ? 255 PHE B CG  1 
ATOM   4673  C CD1 . PHE B 1 255 ? 30.954  52.562  210.531 1.00 79.21  ? 255 PHE B CD1 1 
ATOM   4674  C CD2 . PHE B 1 255 ? 33.153  52.290  211.485 1.00 77.54  ? 255 PHE B CD2 1 
ATOM   4675  C CE1 . PHE B 1 255 ? 30.567  53.501  211.543 1.00 89.41  ? 255 PHE B CE1 1 
ATOM   4676  C CE2 . PHE B 1 255 ? 32.796  53.233  212.522 1.00 93.97  ? 255 PHE B CE2 1 
ATOM   4677  C CZ  . PHE B 1 255 ? 31.481  53.842  212.546 1.00 94.82  ? 255 PHE B CZ  1 
ATOM   4678  N N   . THR B 1 256 ? 30.303  50.341  206.719 1.00 35.33  ? 256 THR B N   1 
ATOM   4679  C CA  . THR B 1 256 ? 30.386  50.357  205.267 1.00 34.07  ? 256 THR B CA  1 
ATOM   4680  C C   . THR B 1 256 ? 29.405  51.007  204.296 1.00 40.40  ? 256 THR B C   1 
ATOM   4681  O O   . THR B 1 256 ? 28.186  50.756  204.262 1.00 43.43  ? 256 THR B O   1 
ATOM   4682  C CB  . THR B 1 256 ? 30.957  49.140  204.644 1.00 28.12  ? 256 THR B CB  1 
ATOM   4683  O OG1 . THR B 1 256 ? 31.927  49.580  203.696 1.00 20.61  ? 256 THR B OG1 1 
ATOM   4684  C CG2 . THR B 1 256 ? 29.930  48.432  203.875 1.00 28.83  ? 256 THR B CG2 1 
ATOM   4685  N N   . ASN B 1 257 ? 30.048  51.766  203.412 1.00 43.41  ? 257 ASN B N   1 
ATOM   4686  C CA  . ASN B 1 257 ? 29.429  52.556  202.356 1.00 44.73  ? 257 ASN B CA  1 
ATOM   4687  C C   . ASN B 1 257 ? 29.386  51.743  201.089 1.00 43.33  ? 257 ASN B C   1 
ATOM   4688  O O   . ASN B 1 257 ? 29.222  52.281  199.995 1.00 41.21  ? 257 ASN B O   1 
ATOM   4689  C CB  . ASN B 1 257 ? 30.299  53.788  202.073 1.00 52.77  ? 257 ASN B CB  1 
ATOM   4690  C CG  . ASN B 1 257 ? 31.666  53.423  201.479 1.00 65.32  ? 257 ASN B CG  1 
ATOM   4691  O OD1 . ASN B 1 257 ? 32.147  54.074  200.560 1.00 76.21  ? 257 ASN B OD1 1 
ATOM   4692  N ND2 . ASN B 1 257 ? 32.286  52.373  202.000 1.00 70.75  ? 257 ASN B ND2 1 
ATOM   4693  N N   . THR B 1 258 ? 29.513  50.444  201.212 1.00 42.37  ? 258 THR B N   1 
ATOM   4694  C CA  . THR B 1 258 ? 29.547  49.651  200.017 1.00 48.39  ? 258 THR B CA  1 
ATOM   4695  C C   . THR B 1 258 ? 28.268  48.944  199.635 1.00 53.09  ? 258 THR B C   1 
ATOM   4696  O O   . THR B 1 258 ? 27.913  48.883  198.433 1.00 57.15  ? 258 THR B O   1 
ATOM   4697  C CB  . THR B 1 258 ? 30.634  48.646  200.173 1.00 48.20  ? 258 THR B CB  1 
ATOM   4698  O OG1 . THR B 1 258 ? 31.558  49.163  201.138 1.00 48.43  ? 258 THR B OG1 1 
ATOM   4699  C CG2 . THR B 1 258 ? 31.333  48.375  198.837 1.00 55.84  ? 258 THR B CG2 1 
ATOM   4700  N N   . LEU B 1 259 ? 27.519  48.511  200.651 1.00 56.34  ? 259 LEU B N   1 
ATOM   4701  C CA  . LEU B 1 259 ? 26.318  47.720  200.405 1.00 58.17  ? 259 LEU B CA  1 
ATOM   4702  C C   . LEU B 1 259 ? 24.894  48.171  200.452 1.00 54.63  ? 259 LEU B C   1 
ATOM   4703  O O   . LEU B 1 259 ? 24.421  48.770  201.432 1.00 59.05  ? 259 LEU B O   1 
ATOM   4704  C CB  . LEU B 1 259 ? 26.413  46.398  201.125 1.00 65.07  ? 259 LEU B CB  1 
ATOM   4705  C CG  . LEU B 1 259 ? 27.355  45.530  200.284 1.00 79.64  ? 259 LEU B CG  1 
ATOM   4706  C CD1 . LEU B 1 259 ? 27.045  45.560  198.677 1.00 89.01  ? 259 LEU B CD1 1 
ATOM   4707  C CD2 . LEU B 1 259 ? 28.790  45.968  200.611 1.00 80.96  ? 259 LEU B CD2 1 
ATOM   4708  N N   . THR B 1 260 ? 24.190  47.716  199.423 1.00 48.03  ? 260 THR B N   1 
ATOM   4709  C CA  . THR B 1 260 ? 22.795  48.020  199.244 1.00 48.64  ? 260 THR B CA  1 
ATOM   4710  C C   . THR B 1 260 ? 22.011  46.783  199.456 1.00 44.58  ? 260 THR B C   1 
ATOM   4711  O O   . THR B 1 260 ? 22.516  45.662  199.238 1.00 46.85  ? 260 THR B O   1 
ATOM   4712  C CB  . THR B 1 260 ? 22.502  48.487  197.850 1.00 54.24  ? 260 THR B CB  1 
ATOM   4713  O OG1 . THR B 1 260 ? 23.750  48.799  197.212 1.00 64.42  ? 260 THR B OG1 1 
ATOM   4714  C CG2 . THR B 1 260 ? 21.541  49.739  197.873 1.00 60.15  ? 260 THR B CG2 1 
ATOM   4715  N N   . THR B 1 261 ? 20.745  47.014  199.788 1.00 39.79  ? 261 THR B N   1 
ATOM   4716  C CA  . THR B 1 261 ? 19.825  45.949  200.081 1.00 35.50  ? 261 THR B CA  1 
ATOM   4717  C C   . THR B 1 261 ? 18.526  46.096  199.429 1.00 34.71  ? 261 THR B C   1 
ATOM   4718  O O   . THR B 1 261 ? 17.947  47.189  199.385 1.00 33.99  ? 261 THR B O   1 
ATOM   4719  C CB  . THR B 1 261 ? 19.511  45.907  201.488 1.00 31.49  ? 261 THR B CB  1 
ATOM   4720  O OG1 . THR B 1 261 ? 20.713  46.155  202.209 1.00 39.35  ? 261 THR B OG1 1 
ATOM   4721  C CG2 . THR B 1 261 ? 18.979  44.561  201.818 1.00 32.08  ? 261 THR B CG2 1 
ATOM   4722  N N   . VAL B 1 262 ? 17.955  44.937  199.183 1.00 31.14  ? 262 VAL B N   1 
ATOM   4723  C CA  . VAL B 1 262 ? 16.729  44.940  198.482 1.00 31.98  ? 262 VAL B CA  1 
ATOM   4724  C C   . VAL B 1 262 ? 15.402  44.779  199.128 1.00 35.02  ? 262 VAL B C   1 
ATOM   4725  O O   . VAL B 1 262 ? 14.935  43.681  199.456 1.00 38.28  ? 262 VAL B O   1 
ATOM   4726  C CB  . VAL B 1 262 ? 16.803  44.074  197.315 1.00 29.31  ? 262 VAL B CB  1 
ATOM   4727  C CG1 . VAL B 1 262 ? 15.976  44.696  196.239 1.00 29.50  ? 262 VAL B CG1 1 
ATOM   4728  C CG2 . VAL B 1 262 ? 18.224  43.969  196.890 1.00 27.80  ? 262 VAL B CG2 1 
ATOM   4729  N N   . LEU B 1 263 ? 14.736  45.915  199.122 1.00 35.87  ? 263 LEU B N   1 
ATOM   4730  C CA  . LEU B 1 263 ? 13.401  46.037  199.629 1.00 36.56  ? 263 LEU B CA  1 
ATOM   4731  C C   . LEU B 1 263 ? 12.541  45.290  198.623 1.00 37.23  ? 263 LEU B C   1 
ATOM   4732  O O   . LEU B 1 263 ? 11.366  45.047  198.882 1.00 39.89  ? 263 LEU B O   1 
ATOM   4733  C CB  . LEU B 1 263 ? 13.016  47.504  199.656 1.00 35.25  ? 263 LEU B CB  1 
ATOM   4734  C CG  . LEU B 1 263 ? 14.257  48.257  200.094 1.00 34.50  ? 263 LEU B CG  1 
ATOM   4735  C CD1 . LEU B 1 263 ? 13.996  49.736  200.134 1.00 36.73  ? 263 LEU B CD1 1 
ATOM   4736  C CD2 . LEU B 1 263 ? 14.679  47.697  201.417 1.00 33.91  ? 263 LEU B CD2 1 
ATOM   4737  N N   . LEU B 1 264 ? 13.106  44.932  197.471 1.00 35.98  ? 264 LEU B N   1 
ATOM   4738  C CA  . LEU B 1 264 ? 12.315  44.209  196.512 1.00 36.59  ? 264 LEU B CA  1 
ATOM   4739  C C   . LEU B 1 264 ? 11.747  42.968  197.086 1.00 38.68  ? 264 LEU B C   1 
ATOM   4740  O O   . LEU B 1 264 ? 12.365  42.286  197.913 1.00 38.55  ? 264 LEU B O   1 
ATOM   4741  C CB  . LEU B 1 264 ? 13.040  43.917  195.233 1.00 33.63  ? 264 LEU B CB  1 
ATOM   4742  C CG  . LEU B 1 264 ? 12.155  44.713  194.297 1.00 40.12  ? 264 LEU B CG  1 
ATOM   4743  C CD1 . LEU B 1 264 ? 12.206  46.180  194.746 1.00 43.42  ? 264 LEU B CD1 1 
ATOM   4744  C CD2 . LEU B 1 264 ? 12.561  44.567  192.852 1.00 41.50  ? 264 LEU B CD2 1 
ATOM   4745  N N   . ASP B 1 265 ? 10.502  42.741  196.714 1.00 42.07  ? 265 ASP B N   1 
ATOM   4746  C CA  . ASP B 1 265 ? 9.808   41.598  197.234 1.00 51.35  ? 265 ASP B CA  1 
ATOM   4747  C C   . ASP B 1 265 ? 10.012  40.373  196.361 1.00 53.80  ? 265 ASP B C   1 
ATOM   4748  O O   . ASP B 1 265 ? 10.882  40.368  195.510 1.00 54.76  ? 265 ASP B O   1 
ATOM   4749  C CB  . ASP B 1 265 ? 8.333   41.944  197.501 1.00 55.87  ? 265 ASP B CB  1 
ATOM   4750  C CG  . ASP B 1 265 ? 7.442   41.699  196.324 1.00 58.01  ? 265 ASP B CG  1 
ATOM   4751  O OD1 . ASP B 1 265 ? 7.915   41.829  195.171 1.00 52.08  ? 265 ASP B OD1 1 
ATOM   4752  O OD2 . ASP B 1 265 ? 6.258   41.371  196.582 1.00 63.08  ? 265 ASP B OD2 1 
ATOM   4753  N N   . GLU B 1 266 ? 9.206   39.345  196.573 1.00 59.20  ? 266 GLU B N   1 
ATOM   4754  C CA  . GLU B 1 266 ? 9.318   38.100  195.838 1.00 64.07  ? 266 GLU B CA  1 
ATOM   4755  C C   . GLU B 1 266 ? 8.777   38.202  194.430 1.00 61.21  ? 266 GLU B C   1 
ATOM   4756  O O   . GLU B 1 266 ? 8.977   37.313  193.624 1.00 61.85  ? 266 GLU B O   1 
ATOM   4757  C CB  . GLU B 1 266 ? 8.565   37.002  196.587 1.00 78.73  ? 266 GLU B CB  1 
ATOM   4758  C CG  . GLU B 1 266 ? 8.835   36.959  198.109 1.00 102.35 ? 266 GLU B CG  1 
ATOM   4759  C CD  . GLU B 1 266 ? 7.632   36.426  198.914 1.00 117.20 ? 266 GLU B CD  1 
ATOM   4760  O OE1 . GLU B 1 266 ? 6.538   37.061  198.869 1.00 126.86 ? 266 GLU B OE1 1 
ATOM   4761  O OE2 . GLU B 1 266 ? 7.777   35.384  199.609 1.00 125.51 ? 266 GLU B OE2 1 
ATOM   4762  N N   . ASN B 1 267 ? 8.057   39.265  194.132 1.00 60.62  ? 267 ASN B N   1 
ATOM   4763  C CA  . ASN B 1 267 ? 7.499   39.412  192.802 1.00 63.67  ? 267 ASN B CA  1 
ATOM   4764  C C   . ASN B 1 267 ? 8.134   40.584  192.129 1.00 59.71  ? 267 ASN B C   1 
ATOM   4765  O O   . ASN B 1 267 ? 7.709   41.039  191.068 1.00 60.75  ? 267 ASN B O   1 
ATOM   4766  C CB  . ASN B 1 267 ? 5.997   39.596  192.903 1.00 75.09  ? 267 ASN B CB  1 
ATOM   4767  C CG  . ASN B 1 267 ? 5.302   38.346  193.416 1.00 87.21  ? 267 ASN B CG  1 
ATOM   4768  O OD1 . ASN B 1 267 ? 5.365   37.290  192.772 1.00 94.39  ? 267 ASN B OD1 1 
ATOM   4769  N ND2 . ASN B 1 267 ? 4.657   38.443  194.593 1.00 93.23  ? 267 ASN B ND2 1 
ATOM   4770  N N   . GLY B 1 268 ? 9.181   41.066  192.773 1.00 57.80  ? 268 GLY B N   1 
ATOM   4771  C CA  . GLY B 1 268 ? 9.919   42.196  192.260 1.00 51.81  ? 268 GLY B CA  1 
ATOM   4772  C C   . GLY B 1 268 ? 9.116   43.424  192.539 1.00 42.32  ? 268 GLY B C   1 
ATOM   4773  O O   . GLY B 1 268 ? 8.736   44.130  191.598 1.00 45.51  ? 268 GLY B O   1 
ATOM   4774  N N   . VAL B 1 269 ? 8.919   43.715  193.819 1.00 30.96  ? 269 VAL B N   1 
ATOM   4775  C CA  . VAL B 1 269 ? 8.112   44.839  194.155 1.00 26.72  ? 269 VAL B CA  1 
ATOM   4776  C C   . VAL B 1 269 ? 8.584   45.796  195.189 1.00 27.96  ? 269 VAL B C   1 
ATOM   4777  O O   . VAL B 1 269 ? 8.425   46.991  195.030 1.00 34.54  ? 269 VAL B O   1 
ATOM   4778  C CB  . VAL B 1 269 ? 6.743   44.383  194.513 1.00 24.51  ? 269 VAL B CB  1 
ATOM   4779  C CG1 . VAL B 1 269 ? 5.951   45.499  195.143 1.00 25.26  ? 269 VAL B CG1 1 
ATOM   4780  C CG2 . VAL B 1 269 ? 6.066   43.871  193.276 1.00 26.87  ? 269 VAL B CG2 1 
ATOM   4781  N N   . GLY B 1 270 ? 9.119   45.323  196.285 1.00 26.58  ? 270 GLY B N   1 
ATOM   4782  C CA  . GLY B 1 270 ? 9.521   46.329  197.238 1.00 26.54  ? 270 GLY B CA  1 
ATOM   4783  C C   . GLY B 1 270 ? 8.294   47.003  197.828 1.00 26.28  ? 270 GLY B C   1 
ATOM   4784  O O   . GLY B 1 270 ? 7.132   46.603  197.610 1.00 23.29  ? 270 GLY B O   1 
ATOM   4785  N N   . PRO B 1 271 ? 8.531   47.990  198.670 1.00 23.36  ? 271 PRO B N   1 
ATOM   4786  C CA  . PRO B 1 271 ? 7.333   48.594  199.214 1.00 24.75  ? 271 PRO B CA  1 
ATOM   4787  C C   . PRO B 1 271 ? 6.874   49.642  198.246 1.00 30.06  ? 271 PRO B C   1 
ATOM   4788  O O   . PRO B 1 271 ? 7.624   50.017  197.324 1.00 28.20  ? 271 PRO B O   1 
ATOM   4789  C CB  . PRO B 1 271 ? 7.830   49.211  200.529 1.00 21.11  ? 271 PRO B CB  1 
ATOM   4790  C CG  . PRO B 1 271 ? 9.151   48.518  200.801 1.00 20.30  ? 271 PRO B CG  1 
ATOM   4791  C CD  . PRO B 1 271 ? 9.719   48.412  199.414 1.00 21.68  ? 271 PRO B CD  1 
ATOM   4792  N N   . LEU B 1 272 ? 5.641   50.104  198.467 1.00 34.57  ? 272 LEU B N   1 
ATOM   4793  C CA  . LEU B 1 272 ? 4.999   51.144  197.657 1.00 38.31  ? 272 LEU B CA  1 
ATOM   4794  C C   . LEU B 1 272 ? 4.414   52.025  198.687 1.00 39.99  ? 272 LEU B C   1 
ATOM   4795  O O   . LEU B 1 272 ? 3.670   51.556  199.530 1.00 38.77  ? 272 LEU B O   1 
ATOM   4796  C CB  . LEU B 1 272 ? 3.866   50.575  196.837 1.00 35.00  ? 272 LEU B CB  1 
ATOM   4797  C CG  . LEU B 1 272 ? 4.374   49.300  196.196 1.00 39.54  ? 272 LEU B CG  1 
ATOM   4798  C CD1 . LEU B 1 272 ? 4.318   48.108  197.178 1.00 35.82  ? 272 LEU B CD1 1 
ATOM   4799  C CD2 . LEU B 1 272 ? 3.560   49.056  194.993 1.00 44.10  ? 272 LEU B CD2 1 
ATOM   4800  N N   . CYS B 1 273 ? 4.765   53.291  198.648 1.00 45.13  ? 273 CYS B N   1 
ATOM   4801  C CA  . CYS B 1 273 ? 4.276   54.201  199.644 1.00 51.06  ? 273 CYS B CA  1 
ATOM   4802  C C   . CYS B 1 273 ? 2.879   54.611  199.333 1.00 55.66  ? 273 CYS B C   1 
ATOM   4803  O O   . CYS B 1 273 ? 2.662   55.320  198.343 1.00 56.16  ? 273 CYS B O   1 
ATOM   4804  C CB  . CYS B 1 273 ? 5.159   55.424  199.703 1.00 52.97  ? 273 CYS B CB  1 
ATOM   4805  S SG  . CYS B 1 273 ? 6.894   55.001  199.921 1.00 56.06  ? 273 CYS B SG  1 
ATOM   4806  N N   . LYS B 1 274 ? 1.932   54.010  200.060 1.00 60.04  ? 274 LYS B N   1 
ATOM   4807  C CA  . LYS B 1 274 ? 0.517   54.372  199.925 1.00 61.86  ? 274 LYS B CA  1 
ATOM   4808  C C   . LYS B 1 274 ? 0.447   55.538  200.907 1.00 62.31  ? 274 LYS B C   1 
ATOM   4809  O O   . LYS B 1 274 ? 0.904   55.426  202.057 1.00 60.19  ? 274 LYS B O   1 
ATOM   4810  C CB  . LYS B 1 274 ? -0.482  53.214  200.229 1.00 60.22  ? 274 LYS B CB  1 
ATOM   4811  C CG  . LYS B 1 274 ? -0.184  52.251  201.369 1.00 59.65  ? 274 LYS B CG  1 
ATOM   4812  C CD  . LYS B 1 274 ? -1.365  51.306  201.606 1.00 57.11  ? 274 LYS B CD  1 
ATOM   4813  C CE  . LYS B 1 274 ? -0.963  50.216  202.591 1.00 58.81  ? 274 LYS B CE  1 
ATOM   4814  N NZ  . LYS B 1 274 ? -2.069  49.401  203.160 1.00 57.98  ? 274 LYS B NZ  1 
ATOM   4815  N N   . GLY B 1 275 ? -0.024  56.687  200.417 1.00 62.94  ? 275 GLY B N   1 
ATOM   4816  C CA  . GLY B 1 275 ? 0.015   57.889  201.226 1.00 63.48  ? 275 GLY B CA  1 
ATOM   4817  C C   . GLY B 1 275 ? 1.418   58.096  200.740 1.00 64.08  ? 275 GLY B C   1 
ATOM   4818  O O   . GLY B 1 275 ? 2.286   57.256  200.987 1.00 64.24  ? 275 GLY B O   1 
ATOM   4819  N N   . GLU B 1 276 ? 1.630   59.118  199.936 1.00 65.52  ? 276 GLU B N   1 
ATOM   4820  C CA  . GLU B 1 276 ? 2.945   59.324  199.340 1.00 65.99  ? 276 GLU B CA  1 
ATOM   4821  C C   . GLU B 1 276 ? 4.175   59.338  200.272 1.00 66.52  ? 276 GLU B C   1 
ATOM   4822  O O   . GLU B 1 276 ? 5.216   59.953  199.946 1.00 63.97  ? 276 GLU B O   1 
ATOM   4823  C CB  . GLU B 1 276 ? 2.897   60.540  198.414 1.00 65.80  ? 276 GLU B CB  1 
ATOM   4824  C CG  . GLU B 1 276 ? 1.671   60.548  197.498 1.00 70.34  ? 276 GLU B CG  1 
ATOM   4825  C CD  . GLU B 1 276 ? 1.094   59.143  197.214 1.00 76.36  ? 276 GLU B CD  1 
ATOM   4826  O OE1 . GLU B 1 276 ? 1.855   58.177  196.960 1.00 77.88  ? 276 GLU B OE1 1 
ATOM   4827  O OE2 . GLU B 1 276 ? -0.146  58.998  197.269 1.00 81.15  ? 276 GLU B OE2 1 
ATOM   4828  N N   . GLY B 1 277 ? 4.046   58.654  201.424 1.00 64.09  ? 277 GLY B N   1 
ATOM   4829  C CA  . GLY B 1 277 ? 5.095   58.561  202.425 1.00 55.46  ? 277 GLY B CA  1 
ATOM   4830  C C   . GLY B 1 277 ? 5.855   57.256  202.536 1.00 47.61  ? 277 GLY B C   1 
ATOM   4831  O O   . GLY B 1 277 ? 5.317   56.143  202.430 1.00 45.69  ? 277 GLY B O   1 
ATOM   4832  N N   . LEU B 1 278 ? 7.124   57.442  202.847 1.00 40.80  ? 278 LEU B N   1 
ATOM   4833  C CA  . LEU B 1 278 ? 8.074   56.385  202.992 1.00 35.20  ? 278 LEU B CA  1 
ATOM   4834  C C   . LEU B 1 278 ? 8.282   56.314  204.477 1.00 33.28  ? 278 LEU B C   1 
ATOM   4835  O O   . LEU B 1 278 ? 8.386   57.343  205.113 1.00 31.81  ? 278 LEU B O   1 
ATOM   4836  C CB  . LEU B 1 278 ? 9.331   56.857  202.332 1.00 36.89  ? 278 LEU B CB  1 
ATOM   4837  C CG  . LEU B 1 278 ? 10.253  55.780  201.863 1.00 39.84  ? 278 LEU B CG  1 
ATOM   4838  C CD1 . LEU B 1 278 ? 11.645  56.341  201.972 1.00 44.71  ? 278 LEU B CD1 1 
ATOM   4839  C CD2 . LEU B 1 278 ? 10.115  54.570  202.757 1.00 44.59  ? 278 LEU B CD2 1 
ATOM   4840  N N   . TYR B 1 279 ? 8.386   55.118  205.026 1.00 34.85  ? 279 TYR B N   1 
ATOM   4841  C CA  . TYR B 1 279 ? 8.534   54.972  206.463 1.00 36.59  ? 279 TYR B CA  1 
ATOM   4842  C C   . TYR B 1 279 ? 9.805   54.262  206.940 1.00 33.78  ? 279 TYR B C   1 
ATOM   4843  O O   . TYR B 1 279 ? 10.043  53.068  206.678 1.00 30.19  ? 279 TYR B O   1 
ATOM   4844  C CB  . TYR B 1 279 ? 7.322   54.215  207.019 1.00 46.55  ? 279 TYR B CB  1 
ATOM   4845  C CG  . TYR B 1 279 ? 5.934   54.830  206.828 1.00 48.91  ? 279 TYR B CG  1 
ATOM   4846  C CD1 . TYR B 1 279 ? 5.284   54.802  205.595 1.00 46.96  ? 279 TYR B CD1 1 
ATOM   4847  C CD2 . TYR B 1 279 ? 5.243   55.376  207.919 1.00 52.68  ? 279 TYR B CD2 1 
ATOM   4848  C CE1 . TYR B 1 279 ? 3.968   55.313  205.463 1.00 54.91  ? 279 TYR B CE1 1 
ATOM   4849  C CE2 . TYR B 1 279 ? 3.936   55.881  207.804 1.00 53.95  ? 279 TYR B CE2 1 
ATOM   4850  C CZ  . TYR B 1 279 ? 3.299   55.859  206.580 1.00 56.09  ? 279 TYR B CZ  1 
ATOM   4851  O OH  . TYR B 1 279 ? 2.034   56.445  206.471 1.00 58.34  ? 279 TYR B OH  1 
ATOM   4852  N N   . LEU B 1 280 ? 10.573  54.965  207.746 1.00 32.69  ? 280 LEU B N   1 
ATOM   4853  C CA  . LEU B 1 280 ? 11.800  54.382  208.263 1.00 36.25  ? 280 LEU B CA  1 
ATOM   4854  C C   . LEU B 1 280 ? 11.674  54.145  209.743 1.00 35.18  ? 280 LEU B C   1 
ATOM   4855  O O   . LEU B 1 280 ? 11.313  55.046  210.496 1.00 36.38  ? 280 LEU B O   1 
ATOM   4856  C CB  . LEU B 1 280 ? 12.981  55.292  207.984 1.00 38.21  ? 280 LEU B CB  1 
ATOM   4857  C CG  . LEU B 1 280 ? 13.028  55.688  206.513 1.00 37.85  ? 280 LEU B CG  1 
ATOM   4858  C CD1 . LEU B 1 280 ? 14.320  56.440  206.233 1.00 35.14  ? 280 LEU B CD1 1 
ATOM   4859  C CD2 . LEU B 1 280 ? 12.910  54.434  205.658 1.00 41.94  ? 280 LEU B CD2 1 
ATOM   4860  N N   . SER B 1 281 ? 12.118  52.980  210.175 1.00 32.60  ? 281 SER B N   1 
ATOM   4861  C CA  . SER B 1 281 ? 11.973  52.623  211.557 1.00 26.39  ? 281 SER B CA  1 
ATOM   4862  C C   . SER B 1 281 ? 13.160  51.756  211.924 1.00 25.18  ? 281 SER B C   1 
ATOM   4863  O O   . SER B 1 281 ? 13.594  50.938  211.104 1.00 20.22  ? 281 SER B O   1 
ATOM   4864  C CB  . SER B 1 281 ? 10.653  51.874  211.644 1.00 25.94  ? 281 SER B CB  1 
ATOM   4865  O OG  . SER B 1 281 ? 10.015  51.828  210.353 1.00 25.95  ? 281 SER B OG  1 
ATOM   4866  N N   . CYS B 1 282 ? 13.687  51.928  213.136 1.00 25.35  ? 282 CYS B N   1 
ATOM   4867  C CA  . CYS B 1 282 ? 14.866  51.166  213.566 1.00 32.27  ? 282 CYS B CA  1 
ATOM   4868  C C   . CYS B 1 282 ? 15.307  51.373  215.023 1.00 34.97  ? 282 CYS B C   1 
ATOM   4869  O O   . CYS B 1 282 ? 14.977  52.393  215.632 1.00 39.69  ? 282 CYS B O   1 
ATOM   4870  C CB  . CYS B 1 282 ? 16.036  51.578  212.705 1.00 38.09  ? 282 CYS B CB  1 
ATOM   4871  S SG  . CYS B 1 282 ? 16.599  53.245  213.114 1.00 49.72  ? 282 CYS B SG  1 
ATOM   4872  N N   . VAL B 1 283 ? 16.198  50.506  215.513 1.00 35.54  ? 283 VAL B N   1 
ATOM   4873  C CA  . VAL B 1 283 ? 16.686  50.558  216.905 1.00 34.02  ? 283 VAL B CA  1 
ATOM   4874  C C   . VAL B 1 283 ? 18.109  50.126  217.002 1.00 32.63  ? 283 VAL B C   1 
ATOM   4875  O O   . VAL B 1 283 ? 18.454  49.072  216.475 1.00 28.53  ? 283 VAL B O   1 
ATOM   4876  C CB  . VAL B 1 283 ? 15.953  49.561  217.750 1.00 35.43  ? 283 VAL B CB  1 
ATOM   4877  C CG1 . VAL B 1 283 ? 14.736  50.211  218.328 1.00 39.13  ? 283 VAL B CG1 1 
ATOM   4878  C CG2 . VAL B 1 283 ? 15.565  48.339  216.888 1.00 33.74  ? 283 VAL B CG2 1 
ATOM   4879  N N   . ASP B 1 284 ? 18.909  50.829  217.791 1.00 34.58  ? 284 ASP B N   1 
ATOM   4880  C CA  . ASP B 1 284 ? 20.317  50.444  217.847 1.00 37.40  ? 284 ASP B CA  1 
ATOM   4881  C C   . ASP B 1 284 ? 21.066  50.478  219.138 1.00 36.96  ? 284 ASP B C   1 
ATOM   4882  O O   . ASP B 1 284 ? 22.016  51.248  219.334 1.00 36.39  ? 284 ASP B O   1 
ATOM   4883  C CB  . ASP B 1 284 ? 21.081  51.207  216.801 1.00 41.34  ? 284 ASP B CB  1 
ATOM   4884  C CG  . ASP B 1 284 ? 20.605  50.873  215.434 1.00 44.67  ? 284 ASP B CG  1 
ATOM   4885  O OD1 . ASP B 1 284 ? 20.899  49.725  214.987 1.00 35.41  ? 284 ASP B OD1 1 
ATOM   4886  O OD2 . ASP B 1 284 ? 19.871  51.725  214.860 1.00 49.40  ? 284 ASP B OD2 1 
ATOM   4887  N N   . ILE B 1 285 ? 20.726  49.518  219.961 1.00 35.71  ? 285 ILE B N   1 
ATOM   4888  C CA  . ILE B 1 285 ? 21.330  49.419  221.239 1.00 37.37  ? 285 ILE B CA  1 
ATOM   4889  C C   . ILE B 1 285 ? 22.675  48.841  221.107 1.00 35.32  ? 285 ILE B C   1 
ATOM   4890  O O   . ILE B 1 285 ? 22.848  47.787  220.512 1.00 31.59  ? 285 ILE B O   1 
ATOM   4891  C CB  . ILE B 1 285 ? 20.586  48.473  222.096 1.00 44.55  ? 285 ILE B CB  1 
ATOM   4892  C CG1 . ILE B 1 285 ? 19.167  49.002  222.347 1.00 49.13  ? 285 ILE B CG1 1 
ATOM   4893  C CG2 . ILE B 1 285 ? 21.422  48.167  223.348 1.00 48.42  ? 285 ILE B CG2 1 
ATOM   4894  C CD1 . ILE B 1 285 ? 18.208  48.825  221.171 1.00 52.08  ? 285 ILE B CD1 1 
ATOM   4895  N N   . MET B 1 286 ? 23.606  49.471  221.782 1.00 37.39  ? 286 MET B N   1 
ATOM   4896  C CA  . MET B 1 286 ? 24.954  48.990  221.770 1.00 43.66  ? 286 MET B CA  1 
ATOM   4897  C C   . MET B 1 286 ? 25.243  48.256  223.051 1.00 46.72  ? 286 MET B C   1 
ATOM   4898  O O   . MET B 1 286 ? 26.073  47.344  223.079 1.00 46.04  ? 286 MET B O   1 
ATOM   4899  C CB  . MET B 1 286 ? 25.912  50.151  221.628 1.00 44.76  ? 286 MET B CB  1 
ATOM   4900  C CG  . MET B 1 286 ? 25.799  50.843  220.299 1.00 44.85  ? 286 MET B CG  1 
ATOM   4901  S SD  . MET B 1 286 ? 26.062  49.710  218.930 1.00 40.73  ? 286 MET B SD  1 
ATOM   4902  C CE  . MET B 1 286 ? 27.154  48.408  219.586 1.00 42.60  ? 286 MET B CE  1 
ATOM   4903  N N   . GLY B 1 287 ? 24.567  48.686  224.113 1.00 50.96  ? 287 GLY B N   1 
ATOM   4904  C CA  . GLY B 1 287 ? 24.765  48.089  225.422 1.00 53.01  ? 287 GLY B CA  1 
ATOM   4905  C C   . GLY B 1 287 ? 24.849  49.109  226.554 1.00 53.41  ? 287 GLY B C   1 
ATOM   4906  O O   . GLY B 1 287 ? 24.759  50.317  226.321 1.00 52.04  ? 287 GLY B O   1 
ATOM   4907  N N   . TRP B 1 288 ? 25.050  48.633  227.778 1.00 53.34  ? 288 TRP B N   1 
ATOM   4908  C CA  . TRP B 1 288 ? 25.115  49.515  228.919 1.00 54.14  ? 288 TRP B CA  1 
ATOM   4909  C C   . TRP B 1 288 ? 26.455  50.175  229.127 1.00 60.07  ? 288 TRP B C   1 
ATOM   4910  O O   . TRP B 1 288 ? 27.523  49.571  228.970 1.00 59.38  ? 288 TRP B O   1 
ATOM   4911  C CB  . TRP B 1 288 ? 24.728  48.801  230.220 1.00 53.42  ? 288 TRP B CB  1 
ATOM   4912  C CG  . TRP B 1 288 ? 24.161  47.439  230.064 1.00 57.60  ? 288 TRP B CG  1 
ATOM   4913  C CD1 . TRP B 1 288 ? 24.820  46.224  230.186 1.00 61.14  ? 288 TRP B CD1 1 
ATOM   4914  C CD2 . TRP B 1 288 ? 22.859  47.137  229.633 1.00 57.80  ? 288 TRP B CD2 1 
ATOM   4915  N NE1 . TRP B 1 288 ? 23.989  45.185  229.818 1.00 55.06  ? 288 TRP B NE1 1 
ATOM   4916  C CE2 . TRP B 1 288 ? 22.782  45.724  229.469 1.00 61.83  ? 288 TRP B CE2 1 
ATOM   4917  C CE3 . TRP B 1 288 ? 21.745  47.916  229.351 1.00 53.70  ? 288 TRP B CE3 1 
ATOM   4918  C CZ2 . TRP B 1 288 ? 21.637  45.101  229.023 1.00 68.29  ? 288 TRP B CZ2 1 
ATOM   4919  C CZ3 . TRP B 1 288 ? 20.612  47.298  228.915 1.00 57.27  ? 288 TRP B CZ3 1 
ATOM   4920  C CH2 . TRP B 1 288 ? 20.555  45.907  228.746 1.00 67.02  ? 288 TRP B CH2 1 
ATOM   4921  N N   . ARG B 1 289 ? 26.375  51.461  229.420 1.00 67.07  ? 289 ARG B N   1 
ATOM   4922  C CA  . ARG B 1 289 ? 27.527  52.256  229.796 1.00 75.12  ? 289 ARG B CA  1 
ATOM   4923  C C   . ARG B 1 289 ? 27.376  52.093  231.323 1.00 79.29  ? 289 ARG B C   1 
ATOM   4924  O O   . ARG B 1 289 ? 26.202  52.069  231.744 1.00 81.89  ? 289 ARG B O   1 
ATOM   4925  C CB  . ARG B 1 289 ? 27.270  53.725  229.416 1.00 80.02  ? 289 ARG B CB  1 
ATOM   4926  C CG  . ARG B 1 289 ? 28.085  54.673  230.284 1.00 84.06  ? 289 ARG B CG  1 
ATOM   4927  C CD  . ARG B 1 289 ? 27.631  56.106  230.220 1.00 88.73  ? 289 ARG B CD  1 
ATOM   4928  N NE  . ARG B 1 289 ? 28.160  56.836  231.370 1.00 94.84  ? 289 ARG B NE  1 
ATOM   4929  C CZ  . ARG B 1 289 ? 27.998  58.142  231.586 1.00 104.29 ? 289 ARG B CZ  1 
ATOM   4930  N NH1 . ARG B 1 289 ? 27.319  58.900  230.712 1.00 106.06 ? 289 ARG B NH1 1 
ATOM   4931  N NH2 . ARG B 1 289 ? 28.472  58.680  232.716 1.00 107.34 ? 289 ARG B NH2 1 
ATOM   4932  N N   . VAL B 1 290 ? 28.464  51.986  232.117 1.00 82.89  ? 290 VAL B N   1 
ATOM   4933  C CA  . VAL B 1 290 ? 28.351  51.892  233.587 1.00 90.05  ? 290 VAL B CA  1 
ATOM   4934  C C   . VAL B 1 290 ? 29.040  52.832  234.498 1.00 94.66  ? 290 VAL B C   1 
ATOM   4935  O O   . VAL B 1 290 ? 30.208  52.751  234.632 1.00 95.59  ? 290 VAL B O   1 
ATOM   4936  C CB  . VAL B 1 290 ? 28.684  50.523  234.103 1.00 88.83  ? 290 VAL B CB  1 
ATOM   4937  C CG1 . VAL B 1 290 ? 27.592  50.143  235.116 1.00 90.08  ? 290 VAL B CG1 1 
ATOM   4938  C CG2 . VAL B 1 290 ? 28.850  49.561  232.988 1.00 92.71  ? 290 VAL B CG2 1 
ATOM   4939  N N   . THR B 1 291 ? 28.273  53.553  235.299 1.00 100.26 ? 291 THR B N   1 
ATOM   4940  C CA  . THR B 1 291 ? 28.864  54.554  236.214 1.00 105.33 ? 291 THR B CA  1 
ATOM   4941  C C   . THR B 1 291 ? 29.698  53.970  237.338 1.00 112.60 ? 291 THR B C   1 
ATOM   4942  O O   . THR B 1 291 ? 29.656  52.778  237.643 1.00 110.19 ? 291 THR B O   1 
ATOM   4943  C CB  . THR B 1 291 ? 27.822  55.414  236.894 1.00 102.42 ? 291 THR B CB  1 
ATOM   4944  O OG1 . THR B 1 291 ? 26.691  54.607  237.232 1.00 98.59  ? 291 THR B OG1 1 
ATOM   4945  C CG2 . THR B 1 291 ? 27.425  56.541  235.978 1.00 101.23 ? 291 THR B CG2 1 
ATOM   4946  N N   . ARG B 1 292 ? 30.342  54.877  238.068 1.00 125.58 ? 292 ARG B N   1 
ATOM   4947  C CA  . ARG B 1 292 ? 31.156  54.489  239.171 1.00 137.39 ? 292 ARG B CA  1 
ATOM   4948  C C   . ARG B 1 292 ? 30.329  54.708  240.427 1.00 137.99 ? 292 ARG B C   1 
ATOM   4949  O O   . ARG B 1 292 ? 30.354  53.857  241.327 1.00 138.91 ? 292 ARG B O   1 
ATOM   4950  C CB  . ARG B 1 292 ? 32.474  55.258  239.122 1.00 146.95 ? 292 ARG B CB  1 
ATOM   4951  C CG  . ARG B 1 292 ? 33.346  55.134  240.345 1.00 160.19 ? 292 ARG B CG  1 
ATOM   4952  C CD  . ARG B 1 292 ? 33.128  56.374  241.226 1.00 175.19 ? 292 ARG B CD  1 
ATOM   4953  N NE  . ARG B 1 292 ? 34.058  56.511  242.366 1.00 191.30 ? 292 ARG B NE  1 
ATOM   4954  C CZ  . ARG B 1 292 ? 34.371  57.672  242.971 1.00 197.45 ? 292 ARG B CZ  1 
ATOM   4955  N NH1 . ARG B 1 292 ? 33.823  58.822  242.563 1.00 202.48 ? 292 ARG B NH1 1 
ATOM   4956  N NH2 . ARG B 1 292 ? 35.241  57.697  243.992 1.00 201.11 ? 292 ARG B NH2 1 
ATOM   4957  N N   . ASN B 1 293 ? 29.508  55.774  240.434 1.00 139.76 ? 293 ASN B N   1 
ATOM   4958  C CA  . ASN B 1 293 ? 28.643  56.100  241.583 1.00 142.88 ? 293 ASN B CA  1 
ATOM   4959  C C   . ASN B 1 293 ? 28.011  54.778  242.019 1.00 141.38 ? 293 ASN B C   1 
ATOM   4960  O O   . ASN B 1 293 ? 28.002  54.444  243.200 1.00 143.23 ? 293 ASN B O   1 
ATOM   4961  C CB  . ASN B 1 293 ? 27.590  57.174  241.191 1.00 148.18 ? 293 ASN B CB  1 
ATOM   4962  C CG  . ASN B 1 293 ? 26.600  57.551  242.352 1.00 151.98 ? 293 ASN B CG  1 
ATOM   4963  O OD1 . ASN B 1 293 ? 25.478  57.038  242.386 1.00 153.77 ? 293 ASN B OD1 1 
ATOM   4964  N ND2 . ASN B 1 293 ? 26.997  58.483  243.259 1.00 155.83 ? 293 ASN B ND2 1 
ATOM   4965  N N   . TYR B 1 294 ? 27.628  53.957  241.054 1.00 137.44 ? 294 TYR B N   1 
ATOM   4966  C CA  . TYR B 1 294 ? 27.050  52.664  241.348 1.00 132.79 ? 294 TYR B CA  1 
ATOM   4967  C C   . TYR B 1 294 ? 26.941  52.022  240.055 1.00 124.40 ? 294 TYR B C   1 
ATOM   4968  O O   . TYR B 1 294 ? 27.316  52.570  239.024 1.00 123.89 ? 294 TYR B O   1 
ATOM   4969  C CB  . TYR B 1 294 ? 25.625  52.793  241.841 1.00 144.08 ? 294 TYR B CB  1 
ATOM   4970  C CG  . TYR B 1 294 ? 25.515  52.423  243.264 1.00 161.65 ? 294 TYR B CG  1 
ATOM   4971  C CD1 . TYR B 1 294 ? 26.276  51.367  243.785 1.00 169.39 ? 294 TYR B CD1 1 
ATOM   4972  C CD2 . TYR B 1 294 ? 24.733  53.183  244.138 1.00 170.68 ? 294 TYR B CD2 1 
ATOM   4973  C CE1 . TYR B 1 294 ? 26.266  51.086  245.156 1.00 180.96 ? 294 TYR B CE1 1 
ATOM   4974  C CE2 . TYR B 1 294 ? 24.708  52.915  245.513 1.00 181.31 ? 294 TYR B CE2 1 
ATOM   4975  C CZ  . TYR B 1 294 ? 25.482  51.873  246.015 1.00 184.41 ? 294 TYR B CZ  1 
ATOM   4976  O OH  . TYR B 1 294 ? 25.452  51.636  247.374 1.00 191.30 ? 294 TYR B OH  1 
ATOM   4977  N N   . ASP B 1 295 ? 26.302  50.885  240.099 1.00 114.54 ? 295 ASP B N   1 
ATOM   4978  C CA  . ASP B 1 295 ? 26.073  50.174  238.897 1.00 108.81 ? 295 ASP B CA  1 
ATOM   4979  C C   . ASP B 1 295 ? 24.783  50.720  238.349 1.00 104.48 ? 295 ASP B C   1 
ATOM   4980  O O   . ASP B 1 295 ? 23.726  50.093  238.406 1.00 102.71 ? 295 ASP B O   1 
ATOM   4981  C CB  . ASP B 1 295 ? 26.051  48.682  239.169 1.00 113.56 ? 295 ASP B CB  1 
ATOM   4982  C CG  . ASP B 1 295 ? 27.431  48.153  239.508 1.00 116.50 ? 295 ASP B CG  1 
ATOM   4983  O OD1 . ASP B 1 295 ? 28.150  48.827  240.309 1.00 117.43 ? 295 ASP B OD1 1 
ATOM   4984  O OD2 . ASP B 1 295 ? 27.813  47.083  238.960 1.00 115.93 ? 295 ASP B OD2 1 
ATOM   4985  N N   . VAL B 1 296 ? 24.860  51.978  237.944 1.00 102.42 ? 296 VAL B N   1 
ATOM   4986  C CA  . VAL B 1 296 ? 23.730  52.651  237.337 1.00 103.69 ? 296 VAL B CA  1 
ATOM   4987  C C   . VAL B 1 296 ? 24.035  52.319  235.892 1.00 99.42  ? 296 VAL B C   1 
ATOM   4988  O O   . VAL B 1 296 ? 24.653  53.076  235.152 1.00 100.14 ? 296 VAL B O   1 
ATOM   4989  C CB  . VAL B 1 296 ? 23.771  54.164  237.542 1.00 110.85 ? 296 VAL B CB  1 
ATOM   4990  C CG1 . VAL B 1 296 ? 22.363  54.726  237.361 1.00 115.47 ? 296 VAL B CG1 1 
ATOM   4991  C CG2 . VAL B 1 296 ? 24.356  54.515  238.921 1.00 114.14 ? 296 VAL B CG2 1 
ATOM   4992  N N   . HIS B 1 297 ? 23.711  51.090  235.563 1.00 93.57  ? 297 HIS B N   1 
ATOM   4993  C CA  . HIS B 1 297 ? 23.961  50.508  234.275 1.00 88.44  ? 297 HIS B CA  1 
ATOM   4994  C C   . HIS B 1 297 ? 23.280  51.096  233.062 1.00 86.76  ? 297 HIS B C   1 
ATOM   4995  O O   . HIS B 1 297 ? 22.917  50.329  232.173 1.00 89.71  ? 297 HIS B O   1 
ATOM   4996  C CB  . HIS B 1 297 ? 23.547  49.068  234.380 1.00 87.75  ? 297 HIS B CB  1 
ATOM   4997  C CG  . HIS B 1 297 ? 24.657  48.116  234.162 1.00 91.16  ? 297 HIS B CG  1 
ATOM   4998  N ND1 . HIS B 1 297 ? 24.772  46.945  234.868 1.00 96.94  ? 297 HIS B ND1 1 
ATOM   4999  C CD2 . HIS B 1 297 ? 25.691  48.138  233.291 1.00 97.80  ? 297 HIS B CD2 1 
ATOM   5000  C CE1 . HIS B 1 297 ? 25.828  46.276  234.437 1.00 102.86 ? 297 HIS B CE1 1 
ATOM   5001  N NE2 . HIS B 1 297 ? 26.404  46.980  233.479 1.00 101.92 ? 297 HIS B NE2 1 
ATOM   5002  N N   . HIS B 1 298 ? 23.181  52.413  232.929 1.00 82.13  ? 298 HIS B N   1 
ATOM   5003  C CA  . HIS B 1 298 ? 22.446  52.937  231.775 1.00 77.11  ? 298 HIS B CA  1 
ATOM   5004  C C   . HIS B 1 298 ? 22.988  52.824  230.362 1.00 68.76  ? 298 HIS B C   1 
ATOM   5005  O O   . HIS B 1 298 ? 24.127  53.212  230.086 1.00 60.86  ? 298 HIS B O   1 
ATOM   5006  C CB  . HIS B 1 298 ? 21.904  54.303  232.053 1.00 84.03  ? 298 HIS B CB  1 
ATOM   5007  C CG  . HIS B 1 298 ? 22.932  55.278  232.490 1.00 84.12  ? 298 HIS B CG  1 
ATOM   5008  N ND1 . HIS B 1 298 ? 23.688  56.001  231.596 1.00 84.05  ? 298 HIS B ND1 1 
ATOM   5009  C CD2 . HIS B 1 298 ? 23.238  55.751  233.719 1.00 84.08  ? 298 HIS B CD2 1 
ATOM   5010  C CE1 . HIS B 1 298 ? 24.403  56.892  232.255 1.00 85.81  ? 298 HIS B CE1 1 
ATOM   5011  N NE2 . HIS B 1 298 ? 24.148  56.761  233.545 1.00 86.13  ? 298 HIS B NE2 1 
ATOM   5012  N N   . TRP B 1 299 ? 22.090  52.436  229.449 1.00 62.81  ? 299 TRP B N   1 
ATOM   5013  C CA  . TRP B 1 299 ? 22.502  52.149  228.099 1.00 59.57  ? 299 TRP B CA  1 
ATOM   5014  C C   . TRP B 1 299 ? 22.450  53.079  226.933 1.00 55.50  ? 299 TRP B C   1 
ATOM   5015  O O   . TRP B 1 299 ? 21.650  53.978  226.912 1.00 54.40  ? 299 TRP B O   1 
ATOM   5016  C CB  . TRP B 1 299 ? 22.191  50.688  227.713 1.00 68.93  ? 299 TRP B CB  1 
ATOM   5017  C CG  . TRP B 1 299 ? 20.801  50.077  227.376 1.00 74.49  ? 299 TRP B CG  1 
ATOM   5018  C CD1 . TRP B 1 299 ? 20.618  49.054  226.482 1.00 79.54  ? 299 TRP B CD1 1 
ATOM   5019  C CD2 . TRP B 1 299 ? 19.569  50.149  228.109 1.00 76.68  ? 299 TRP B CD2 1 
ATOM   5020  N NE1 . TRP B 1 299 ? 19.404  48.458  226.646 1.00 77.57  ? 299 TRP B NE1 1 
ATOM   5021  C CE2 . TRP B 1 299 ? 18.731  49.110  227.632 1.00 77.21  ? 299 TRP B CE2 1 
ATOM   5022  C CE3 . TRP B 1 299 ? 19.103  50.958  229.128 1.00 83.04  ? 299 TRP B CE3 1 
ATOM   5023  C CZ2 . TRP B 1 299 ? 17.465  48.863  228.144 1.00 81.86  ? 299 TRP B CZ2 1 
ATOM   5024  C CZ3 . TRP B 1 299 ? 17.829  50.716  229.641 1.00 91.62  ? 299 TRP B CZ3 1 
ATOM   5025  C CH2 . TRP B 1 299 ? 17.027  49.672  229.146 1.00 88.53  ? 299 TRP B CH2 1 
ATOM   5026  N N   . ARG B 1 300 ? 23.392  52.864  226.003 1.00 54.70  ? 300 ARG B N   1 
ATOM   5027  C CA  . ARG B 1 300 ? 23.603  53.669  224.779 1.00 53.65  ? 300 ARG B CA  1 
ATOM   5028  C C   . ARG B 1 300 ? 23.180  53.100  223.447 1.00 51.76  ? 300 ARG B C   1 
ATOM   5029  O O   . ARG B 1 300 ? 23.229  51.876  223.208 1.00 48.01  ? 300 ARG B O   1 
ATOM   5030  C CB  . ARG B 1 300 ? 25.087  54.063  224.616 1.00 52.93  ? 300 ARG B CB  1 
ATOM   5031  C CG  . ARG B 1 300 ? 25.417  54.802  223.306 1.00 49.32  ? 300 ARG B CG  1 
ATOM   5032  C CD  . ARG B 1 300 ? 26.575  55.738  223.515 1.00 56.02  ? 300 ARG B CD  1 
ATOM   5033  N NE  . ARG B 1 300 ? 26.829  56.665  222.408 1.00 56.47  ? 300 ARG B NE  1 
ATOM   5034  C CZ  . ARG B 1 300 ? 26.020  57.658  222.048 1.00 59.75  ? 300 ARG B CZ  1 
ATOM   5035  N NH1 . ARG B 1 300 ? 24.872  57.849  222.695 1.00 64.64  ? 300 ARG B NH1 1 
ATOM   5036  N NH2 . ARG B 1 300 ? 26.414  58.530  221.119 1.00 59.05  ? 300 ARG B NH2 1 
ATOM   5037  N N   . GLY B 1 301 ? 22.919  54.043  222.544 1.00 52.30  ? 301 GLY B N   1 
ATOM   5038  C CA  . GLY B 1 301 ? 22.513  53.725  221.190 1.00 51.55  ? 301 GLY B CA  1 
ATOM   5039  C C   . GLY B 1 301 ? 23.166  54.670  220.209 1.00 45.73  ? 301 GLY B C   1 
ATOM   5040  O O   . GLY B 1 301 ? 23.690  55.727  220.598 1.00 43.81  ? 301 GLY B O   1 
ATOM   5041  N N   . LEU B 1 302 ? 23.123  54.287  218.939 1.00 40.10  ? 302 LEU B N   1 
ATOM   5042  C CA  . LEU B 1 302 ? 23.719  55.077  217.881 1.00 35.47  ? 302 LEU B CA  1 
ATOM   5043  C C   . LEU B 1 302 ? 22.697  55.355  216.809 1.00 33.14  ? 302 LEU B C   1 
ATOM   5044  O O   . LEU B 1 302 ? 21.666  54.667  216.727 1.00 36.69  ? 302 LEU B O   1 
ATOM   5045  C CB  . LEU B 1 302 ? 24.897  54.327  217.287 1.00 34.71  ? 302 LEU B CB  1 
ATOM   5046  C CG  . LEU B 1 302 ? 26.146  54.416  218.144 1.00 35.15  ? 302 LEU B CG  1 
ATOM   5047  C CD1 . LEU B 1 302 ? 27.163  53.349  217.756 1.00 36.16  ? 302 LEU B CD1 1 
ATOM   5048  C CD2 . LEU B 1 302 ? 26.713  55.821  217.975 1.00 38.38  ? 302 LEU B CD2 1 
ATOM   5049  N N   . PRO B 1 303 ? 22.957  56.372  215.974 1.00 26.64  ? 303 PRO B N   1 
ATOM   5050  C CA  . PRO B 1 303 ? 22.083  56.798  214.872 1.00 25.68  ? 303 PRO B CA  1 
ATOM   5051  C C   . PRO B 1 303 ? 22.242  55.916  213.654 1.00 27.64  ? 303 PRO B C   1 
ATOM   5052  O O   . PRO B 1 303 ? 23.308  55.302  213.439 1.00 29.65  ? 303 PRO B O   1 
ATOM   5053  C CB  . PRO B 1 303 ? 22.585  58.203  214.570 1.00 22.00  ? 303 PRO B CB  1 
ATOM   5054  C CG  . PRO B 1 303 ? 24.066  58.005  214.732 1.00 27.73  ? 303 PRO B CG  1 
ATOM   5055  C CD  . PRO B 1 303 ? 24.187  57.178  216.008 1.00 25.34  ? 303 PRO B CD  1 
ATOM   5056  N N   . ARG B 1 304 ? 21.251  55.982  212.777 1.00 28.42  ? 304 ARG B N   1 
ATOM   5057  C CA  . ARG B 1 304 ? 21.284  55.170  211.582 1.00 29.63  ? 304 ARG B CA  1 
ATOM   5058  C C   . ARG B 1 304 ? 20.992  55.910  210.272 1.00 27.56  ? 304 ARG B C   1 
ATOM   5059  O O   . ARG B 1 304 ? 20.004  56.648  210.168 1.00 27.53  ? 304 ARG B O   1 
ATOM   5060  C CB  . ARG B 1 304 ? 20.305  54.047  211.762 1.00 33.01  ? 304 ARG B CB  1 
ATOM   5061  C CG  . ARG B 1 304 ? 20.401  53.053  210.689 1.00 39.64  ? 304 ARG B CG  1 
ATOM   5062  C CD  . ARG B 1 304 ? 19.199  52.164  210.743 1.00 49.03  ? 304 ARG B CD  1 
ATOM   5063  N NE  . ARG B 1 304 ? 19.577  50.815  210.381 1.00 57.53  ? 304 ARG B NE  1 
ATOM   5064  C CZ  . ARG B 1 304 ? 19.930  49.895  211.262 1.00 62.83  ? 304 ARG B CZ  1 
ATOM   5065  N NH1 . ARG B 1 304 ? 19.927  50.174  212.561 1.00 66.00  ? 304 ARG B NH1 1 
ATOM   5066  N NH2 . ARG B 1 304 ? 20.414  48.745  210.828 1.00 70.41  ? 304 ARG B NH2 1 
ATOM   5067  N N   . TYR B 1 305 ? 21.851  55.681  209.280 1.00 24.17  ? 305 TYR B N   1 
ATOM   5068  C CA  . TYR B 1 305 ? 21.753  56.293  207.954 1.00 23.52  ? 305 TYR B CA  1 
ATOM   5069  C C   . TYR B 1 305 ? 20.807  55.538  207.091 1.00 22.63  ? 305 TYR B C   1 
ATOM   5070  O O   . TYR B 1 305 ? 20.628  54.354  207.278 1.00 23.46  ? 305 TYR B O   1 
ATOM   5071  C CB  . TYR B 1 305 ? 23.081  56.209  207.259 1.00 28.11  ? 305 TYR B CB  1 
ATOM   5072  C CG  . TYR B 1 305 ? 23.079  56.615  205.804 1.00 37.54  ? 305 TYR B CG  1 
ATOM   5073  C CD1 . TYR B 1 305 ? 23.421  57.901  205.458 1.00 47.95  ? 305 TYR B CD1 1 
ATOM   5074  C CD2 . TYR B 1 305 ? 22.961  55.679  204.773 1.00 44.36  ? 305 TYR B CD2 1 
ATOM   5075  C CE1 . TYR B 1 305 ? 23.688  58.269  204.136 1.00 57.80  ? 305 TYR B CE1 1 
ATOM   5076  C CE2 . TYR B 1 305 ? 23.226  56.041  203.429 1.00 51.68  ? 305 TYR B CE2 1 
ATOM   5077  C CZ  . TYR B 1 305 ? 23.610  57.352  203.129 1.00 55.91  ? 305 TYR B CZ  1 
ATOM   5078  O OH  . TYR B 1 305 ? 24.037  57.776  201.880 1.00 56.76  ? 305 TYR B OH  1 
ATOM   5079  N N   . PHE B 1 306 ? 20.327  56.176  206.042 1.00 21.82  ? 306 PHE B N   1 
ATOM   5080  C CA  . PHE B 1 306 ? 19.403  55.512  205.158 1.00 21.65  ? 306 PHE B CA  1 
ATOM   5081  C C   . PHE B 1 306 ? 19.523  56.011  203.752 1.00 22.48  ? 306 PHE B C   1 
ATOM   5082  O O   . PHE B 1 306 ? 19.512  57.208  203.531 1.00 25.81  ? 306 PHE B O   1 
ATOM   5083  C CB  . PHE B 1 306 ? 18.007  55.789  205.639 1.00 21.23  ? 306 PHE B CB  1 
ATOM   5084  C CG  . PHE B 1 306 ? 17.631  55.006  206.826 1.00 24.53  ? 306 PHE B CG  1 
ATOM   5085  C CD1 . PHE B 1 306 ? 18.040  55.406  208.087 1.00 27.56  ? 306 PHE B CD1 1 
ATOM   5086  C CD2 . PHE B 1 306 ? 16.848  53.861  206.689 1.00 25.36  ? 306 PHE B CD2 1 
ATOM   5087  C CE1 . PHE B 1 306 ? 17.677  54.678  209.203 1.00 32.16  ? 306 PHE B CE1 1 
ATOM   5088  C CE2 . PHE B 1 306 ? 16.467  53.118  207.791 1.00 28.79  ? 306 PHE B CE2 1 
ATOM   5089  C CZ  . PHE B 1 306 ? 16.881  53.522  209.057 1.00 32.41  ? 306 PHE B CZ  1 
ATOM   5090  N N   . LYS B 1 307 ? 19.616  55.112  202.793 1.00 22.37  ? 307 LYS B N   1 
ATOM   5091  C CA  . LYS B 1 307 ? 19.701  55.559  201.425 1.00 24.61  ? 307 LYS B CA  1 
ATOM   5092  C C   . LYS B 1 307 ? 18.701  54.759  200.640 1.00 25.97  ? 307 LYS B C   1 
ATOM   5093  O O   . LYS B 1 307 ? 18.960  53.642  200.133 1.00 24.50  ? 307 LYS B O   1 
ATOM   5094  C CB  . LYS B 1 307 ? 21.090  55.387  200.869 1.00 31.78  ? 307 LYS B CB  1 
ATOM   5095  C CG  . LYS B 1 307 ? 21.268  56.045  199.511 1.00 43.58  ? 307 LYS B CG  1 
ATOM   5096  C CD  . LYS B 1 307 ? 22.582  55.573  198.824 1.00 57.06  ? 307 LYS B CD  1 
ATOM   5097  C CE  . LYS B 1 307 ? 23.011  56.449  197.616 1.00 59.50  ? 307 LYS B CE  1 
ATOM   5098  N NZ  . LYS B 1 307 ? 24.341  56.126  196.974 1.00 60.69  ? 307 LYS B NZ  1 
ATOM   5099  N N   . ILE B 1 308 ? 17.531  55.355  200.549 1.00 26.19  ? 308 ILE B N   1 
ATOM   5100  C CA  . ILE B 1 308 ? 16.452  54.708  199.865 1.00 28.48  ? 308 ILE B CA  1 
ATOM   5101  C C   . ILE B 1 308 ? 16.390  55.115  198.429 1.00 31.47  ? 308 ILE B C   1 
ATOM   5102  O O   . ILE B 1 308 ? 16.383  56.309  198.084 1.00 27.82  ? 308 ILE B O   1 
ATOM   5103  C CB  . ILE B 1 308 ? 15.108  54.981  200.505 1.00 30.58  ? 308 ILE B CB  1 
ATOM   5104  C CG1 . ILE B 1 308 ? 15.153  54.568  201.969 1.00 31.55  ? 308 ILE B CG1 1 
ATOM   5105  C CG2 . ILE B 1 308 ? 14.016  54.187  199.773 1.00 31.13  ? 308 ILE B CG2 1 
ATOM   5106  C CD1 . ILE B 1 308 ? 16.096  55.403  202.800 1.00 38.27  ? 308 ILE B CD1 1 
ATOM   5107  N N   . THR B 1 309 ? 16.304  54.078  197.611 1.00 35.42  ? 309 THR B N   1 
ATOM   5108  C CA  . THR B 1 309 ? 16.241  54.178  196.172 1.00 38.18  ? 309 THR B CA  1 
ATOM   5109  C C   . THR B 1 309 ? 14.840  53.705  195.772 1.00 37.92  ? 309 THR B C   1 
ATOM   5110  O O   . THR B 1 309 ? 14.468  52.543  196.019 1.00 37.70  ? 309 THR B O   1 
ATOM   5111  C CB  . THR B 1 309 ? 17.352  53.277  195.555 1.00 42.82  ? 309 THR B CB  1 
ATOM   5112  O OG1 . THR B 1 309 ? 18.179  52.705  196.605 1.00 50.28  ? 309 THR B OG1 1 
ATOM   5113  C CG2 . THR B 1 309 ? 18.238  54.114  194.646 1.00 45.46  ? 309 THR B CG2 1 
ATOM   5114  N N   . LEU B 1 310 ? 14.028  54.627  195.262 1.00 36.52  ? 310 LEU B N   1 
ATOM   5115  C CA  . LEU B 1 310 ? 12.666  54.282  194.854 1.00 33.21  ? 310 LEU B CA  1 
ATOM   5116  C C   . LEU B 1 310 ? 12.346  54.863  193.524 1.00 31.99  ? 310 LEU B C   1 
ATOM   5117  O O   . LEU B 1 310 ? 12.792  55.970  193.195 1.00 24.86  ? 310 LEU B O   1 
ATOM   5118  C CB  . LEU B 1 310 ? 11.623  54.717  195.862 1.00 32.46  ? 310 LEU B CB  1 
ATOM   5119  C CG  . LEU B 1 310 ? 12.198  55.677  196.865 1.00 38.79  ? 310 LEU B CG  1 
ATOM   5120  C CD1 . LEU B 1 310 ? 12.554  56.943  196.146 1.00 41.84  ? 310 LEU B CD1 1 
ATOM   5121  C CD2 . LEU B 1 310 ? 11.188  55.928  197.931 1.00 44.97  ? 310 LEU B CD2 1 
ATOM   5122  N N   . ARG B 1 311 ? 11.581  54.072  192.775 1.00 35.61  ? 311 ARG B N   1 
ATOM   5123  C CA  . ARG B 1 311 ? 11.173  54.371  191.412 1.00 42.45  ? 311 ARG B CA  1 
ATOM   5124  C C   . ARG B 1 311 ? 9.695   54.557  191.314 1.00 42.00  ? 311 ARG B C   1 
ATOM   5125  O O   . ARG B 1 311 ? 8.936   54.324  192.267 1.00 39.91  ? 311 ARG B O   1 
ATOM   5126  C CB  . ARG B 1 311 ? 11.508  53.204  190.513 1.00 49.14  ? 311 ARG B CB  1 
ATOM   5127  C CG  . ARG B 1 311 ? 10.853  51.922  191.022 1.00 64.93  ? 311 ARG B CG  1 
ATOM   5128  C CD  . ARG B 1 311 ? 11.272  50.670  190.242 1.00 78.88  ? 311 ARG B CD  1 
ATOM   5129  N NE  . ARG B 1 311 ? 10.555  49.476  190.705 1.00 88.57  ? 311 ARG B NE  1 
ATOM   5130  C CZ  . ARG B 1 311 ? 10.928  48.217  190.471 1.00 92.28  ? 311 ARG B CZ  1 
ATOM   5131  N NH1 . ARG B 1 311 ? 12.034  47.953  189.770 1.00 94.68  ? 311 ARG B NH1 1 
ATOM   5132  N NH2 . ARG B 1 311 ? 10.196  47.220  190.961 1.00 92.09  ? 311 ARG B NH2 1 
ATOM   5133  N N   . LYS B 1 312 ? 9.285   54.846  190.094 1.00 42.86  ? 312 LYS B N   1 
ATOM   5134  C CA  . LYS B 1 312 ? 7.898   55.071  189.833 1.00 46.86  ? 312 LYS B CA  1 
ATOM   5135  C C   . LYS B 1 312 ? 7.233   53.815  189.303 1.00 47.90  ? 312 LYS B C   1 
ATOM   5136  O O   . LYS B 1 312 ? 7.581   53.341  188.198 1.00 48.18  ? 312 LYS B O   1 
ATOM   5137  C CB  . LYS B 1 312 ? 7.779   56.166  188.798 1.00 52.74  ? 312 LYS B CB  1 
ATOM   5138  C CG  . LYS B 1 312 ? 8.413   57.469  189.190 1.00 59.50  ? 312 LYS B CG  1 
ATOM   5139  C CD  . LYS B 1 312 ? 7.885   58.574  188.283 1.00 68.71  ? 312 LYS B CD  1 
ATOM   5140  C CE  . LYS B 1 312 ? 8.258   59.976  188.774 1.00 75.53  ? 312 LYS B CE  1 
ATOM   5141  N NZ  . LYS B 1 312 ? 7.512   61.096  188.079 1.00 81.63  ? 312 LYS B NZ  1 
ATOM   5142  N N   . ARG B 1 313 ? 6.315   53.232  190.075 1.00 47.22  ? 313 ARG B N   1 
ATOM   5143  C CA  . ARG B 1 313 ? 5.651   52.064  189.528 1.00 49.65  ? 313 ARG B CA  1 
ATOM   5144  C C   . ARG B 1 313 ? 4.194   52.164  189.271 1.00 49.01  ? 313 ARG B C   1 
ATOM   5145  O O   . ARG B 1 313 ? 3.399   52.523  190.127 1.00 44.44  ? 313 ARG B O   1 
ATOM   5146  C CB  . ARG B 1 313 ? 5.879   50.756  190.265 1.00 53.22  ? 313 ARG B CB  1 
ATOM   5147  C CG  . ARG B 1 313 ? 5.433   49.596  189.335 1.00 59.48  ? 313 ARG B CG  1 
ATOM   5148  C CD  . ARG B 1 313 ? 4.908   48.404  190.068 1.00 60.39  ? 313 ARG B CD  1 
ATOM   5149  N NE  . ARG B 1 313 ? 5.942   47.860  190.931 1.00 59.86  ? 313 ARG B NE  1 
ATOM   5150  C CZ  . ARG B 1 313 ? 6.617   46.746  190.686 1.00 58.53  ? 313 ARG B CZ  1 
ATOM   5151  N NH1 . ARG B 1 313 ? 6.374   46.020  189.593 1.00 59.25  ? 313 ARG B NH1 1 
ATOM   5152  N NH2 . ARG B 1 313 ? 7.566   46.389  191.528 1.00 53.70  ? 313 ARG B NH2 1 
ATOM   5153  N N   . TRP B 1 314 ? 3.872   51.714  188.077 1.00 51.01  ? 314 TRP B N   1 
ATOM   5154  C CA  . TRP B 1 314 ? 2.541   51.662  187.577 1.00 52.28  ? 314 TRP B CA  1 
ATOM   5155  C C   . TRP B 1 314 ? 1.850   50.490  188.171 1.00 47.89  ? 314 TRP B C   1 
ATOM   5156  O O   . TRP B 1 314 ? 2.328   49.362  188.043 1.00 50.90  ? 314 TRP B O   1 
ATOM   5157  C CB  . TRP B 1 314 ? 2.640   51.483  186.101 1.00 62.39  ? 314 TRP B CB  1 
ATOM   5158  C CG  . TRP B 1 314 ? 2.626   52.759  185.491 1.00 76.65  ? 314 TRP B CG  1 
ATOM   5159  C CD1 . TRP B 1 314 ? 3.568   53.300  184.683 1.00 83.92  ? 314 TRP B CD1 1 
ATOM   5160  C CD2 . TRP B 1 314 ? 1.590   53.716  185.618 1.00 81.98  ? 314 TRP B CD2 1 
ATOM   5161  N NE1 . TRP B 1 314 ? 3.173   54.551  184.284 1.00 89.23  ? 314 TRP B NE1 1 
ATOM   5162  C CE2 . TRP B 1 314 ? 1.958   54.828  184.848 1.00 86.14  ? 314 TRP B CE2 1 
ATOM   5163  C CE3 . TRP B 1 314 ? 0.377   53.739  186.311 1.00 86.09  ? 314 TRP B CE3 1 
ATOM   5164  C CZ2 . TRP B 1 314 ? 1.156   55.957  184.748 1.00 91.92  ? 314 TRP B CZ2 1 
ATOM   5165  C CZ3 . TRP B 1 314 ? -0.419  54.855  186.213 1.00 88.81  ? 314 TRP B CZ3 1 
ATOM   5166  C CH2 . TRP B 1 314 ? -0.030  55.951  185.438 1.00 92.73  ? 314 TRP B CH2 1 
ATOM   5167  N N   . VAL B 1 315 ? 0.715   50.744  188.792 1.00 42.35  ? 315 VAL B N   1 
ATOM   5168  C CA  . VAL B 1 315 ? -0.021  49.685  189.430 1.00 43.39  ? 315 VAL B CA  1 
ATOM   5169  C C   . VAL B 1 315 ? -1.469  49.792  189.139 1.00 49.36  ? 315 VAL B C   1 
ATOM   5170  O O   . VAL B 1 315 ? -1.985  50.870  188.859 1.00 52.77  ? 315 VAL B O   1 
ATOM   5171  C CB  . VAL B 1 315 ? 0.167   49.674  190.959 1.00 39.13  ? 315 VAL B CB  1 
ATOM   5172  C CG1 . VAL B 1 315 ? 1.560   50.073  191.285 1.00 41.49  ? 315 VAL B CG1 1 
ATOM   5173  C CG2 . VAL B 1 315 ? -0.816  50.564  191.663 1.00 29.00  ? 315 VAL B CG2 1 
ATOM   5174  N N   . LYS B 1 316 ? -2.117  48.643  189.187 1.00 56.13  ? 316 LYS B N   1 
ATOM   5175  C CA  . LYS B 1 316 ? -3.534  48.546  188.956 1.00 60.16  ? 316 LYS B CA  1 
ATOM   5176  C C   . LYS B 1 316 ? -4.195  49.206  190.131 1.00 59.31  ? 316 LYS B C   1 
ATOM   5177  O O   . LYS B 1 316 ? -3.882  48.898  191.276 1.00 55.19  ? 316 LYS B O   1 
ATOM   5178  C CB  . LYS B 1 316 ? -3.955  47.083  188.937 1.00 72.03  ? 316 LYS B CB  1 
ATOM   5179  C CG  . LYS B 1 316 ? -4.929  46.760  187.844 1.00 87.01  ? 316 LYS B CG  1 
ATOM   5180  C CD  . LYS B 1 316 ? -6.059  47.778  187.787 1.00 100.00 ? 316 LYS B CD  1 
ATOM   5181  C CE  . LYS B 1 316 ? -6.544  48.000  186.341 1.00 110.00 ? 316 LYS B CE  1 
ATOM   5182  N NZ  . LYS B 1 316 ? -5.642  48.873  185.486 1.00 117.48 ? 316 LYS B NZ  1 
ATOM   5183  N N   . ASN B 1 317 ? -5.086  50.139  189.871 1.00 61.39  ? 317 ASN B N   1 
ATOM   5184  C CA  . ASN B 1 317 ? -5.743  50.743  190.991 1.00 70.02  ? 317 ASN B CA  1 
ATOM   5185  C C   . ASN B 1 317 ? -6.526  49.634  191.663 1.00 73.43  ? 317 ASN B C   1 
ATOM   5186  O O   . ASN B 1 317 ? -7.033  48.731  191.010 1.00 73.91  ? 317 ASN B O   1 
ATOM   5187  C CB  . ASN B 1 317 ? -6.674  51.856  190.564 1.00 77.45  ? 317 ASN B CB  1 
ATOM   5188  C CG  . ASN B 1 317 ? -7.634  52.244  191.669 1.00 85.85  ? 317 ASN B CG  1 
ATOM   5189  O OD1 . ASN B 1 317 ? -7.228  52.762  192.716 1.00 89.71  ? 317 ASN B OD1 1 
ATOM   5190  N ND2 . ASN B 1 317 ? -8.904  51.939  191.474 1.00 93.52  ? 317 ASN B ND2 1 
ATOM   5191  N N   . PRO B 1 318 ? -6.541  49.629  192.991 1.00 78.01  ? 318 PRO B N   1 
ATOM   5192  C CA  . PRO B 1 318 ? -7.259  48.615  193.751 1.00 81.54  ? 318 PRO B CA  1 
ATOM   5193  C C   . PRO B 1 318 ? -8.761  48.805  193.714 1.00 86.28  ? 318 PRO B C   1 
ATOM   5194  O O   . PRO B 1 318 ? -9.448  48.191  192.915 1.00 87.42  ? 318 PRO B O   1 
ATOM   5195  C CB  . PRO B 1 318 ? -6.731  48.829  195.155 1.00 81.52  ? 318 PRO B CB  1 
ATOM   5196  C CG  . PRO B 1 318 ? -6.484  50.331  195.187 1.00 81.04  ? 318 PRO B CG  1 
ATOM   5197  C CD  . PRO B 1 318 ? -5.788  50.525  193.883 1.00 81.08  ? 318 PRO B CD  1 
ATOM   5198  N N   . TYR B 1 319 ? -9.247  49.722  194.535 1.00 92.16  ? 319 TYR B N   1 
ATOM   5199  C CA  . TYR B 1 319 ? -10.667 49.997  194.693 1.00 100.44 ? 319 TYR B CA  1 
ATOM   5200  C C   . TYR B 1 319 ? -11.284 50.845  193.589 1.00 106.88 ? 319 TYR B C   1 
ATOM   5201  O O   . TYR B 1 319 ? -10.849 51.969  193.347 1.00 109.64 ? 319 TYR B O   1 
ATOM   5202  C CB  . TYR B 1 319 ? -10.845 50.646  196.052 1.00 100.79 ? 319 TYR B CB  1 
ATOM   5203  C CG  . TYR B 1 319 ? -9.886  50.024  197.018 1.00 98.36  ? 319 TYR B CG  1 
ATOM   5204  C CD1 . TYR B 1 319 ? -9.960  48.667  197.285 1.00 98.01  ? 319 TYR B CD1 1 
ATOM   5205  C CD2 . TYR B 1 319 ? -8.828  50.747  197.558 1.00 98.80  ? 319 TYR B CD2 1 
ATOM   5206  C CE1 . TYR B 1 319 ? -9.013  48.034  198.043 1.00 97.36  ? 319 TYR B CE1 1 
ATOM   5207  C CE2 . TYR B 1 319 ? -7.865  50.121  198.328 1.00 97.96  ? 319 TYR B CE2 1 
ATOM   5208  C CZ  . TYR B 1 319 ? -7.969  48.755  198.559 1.00 97.50  ? 319 TYR B CZ  1 
ATOM   5209  O OH  . TYR B 1 319 ? -7.021  48.066  199.268 1.00 96.41  ? 319 TYR B OH  1 
ATOM   5210  N N   . PRO B 1 320 ? -12.380 50.351  192.983 1.00 110.89 ? 320 PRO B N   1 
ATOM   5211  C CA  . PRO B 1 320 ? -13.169 50.945  191.887 1.00 111.73 ? 320 PRO B CA  1 
ATOM   5212  C C   . PRO B 1 320 ? -13.631 52.380  192.099 1.00 112.28 ? 320 PRO B C   1 
ATOM   5213  O O   . PRO B 1 320 ? -14.267 52.694  193.106 1.00 109.45 ? 320 PRO B O   1 
ATOM   5214  C CB  . PRO B 1 320 ? -14.373 50.012  191.789 1.00 113.29 ? 320 PRO B CB  1 
ATOM   5215  C CG  . PRO B 1 320 ? -13.835 48.699  192.308 1.00 115.21 ? 320 PRO B CG  1 
ATOM   5216  C CD  . PRO B 1 320 ? -13.036 49.136  193.497 1.00 111.27 ? 320 PRO B CD  1 
ATOM   5217  N N   . MET B 1 321 ? -13.412 53.214  191.087 1.00 113.90 ? 321 MET B N   1 
ATOM   5218  C CA  . MET B 1 321 ? -13.799 54.619  191.152 1.00 116.64 ? 321 MET B CA  1 
ATOM   5219  C C   . MET B 1 321 ? -15.129 54.875  191.779 1.00 115.17 ? 321 MET B C   1 
ATOM   5220  O O   . MET B 1 321 ? -15.217 55.518  192.822 1.00 112.05 ? 321 MET B O   1 
ATOM   5221  C CB  . MET B 1 321 ? -13.765 55.262  189.775 1.00 121.97 ? 321 MET B CB  1 
ATOM   5222  C CG  . MET B 1 321 ? -12.401 55.795  189.523 1.00 132.70 ? 321 MET B CG  1 
ATOM   5223  S SD  . MET B 1 321 ? -11.616 56.037  191.175 1.00 140.00 ? 321 MET B SD  1 
ATOM   5224  C CE  . MET B 1 321 ? -11.657 57.864  191.340 1.00 140.79 ? 321 MET B CE  1 
ATOM   5225  N N   . ALA B 1 322 ? -16.158 54.370  191.110 1.00 115.76 ? 322 ALA B N   1 
ATOM   5226  C CA  . ALA B 1 322 ? -17.540 54.489  191.548 1.00 114.94 ? 322 ALA B CA  1 
ATOM   5227  C C   . ALA B 1 322 ? -17.616 54.476  193.036 1.00 113.13 ? 322 ALA B C   1 
ATOM   5228  O O   . ALA B 1 322 ? -18.048 55.449  193.649 1.00 113.37 ? 322 ALA B O   1 
ATOM   5229  C CB  . ALA B 1 322 ? -18.333 53.344  191.035 1.00 117.05 ? 322 ALA B CB  1 
ATOM   5230  N N   . SER B 1 323 ? -17.182 53.353  193.595 1.00 110.54 ? 323 SER B N   1 
ATOM   5231  C CA  . SER B 1 323 ? -17.184 53.159  195.016 1.00 110.87 ? 323 SER B CA  1 
ATOM   5232  C C   . SER B 1 323 ? -16.847 54.496  195.648 1.00 108.11 ? 323 SER B C   1 
ATOM   5233  O O   . SER B 1 323 ? -17.740 55.186  196.075 1.00 106.32 ? 323 SER B O   1 
ATOM   5234  C CB  . SER B 1 323 ? -16.158 52.091  195.396 1.00 116.51 ? 323 SER B CB  1 
ATOM   5235  O OG  . SER B 1 323 ? -16.320 51.664  196.743 1.00 122.52 ? 323 SER B OG  1 
ATOM   5236  N N   . LEU B 1 324 ? -15.623 54.963  195.470 1.00 106.01 ? 324 LEU B N   1 
ATOM   5237  C CA  . LEU B 1 324 ? -15.203 56.223  196.070 1.00 105.54 ? 324 LEU B CA  1 
ATOM   5238  C C   . LEU B 1 324 ? -16.054 57.401  195.646 1.00 103.16 ? 324 LEU B C   1 
ATOM   5239  O O   . LEU B 1 324 ? -16.608 58.107  196.481 1.00 101.38 ? 324 LEU B O   1 
ATOM   5240  C CB  . LEU B 1 324 ? -13.753 56.517  195.719 1.00 112.61 ? 324 LEU B CB  1 
ATOM   5241  C CG  . LEU B 1 324 ? -12.690 55.440  195.960 1.00 116.82 ? 324 LEU B CG  1 
ATOM   5242  C CD1 . LEU B 1 324 ? -12.955 54.757  197.306 1.00 119.38 ? 324 LEU B CD1 1 
ATOM   5243  C CD2 . LEU B 1 324 ? -12.655 54.434  194.802 1.00 116.54 ? 324 LEU B CD2 1 
ATOM   5244  N N   . ILE B 1 325 ? -16.131 57.619  194.342 1.00 101.14 ? 325 ILE B N   1 
ATOM   5245  C CA  . ILE B 1 325 ? -16.908 58.707  193.787 1.00 99.98  ? 325 ILE B CA  1 
ATOM   5246  C C   . ILE B 1 325 ? -18.257 58.716  194.488 1.00 101.86 ? 325 ILE B C   1 
ATOM   5247  O O   . ILE B 1 325 ? -18.493 59.493  195.417 1.00 98.52  ? 325 ILE B O   1 
ATOM   5248  C CB  . ILE B 1 325 ? -17.172 58.473  192.282 1.00 99.33  ? 325 ILE B CB  1 
ATOM   5249  C CG1 . ILE B 1 325 ? -15.862 58.210  191.524 1.00 97.19  ? 325 ILE B CG1 1 
ATOM   5250  C CG2 . ILE B 1 325 ? -17.990 59.624  191.702 1.00 98.33  ? 325 ILE B CG2 1 
ATOM   5251  C CD1 . ILE B 1 325 ? -14.939 59.386  191.426 1.00 96.14  ? 325 ILE B CD1 1 
ATOM   5252  N N   . SER B 1 326 ? -19.081 57.746  194.102 1.00 105.78 ? 326 SER B N   1 
ATOM   5253  C CA  . SER B 1 326 ? -20.434 57.582  194.609 1.00 109.84 ? 326 SER B CA  1 
ATOM   5254  C C   . SER B 1 326 ? -20.599 57.060  196.040 1.00 110.71 ? 326 SER B C   1 
ATOM   5255  O O   . SER B 1 326 ? -21.717 57.030  196.539 1.00 112.42 ? 326 SER B O   1 
ATOM   5256  C CB  . SER B 1 326 ? -21.269 56.754  193.614 1.00 111.80 ? 326 SER B CB  1 
ATOM   5257  O OG  . SER B 1 326 ? -21.206 57.305  192.295 1.00 115.34 ? 326 SER B OG  1 
ATOM   5258  N N   . SER B 1 327 ? -19.518 56.645  196.701 1.00 113.04 ? 327 SER B N   1 
ATOM   5259  C CA  . SER B 1 327 ? -19.621 56.184  198.102 1.00 115.41 ? 327 SER B CA  1 
ATOM   5260  C C   . SER B 1 327 ? -19.747 57.483  198.852 1.00 114.55 ? 327 SER B C   1 
ATOM   5261  O O   . SER B 1 327 ? -20.452 57.602  199.864 1.00 113.29 ? 327 SER B O   1 
ATOM   5262  C CB  . SER B 1 327 ? -18.349 55.468  198.604 1.00 119.08 ? 327 SER B CB  1 
ATOM   5263  O OG  . SER B 1 327 ? -17.195 56.311  198.601 1.00 122.07 ? 327 SER B OG  1 
ATOM   5264  N N   . LEU B 1 328 ? -19.012 58.454  198.336 1.00 113.54 ? 328 LEU B N   1 
ATOM   5265  C CA  . LEU B 1 328 ? -19.018 59.763  198.891 1.00 113.54 ? 328 LEU B CA  1 
ATOM   5266  C C   . LEU B 1 328 ? -20.409 60.352  198.684 1.00 114.41 ? 328 LEU B C   1 
ATOM   5267  O O   . LEU B 1 328 ? -21.144 60.476  199.653 1.00 112.93 ? 328 LEU B O   1 
ATOM   5268  C CB  . LEU B 1 328 ? -17.891 60.596  198.277 1.00 114.01 ? 328 LEU B CB  1 
ATOM   5269  C CG  . LEU B 1 328 ? -16.572 60.465  199.061 1.00 116.56 ? 328 LEU B CG  1 
ATOM   5270  C CD1 . LEU B 1 328 ? -16.844 60.913  200.488 1.00 118.76 ? 328 LEU B CD1 1 
ATOM   5271  C CD2 . LEU B 1 328 ? -16.000 59.036  199.088 1.00 116.99 ? 328 LEU B CD2 1 
ATOM   5272  N N   . PHE B 1 329 ? -20.842 60.552  197.438 1.00 116.18 ? 329 PHE B N   1 
ATOM   5273  C CA  . PHE B 1 329 ? -22.169 61.150  197.156 1.00 118.96 ? 329 PHE B CA  1 
ATOM   5274  C C   . PHE B 1 329 ? -23.409 60.533  197.809 1.00 120.21 ? 329 PHE B C   1 
ATOM   5275  O O   . PHE B 1 329 ? -24.525 61.047  197.656 1.00 119.21 ? 329 PHE B O   1 
ATOM   5276  C CB  . PHE B 1 329 ? -22.407 61.259  195.656 1.00 120.41 ? 329 PHE B CB  1 
ATOM   5277  C CG  . PHE B 1 329 ? -21.506 62.241  194.974 1.00 126.17 ? 329 PHE B CG  1 
ATOM   5278  C CD1 . PHE B 1 329 ? -21.551 63.590  195.310 1.00 128.26 ? 329 PHE B CD1 1 
ATOM   5279  C CD2 . PHE B 1 329 ? -20.621 61.821  193.978 1.00 128.44 ? 329 PHE B CD2 1 
ATOM   5280  C CE1 . PHE B 1 329 ? -20.723 64.515  194.656 1.00 131.12 ? 329 PHE B CE1 1 
ATOM   5281  C CE2 . PHE B 1 329 ? -19.793 62.734  193.319 1.00 130.78 ? 329 PHE B CE2 1 
ATOM   5282  C CZ  . PHE B 1 329 ? -19.844 64.086  193.659 1.00 131.98 ? 329 PHE B CZ  1 
ATOM   5283  N N   . ASN B 1 330 ? -23.208 59.425  198.510 1.00 124.15 ? 330 ASN B N   1 
ATOM   5284  C CA  . ASN B 1 330 ? -24.280 58.734  199.206 1.00 128.86 ? 330 ASN B CA  1 
ATOM   5285  C C   . ASN B 1 330 ? -24.140 59.031  200.697 1.00 131.32 ? 330 ASN B C   1 
ATOM   5286  O O   . ASN B 1 330 ? -25.077 58.820  201.478 1.00 132.54 ? 330 ASN B O   1 
ATOM   5287  C CB  . ASN B 1 330 ? -24.209 57.228  198.923 1.00 133.05 ? 330 ASN B CB  1 
ATOM   5288  C CG  . ASN B 1 330 ? -24.670 56.866  197.497 1.00 137.02 ? 330 ASN B CG  1 
ATOM   5289  O OD1 . ASN B 1 330 ? -24.309 57.524  196.507 1.00 138.46 ? 330 ASN B OD1 1 
ATOM   5290  N ND2 . ASN B 1 330 ? -25.481 55.814  197.398 1.00 138.04 ? 330 ASN B ND2 1 
ATOM   5291  N N   . ASN B 1 331 ? -22.936 59.467  201.071 1.00 134.41 ? 331 ASN B N   1 
ATOM   5292  C CA  . ASN B 1 331 ? -22.560 59.874  202.436 1.00 139.27 ? 331 ASN B CA  1 
ATOM   5293  C C   . ASN B 1 331 ? -22.882 61.356  202.632 1.00 141.46 ? 331 ASN B C   1 
ATOM   5294  O O   . ASN B 1 331 ? -22.730 61.922  203.728 1.00 139.87 ? 331 ASN B O   1 
ATOM   5295  C CB  . ASN B 1 331 ? -21.059 59.684  202.650 1.00 141.08 ? 331 ASN B CB  1 
ATOM   5296  C CG  . ASN B 1 331 ? -20.749 58.504  203.529 1.00 143.22 ? 331 ASN B CG  1 
ATOM   5297  O OD1 . ASN B 1 331 ? -20.651 58.639  204.751 1.00 144.98 ? 331 ASN B OD1 1 
ATOM   5298  N ND2 . ASN B 1 331 ? -20.601 57.329  202.917 1.00 144.89 ? 331 ASN B ND2 1 
ATOM   5299  N N   . MET B 1 332 ? -23.227 61.987  201.514 1.00 145.29 ? 332 MET B N   1 
ATOM   5300  C CA  . MET B 1 332 ? -23.589 63.394  201.463 1.00 149.61 ? 332 MET B CA  1 
ATOM   5301  C C   . MET B 1 332 ? -25.035 63.536  201.881 1.00 146.33 ? 332 MET B C   1 
ATOM   5302  O O   . MET B 1 332 ? -25.429 64.526  202.503 1.00 147.43 ? 332 MET B O   1 
ATOM   5303  C CB  . MET B 1 332 ? -23.465 63.914  200.025 1.00 160.99 ? 332 MET B CB  1 
ATOM   5304  C CG  . MET B 1 332 ? -22.058 64.277  199.572 1.00 177.05 ? 332 MET B CG  1 
ATOM   5305  S SD  . MET B 1 332 ? -20.839 62.950  199.753 1.00 195.65 ? 332 MET B SD  1 
ATOM   5306  C CE  . MET B 1 332 ? -19.623 63.703  200.933 1.00 195.02 ? 332 MET B CE  1 
ATOM   5307  N N   . LEU B 1 333 ? -25.829 62.545  201.499 1.00 142.35 ? 333 LEU B N   1 
ATOM   5308  C CA  . LEU B 1 333 ? -27.245 62.560  201.787 1.00 138.59 ? 333 LEU B CA  1 
ATOM   5309  C C   . LEU B 1 333 ? -27.651 62.616  203.267 1.00 133.93 ? 333 LEU B C   1 
ATOM   5310  O O   . LEU B 1 333 ? -26.919 62.169  204.163 1.00 131.98 ? 333 LEU B O   1 
ATOM   5311  C CB  . LEU B 1 333 ? -27.958 61.441  201.014 1.00 142.74 ? 333 LEU B CB  1 
ATOM   5312  C CG  . LEU B 1 333 ? -28.095 61.619  199.483 1.00 146.16 ? 333 LEU B CG  1 
ATOM   5313  C CD1 . LEU B 1 333 ? -29.457 61.055  199.046 1.00 150.19 ? 333 LEU B CD1 1 
ATOM   5314  C CD2 . LEU B 1 333 ? -28.002 63.090  199.047 1.00 149.92 ? 333 LEU B CD2 1 
ATOM   5315  N N   . PRO B 1 334 ? -28.836 63.194  203.531 1.00 130.72 ? 334 PRO B N   1 
ATOM   5316  C CA  . PRO B 1 334 ? -29.390 63.350  204.873 1.00 126.49 ? 334 PRO B CA  1 
ATOM   5317  C C   . PRO B 1 334 ? -29.333 62.039  205.568 1.00 121.69 ? 334 PRO B C   1 
ATOM   5318  O O   . PRO B 1 334 ? -29.637 60.990  204.981 1.00 119.98 ? 334 PRO B O   1 
ATOM   5319  C CB  . PRO B 1 334 ? -30.845 63.719  204.607 1.00 128.68 ? 334 PRO B CB  1 
ATOM   5320  C CG  . PRO B 1 334 ? -30.796 64.385  203.273 1.00 131.54 ? 334 PRO B CG  1 
ATOM   5321  C CD  . PRO B 1 334 ? -29.860 63.508  202.516 1.00 131.58 ? 334 PRO B CD  1 
ATOM   5322  N N   . GLN B 1 335 ? -28.912 62.076  206.814 1.00 117.55 ? 335 GLN B N   1 
ATOM   5323  C CA  . GLN B 1 335 ? -28.867 60.831  207.510 1.00 113.93 ? 335 GLN B CA  1 
ATOM   5324  C C   . GLN B 1 335 ? -30.200 60.413  208.077 1.00 104.63 ? 335 GLN B C   1 
ATOM   5325  O O   . GLN B 1 335 ? -30.928 61.178  208.719 1.00 103.12 ? 335 GLN B O   1 
ATOM   5326  C CB  . GLN B 1 335 ? -27.686 60.734  208.477 1.00 121.46 ? 335 GLN B CB  1 
ATOM   5327  C CG  . GLN B 1 335 ? -26.422 60.234  207.744 1.00 130.11 ? 335 GLN B CG  1 
ATOM   5328  C CD  . GLN B 1 335 ? -26.750 59.158  206.679 1.00 135.45 ? 335 GLN B CD  1 
ATOM   5329  O OE1 . GLN B 1 335 ? -27.100 58.017  207.013 1.00 136.72 ? 335 GLN B OE1 1 
ATOM   5330  N NE2 . GLN B 1 335 ? -26.696 59.545  205.401 1.00 137.47 ? 335 GLN B NE2 1 
ATOM   5331  N N   . VAL B 1 336 ? -30.566 59.225  207.639 1.00 95.43  ? 336 VAL B N   1 
ATOM   5332  C CA  . VAL B 1 336 ? -31.796 58.606  208.011 1.00 87.14  ? 336 VAL B CA  1 
ATOM   5333  C C   . VAL B 1 336 ? -31.484 57.187  208.414 1.00 86.98  ? 336 VAL B C   1 
ATOM   5334  O O   . VAL B 1 336 ? -32.192 56.588  209.212 1.00 83.35  ? 336 VAL B O   1 
ATOM   5335  C CB  . VAL B 1 336 ? -32.779 58.623  206.856 1.00 83.53  ? 336 VAL B CB  1 
ATOM   5336  C CG1 . VAL B 1 336 ? -33.838 59.619  207.126 1.00 81.20  ? 336 VAL B CG1 1 
ATOM   5337  C CG2 . VAL B 1 336 ? -32.066 58.965  205.538 1.00 83.05  ? 336 VAL B CG2 1 
ATOM   5338  N N   . GLN B 1 337 ? -32.784 59.363  210.296 1.00 102.80 ? 337 GLN B N   1 
ATOM   5339  C CA  . GLN B 1 337 ? -32.892 58.152  211.076 1.00 106.04 ? 337 GLN B CA  1 
ATOM   5340  C C   . GLN B 1 337 ? -34.318 57.571  210.976 1.00 98.82  ? 337 GLN B C   1 
ATOM   5341  O O   . GLN B 1 337 ? -35.296 58.293  211.169 1.00 100.36 ? 337 GLN B O   1 
ATOM   5342  C CB  . GLN B 1 337 ? -32.440 58.448  212.502 1.00 121.97 ? 337 GLN B CB  1 
ATOM   5343  C CG  . GLN B 1 337 ? -32.736 57.355  213.502 1.00 146.80 ? 337 GLN B CG  1 
ATOM   5344  C CD  . GLN B 1 337 ? -33.899 57.716  214.429 1.00 160.09 ? 337 GLN B CD  1 
ATOM   5345  O OE1 . GLN B 1 337 ? -33.821 58.694  215.189 1.00 168.26 ? 337 GLN B OE1 1 
ATOM   5346  N NE2 . GLN B 1 337 ? -34.980 56.926  214.374 1.00 168.19 ? 337 GLN B NE2 1 
ATOM   5347  N N   . GLY B 1 338 ? -34.443 56.281  210.656 1.00 91.88  ? 338 GLY B N   1 
ATOM   5348  C CA  . GLY B 1 338 ? -35.775 55.693  210.517 1.00 86.57  ? 338 GLY B CA  1 
ATOM   5349  C C   . GLY B 1 338 ? -35.953 54.203  210.760 1.00 82.04  ? 338 GLY B C   1 
ATOM   5350  O O   . GLY B 1 338 ? -35.008 53.542  211.163 1.00 85.58  ? 338 GLY B O   1 
ATOM   5351  N N   . GLN B 1 339 ? -37.164 53.682  210.523 1.00 76.94  ? 339 GLN B N   1 
ATOM   5352  C CA  . GLN B 1 339 ? -37.487 52.266  210.740 1.00 71.74  ? 339 GLN B CA  1 
ATOM   5353  C C   . GLN B 1 339 ? -36.516 51.365  209.987 1.00 69.75  ? 339 GLN B C   1 
ATOM   5354  O O   . GLN B 1 339 ? -35.995 51.742  208.921 1.00 71.68  ? 339 GLN B O   1 
ATOM   5355  C CB  . GLN B 1 339 ? -38.927 51.964  210.338 1.00 73.51  ? 339 GLN B CB  1 
ATOM   5356  C CG  . GLN B 1 339 ? -39.801 51.399  211.450 1.00 83.72  ? 339 GLN B CG  1 
ATOM   5357  C CD  . GLN B 1 339 ? -41.252 51.139  211.004 1.00 91.11  ? 339 GLN B CD  1 
ATOM   5358  O OE1 . GLN B 1 339 ? -42.164 51.906  211.312 1.00 94.24  ? 339 GLN B OE1 1 
ATOM   5359  N NE2 . GLN B 1 339 ? -41.460 50.057  210.280 1.00 95.35  ? 339 GLN B NE2 1 
ATOM   5360  N N   . PRO B 1 340 ? -36.248 50.170  210.543 1.00 65.42  ? 340 PRO B N   1 
ATOM   5361  C CA  . PRO B 1 340 ? -35.361 49.086  210.100 1.00 62.84  ? 340 PRO B CA  1 
ATOM   5362  C C   . PRO B 1 340 ? -35.699 48.239  208.895 1.00 61.41  ? 340 PRO B C   1 
ATOM   5363  O O   . PRO B 1 340 ? -36.535 47.354  208.967 1.00 62.23  ? 340 PRO B O   1 
ATOM   5364  C CB  . PRO B 1 340 ? -35.288 48.214  211.334 1.00 62.57  ? 340 PRO B CB  1 
ATOM   5365  C CG  . PRO B 1 340 ? -36.665 48.319  211.846 1.00 62.78  ? 340 PRO B CG  1 
ATOM   5366  C CD  . PRO B 1 340 ? -36.866 49.803  211.823 1.00 62.50  ? 340 PRO B CD  1 
ATOM   5367  N N   . MET B 1 341 ? -34.961 48.423  207.821 1.00 63.45  ? 341 MET B N   1 
ATOM   5368  C CA  . MET B 1 341 ? -35.189 47.639  206.623 1.00 70.40  ? 341 MET B CA  1 
ATOM   5369  C C   . MET B 1 341 ? -33.901 46.914  206.448 1.00 77.77  ? 341 MET B C   1 
ATOM   5370  O O   . MET B 1 341 ? -33.442 46.582  205.346 1.00 79.01  ? 341 MET B O   1 
ATOM   5371  C CB  . MET B 1 341 ? -35.507 48.546  205.444 1.00 67.58  ? 341 MET B CB  1 
ATOM   5372  C CG  . MET B 1 341 ? -36.831 49.279  205.573 1.00 57.34  ? 341 MET B CG  1 
ATOM   5373  S SD  . MET B 1 341 ? -38.177 48.212  206.108 1.00 49.23  ? 341 MET B SD  1 
ATOM   5374  C CE  . MET B 1 341 ? -37.828 46.782  205.195 1.00 47.82  ? 341 MET B CE  1 
ATOM   5375  N N   . GLU B 1 342 ? -33.420 46.526  207.607 1.00 88.63  ? 342 GLU B N   1 
ATOM   5376  C CA  . GLU B 1 342 ? -32.142 45.886  207.686 1.00 104.32 ? 342 GLU B CA  1 
ATOM   5377  C C   . GLU B 1 342 ? -32.068 44.990  208.901 1.00 104.56 ? 342 GLU B C   1 
ATOM   5378  O O   . GLU B 1 342 ? -33.060 44.686  209.541 1.00 107.42 ? 342 GLU B O   1 
ATOM   5379  C CB  . GLU B 1 342 ? -31.157 46.990  207.974 1.00 120.97 ? 342 GLU B CB  1 
ATOM   5380  C CG  . GLU B 1 342 ? -30.163 47.358  206.957 1.00 143.12 ? 342 GLU B CG  1 
ATOM   5381  C CD  . GLU B 1 342 ? -28.970 47.962  207.673 1.00 155.31 ? 342 GLU B CD  1 
ATOM   5382  O OE1 . GLU B 1 342 ? -28.553 47.383  208.728 1.00 162.39 ? 342 GLU B OE1 1 
ATOM   5383  O OE2 . GLU B 1 342 ? -28.492 49.048  207.246 1.00 163.85 ? 342 GLU B OE2 1 
ATOM   5384  N N   . GLY B 1 343 ? -30.823 44.773  209.305 1.00 104.28 ? 343 GLY B N   1 
ATOM   5385  C CA  . GLY B 1 343 ? -30.476 43.988  210.489 1.00 104.24 ? 343 GLY B CA  1 
ATOM   5386  C C   . GLY B 1 343 ? -31.132 42.684  210.903 1.00 103.35 ? 343 GLY B C   1 
ATOM   5387  O O   . GLY B 1 343 ? -31.211 41.725  210.140 1.00 102.62 ? 343 GLY B O   1 
ATOM   5388  N N   . GLU B 1 344 ? -31.556 42.629  212.157 1.00 102.78 ? 344 GLU B N   1 
ATOM   5389  C CA  . GLU B 1 344 ? -32.153 41.415  212.682 1.00 104.15 ? 344 GLU B CA  1 
ATOM   5390  C C   . GLU B 1 344 ? -33.667 41.488  212.726 1.00 98.28  ? 344 GLU B C   1 
ATOM   5391  O O   . GLU B 1 344 ? -34.323 40.473  212.932 1.00 96.97  ? 344 GLU B O   1 
ATOM   5392  C CB  . GLU B 1 344 ? -31.596 41.145  214.080 1.00 117.21 ? 344 GLU B CB  1 
ATOM   5393  C CG  . GLU B 1 344 ? -31.313 39.673  214.399 1.00 135.02 ? 344 GLU B CG  1 
ATOM   5394  C CD  . GLU B 1 344 ? -30.845 39.448  215.855 1.00 144.11 ? 344 GLU B CD  1 
ATOM   5395  O OE1 . GLU B 1 344 ? -29.960 40.213  216.322 1.00 147.78 ? 344 GLU B OE1 1 
ATOM   5396  O OE2 . GLU B 1 344 ? -31.370 38.517  216.531 1.00 149.33 ? 344 GLU B OE2 1 
ATOM   5397  N N   . ASN B 1 345 ? -34.226 42.676  212.504 1.00 93.45  ? 345 ASN B N   1 
ATOM   5398  C CA  . ASN B 1 345 ? -35.689 42.847  212.533 1.00 91.00  ? 345 ASN B CA  1 
ATOM   5399  C C   . ASN B 1 345 ? -36.221 43.597  211.322 1.00 82.66  ? 345 ASN B C   1 
ATOM   5400  O O   . ASN B 1 345 ? -37.087 44.482  211.452 1.00 78.56  ? 345 ASN B O   1 
ATOM   5401  C CB  . ASN B 1 345 ? -36.127 43.602  213.796 1.00 99.61  ? 345 ASN B CB  1 
ATOM   5402  C CG  . ASN B 1 345 ? -35.379 43.153  215.038 1.00 106.33 ? 345 ASN B CG  1 
ATOM   5403  O OD1 . ASN B 1 345 ? -34.469 43.847  215.510 1.00 110.64 ? 345 ASN B OD1 1 
ATOM   5404  N ND2 . ASN B 1 345 ? -35.747 41.983  215.573 1.00 112.81 ? 345 ASN B ND2 1 
ATOM   5405  N N   . THR B 1 346 ? -35.771 43.210  210.138 1.00 73.53  ? 346 THR B N   1 
ATOM   5406  C CA  . THR B 1 346 ? -36.239 43.925  208.981 1.00 69.84  ? 346 THR B CA  1 
ATOM   5407  C C   . THR B 1 346 ? -37.720 43.843  208.870 1.00 62.66  ? 346 THR B C   1 
ATOM   5408  O O   . THR B 1 346 ? -38.316 42.784  208.949 1.00 62.94  ? 346 THR B O   1 
ATOM   5409  C CB  . THR B 1 346 ? -35.715 43.422  207.645 1.00 76.03  ? 346 THR B CB  1 
ATOM   5410  O OG1 . THR B 1 346 ? -34.375 42.945  207.767 1.00 87.03  ? 346 THR B OG1 1 
ATOM   5411  C CG2 . THR B 1 346 ? -35.697 44.573  206.686 1.00 75.74  ? 346 THR B CG2 1 
ATOM   5412  N N   . GLN B 1 347 ? -38.298 44.985  208.603 1.00 56.87  ? 347 GLN B N   1 
ATOM   5413  C CA  . GLN B 1 347 ? -39.701 45.069  208.407 1.00 51.20  ? 347 GLN B CA  1 
ATOM   5414  C C   . GLN B 1 347 ? -39.921 44.655  206.956 1.00 48.52  ? 347 GLN B C   1 
ATOM   5415  O O   . GLN B 1 347 ? -40.987 44.906  206.393 1.00 44.79  ? 347 GLN B O   1 
ATOM   5416  C CB  . GLN B 1 347 ? -40.110 46.489  208.662 1.00 55.30  ? 347 GLN B CB  1 
ATOM   5417  C CG  . GLN B 1 347 ? -39.514 46.974  209.967 1.00 64.55  ? 347 GLN B CG  1 
ATOM   5418  C CD  . GLN B 1 347 ? -40.566 47.307  210.990 1.00 75.99  ? 347 GLN B CD  1 
ATOM   5419  O OE1 . GLN B 1 347 ? -40.293 47.355  212.193 1.00 81.47  ? 347 GLN B OE1 1 
ATOM   5420  N NE2 . GLN B 1 347 ? -41.785 47.582  210.514 1.00 80.57  ? 347 GLN B NE2 1 
ATOM   5421  N N   . VAL B 1 348 ? -38.869 44.121  206.320 1.00 47.34  ? 348 VAL B N   1 
ATOM   5422  C CA  . VAL B 1 348 ? -38.987 43.623  204.953 1.00 48.38  ? 348 VAL B CA  1 
ATOM   5423  C C   . VAL B 1 348 ? -39.239 42.148  205.063 1.00 50.08  ? 348 VAL B C   1 
ATOM   5424  O O   . VAL B 1 348 ? -38.482 41.413  205.688 1.00 46.05  ? 348 VAL B O   1 
ATOM   5425  C CB  . VAL B 1 348 ? -37.747 43.836  204.021 1.00 45.73  ? 348 VAL B CB  1 
ATOM   5426  C CG1 . VAL B 1 348 ? -36.607 42.960  204.393 1.00 50.40  ? 348 VAL B CG1 1 
ATOM   5427  C CG2 . VAL B 1 348 ? -38.124 43.473  202.592 1.00 44.29  ? 348 VAL B CG2 1 
ATOM   5428  N N   . GLU B 1 349 ? -40.352 41.723  204.514 1.00 55.27  ? 349 GLU B N   1 
ATOM   5429  C CA  . GLU B 1 349 ? -40.666 40.330  204.579 1.00 58.12  ? 349 GLU B CA  1 
ATOM   5430  C C   . GLU B 1 349 ? -40.175 39.631  203.337 1.00 52.89  ? 349 GLU B C   1 
ATOM   5431  O O   . GLU B 1 349 ? -39.930 38.424  203.366 1.00 53.67  ? 349 GLU B O   1 
ATOM   5432  C CB  . GLU B 1 349 ? -42.177 40.145  204.672 1.00 64.79  ? 349 GLU B CB  1 
ATOM   5433  C CG  . GLU B 1 349 ? -42.783 40.178  206.054 1.00 76.87  ? 349 GLU B CG  1 
ATOM   5434  C CD  . GLU B 1 349 ? -44.310 40.096  205.997 1.00 89.09  ? 349 GLU B CD  1 
ATOM   5435  O OE1 . GLU B 1 349 ? -44.838 39.223  205.266 1.00 96.22  ? 349 GLU B OE1 1 
ATOM   5436  O OE2 . GLU B 1 349 ? -44.995 40.899  206.681 1.00 94.91  ? 349 GLU B OE2 1 
ATOM   5437  N N   . GLU B 1 350 ? -39.884 40.372  202.282 1.00 46.88  ? 350 GLU B N   1 
ATOM   5438  C CA  . GLU B 1 350 ? -39.578 39.617  201.104 1.00 46.99  ? 350 GLU B CA  1 
ATOM   5439  C C   . GLU B 1 350 ? -39.128 40.255  199.831 1.00 42.27  ? 350 GLU B C   1 
ATOM   5440  O O   . GLU B 1 350 ? -39.699 41.254  199.376 1.00 42.44  ? 350 GLU B O   1 
ATOM   5441  C CB  . GLU B 1 350 ? -40.856 38.905  200.749 1.00 52.73  ? 350 GLU B CB  1 
ATOM   5442  C CG  . GLU B 1 350 ? -40.861 38.348  199.379 1.00 73.85  ? 350 GLU B CG  1 
ATOM   5443  C CD  . GLU B 1 350 ? -40.736 36.865  199.429 1.00 84.08  ? 350 GLU B CD  1 
ATOM   5444  O OE1 . GLU B 1 350 ? -40.245 36.355  200.470 1.00 90.46  ? 350 GLU B OE1 1 
ATOM   5445  O OE2 . GLU B 1 350 ? -41.220 36.196  198.479 1.00 89.35  ? 350 GLU B OE2 1 
ATOM   5446  N N   . VAL B 1 351 ? -38.315 39.497  199.116 1.00 35.10  ? 351 VAL B N   1 
ATOM   5447  C CA  . VAL B 1 351 ? -37.878 39.979  197.856 1.00 33.95  ? 351 VAL B CA  1 
ATOM   5448  C C   . VAL B 1 351 ? -37.569 38.934  196.818 1.00 31.19  ? 351 VAL B C   1 
ATOM   5449  O O   . VAL B 1 351 ? -36.976 37.909  197.100 1.00 26.87  ? 351 VAL B O   1 
ATOM   5450  C CB  . VAL B 1 351 ? -36.715 40.945  198.030 1.00 38.17  ? 351 VAL B CB  1 
ATOM   5451  C CG1 . VAL B 1 351 ? -35.644 40.327  198.860 1.00 27.46  ? 351 VAL B CG1 1 
ATOM   5452  C CG2 . VAL B 1 351 ? -36.195 41.381  196.667 1.00 39.97  ? 351 VAL B CG2 1 
ATOM   5453  N N   . ARG B 1 352 ? -38.021 39.206  195.610 1.00 29.34  ? 352 ARG B N   1 
ATOM   5454  C CA  . ARG B 1 352 ? -37.770 38.343  194.493 1.00 33.57  ? 352 ARG B CA  1 
ATOM   5455  C C   . ARG B 1 352 ? -37.218 39.227  193.421 1.00 35.88  ? 352 ARG B C   1 
ATOM   5456  O O   . ARG B 1 352 ? -37.298 40.451  193.528 1.00 36.57  ? 352 ARG B O   1 
ATOM   5457  C CB  . ARG B 1 352 ? -39.057 37.762  193.996 1.00 43.34  ? 352 ARG B CB  1 
ATOM   5458  C CG  . ARG B 1 352 ? -39.480 36.526  194.731 1.00 66.10  ? 352 ARG B CG  1 
ATOM   5459  C CD  . ARG B 1 352 ? -40.979 36.525  194.971 1.00 79.56  ? 352 ARG B CD  1 
ATOM   5460  N NE  . ARG B 1 352 ? -41.309 37.666  195.822 1.00 99.80  ? 352 ARG B NE  1 
ATOM   5461  C CZ  . ARG B 1 352 ? -42.239 38.571  195.540 1.00 108.56 ? 352 ARG B CZ  1 
ATOM   5462  N NH1 . ARG B 1 352 ? -42.967 38.445  194.436 1.00 115.11 ? 352 ARG B NH1 1 
ATOM   5463  N NH2 . ARG B 1 352 ? -42.343 39.661  196.289 1.00 111.82 ? 352 ARG B NH2 1 
ATOM   5464  N N   . VAL B 1 353 ? -36.755 38.606  192.344 1.00 38.42  ? 353 VAL B N   1 
ATOM   5465  C CA  . VAL B 1 353 ? -36.177 39.313  191.200 1.00 37.79  ? 353 VAL B CA  1 
ATOM   5466  C C   . VAL B 1 353 ? -36.374 38.443  190.017 1.00 38.87  ? 353 VAL B C   1 
ATOM   5467  O O   . VAL B 1 353 ? -36.206 37.227  190.132 1.00 39.34  ? 353 VAL B O   1 
ATOM   5468  C CB  . VAL B 1 353 ? -34.694 39.362  191.288 1.00 36.03  ? 353 VAL B CB  1 
ATOM   5469  C CG1 . VAL B 1 353 ? -34.224 40.730  191.697 1.00 40.29  ? 353 VAL B CG1 1 
ATOM   5470  C CG2 . VAL B 1 353 ? -34.231 38.288  192.239 1.00 39.95  ? 353 VAL B CG2 1 
ATOM   5471  N N   . TYR B 1 354 ? -36.706 39.040  188.882 1.00 40.93  ? 354 TYR B N   1 
ATOM   5472  C CA  . TYR B 1 354 ? -36.894 38.270  187.656 1.00 47.95  ? 354 TYR B CA  1 
ATOM   5473  C C   . TYR B 1 354 ? -36.327 39.082  186.539 1.00 50.91  ? 354 TYR B C   1 
ATOM   5474  O O   . TYR B 1 354 ? -36.247 40.294  186.665 1.00 51.23  ? 354 TYR B O   1 
ATOM   5475  C CB  . TYR B 1 354 ? -38.357 38.096  187.294 1.00 51.17  ? 354 TYR B CB  1 
ATOM   5476  C CG  . TYR B 1 354 ? -39.275 37.697  188.401 1.00 60.08  ? 354 TYR B CG  1 
ATOM   5477  C CD1 . TYR B 1 354 ? -39.317 38.411  189.590 1.00 65.13  ? 354 TYR B CD1 1 
ATOM   5478  C CD2 . TYR B 1 354 ? -40.187 36.665  188.220 1.00 65.19  ? 354 TYR B CD2 1 
ATOM   5479  C CE1 . TYR B 1 354 ? -40.243 38.116  190.570 1.00 70.14  ? 354 TYR B CE1 1 
ATOM   5480  C CE2 . TYR B 1 354 ? -41.127 36.362  189.191 1.00 71.51  ? 354 TYR B CE2 1 
ATOM   5481  C CZ  . TYR B 1 354 ? -41.152 37.094  190.368 1.00 71.18  ? 354 TYR B CZ  1 
ATOM   5482  O OH  . TYR B 1 354 ? -42.094 36.812  191.343 1.00 76.40  ? 354 TYR B OH  1 
ATOM   5483  N N   . ASP B 1 355 ? -35.922 38.427  185.455 1.00 56.91  ? 355 ASP B N   1 
ATOM   5484  C CA  . ASP B 1 355 ? -35.425 39.149  184.282 1.00 64.41  ? 355 ASP B CA  1 
ATOM   5485  C C   . ASP B 1 355 ? -35.928 38.376  183.109 1.00 65.38  ? 355 ASP B C   1 
ATOM   5486  O O   . ASP B 1 355 ? -36.407 38.932  182.113 1.00 67.69  ? 355 ASP B O   1 
ATOM   5487  C CB  . ASP B 1 355 ? -33.897 39.242  184.187 1.00 68.90  ? 355 ASP B CB  1 
ATOM   5488  C CG  . ASP B 1 355 ? -33.439 40.272  183.116 1.00 76.18  ? 355 ASP B CG  1 
ATOM   5489  O OD1 . ASP B 1 355 ? -34.127 41.304  182.914 1.00 76.39  ? 355 ASP B OD1 1 
ATOM   5490  O OD2 . ASP B 1 355 ? -32.380 40.065  182.486 1.00 80.55  ? 355 ASP B OD2 1 
ATOM   5491  N N   . GLY B 1 356 ? -35.857 37.069  183.255 1.00 64.86  ? 356 GLY B N   1 
ATOM   5492  C CA  . GLY B 1 356 ? -36.321 36.219  182.187 1.00 69.90  ? 356 GLY B CA  1 
ATOM   5493  C C   . GLY B 1 356 ? -37.830 36.029  182.119 1.00 68.38  ? 356 GLY B C   1 
ATOM   5494  O O   . GLY B 1 356 ? -38.595 36.679  182.848 1.00 67.45  ? 356 GLY B O   1 
ATOM   5495  N N   . THR B 1 357 ? -38.229 35.063  181.288 1.00 67.18  ? 357 THR B N   1 
ATOM   5496  C CA  . THR B 1 357 ? -39.615 34.718  181.055 1.00 66.27  ? 357 THR B CA  1 
ATOM   5497  C C   . THR B 1 357 ? -39.758 33.250  180.780 1.00 64.60  ? 357 THR B C   1 
ATOM   5498  O O   . THR B 1 357 ? -39.870 32.815  179.625 1.00 67.70  ? 357 THR B O   1 
ATOM   5499  C CB  . THR B 1 357 ? -40.115 35.397  179.839 1.00 68.76  ? 357 THR B CB  1 
ATOM   5500  O OG1 . THR B 1 357 ? -39.111 35.303  178.817 1.00 72.64  ? 357 THR B OG1 1 
ATOM   5501  C CG2 . THR B 1 357 ? -40.432 36.830  180.157 1.00 76.64  ? 357 THR B CG2 1 
ATOM   5502  N N   . GLU B 1 358 ? -39.749 32.465  181.834 1.00 62.51  ? 358 GLU B N   1 
ATOM   5503  C CA  . GLU B 1 358 ? -39.898 31.056  181.616 1.00 62.63  ? 358 GLU B CA  1 
ATOM   5504  C C   . GLU B 1 358 ? -41.352 30.847  181.349 1.00 58.26  ? 358 GLU B C   1 
ATOM   5505  O O   . GLU B 1 358 ? -42.139 31.783  181.382 1.00 62.29  ? 358 GLU B O   1 
ATOM   5506  C CB  . GLU B 1 358 ? -39.505 30.272  182.850 1.00 65.32  ? 358 GLU B CB  1 
ATOM   5507  C CG  . GLU B 1 358 ? -40.478 30.342  183.964 1.00 68.01  ? 358 GLU B CG  1 
ATOM   5508  C CD  . GLU B 1 358 ? -39.846 29.839  185.201 1.00 73.07  ? 358 GLU B CD  1 
ATOM   5509  O OE1 . GLU B 1 358 ? -39.607 28.613  185.283 1.00 78.79  ? 358 GLU B OE1 1 
ATOM   5510  O OE2 . GLU B 1 358 ? -39.504 30.682  186.065 1.00 73.38  ? 358 GLU B OE2 1 
ATOM   5511  N N   . PRO B 1 359 ? -41.706 29.657  180.913 1.00 53.06  ? 359 PRO B N   1 
ATOM   5512  C CA  . PRO B 1 359 ? -43.122 29.474  180.690 1.00 47.22  ? 359 PRO B CA  1 
ATOM   5513  C C   . PRO B 1 359 ? -43.583 29.107  182.088 1.00 41.99  ? 359 PRO B C   1 
ATOM   5514  O O   . PRO B 1 359 ? -42.769 28.706  182.953 1.00 39.22  ? 359 PRO B O   1 
ATOM   5515  C CB  . PRO B 1 359 ? -43.146 28.285  179.778 1.00 50.49  ? 359 PRO B CB  1 
ATOM   5516  C CG  . PRO B 1 359 ? -42.047 27.460  180.373 1.00 55.89  ? 359 PRO B CG  1 
ATOM   5517  C CD  . PRO B 1 359 ? -40.951 28.446  180.572 1.00 55.66  ? 359 PRO B CD  1 
ATOM   5518  N N   . VAL B 1 360 ? -44.870 29.311  182.310 1.00 35.16  ? 360 VAL B N   1 
ATOM   5519  C CA  . VAL B 1 360 ? -45.523 29.031  183.565 1.00 30.76  ? 360 VAL B CA  1 
ATOM   5520  C C   . VAL B 1 360 ? -44.853 27.908  184.288 1.00 29.90  ? 360 VAL B C   1 
ATOM   5521  O O   . VAL B 1 360 ? -44.403 26.970  183.671 1.00 36.76  ? 360 VAL B O   1 
ATOM   5522  C CB  . VAL B 1 360 ? -46.874 28.467  183.290 1.00 33.02  ? 360 VAL B CB  1 
ATOM   5523  C CG1 . VAL B 1 360 ? -47.548 28.117  184.563 1.00 37.12  ? 360 VAL B CG1 1 
ATOM   5524  C CG2 . VAL B 1 360 ? -47.683 29.405  182.486 1.00 36.23  ? 360 VAL B CG2 1 
ATOM   5525  N N   . PRO B 1 361 ? -44.802 27.960  185.603 1.00 27.31  ? 361 PRO B N   1 
ATOM   5526  C CA  . PRO B 1 361 ? -44.163 26.837  186.272 1.00 28.47  ? 361 PRO B CA  1 
ATOM   5527  C C   . PRO B 1 361 ? -45.348 25.943  186.657 1.00 28.26  ? 361 PRO B C   1 
ATOM   5528  O O   . PRO B 1 361 ? -46.379 25.941  185.988 1.00 25.21  ? 361 PRO B O   1 
ATOM   5529  C CB  . PRO B 1 361 ? -43.606 27.490  187.508 1.00 28.27  ? 361 PRO B CB  1 
ATOM   5530  C CG  . PRO B 1 361 ? -44.791 28.338  187.914 1.00 31.01  ? 361 PRO B CG  1 
ATOM   5531  C CD  . PRO B 1 361 ? -45.231 28.964  186.578 1.00 29.93  ? 361 PRO B CD  1 
ATOM   5532  N N   . GLY B 1 362 ? -45.180 25.178  187.723 1.00 29.12  ? 362 GLY B N   1 
ATOM   5533  C CA  . GLY B 1 362 ? -46.244 24.344  188.240 1.00 31.50  ? 362 GLY B CA  1 
ATOM   5534  C C   . GLY B 1 362 ? -46.378 25.106  189.524 1.00 35.17  ? 362 GLY B C   1 
ATOM   5535  O O   . GLY B 1 362 ? -46.702 26.296  189.470 1.00 37.31  ? 362 GLY B O   1 
ATOM   5536  N N   . ASP B 1 363 ? -45.950 24.500  190.632 1.00 38.13  ? 363 ASP B N   1 
ATOM   5537  C CA  . ASP B 1 363 ? -45.973 25.149  191.948 1.00 40.53  ? 363 ASP B CA  1 
ATOM   5538  C C   . ASP B 1 363 ? -45.583 26.616  191.849 1.00 42.25  ? 363 ASP B C   1 
ATOM   5539  O O   . ASP B 1 363 ? -44.413 26.942  191.792 1.00 44.34  ? 363 ASP B O   1 
ATOM   5540  C CB  . ASP B 1 363 ? -44.987 24.481  192.906 1.00 40.28  ? 363 ASP B CB  1 
ATOM   5541  C CG  . ASP B 1 363 ? -44.900 25.200  194.255 1.00 46.33  ? 363 ASP B CG  1 
ATOM   5542  O OD1 . ASP B 1 363 ? -45.591 26.226  194.439 1.00 43.61  ? 363 ASP B OD1 1 
ATOM   5543  O OD2 . ASP B 1 363 ? -44.179 24.730  195.170 1.00 57.06  ? 363 ASP B OD2 1 
ATOM   5544  N N   . PRO B 1 364 ? -46.550 27.515  192.002 1.00 45.36  ? 364 PRO B N   1 
ATOM   5545  C CA  . PRO B 1 364 ? -46.287 28.941  191.919 1.00 52.92  ? 364 PRO B CA  1 
ATOM   5546  C C   . PRO B 1 364 ? -45.522 29.434  193.158 1.00 60.04  ? 364 PRO B C   1 
ATOM   5547  O O   . PRO B 1 364 ? -44.702 30.357  193.086 1.00 65.37  ? 364 PRO B O   1 
ATOM   5548  C CB  . PRO B 1 364 ? -47.688 29.501  191.842 1.00 50.80  ? 364 PRO B CB  1 
ATOM   5549  C CG  . PRO B 1 364 ? -48.366 28.666  192.862 1.00 47.73  ? 364 PRO B CG  1 
ATOM   5550  C CD  . PRO B 1 364 ? -47.915 27.284  192.489 1.00 47.06  ? 364 PRO B CD  1 
ATOM   5551  N N   . ASP B 1 365 ? -45.758 28.802  194.292 1.00 64.07  ? 365 ASP B N   1 
ATOM   5552  C CA  . ASP B 1 365 ? -45.063 29.190  195.496 1.00 71.48  ? 365 ASP B CA  1 
ATOM   5553  C C   . ASP B 1 365 ? -43.613 28.613  195.479 1.00 69.80  ? 365 ASP B C   1 
ATOM   5554  O O   . ASP B 1 365 ? -42.953 28.484  196.534 1.00 72.09  ? 365 ASP B O   1 
ATOM   5555  C CB  . ASP B 1 365 ? -45.887 28.695  196.687 1.00 86.01  ? 365 ASP B CB  1 
ATOM   5556  C CG  . ASP B 1 365 ? -45.450 29.304  198.016 1.00 102.97 ? 365 ASP B CG  1 
ATOM   5557  O OD1 . ASP B 1 365 ? -44.712 30.331  198.018 1.00 110.66 ? 365 ASP B OD1 1 
ATOM   5558  O OD2 . ASP B 1 365 ? -45.853 28.732  199.067 1.00 111.71 ? 365 ASP B OD2 1 
ATOM   5559  N N   . MET B 1 366 ? -43.102 28.307  194.277 1.00 64.62  ? 366 MET B N   1 
ATOM   5560  C CA  . MET B 1 366 ? -41.748 27.752  194.110 1.00 56.40  ? 366 MET B CA  1 
ATOM   5561  C C   . MET B 1 366 ? -40.726 28.784  194.470 1.00 51.56  ? 366 MET B C   1 
ATOM   5562  O O   . MET B 1 366 ? -41.003 29.983  194.430 1.00 52.06  ? 366 MET B O   1 
ATOM   5563  C CB  . MET B 1 366 ? -41.483 27.310  192.673 1.00 55.79  ? 366 MET B CB  1 
ATOM   5564  C CG  . MET B 1 366 ? -40.705 28.321  191.823 1.00 56.05  ? 366 MET B CG  1 
ATOM   5565  S SD  . MET B 1 366 ? -40.236 27.737  190.129 1.00 63.60  ? 366 MET B SD  1 
ATOM   5566  C CE  . MET B 1 366 ? -38.617 27.006  190.385 1.00 65.28  ? 366 MET B CE  1 
ATOM   5567  N N   . THR B 1 367 ? -39.529 28.324  194.790 1.00 45.81  ? 367 THR B N   1 
ATOM   5568  C CA  . THR B 1 367 ? -38.462 29.237  195.167 1.00 44.62  ? 367 THR B CA  1 
ATOM   5569  C C   . THR B 1 367 ? -37.332 29.174  194.133 1.00 46.25  ? 367 THR B C   1 
ATOM   5570  O O   . THR B 1 367 ? -37.451 28.449  193.146 1.00 55.57  ? 367 THR B O   1 
ATOM   5571  C CB  . THR B 1 367 ? -37.946 28.858  196.533 1.00 43.60  ? 367 THR B CB  1 
ATOM   5572  O OG1 . THR B 1 367 ? -39.025 28.279  197.298 1.00 52.70  ? 367 THR B OG1 1 
ATOM   5573  C CG2 . THR B 1 367 ? -37.342 30.088  197.236 1.00 36.78  ? 367 THR B CG2 1 
ATOM   5574  N N   . ARG B 1 368 ? -36.241 29.910  194.330 1.00 41.61  ? 368 ARG B N   1 
ATOM   5575  C CA  . ARG B 1 368 ? -35.134 29.886  193.369 1.00 35.96  ? 368 ARG B CA  1 
ATOM   5576  C C   . ARG B 1 368 ? -34.009 30.582  194.048 1.00 37.63  ? 368 ARG B C   1 
ATOM   5577  O O   . ARG B 1 368 ? -34.194 31.591  194.728 1.00 39.17  ? 368 ARG B O   1 
ATOM   5578  C CB  . ARG B 1 368 ? -35.473 30.680  192.122 1.00 31.29  ? 368 ARG B CB  1 
ATOM   5579  C CG  . ARG B 1 368 ? -34.957 30.106  190.889 1.00 31.48  ? 368 ARG B CG  1 
ATOM   5580  C CD  . ARG B 1 368 ? -35.858 28.981  190.403 1.00 39.35  ? 368 ARG B CD  1 
ATOM   5581  N NE  . ARG B 1 368 ? -36.794 29.408  189.349 1.00 41.67  ? 368 ARG B NE  1 
ATOM   5582  C CZ  . ARG B 1 368 ? -36.851 28.895  188.109 1.00 43.50  ? 368 ARG B CZ  1 
ATOM   5583  N NH1 . ARG B 1 368 ? -36.024 27.922  187.715 1.00 46.61  ? 368 ARG B NH1 1 
ATOM   5584  N NH2 . ARG B 1 368 ? -37.760 29.344  187.255 1.00 38.86  ? 368 ARG B NH2 1 
ATOM   5585  N N   . TYR B 1 369 ? -32.827 30.066  193.861 1.00 39.72  ? 369 TYR B N   1 
ATOM   5586  C CA  . TYR B 1 369 ? -31.707 30.682  194.497 1.00 46.95  ? 369 TYR B CA  1 
ATOM   5587  C C   . TYR B 1 369 ? -30.535 30.411  193.642 1.00 51.17  ? 369 TYR B C   1 
ATOM   5588  O O   . TYR B 1 369 ? -30.620 29.667  192.680 1.00 55.69  ? 369 TYR B O   1 
ATOM   5589  C CB  . TYR B 1 369 ? -31.475 30.072  195.853 1.00 49.29  ? 369 TYR B CB  1 
ATOM   5590  C CG  . TYR B 1 369 ? -31.020 31.088  196.840 1.00 60.34  ? 369 TYR B CG  1 
ATOM   5591  C CD1 . TYR B 1 369 ? -29.682 31.460  196.924 1.00 63.47  ? 369 TYR B CD1 1 
ATOM   5592  C CD2 . TYR B 1 369 ? -31.929 31.684  197.704 1.00 66.63  ? 369 TYR B CD2 1 
ATOM   5593  C CE1 . TYR B 1 369 ? -29.254 32.407  197.855 1.00 69.67  ? 369 TYR B CE1 1 
ATOM   5594  C CE2 . TYR B 1 369 ? -31.517 32.632  198.641 1.00 72.02  ? 369 TYR B CE2 1 
ATOM   5595  C CZ  . TYR B 1 369 ? -30.178 32.989  198.714 1.00 71.01  ? 369 TYR B CZ  1 
ATOM   5596  O OH  . TYR B 1 369 ? -29.771 33.906  199.659 1.00 71.09  ? 369 TYR B OH  1 
ATOM   5597  N N   . VAL B 1 370 ? -29.419 30.994  194.010 1.00 53.84  ? 370 VAL B N   1 
ATOM   5598  C CA  . VAL B 1 370 ? -28.215 30.826  193.260 1.00 59.96  ? 370 VAL B CA  1 
ATOM   5599  C C   . VAL B 1 370 ? -27.204 30.630  194.299 1.00 67.19  ? 370 VAL B C   1 
ATOM   5600  O O   . VAL B 1 370 ? -27.307 31.331  195.313 1.00 64.29  ? 370 VAL B O   1 
ATOM   5601  C CB  . VAL B 1 370 ? -27.821 32.144  192.671 1.00 57.55  ? 370 VAL B CB  1 
ATOM   5602  C CG1 . VAL B 1 370 ? -26.744 31.945  191.660 1.00 65.19  ? 370 VAL B CG1 1 
ATOM   5603  C CG2 . VAL B 1 370 ? -29.016 32.865  192.126 1.00 61.23  ? 370 VAL B CG2 1 
ATOM   5604  N N   . ASP B 1 371 ? -26.263 29.695  194.166 1.00 79.54  ? 371 ASP B N   1 
ATOM   5605  C CA  . ASP B 1 371 ? -25.310 29.734  195.227 1.00 94.56  ? 371 ASP B CA  1 
ATOM   5606  C C   . ASP B 1 371 ? -23.916 30.068  195.037 1.00 97.08  ? 371 ASP B C   1 
ATOM   5607  O O   . ASP B 1 371 ? -23.654 31.039  194.341 1.00 98.18  ? 371 ASP B O   1 
ATOM   5608  C CB  . ASP B 1 371 ? -25.488 28.823  196.408 1.00 112.29 ? 371 ASP B CB  1 
ATOM   5609  C CG  . ASP B 1 371 ? -25.188 29.578  197.745 1.00 127.33 ? 371 ASP B CG  1 
ATOM   5610  O OD1 . ASP B 1 371 ? -26.064 30.374  198.209 1.00 133.12 ? 371 ASP B OD1 1 
ATOM   5611  O OD2 . ASP B 1 371 ? -24.051 29.459  198.290 1.00 135.77 ? 371 ASP B OD2 1 
ATOM   5612  N N   . ARG B 1 372 ? -22.981 29.253  195.500 1.00 101.65 ? 372 ARG B N   1 
ATOM   5613  C CA  . ARG B 1 372 ? -21.640 29.796  195.406 1.00 109.07 ? 372 ARG B CA  1 
ATOM   5614  C C   . ARG B 1 372 ? -21.219 30.024  193.988 1.00 107.20 ? 372 ARG B C   1 
ATOM   5615  O O   . ARG B 1 372 ? -20.125 30.521  193.722 1.00 110.13 ? 372 ARG B O   1 
ATOM   5616  C CB  . ARG B 1 372 ? -20.630 29.013  196.256 1.00 119.71 ? 372 ARG B CB  1 
ATOM   5617  C CG  . ARG B 1 372 ? -20.409 29.624  197.667 1.00 135.78 ? 372 ARG B CG  1 
ATOM   5618  C CD  . ARG B 1 372 ? -19.065 30.379  197.810 1.00 146.95 ? 372 ARG B CD  1 
ATOM   5619  N NE  . ARG B 1 372 ? -18.978 31.230  199.020 1.00 157.13 ? 372 ARG B NE  1 
ATOM   5620  C CZ  . ARG B 1 372 ? -17.946 31.274  199.885 1.00 159.90 ? 372 ARG B CZ  1 
ATOM   5621  N NH1 . ARG B 1 372 ? -16.875 30.501  199.722 1.00 160.50 ? 372 ARG B NH1 1 
ATOM   5622  N NH2 . ARG B 1 372 ? -17.968 32.126  200.916 1.00 162.12 ? 372 ARG B NH2 1 
ATOM   5623  N N   . PHE B 1 373 ? -22.139 29.718  193.081 1.00 105.21 ? 373 PHE B N   1 
ATOM   5624  C CA  . PHE B 1 373 ? -21.878 29.844  191.687 1.00 106.56 ? 373 PHE B CA  1 
ATOM   5625  C C   . PHE B 1 373 ? -23.164 29.918  190.884 1.00 104.47 ? 373 PHE B C   1 
ATOM   5626  O O   . PHE B 1 373 ? -23.514 30.955  190.294 1.00 101.56 ? 373 PHE B O   1 
ATOM   5627  C CB  . PHE B 1 373 ? -21.086 28.623  191.198 1.00 115.91 ? 373 PHE B CB  1 
ATOM   5628  C CG  . PHE B 1 373 ? -20.629 27.662  192.304 1.00 127.38 ? 373 PHE B CG  1 
ATOM   5629  C CD1 . PHE B 1 373 ? -21.498 27.225  193.320 1.00 131.80 ? 373 PHE B CD1 1 
ATOM   5630  C CD2 . PHE B 1 373 ? -19.305 27.206  192.332 1.00 133.14 ? 373 PHE B CD2 1 
ATOM   5631  C CE1 . PHE B 1 373 ? -21.043 26.363  194.340 1.00 135.20 ? 373 PHE B CE1 1 
ATOM   5632  C CE2 . PHE B 1 373 ? -18.842 26.339  193.347 1.00 134.86 ? 373 PHE B CE2 1 
ATOM   5633  C CZ  . PHE B 1 373 ? -19.710 25.922  194.350 1.00 133.50 ? 373 PHE B CZ  1 
ATOM   5634  N N   . GLY B 1 374 ? -23.898 28.810  190.916 1.00 102.69 ? 374 GLY B N   1 
ATOM   5635  C CA  . GLY B 1 374 ? -25.095 28.694  190.111 1.00 97.84  ? 374 GLY B CA  1 
ATOM   5636  C C   . GLY B 1 374 ? -26.457 28.738  190.739 1.00 94.87  ? 374 GLY B C   1 
ATOM   5637  O O   . GLY B 1 374 ? -26.619 28.510  191.950 1.00 91.52  ? 374 GLY B O   1 
ATOM   5638  N N   . LYS B 1 375 ? -27.420 28.925  189.828 1.00 92.80  ? 375 LYS B N   1 
ATOM   5639  C CA  . LYS B 1 375 ? -28.860 29.051  190.070 1.00 91.87  ? 375 LYS B CA  1 
ATOM   5640  C C   . LYS B 1 375 ? -29.697 27.768  190.004 1.00 87.23  ? 375 LYS B C   1 
ATOM   5641  O O   . LYS B 1 375 ? -29.630 27.031  189.023 1.00 86.77  ? 375 LYS B O   1 
ATOM   5642  C CB  . LYS B 1 375 ? -29.425 30.051  189.077 1.00 99.39  ? 375 LYS B CB  1 
ATOM   5643  C CG  . LYS B 1 375 ? -30.908 29.958  188.948 1.00 110.86 ? 375 LYS B CG  1 
ATOM   5644  C CD  . LYS B 1 375 ? -31.490 31.151  188.247 1.00 123.31 ? 375 LYS B CD  1 
ATOM   5645  C CE  . LYS B 1 375 ? -32.989 30.953  188.084 1.00 129.86 ? 375 LYS B CE  1 
ATOM   5646  N NZ  . LYS B 1 375 ? -33.661 32.184  187.629 1.00 134.50 ? 375 LYS B NZ  1 
ATOM   5647  N N   . THR B 1 376 ? -30.644 27.648  190.932 1.00 83.03  ? 376 THR B N   1 
ATOM   5648  C CA  . THR B 1 376 ? -31.472 26.455  191.055 1.00 82.39  ? 376 THR B CA  1 
ATOM   5649  C C   . THR B 1 376 ? -32.997 26.524  191.266 1.00 84.10  ? 376 THR B C   1 
ATOM   5650  O O   . THR B 1 376 ? -33.519 27.396  191.975 1.00 85.86  ? 376 THR B O   1 
ATOM   5651  C CB  . THR B 1 376 ? -30.936 25.605  192.209 1.00 81.00  ? 376 THR B CB  1 
ATOM   5652  O OG1 . THR B 1 376 ? -30.687 26.437  193.353 1.00 73.25  ? 376 THR B OG1 1 
ATOM   5653  C CG2 . THR B 1 376 ? -29.658 24.925  191.799 1.00 84.50  ? 376 THR B CG2 1 
ATOM   5654  N N   . LYS B 1 377 ? -33.707 25.589  190.636 1.00 83.28  ? 377 LYS B N   1 
ATOM   5655  C CA  . LYS B 1 377 ? -35.140 25.471  190.824 1.00 82.98  ? 377 LYS B CA  1 
ATOM   5656  C C   . LYS B 1 377 ? -35.021 24.977  192.245 1.00 80.77  ? 377 LYS B C   1 
ATOM   5657  O O   . LYS B 1 377 ? -34.602 23.845  192.456 1.00 78.18  ? 377 LYS B O   1 
ATOM   5658  C CB  . LYS B 1 377 ? -35.664 24.319  189.980 1.00 91.98  ? 377 LYS B CB  1 
ATOM   5659  C CG  . LYS B 1 377 ? -36.776 24.649  188.982 1.00 109.76 ? 377 LYS B CG  1 
ATOM   5660  C CD  . LYS B 1 377 ? -37.232 23.366  188.184 1.00 122.48 ? 377 LYS B CD  1 
ATOM   5661  C CE  . LYS B 1 377 ? -38.229 23.629  186.989 1.00 125.76 ? 377 LYS B CE  1 
ATOM   5662  N NZ  . LYS B 1 377 ? -38.748 22.374  186.270 1.00 122.72 ? 377 LYS B NZ  1 
ATOM   5663  N N   . THR B 1 378 ? -35.202 25.862  193.211 1.00 82.37  ? 378 THR B N   1 
ATOM   5664  C CA  . THR B 1 378 ? -35.069 25.468  194.610 1.00 88.88  ? 378 THR B CA  1 
ATOM   5665  C C   . THR B 1 378 ? -35.746 24.180  194.818 1.00 92.68  ? 378 THR B C   1 
ATOM   5666  O O   . THR B 1 378 ? -36.810 23.956  194.272 1.00 95.41  ? 378 THR B O   1 
ATOM   5667  C CB  . THR B 1 378 ? -35.791 26.390  195.561 1.00 92.36  ? 378 THR B CB  1 
ATOM   5668  O OG1 . THR B 1 378 ? -35.199 27.691  195.503 1.00 101.80 ? 378 THR B OG1 1 
ATOM   5669  C CG2 . THR B 1 378 ? -35.731 25.841  196.997 1.00 88.92  ? 378 THR B CG2 1 
ATOM   5670  N N   . VAL B 1 379 ? -35.178 23.377  195.694 1.00 99.44  ? 379 VAL B N   1 
ATOM   5671  C CA  . VAL B 1 379 ? -35.751 22.080  195.997 1.00 108.93 ? 379 VAL B CA  1 
ATOM   5672  C C   . VAL B 1 379 ? -37.193 22.201  196.380 1.00 105.19 ? 379 VAL B C   1 
ATOM   5673  O O   . VAL B 1 379 ? -37.594 23.141  197.070 1.00 104.54 ? 379 VAL B O   1 
ATOM   5674  C CB  . VAL B 1 379 ? -35.054 21.390  197.191 1.00 118.39 ? 379 VAL B CB  1 
ATOM   5675  C CG1 . VAL B 1 379 ? -35.758 20.053  197.541 1.00 123.24 ? 379 VAL B CG1 1 
ATOM   5676  C CG2 . VAL B 1 379 ? -33.567 21.152  196.866 1.00 127.70 ? 379 VAL B CG2 1 
ATOM   5677  N N   . PHE B 1 380 ? -37.979 21.273  195.857 1.00 104.19 ? 380 PHE B N   1 
ATOM   5678  C CA  . PHE B 1 380 ? -39.371 21.215  196.195 1.00 102.25 ? 380 PHE B CA  1 
ATOM   5679  C C   . PHE B 1 380 ? -39.163 21.172  197.673 1.00 103.57 ? 380 PHE B C   1 
ATOM   5680  O O   . PHE B 1 380 ? -38.386 20.398  198.203 1.00 94.80  ? 380 PHE B O   1 
ATOM   5681  C CB  . PHE B 1 380 ? -39.999 19.930  195.686 1.00 105.27 ? 380 PHE B CB  1 
ATOM   5682  C CG  . PHE B 1 380 ? -39.076 18.763  195.743 1.00 106.96 ? 380 PHE B CG  1 
ATOM   5683  C CD1 . PHE B 1 380 ? -38.085 18.611  194.787 1.00 107.21 ? 380 PHE B CD1 1 
ATOM   5684  C CD2 . PHE B 1 380 ? -39.136 17.870  196.805 1.00 107.31 ? 380 PHE B CD2 1 
ATOM   5685  C CE1 . PHE B 1 380 ? -37.170 17.601  194.895 1.00 108.79 ? 380 PHE B CE1 1 
ATOM   5686  C CE2 . PHE B 1 380 ? -38.221 16.847  196.924 1.00 108.42 ? 380 PHE B CE2 1 
ATOM   5687  C CZ  . PHE B 1 380 ? -37.233 16.711  195.974 1.00 109.82 ? 380 PHE B CZ  1 
ATOM   5688  N N   . PRO B 1 381 ? -39.677 22.174  198.316 1.00 112.95 ? 381 PRO B N   1 
ATOM   5689  C CA  . PRO B 1 381 ? -39.624 22.401  199.757 1.00 123.26 ? 381 PRO B CA  1 
ATOM   5690  C C   . PRO B 1 381 ? -39.682 21.117  200.561 1.00 131.23 ? 381 PRO B C   1 
ATOM   5691  O O   . PRO B 1 381 ? -39.280 21.082  201.727 1.00 130.19 ? 381 PRO B O   1 
ATOM   5692  C CB  . PRO B 1 381 ? -40.874 23.252  199.996 1.00 127.16 ? 381 PRO B CB  1 
ATOM   5693  C CG  . PRO B 1 381 ? -41.760 23.019  198.675 1.00 126.15 ? 381 PRO B CG  1 
ATOM   5694  C CD  . PRO B 1 381 ? -40.692 23.012  197.656 1.00 117.83 ? 381 PRO B CD  1 
ATOM   5695  N N   . GLY B 1 382 ? -40.251 20.091  199.929 1.00 142.92 ? 382 GLY B N   1 
ATOM   5696  C CA  . GLY B 1 382 ? -40.445 18.778  200.529 1.00 159.00 ? 382 GLY B CA  1 
ATOM   5697  C C   . GLY B 1 382 ? -39.255 17.856  200.743 1.00 169.23 ? 382 GLY B C   1 
ATOM   5698  O O   . GLY B 1 382 ? -39.128 16.784  200.111 1.00 167.64 ? 382 GLY B O   1 
ATOM   5699  N N   . ASN B 1 383 ? -38.432 18.253  201.708 1.00 179.69 ? 383 ASN B N   1 
ATOM   5700  C CA  . ASN B 1 383 ? -37.223 17.526  202.095 1.00 188.04 ? 383 ASN B CA  1 
ATOM   5701  C C   . ASN B 1 383 ? -37.540 16.290  202.981 1.00 189.42 ? 383 ASN B C   1 
ATOM   5702  O O   . ASN B 1 383 ? -38.635 15.701  202.937 1.00 191.82 ? 383 ASN B O   1 
ATOM   5703  C CB  . ASN B 1 383 ? -36.246 18.490  202.828 1.00 194.65 ? 383 ASN B CB  1 
ATOM   5704  C CG  . ASN B 1 383 ? -35.782 19.688  201.949 1.00 198.65 ? 383 ASN B CG  1 
ATOM   5705  O OD1 . ASN B 1 383 ? -36.482 20.710  201.824 1.00 199.67 ? 383 ASN B OD1 1 
ATOM   5706  N ND2 . ASN B 1 383 ? -34.573 19.579  201.390 1.00 201.10 ? 383 ASN B ND2 1 
ATOM   5707  N N   . LYS C 1 17  ? 57.557  24.937  160.655 1.00 211.09 ? 17  LYS C N   1 
ATOM   5708  C CA  . LYS C 1 17  ? 57.448  24.522  162.060 1.00 209.75 ? 17  LYS C CA  1 
ATOM   5709  C C   . LYS C 1 17  ? 56.947  25.605  163.071 1.00 204.85 ? 17  LYS C C   1 
ATOM   5710  O O   . LYS C 1 17  ? 57.191  26.822  162.893 1.00 206.40 ? 17  LYS C O   1 
ATOM   5711  C CB  . LYS C 1 17  ? 58.769  23.853  162.534 1.00 213.95 ? 17  LYS C CB  1 
ATOM   5712  C CG  . LYS C 1 17  ? 60.093  24.608  162.209 1.00 215.75 ? 17  LYS C CG  1 
ATOM   5713  C CD  . LYS C 1 17  ? 61.333  23.900  162.826 1.00 215.50 ? 17  LYS C CD  1 
ATOM   5714  C CE  . LYS C 1 17  ? 62.664  24.609  162.499 1.00 215.09 ? 17  LYS C CE  1 
ATOM   5715  N NZ  . LYS C 1 17  ? 63.853  23.956  163.154 1.00 213.52 ? 17  LYS C NZ  1 
ATOM   5716  N N   . ALA C 1 18  ? 56.226  25.138  164.106 1.00 195.88 ? 18  ALA C N   1 
ATOM   5717  C CA  . ALA C 1 18  ? 55.658  25.992  165.161 1.00 183.85 ? 18  ALA C CA  1 
ATOM   5718  C C   . ALA C 1 18  ? 56.144  25.664  166.582 1.00 174.49 ? 18  ALA C C   1 
ATOM   5719  O O   . ALA C 1 18  ? 56.551  24.535  166.909 1.00 176.23 ? 18  ALA C O   1 
ATOM   5720  C CB  . ALA C 1 18  ? 54.119  25.987  165.105 1.00 184.06 ? 18  ALA C CB  1 
ATOM   5721  N N   . CYS C 1 19  ? 56.008  26.664  167.436 1.00 160.13 ? 19  CYS C N   1 
ATOM   5722  C CA  . CYS C 1 19  ? 56.455  26.592  168.807 1.00 145.41 ? 19  CYS C CA  1 
ATOM   5723  C C   . CYS C 1 19  ? 55.326  26.482  169.813 1.00 139.45 ? 19  CYS C C   1 
ATOM   5724  O O   . CYS C 1 19  ? 54.139  26.565  169.466 1.00 140.72 ? 19  CYS C O   1 
ATOM   5725  C CB  . CYS C 1 19  ? 57.206  27.885  169.113 1.00 138.50 ? 19  CYS C CB  1 
ATOM   5726  S SG  . CYS C 1 19  ? 58.678  28.172  168.101 1.00 124.85 ? 19  CYS C SG  1 
ATOM   5727  N N   . PRO C 1 20  ? 55.691  26.220  171.076 1.00 133.03 ? 20  PRO C N   1 
ATOM   5728  C CA  . PRO C 1 20  ? 54.714  26.116  172.158 1.00 128.11 ? 20  PRO C CA  1 
ATOM   5729  C C   . PRO C 1 20  ? 54.369  27.589  172.457 1.00 123.19 ? 20  PRO C C   1 
ATOM   5730  O O   . PRO C 1 20  ? 55.198  28.469  172.207 1.00 121.73 ? 20  PRO C O   1 
ATOM   5731  C CB  . PRO C 1 20  ? 55.541  25.494  173.284 1.00 128.88 ? 20  PRO C CB  1 
ATOM   5732  C CG  . PRO C 1 20  ? 56.595  24.714  172.553 1.00 129.25 ? 20  PRO C CG  1 
ATOM   5733  C CD  . PRO C 1 20  ? 56.996  25.687  171.502 1.00 130.00 ? 20  PRO C CD  1 
ATOM   5734  N N   . ARG C 1 21  ? 53.179  27.880  172.977 1.00 118.25 ? 21  ARG C N   1 
ATOM   5735  C CA  . ARG C 1 21  ? 52.833  29.274  173.241 1.00 113.77 ? 21  ARG C CA  1 
ATOM   5736  C C   . ARG C 1 21  ? 52.496  29.592  174.708 1.00 101.59 ? 21  ARG C C   1 
ATOM   5737  O O   . ARG C 1 21  ? 51.368  29.346  175.160 1.00 100.87 ? 21  ARG C O   1 
ATOM   5738  C CB  . ARG C 1 21  ? 51.690  29.685  172.318 1.00 128.88 ? 21  ARG C CB  1 
ATOM   5739  C CG  . ARG C 1 21  ? 51.641  31.177  172.034 1.00 151.66 ? 21  ARG C CG  1 
ATOM   5740  C CD  . ARG C 1 21  ? 50.363  31.580  171.259 1.00 172.03 ? 21  ARG C CD  1 
ATOM   5741  N NE  . ARG C 1 21  ? 50.218  33.043  171.097 1.00 188.45 ? 21  ARG C NE  1 
ATOM   5742  C CZ  . ARG C 1 21  ? 49.074  33.687  170.807 1.00 194.50 ? 21  ARG C CZ  1 
ATOM   5743  N NH1 . ARG C 1 21  ? 47.928  33.007  170.638 1.00 197.18 ? 21  ARG C NH1 1 
ATOM   5744  N NH2 . ARG C 1 21  ? 49.076  35.024  170.690 1.00 197.83 ? 21  ARG C NH2 1 
ATOM   5745  N N   . PRO C 1 22  ? 53.469  30.155  175.467 1.00 89.04  ? 22  PRO C N   1 
ATOM   5746  C CA  . PRO C 1 22  ? 53.270  30.499  176.873 1.00 81.97  ? 22  PRO C CA  1 
ATOM   5747  C C   . PRO C 1 22  ? 52.081  31.383  176.943 1.00 77.11  ? 22  PRO C C   1 
ATOM   5748  O O   . PRO C 1 22  ? 51.972  32.356  176.202 1.00 77.00  ? 22  PRO C O   1 
ATOM   5749  C CB  . PRO C 1 22  ? 54.530  31.281  177.231 1.00 78.25  ? 22  PRO C CB  1 
ATOM   5750  C CG  . PRO C 1 22  ? 55.525  30.671  176.413 1.00 81.06  ? 22  PRO C CG  1 
ATOM   5751  C CD  . PRO C 1 22  ? 54.821  30.555  175.065 1.00 85.77  ? 22  PRO C CD  1 
ATOM   5752  N N   . ALA C 1 23  ? 51.165  31.005  177.808 1.00 71.76  ? 23  ALA C N   1 
ATOM   5753  C CA  . ALA C 1 23  ? 49.956  31.761  177.981 1.00 64.48  ? 23  ALA C CA  1 
ATOM   5754  C C   . ALA C 1 23  ? 50.240  33.235  178.115 1.00 58.04  ? 23  ALA C C   1 
ATOM   5755  O O   . ALA C 1 23  ? 51.225  33.659  178.694 1.00 55.22  ? 23  ALA C O   1 
ATOM   5756  C CB  . ALA C 1 23  ? 49.213  31.272  179.197 1.00 73.34  ? 23  ALA C CB  1 
ATOM   5757  N N   . PRO C 1 24  ? 49.416  34.035  177.487 1.00 52.27  ? 24  PRO C N   1 
ATOM   5758  C CA  . PRO C 1 24  ? 49.598  35.473  177.563 1.00 49.13  ? 24  PRO C CA  1 
ATOM   5759  C C   . PRO C 1 24  ? 49.197  35.963  178.938 1.00 43.22  ? 24  PRO C C   1 
ATOM   5760  O O   . PRO C 1 24  ? 48.250  35.507  179.586 1.00 39.60  ? 24  PRO C O   1 
ATOM   5761  C CB  . PRO C 1 24  ? 48.711  35.993  176.454 1.00 53.96  ? 24  PRO C CB  1 
ATOM   5762  C CG  . PRO C 1 24  ? 47.609  34.964  176.454 1.00 61.17  ? 24  PRO C CG  1 
ATOM   5763  C CD  . PRO C 1 24  ? 48.362  33.674  176.541 1.00 54.25  ? 24  PRO C CD  1 
ATOM   5764  N N   . VAL C 1 25  ? 49.924  36.980  179.310 1.00 40.84  ? 25  VAL C N   1 
ATOM   5765  C CA  . VAL C 1 25  ? 49.866  37.603  180.584 1.00 41.89  ? 25  VAL C CA  1 
ATOM   5766  C C   . VAL C 1 25  ? 50.070  39.055  180.248 1.00 44.61  ? 25  VAL C C   1 
ATOM   5767  O O   . VAL C 1 25  ? 50.501  39.392  179.154 1.00 49.12  ? 25  VAL C O   1 
ATOM   5768  C CB  . VAL C 1 25  ? 51.156  37.173  181.285 1.00 44.50  ? 25  VAL C CB  1 
ATOM   5769  C CG1 . VAL C 1 25  ? 51.322  37.823  182.639 1.00 50.76  ? 25  VAL C CG1 1 
ATOM   5770  C CG2 . VAL C 1 25  ? 51.264  35.652  181.322 1.00 45.33  ? 25  VAL C CG2 1 
ATOM   5771  N N   . PRO C 1 26  ? 49.728  39.946  181.158 1.00 44.39  ? 26  PRO C N   1 
ATOM   5772  C CA  . PRO C 1 26  ? 49.939  41.355  180.871 1.00 46.88  ? 26  PRO C CA  1 
ATOM   5773  C C   . PRO C 1 26  ? 51.440  41.579  180.855 1.00 48.74  ? 26  PRO C C   1 
ATOM   5774  O O   . PRO C 1 26  ? 52.173  41.005  181.676 1.00 46.24  ? 26  PRO C O   1 
ATOM   5775  C CB  . PRO C 1 26  ? 49.353  42.017  182.092 1.00 49.29  ? 26  PRO C CB  1 
ATOM   5776  C CG  . PRO C 1 26  ? 49.606  40.969  183.178 1.00 49.54  ? 26  PRO C CG  1 
ATOM   5777  C CD  . PRO C 1 26  ? 49.056  39.793  182.445 1.00 45.37  ? 26  PRO C CD  1 
ATOM   5778  N N   . LYS C 1 27  ? 51.887  42.431  179.942 1.00 51.93  ? 27  LYS C N   1 
ATOM   5779  C CA  . LYS C 1 27  ? 53.299  42.719  179.821 1.00 54.33  ? 27  LYS C CA  1 
ATOM   5780  C C   . LYS C 1 27  ? 53.699  43.944  180.604 1.00 47.87  ? 27  LYS C C   1 
ATOM   5781  O O   . LYS C 1 27  ? 53.111  45.027  180.489 1.00 42.11  ? 27  LYS C O   1 
ATOM   5782  C CB  . LYS C 1 27  ? 53.727  42.859  178.359 1.00 62.95  ? 27  LYS C CB  1 
ATOM   5783  C CG  . LYS C 1 27  ? 53.687  44.274  177.808 1.00 77.71  ? 27  LYS C CG  1 
ATOM   5784  C CD  . LYS C 1 27  ? 54.193  44.330  176.372 1.00 92.68  ? 27  LYS C CD  1 
ATOM   5785  C CE  . LYS C 1 27  ? 55.658  43.914  176.305 1.00 106.50 ? 27  LYS C CE  1 
ATOM   5786  N NZ  . LYS C 1 27  ? 56.250  44.068  174.939 1.00 118.09 ? 27  LYS C NZ  1 
ATOM   5787  N N   . LEU C 1 28  ? 54.743  43.758  181.382 1.00 43.45  ? 28  LEU C N   1 
ATOM   5788  C CA  . LEU C 1 28  ? 55.248  44.817  182.191 1.00 40.77  ? 28  LEU C CA  1 
ATOM   5789  C C   . LEU C 1 28  ? 55.942  45.852  181.360 1.00 38.68  ? 28  LEU C C   1 
ATOM   5790  O O   . LEU C 1 28  ? 56.714  45.540  180.465 1.00 36.51  ? 28  LEU C O   1 
ATOM   5791  C CB  . LEU C 1 28  ? 56.223  44.270  183.195 1.00 41.70  ? 28  LEU C CB  1 
ATOM   5792  C CG  . LEU C 1 28  ? 56.467  45.284  184.301 1.00 39.12  ? 28  LEU C CG  1 
ATOM   5793  C CD1 . LEU C 1 28  ? 56.964  44.541  185.477 1.00 47.37  ? 28  LEU C CD1 1 
ATOM   5794  C CD2 . LEU C 1 28  ? 57.470  46.274  183.931 1.00 35.09  ? 28  LEU C CD2 1 
ATOM   5795  N N   . LEU C 1 29  ? 55.744  47.090  181.763 1.00 36.19  ? 29  LEU C N   1 
ATOM   5796  C CA  . LEU C 1 29  ? 56.334  48.217  181.108 1.00 33.65  ? 29  LEU C CA  1 
ATOM   5797  C C   . LEU C 1 29  ? 57.486  48.695  181.873 1.00 30.31  ? 29  LEU C C   1 
ATOM   5798  O O   . LEU C 1 29  ? 58.538  48.945  181.329 1.00 30.02  ? 29  LEU C O   1 
ATOM   5799  C CB  . LEU C 1 29  ? 55.308  49.278  180.957 1.00 37.65  ? 29  LEU C CB  1 
ATOM   5800  C CG  . LEU C 1 29  ? 54.949  48.697  179.611 1.00 44.67  ? 29  LEU C CG  1 
ATOM   5801  C CD1 . LEU C 1 29  ? 53.449  48.520  179.358 1.00 49.71  ? 29  LEU C CD1 1 
ATOM   5802  C CD2 . LEU C 1 29  ? 55.683  49.565  178.600 1.00 51.25  ? 29  LEU C CD2 1 
ATOM   5803  N N   . ILE C 1 30  ? 57.274  48.840  183.155 1.00 27.36  ? 30  ILE C N   1 
ATOM   5804  C CA  . ILE C 1 30  ? 58.343  49.233  183.991 1.00 26.87  ? 30  ILE C CA  1 
ATOM   5805  C C   . ILE C 1 30  ? 57.896  49.063  185.396 1.00 28.75  ? 30  ILE C C   1 
ATOM   5806  O O   . ILE C 1 30  ? 56.711  49.078  185.711 1.00 28.77  ? 30  ILE C O   1 
ATOM   5807  C CB  . ILE C 1 30  ? 58.815  50.615  183.678 1.00 27.05  ? 30  ILE C CB  1 
ATOM   5808  C CG1 . ILE C 1 30  ? 59.730  51.125  184.779 1.00 29.65  ? 30  ILE C CG1 1 
ATOM   5809  C CG2 . ILE C 1 30  ? 57.658  51.496  183.389 1.00 23.22  ? 30  ILE C CG2 1 
ATOM   5810  C CD1 . ILE C 1 30  ? 60.234  52.542  184.534 1.00 36.45  ? 30  ILE C CD1 1 
ATOM   5811  N N   . LYS C 1 31  ? 58.863  48.677  186.184 1.00 31.02  ? 31  LYS C N   1 
ATOM   5812  C CA  . LYS C 1 31  ? 58.686  48.427  187.573 1.00 40.13  ? 31  LYS C CA  1 
ATOM   5813  C C   . LYS C 1 31  ? 59.633  49.399  188.206 1.00 44.09  ? 31  LYS C C   1 
ATOM   5814  O O   . LYS C 1 31  ? 60.602  49.813  187.587 1.00 43.85  ? 31  LYS C O   1 
ATOM   5815  C CB  . LYS C 1 31  ? 59.102  46.977  187.839 1.00 47.75  ? 31  LYS C CB  1 
ATOM   5816  C CG  . LYS C 1 31  ? 59.708  46.598  189.219 1.00 61.63  ? 31  LYS C CG  1 
ATOM   5817  C CD  . LYS C 1 31  ? 59.537  45.050  189.474 1.00 73.74  ? 31  LYS C CD  1 
ATOM   5818  C CE  . LYS C 1 31  ? 60.819  44.294  189.966 1.00 80.67  ? 31  LYS C CE  1 
ATOM   5819  N NZ  . LYS C 1 31  ? 60.700  42.764  190.009 1.00 81.43  ? 31  LYS C NZ  1 
ATOM   5820  N N   . GLY C 1 32  ? 59.320  49.808  189.419 1.00 51.01  ? 32  GLY C N   1 
ATOM   5821  C CA  . GLY C 1 32  ? 60.171  50.730  190.129 1.00 56.11  ? 32  GLY C CA  1 
ATOM   5822  C C   . GLY C 1 32  ? 59.313  51.573  191.048 1.00 60.48  ? 32  GLY C C   1 
ATOM   5823  O O   . GLY C 1 32  ? 58.209  51.162  191.473 1.00 58.12  ? 32  GLY C O   1 
ATOM   5824  N N   . GLY C 1 33  ? 59.816  52.779  191.309 1.00 64.55  ? 33  GLY C N   1 
ATOM   5825  C CA  . GLY C 1 33  ? 59.159  53.745  192.181 1.00 66.73  ? 33  GLY C CA  1 
ATOM   5826  C C   . GLY C 1 33  ? 58.206  54.764  191.563 1.00 65.56  ? 33  GLY C C   1 
ATOM   5827  O O   . GLY C 1 33  ? 57.810  54.684  190.384 1.00 63.44  ? 33  GLY C O   1 
ATOM   5828  N N   . MET C 1 34  ? 57.869  55.773  192.357 1.00 63.74  ? 34  MET C N   1 
ATOM   5829  C CA  . MET C 1 34  ? 56.922  56.761  191.886 1.00 62.92  ? 34  MET C CA  1 
ATOM   5830  C C   . MET C 1 34  ? 57.263  57.366  190.526 1.00 59.78  ? 34  MET C C   1 
ATOM   5831  O O   . MET C 1 34  ? 56.389  57.690  189.713 1.00 57.49  ? 34  MET C O   1 
ATOM   5832  C CB  . MET C 1 34  ? 56.653  57.803  192.977 1.00 64.31  ? 34  MET C CB  1 
ATOM   5833  C CG  . MET C 1 34  ? 55.535  57.350  193.935 1.00 62.37  ? 34  MET C CG  1 
ATOM   5834  S SD  . MET C 1 34  ? 54.064  56.609  193.047 1.00 59.46  ? 34  MET C SD  1 
ATOM   5835  C CE  . MET C 1 34  ? 52.914  58.037  192.987 1.00 61.45  ? 34  MET C CE  1 
ATOM   5836  N N   . GLU C 1 35  ? 58.544  57.387  190.236 1.00 56.36  ? 35  GLU C N   1 
ATOM   5837  C CA  . GLU C 1 35  ? 58.996  57.926  188.989 1.00 57.35  ? 35  GLU C CA  1 
ATOM   5838  C C   . GLU C 1 35  ? 58.463  57.114  187.826 1.00 54.95  ? 35  GLU C C   1 
ATOM   5839  O O   . GLU C 1 35  ? 58.132  57.653  186.778 1.00 59.58  ? 35  GLU C O   1 
ATOM   5840  C CB  . GLU C 1 35  ? 60.505  57.924  188.957 1.00 62.27  ? 35  GLU C CB  1 
ATOM   5841  C CG  . GLU C 1 35  ? 61.096  56.542  188.749 1.00 71.04  ? 35  GLU C CG  1 
ATOM   5842  C CD  . GLU C 1 35  ? 61.073  55.673  189.990 1.00 77.49  ? 35  GLU C CD  1 
ATOM   5843  O OE1 . GLU C 1 35  ? 60.797  56.194  191.109 1.00 80.75  ? 35  GLU C OE1 1 
ATOM   5844  O OE2 . GLU C 1 35  ? 61.362  54.460  189.832 1.00 78.28  ? 35  GLU C OE2 1 
ATOM   5845  N N   . VAL C 1 36  ? 58.353  55.817  188.007 1.00 51.73  ? 36  VAL C N   1 
ATOM   5846  C CA  . VAL C 1 36  ? 57.872  54.990  186.930 1.00 56.28  ? 36  VAL C CA  1 
ATOM   5847  C C   . VAL C 1 36  ? 56.618  55.604  186.317 1.00 57.20  ? 36  VAL C C   1 
ATOM   5848  O O   . VAL C 1 36  ? 56.365  55.481  185.120 1.00 56.51  ? 36  VAL C O   1 
ATOM   5849  C CB  . VAL C 1 36  ? 57.604  53.569  187.439 1.00 60.95  ? 36  VAL C CB  1 
ATOM   5850  C CG1 . VAL C 1 36  ? 56.861  52.743  186.414 1.00 63.92  ? 36  VAL C CG1 1 
ATOM   5851  C CG2 . VAL C 1 36  ? 58.918  52.902  187.763 1.00 65.99  ? 36  VAL C CG2 1 
ATOM   5852  N N   . LEU C 1 37  ? 55.902  56.373  187.123 1.00 61.32  ? 37  LEU C N   1 
ATOM   5853  C CA  . LEU C 1 37  ? 54.666  57.001  186.685 1.00 66.08  ? 37  LEU C CA  1 
ATOM   5854  C C   . LEU C 1 37  ? 54.799  57.928  185.493 1.00 68.73  ? 37  LEU C C   1 
ATOM   5855  O O   . LEU C 1 37  ? 53.998  57.865  184.535 1.00 71.24  ? 37  LEU C O   1 
ATOM   5856  C CB  . LEU C 1 37  ? 54.041  57.746  187.861 1.00 65.58  ? 37  LEU C CB  1 
ATOM   5857  C CG  . LEU C 1 37  ? 52.664  57.218  188.276 1.00 63.32  ? 37  LEU C CG  1 
ATOM   5858  C CD1 . LEU C 1 37  ? 52.357  55.908  187.558 1.00 62.09  ? 37  LEU C CD1 1 
ATOM   5859  C CD2 . LEU C 1 37  ? 52.576  57.072  189.786 1.00 63.40  ? 37  LEU C CD2 1 
ATOM   5860  N N   . ASP C 1 38  ? 55.835  58.757  185.563 1.00 69.43  ? 38  ASP C N   1 
ATOM   5861  C CA  . ASP C 1 38  ? 56.151  59.744  184.546 1.00 71.47  ? 38  ASP C CA  1 
ATOM   5862  C C   . ASP C 1 38  ? 56.262  59.137  183.193 1.00 68.16  ? 38  ASP C C   1 
ATOM   5863  O O   . ASP C 1 38  ? 56.338  59.836  182.194 1.00 67.57  ? 38  ASP C O   1 
ATOM   5864  C CB  . ASP C 1 38  ? 57.462  60.443  184.858 1.00 82.15  ? 38  ASP C CB  1 
ATOM   5865  C CG  . ASP C 1 38  ? 57.343  61.426  186.004 1.00 94.85  ? 38  ASP C CG  1 
ATOM   5866  O OD1 . ASP C 1 38  ? 56.304  61.411  186.716 1.00 102.79 ? 38  ASP C OD1 1 
ATOM   5867  O OD2 . ASP C 1 38  ? 58.306  62.210  186.201 1.00 102.39 ? 38  ASP C OD2 1 
ATOM   5868  N N   . LEU C 1 39  ? 56.356  57.830  183.138 1.00 66.33  ? 39  LEU C N   1 
ATOM   5869  C CA  . LEU C 1 39  ? 56.422  57.264  181.841 1.00 67.34  ? 39  LEU C CA  1 
ATOM   5870  C C   . LEU C 1 39  ? 55.101  57.477  181.192 1.00 70.19  ? 39  LEU C C   1 
ATOM   5871  O O   . LEU C 1 39  ? 54.056  57.525  181.846 1.00 74.18  ? 39  LEU C O   1 
ATOM   5872  C CB  . LEU C 1 39  ? 56.689  55.788  181.870 1.00 69.98  ? 39  LEU C CB  1 
ATOM   5873  C CG  . LEU C 1 39  ? 56.715  55.291  180.422 1.00 73.42  ? 39  LEU C CG  1 
ATOM   5874  C CD1 . LEU C 1 39  ? 57.644  56.153  179.533 1.00 76.92  ? 39  LEU C CD1 1 
ATOM   5875  C CD2 . LEU C 1 39  ? 57.159  53.851  180.414 1.00 79.81  ? 39  LEU C CD2 1 
ATOM   5876  N N   . VAL C 1 40  ? 55.191  57.662  179.890 1.00 72.36  ? 40  VAL C N   1 
ATOM   5877  C CA  . VAL C 1 40  ? 54.058  57.842  179.023 1.00 77.27  ? 40  VAL C CA  1 
ATOM   5878  C C   . VAL C 1 40  ? 53.396  56.515  178.869 1.00 75.97  ? 40  VAL C C   1 
ATOM   5879  O O   . VAL C 1 40  ? 53.649  55.743  177.948 1.00 76.11  ? 40  VAL C O   1 
ATOM   5880  C CB  . VAL C 1 40  ? 54.475  58.193  177.673 1.00 83.51  ? 40  VAL C CB  1 
ATOM   5881  C CG1 . VAL C 1 40  ? 53.247  58.626  176.902 1.00 89.91  ? 40  VAL C CG1 1 
ATOM   5882  C CG2 . VAL C 1 40  ? 55.601  59.221  177.727 1.00 92.28  ? 40  VAL C CG2 1 
ATOM   5883  N N   . THR C 1 41  ? 52.425  56.347  179.716 1.00 75.44  ? 41  THR C N   1 
ATOM   5884  C CA  . THR C 1 41  ? 51.687  55.138  179.818 1.00 73.32  ? 41  THR C CA  1 
ATOM   5885  C C   . THR C 1 41  ? 50.957  54.712  178.544 1.00 68.05  ? 41  THR C C   1 
ATOM   5886  O O   . THR C 1 41  ? 51.268  53.682  177.972 1.00 70.28  ? 41  THR C O   1 
ATOM   5887  C CB  . THR C 1 41  ? 50.800  55.272  181.093 1.00 79.45  ? 41  THR C CB  1 
ATOM   5888  O OG1 . THR C 1 41  ? 50.483  56.672  181.285 1.00 84.76  ? 41  THR C OG1 1 
ATOM   5889  C CG2 . THR C 1 41  ? 51.589  54.788  182.379 1.00 81.70  ? 41  THR C CG2 1 
ATOM   5890  N N   . GLY C 1 42  ? 50.110  55.558  178.001 1.00 62.84  ? 42  GLY C N   1 
ATOM   5891  C CA  . GLY C 1 42  ? 49.366  55.106  176.842 1.00 62.68  ? 42  GLY C CA  1 
ATOM   5892  C C   . GLY C 1 42  ? 47.908  55.278  177.242 1.00 61.76  ? 42  GLY C C   1 
ATOM   5893  O O   . GLY C 1 42  ? 47.621  56.338  177.806 1.00 72.34  ? 42  GLY C O   1 
ATOM   5894  N N   . PRO C 1 43  ? 46.977  54.315  177.037 1.00 53.22  ? 43  PRO C N   1 
ATOM   5895  C CA  . PRO C 1 43  ? 45.604  54.597  177.460 1.00 52.94  ? 43  PRO C CA  1 
ATOM   5896  C C   . PRO C 1 43  ? 44.959  53.541  178.336 1.00 56.83  ? 43  PRO C C   1 
ATOM   5897  O O   . PRO C 1 43  ? 44.168  53.865  179.204 1.00 63.02  ? 43  PRO C O   1 
ATOM   5898  C CB  . PRO C 1 43  ? 44.891  54.661  176.150 1.00 48.35  ? 43  PRO C CB  1 
ATOM   5899  C CG  . PRO C 1 43  ? 45.496  53.450  175.479 1.00 53.41  ? 43  PRO C CG  1 
ATOM   5900  C CD  . PRO C 1 43  ? 46.950  53.335  175.949 1.00 49.12  ? 43  PRO C CD  1 
ATOM   5901  N N   . ASP C 1 44  ? 45.271  52.276  178.116 1.00 57.75  ? 44  ASP C N   1 
ATOM   5902  C CA  . ASP C 1 44  ? 44.675  51.215  178.922 1.00 59.11  ? 44  ASP C CA  1 
ATOM   5903  C C   . ASP C 1 44  ? 45.782  50.737  179.834 1.00 52.98  ? 44  ASP C C   1 
ATOM   5904  O O   . ASP C 1 44  ? 45.764  49.670  180.426 1.00 47.54  ? 44  ASP C O   1 
ATOM   5905  C CB  . ASP C 1 44  ? 44.191  50.112  177.984 1.00 74.18  ? 44  ASP C CB  1 
ATOM   5906  C CG  . ASP C 1 44  ? 43.548  50.673  176.698 1.00 80.80  ? 44  ASP C CG  1 
ATOM   5907  O OD1 . ASP C 1 44  ? 42.410  51.217  176.752 1.00 81.19  ? 44  ASP C OD1 1 
ATOM   5908  O OD2 . ASP C 1 44  ? 44.207  50.583  175.633 1.00 87.45  ? 44  ASP C OD2 1 
ATOM   5909  N N   . SER C 1 45  ? 46.775  51.594  179.896 1.00 50.26  ? 45  SER C N   1 
ATOM   5910  C CA  . SER C 1 45  ? 47.958  51.398  180.672 1.00 47.47  ? 45  SER C CA  1 
ATOM   5911  C C   . SER C 1 45  ? 47.592  51.328  182.127 1.00 43.38  ? 45  SER C C   1 
ATOM   5912  O O   . SER C 1 45  ? 47.273  52.337  182.767 1.00 39.72  ? 45  SER C O   1 
ATOM   5913  C CB  . SER C 1 45  ? 48.911  52.574  180.454 1.00 51.84  ? 45  SER C CB  1 
ATOM   5914  O OG  . SER C 1 45  ? 48.549  53.348  179.310 1.00 55.02  ? 45  SER C OG  1 
ATOM   5915  N N   . VAL C 1 46  ? 47.683  50.121  182.647 1.00 41.90  ? 46  VAL C N   1 
ATOM   5916  C CA  . VAL C 1 46  ? 47.399  49.870  184.037 1.00 38.89  ? 46  VAL C CA  1 
ATOM   5917  C C   . VAL C 1 46  ? 48.563  50.112  184.974 1.00 36.94  ? 46  VAL C C   1 
ATOM   5918  O O   . VAL C 1 46  ? 49.702  49.625  184.792 1.00 33.02  ? 46  VAL C O   1 
ATOM   5919  C CB  . VAL C 1 46  ? 47.007  48.472  184.280 1.00 39.72  ? 46  VAL C CB  1 
ATOM   5920  C CG1 . VAL C 1 46  ? 46.248  48.449  185.535 1.00 41.39  ? 46  VAL C CG1 1 
ATOM   5921  C CG2 . VAL C 1 46  ? 46.230  47.910  183.115 1.00 47.25  ? 46  VAL C CG2 1 
ATOM   5922  N N   . THR C 1 47  ? 48.208  50.705  186.084 1.00 33.33  ? 47  THR C N   1 
ATOM   5923  C CA  . THR C 1 47  ? 49.202  51.014  187.039 1.00 35.20  ? 47  THR C CA  1 
ATOM   5924  C C   . THR C 1 47  ? 48.887  50.354  188.345 1.00 36.04  ? 47  THR C C   1 
ATOM   5925  O O   . THR C 1 47  ? 47.732  50.359  188.797 1.00 35.70  ? 47  THR C O   1 
ATOM   5926  C CB  . THR C 1 47  ? 49.257  52.488  187.204 1.00 39.09  ? 47  THR C CB  1 
ATOM   5927  O OG1 . THR C 1 47  ? 49.406  53.111  185.899 1.00 34.87  ? 47  THR C OG1 1 
ATOM   5928  C CG2 . THR C 1 47  ? 50.385  52.824  188.182 1.00 39.51  ? 47  THR C CG2 1 
ATOM   5929  N N   . GLU C 1 48  ? 49.905  49.725  188.913 1.00 35.61  ? 48  GLU C N   1 
ATOM   5930  C CA  . GLU C 1 48  ? 49.758  49.042  190.183 1.00 36.10  ? 48  GLU C CA  1 
ATOM   5931  C C   . GLU C 1 48  ? 50.685  49.735  191.168 1.00 30.86  ? 48  GLU C C   1 
ATOM   5932  O O   . GLU C 1 48  ? 51.903  49.776  190.973 1.00 31.81  ? 48  GLU C O   1 
ATOM   5933  C CB  . GLU C 1 48  ? 50.096  47.531  190.063 1.00 37.97  ? 48  GLU C CB  1 
ATOM   5934  C CG  . GLU C 1 48  ? 49.037  46.663  189.319 1.00 48.24  ? 48  GLU C CG  1 
ATOM   5935  C CD  . GLU C 1 48  ? 49.284  45.119  189.365 1.00 57.30  ? 48  GLU C CD  1 
ATOM   5936  O OE1 . GLU C 1 48  ? 50.307  44.681  189.934 1.00 60.88  ? 48  GLU C OE1 1 
ATOM   5937  O OE2 . GLU C 1 48  ? 48.441  44.320  188.860 1.00 62.97  ? 48  GLU C OE2 1 
ATOM   5938  N N   . ILE C 1 49  ? 50.100  50.311  192.205 1.00 25.06  ? 49  ILE C N   1 
ATOM   5939  C CA  . ILE C 1 49  ? 50.879  50.985  193.221 1.00 20.90  ? 49  ILE C CA  1 
ATOM   5940  C C   . ILE C 1 49  ? 50.698  50.343  194.582 1.00 20.75  ? 49  ILE C C   1 
ATOM   5941  O O   . ILE C 1 49  ? 49.569  50.127  195.045 1.00 19.01  ? 49  ILE C O   1 
ATOM   5942  C CB  . ILE C 1 49  ? 50.443  52.402  193.375 1.00 22.79  ? 49  ILE C CB  1 
ATOM   5943  C CG1 . ILE C 1 49  ? 50.318  53.064  192.009 1.00 23.79  ? 49  ILE C CG1 1 
ATOM   5944  C CG2 . ILE C 1 49  ? 51.380  53.122  194.330 1.00 18.76  ? 49  ILE C CG2 1 
ATOM   5945  C CD1 . ILE C 1 49  ? 49.841  54.514  192.123 1.00 28.56  ? 49  ILE C CD1 1 
ATOM   5946  N N   . GLU C 1 50  ? 51.804  50.141  195.273 1.00 18.99  ? 50  GLU C N   1 
ATOM   5947  C CA  . GLU C 1 50  ? 51.740  49.528  196.568 1.00 22.52  ? 50  GLU C CA  1 
ATOM   5948  C C   . GLU C 1 50  ? 52.433  50.352  197.567 1.00 20.47  ? 50  GLU C C   1 
ATOM   5949  O O   . GLU C 1 50  ? 53.642  50.549  197.481 1.00 17.83  ? 50  GLU C O   1 
ATOM   5950  C CB  . GLU C 1 50  ? 52.449  48.215  196.562 1.00 28.79  ? 50  GLU C CB  1 
ATOM   5951  C CG  . GLU C 1 50  ? 51.888  47.243  195.628 1.00 47.70  ? 50  GLU C CG  1 
ATOM   5952  C CD  . GLU C 1 50  ? 52.835  46.112  195.412 1.00 56.51  ? 50  GLU C CD  1 
ATOM   5953  O OE1 . GLU C 1 50  ? 52.802  45.122  196.188 1.00 54.28  ? 50  GLU C OE1 1 
ATOM   5954  O OE2 . GLU C 1 50  ? 53.634  46.246  194.469 1.00 63.59  ? 50  GLU C OE2 1 
ATOM   5955  N N   . ALA C 1 51  ? 51.696  50.734  198.587 1.00 21.92  ? 51  ALA C N   1 
ATOM   5956  C CA  . ALA C 1 51  ? 52.256  51.521  199.658 1.00 21.71  ? 51  ALA C CA  1 
ATOM   5957  C C   . ALA C 1 51  ? 51.619  51.020  200.904 1.00 23.92  ? 51  ALA C C   1 
ATOM   5958  O O   . ALA C 1 51  ? 50.747  50.151  200.876 1.00 26.04  ? 51  ALA C O   1 
ATOM   5959  C CB  . ALA C 1 51  ? 51.913  52.940  199.488 1.00 20.41  ? 51  ALA C CB  1 
ATOM   5960  N N   . PHE C 1 52  ? 51.955  51.668  201.993 1.00 25.07  ? 52  PHE C N   1 
ATOM   5961  C CA  . PHE C 1 52  ? 51.411  51.267  203.251 1.00 27.02  ? 52  PHE C CA  1 
ATOM   5962  C C   . PHE C 1 52  ? 51.297  52.521  204.070 1.00 29.79  ? 52  PHE C C   1 
ATOM   5963  O O   . PHE C 1 52  ? 51.872  53.565  203.741 1.00 26.80  ? 52  PHE C O   1 
ATOM   5964  C CB  . PHE C 1 52  ? 52.413  50.390  203.924 1.00 26.05  ? 52  PHE C CB  1 
ATOM   5965  C CG  . PHE C 1 52  ? 53.685  51.106  204.220 1.00 30.54  ? 52  PHE C CG  1 
ATOM   5966  C CD1 . PHE C 1 52  ? 53.836  51.833  205.403 1.00 32.31  ? 52  PHE C CD1 1 
ATOM   5967  C CD2 . PHE C 1 52  ? 54.739  51.065  203.327 1.00 34.41  ? 52  PHE C CD2 1 
ATOM   5968  C CE1 . PHE C 1 52  ? 55.035  52.473  205.707 1.00 29.89  ? 52  PHE C CE1 1 
ATOM   5969  C CE2 . PHE C 1 52  ? 55.952  51.707  203.628 1.00 36.06  ? 52  PHE C CE2 1 
ATOM   5970  C CZ  . PHE C 1 52  ? 56.090  52.419  204.814 1.00 33.67  ? 52  PHE C CZ  1 
ATOM   5971  N N   . LEU C 1 53  ? 50.680  52.362  205.223 1.00 35.07  ? 53  LEU C N   1 
ATOM   5972  C CA  . LEU C 1 53  ? 50.510  53.449  206.146 1.00 41.84  ? 53  LEU C CA  1 
ATOM   5973  C C   . LEU C 1 53  ? 50.888  52.949  207.505 1.00 45.58  ? 53  LEU C C   1 
ATOM   5974  O O   . LEU C 1 53  ? 50.575  51.805  207.868 1.00 46.86  ? 53  LEU C O   1 
ATOM   5975  C CB  . LEU C 1 53  ? 49.062  53.840  206.185 1.00 48.04  ? 53  LEU C CB  1 
ATOM   5976  C CG  . LEU C 1 53  ? 48.606  54.909  205.210 1.00 58.42  ? 53  LEU C CG  1 
ATOM   5977  C CD1 . LEU C 1 53  ? 49.539  55.060  204.017 1.00 60.81  ? 53  LEU C CD1 1 
ATOM   5978  C CD2 . LEU C 1 53  ? 47.181  54.562  204.786 1.00 63.85  ? 53  LEU C CD2 1 
ATOM   5979  N N   . ASN C 1 54  ? 51.612  53.778  208.240 1.00 48.46  ? 54  ASN C N   1 
ATOM   5980  C CA  . ASN C 1 54  ? 51.980  53.403  209.585 1.00 52.98  ? 54  ASN C CA  1 
ATOM   5981  C C   . ASN C 1 54  ? 50.902  53.997  210.480 1.00 54.42  ? 54  ASN C C   1 
ATOM   5982  O O   . ASN C 1 54  ? 50.521  55.151  210.338 1.00 54.41  ? 54  ASN C O   1 
ATOM   5983  C CB  . ASN C 1 54  ? 53.406  53.832  209.928 1.00 56.27  ? 54  ASN C CB  1 
ATOM   5984  C CG  . ASN C 1 54  ? 54.412  52.672  209.776 1.00 57.86  ? 54  ASN C CG  1 
ATOM   5985  O OD1 . ASN C 1 54  ? 55.509  52.838  209.215 1.00 58.13  ? 54  ASN C OD1 1 
ATOM   5986  N ND2 . ASN C 1 54  ? 54.037  51.497  210.287 1.00 51.68  ? 54  ASN C ND2 1 
ATOM   5987  N N   . PRO C 1 55  ? 50.311  53.154  211.329 1.00 58.40  ? 55  PRO C N   1 
ATOM   5988  C CA  . PRO C 1 55  ? 49.235  53.455  212.283 1.00 61.44  ? 55  PRO C CA  1 
ATOM   5989  C C   . PRO C 1 55  ? 49.658  54.511  213.258 1.00 61.36  ? 55  PRO C C   1 
ATOM   5990  O O   . PRO C 1 55  ? 50.607  54.332  214.012 1.00 59.46  ? 55  PRO C O   1 
ATOM   5991  C CB  . PRO C 1 55  ? 49.011  52.112  212.968 1.00 66.55  ? 55  PRO C CB  1 
ATOM   5992  C CG  . PRO C 1 55  ? 50.432  51.528  213.011 1.00 64.39  ? 55  PRO C CG  1 
ATOM   5993  C CD  . PRO C 1 55  ? 50.950  51.855  211.632 1.00 60.42  ? 55  PRO C CD  1 
ATOM   5994  N N   . ARG C 1 56  ? 48.926  55.600  213.311 1.00 63.61  ? 56  ARG C N   1 
ATOM   5995  C CA  . ARG C 1 56  ? 49.379  56.623  214.203 1.00 68.79  ? 56  ARG C CA  1 
ATOM   5996  C C   . ARG C 1 56  ? 48.411  57.014  215.306 1.00 68.68  ? 56  ARG C C   1 
ATOM   5997  O O   . ARG C 1 56  ? 47.593  57.923  215.180 1.00 66.97  ? 56  ARG C O   1 
ATOM   5998  C CB  . ARG C 1 56  ? 50.019  57.765  213.376 1.00 73.81  ? 56  ARG C CB  1 
ATOM   5999  C CG  . ARG C 1 56  ? 51.354  57.239  212.655 1.00 78.82  ? 56  ARG C CG  1 
ATOM   6000  C CD  . ARG C 1 56  ? 52.149  58.176  211.699 1.00 80.55  ? 56  ARG C CD  1 
ATOM   6001  N NE  . ARG C 1 56  ? 51.433  58.343  210.446 1.00 92.73  ? 56  ARG C NE  1 
ATOM   6002  C CZ  . ARG C 1 56  ? 50.772  59.445  210.093 1.00 98.00  ? 56  ARG C CZ  1 
ATOM   6003  N NH1 . ARG C 1 56  ? 50.761  60.511  210.882 1.00 102.74 ? 56  ARG C NH1 1 
ATOM   6004  N NH2 . ARG C 1 56  ? 49.972  59.419  209.039 1.00 99.38  ? 56  ARG C NH2 1 
ATOM   6005  N N   . MET C 1 57  ? 48.469  56.204  216.361 1.00 70.10  ? 57  MET C N   1 
ATOM   6006  C CA  . MET C 1 57  ? 47.648  56.382  217.548 1.00 71.06  ? 57  MET C CA  1 
ATOM   6007  C C   . MET C 1 57  ? 48.624  56.770  218.606 1.00 70.68  ? 57  MET C C   1 
ATOM   6008  O O   . MET C 1 57  ? 49.559  56.007  218.874 1.00 65.91  ? 57  MET C O   1 
ATOM   6009  C CB  . MET C 1 57  ? 47.043  55.070  218.001 1.00 73.31  ? 57  MET C CB  1 
ATOM   6010  C CG  . MET C 1 57  ? 46.731  54.121  216.893 1.00 80.27  ? 57  MET C CG  1 
ATOM   6011  S SD  . MET C 1 57  ? 46.832  52.451  217.507 1.00 84.55  ? 57  MET C SD  1 
ATOM   6012  C CE  . MET C 1 57  ? 48.595  52.447  217.967 1.00 85.72  ? 57  MET C CE  1 
ATOM   6013  N N   . GLY C 1 58  ? 48.433  57.974  219.144 1.00 74.72  ? 58  GLY C N   1 
ATOM   6014  C CA  . GLY C 1 58  ? 49.262  58.529  220.212 1.00 78.36  ? 58  GLY C CA  1 
ATOM   6015  C C   . GLY C 1 58  ? 50.666  59.084  219.975 1.00 77.93  ? 58  GLY C C   1 
ATOM   6016  O O   . GLY C 1 58  ? 50.875  60.249  219.622 1.00 74.01  ? 58  GLY C O   1 
ATOM   6017  N N   . GLN C 1 59  ? 51.636  58.239  220.295 1.00 79.02  ? 59  GLN C N   1 
ATOM   6018  C CA  . GLN C 1 59  ? 53.038  58.557  220.170 1.00 75.74  ? 59  GLN C CA  1 
ATOM   6019  C C   . GLN C 1 59  ? 53.432  58.705  218.747 1.00 73.94  ? 59  GLN C C   1 
ATOM   6020  O O   . GLN C 1 59  ? 53.377  57.765  217.954 1.00 73.44  ? 59  GLN C O   1 
ATOM   6021  C CB  . GLN C 1 59  ? 53.915  57.469  220.776 1.00 77.98  ? 59  GLN C CB  1 
ATOM   6022  C CG  . GLN C 1 59  ? 55.395  57.692  220.561 1.00 80.98  ? 59  GLN C CG  1 
ATOM   6023  C CD  . GLN C 1 59  ? 55.963  58.756  221.461 1.00 85.76  ? 59  GLN C CD  1 
ATOM   6024  O OE1 . GLN C 1 59  ? 55.259  59.678  221.902 1.00 85.26  ? 59  GLN C OE1 1 
ATOM   6025  N NE2 . GLN C 1 59  ? 57.240  58.614  221.781 1.00 90.38  ? 59  GLN C NE2 1 
ATOM   6026  N N   . PRO C 1 60  ? 53.887  59.892  218.418 1.00 74.25  ? 60  PRO C N   1 
ATOM   6027  C CA  . PRO C 1 60  ? 54.339  60.247  217.087 1.00 73.08  ? 60  PRO C CA  1 
ATOM   6028  C C   . PRO C 1 60  ? 55.739  59.692  217.006 1.00 70.46  ? 60  PRO C C   1 
ATOM   6029  O O   . PRO C 1 60  ? 56.407  59.470  218.024 1.00 68.84  ? 60  PRO C O   1 
ATOM   6030  C CB  . PRO C 1 60  ? 54.418  61.755  217.164 1.00 77.89  ? 60  PRO C CB  1 
ATOM   6031  C CG  . PRO C 1 60  ? 54.967  61.947  218.576 1.00 80.06  ? 60  PRO C CG  1 
ATOM   6032  C CD  . PRO C 1 60  ? 54.090  60.998  219.369 1.00 77.20  ? 60  PRO C CD  1 
ATOM   6033  N N   . PRO C 1 61  ? 56.224  59.517  215.793 1.00 69.68  ? 61  PRO C N   1 
ATOM   6034  C CA  . PRO C 1 61  ? 57.569  58.992  215.563 1.00 74.38  ? 61  PRO C CA  1 
ATOM   6035  C C   . PRO C 1 61  ? 58.592  59.877  216.267 1.00 79.86  ? 61  PRO C C   1 
ATOM   6036  O O   . PRO C 1 61  ? 58.989  59.601  217.395 1.00 77.70  ? 61  PRO C O   1 
ATOM   6037  C CB  . PRO C 1 61  ? 57.701  59.088  214.054 1.00 74.06  ? 61  PRO C CB  1 
ATOM   6038  C CG  . PRO C 1 61  ? 56.720  60.232  213.703 1.00 72.40  ? 61  PRO C CG  1 
ATOM   6039  C CD  . PRO C 1 61  ? 55.566  59.929  214.548 1.00 65.24  ? 61  PRO C CD  1 
ATOM   6040  N N   . THR C 1 62  ? 58.949  60.967  215.588 1.00 86.15  ? 62  THR C N   1 
ATOM   6041  C CA  . THR C 1 62  ? 59.900  61.974  216.037 1.00 90.89  ? 62  THR C CA  1 
ATOM   6042  C C   . THR C 1 62  ? 60.826  61.606  217.160 1.00 92.87  ? 62  THR C C   1 
ATOM   6043  O O   . THR C 1 62  ? 62.014  61.361  216.926 1.00 96.46  ? 62  THR C O   1 
ATOM   6044  C CB  . THR C 1 62  ? 59.214  63.289  216.367 1.00 92.48  ? 62  THR C CB  1 
ATOM   6045  O OG1 . THR C 1 62  ? 57.939  63.031  216.974 1.00 97.16  ? 62  THR C OG1 1 
ATOM   6046  C CG2 . THR C 1 62  ? 59.047  64.098  215.113 1.00 98.37  ? 62  THR C CG2 1 
ATOM   6047  N N   . PRO C 1 63  ? 60.342  61.644  218.405 1.00 92.46  ? 63  PRO C N   1 
ATOM   6048  C CA  . PRO C 1 63  ? 61.365  61.255  219.366 1.00 93.94  ? 63  PRO C CA  1 
ATOM   6049  C C   . PRO C 1 63  ? 61.734  59.806  219.036 1.00 95.18  ? 63  PRO C C   1 
ATOM   6050  O O   . PRO C 1 63  ? 60.911  58.898  219.130 1.00 96.87  ? 63  PRO C O   1 
ATOM   6051  C CB  . PRO C 1 63  ? 60.635  61.423  220.693 1.00 95.70  ? 63  PRO C CB  1 
ATOM   6052  C CG  . PRO C 1 63  ? 59.578  62.507  220.367 1.00 93.14  ? 63  PRO C CG  1 
ATOM   6053  C CD  . PRO C 1 63  ? 59.080  61.975  219.088 1.00 89.73  ? 63  PRO C CD  1 
ATOM   6054  N N   . GLU C 1 64  ? 62.935  59.616  218.518 1.00 96.95  ? 64  GLU C N   1 
ATOM   6055  C CA  . GLU C 1 64  ? 63.337  58.288  218.136 1.00 104.30 ? 64  GLU C CA  1 
ATOM   6056  C C   . GLU C 1 64  ? 64.021  57.490  219.200 1.00 105.53 ? 64  GLU C C   1 
ATOM   6057  O O   . GLU C 1 64  ? 64.145  56.273  219.082 1.00 107.20 ? 64  GLU C O   1 
ATOM   6058  C CB  . GLU C 1 64  ? 64.212  58.347  216.909 1.00 111.44 ? 64  GLU C CB  1 
ATOM   6059  C CG  . GLU C 1 64  ? 63.425  58.607  215.658 1.00 125.61 ? 64  GLU C CG  1 
ATOM   6060  C CD  . GLU C 1 64  ? 64.304  59.068  214.517 1.00 133.97 ? 64  GLU C CD  1 
ATOM   6061  O OE1 . GLU C 1 64  ? 64.934  60.142  214.673 1.00 139.77 ? 64  GLU C OE1 1 
ATOM   6062  O OE2 . GLU C 1 64  ? 64.365  58.371  213.471 1.00 136.53 ? 64  GLU C OE2 1 
ATOM   6063  N N   . SER C 1 65  ? 64.488  58.153  220.243 1.00 106.36 ? 65  SER C N   1 
ATOM   6064  C CA  . SER C 1 65  ? 65.173  57.411  221.273 1.00 107.97 ? 65  SER C CA  1 
ATOM   6065  C C   . SER C 1 65  ? 64.198  56.575  222.053 1.00 104.90 ? 65  SER C C   1 
ATOM   6066  O O   . SER C 1 65  ? 63.239  57.066  222.636 1.00 103.30 ? 65  SER C O   1 
ATOM   6067  C CB  . SER C 1 65  ? 65.985  58.326  222.183 1.00 114.59 ? 65  SER C CB  1 
ATOM   6068  O OG  . SER C 1 65  ? 67.109  57.635  222.717 1.00 123.48 ? 65  SER C OG  1 
ATOM   6069  N N   . LEU C 1 66  ? 64.511  55.301  222.118 1.00 105.75 ? 66  LEU C N   1 
ATOM   6070  C CA  . LEU C 1 66  ? 63.683  54.348  222.807 1.00 111.69 ? 66  LEU C CA  1 
ATOM   6071  C C   . LEU C 1 66  ? 63.811  54.561  224.298 1.00 115.15 ? 66  LEU C C   1 
ATOM   6072  O O   . LEU C 1 66  ? 63.612  53.644  225.088 1.00 116.29 ? 66  LEU C O   1 
ATOM   6073  C CB  . LEU C 1 66  ? 64.149  52.948  222.452 1.00 114.26 ? 66  LEU C CB  1 
ATOM   6074  C CG  . LEU C 1 66  ? 64.924  52.786  221.141 1.00 116.60 ? 66  LEU C CG  1 
ATOM   6075  C CD1 . LEU C 1 66  ? 65.173  51.308  220.915 1.00 118.92 ? 66  LEU C CD1 1 
ATOM   6076  C CD2 . LEU C 1 66  ? 64.168  53.371  219.960 1.00 116.49 ? 66  LEU C CD2 1 
ATOM   6077  N N   . THR C 1 67  ? 64.185  55.767  224.686 1.00 119.50 ? 67  THR C N   1 
ATOM   6078  C CA  . THR C 1 67  ? 64.360  56.081  226.083 1.00 126.23 ? 67  THR C CA  1 
ATOM   6079  C C   . THR C 1 67  ? 63.534  57.305  226.374 1.00 127.86 ? 67  THR C C   1 
ATOM   6080  O O   . THR C 1 67  ? 62.648  57.291  227.225 1.00 128.04 ? 67  THR C O   1 
ATOM   6081  C CB  . THR C 1 67  ? 65.839  56.417  226.364 1.00 130.14 ? 67  THR C CB  1 
ATOM   6082  O OG1 . THR C 1 67  ? 66.177  57.670  225.754 1.00 133.13 ? 67  THR C OG1 1 
ATOM   6083  C CG2 . THR C 1 67  ? 66.749  55.347  225.762 1.00 135.08 ? 67  THR C CG2 1 
ATOM   6084  N N   . GLU C 1 68  ? 63.805  58.337  225.586 1.00 130.36 ? 68  GLU C N   1 
ATOM   6085  C CA  . GLU C 1 68  ? 63.162  59.632  225.693 1.00 134.57 ? 68  GLU C CA  1 
ATOM   6086  C C   . GLU C 1 68  ? 61.761  59.542  225.135 1.00 130.55 ? 68  GLU C C   1 
ATOM   6087  O O   . GLU C 1 68  ? 60.789  59.984  225.750 1.00 131.41 ? 68  GLU C O   1 
ATOM   6088  C CB  . GLU C 1 68  ? 64.004  60.653  224.935 1.00 144.37 ? 68  GLU C CB  1 
ATOM   6089  C CG  . GLU C 1 68  ? 65.462  60.681  225.440 1.00 161.83 ? 68  GLU C CG  1 
ATOM   6090  C CD  . GLU C 1 68  ? 66.402  61.570  224.621 1.00 171.37 ? 68  GLU C CD  1 
ATOM   6091  O OE1 . GLU C 1 68  ? 66.406  61.441  223.371 1.00 177.32 ? 68  GLU C OE1 1 
ATOM   6092  O OE2 . GLU C 1 68  ? 67.157  62.374  225.232 1.00 177.64 ? 68  GLU C OE2 1 
ATOM   6093  N N   . GLY C 1 69  ? 61.656  58.969  223.950 1.00 126.44 ? 69  GLY C N   1 
ATOM   6094  C CA  . GLY C 1 69  ? 60.342  58.795  223.382 1.00 123.54 ? 69  GLY C CA  1 
ATOM   6095  C C   . GLY C 1 69  ? 59.827  57.493  223.959 1.00 122.18 ? 69  GLY C C   1 
ATOM   6096  O O   . GLY C 1 69  ? 58.743  57.011  223.554 1.00 123.48 ? 69  GLY C O   1 
ATOM   6097  N N   . GLY C 1 70  ? 60.681  56.862  224.787 1.00 118.27 ? 70  GLY C N   1 
ATOM   6098  C CA  . GLY C 1 70  ? 60.395  55.595  225.453 1.00 107.17 ? 70  GLY C CA  1 
ATOM   6099  C C   . GLY C 1 70  ? 60.027  54.526  224.450 1.00 98.78  ? 70  GLY C C   1 
ATOM   6100  O O   . GLY C 1 70  ? 59.981  53.346  224.759 1.00 101.39 ? 70  GLY C O   1 
ATOM   6101  N N   . GLN C 1 71  ? 59.872  54.964  223.209 1.00 89.36  ? 71  GLN C N   1 
ATOM   6102  C CA  . GLN C 1 71  ? 59.459  54.174  222.105 1.00 77.45  ? 71  GLN C CA  1 
ATOM   6103  C C   . GLN C 1 71  ? 58.224  53.391  222.199 1.00 74.65  ? 71  GLN C C   1 
ATOM   6104  O O   . GLN C 1 71  ? 58.162  52.212  222.547 1.00 69.91  ? 71  GLN C O   1 
ATOM   6105  C CB  . GLN C 1 71  ? 60.576  53.679  221.239 1.00 76.03  ? 71  GLN C CB  1 
ATOM   6106  C CG  . GLN C 1 71  ? 60.980  54.864  220.397 1.00 75.91  ? 71  GLN C CG  1 
ATOM   6107  C CD  . GLN C 1 71  ? 59.946  55.993  220.487 1.00 76.31  ? 71  GLN C CD  1 
ATOM   6108  O OE1 . GLN C 1 71  ? 60.123  56.937  221.227 1.00 76.88  ? 71  GLN C OE1 1 
ATOM   6109  N NE2 . GLN C 1 71  ? 58.804  55.802  219.865 1.00 76.41  ? 71  GLN C NE2 1 
ATOM   6110  N N   . TYR C 1 72  ? 57.230  54.257  222.171 1.00 72.66  ? 72  TYR C N   1 
ATOM   6111  C CA  . TYR C 1 72  ? 55.850  53.911  222.239 1.00 75.95  ? 72  TYR C CA  1 
ATOM   6112  C C   . TYR C 1 72  ? 55.330  54.112  220.827 1.00 73.38  ? 72  TYR C C   1 
ATOM   6113  O O   . TYR C 1 72  ? 54.125  54.030  220.572 1.00 75.40  ? 72  TYR C O   1 
ATOM   6114  C CB  . TYR C 1 72  ? 55.177  54.872  223.217 1.00 83.58  ? 72  TYR C CB  1 
ATOM   6115  C CG  . TYR C 1 72  ? 55.673  54.747  224.645 1.00 93.56  ? 72  TYR C CG  1 
ATOM   6116  C CD1 . TYR C 1 72  ? 55.332  53.636  225.432 1.00 98.89  ? 72  TYR C CD1 1 
ATOM   6117  C CD2 . TYR C 1 72  ? 56.499  55.717  225.208 1.00 95.83  ? 72  TYR C CD2 1 
ATOM   6118  C CE1 . TYR C 1 72  ? 55.808  53.491  226.756 1.00 103.74 ? 72  TYR C CE1 1 
ATOM   6119  C CE2 . TYR C 1 72  ? 56.984  55.584  226.531 1.00 102.15 ? 72  TYR C CE2 1 
ATOM   6120  C CZ  . TYR C 1 72  ? 56.635  54.469  227.296 1.00 105.09 ? 72  TYR C CZ  1 
ATOM   6121  O OH  . TYR C 1 72  ? 57.124  54.330  228.581 1.00 106.18 ? 72  TYR C OH  1 
ATOM   6122  N N   . TYR C 1 73  ? 56.248  54.351  219.895 1.00 69.48  ? 73  TYR C N   1 
ATOM   6123  C CA  . TYR C 1 73  ? 55.824  54.588  218.528 1.00 67.18  ? 73  TYR C CA  1 
ATOM   6124  C C   . TYR C 1 73  ? 54.853  53.525  218.127 1.00 64.98  ? 73  TYR C C   1 
ATOM   6125  O O   . TYR C 1 73  ? 55.189  52.338  218.088 1.00 60.74  ? 73  TYR C O   1 
ATOM   6126  C CB  . TYR C 1 73  ? 56.982  54.607  217.545 1.00 68.89  ? 73  TYR C CB  1 
ATOM   6127  C CG  . TYR C 1 73  ? 56.572  55.068  216.151 1.00 69.60  ? 73  TYR C CG  1 
ATOM   6128  C CD1 . TYR C 1 73  ? 55.614  56.058  215.963 1.00 66.68  ? 73  TYR C CD1 1 
ATOM   6129  C CD2 . TYR C 1 73  ? 57.152  54.509  215.017 1.00 72.92  ? 73  TYR C CD2 1 
ATOM   6130  C CE1 . TYR C 1 73  ? 55.249  56.476  214.665 1.00 67.81  ? 73  TYR C CE1 1 
ATOM   6131  C CE2 . TYR C 1 73  ? 56.793  54.918  213.717 1.00 70.39  ? 73  TYR C CE2 1 
ATOM   6132  C CZ  . TYR C 1 73  ? 55.844  55.896  213.536 1.00 67.65  ? 73  TYR C CZ  1 
ATOM   6133  O OH  . TYR C 1 73  ? 55.503  56.260  212.227 1.00 64.88  ? 73  TYR C OH  1 
ATOM   6134  N N   . GLY C 1 74  ? 53.630  53.966  217.873 1.00 64.55  ? 74  GLY C N   1 
ATOM   6135  C CA  . GLY C 1 74  ? 52.608  53.029  217.490 1.00 66.53  ? 74  GLY C CA  1 
ATOM   6136  C C   . GLY C 1 74  ? 52.121  52.372  218.751 1.00 66.58  ? 74  GLY C C   1 
ATOM   6137  O O   . GLY C 1 74  ? 52.299  51.168  219.008 1.00 60.76  ? 74  GLY C O   1 
ATOM   6138  N N   . TRP C 1 75  ? 51.490  53.212  219.544 1.00 69.41  ? 75  TRP C N   1 
ATOM   6139  C CA  . TRP C 1 75  ? 50.935  52.809  220.805 1.00 73.35  ? 75  TRP C CA  1 
ATOM   6140  C C   . TRP C 1 75  ? 50.415  54.081  221.387 1.00 76.80  ? 75  TRP C C   1 
ATOM   6141  O O   . TRP C 1 75  ? 50.967  55.142  221.125 1.00 77.89  ? 75  TRP C O   1 
ATOM   6142  C CB  . TRP C 1 75  ? 52.023  52.269  221.710 1.00 72.66  ? 75  TRP C CB  1 
ATOM   6143  C CG  . TRP C 1 75  ? 52.019  50.812  221.840 1.00 73.72  ? 75  TRP C CG  1 
ATOM   6144  C CD1 . TRP C 1 75  ? 50.986  50.027  222.248 1.00 77.60  ? 75  TRP C CD1 1 
ATOM   6145  C CD2 . TRP C 1 75  ? 53.117  49.951  221.626 1.00 72.63  ? 75  TRP C CD2 1 
ATOM   6146  N NE1 . TRP C 1 75  ? 51.379  48.714  222.307 1.00 73.23  ? 75  TRP C NE1 1 
ATOM   6147  C CE2 . TRP C 1 75  ? 52.686  48.640  221.929 1.00 73.83  ? 75  TRP C CE2 1 
ATOM   6148  C CE3 . TRP C 1 75  ? 54.429  50.157  221.223 1.00 77.52  ? 75  TRP C CE3 1 
ATOM   6149  C CZ2 . TRP C 1 75  ? 53.523  47.540  221.839 1.00 79.28  ? 75  TRP C CZ2 1 
ATOM   6150  C CZ3 . TRP C 1 75  ? 55.270  49.061  221.137 1.00 84.79  ? 75  TRP C CZ3 1 
ATOM   6151  C CH2 . TRP C 1 75  ? 54.812  47.763  221.444 1.00 82.53  ? 75  TRP C CH2 1 
ATOM   6152  N N   . SER C 1 76  ? 49.321  53.992  222.124 1.00 82.88  ? 76  SER C N   1 
ATOM   6153  C CA  . SER C 1 76  ? 48.765  55.167  222.743 1.00 88.04  ? 76  SER C CA  1 
ATOM   6154  C C   . SER C 1 76  ? 49.748  55.326  223.851 1.00 86.55  ? 76  SER C C   1 
ATOM   6155  O O   . SER C 1 76  ? 50.145  54.340  224.463 1.00 88.62  ? 76  SER C O   1 
ATOM   6156  C CB  . SER C 1 76  ? 47.355  54.888  223.251 1.00 94.19  ? 76  SER C CB  1 
ATOM   6157  O OG  . SER C 1 76  ? 46.550  54.345  222.199 1.00 101.75 ? 76  SER C OG  1 
ATOM   6158  N N   . ARG C 1 77  ? 50.231  56.545  224.017 1.00 85.86  ? 77  ARG C N   1 
ATOM   6159  C CA  . ARG C 1 77  ? 51.229  56.827  225.028 1.00 87.99  ? 77  ARG C CA  1 
ATOM   6160  C C   . ARG C 1 77  ? 50.784  56.186  226.340 1.00 87.37  ? 77  ARG C C   1 
ATOM   6161  O O   . ARG C 1 77  ? 51.139  55.047  226.631 1.00 89.30  ? 77  ARG C O   1 
ATOM   6162  C CB  . ARG C 1 77  ? 51.442  58.344  225.138 1.00 89.47  ? 77  ARG C CB  1 
ATOM   6163  C CG  . ARG C 1 77  ? 52.700  58.794  225.852 1.00 98.17  ? 77  ARG C CG  1 
ATOM   6164  C CD  . ARG C 1 77  ? 53.973  58.162  225.332 1.00 108.32 ? 77  ARG C CD  1 
ATOM   6165  N NE  . ARG C 1 77  ? 54.963  58.194  226.402 1.00 126.66 ? 77  ARG C NE  1 
ATOM   6166  C CZ  . ARG C 1 77  ? 55.917  59.112  226.529 1.00 135.85 ? 77  ARG C CZ  1 
ATOM   6167  N NH1 . ARG C 1 77  ? 56.036  60.077  225.627 1.00 142.76 ? 77  ARG C NH1 1 
ATOM   6168  N NH2 . ARG C 1 77  ? 56.691  59.121  227.613 1.00 141.54 ? 77  ARG C NH2 1 
ATOM   6169  N N   . GLY C 1 78  ? 49.926  56.865  227.075 1.00 85.63  ? 78  GLY C N   1 
ATOM   6170  C CA  . GLY C 1 78  ? 49.451  56.310  228.316 1.00 87.78  ? 78  GLY C CA  1 
ATOM   6171  C C   . GLY C 1 78  ? 47.984  56.485  228.162 1.00 90.42  ? 78  GLY C C   1 
ATOM   6172  O O   . GLY C 1 78  ? 47.531  57.102  227.204 1.00 95.86  ? 78  GLY C O   1 
ATOM   6173  N N   . ILE C 1 79  ? 47.212  55.887  229.033 1.00 92.03  ? 79  ILE C N   1 
ATOM   6174  C CA  . ILE C 1 79  ? 45.808  56.078  228.892 1.00 95.58  ? 79  ILE C CA  1 
ATOM   6175  C C   . ILE C 1 79  ? 45.404  56.987  229.974 1.00 102.23 ? 79  ILE C C   1 
ATOM   6176  O O   . ILE C 1 79  ? 45.483  56.668  231.159 1.00 109.11 ? 79  ILE C O   1 
ATOM   6177  C CB  . ILE C 1 79  ? 45.030  54.787  228.893 1.00 92.53  ? 79  ILE C CB  1 
ATOM   6178  C CG1 . ILE C 1 79  ? 44.571  54.554  227.475 1.00 90.61  ? 79  ILE C CG1 1 
ATOM   6179  C CG2 . ILE C 1 79  ? 43.804  54.890  229.723 1.00 94.40  ? 79  ILE C CG2 1 
ATOM   6180  C CD1 . ILE C 1 79  ? 43.749  55.711  226.938 1.00 87.37  ? 79  ILE C CD1 1 
ATOM   6181  N N   . ASN C 1 80  ? 45.183  58.209  229.565 1.00 107.10 ? 80  ASN C N   1 
ATOM   6182  C CA  . ASN C 1 80  ? 44.775  59.195  230.507 1.00 112.58 ? 80  ASN C CA  1 
ATOM   6183  C C   . ASN C 1 80  ? 43.344  58.993  230.850 1.00 108.41 ? 80  ASN C C   1 
ATOM   6184  O O   . ASN C 1 80  ? 42.456  59.138  229.994 1.00 106.43 ? 80  ASN C O   1 
ATOM   6185  C CB  . ASN C 1 80  ? 44.855  60.582  229.941 1.00 129.84 ? 80  ASN C CB  1 
ATOM   6186  C CG  . ASN C 1 80  ? 44.322  61.602  230.920 1.00 145.56 ? 80  ASN C CG  1 
ATOM   6187  O OD1 . ASN C 1 80  ? 43.254  62.179  230.730 1.00 155.50 ? 80  ASN C OD1 1 
ATOM   6188  N ND2 . ASN C 1 80  ? 45.023  61.758  232.034 1.00 155.25 ? 80  ASN C ND2 1 
ATOM   6189  N N   . LEU C 1 81  ? 43.112  58.692  232.112 1.00 107.12 ? 81  LEU C N   1 
ATOM   6190  C CA  . LEU C 1 81  ? 41.759  58.517  232.591 1.00 108.20 ? 81  LEU C CA  1 
ATOM   6191  C C   . LEU C 1 81  ? 41.290  59.902  233.009 1.00 108.20 ? 81  LEU C C   1 
ATOM   6192  O O   . LEU C 1 81  ? 42.113  60.761  233.299 1.00 106.44 ? 81  LEU C O   1 
ATOM   6193  C CB  . LEU C 1 81  ? 41.754  57.611  233.810 1.00 110.87 ? 81  LEU C CB  1 
ATOM   6194  C CG  . LEU C 1 81  ? 40.383  56.977  234.040 1.00 113.90 ? 81  LEU C CG  1 
ATOM   6195  C CD1 . LEU C 1 81  ? 40.326  55.637  233.293 1.00 114.61 ? 81  LEU C CD1 1 
ATOM   6196  C CD2 . LEU C 1 81  ? 40.137  56.780  235.540 1.00 120.33 ? 81  LEU C CD2 1 
ATOM   6197  N N   . ALA C 1 82  ? 39.986  60.115  233.102 1.00 109.08 ? 82  ALA C N   1 
ATOM   6198  C CA  . ALA C 1 82  ? 39.509  61.432  233.502 1.00 111.50 ? 82  ALA C CA  1 
ATOM   6199  C C   . ALA C 1 82  ? 39.342  61.602  235.016 1.00 113.69 ? 82  ALA C C   1 
ATOM   6200  O O   . ALA C 1 82  ? 39.586  60.676  235.799 1.00 113.21 ? 82  ALA C O   1 
ATOM   6201  C CB  . ALA C 1 82  ? 38.236  61.758  232.797 1.00 109.54 ? 82  ALA C CB  1 
ATOM   6202  N N   . THR C 1 83  ? 38.927  62.804  235.406 1.00 115.87 ? 83  THR C N   1 
ATOM   6203  C CA  . THR C 1 83  ? 38.709  63.178  236.801 1.00 116.91 ? 83  THR C CA  1 
ATOM   6204  C C   . THR C 1 83  ? 37.354  62.715  237.312 1.00 117.76 ? 83  THR C C   1 
ATOM   6205  O O   . THR C 1 83  ? 37.282  61.956  238.276 1.00 118.87 ? 83  THR C O   1 
ATOM   6206  C CB  . THR C 1 83  ? 38.812  64.701  236.970 1.00 117.01 ? 83  THR C CB  1 
ATOM   6207  O OG1 . THR C 1 83  ? 40.192  65.091  236.932 1.00 115.07 ? 83  THR C OG1 1 
ATOM   6208  C CG2 . THR C 1 83  ? 38.148  65.164  238.267 1.00 117.50 ? 83  THR C CG2 1 
ATOM   6209  N N   . SER C 1 84  ? 36.284  63.215  236.702 1.00 119.68 ? 84  SER C N   1 
ATOM   6210  C CA  . SER C 1 84  ? 34.940  62.828  237.094 1.00 122.16 ? 84  SER C CA  1 
ATOM   6211  C C   . SER C 1 84  ? 33.904  63.565  236.294 1.00 120.62 ? 84  SER C C   1 
ATOM   6212  O O   . SER C 1 84  ? 33.952  64.789  236.221 1.00 118.63 ? 84  SER C O   1 
ATOM   6213  C CB  . SER C 1 84  ? 34.689  63.111  238.568 1.00 128.35 ? 84  SER C CB  1 
ATOM   6214  O OG  . SER C 1 84  ? 33.353  62.770  238.917 1.00 135.87 ? 84  SER C OG  1 
ATOM   6215  N N   . ASP C 1 85  ? 32.924  62.790  235.818 1.00 121.03 ? 85  ASP C N   1 
ATOM   6216  C CA  . ASP C 1 85  ? 31.774  63.212  234.999 1.00 120.70 ? 85  ASP C CA  1 
ATOM   6217  C C   . ASP C 1 85  ? 31.929  64.578  234.347 1.00 120.77 ? 85  ASP C C   1 
ATOM   6218  O O   . ASP C 1 85  ? 31.922  64.698  233.123 1.00 122.51 ? 85  ASP C O   1 
ATOM   6219  C CB  . ASP C 1 85  ? 30.472  63.131  235.817 1.00 121.93 ? 85  ASP C CB  1 
ATOM   6220  C CG  . ASP C 1 85  ? 29.216  62.974  234.945 1.00 122.27 ? 85  ASP C CG  1 
ATOM   6221  O OD1 . ASP C 1 85  ? 28.954  61.872  234.402 1.00 124.01 ? 85  ASP C OD1 1 
ATOM   6222  O OD2 . ASP C 1 85  ? 28.450  63.951  234.840 1.00 121.53 ? 85  ASP C OD2 1 
ATOM   6223  N N   . THR C 1 86  ? 32.085  65.607  235.157 1.00 119.14 ? 86  THR C N   1 
ATOM   6224  C CA  . THR C 1 86  ? 32.276  66.935  234.621 1.00 121.38 ? 86  THR C CA  1 
ATOM   6225  C C   . THR C 1 86  ? 33.652  67.128  233.980 1.00 120.55 ? 86  THR C C   1 
ATOM   6226  O O   . THR C 1 86  ? 33.773  67.798  232.964 1.00 120.71 ? 86  THR C O   1 
ATOM   6227  C CB  . THR C 1 86  ? 32.122  67.980  235.718 1.00 123.80 ? 86  THR C CB  1 
ATOM   6228  O OG1 . THR C 1 86  ? 32.409  69.286  235.179 1.00 126.92 ? 86  THR C OG1 1 
ATOM   6229  C CG2 . THR C 1 86  ? 33.083  67.659  236.880 1.00 124.35 ? 86  THR C CG2 1 
ATOM   6230  N N   . GLU C 1 87  ? 34.692  66.556  234.584 1.00 110.80 ? 87  GLU C N   1 
ATOM   6231  C CA  . GLU C 1 87  ? 36.047  66.741  234.092 1.00 115.40 ? 87  GLU C CA  1 
ATOM   6232  C C   . GLU C 1 87  ? 36.628  65.572  233.330 1.00 119.82 ? 87  GLU C C   1 
ATOM   6233  O O   . GLU C 1 87  ? 37.268  64.680  233.930 1.00 110.84 ? 87  GLU C O   1 
ATOM   6234  C CB  . GLU C 1 87  ? 36.971  67.104  235.209 1.00 123.73 ? 87  GLU C CB  1 
ATOM   6235  C CG  . GLU C 1 87  ? 38.342  67.367  234.684 1.00 125.44 ? 87  GLU C CG  1 
ATOM   6236  C CD  . GLU C 1 87  ? 39.032  68.471  235.441 1.00 127.14 ? 87  GLU C CD  1 
ATOM   6237  O OE1 . GLU C 1 87  ? 38.386  69.059  236.363 1.00 122.97 ? 87  GLU C OE1 1 
ATOM   6238  O OE2 . GLU C 1 87  ? 40.212  68.755  235.109 1.00 115.04 ? 87  GLU C OE2 1 
ATOM   6239  N N   . ASP C 1 88  ? 36.538  65.633  232.006 1.00 110.65 ? 88  ASP C N   1 
ATOM   6240  C CA  . ASP C 1 88  ? 37.142  64.608  231.196 1.00 103.34 ? 88  ASP C CA  1 
ATOM   6241  C C   . ASP C 1 88  ? 38.089  65.216  230.222 1.00 98.79  ? 88  ASP C C   1 
ATOM   6242  O O   . ASP C 1 88  ? 37.690  65.754  229.185 1.00 94.26  ? 88  ASP C O   1 
ATOM   6243  C CB  . ASP C 1 88  ? 36.147  63.781  230.383 1.00 103.40 ? 88  ASP C CB  1 
ATOM   6244  C CG  . ASP C 1 88  ? 36.858  62.732  229.499 1.00 102.77 ? 88  ASP C CG  1 
ATOM   6245  O OD1 . ASP C 1 88  ? 37.961  62.264  229.880 1.00 100.99 ? 88  ASP C OD1 1 
ATOM   6246  O OD2 . ASP C 1 88  ? 36.329  62.369  228.435 1.00 101.41 ? 88  ASP C OD2 1 
ATOM   6247  N N   . SER C 1 89  ? 39.341  65.169  230.576 1.00 95.85  ? 89  SER C N   1 
ATOM   6248  C CA  . SER C 1 89  ? 40.344  65.661  229.684 1.00 95.86  ? 89  SER C CA  1 
ATOM   6249  C C   . SER C 1 89  ? 40.986  64.381  229.189 1.00 93.85  ? 89  SER C C   1 
ATOM   6250  O O   . SER C 1 89  ? 41.001  63.378  229.896 1.00 97.12  ? 89  SER C O   1 
ATOM   6251  C CB  . SER C 1 89  ? 41.368  66.522  230.412 1.00 101.12 ? 89  SER C CB  1 
ATOM   6252  O OG  . SER C 1 89  ? 42.435  66.861  229.534 1.00 106.61 ? 89  SER C OG  1 
ATOM   6253  N N   . PRO C 1 90  ? 41.307  64.337  227.900 1.00 89.98  ? 90  PRO C N   1 
ATOM   6254  C CA  . PRO C 1 90  ? 41.940  63.155  227.337 1.00 86.33  ? 90  PRO C CA  1 
ATOM   6255  C C   . PRO C 1 90  ? 43.429  63.330  227.407 1.00 83.02  ? 90  PRO C C   1 
ATOM   6256  O O   . PRO C 1 90  ? 44.024  63.103  228.428 1.00 86.99  ? 90  PRO C O   1 
ATOM   6257  C CB  . PRO C 1 90  ? 41.468  63.173  225.900 1.00 88.65  ? 90  PRO C CB  1 
ATOM   6258  C CG  . PRO C 1 90  ? 40.162  63.818  226.005 1.00 93.50  ? 90  PRO C CG  1 
ATOM   6259  C CD  . PRO C 1 90  ? 40.474  64.978  226.881 1.00 91.96  ? 90  PRO C CD  1 
ATOM   6260  N N   . GLY C 1 91  ? 44.019  63.896  226.375 1.00 78.52  ? 91  GLY C N   1 
ATOM   6261  C CA  . GLY C 1 91  ? 45.456  64.034  226.382 1.00 77.87  ? 91  GLY C CA  1 
ATOM   6262  C C   . GLY C 1 91  ? 45.742  63.553  224.996 1.00 78.20  ? 91  GLY C C   1 
ATOM   6263  O O   . GLY C 1 91  ? 45.359  62.459  224.610 1.00 79.35  ? 91  GLY C O   1 
ATOM   6264  N N   . ASN C 1 92  ? 46.474  64.336  224.247 1.00 78.58  ? 92  ASN C N   1 
ATOM   6265  C CA  . ASN C 1 92  ? 46.684  63.973  222.873 1.00 78.99  ? 92  ASN C CA  1 
ATOM   6266  C C   . ASN C 1 92  ? 47.367  62.670  222.480 1.00 76.01  ? 92  ASN C C   1 
ATOM   6267  O O   . ASN C 1 92  ? 47.187  62.187  221.379 1.00 73.44  ? 92  ASN C O   1 
ATOM   6268  C CB  . ASN C 1 92  ? 47.193  65.192  222.125 1.00 84.20  ? 92  ASN C CB  1 
ATOM   6269  C CG  . ASN C 1 92  ? 46.166  66.327  222.133 1.00 87.09  ? 92  ASN C CG  1 
ATOM   6270  O OD1 . ASN C 1 92  ? 44.994  66.117  222.501 1.00 83.49  ? 92  ASN C OD1 1 
ATOM   6271  N ND2 . ASN C 1 92  ? 46.599  67.531  221.762 1.00 90.42  ? 92  ASN C ND2 1 
ATOM   6272  N N   . ASN C 1 93  ? 48.077  62.041  223.390 1.00 75.41  ? 93  ASN C N   1 
ATOM   6273  C CA  . ASN C 1 93  ? 48.715  60.785  223.029 1.00 78.27  ? 93  ASN C CA  1 
ATOM   6274  C C   . ASN C 1 93  ? 47.893  59.674  223.643 1.00 76.13  ? 93  ASN C C   1 
ATOM   6275  O O   . ASN C 1 93  ? 48.257  58.495  223.653 1.00 76.67  ? 93  ASN C O   1 
ATOM   6276  C CB  . ASN C 1 93  ? 50.152  60.763  223.499 1.00 87.18  ? 93  ASN C CB  1 
ATOM   6277  C CG  . ASN C 1 93  ? 50.475  61.945  224.344 1.00 95.40  ? 93  ASN C CG  1 
ATOM   6278  O OD1 . ASN C 1 93  ? 51.063  62.912  223.876 1.00 101.19 ? 93  ASN C OD1 1 
ATOM   6279  N ND2 . ASN C 1 93  ? 49.991  61.933  225.576 1.00 101.46 ? 93  ASN C ND2 1 
ATOM   6280  N N   . THR C 1 94  ? 46.782  60.088  224.207 1.00 71.74  ? 94  THR C N   1 
ATOM   6281  C CA  . THR C 1 94  ? 45.839  59.171  224.779 1.00 71.89  ? 94  THR C CA  1 
ATOM   6282  C C   . THR C 1 94  ? 45.002  58.863  223.568 1.00 70.03  ? 94  THR C C   1 
ATOM   6283  O O   . THR C 1 94  ? 44.206  57.938  223.572 1.00 73.59  ? 94  THR C O   1 
ATOM   6284  C CB  . THR C 1 94  ? 44.923  59.926  225.729 1.00 75.41  ? 94  THR C CB  1 
ATOM   6285  O OG1 . THR C 1 94  ? 45.719  60.555  226.738 1.00 83.99  ? 94  THR C OG1 1 
ATOM   6286  C CG2 . THR C 1 94  ? 43.838  59.028  226.331 1.00 76.30  ? 94  THR C CG2 1 
ATOM   6287  N N   . LEU C 1 95  ? 45.222  59.618  222.501 1.00 64.89  ? 95  LEU C N   1 
ATOM   6288  C CA  . LEU C 1 95  ? 44.397  59.459  221.344 1.00 61.55  ? 95  LEU C CA  1 
ATOM   6289  C C   . LEU C 1 95  ? 44.773  58.839  220.044 1.00 60.69  ? 95  LEU C C   1 
ATOM   6290  O O   . LEU C 1 95  ? 45.702  59.242  219.367 1.00 64.98  ? 95  LEU C O   1 
ATOM   6291  C CB  . LEU C 1 95  ? 43.708  60.763  221.081 1.00 59.85  ? 95  LEU C CB  1 
ATOM   6292  C CG  . LEU C 1 95  ? 42.675  60.691  222.169 1.00 62.23  ? 95  LEU C CG  1 
ATOM   6293  C CD1 . LEU C 1 95  ? 42.233  62.060  222.595 1.00 65.87  ? 95  LEU C CD1 1 
ATOM   6294  C CD2 . LEU C 1 95  ? 41.554  59.791  221.652 1.00 67.45  ? 95  LEU C CD2 1 
ATOM   6295  N N   . PRO C 1 96  ? 44.083  57.771  219.709 1.00 58.16  ? 96  PRO C N   1 
ATOM   6296  C CA  . PRO C 1 96  ? 44.347  57.106  218.450 1.00 53.29  ? 96  PRO C CA  1 
ATOM   6297  C C   . PRO C 1 96  ? 43.557  57.928  217.416 1.00 47.34  ? 96  PRO C C   1 
ATOM   6298  O O   . PRO C 1 96  ? 42.343  58.220  217.561 1.00 39.17  ? 96  PRO C O   1 
ATOM   6299  C CB  . PRO C 1 96  ? 43.803  55.710  218.696 1.00 53.91  ? 96  PRO C CB  1 
ATOM   6300  C CG  . PRO C 1 96  ? 42.713  55.966  219.672 1.00 60.84  ? 96  PRO C CG  1 
ATOM   6301  C CD  . PRO C 1 96  ? 43.342  56.898  220.622 1.00 57.74  ? 96  PRO C CD  1 
ATOM   6302  N N   . THR C 1 97  ? 44.317  58.390  216.440 1.00 44.30  ? 97  THR C N   1 
ATOM   6303  C CA  . THR C 1 97  ? 43.828  59.225  215.375 1.00 48.13  ? 97  THR C CA  1 
ATOM   6304  C C   . THR C 1 97  ? 43.985  58.596  214.018 1.00 49.65  ? 97  THR C C   1 
ATOM   6305  O O   . THR C 1 97  ? 44.916  57.829  213.775 1.00 50.65  ? 97  THR C O   1 
ATOM   6306  C CB  . THR C 1 97  ? 44.644  60.459  215.323 1.00 51.33  ? 97  THR C CB  1 
ATOM   6307  O OG1 . THR C 1 97  ? 45.994  60.109  215.658 1.00 56.69  ? 97  THR C OG1 1 
ATOM   6308  C CG2 . THR C 1 97  ? 44.124  61.472  216.292 1.00 54.07  ? 97  THR C CG2 1 
ATOM   6309  N N   . TRP C 1 98  ? 43.093  59.014  213.129 1.00 51.70  ? 98  TRP C N   1 
ATOM   6310  C CA  . TRP C 1 98  ? 43.013  58.576  211.750 1.00 51.55  ? 98  TRP C CA  1 
ATOM   6311  C C   . TRP C 1 98  ? 44.286  58.818  211.017 1.00 53.59  ? 98  TRP C C   1 
ATOM   6312  O O   . TRP C 1 98  ? 44.763  59.965  210.995 1.00 55.51  ? 98  TRP C O   1 
ATOM   6313  C CB  . TRP C 1 98  ? 41.941  59.377  211.036 1.00 54.74  ? 98  TRP C CB  1 
ATOM   6314  C CG  . TRP C 1 98  ? 40.611  58.800  211.186 1.00 56.45  ? 98  TRP C CG  1 
ATOM   6315  C CD1 . TRP C 1 98  ? 39.666  59.111  212.138 1.00 56.20  ? 98  TRP C CD1 1 
ATOM   6316  C CD2 . TRP C 1 98  ? 40.048  57.780  210.369 1.00 60.03  ? 98  TRP C CD2 1 
ATOM   6317  N NE1 . TRP C 1 98  ? 38.544  58.335  211.954 1.00 59.79  ? 98  TRP C NE1 1 
ATOM   6318  C CE2 . TRP C 1 98  ? 38.752  57.506  210.875 1.00 62.50  ? 98  TRP C CE2 1 
ATOM   6319  C CE3 . TRP C 1 98  ? 40.516  57.052  209.262 1.00 61.94  ? 98  TRP C CE3 1 
ATOM   6320  C CZ2 . TRP C 1 98  ? 37.915  56.530  210.301 1.00 63.43  ? 98  TRP C CZ2 1 
ATOM   6321  C CZ3 . TRP C 1 98  ? 39.692  56.082  208.695 1.00 63.14  ? 98  TRP C CZ3 1 
ATOM   6322  C CH2 . TRP C 1 98  ? 38.407  55.829  209.218 1.00 64.52  ? 98  TRP C CH2 1 
ATOM   6323  N N   . SER C 1 99  ? 44.750  57.773  210.328 1.00 54.19  ? 99  SER C N   1 
ATOM   6324  C CA  . SER C 1 99  ? 45.979  57.805  209.525 1.00 54.75  ? 99  SER C CA  1 
ATOM   6325  C C   . SER C 1 99  ? 45.610  57.788  208.038 1.00 53.07  ? 99  SER C C   1 
ATOM   6326  O O   . SER C 1 99  ? 44.680  57.075  207.622 1.00 50.92  ? 99  SER C O   1 
ATOM   6327  C CB  . SER C 1 99  ? 46.867  56.574  209.805 1.00 57.89  ? 99  SER C CB  1 
ATOM   6328  O OG  . SER C 1 99  ? 47.122  56.330  211.187 1.00 65.82  ? 99  SER C OG  1 
ATOM   6329  N N   . MET C 1 100 ? 46.361  58.537  207.233 1.00 53.89  ? 100 MET C N   1 
ATOM   6330  C CA  . MET C 1 100 ? 46.115  58.587  205.786 1.00 55.35  ? 100 MET C CA  1 
ATOM   6331  C C   . MET C 1 100 ? 47.213  59.306  205.002 1.00 52.86  ? 100 MET C C   1 
ATOM   6332  O O   . MET C 1 100 ? 48.128  59.902  205.580 1.00 51.90  ? 100 MET C O   1 
ATOM   6333  C CB  . MET C 1 100 ? 44.797  59.304  205.495 1.00 58.75  ? 100 MET C CB  1 
ATOM   6334  C CG  . MET C 1 100 ? 44.895  60.833  205.634 1.00 63.15  ? 100 MET C CG  1 
ATOM   6335  S SD  . MET C 1 100 ? 46.039  61.716  204.504 1.00 58.56  ? 100 MET C SD  1 
ATOM   6336  C CE  . MET C 1 100 ? 45.144  63.276  204.396 1.00 64.92  ? 100 MET C CE  1 
ATOM   6337  N N   . ALA C 1 101 ? 47.051  59.325  203.683 1.00 51.23  ? 101 ALA C N   1 
ATOM   6338  C CA  . ALA C 1 101 ? 47.987  60.003  202.816 1.00 51.45  ? 101 ALA C CA  1 
ATOM   6339  C C   . ALA C 1 101 ? 47.461  60.076  201.413 1.00 48.70  ? 101 ALA C C   1 
ATOM   6340  O O   . ALA C 1 101 ? 46.529  59.349  201.028 1.00 42.79  ? 101 ALA C O   1 
ATOM   6341  C CB  . ALA C 1 101 ? 49.296  59.296  202.817 1.00 56.86  ? 101 ALA C CB  1 
ATOM   6342  N N   . LYS C 1 102 ? 48.093  60.942  200.639 1.00 47.37  ? 102 LYS C N   1 
ATOM   6343  C CA  . LYS C 1 102 ? 47.690  61.078  199.272 1.00 51.47  ? 102 LYS C CA  1 
ATOM   6344  C C   . LYS C 1 102 ? 48.817  60.769  198.342 1.00 49.60  ? 102 LYS C C   1 
ATOM   6345  O O   . LYS C 1 102 ? 49.942  61.266  198.489 1.00 48.31  ? 102 LYS C O   1 
ATOM   6346  C CB  . LYS C 1 102 ? 47.144  62.464  198.963 1.00 59.75  ? 102 LYS C CB  1 
ATOM   6347  C CG  . LYS C 1 102 ? 46.696  62.623  197.506 1.00 68.04  ? 102 LYS C CG  1 
ATOM   6348  C CD  . LYS C 1 102 ? 46.261  64.068  197.158 1.00 77.76  ? 102 LYS C CD  1 
ATOM   6349  C CE  . LYS C 1 102 ? 47.410  65.113  197.193 1.00 82.54  ? 102 LYS C CE  1 
ATOM   6350  N NZ  . LYS C 1 102 ? 47.079  66.453  196.558 1.00 86.95  ? 102 LYS C NZ  1 
ATOM   6351  N N   . LEU C 1 103 ? 48.494  59.883  197.417 1.00 48.27  ? 103 LEU C N   1 
ATOM   6352  C CA  . LEU C 1 103 ? 49.400  59.465  196.386 1.00 46.59  ? 103 LEU C CA  1 
ATOM   6353  C C   . LEU C 1 103 ? 49.201  60.491  195.336 1.00 48.56  ? 103 LEU C C   1 
ATOM   6354  O O   . LEU C 1 103 ? 48.063  60.742  194.911 1.00 45.29  ? 103 LEU C O   1 
ATOM   6355  C CB  . LEU C 1 103 ? 48.975  58.128  195.802 1.00 41.94  ? 103 LEU C CB  1 
ATOM   6356  C CG  . LEU C 1 103 ? 49.582  57.009  196.596 1.00 38.44  ? 103 LEU C CG  1 
ATOM   6357  C CD1 . LEU C 1 103 ? 51.070  57.134  196.506 1.00 37.35  ? 103 LEU C CD1 1 
ATOM   6358  C CD2 . LEU C 1 103 ? 49.126  57.147  198.030 1.00 39.41  ? 103 LEU C CD2 1 
ATOM   6359  N N   . GLN C 1 104 ? 50.284  61.120  194.926 1.00 51.75  ? 104 GLN C N   1 
ATOM   6360  C CA  . GLN C 1 104 ? 50.122  62.095  193.885 1.00 54.17  ? 104 GLN C CA  1 
ATOM   6361  C C   . GLN C 1 104 ? 50.417  61.483  192.529 1.00 50.21  ? 104 GLN C C   1 
ATOM   6362  O O   . GLN C 1 104 ? 51.559  61.133  192.209 1.00 48.17  ? 104 GLN C O   1 
ATOM   6363  C CB  . GLN C 1 104 ? 50.977  63.326  194.152 1.00 63.51  ? 104 GLN C CB  1 
ATOM   6364  C CG  . GLN C 1 104 ? 50.771  64.455  193.122 1.00 70.71  ? 104 GLN C CG  1 
ATOM   6365  C CD  . GLN C 1 104 ? 49.305  64.778  192.839 1.00 72.21  ? 104 GLN C CD  1 
ATOM   6366  O OE1 . GLN C 1 104 ? 48.702  65.677  193.464 1.00 74.75  ? 104 GLN C OE1 1 
ATOM   6367  N NE2 . GLN C 1 104 ? 48.730  64.063  191.881 1.00 73.88  ? 104 GLN C NE2 1 
ATOM   6368  N N   . LEU C 1 105 ? 49.366  61.296  191.754 1.00 45.68  ? 105 LEU C N   1 
ATOM   6369  C CA  . LEU C 1 105 ? 49.549  60.736  190.444 1.00 45.77  ? 105 LEU C CA  1 
ATOM   6370  C C   . LEU C 1 105 ? 49.871  61.830  189.450 1.00 49.46  ? 105 LEU C C   1 
ATOM   6371  O O   . LEU C 1 105 ? 49.695  63.009  189.735 1.00 50.45  ? 105 LEU C O   1 
ATOM   6372  C CB  . LEU C 1 105 ? 48.326  59.968  190.038 1.00 38.04  ? 105 LEU C CB  1 
ATOM   6373  C CG  . LEU C 1 105 ? 48.370  58.643  190.749 1.00 34.95  ? 105 LEU C CG  1 
ATOM   6374  C CD1 . LEU C 1 105 ? 48.029  58.836  192.202 1.00 33.43  ? 105 LEU C CD1 1 
ATOM   6375  C CD2 . LEU C 1 105 ? 47.410  57.716  190.088 1.00 35.71  ? 105 LEU C CD2 1 
ATOM   6376  N N   . PRO C 1 106 ? 50.390  61.461  188.281 1.00 52.71  ? 106 PRO C N   1 
ATOM   6377  C CA  . PRO C 1 106 ? 50.740  62.439  187.254 1.00 59.56  ? 106 PRO C CA  1 
ATOM   6378  C C   . PRO C 1 106 ? 49.484  62.876  186.508 1.00 66.00  ? 106 PRO C C   1 
ATOM   6379  O O   . PRO C 1 106 ? 48.533  62.101  186.427 1.00 64.79  ? 106 PRO C O   1 
ATOM   6380  C CB  . PRO C 1 106 ? 51.655  61.630  186.352 1.00 60.11  ? 106 PRO C CB  1 
ATOM   6381  C CG  . PRO C 1 106 ? 50.963  60.310  186.331 1.00 57.29  ? 106 PRO C CG  1 
ATOM   6382  C CD  . PRO C 1 106 ? 50.609  60.091  187.793 1.00 53.25  ? 106 PRO C CD  1 
ATOM   6383  N N   . MET C 1 107 ? 49.496  64.092  185.950 1.00 75.63  ? 107 MET C N   1 
ATOM   6384  C CA  . MET C 1 107 ? 48.347  64.630  185.199 1.00 84.21  ? 107 MET C CA  1 
ATOM   6385  C C   . MET C 1 107 ? 48.239  63.982  183.846 1.00 80.67  ? 107 MET C C   1 
ATOM   6386  O O   . MET C 1 107 ? 49.191  63.960  183.082 1.00 77.02  ? 107 MET C O   1 
ATOM   6387  C CB  . MET C 1 107 ? 48.433  66.158  185.036 1.00 100.53 ? 107 MET C CB  1 
ATOM   6388  C CG  . MET C 1 107 ? 47.364  66.789  184.086 1.00 115.98 ? 107 MET C CG  1 
ATOM   6389  S SD  . MET C 1 107 ? 47.035  68.595  184.370 1.00 135.92 ? 107 MET C SD  1 
ATOM   6390  C CE  . MET C 1 107 ? 48.796  69.353  184.533 1.00 127.50 ? 107 MET C CE  1 
ATOM   6391  N N   . LEU C 1 108 ? 47.048  63.523  183.519 1.00 80.34  ? 108 LEU C N   1 
ATOM   6392  C CA  . LEU C 1 108 ? 46.883  62.836  182.275 1.00 83.88  ? 108 LEU C CA  1 
ATOM   6393  C C   . LEU C 1 108 ? 46.521  63.666  181.106 1.00 89.52  ? 108 LEU C C   1 
ATOM   6394  O O   . LEU C 1 108 ? 47.022  63.395  180.023 1.00 91.28  ? 108 LEU C O   1 
ATOM   6395  C CB  . LEU C 1 108 ? 45.921  61.652  182.407 1.00 82.22  ? 108 LEU C CB  1 
ATOM   6396  C CG  . LEU C 1 108 ? 46.493  60.360  183.026 1.00 78.00  ? 108 LEU C CG  1 
ATOM   6397  C CD1 . LEU C 1 108 ? 46.931  60.602  184.446 1.00 76.96  ? 108 LEU C CD1 1 
ATOM   6398  C CD2 . LEU C 1 108 ? 45.499  59.222  182.999 1.00 76.91  ? 108 LEU C CD2 1 
ATOM   6399  N N   . ASN C 1 109 ? 45.697  64.687  181.272 1.00 98.39  ? 109 ASN C N   1 
ATOM   6400  C CA  . ASN C 1 109 ? 45.380  65.387  180.062 1.00 112.30 ? 109 ASN C CA  1 
ATOM   6401  C C   . ASN C 1 109 ? 45.359  66.890  179.960 1.00 121.73 ? 109 ASN C C   1 
ATOM   6402  O O   . ASN C 1 109 ? 45.240  67.575  180.982 1.00 122.00 ? 109 ASN C O   1 
ATOM   6403  C CB  . ASN C 1 109 ? 44.164  64.759  179.405 1.00 114.05 ? 109 ASN C CB  1 
ATOM   6404  C CG  . ASN C 1 109 ? 44.513  64.107  178.079 1.00 120.98 ? 109 ASN C CG  1 
ATOM   6405  O OD1 . ASN C 1 109 ? 45.477  63.343  177.975 1.00 126.92 ? 109 ASN C OD1 1 
ATOM   6406  N ND2 . ASN C 1 109 ? 43.754  64.433  177.046 1.00 122.56 ? 109 ASN C ND2 1 
ATOM   6407  N N   . GLU C 1 110 ? 45.510  67.352  178.694 1.00 134.39 ? 110 GLU C N   1 
ATOM   6408  C CA  . GLU C 1 110 ? 45.566  68.775  178.206 1.00 143.25 ? 110 GLU C CA  1 
ATOM   6409  C C   . GLU C 1 110 ? 44.508  69.260  177.140 1.00 142.47 ? 110 GLU C C   1 
ATOM   6410  O O   . GLU C 1 110 ? 44.663  70.327  176.504 1.00 139.00 ? 110 GLU C O   1 
ATOM   6411  C CB  . GLU C 1 110 ? 46.973  69.073  177.631 1.00 151.91 ? 110 GLU C CB  1 
ATOM   6412  C CG  . GLU C 1 110 ? 48.095  68.072  178.009 1.00 164.10 ? 110 GLU C CG  1 
ATOM   6413  C CD  . GLU C 1 110 ? 48.412  67.057  176.893 1.00 170.89 ? 110 GLU C CD  1 
ATOM   6414  O OE1 . GLU C 1 110 ? 47.465  66.415  176.367 1.00 175.25 ? 110 GLU C OE1 1 
ATOM   6415  O OE2 . GLU C 1 110 ? 49.612  66.907  176.544 1.00 175.45 ? 110 GLU C OE2 1 
ATOM   6416  N N   . ASP C 1 111 ? 43.424  68.489  177.019 1.00 143.31 ? 111 ASP C N   1 
ATOM   6417  C CA  . ASP C 1 111 ? 42.293  68.702  176.090 1.00 141.53 ? 111 ASP C CA  1 
ATOM   6418  C C   . ASP C 1 111 ? 41.234  69.705  176.642 1.00 139.94 ? 111 ASP C C   1 
ATOM   6419  O O   . ASP C 1 111 ? 40.034  69.538  176.387 1.00 139.02 ? 111 ASP C O   1 
ATOM   6420  C CB  . ASP C 1 111 ? 41.636  67.308  175.803 1.00 141.20 ? 111 ASP C CB  1 
ATOM   6421  C CG  . ASP C 1 111 ? 40.839  67.230  174.471 1.00 137.12 ? 111 ASP C CG  1 
ATOM   6422  O OD1 . ASP C 1 111 ? 41.131  67.968  173.499 1.00 134.44 ? 111 ASP C OD1 1 
ATOM   6423  O OD2 . ASP C 1 111 ? 39.935  66.363  174.384 1.00 136.25 ? 111 ASP C OD2 1 
ATOM   6424  N N   . LEU C 1 112 ? 41.648  70.703  177.436 1.00 136.15 ? 112 LEU C N   1 
ATOM   6425  C CA  . LEU C 1 112 ? 40.689  71.704  177.936 1.00 132.46 ? 112 LEU C CA  1 
ATOM   6426  C C   . LEU C 1 112 ? 40.598  72.662  176.764 1.00 134.35 ? 112 LEU C C   1 
ATOM   6427  O O   . LEU C 1 112 ? 40.974  73.837  176.826 1.00 133.25 ? 112 LEU C O   1 
ATOM   6428  C CB  . LEU C 1 112 ? 41.151  72.423  179.214 1.00 124.91 ? 112 LEU C CB  1 
ATOM   6429  C CG  . LEU C 1 112 ? 42.551  72.339  179.807 1.00 117.84 ? 112 LEU C CG  1 
ATOM   6430  C CD1 . LEU C 1 112 ? 42.696  71.056  180.616 1.00 110.09 ? 112 LEU C CD1 1 
ATOM   6431  C CD2 . LEU C 1 112 ? 43.604  72.529  178.707 1.00 112.32 ? 112 LEU C CD2 1 
ATOM   6432  N N   . THR C 1 113 ? 40.165  72.056  175.670 1.00 138.19 ? 113 THR C N   1 
ATOM   6433  C CA  . THR C 1 113 ? 40.005  72.634  174.357 1.00 144.38 ? 113 THR C CA  1 
ATOM   6434  C C   . THR C 1 113 ? 38.817  71.811  173.834 1.00 144.06 ? 113 THR C C   1 
ATOM   6435  O O   . THR C 1 113 ? 37.895  72.347  173.225 1.00 145.40 ? 113 THR C O   1 
ATOM   6436  C CB  . THR C 1 113 ? 41.310  72.406  173.494 1.00 148.51 ? 113 THR C CB  1 
ATOM   6437  O OG1 . THR C 1 113 ? 41.675  71.015  173.490 1.00 151.07 ? 113 THR C OG1 1 
ATOM   6438  C CG2 . THR C 1 113 ? 42.500  73.209  174.069 1.00 151.60 ? 113 THR C CG2 1 
ATOM   6439  N N   . CYS C 1 114 ? 38.878  70.494  174.041 1.00 144.30 ? 114 CYS C N   1 
ATOM   6440  C CA  . CYS C 1 114 ? 37.781  69.597  173.694 1.00 142.14 ? 114 CYS C CA  1 
ATOM   6441  C C   . CYS C 1 114 ? 37.240  69.296  175.089 1.00 136.63 ? 114 CYS C C   1 
ATOM   6442  O O   . CYS C 1 114 ? 37.689  69.901  176.068 1.00 133.66 ? 114 CYS C O   1 
ATOM   6443  C CB  . CYS C 1 114 ? 38.272  68.327  172.994 1.00 145.75 ? 114 CYS C CB  1 
ATOM   6444  S SG  . CYS C 1 114 ? 37.004  67.072  172.598 1.00 153.20 ? 114 CYS C SG  1 
ATOM   6445  N N   . ASP C 1 115 ? 36.252  68.424  175.199 1.00 129.76 ? 115 ASP C N   1 
ATOM   6446  C CA  . ASP C 1 115 ? 35.692  68.145  176.510 1.00 123.36 ? 115 ASP C CA  1 
ATOM   6447  C C   . ASP C 1 115 ? 36.318  66.914  177.124 1.00 114.56 ? 115 ASP C C   1 
ATOM   6448  O O   . ASP C 1 115 ? 37.156  66.995  178.027 1.00 111.05 ? 115 ASP C O   1 
ATOM   6449  C CB  . ASP C 1 115 ? 34.165  68.004  176.418 1.00 130.90 ? 115 ASP C CB  1 
ATOM   6450  C CG  . ASP C 1 115 ? 33.727  66.942  175.416 1.00 140.06 ? 115 ASP C CG  1 
ATOM   6451  O OD1 . ASP C 1 115 ? 34.040  67.067  174.204 1.00 145.16 ? 115 ASP C OD1 1 
ATOM   6452  O OD2 . ASP C 1 115 ? 33.108  65.947  175.862 1.00 145.75 ? 115 ASP C OD2 1 
ATOM   6453  N N   . THR C 1 116 ? 35.863  65.778  176.630 1.00 105.28 ? 116 THR C N   1 
ATOM   6454  C CA  . THR C 1 116 ? 36.305  64.481  177.026 1.00 96.64  ? 116 THR C CA  1 
ATOM   6455  C C   . THR C 1 116 ? 37.699  64.524  177.599 1.00 91.31  ? 116 THR C C   1 
ATOM   6456  O O   . THR C 1 116 ? 38.673  64.750  176.889 1.00 93.98  ? 116 THR C O   1 
ATOM   6457  C CB  . THR C 1 116 ? 36.247  63.595  175.792 1.00 97.23  ? 116 THR C CB  1 
ATOM   6458  O OG1 . THR C 1 116 ? 34.897  63.159  175.609 1.00 98.48  ? 116 THR C OG1 1 
ATOM   6459  C CG2 . THR C 1 116 ? 37.198  62.431  175.870 1.00 98.50  ? 116 THR C CG2 1 
ATOM   6460  N N   . LEU C 1 117 ? 37.780  64.413  178.910 1.00 83.01  ? 117 LEU C N   1 
ATOM   6461  C CA  . LEU C 1 117 ? 39.071  64.411  179.542 1.00 77.25  ? 117 LEU C CA  1 
ATOM   6462  C C   . LEU C 1 117 ? 39.304  63.064  180.211 1.00 74.20  ? 117 LEU C C   1 
ATOM   6463  O O   . LEU C 1 117 ? 38.351  62.354  180.569 1.00 73.15  ? 117 LEU C O   1 
ATOM   6464  C CB  . LEU C 1 117 ? 39.193  65.560  180.532 1.00 76.99  ? 117 LEU C CB  1 
ATOM   6465  C CG  . LEU C 1 117 ? 40.636  66.049  180.562 1.00 84.17  ? 117 LEU C CG  1 
ATOM   6466  C CD1 . LEU C 1 117 ? 41.539  65.242  181.516 1.00 86.88  ? 117 LEU C CD1 1 
ATOM   6467  C CD2 . LEU C 1 117 ? 41.153  65.997  179.137 1.00 82.60  ? 117 LEU C CD2 1 
ATOM   6468  N N   . GLN C 1 118 ? 40.561  62.643  180.262 1.00 67.51  ? 118 GLN C N   1 
ATOM   6469  C CA  . GLN C 1 118 ? 40.835  61.382  180.896 1.00 60.79  ? 118 GLN C CA  1 
ATOM   6470  C C   . GLN C 1 118 ? 41.526  61.615  182.210 1.00 56.09  ? 118 GLN C C   1 
ATOM   6471  O O   . GLN C 1 118 ? 42.313  62.558  182.328 1.00 52.43  ? 118 GLN C O   1 
ATOM   6472  C CB  . GLN C 1 118 ? 41.654  60.456  179.988 1.00 64.72  ? 118 GLN C CB  1 
ATOM   6473  C CG  . GLN C 1 118 ? 43.157  60.734  179.841 1.00 74.61  ? 118 GLN C CG  1 
ATOM   6474  C CD  . GLN C 1 118 ? 43.934  59.573  179.124 1.00 81.50  ? 118 GLN C CD  1 
ATOM   6475  O OE1 . GLN C 1 118 ? 43.348  58.539  178.744 1.00 79.89  ? 118 GLN C OE1 1 
ATOM   6476  N NE2 . GLN C 1 118 ? 45.256  59.758  178.940 1.00 85.03  ? 118 GLN C NE2 1 
ATOM   6477  N N   . MET C 1 119 ? 41.146  60.819  183.213 1.00 55.22  ? 119 MET C N   1 
ATOM   6478  C CA  . MET C 1 119 ? 41.751  60.875  184.542 1.00 57.38  ? 119 MET C CA  1 
ATOM   6479  C C   . MET C 1 119 ? 41.913  59.511  185.274 1.00 56.23  ? 119 MET C C   1 
ATOM   6480  O O   . MET C 1 119 ? 41.323  58.470  184.884 1.00 54.10  ? 119 MET C O   1 
ATOM   6481  C CB  . MET C 1 119 ? 41.055  61.897  185.434 1.00 62.98  ? 119 MET C CB  1 
ATOM   6482  C CG  . MET C 1 119 ? 39.580  61.653  185.633 1.00 70.46  ? 119 MET C CG  1 
ATOM   6483  S SD  . MET C 1 119 ? 38.919  62.721  186.948 1.00 82.39  ? 119 MET C SD  1 
ATOM   6484  C CE  . MET C 1 119 ? 37.394  63.317  186.185 1.00 77.76  ? 119 MET C CE  1 
ATOM   6485  N N   . TRP C 1 120 ? 42.787  59.530  186.287 1.00 50.98  ? 120 TRP C N   1 
ATOM   6486  C CA  . TRP C 1 120 ? 43.115  58.361  187.088 1.00 42.86  ? 120 TRP C CA  1 
ATOM   6487  C C   . TRP C 1 120 ? 41.924  57.792  187.762 1.00 37.08  ? 120 TRP C C   1 
ATOM   6488  O O   . TRP C 1 120 ? 41.142  58.507  188.402 1.00 33.81  ? 120 TRP C O   1 
ATOM   6489  C CB  . TRP C 1 120 ? 44.138  58.719  188.141 1.00 45.13  ? 120 TRP C CB  1 
ATOM   6490  C CG  . TRP C 1 120 ? 45.484  58.782  187.587 1.00 50.19  ? 120 TRP C CG  1 
ATOM   6491  C CD1 . TRP C 1 120 ? 46.418  59.753  187.785 1.00 53.02  ? 120 TRP C CD1 1 
ATOM   6492  C CD2 . TRP C 1 120 ? 46.082  57.817  186.751 1.00 52.13  ? 120 TRP C CD2 1 
ATOM   6493  N NE1 . TRP C 1 120 ? 47.578  59.445  187.125 1.00 46.06  ? 120 TRP C NE1 1 
ATOM   6494  C CE2 . TRP C 1 120 ? 47.396  58.256  186.478 1.00 51.01  ? 120 TRP C CE2 1 
ATOM   6495  C CE3 . TRP C 1 120 ? 45.639  56.617  186.204 1.00 54.61  ? 120 TRP C CE3 1 
ATOM   6496  C CZ2 . TRP C 1 120 ? 48.270  57.534  185.680 1.00 57.13  ? 120 TRP C CZ2 1 
ATOM   6497  C CZ3 . TRP C 1 120 ? 46.514  55.894  185.407 1.00 60.12  ? 120 TRP C CZ3 1 
ATOM   6498  C CH2 . TRP C 1 120 ? 47.817  56.353  185.152 1.00 60.18  ? 120 TRP C CH2 1 
ATOM   6499  N N   . GLU C 1 121 ? 41.828  56.484  187.704 1.00 32.83  ? 121 GLU C N   1 
ATOM   6500  C CA  . GLU C 1 121 ? 40.692  55.873  188.318 1.00 29.34  ? 121 GLU C CA  1 
ATOM   6501  C C   . GLU C 1 121 ? 41.031  54.563  188.970 1.00 24.98  ? 121 GLU C C   1 
ATOM   6502  O O   . GLU C 1 121 ? 41.541  53.643  188.336 1.00 19.98  ? 121 GLU C O   1 
ATOM   6503  C CB  . GLU C 1 121 ? 39.627  55.716  187.268 1.00 30.58  ? 121 GLU C CB  1 
ATOM   6504  C CG  . GLU C 1 121 ? 38.307  55.291  187.800 1.00 34.12  ? 121 GLU C CG  1 
ATOM   6505  C CD  . GLU C 1 121 ? 37.914  53.981  187.220 1.00 37.37  ? 121 GLU C CD  1 
ATOM   6506  O OE1 . GLU C 1 121 ? 37.294  53.950  186.108 1.00 32.89  ? 121 GLU C OE1 1 
ATOM   6507  O OE2 . GLU C 1 121 ? 38.262  52.981  187.880 1.00 43.92  ? 121 GLU C OE2 1 
ATOM   6508  N N   . ALA C 1 122 ? 40.838  54.529  190.276 1.00 21.73  ? 122 ALA C N   1 
ATOM   6509  C CA  . ALA C 1 122 ? 41.123  53.333  191.020 1.00 19.02  ? 122 ALA C CA  1 
ATOM   6510  C C   . ALA C 1 122 ? 40.012  52.318  190.875 1.00 18.01  ? 122 ALA C C   1 
ATOM   6511  O O   . ALA C 1 122 ? 38.791  52.603  190.947 1.00 14.19  ? 122 ALA C O   1 
ATOM   6512  C CB  . ALA C 1 122 ? 41.356  53.639  192.420 1.00 20.77  ? 122 ALA C CB  1 
ATOM   6513  N N   . VAL C 1 123 ? 40.477  51.091  190.837 1.00 14.72  ? 123 VAL C N   1 
ATOM   6514  C CA  . VAL C 1 123 ? 39.606  49.984  190.610 1.00 14.92  ? 123 VAL C CA  1 
ATOM   6515  C C   . VAL C 1 123 ? 39.464  49.018  191.756 1.00 17.00  ? 123 VAL C C   1 
ATOM   6516  O O   . VAL C 1 123 ? 38.372  48.767  192.277 1.00 19.68  ? 123 VAL C O   1 
ATOM   6517  C CB  . VAL C 1 123 ? 40.151  49.225  189.454 1.00 8.72   ? 123 VAL C CB  1 
ATOM   6518  C CG1 . VAL C 1 123 ? 39.334  47.996  189.234 1.00 10.23  ? 123 VAL C CG1 1 
ATOM   6519  C CG2 . VAL C 1 123 ? 40.176  50.117  188.246 1.00 8.69   ? 123 VAL C CG2 1 
ATOM   6520  N N   . SER C 1 124 ? 40.566  48.354  192.029 1.00 17.64  ? 124 SER C N   1 
ATOM   6521  C CA  . SER C 1 124 ? 40.604  47.389  193.080 1.00 17.50  ? 124 SER C CA  1 
ATOM   6522  C C   . SER C 1 124 ? 41.828  47.664  193.895 1.00 17.21  ? 124 SER C C   1 
ATOM   6523  O O   . SER C 1 124 ? 42.733  48.444  193.519 1.00 12.70  ? 124 SER C O   1 
ATOM   6524  C CB  . SER C 1 124 ? 40.664  45.993  192.505 1.00 22.57  ? 124 SER C CB  1 
ATOM   6525  O OG  . SER C 1 124 ? 41.695  45.887  191.539 1.00 36.51  ? 124 SER C OG  1 
ATOM   6526  N N   . VAL C 1 125 ? 41.910  46.945  194.981 1.00 17.37  ? 125 VAL C N   1 
ATOM   6527  C CA  . VAL C 1 125 ? 42.990  47.202  195.858 1.00 20.18  ? 125 VAL C CA  1 
ATOM   6528  C C   . VAL C 1 125 ? 43.040  46.045  196.787 1.00 24.95  ? 125 VAL C C   1 
ATOM   6529  O O   . VAL C 1 125 ? 41.994  45.503  197.172 1.00 25.89  ? 125 VAL C O   1 
ATOM   6530  C CB  . VAL C 1 125 ? 42.626  48.462  196.705 1.00 16.47  ? 125 VAL C CB  1 
ATOM   6531  C CG1 . VAL C 1 125 ? 41.340  48.177  197.520 1.00 3.79   ? 125 VAL C CG1 1 
ATOM   6532  C CG2 . VAL C 1 125 ? 43.783  48.904  197.606 1.00 10.66  ? 125 VAL C CG2 1 
ATOM   6533  N N   . LYS C 1 126 ? 44.245  45.573  197.043 1.00 26.76  ? 126 LYS C N   1 
ATOM   6534  C CA  . LYS C 1 126 ? 44.388  44.548  198.038 1.00 30.41  ? 126 LYS C CA  1 
ATOM   6535  C C   . LYS C 1 126 ? 44.973  45.347  199.186 1.00 32.77  ? 126 LYS C C   1 
ATOM   6536  O O   . LYS C 1 126 ? 45.765  46.287  198.977 1.00 28.26  ? 126 LYS C O   1 
ATOM   6537  C CB  . LYS C 1 126 ? 45.398  43.497  197.645 1.00 34.70  ? 126 LYS C CB  1 
ATOM   6538  C CG  . LYS C 1 126 ? 44.960  42.547  196.588 1.00 46.17  ? 126 LYS C CG  1 
ATOM   6539  C CD  . LYS C 1 126 ? 46.009  41.433  196.399 1.00 56.31  ? 126 LYS C CD  1 
ATOM   6540  C CE  . LYS C 1 126 ? 45.762  40.601  195.119 1.00 62.92  ? 126 LYS C CE  1 
ATOM   6541  N NZ  . LYS C 1 126 ? 46.574  39.331  195.029 1.00 69.93  ? 126 LYS C NZ  1 
ATOM   6542  N N   . THR C 1 127 ? 44.527  45.036  200.392 1.00 36.16  ? 127 THR C N   1 
ATOM   6543  C CA  . THR C 1 127 ? 45.074  45.695  201.562 1.00 40.60  ? 127 THR C CA  1 
ATOM   6544  C C   . THR C 1 127 ? 45.336  44.600  202.568 1.00 42.57  ? 127 THR C C   1 
ATOM   6545  O O   . THR C 1 127 ? 44.749  43.503  202.451 1.00 46.11  ? 127 THR C O   1 
ATOM   6546  C CB  . THR C 1 127 ? 44.140  46.770  202.168 1.00 44.41  ? 127 THR C CB  1 
ATOM   6547  O OG1 . THR C 1 127 ? 44.898  47.544  203.101 1.00 52.47  ? 127 THR C OG1 1 
ATOM   6548  C CG2 . THR C 1 127 ? 42.924  46.163  202.919 1.00 44.48  ? 127 THR C CG2 1 
ATOM   6549  N N   . GLU C 1 128 ? 46.222  44.873  203.528 1.00 42.10  ? 128 GLU C N   1 
ATOM   6550  C CA  . GLU C 1 128 ? 46.547  43.875  204.545 1.00 43.32  ? 128 GLU C CA  1 
ATOM   6551  C C   . GLU C 1 128 ? 47.249  44.531  205.706 1.00 41.82  ? 128 GLU C C   1 
ATOM   6552  O O   . GLU C 1 128 ? 48.112  45.410  205.533 1.00 38.62  ? 128 GLU C O   1 
ATOM   6553  C CB  . GLU C 1 128 ? 47.449  42.814  203.940 1.00 50.63  ? 128 GLU C CB  1 
ATOM   6554  C CG  . GLU C 1 128 ? 47.456  41.440  204.570 1.00 56.22  ? 128 GLU C CG  1 
ATOM   6555  C CD  . GLU C 1 128 ? 48.559  40.606  203.935 1.00 58.09  ? 128 GLU C CD  1 
ATOM   6556  O OE1 . GLU C 1 128 ? 48.526  40.429  202.685 1.00 58.45  ? 128 GLU C OE1 1 
ATOM   6557  O OE2 . GLU C 1 128 ? 49.483  40.188  204.673 1.00 58.67  ? 128 GLU C OE2 1 
ATOM   6558  N N   . VAL C 1 129 ? 46.819  44.149  206.897 1.00 40.10  ? 129 VAL C N   1 
ATOM   6559  C CA  . VAL C 1 129 ? 47.421  44.708  208.077 1.00 42.85  ? 129 VAL C CA  1 
ATOM   6560  C C   . VAL C 1 129 ? 48.397  43.701  208.488 1.00 42.25  ? 129 VAL C C   1 
ATOM   6561  O O   . VAL C 1 129 ? 48.048  42.533  208.638 1.00 44.89  ? 129 VAL C O   1 
ATOM   6562  C CB  . VAL C 1 129 ? 46.473  44.833  209.207 1.00 47.25  ? 129 VAL C CB  1 
ATOM   6563  C CG1 . VAL C 1 129 ? 47.266  45.192  210.455 1.00 51.11  ? 129 VAL C CG1 1 
ATOM   6564  C CG2 . VAL C 1 129 ? 45.438  45.902  208.888 1.00 53.99  ? 129 VAL C CG2 1 
ATOM   6565  N N   . VAL C 1 130 ? 49.571  44.166  208.844 1.00 39.68  ? 130 VAL C N   1 
ATOM   6566  C CA  . VAL C 1 130 ? 50.591  43.220  209.181 1.00 37.90  ? 130 VAL C CA  1 
ATOM   6567  C C   . VAL C 1 130 ? 51.175  43.456  210.509 1.00 35.65  ? 130 VAL C C   1 
ATOM   6568  O O   . VAL C 1 130 ? 51.284  44.604  210.958 1.00 34.28  ? 130 VAL C O   1 
ATOM   6569  C CB  . VAL C 1 130 ? 51.697  43.334  208.189 1.00 40.03  ? 130 VAL C CB  1 
ATOM   6570  C CG1 . VAL C 1 130 ? 51.260  42.748  206.840 1.00 41.21  ? 130 VAL C CG1 1 
ATOM   6571  C CG2 . VAL C 1 130 ? 52.051  44.814  208.032 1.00 35.86  ? 130 VAL C CG2 1 
ATOM   6572  N N   . GLY C 1 131 ? 51.632  42.363  211.100 1.00 32.72  ? 131 GLY C N   1 
ATOM   6573  C CA  . GLY C 1 131 ? 52.257  42.475  212.405 1.00 34.19  ? 131 GLY C CA  1 
ATOM   6574  C C   . GLY C 1 131 ? 51.490  41.759  213.482 1.00 31.37  ? 131 GLY C C   1 
ATOM   6575  O O   . GLY C 1 131 ? 51.869  41.707  214.659 1.00 26.46  ? 131 GLY C O   1 
ATOM   6576  N N   . SER C 1 132 ? 50.438  41.121  213.029 1.00 28.93  ? 132 SER C N   1 
ATOM   6577  C CA  . SER C 1 132 ? 49.580  40.372  213.889 1.00 30.92  ? 132 SER C CA  1 
ATOM   6578  C C   . SER C 1 132 ? 50.441  39.324  214.581 1.00 32.32  ? 132 SER C C   1 
ATOM   6579  O O   . SER C 1 132 ? 50.073  38.802  215.630 1.00 32.16  ? 132 SER C O   1 
ATOM   6580  C CB  . SER C 1 132 ? 48.533  39.769  213.009 1.00 33.80  ? 132 SER C CB  1 
ATOM   6581  O OG  . SER C 1 132 ? 48.614  40.454  211.759 1.00 37.15  ? 132 SER C OG  1 
ATOM   6582  N N   . GLY C 1 133 ? 51.611  39.046  214.009 1.00 31.93  ? 133 GLY C N   1 
ATOM   6583  C CA  . GLY C 1 133 ? 52.522  38.109  214.642 1.00 34.55  ? 133 GLY C CA  1 
ATOM   6584  C C   . GLY C 1 133 ? 53.087  38.691  215.938 1.00 34.07  ? 133 GLY C C   1 
ATOM   6585  O O   . GLY C 1 133 ? 53.100  38.055  216.994 1.00 30.57  ? 133 GLY C O   1 
ATOM   6586  N N   . SER C 1 134 ? 53.454  39.959  215.870 1.00 35.94  ? 134 SER C N   1 
ATOM   6587  C CA  . SER C 1 134 ? 54.020  40.661  217.002 1.00 40.94  ? 134 SER C CA  1 
ATOM   6588  C C   . SER C 1 134 ? 53.187  40.493  218.268 1.00 43.04  ? 134 SER C C   1 
ATOM   6589  O O   . SER C 1 134 ? 53.675  40.703  219.373 1.00 47.02  ? 134 SER C O   1 
ATOM   6590  C CB  . SER C 1 134 ? 54.179  42.150  216.654 1.00 43.28  ? 134 SER C CB  1 
ATOM   6591  O OG  . SER C 1 134 ? 53.328  43.018  217.399 1.00 51.43  ? 134 SER C OG  1 
ATOM   6592  N N   . LEU C 1 135 ? 51.947  40.061  218.126 1.00 41.73  ? 135 LEU C N   1 
ATOM   6593  C CA  . LEU C 1 135 ? 51.098  39.918  219.291 1.00 43.80  ? 135 LEU C CA  1 
ATOM   6594  C C   . LEU C 1 135 ? 51.418  38.720  220.131 1.00 45.32  ? 135 LEU C C   1 
ATOM   6595  O O   . LEU C 1 135 ? 50.818  38.500  221.178 1.00 42.59  ? 135 LEU C O   1 
ATOM   6596  C CB  . LEU C 1 135 ? 49.657  39.867  218.859 1.00 45.20  ? 135 LEU C CB  1 
ATOM   6597  C CG  . LEU C 1 135 ? 49.193  41.200  218.293 1.00 47.76  ? 135 LEU C CG  1 
ATOM   6598  C CD1 . LEU C 1 135 ? 49.532  42.287  219.277 1.00 47.79  ? 135 LEU C CD1 1 
ATOM   6599  C CD2 . LEU C 1 135 ? 49.861  41.480  216.970 1.00 48.76  ? 135 LEU C CD2 1 
ATOM   6600  N N   . LEU C 1 136 ? 52.400  37.965  219.676 1.00 50.21  ? 136 LEU C N   1 
ATOM   6601  C CA  . LEU C 1 136 ? 52.813  36.762  220.363 1.00 57.30  ? 136 LEU C CA  1 
ATOM   6602  C C   . LEU C 1 136 ? 53.964  36.916  221.349 1.00 63.18  ? 136 LEU C C   1 
ATOM   6603  O O   . LEU C 1 136 ? 54.452  35.921  221.934 1.00 61.54  ? 136 LEU C O   1 
ATOM   6604  C CB  . LEU C 1 136 ? 53.112  35.702  219.334 1.00 57.14  ? 136 LEU C CB  1 
ATOM   6605  C CG  . LEU C 1 136 ? 51.843  35.562  218.512 1.00 55.38  ? 136 LEU C CG  1 
ATOM   6606  C CD1 . LEU C 1 136 ? 52.034  34.529  217.410 1.00 54.25  ? 136 LEU C CD1 1 
ATOM   6607  C CD2 . LEU C 1 136 ? 50.711  35.187  219.468 1.00 58.47  ? 136 LEU C CD2 1 
ATOM   6608  N N   . ASP C 1 137 ? 54.422  38.156  221.501 1.00 69.30  ? 137 ASP C N   1 
ATOM   6609  C CA  . ASP C 1 137 ? 55.462  38.416  222.466 1.00 75.23  ? 137 ASP C CA  1 
ATOM   6610  C C   . ASP C 1 137 ? 54.666  38.464  223.733 1.00 77.56  ? 137 ASP C C   1 
ATOM   6611  O O   . ASP C 1 137 ? 53.755  39.281  223.884 1.00 78.65  ? 137 ASP C O   1 
ATOM   6612  C CB  . ASP C 1 137 ? 56.155  39.758  222.271 1.00 81.03  ? 137 ASP C CB  1 
ATOM   6613  C CG  . ASP C 1 137 ? 57.295  39.970  223.272 1.00 87.71  ? 137 ASP C CG  1 
ATOM   6614  O OD1 . ASP C 1 137 ? 57.262  39.353  224.362 1.00 93.38  ? 137 ASP C OD1 1 
ATOM   6615  O OD2 . ASP C 1 137 ? 58.238  40.735  222.979 1.00 91.61  ? 137 ASP C OD2 1 
ATOM   6616  N N   . VAL C 1 138 ? 55.006  37.554  224.625 1.00 80.70  ? 138 VAL C N   1 
ATOM   6617  C CA  . VAL C 1 138 ? 54.325  37.437  225.890 1.00 82.91  ? 138 VAL C CA  1 
ATOM   6618  C C   . VAL C 1 138 ? 55.215  37.620  227.092 1.00 87.16  ? 138 VAL C C   1 
ATOM   6619  O O   . VAL C 1 138 ? 54.820  37.278  228.211 1.00 85.46  ? 138 VAL C O   1 
ATOM   6620  C CB  . VAL C 1 138 ? 53.618  36.135  225.961 1.00 78.90  ? 138 VAL C CB  1 
ATOM   6621  C CG1 . VAL C 1 138 ? 52.274  36.302  225.329 1.00 75.72  ? 138 VAL C CG1 1 
ATOM   6622  C CG2 . VAL C 1 138 ? 54.428  35.079  225.214 1.00 79.70  ? 138 VAL C CG2 1 
ATOM   6623  N N   . HIS C 1 139 ? 56.461  38.015  226.828 1.00 90.77  ? 139 HIS C N   1 
ATOM   6624  C CA  . HIS C 1 139 ? 57.405  38.339  227.890 1.00 93.35  ? 139 HIS C CA  1 
ATOM   6625  C C   . HIS C 1 139 ? 57.359  39.856  228.003 1.00 98.72  ? 139 HIS C C   1 
ATOM   6626  O O   . HIS C 1 139 ? 56.343  40.463  227.653 1.00 101.74 ? 139 HIS C O   1 
ATOM   6627  C CB  . HIS C 1 139 ? 58.831  37.839  227.635 1.00 87.51  ? 139 HIS C CB  1 
ATOM   6628  C CG  . HIS C 1 139 ? 59.248  37.848  226.206 1.00 83.90  ? 139 HIS C CG  1 
ATOM   6629  N ND1 . HIS C 1 139 ? 58.943  36.821  225.338 1.00 83.74  ? 139 HIS C ND1 1 
ATOM   6630  C CD2 . HIS C 1 139 ? 60.016  38.716  225.510 1.00 83.75  ? 139 HIS C CD2 1 
ATOM   6631  C CE1 . HIS C 1 139 ? 59.511  37.059  224.169 1.00 86.20  ? 139 HIS C CE1 1 
ATOM   6632  N NE2 . HIS C 1 139 ? 60.166  38.203  224.246 1.00 85.05  ? 139 HIS C NE2 1 
ATOM   6633  N N   . GLY C 1 140 ? 58.431  40.484  228.469 1.00 102.65 ? 140 GLY C N   1 
ATOM   6634  C CA  . GLY C 1 140 ? 58.395  41.936  228.609 1.00 106.37 ? 140 GLY C CA  1 
ATOM   6635  C C   . GLY C 1 140 ? 57.510  42.300  229.788 1.00 105.68 ? 140 GLY C C   1 
ATOM   6636  O O   . GLY C 1 140 ? 57.023  41.393  230.458 1.00 104.82 ? 140 GLY C O   1 
ATOM   6637  N N   . PHE C 1 141 ? 57.301  43.579  230.089 1.00 104.36 ? 141 PHE C N   1 
ATOM   6638  C CA  . PHE C 1 141 ? 56.449  43.839  231.227 1.00 103.42 ? 141 PHE C CA  1 
ATOM   6639  C C   . PHE C 1 141 ? 55.064  44.387  231.100 1.00 98.39  ? 141 PHE C C   1 
ATOM   6640  O O   . PHE C 1 141 ? 54.833  45.598  231.112 1.00 101.73 ? 141 PHE C O   1 
ATOM   6641  C CB  . PHE C 1 141 ? 57.188  44.406  232.435 1.00 108.73 ? 141 PHE C CB  1 
ATOM   6642  C CG  . PHE C 1 141 ? 57.257  43.413  233.536 1.00 113.63 ? 141 PHE C CG  1 
ATOM   6643  C CD1 . PHE C 1 141 ? 56.098  42.706  233.891 1.00 115.20 ? 141 PHE C CD1 1 
ATOM   6644  C CD2 . PHE C 1 141 ? 58.470  43.018  234.075 1.00 116.14 ? 141 PHE C CD2 1 
ATOM   6645  C CE1 . PHE C 1 141 ? 56.138  41.607  234.748 1.00 114.69 ? 141 PHE C CE1 1 
ATOM   6646  C CE2 . PHE C 1 141 ? 58.531  41.907  234.944 1.00 121.20 ? 141 PHE C CE2 1 
ATOM   6647  C CZ  . PHE C 1 141 ? 57.354  41.198  235.278 1.00 118.10 ? 141 PHE C CZ  1 
ATOM   6648  N N   . ASN C 1 142 ? 54.139  43.443  231.169 1.00 88.74  ? 142 ASN C N   1 
ATOM   6649  C CA  . ASN C 1 142 ? 52.726  43.690  231.067 1.00 82.51  ? 142 ASN C CA  1 
ATOM   6650  C C   . ASN C 1 142 ? 52.175  42.925  232.233 1.00 77.68  ? 142 ASN C C   1 
ATOM   6651  O O   . ASN C 1 142 ? 52.845  42.023  232.743 1.00 72.13  ? 142 ASN C O   1 
ATOM   6652  C CB  . ASN C 1 142 ? 52.168  43.100  229.773 1.00 86.67  ? 142 ASN C CB  1 
ATOM   6653  C CG  . ASN C 1 142 ? 52.618  43.859  228.536 1.00 88.79  ? 142 ASN C CG  1 
ATOM   6654  O OD1 . ASN C 1 142 ? 53.534  43.443  227.820 1.00 92.73  ? 142 ASN C OD1 1 
ATOM   6655  N ND2 . ASN C 1 142 ? 51.964  44.976  228.271 1.00 85.93  ? 142 ASN C ND2 1 
ATOM   6656  N N   . LYS C 1 143 ? 51.032  43.389  232.741 1.00 77.42  ? 143 LYS C N   1 
ATOM   6657  C CA  . LYS C 1 143 ? 50.337  42.764  233.869 1.00 78.10  ? 143 LYS C CA  1 
ATOM   6658  C C   . LYS C 1 143 ? 50.485  41.306  233.545 1.00 74.73  ? 143 LYS C C   1 
ATOM   6659  O O   . LYS C 1 143 ? 50.245  40.885  232.426 1.00 74.16  ? 143 LYS C O   1 
ATOM   6660  C CB  . LYS C 1 143 ? 48.867  43.195  233.876 1.00 83.66  ? 143 LYS C CB  1 
ATOM   6661  C CG  . LYS C 1 143 ? 48.077  43.001  235.196 1.00 93.55  ? 143 LYS C CG  1 
ATOM   6662  C CD  . LYS C 1 143 ? 46.767  43.902  235.238 1.00 100.82 ? 143 LYS C CD  1 
ATOM   6663  C CE  . LYS C 1 143 ? 45.891  43.785  236.544 1.00 105.76 ? 143 LYS C CE  1 
ATOM   6664  N NZ  . LYS C 1 143 ? 44.645  44.659  236.654 1.00 103.46 ? 143 LYS C NZ  1 
ATOM   6665  N N   . PRO C 1 144 ? 51.030  40.543  234.465 1.00 73.59  ? 144 PRO C N   1 
ATOM   6666  C CA  . PRO C 1 144 ? 51.146  39.163  234.035 1.00 73.74  ? 144 PRO C CA  1 
ATOM   6667  C C   . PRO C 1 144 ? 49.990  38.339  234.406 1.00 72.80  ? 144 PRO C C   1 
ATOM   6668  O O   . PRO C 1 144 ? 49.137  38.768  235.159 1.00 71.46  ? 144 PRO C O   1 
ATOM   6669  C CB  . PRO C 1 144 ? 52.413  38.704  234.721 1.00 76.79  ? 144 PRO C CB  1 
ATOM   6670  C CG  . PRO C 1 144 ? 53.162  40.024  234.960 1.00 78.21  ? 144 PRO C CG  1 
ATOM   6671  C CD  . PRO C 1 144 ? 52.033  40.844  235.477 1.00 75.34  ? 144 PRO C CD  1 
ATOM   6672  N N   . THR C 1 145 ? 49.968  37.158  233.823 1.00 74.78  ? 145 THR C N   1 
ATOM   6673  C CA  . THR C 1 145 ? 48.917  36.197  234.037 1.00 83.29  ? 145 THR C CA  1 
ATOM   6674  C C   . THR C 1 145 ? 48.619  36.096  235.503 1.00 93.96  ? 145 THR C C   1 
ATOM   6675  O O   . THR C 1 145 ? 47.497  36.358  235.951 1.00 98.61  ? 145 THR C O   1 
ATOM   6676  C CB  . THR C 1 145 ? 49.398  34.856  233.633 1.00 78.49  ? 145 THR C CB  1 
ATOM   6677  O OG1 . THR C 1 145 ? 50.188  35.006  232.454 1.00 77.06  ? 145 THR C OG1 1 
ATOM   6678  C CG2 . THR C 1 145 ? 48.221  33.920  233.394 1.00 79.07  ? 145 THR C CG2 1 
ATOM   6679  N N   . ASP C 1 146 ? 49.638  35.654  236.230 1.00 101.46 ? 146 ASP C N   1 
ATOM   6680  C CA  . ASP C 1 146 ? 49.586  35.479  237.669 1.00 105.59 ? 146 ASP C CA  1 
ATOM   6681  C C   . ASP C 1 146 ? 50.091  36.762  238.313 1.00 109.17 ? 146 ASP C C   1 
ATOM   6682  O O   . ASP C 1 146 ? 51.275  37.088  238.266 1.00 106.82 ? 146 ASP C O   1 
ATOM   6683  C CB  . ASP C 1 146 ? 50.476  34.314  238.057 1.00 105.85 ? 146 ASP C CB  1 
ATOM   6684  C CG  . ASP C 1 146 ? 50.696  34.238  239.518 1.00 108.96 ? 146 ASP C CG  1 
ATOM   6685  O OD1 . ASP C 1 146 ? 49.777  33.779  240.217 1.00 112.73 ? 146 ASP C OD1 1 
ATOM   6686  O OD2 . ASP C 1 146 ? 51.773  34.669  239.971 1.00 111.85 ? 146 ASP C OD2 1 
ATOM   6687  N N   . THR C 1 147 ? 49.171  37.511  238.887 1.00 114.20 ? 147 THR C N   1 
ATOM   6688  C CA  . THR C 1 147 ? 49.510  38.778  239.514 1.00 119.93 ? 147 THR C CA  1 
ATOM   6689  C C   . THR C 1 147 ? 50.065  38.558  240.901 1.00 120.87 ? 147 THR C C   1 
ATOM   6690  O O   . THR C 1 147 ? 50.819  39.377  241.433 1.00 121.80 ? 147 THR C O   1 
ATOM   6691  C CB  . THR C 1 147 ? 48.264  39.633  239.644 1.00 122.58 ? 147 THR C CB  1 
ATOM   6692  O OG1 . THR C 1 147 ? 47.293  38.931  240.437 1.00 125.98 ? 147 THR C OG1 1 
ATOM   6693  C CG2 . THR C 1 147 ? 47.678  39.898  238.268 1.00 126.77 ? 147 THR C CG2 1 
ATOM   6694  N N   . VAL C 1 148 ? 49.629  37.455  241.490 1.00 121.73 ? 148 VAL C N   1 
ATOM   6695  C CA  . VAL C 1 148 ? 50.020  37.055  242.826 1.00 121.45 ? 148 VAL C CA  1 
ATOM   6696  C C   . VAL C 1 148 ? 51.535  36.944  242.922 1.00 121.20 ? 148 VAL C C   1 
ATOM   6697  O O   . VAL C 1 148 ? 52.215  37.844  243.416 1.00 122.28 ? 148 VAL C O   1 
ATOM   6698  C CB  . VAL C 1 148 ? 49.369  35.701  243.167 1.00 120.42 ? 148 VAL C CB  1 
ATOM   6699  C CG1 . VAL C 1 148 ? 49.859  35.195  244.501 1.00 121.74 ? 148 VAL C CG1 1 
ATOM   6700  C CG2 . VAL C 1 148 ? 47.842  35.832  243.151 1.00 119.96 ? 148 VAL C CG2 1 
ATOM   6701  N N   . ASN C 1 149 ? 52.066  35.863  242.381 1.00 119.25 ? 149 ASN C N   1 
ATOM   6702  C CA  . ASN C 1 149 ? 53.489  35.640  242.408 1.00 119.79 ? 149 ASN C CA  1 
ATOM   6703  C C   . ASN C 1 149 ? 54.132  36.484  241.347 1.00 114.43 ? 149 ASN C C   1 
ATOM   6704  O O   . ASN C 1 149 ? 55.337  36.385  241.123 1.00 113.12 ? 149 ASN C O   1 
ATOM   6705  C CB  . ASN C 1 149 ? 53.764  34.181  242.131 1.00 133.42 ? 149 ASN C CB  1 
ATOM   6706  C CG  . ASN C 1 149 ? 52.861  33.282  242.929 1.00 147.92 ? 149 ASN C CG  1 
ATOM   6707  O OD1 . ASN C 1 149 ? 53.037  33.142  244.142 1.00 157.26 ? 149 ASN C OD1 1 
ATOM   6708  N ND2 . ASN C 1 149 ? 51.841  32.722  242.279 1.00 156.22 ? 149 ASN C ND2 1 
ATOM   6709  N N   . THR C 1 150 ? 53.326  37.309  240.685 1.00 110.40 ? 150 THR C N   1 
ATOM   6710  C CA  . THR C 1 150 ? 53.823  38.177  239.634 1.00 106.49 ? 150 THR C CA  1 
ATOM   6711  C C   . THR C 1 150 ? 54.480  37.250  238.626 1.00 103.68 ? 150 THR C C   1 
ATOM   6712  O O   . THR C 1 150 ? 55.686  37.338  238.371 1.00 100.95 ? 150 THR C O   1 
ATOM   6713  C CB  . THR C 1 150 ? 54.859  39.197  240.199 1.00 107.39 ? 150 THR C CB  1 
ATOM   6714  O OG1 . THR C 1 150 ? 54.216  40.076  241.134 1.00 109.84 ? 150 THR C OG1 1 
ATOM   6715  C CG2 . THR C 1 150 ? 55.479  40.024  239.086 1.00 107.00 ? 150 THR C CG2 1 
ATOM   6716  N N   . LYS C 1 151 ? 53.706  36.304  238.113 1.00 102.32 ? 151 LYS C N   1 
ATOM   6717  C CA  . LYS C 1 151 ? 54.243  35.370  237.153 1.00 101.65 ? 151 LYS C CA  1 
ATOM   6718  C C   . LYS C 1 151 ? 53.339  35.029  235.980 1.00 96.03  ? 151 LYS C C   1 
ATOM   6719  O O   . LYS C 1 151 ? 52.294  35.651  235.750 1.00 93.78  ? 151 LYS C O   1 
ATOM   6720  C CB  . LYS C 1 151 ? 54.656  34.096  237.876 1.00 110.37 ? 151 LYS C CB  1 
ATOM   6721  C CG  . LYS C 1 151 ? 56.035  33.618  237.483 1.00 125.97 ? 151 LYS C CG  1 
ATOM   6722  C CD  . LYS C 1 151 ? 57.076  34.708  237.729 1.00 138.96 ? 151 LYS C CD  1 
ATOM   6723  C CE  . LYS C 1 151 ? 57.346  34.912  239.215 1.00 145.31 ? 151 LYS C CE  1 
ATOM   6724  N NZ  . LYS C 1 151 ? 57.690  36.326  239.555 1.00 151.11 ? 151 LYS C NZ  1 
ATOM   6725  N N   . GLY C 1 152 ? 53.817  34.101  235.167 1.00 92.63  ? 152 GLY C N   1 
ATOM   6726  C CA  . GLY C 1 152 ? 53.040  33.658  234.037 1.00 89.70  ? 152 GLY C CA  1 
ATOM   6727  C C   . GLY C 1 152 ? 53.442  34.150  232.680 1.00 84.85  ? 152 GLY C C   1 
ATOM   6728  O O   . GLY C 1 152 ? 54.420  33.683  232.093 1.00 82.28  ? 152 GLY C O   1 
ATOM   6729  N N   . ILE C 1 153 ? 52.662  35.109  232.201 1.00 81.00  ? 153 ILE C N   1 
ATOM   6730  C CA  . ILE C 1 153 ? 52.848  35.688  230.894 1.00 73.10  ? 153 ILE C CA  1 
ATOM   6731  C C   . ILE C 1 153 ? 52.584  37.130  231.001 1.00 68.50  ? 153 ILE C C   1 
ATOM   6732  O O   . ILE C 1 153 ? 51.654  37.543  231.693 1.00 65.22  ? 153 ILE C O   1 
ATOM   6733  C CB  . ILE C 1 153 ? 51.785  35.222  229.934 1.00 72.88  ? 153 ILE C CB  1 
ATOM   6734  C CG1 . ILE C 1 153 ? 51.925  33.739  229.693 1.00 72.07  ? 153 ILE C CG1 1 
ATOM   6735  C CG2 . ILE C 1 153 ? 51.874  35.995  228.649 1.00 70.58  ? 153 ILE C CG2 1 
ATOM   6736  C CD1 . ILE C 1 153 ? 53.256  33.405  229.181 1.00 78.23  ? 153 ILE C CD1 1 
ATOM   6737  N N   . SER C 1 154 ? 53.383  37.889  230.281 1.00 64.99  ? 154 SER C N   1 
ATOM   6738  C CA  . SER C 1 154 ? 53.183  39.305  230.240 1.00 66.36  ? 154 SER C CA  1 
ATOM   6739  C C   . SER C 1 154 ? 51.987  39.348  229.330 1.00 64.46  ? 154 SER C C   1 
ATOM   6740  O O   . SER C 1 154 ? 52.095  39.150  228.116 1.00 61.12  ? 154 SER C O   1 
ATOM   6741  C CB  . SER C 1 154 ? 54.359  40.020  229.599 1.00 69.21  ? 154 SER C CB  1 
ATOM   6742  O OG  . SER C 1 154 ? 54.620  41.254  230.253 1.00 67.95  ? 154 SER C OG  1 
ATOM   6743  N N   . THR C 1 155 ? 50.840  39.392  229.991 1.00 63.13  ? 155 THR C N   1 
ATOM   6744  C CA  . THR C 1 155 ? 49.540  39.438  229.369 1.00 61.34  ? 155 THR C CA  1 
ATOM   6745  C C   . THR C 1 155 ? 49.550  40.170  228.060 1.00 58.21  ? 155 THR C C   1 
ATOM   6746  O O   . THR C 1 155 ? 49.914  41.342  228.010 1.00 54.35  ? 155 THR C O   1 
ATOM   6747  C CB  . THR C 1 155 ? 48.541  40.139  230.288 1.00 64.91  ? 155 THR C CB  1 
ATOM   6748  O OG1 . THR C 1 155 ? 48.293  39.317  231.444 1.00 70.01  ? 155 THR C OG1 1 
ATOM   6749  C CG2 . THR C 1 155 ? 47.233  40.455  229.547 1.00 68.21  ? 155 THR C CG2 1 
ATOM   6750  N N   . PRO C 1 156 ? 49.100  39.493  226.994 1.00 58.91  ? 156 PRO C N   1 
ATOM   6751  C CA  . PRO C 1 156 ? 49.022  40.017  225.631 1.00 63.31  ? 156 PRO C CA  1 
ATOM   6752  C C   . PRO C 1 156 ? 48.022  41.161  225.475 1.00 66.93  ? 156 PRO C C   1 
ATOM   6753  O O   . PRO C 1 156 ? 47.423  41.672  226.454 1.00 70.29  ? 156 PRO C O   1 
ATOM   6754  C CB  . PRO C 1 156 ? 48.572  38.801  224.827 1.00 62.81  ? 156 PRO C CB  1 
ATOM   6755  C CG  . PRO C 1 156 ? 47.700  38.090  225.796 1.00 62.07  ? 156 PRO C CG  1 
ATOM   6756  C CD  . PRO C 1 156 ? 48.558  38.128  227.038 1.00 59.33  ? 156 PRO C CD  1 
ATOM   6757  N N   . VAL C 1 157 ? 47.858  41.576  224.227 1.00 64.92  ? 157 VAL C N   1 
ATOM   6758  C CA  . VAL C 1 157 ? 46.941  42.642  223.951 1.00 61.69  ? 157 VAL C CA  1 
ATOM   6759  C C   . VAL C 1 157 ? 45.593  42.032  223.901 1.00 62.09  ? 157 VAL C C   1 
ATOM   6760  O O   . VAL C 1 157 ? 45.408  40.929  223.358 1.00 61.06  ? 157 VAL C O   1 
ATOM   6761  C CB  . VAL C 1 157 ? 47.170  43.217  222.615 1.00 60.52  ? 157 VAL C CB  1 
ATOM   6762  C CG1 . VAL C 1 157 ? 46.360  44.468  222.472 1.00 63.39  ? 157 VAL C CG1 1 
ATOM   6763  C CG2 . VAL C 1 157 ? 48.625  43.450  222.417 1.00 62.94  ? 157 VAL C CG2 1 
ATOM   6764  N N   . GLU C 1 158 ? 44.656  42.754  224.473 1.00 63.29  ? 158 GLU C N   1 
ATOM   6765  C CA  . GLU C 1 158 ? 43.287  42.320  224.485 1.00 69.09  ? 158 GLU C CA  1 
ATOM   6766  C C   . GLU C 1 158 ? 42.499  43.614  224.463 1.00 66.60  ? 158 GLU C C   1 
ATOM   6767  O O   . GLU C 1 158 ? 43.107  44.686  224.369 1.00 64.31  ? 158 GLU C O   1 
ATOM   6768  C CB  . GLU C 1 158 ? 43.012  41.488  225.747 1.00 78.06  ? 158 GLU C CB  1 
ATOM   6769  C CG  . GLU C 1 158 ? 43.751  40.125  225.778 1.00 88.98  ? 158 GLU C CG  1 
ATOM   6770  C CD  . GLU C 1 158 ? 43.223  39.159  226.839 1.00 96.43  ? 158 GLU C CD  1 
ATOM   6771  O OE1 . GLU C 1 158 ? 43.283  39.517  228.037 1.00 103.26 ? 158 GLU C OE1 1 
ATOM   6772  O OE2 . GLU C 1 158 ? 42.763  38.040  226.480 1.00 100.09 ? 158 GLU C OE2 1 
ATOM   6773  N N   . GLY C 1 159 ? 41.169  43.518  224.472 1.00 63.27  ? 159 GLY C N   1 
ATOM   6774  C CA  . GLY C 1 159 ? 40.323  44.704  224.484 1.00 60.66  ? 159 GLY C CA  1 
ATOM   6775  C C   . GLY C 1 159 ? 39.678  45.091  223.165 1.00 56.42  ? 159 GLY C C   1 
ATOM   6776  O O   . GLY C 1 159 ? 39.839  44.396  222.159 1.00 55.40  ? 159 GLY C O   1 
ATOM   6777  N N   . SER C 1 160 ? 38.913  46.181  223.172 1.00 51.74  ? 160 SER C N   1 
ATOM   6778  C CA  . SER C 1 160 ? 38.257  46.644  221.953 1.00 45.94  ? 160 SER C CA  1 
ATOM   6779  C C   . SER C 1 160 ? 39.284  46.867  220.822 1.00 43.37  ? 160 SER C C   1 
ATOM   6780  O O   . SER C 1 160 ? 40.381  47.384  221.042 1.00 39.67  ? 160 SER C O   1 
ATOM   6781  C CB  . SER C 1 160 ? 37.509  47.969  222.210 1.00 44.88  ? 160 SER C CB  1 
ATOM   6782  O OG  . SER C 1 160 ? 36.488  47.868  223.189 1.00 37.88  ? 160 SER C OG  1 
ATOM   6783  N N   . GLN C 1 161 ? 38.953  46.440  219.617 1.00 40.15  ? 161 GLN C N   1 
ATOM   6784  C CA  . GLN C 1 161 ? 39.844  46.679  218.500 1.00 38.35  ? 161 GLN C CA  1 
ATOM   6785  C C   . GLN C 1 161 ? 38.999  47.349  217.402 1.00 38.34  ? 161 GLN C C   1 
ATOM   6786  O O   . GLN C 1 161 ? 37.753  47.479  217.529 1.00 37.53  ? 161 GLN C O   1 
ATOM   6787  C CB  . GLN C 1 161 ? 40.546  45.396  218.067 1.00 39.24  ? 161 GLN C CB  1 
ATOM   6788  C CG  . GLN C 1 161 ? 39.602  44.237  217.898 1.00 52.83  ? 161 GLN C CG  1 
ATOM   6789  C CD  . GLN C 1 161 ? 40.274  42.874  217.920 1.00 57.12  ? 161 GLN C CD  1 
ATOM   6790  O OE1 . GLN C 1 161 ? 40.680  42.335  216.873 1.00 58.40  ? 161 GLN C OE1 1 
ATOM   6791  N NE2 . GLN C 1 161 ? 40.348  42.285  219.107 1.00 60.66  ? 161 GLN C NE2 1 
ATOM   6792  N N   . TYR C 1 162 ? 39.654  47.796  216.337 1.00 35.14  ? 162 TYR C N   1 
ATOM   6793  C CA  . TYR C 1 162 ? 38.939  48.522  215.310 1.00 33.15  ? 162 TYR C CA  1 
ATOM   6794  C C   . TYR C 1 162 ? 39.811  48.736  214.101 1.00 34.57  ? 162 TYR C C   1 
ATOM   6795  O O   . TYR C 1 162 ? 40.982  49.093  214.218 1.00 34.91  ? 162 TYR C O   1 
ATOM   6796  C CB  . TYR C 1 162 ? 38.612  49.866  215.910 1.00 31.71  ? 162 TYR C CB  1 
ATOM   6797  C CG  . TYR C 1 162 ? 37.901  50.844  215.057 1.00 33.62  ? 162 TYR C CG  1 
ATOM   6798  C CD1 . TYR C 1 162 ? 36.521  50.910  215.085 1.00 41.76  ? 162 TYR C CD1 1 
ATOM   6799  C CD2 . TYR C 1 162 ? 38.590  51.855  214.398 1.00 35.83  ? 162 TYR C CD2 1 
ATOM   6800  C CE1 . TYR C 1 162 ? 35.806  52.001  214.493 1.00 46.07  ? 162 TYR C CE1 1 
ATOM   6801  C CE2 . TYR C 1 162 ? 37.903  52.952  213.801 1.00 41.89  ? 162 TYR C CE2 1 
ATOM   6802  C CZ  . TYR C 1 162 ? 36.495  53.036  213.864 1.00 44.28  ? 162 TYR C CZ  1 
ATOM   6803  O OH  . TYR C 1 162 ? 35.773  54.170  213.442 1.00 33.13  ? 162 TYR C OH  1 
ATOM   6804  N N   . HIS C 1 163 ? 39.248  48.503  212.929 1.00 34.78  ? 163 HIS C N   1 
ATOM   6805  C CA  . HIS C 1 163 ? 39.996  48.706  211.695 1.00 36.37  ? 163 HIS C CA  1 
ATOM   6806  C C   . HIS C 1 163 ? 39.048  49.183  210.628 1.00 33.64  ? 163 HIS C C   1 
ATOM   6807  O O   . HIS C 1 163 ? 37.977  48.589  210.429 1.00 29.61  ? 163 HIS C O   1 
ATOM   6808  C CB  . HIS C 1 163 ? 40.616  47.422  211.174 1.00 41.81  ? 163 HIS C CB  1 
ATOM   6809  C CG  . HIS C 1 163 ? 41.186  46.554  212.234 1.00 52.04  ? 163 HIS C CG  1 
ATOM   6810  N ND1 . HIS C 1 163 ? 42.403  46.810  212.816 1.00 57.06  ? 163 HIS C ND1 1 
ATOM   6811  C CD2 . HIS C 1 163 ? 40.709  45.426  212.818 1.00 56.11  ? 163 HIS C CD2 1 
ATOM   6812  C CE1 . HIS C 1 163 ? 42.657  45.875  213.717 1.00 64.00  ? 163 HIS C CE1 1 
ATOM   6813  N NE2 . HIS C 1 163 ? 41.645  45.023  213.738 1.00 61.61  ? 163 HIS C NE2 1 
ATOM   6814  N N   . VAL C 1 164 ? 39.455  50.238  209.936 1.00 29.67  ? 164 VAL C N   1 
ATOM   6815  C CA  . VAL C 1 164 ? 38.671  50.793  208.859 1.00 26.60  ? 164 VAL C CA  1 
ATOM   6816  C C   . VAL C 1 164 ? 39.667  51.343  207.906 1.00 25.15  ? 164 VAL C C   1 
ATOM   6817  O O   . VAL C 1 164 ? 40.777  51.725  208.307 1.00 24.25  ? 164 VAL C O   1 
ATOM   6818  C CB  . VAL C 1 164 ? 37.837  52.003  209.275 1.00 29.70  ? 164 VAL C CB  1 
ATOM   6819  C CG1 . VAL C 1 164 ? 36.843  52.328  208.191 1.00 31.55  ? 164 VAL C CG1 1 
ATOM   6820  C CG2 . VAL C 1 164 ? 37.098  51.740  210.543 1.00 38.80  ? 164 VAL C CG2 1 
ATOM   6821  N N   . PHE C 1 165 ? 39.257  51.399  206.645 1.00 24.80  ? 165 PHE C N   1 
ATOM   6822  C CA  . PHE C 1 165 ? 40.088  51.955  205.599 1.00 21.24  ? 165 PHE C CA  1 
ATOM   6823  C C   . PHE C 1 165 ? 39.247  52.351  204.398 1.00 13.73  ? 165 PHE C C   1 
ATOM   6824  O O   . PHE C 1 165 ? 38.189  51.777  204.103 1.00 7.55   ? 165 PHE C O   1 
ATOM   6825  C CB  . PHE C 1 165 ? 41.143  50.973  205.153 1.00 24.25  ? 165 PHE C CB  1 
ATOM   6826  C CG  . PHE C 1 165 ? 40.603  49.978  204.245 1.00 30.38  ? 165 PHE C CG  1 
ATOM   6827  C CD1 . PHE C 1 165 ? 39.845  48.944  204.726 1.00 34.55  ? 165 PHE C CD1 1 
ATOM   6828  C CD2 . PHE C 1 165 ? 40.752  50.120  202.894 1.00 35.53  ? 165 PHE C CD2 1 
ATOM   6829  C CE1 . PHE C 1 165 ? 39.230  48.073  203.869 1.00 38.59  ? 165 PHE C CE1 1 
ATOM   6830  C CE2 . PHE C 1 165 ? 40.131  49.241  202.037 1.00 37.64  ? 165 PHE C CE2 1 
ATOM   6831  C CZ  . PHE C 1 165 ? 39.373  48.212  202.528 1.00 33.89  ? 165 PHE C CZ  1 
ATOM   6832  N N   . ALA C 1 166 ? 39.846  53.231  203.629 1.00 11.42  ? 166 ALA C N   1 
ATOM   6833  C CA  . ALA C 1 166 ? 39.206  53.758  202.489 1.00 14.21  ? 166 ALA C CA  1 
ATOM   6834  C C   . ALA C 1 166 ? 40.187  54.151  201.442 1.00 16.31  ? 166 ALA C C   1 
ATOM   6835  O O   . ALA C 1 166 ? 41.320  54.583  201.687 1.00 15.02  ? 166 ALA C O   1 
ATOM   6836  C CB  . ALA C 1 166 ? 38.377  54.947  202.873 1.00 14.04  ? 166 ALA C CB  1 
ATOM   6837  N N   . VAL C 1 167 ? 39.690  54.022  200.241 1.00 19.57  ? 167 VAL C N   1 
ATOM   6838  C CA  . VAL C 1 167 ? 40.445  54.360  199.092 1.00 22.32  ? 167 VAL C CA  1 
ATOM   6839  C C   . VAL C 1 167 ? 39.561  55.343  198.402 1.00 27.84  ? 167 VAL C C   1 
ATOM   6840  O O   . VAL C 1 167 ? 38.412  55.012  198.081 1.00 24.44  ? 167 VAL C O   1 
ATOM   6841  C CB  . VAL C 1 167 ? 40.562  53.188  198.218 1.00 18.19  ? 167 VAL C CB  1 
ATOM   6842  C CG1 . VAL C 1 167 ? 41.503  53.497  197.130 1.00 11.90  ? 167 VAL C CG1 1 
ATOM   6843  C CG2 . VAL C 1 167 ? 41.035  52.034  199.014 1.00 18.96  ? 167 VAL C CG2 1 
ATOM   6844  N N   . GLY C 1 168 ? 40.077  56.554  198.202 1.00 35.16  ? 168 GLY C N   1 
ATOM   6845  C CA  . GLY C 1 168 ? 39.292  57.583  197.544 1.00 42.59  ? 168 GLY C CA  1 
ATOM   6846  C C   . GLY C 1 168 ? 39.942  58.583  196.592 1.00 46.94  ? 168 GLY C C   1 
ATOM   6847  O O   . GLY C 1 168 ? 41.171  58.765  196.577 1.00 47.61  ? 168 GLY C O   1 
ATOM   6848  N N   . GLY C 1 169 ? 39.070  59.224  195.798 1.00 49.72  ? 169 GLY C N   1 
ATOM   6849  C CA  . GLY C 1 169 ? 39.434  60.234  194.806 1.00 48.98  ? 169 GLY C CA  1 
ATOM   6850  C C   . GLY C 1 169 ? 39.647  61.629  195.362 1.00 47.54  ? 169 GLY C C   1 
ATOM   6851  O O   . GLY C 1 169 ? 40.162  62.486  194.665 1.00 51.52  ? 169 GLY C O   1 
ATOM   6852  N N   . GLU C 1 170 ? 39.141  61.881  196.559 1.00 45.91  ? 170 GLU C N   1 
ATOM   6853  C CA  . GLU C 1 170 ? 39.336  63.137  197.260 1.00 48.80  ? 170 GLU C CA  1 
ATOM   6854  C C   . GLU C 1 170 ? 39.434  62.686  198.704 1.00 49.59  ? 170 GLU C C   1 
ATOM   6855  O O   . GLU C 1 170 ? 39.122  61.536  199.032 1.00 52.00  ? 170 GLU C O   1 
ATOM   6856  C CB  . GLU C 1 170 ? 38.193  64.137  197.047 1.00 54.19  ? 170 GLU C CB  1 
ATOM   6857  C CG  . GLU C 1 170 ? 36.883  63.811  197.726 1.00 63.38  ? 170 GLU C CG  1 
ATOM   6858  C CD  . GLU C 1 170 ? 35.721  63.743  196.736 1.00 70.78  ? 170 GLU C CD  1 
ATOM   6859  O OE1 . GLU C 1 170 ? 35.818  62.963  195.753 1.00 69.14  ? 170 GLU C OE1 1 
ATOM   6860  O OE2 . GLU C 1 170 ? 34.721  64.485  196.918 1.00 76.58  ? 170 GLU C OE2 1 
ATOM   6861  N N   . PRO C 1 171 ? 39.902  63.559  199.591 1.00 50.90  ? 171 PRO C N   1 
ATOM   6862  C CA  . PRO C 1 171 ? 40.011  63.124  200.989 1.00 51.78  ? 171 PRO C CA  1 
ATOM   6863  C C   . PRO C 1 171 ? 38.732  62.525  201.515 1.00 49.67  ? 171 PRO C C   1 
ATOM   6864  O O   . PRO C 1 171 ? 37.660  62.795  200.987 1.00 45.07  ? 171 PRO C O   1 
ATOM   6865  C CB  . PRO C 1 171 ? 40.374  64.405  201.721 1.00 51.41  ? 171 PRO C CB  1 
ATOM   6866  C CG  . PRO C 1 171 ? 39.782  65.462  200.832 1.00 54.15  ? 171 PRO C CG  1 
ATOM   6867  C CD  . PRO C 1 171 ? 40.121  65.004  199.463 1.00 52.71  ? 171 PRO C CD  1 
ATOM   6868  N N   . LEU C 1 172 ? 38.853  61.699  202.539 1.00 50.67  ? 172 LEU C N   1 
ATOM   6869  C CA  . LEU C 1 172 ? 37.674  61.089  203.103 1.00 55.45  ? 172 LEU C CA  1 
ATOM   6870  C C   . LEU C 1 172 ? 36.859  62.109  203.895 1.00 56.80  ? 172 LEU C C   1 
ATOM   6871  O O   . LEU C 1 172 ? 37.432  63.008  204.540 1.00 56.08  ? 172 LEU C O   1 
ATOM   6872  C CB  . LEU C 1 172 ? 38.068  59.897  203.965 1.00 56.20  ? 172 LEU C CB  1 
ATOM   6873  C CG  . LEU C 1 172 ? 37.003  59.147  204.775 1.00 57.26  ? 172 LEU C CG  1 
ATOM   6874  C CD1 . LEU C 1 172 ? 37.075  59.652  206.187 1.00 56.31  ? 172 LEU C CD1 1 
ATOM   6875  C CD2 . LEU C 1 172 ? 35.556  59.222  204.173 1.00 57.36  ? 172 LEU C CD2 1 
ATOM   6876  N N   . ASP C 1 173 ? 35.532  61.988  203.768 1.00 56.88  ? 173 ASP C N   1 
ATOM   6877  C CA  . ASP C 1 173 ? 34.550  62.840  204.437 1.00 58.25  ? 173 ASP C CA  1 
ATOM   6878  C C   . ASP C 1 173 ? 34.146  62.196  205.713 1.00 54.83  ? 173 ASP C C   1 
ATOM   6879  O O   . ASP C 1 173 ? 33.720  61.028  205.739 1.00 52.02  ? 173 ASP C O   1 
ATOM   6880  C CB  . ASP C 1 173 ? 33.296  62.977  203.614 1.00 69.71  ? 173 ASP C CB  1 
ATOM   6881  C CG  . ASP C 1 173 ? 33.589  63.296  202.201 1.00 81.35  ? 173 ASP C CG  1 
ATOM   6882  O OD1 . ASP C 1 173 ? 34.200  62.441  201.520 1.00 89.17  ? 173 ASP C OD1 1 
ATOM   6883  O OD2 . ASP C 1 173 ? 33.262  64.427  201.782 1.00 91.52  ? 173 ASP C OD2 1 
ATOM   6884  N N   . LEU C 1 174 ? 34.118  63.020  206.744 1.00 50.53  ? 174 LEU C N   1 
ATOM   6885  C CA  . LEU C 1 174 ? 33.822  62.530  208.055 1.00 47.14  ? 174 LEU C CA  1 
ATOM   6886  C C   . LEU C 1 174 ? 32.630  63.162  208.695 1.00 47.66  ? 174 LEU C C   1 
ATOM   6887  O O   . LEU C 1 174 ? 32.112  64.180  208.219 1.00 45.51  ? 174 LEU C O   1 
ATOM   6888  C CB  . LEU C 1 174 ? 35.021  62.759  208.955 1.00 44.39  ? 174 LEU C CB  1 
ATOM   6889  C CG  . LEU C 1 174 ? 36.384  62.360  208.401 1.00 41.72  ? 174 LEU C CG  1 
ATOM   6890  C CD1 . LEU C 1 174 ? 36.946  63.375  207.446 1.00 37.50  ? 174 LEU C CD1 1 
ATOM   6891  C CD2 . LEU C 1 174 ? 37.301  62.238  209.551 1.00 43.08  ? 174 LEU C CD2 1 
ATOM   6892  N N   . GLN C 1 175 ? 32.249  62.546  209.816 1.00 47.43  ? 175 GLN C N   1 
ATOM   6893  C CA  . GLN C 1 175 ? 31.137  62.951  210.656 1.00 43.87  ? 175 GLN C CA  1 
ATOM   6894  C C   . GLN C 1 175 ? 31.477  62.681  212.072 1.00 41.77  ? 175 GLN C C   1 
ATOM   6895  O O   . GLN C 1 175 ? 32.023  61.630  212.432 1.00 38.46  ? 175 GLN C O   1 
ATOM   6896  C CB  . GLN C 1 175 ? 29.894  62.141  210.386 1.00 40.53  ? 175 GLN C CB  1 
ATOM   6897  C CG  . GLN C 1 175 ? 28.737  62.989  210.060 1.00 42.49  ? 175 GLN C CG  1 
ATOM   6898  C CD  . GLN C 1 175 ? 27.976  63.428  211.277 1.00 44.80  ? 175 GLN C CD  1 
ATOM   6899  O OE1 . GLN C 1 175 ? 26.771  63.303  211.310 1.00 50.43  ? 175 GLN C OE1 1 
ATOM   6900  N NE2 . GLN C 1 175 ? 28.641  64.051  212.221 1.00 45.88  ? 175 GLN C NE2 1 
ATOM   6901  N N   . GLY C 1 176 ? 31.114  63.645  212.911 1.00 43.80  ? 176 GLY C N   1 
ATOM   6902  C CA  . GLY C 1 176 ? 31.374  63.503  214.321 1.00 44.64  ? 176 GLY C CA  1 
ATOM   6903  C C   . GLY C 1 176 ? 30.176  63.294  215.197 1.00 44.41  ? 176 GLY C C   1 
ATOM   6904  O O   . GLY C 1 176 ? 29.079  63.910  214.990 1.00 38.14  ? 176 GLY C O   1 
ATOM   6905  N N   . LEU C 1 177 ? 30.319  62.196  215.983 1.00 42.29  ? 177 LEU C N   1 
ATOM   6906  C CA  . LEU C 1 177 ? 29.412  61.825  217.099 1.00 46.38  ? 177 LEU C CA  1 
ATOM   6907  C C   . LEU C 1 177 ? 30.470  61.544  218.073 1.00 52.32  ? 177 LEU C C   1 
ATOM   6908  O O   . LEU C 1 177 ? 31.631  61.270  217.717 1.00 51.42  ? 177 LEU C O   1 
ATOM   6909  C CB  . LEU C 1 177 ? 28.718  60.438  217.023 1.00 43.34  ? 177 LEU C CB  1 
ATOM   6910  C CG  . LEU C 1 177 ? 28.545  60.147  215.581 1.00 45.91  ? 177 LEU C CG  1 
ATOM   6911  C CD1 . LEU C 1 177 ? 27.925  58.660  215.430 1.00 48.80  ? 177 LEU C CD1 1 
ATOM   6912  C CD2 . LEU C 1 177 ? 27.864  61.456  214.745 1.00 42.19  ? 177 LEU C CD2 1 
ATOM   6913  N N   . VAL C 1 178 ? 30.051  61.563  219.338 1.00 50.94  ? 178 VAL C N   1 
ATOM   6914  C CA  . VAL C 1 178 ? 30.962  61.362  220.373 1.00 54.47  ? 178 VAL C CA  1 
ATOM   6915  C C   . VAL C 1 178 ? 30.162  60.880  221.562 1.00 59.25  ? 178 VAL C C   1 
ATOM   6916  O O   . VAL C 1 178 ? 28.927  60.912  221.567 1.00 59.76  ? 178 VAL C O   1 
ATOM   6917  C CB  . VAL C 1 178 ? 31.665  62.613  220.654 1.00 51.39  ? 178 VAL C CB  1 
ATOM   6918  C CG1 . VAL C 1 178 ? 30.641  63.662  221.059 1.00 48.92  ? 178 VAL C CG1 1 
ATOM   6919  C CG2 . VAL C 1 178 ? 32.708  62.379  221.720 1.00 56.08  ? 178 VAL C CG2 1 
ATOM   6920  N N   . THR C 1 179 ? 30.901  60.373  222.514 1.00 64.54  ? 179 THR C N   1 
ATOM   6921  C CA  . THR C 1 179 ? 30.340  59.892  223.747 1.00 70.75  ? 179 THR C CA  1 
ATOM   6922  C C   . THR C 1 179 ? 30.036  61.106  224.613 1.00 79.15  ? 179 THR C C   1 
ATOM   6923  O O   . THR C 1 179 ? 28.900  61.551  224.657 1.00 84.54  ? 179 THR C O   1 
ATOM   6924  C CB  . THR C 1 179 ? 31.330  59.002  224.426 1.00 67.69  ? 179 THR C CB  1 
ATOM   6925  O OG1 . THR C 1 179 ? 32.643  59.356  223.961 1.00 66.76  ? 179 THR C OG1 1 
ATOM   6926  C CG2 . THR C 1 179 ? 31.031  57.558  224.096 1.00 67.63  ? 179 THR C CG2 1 
ATOM   6927  N N   . ASP C 1 180 ? 31.028  61.728  225.231 1.00 84.01  ? 180 ASP C N   1 
ATOM   6928  C CA  . ASP C 1 180 ? 30.656  62.863  226.049 1.00 86.06  ? 180 ASP C CA  1 
ATOM   6929  C C   . ASP C 1 180 ? 30.924  64.207  225.434 1.00 78.81  ? 180 ASP C C   1 
ATOM   6930  O O   . ASP C 1 180 ? 32.060  64.534  225.138 1.00 77.14  ? 180 ASP C O   1 
ATOM   6931  C CB  . ASP C 1 180 ? 31.269  62.761  227.430 1.00 100.05 ? 180 ASP C CB  1 
ATOM   6932  C CG  . ASP C 1 180 ? 30.281  63.109  228.511 1.00 113.09 ? 180 ASP C CG  1 
ATOM   6933  O OD1 . ASP C 1 180 ? 29.048  63.049  228.256 1.00 117.77 ? 180 ASP C OD1 1 
ATOM   6934  O OD2 . ASP C 1 180 ? 30.743  63.459  229.614 1.00 122.26 ? 180 ASP C OD2 1 
ATOM   6935  N N   . ALA C 1 181 ? 29.879  65.004  225.269 1.00 71.08  ? 181 ALA C N   1 
ATOM   6936  C CA  . ALA C 1 181 ? 30.043  66.320  224.681 1.00 70.81  ? 181 ALA C CA  1 
ATOM   6937  C C   . ALA C 1 181 ? 30.765  67.253  225.649 1.00 72.68  ? 181 ALA C C   1 
ATOM   6938  O O   . ALA C 1 181 ? 31.074  68.400  225.351 1.00 70.93  ? 181 ALA C O   1 
ATOM   6939  C CB  . ALA C 1 181 ? 28.705  66.873  224.315 1.00 70.28  ? 181 ALA C CB  1 
ATOM   6940  N N   . ARG C 1 182 ? 31.078  66.728  226.811 1.00 77.57  ? 182 ARG C N   1 
ATOM   6941  C CA  . ARG C 1 182 ? 31.745  67.510  227.824 1.00 84.38  ? 182 ARG C CA  1 
ATOM   6942  C C   . ARG C 1 182 ? 33.229  67.214  227.838 1.00 86.53  ? 182 ARG C C   1 
ATOM   6943  O O   . ARG C 1 182 ? 33.982  67.750  228.645 1.00 87.16  ? 182 ARG C O   1 
ATOM   6944  C CB  . ARG C 1 182 ? 31.121  67.145  229.152 1.00 89.70  ? 182 ARG C CB  1 
ATOM   6945  C CG  . ARG C 1 182 ? 29.615  67.096  229.037 1.00 93.56  ? 182 ARG C CG  1 
ATOM   6946  C CD  . ARG C 1 182 ? 29.066  65.840  229.623 1.00 102.63 ? 182 ARG C CD  1 
ATOM   6947  N NE  . ARG C 1 182 ? 28.372  66.091  230.877 1.00 117.86 ? 182 ARG C NE  1 
ATOM   6948  C CZ  . ARG C 1 182 ? 28.320  65.240  231.898 1.00 126.58 ? 182 ARG C CZ  1 
ATOM   6949  N NH1 . ARG C 1 182 ? 28.934  64.062  231.825 1.00 131.83 ? 182 ARG C NH1 1 
ATOM   6950  N NH2 . ARG C 1 182 ? 27.585  65.546  232.969 1.00 132.60 ? 182 ARG C NH2 1 
ATOM   6951  N N   . THR C 1 183 ? 33.643  66.325  226.954 1.00 89.36  ? 183 THR C N   1 
ATOM   6952  C CA  . THR C 1 183 ? 35.037  65.967  226.881 1.00 90.24  ? 183 THR C CA  1 
ATOM   6953  C C   . THR C 1 183 ? 35.828  67.204  226.522 1.00 89.12  ? 183 THR C C   1 
ATOM   6954  O O   . THR C 1 183 ? 35.428  68.032  225.695 1.00 87.01  ? 183 THR C O   1 
ATOM   6955  C CB  . THR C 1 183 ? 35.283  64.844  225.883 1.00 94.05  ? 183 THR C CB  1 
ATOM   6956  O OG1 . THR C 1 183 ? 34.393  63.748  226.160 1.00 95.90  ? 183 THR C OG1 1 
ATOM   6957  C CG2 . THR C 1 183 ? 36.710  64.363  226.006 1.00 96.32  ? 183 THR C CG2 1 
ATOM   6958  N N   . LYS C 1 184 ? 36.982  67.291  227.142 1.00 90.91  ? 184 LYS C N   1 
ATOM   6959  C CA  . LYS C 1 184 ? 37.842  68.430  227.004 1.00 95.62  ? 184 LYS C CA  1 
ATOM   6960  C C   . LYS C 1 184 ? 39.048  68.191  226.121 1.00 92.02  ? 184 LYS C C   1 
ATOM   6961  O O   . LYS C 1 184 ? 40.190  68.153  226.579 1.00 91.18  ? 184 LYS C O   1 
ATOM   6962  C CB  . LYS C 1 184 ? 38.243  68.860  228.411 1.00 108.17 ? 184 LYS C CB  1 
ATOM   6963  C CG  . LYS C 1 184 ? 37.021  68.905  229.371 1.00 124.00 ? 184 LYS C CG  1 
ATOM   6964  C CD  . LYS C 1 184 ? 37.354  69.314  230.835 1.00 135.07 ? 184 LYS C CD  1 
ATOM   6965  C CE  . LYS C 1 184 ? 36.069  69.491  231.702 1.00 140.29 ? 184 LYS C CE  1 
ATOM   6966  N NZ  . LYS C 1 184 ? 36.294  69.955  233.120 1.00 139.29 ? 184 LYS C NZ  1 
ATOM   6967  N N   . TYR C 1 185 ? 38.790  67.985  224.843 1.00 90.06  ? 185 TYR C N   1 
ATOM   6968  C CA  . TYR C 1 185 ? 39.869  67.768  223.904 1.00 89.67  ? 185 TYR C CA  1 
ATOM   6969  C C   . TYR C 1 185 ? 40.650  69.042  223.866 1.00 92.72  ? 185 TYR C C   1 
ATOM   6970  O O   . TYR C 1 185 ? 40.073  70.113  223.806 1.00 93.11  ? 185 TYR C O   1 
ATOM   6971  C CB  . TYR C 1 185 ? 39.293  67.476  222.544 1.00 85.23  ? 185 TYR C CB  1 
ATOM   6972  C CG  . TYR C 1 185 ? 38.504  66.209  222.559 1.00 80.18  ? 185 TYR C CG  1 
ATOM   6973  C CD1 . TYR C 1 185 ? 39.150  64.997  222.703 1.00 78.81  ? 185 TYR C CD1 1 
ATOM   6974  C CD2 . TYR C 1 185 ? 37.120  66.212  222.444 1.00 78.56  ? 185 TYR C CD2 1 
ATOM   6975  C CE1 . TYR C 1 185 ? 38.453  63.805  222.731 1.00 78.28  ? 185 TYR C CE1 1 
ATOM   6976  C CE2 . TYR C 1 185 ? 36.405  65.020  222.466 1.00 78.60  ? 185 TYR C CE2 1 
ATOM   6977  C CZ  . TYR C 1 185 ? 37.085  63.807  222.612 1.00 78.66  ? 185 TYR C CZ  1 
ATOM   6978  O OH  . TYR C 1 185 ? 36.429  62.584  222.630 1.00 78.36  ? 185 TYR C OH  1 
ATOM   6979  N N   . LYS C 1 186 ? 41.962  68.946  223.897 1.00 96.57  ? 186 LYS C N   1 
ATOM   6980  C CA  . LYS C 1 186 ? 42.756  70.154  223.892 1.00 104.60 ? 186 LYS C CA  1 
ATOM   6981  C C   . LYS C 1 186 ? 42.695  70.585  222.468 1.00 108.67 ? 186 LYS C C   1 
ATOM   6982  O O   . LYS C 1 186 ? 43.231  69.924  221.606 1.00 109.97 ? 186 LYS C O   1 
ATOM   6983  C CB  . LYS C 1 186 ? 44.196  69.875  224.296 1.00 107.47 ? 186 LYS C CB  1 
ATOM   6984  C CG  . LYS C 1 186 ? 44.321  68.972  225.502 1.00 115.14 ? 186 LYS C CG  1 
ATOM   6985  C CD  . LYS C 1 186 ? 44.112  67.500  225.111 1.00 120.90 ? 186 LYS C CD  1 
ATOM   6986  C CE  . LYS C 1 186 ? 42.835  66.896  225.670 1.00 120.94 ? 186 LYS C CE  1 
ATOM   6987  N NZ  . LYS C 1 186 ? 42.866  66.829  227.154 1.00 125.79 ? 186 LYS C NZ  1 
ATOM   6988  N N   . GLU C 1 187 ? 41.960  71.652  222.211 1.00 115.62 ? 187 GLU C N   1 
ATOM   6989  C CA  . GLU C 1 187 ? 41.812  72.183  220.861 1.00 124.25 ? 187 GLU C CA  1 
ATOM   6990  C C   . GLU C 1 187 ? 43.177  72.468  220.305 1.00 121.81 ? 187 GLU C C   1 
ATOM   6991  O O   . GLU C 1 187 ? 43.352  72.784  219.130 1.00 122.89 ? 187 GLU C O   1 
ATOM   6992  C CB  . GLU C 1 187 ? 41.076  73.486  220.938 1.00 137.16 ? 187 GLU C CB  1 
ATOM   6993  C CG  . GLU C 1 187 ? 41.703  74.390  221.965 1.00 155.87 ? 187 GLU C CG  1 
ATOM   6994  C CD  . GLU C 1 187 ? 40.859  75.603  222.230 1.00 167.97 ? 187 GLU C CD  1 
ATOM   6995  O OE1 . GLU C 1 187 ? 39.650  75.439  222.551 1.00 175.61 ? 187 GLU C OE1 1 
ATOM   6996  O OE2 . GLU C 1 187 ? 41.410  76.719  222.106 1.00 175.51 ? 187 GLU C OE2 1 
ATOM   6997  N N   . GLU C 1 188 ? 44.131  72.482  221.206 1.00 118.40 ? 188 GLU C N   1 
ATOM   6998  C CA  . GLU C 1 188 ? 45.474  72.703  220.811 1.00 118.15 ? 188 GLU C CA  1 
ATOM   6999  C C   . GLU C 1 188 ? 46.122  71.373  220.419 1.00 110.96 ? 188 GLU C C   1 
ATOM   7000  O O   . GLU C 1 188 ? 46.362  70.519  221.281 1.00 111.32 ? 188 GLU C O   1 
ATOM   7001  C CB  . GLU C 1 188 ? 46.230  73.355  221.961 1.00 132.06 ? 188 GLU C CB  1 
ATOM   7002  C CG  . GLU C 1 188 ? 47.570  73.926  221.532 1.00 153.35 ? 188 GLU C CG  1 
ATOM   7003  C CD  . GLU C 1 188 ? 47.446  74.837  220.307 1.00 164.85 ? 188 GLU C CD  1 
ATOM   7004  O OE1 . GLU C 1 188 ? 47.317  74.308  219.168 1.00 171.49 ? 188 GLU C OE1 1 
ATOM   7005  O OE2 . GLU C 1 188 ? 47.470  76.080  220.491 1.00 172.48 ? 188 GLU C OE2 1 
ATOM   7006  N N   . GLY C 1 189 ? 46.334  71.165  219.120 1.00 102.70 ? 189 GLY C N   1 
ATOM   7007  C CA  . GLY C 1 189 ? 46.993  69.946  218.662 1.00 93.47  ? 189 GLY C CA  1 
ATOM   7008  C C   . GLY C 1 189 ? 46.226  68.708  218.198 1.00 85.60  ? 189 GLY C C   1 
ATOM   7009  O O   . GLY C 1 189 ? 46.782  67.597  218.182 1.00 85.56  ? 189 GLY C O   1 
ATOM   7010  N N   . VAL C 1 190 ? 44.969  68.886  217.806 1.00 75.75  ? 190 VAL C N   1 
ATOM   7011  C CA  . VAL C 1 190 ? 44.144  67.786  217.321 1.00 66.47  ? 190 VAL C CA  1 
ATOM   7012  C C   . VAL C 1 190 ? 42.764  68.275  216.978 1.00 62.93  ? 190 VAL C C   1 
ATOM   7013  O O   . VAL C 1 190 ? 42.102  68.935  217.778 1.00 63.20  ? 190 VAL C O   1 
ATOM   7014  C CB  . VAL C 1 190 ? 44.013  66.635  218.336 1.00 65.19  ? 190 VAL C CB  1 
ATOM   7015  C CG1 . VAL C 1 190 ? 43.809  67.173  219.719 1.00 63.22  ? 190 VAL C CG1 1 
ATOM   7016  C CG2 . VAL C 1 190 ? 42.837  65.749  217.964 1.00 63.41  ? 190 VAL C CG2 1 
ATOM   7017  N N   . VAL C 1 191 ? 42.336  67.955  215.771 1.00 59.67  ? 191 VAL C N   1 
ATOM   7018  C CA  . VAL C 1 191 ? 41.018  68.356  215.326 1.00 59.42  ? 191 VAL C CA  1 
ATOM   7019  C C   . VAL C 1 191 ? 39.928  67.702  216.138 1.00 61.30  ? 191 VAL C C   1 
ATOM   7020  O O   . VAL C 1 191 ? 39.994  66.507  216.459 1.00 62.58  ? 191 VAL C O   1 
ATOM   7021  C CB  . VAL C 1 191 ? 40.758  67.989  213.897 1.00 58.65  ? 191 VAL C CB  1 
ATOM   7022  C CG1 . VAL C 1 191 ? 41.094  69.140  213.012 1.00 59.44  ? 191 VAL C CG1 1 
ATOM   7023  C CG2 . VAL C 1 191 ? 41.548  66.759  213.543 1.00 60.33  ? 191 VAL C CG2 1 
ATOM   7024  N N   . THR C 1 192 ? 38.876  68.486  216.347 1.00 59.46  ? 192 THR C N   1 
ATOM   7025  C CA  . THR C 1 192 ? 37.705  68.113  217.110 1.00 53.78  ? 192 THR C CA  1 
ATOM   7026  C C   . THR C 1 192 ? 36.598  68.940  216.561 1.00 53.08  ? 192 THR C C   1 
ATOM   7027  O O   . THR C 1 192 ? 36.816  69.969  215.917 1.00 51.55  ? 192 THR C O   1 
ATOM   7028  C CB  . THR C 1 192 ? 37.762  68.575  218.570 1.00 49.96  ? 192 THR C CB  1 
ATOM   7029  O OG1 . THR C 1 192 ? 38.974  69.306  218.846 1.00 50.33  ? 192 THR C OG1 1 
ATOM   7030  C CG2 . THR C 1 192 ? 37.593  67.411  219.481 1.00 47.47  ? 192 THR C CG2 1 
ATOM   7031  N N   . ILE C 1 193 ? 35.402  68.533  216.923 1.00 55.22  ? 193 ILE C N   1 
ATOM   7032  C CA  . ILE C 1 193 ? 34.200  69.243  216.537 1.00 60.29  ? 193 ILE C CA  1 
ATOM   7033  C C   . ILE C 1 193 ? 34.338  70.761  216.724 1.00 63.02  ? 193 ILE C C   1 
ATOM   7034  O O   . ILE C 1 193 ? 33.940  71.528  215.860 1.00 61.82  ? 193 ILE C O   1 
ATOM   7035  C CB  . ILE C 1 193 ? 32.985  68.736  217.327 1.00 59.32  ? 193 ILE C CB  1 
ATOM   7036  C CG1 . ILE C 1 193 ? 33.432  67.816  218.470 1.00 60.16  ? 193 ILE C CG1 1 
ATOM   7037  C CG2 . ILE C 1 193 ? 32.092  67.946  216.420 1.00 57.40  ? 193 ILE C CG2 1 
ATOM   7038  C CD1 . ILE C 1 193 ? 34.408  68.430  219.481 1.00 63.53  ? 193 ILE C CD1 1 
ATOM   7039  N N   . LYS C 1 194 ? 34.961  71.202  217.808 1.00 67.56  ? 194 LYS C N   1 
ATOM   7040  C CA  . LYS C 1 194 ? 35.088  72.642  217.992 1.00 76.60  ? 194 LYS C CA  1 
ATOM   7041  C C   . LYS C 1 194 ? 36.040  73.182  216.969 1.00 75.12  ? 194 LYS C C   1 
ATOM   7042  O O   . LYS C 1 194 ? 35.662  73.979  216.121 1.00 72.01  ? 194 LYS C O   1 
ATOM   7043  C CB  . LYS C 1 194 ? 35.557  73.034  219.398 1.00 87.72  ? 194 LYS C CB  1 
ATOM   7044  C CG  . LYS C 1 194 ? 36.790  72.298  219.912 1.00 106.40 ? 194 LYS C CG  1 
ATOM   7045  C CD  . LYS C 1 194 ? 36.433  70.916  220.508 1.00 119.19 ? 194 LYS C CD  1 
ATOM   7046  C CE  . LYS C 1 194 ? 37.611  70.259  221.270 1.00 128.09 ? 194 LYS C CE  1 
ATOM   7047  N NZ  . LYS C 1 194 ? 38.171  71.066  222.401 1.00 136.30 ? 194 LYS C NZ  1 
ATOM   7048  N N   . THR C 1 195 ? 37.256  72.661  216.990 1.00 76.75  ? 195 THR C N   1 
ATOM   7049  C CA  . THR C 1 195 ? 38.280  73.105  216.070 1.00 76.53  ? 195 THR C CA  1 
ATOM   7050  C C   . THR C 1 195 ? 37.728  73.269  214.654 1.00 74.23  ? 195 THR C C   1 
ATOM   7051  O O   . THR C 1 195 ? 38.188  74.113  213.883 1.00 73.52  ? 195 THR C O   1 
ATOM   7052  C CB  . THR C 1 195 ? 39.545  72.204  216.171 1.00 76.66  ? 195 THR C CB  1 
ATOM   7053  O OG1 . THR C 1 195 ? 39.154  70.886  216.545 1.00 77.05  ? 195 THR C OG1 1 
ATOM   7054  C CG2 . THR C 1 195 ? 40.484  72.732  217.262 1.00 78.81  ? 195 THR C CG2 1 
ATOM   7055  N N   . ILE C 1 196 ? 36.663  72.556  214.348 1.00 71.93  ? 196 ILE C N   1 
ATOM   7056  C CA  . ILE C 1 196 ? 36.074  72.714  213.045 1.00 76.44  ? 196 ILE C CA  1 
ATOM   7057  C C   . ILE C 1 196 ? 34.906  73.647  213.156 1.00 75.19  ? 196 ILE C C   1 
ATOM   7058  O O   . ILE C 1 196 ? 34.670  74.470  212.288 1.00 73.02  ? 196 ILE C O   1 
ATOM   7059  C CB  . ILE C 1 196 ? 35.614  71.408  212.485 1.00 83.69  ? 196 ILE C CB  1 
ATOM   7060  C CG1 . ILE C 1 196 ? 34.537  71.625  211.423 1.00 90.71  ? 196 ILE C CG1 1 
ATOM   7061  C CG2 . ILE C 1 196 ? 35.118  70.530  213.564 1.00 88.84  ? 196 ILE C CG2 1 
ATOM   7062  C CD1 . ILE C 1 196 ? 35.012  72.409  210.217 1.00 99.05  ? 196 ILE C CD1 1 
ATOM   7063  N N   . THR C 1 197 ? 34.132  73.497  214.204 1.00 80.36  ? 197 THR C N   1 
ATOM   7064  C CA  . THR C 1 197 ? 33.029  74.400  214.353 1.00 89.09  ? 197 THR C CA  1 
ATOM   7065  C C   . THR C 1 197 ? 33.114  75.192  215.601 1.00 91.94  ? 197 THR C C   1 
ATOM   7066  O O   . THR C 1 197 ? 32.514  74.905  216.610 1.00 88.50  ? 197 THR C O   1 
ATOM   7067  C CB  . THR C 1 197 ? 31.706  73.755  214.252 1.00 93.44  ? 197 THR C CB  1 
ATOM   7068  O OG1 . THR C 1 197 ? 30.768  74.808  214.024 1.00 95.51  ? 197 THR C OG1 1 
ATOM   7069  C CG2 . THR C 1 197 ? 31.352  72.916  215.538 1.00 93.67  ? 197 THR C CG2 1 
ATOM   7070  N N   . LYS C 1 198 ? 33.926  76.198  215.474 1.00 98.83  ? 198 LYS C N   1 
ATOM   7071  C CA  . LYS C 1 198 ? 34.223  77.108  216.545 1.00 108.78 ? 198 LYS C CA  1 
ATOM   7072  C C   . LYS C 1 198 ? 33.635  76.773  217.907 1.00 111.62 ? 198 LYS C C   1 
ATOM   7073  O O   . LYS C 1 198 ? 34.356  76.550  218.879 1.00 113.45 ? 198 LYS C O   1 
ATOM   7074  C CB  . LYS C 1 198 ? 33.823  78.477  216.087 1.00 117.65 ? 198 LYS C CB  1 
ATOM   7075  C CG  . LYS C 1 198 ? 34.259  78.636  214.609 1.00 132.27 ? 198 LYS C CG  1 
ATOM   7076  C CD  . LYS C 1 198 ? 35.711  78.067  214.430 1.00 146.03 ? 198 LYS C CD  1 
ATOM   7077  C CE  . LYS C 1 198 ? 36.181  78.076  212.961 1.00 153.37 ? 198 LYS C CE  1 
ATOM   7078  N NZ  . LYS C 1 198 ? 37.629  77.665  212.812 1.00 157.57 ? 198 LYS C NZ  1 
ATOM   7079  N N   . LYS C 1 199 ? 32.307  76.825  217.954 1.00 114.69 ? 199 LYS C N   1 
ATOM   7080  C CA  . LYS C 1 199 ? 31.535  76.560  219.166 1.00 118.66 ? 199 LYS C CA  1 
ATOM   7081  C C   . LYS C 1 199 ? 31.632  75.132  219.666 1.00 113.33 ? 199 LYS C C   1 
ATOM   7082  O O   . LYS C 1 199 ? 31.555  74.192  218.893 1.00 114.55 ? 199 LYS C O   1 
ATOM   7083  C CB  . LYS C 1 199 ? 30.075  76.902  218.921 1.00 131.44 ? 199 LYS C CB  1 
ATOM   7084  C CG  . LYS C 1 199 ? 29.830  78.392  218.495 1.00 146.22 ? 199 LYS C CG  1 
ATOM   7085  C CD  . LYS C 1 199 ? 29.129  78.513  217.104 1.00 157.09 ? 199 LYS C CD  1 
ATOM   7086  C CE  . LYS C 1 199 ? 30.071  78.273  215.884 1.00 163.51 ? 199 LYS C CE  1 
ATOM   7087  N NZ  . LYS C 1 199 ? 29.330  78.396  214.571 1.00 167.63 ? 199 LYS C NZ  1 
ATOM   7088  N N   . ASP C 1 200 ? 31.663  74.991  220.980 1.00 109.07 ? 200 ASP C N   1 
ATOM   7089  C CA  . ASP C 1 200 ? 31.786  73.689  221.594 1.00 105.03 ? 200 ASP C CA  1 
ATOM   7090  C C   . ASP C 1 200 ? 30.762  72.676  221.171 1.00 96.17  ? 200 ASP C C   1 
ATOM   7091  O O   . ASP C 1 200 ? 29.864  72.947  220.381 1.00 95.47  ? 200 ASP C O   1 
ATOM   7092  C CB  . ASP C 1 200 ? 31.820  73.804  223.118 1.00 117.84 ? 200 ASP C CB  1 
ATOM   7093  C CG  . ASP C 1 200 ? 33.029  74.583  223.613 1.00 127.68 ? 200 ASP C CG  1 
ATOM   7094  O OD1 . ASP C 1 200 ? 34.178  74.160  223.324 1.00 134.45 ? 200 ASP C OD1 1 
ATOM   7095  O OD2 . ASP C 1 200 ? 32.825  75.625  224.280 1.00 132.77 ? 200 ASP C OD2 1 
ATOM   7096  N N   . MET C 1 201 ? 30.930  71.488  221.720 1.00 87.22  ? 201 MET C N   1 
ATOM   7097  C CA  . MET C 1 201 ? 30.069  70.369  221.433 1.00 79.50  ? 201 MET C CA  1 
ATOM   7098  C C   . MET C 1 201 ? 28.684  70.723  221.885 1.00 73.72  ? 201 MET C C   1 
ATOM   7099  O O   . MET C 1 201 ? 28.485  71.712  222.575 1.00 71.92  ? 201 MET C O   1 
ATOM   7100  C CB  . MET C 1 201 ? 30.520  69.154  222.220 1.00 84.32  ? 201 MET C CB  1 
ATOM   7101  C CG  . MET C 1 201 ? 32.027  69.075  222.461 1.00 91.49  ? 201 MET C CG  1 
ATOM   7102  S SD  . MET C 1 201 ? 32.790  67.653  221.663 1.00 93.78  ? 201 MET C SD  1 
ATOM   7103  C CE  . MET C 1 201 ? 31.392  67.018  220.790 1.00 92.99  ? 201 MET C CE  1 
ATOM   7104  N N   . VAL C 1 202 ? 27.729  69.903  221.483 1.00 70.65  ? 202 VAL C N   1 
ATOM   7105  C CA  . VAL C 1 202 ? 26.331  70.068  221.848 1.00 69.43  ? 202 VAL C CA  1 
ATOM   7106  C C   . VAL C 1 202 ? 25.929  68.645  222.042 1.00 68.58  ? 202 VAL C C   1 
ATOM   7107  O O   . VAL C 1 202 ? 26.561  67.745  221.498 1.00 66.97  ? 202 VAL C O   1 
ATOM   7108  C CB  . VAL C 1 202 ? 25.452  70.527  220.671 1.00 68.34  ? 202 VAL C CB  1 
ATOM   7109  C CG1 . VAL C 1 202 ? 24.100  70.947  221.171 1.00 65.92  ? 202 VAL C CG1 1 
ATOM   7110  C CG2 . VAL C 1 202 ? 26.118  71.622  219.863 1.00 73.34  ? 202 VAL C CG2 1 
ATOM   7111  N N   . ASN C 1 203 ? 24.856  68.419  222.766 1.00 68.79  ? 203 ASN C N   1 
ATOM   7112  C CA  . ASN C 1 203 ? 24.414  67.052  222.927 1.00 72.24  ? 203 ASN C CA  1 
ATOM   7113  C C   . ASN C 1 203 ? 24.201  66.431  221.538 1.00 72.69  ? 203 ASN C C   1 
ATOM   7114  O O   . ASN C 1 203 ? 24.631  65.320  221.258 1.00 70.78  ? 203 ASN C O   1 
ATOM   7115  C CB  . ASN C 1 203 ? 23.124  66.991  223.747 1.00 72.93  ? 203 ASN C CB  1 
ATOM   7116  C CG  . ASN C 1 203 ? 22.118  68.026  223.326 1.00 76.19  ? 203 ASN C CG  1 
ATOM   7117  O OD1 . ASN C 1 203 ? 22.395  68.835  222.444 1.00 81.65  ? 203 ASN C OD1 1 
ATOM   7118  N ND2 . ASN C 1 203 ? 20.947  68.020  223.957 1.00 76.05  ? 203 ASN C ND2 1 
ATOM   7119  N N   . LYS C 1 204 ? 23.623  67.191  220.627 1.00 74.50  ? 204 LYS C N   1 
ATOM   7120  C CA  . LYS C 1 204 ? 23.367  66.657  219.300 1.00 76.23  ? 204 LYS C CA  1 
ATOM   7121  C C   . LYS C 1 204 ? 24.588  66.005  218.647 1.00 71.21  ? 204 LYS C C   1 
ATOM   7122  O O   . LYS C 1 204 ? 24.470  64.933  218.036 1.00 69.17  ? 204 LYS C O   1 
ATOM   7123  C CB  . LYS C 1 204 ? 22.733  67.741  218.431 1.00 87.70  ? 204 LYS C CB  1 
ATOM   7124  C CG  . LYS C 1 204 ? 21.337  68.141  218.951 1.00 103.08 ? 204 LYS C CG  1 
ATOM   7125  C CD  . LYS C 1 204 ? 20.910  69.555  218.541 1.00 116.63 ? 204 LYS C CD  1 
ATOM   7126  C CE  . LYS C 1 204 ? 19.666  69.572  217.623 1.00 126.58 ? 204 LYS C CE  1 
ATOM   7127  N NZ  . LYS C 1 204 ? 19.971  69.186  216.194 1.00 135.85 ? 204 LYS C NZ  1 
ATOM   7128  N N   . ASP C 1 205 ? 25.759  66.614  218.835 1.00 66.99  ? 205 ASP C N   1 
ATOM   7129  C CA  . ASP C 1 205 ? 26.998  66.081  218.285 1.00 62.87  ? 205 ASP C CA  1 
ATOM   7130  C C   . ASP C 1 205 ? 27.049  64.651  218.783 1.00 61.58  ? 205 ASP C C   1 
ATOM   7131  O O   . ASP C 1 205 ? 27.077  63.689  218.007 1.00 65.14  ? 205 ASP C O   1 
ATOM   7132  C CB  . ASP C 1 205 ? 28.207  66.842  218.834 1.00 61.20  ? 205 ASP C CB  1 
ATOM   7133  C CG  . ASP C 1 205 ? 28.300  68.268  218.331 1.00 62.06  ? 205 ASP C CG  1 
ATOM   7134  O OD1 . ASP C 1 205 ? 27.491  68.662  217.496 1.00 63.67  ? 205 ASP C OD1 1 
ATOM   7135  O OD2 . ASP C 1 205 ? 29.193  69.016  218.779 1.00 64.56  ? 205 ASP C OD2 1 
ATOM   7136  N N   . GLN C 1 206 ? 26.875  64.549  220.093 1.00 58.60  ? 206 GLN C N   1 
ATOM   7137  C CA  . GLN C 1 206 ? 26.874  63.311  220.851 1.00 57.95  ? 206 GLN C CA  1 
ATOM   7138  C C   . GLN C 1 206 ? 26.034  62.230  220.199 1.00 54.49  ? 206 GLN C C   1 
ATOM   7139  O O   . GLN C 1 206 ? 26.121  61.058  220.574 1.00 52.55  ? 206 GLN C O   1 
ATOM   7140  C CB  . GLN C 1 206 ? 26.399  63.629  222.269 1.00 64.09  ? 206 GLN C CB  1 
ATOM   7141  C CG  . GLN C 1 206 ? 26.427  62.540  223.290 1.00 72.62  ? 206 GLN C CG  1 
ATOM   7142  C CD  . GLN C 1 206 ? 26.253  63.089  224.702 1.00 77.00  ? 206 GLN C CD  1 
ATOM   7143  O OE1 . GLN C 1 206 ? 25.135  63.092  225.242 1.00 84.28  ? 206 GLN C OE1 1 
ATOM   7144  N NE2 . GLN C 1 206 ? 27.354  63.567  225.306 1.00 67.95  ? 206 GLN C NE2 1 
ATOM   7145  N N   . VAL C 1 207 ? 25.181  62.616  219.256 1.00 51.24  ? 207 VAL C N   1 
ATOM   7146  C CA  . VAL C 1 207 ? 24.401  61.625  218.533 1.00 50.00  ? 207 VAL C CA  1 
ATOM   7147  C C   . VAL C 1 207 ? 24.511  61.748  217.042 1.00 47.06  ? 207 VAL C C   1 
ATOM   7148  O O   . VAL C 1 207 ? 24.857  60.791  216.396 1.00 55.65  ? 207 VAL C O   1 
ATOM   7149  C CB  . VAL C 1 207 ? 22.964  61.579  218.902 1.00 51.90  ? 207 VAL C CB  1 
ATOM   7150  C CG1 . VAL C 1 207 ? 22.839  61.181  220.345 1.00 56.99  ? 207 VAL C CG1 1 
ATOM   7151  C CG2 . VAL C 1 207 ? 22.311  62.918  218.618 1.00 54.32  ? 207 VAL C CG2 1 
ATOM   7152  N N   . LEU C 1 208 ? 24.135  62.852  216.443 1.00 39.62  ? 208 LEU C N   1 
ATOM   7153  C CA  . LEU C 1 208 ? 24.323  62.920  215.015 1.00 36.71  ? 208 LEU C CA  1 
ATOM   7154  C C   . LEU C 1 208 ? 24.345  64.330  214.638 1.00 40.60  ? 208 LEU C C   1 
ATOM   7155  O O   . LEU C 1 208 ? 23.311  64.897  214.262 1.00 38.59  ? 208 LEU C O   1 
ATOM   7156  C CB  . LEU C 1 208 ? 23.218  62.235  214.190 1.00 34.27  ? 208 LEU C CB  1 
ATOM   7157  C CG  . LEU C 1 208 ? 23.571  62.470  212.703 1.00 27.90  ? 208 LEU C CG  1 
ATOM   7158  C CD1 . LEU C 1 208 ? 24.863  61.830  212.425 1.00 27.49  ? 208 LEU C CD1 1 
ATOM   7159  C CD2 . LEU C 1 208 ? 22.695  61.877  211.725 1.00 24.71  ? 208 LEU C CD2 1 
ATOM   7160  N N   . ASN C 1 209 ? 25.518  64.917  214.691 1.00 44.12  ? 209 ASN C N   1 
ATOM   7161  C CA  . ASN C 1 209 ? 25.503  66.293  214.305 1.00 46.52  ? 209 ASN C CA  1 
ATOM   7162  C C   . ASN C 1 209 ? 25.881  66.624  212.879 1.00 45.93  ? 209 ASN C C   1 
ATOM   7163  O O   . ASN C 1 209 ? 27.042  66.886  212.565 1.00 47.62  ? 209 ASN C O   1 
ATOM   7164  C CB  . ASN C 1 209 ? 26.225  67.189  215.263 1.00 51.98  ? 209 ASN C CB  1 
ATOM   7165  C CG  . ASN C 1 209 ? 25.705  68.555  215.177 1.00 59.40  ? 209 ASN C CG  1 
ATOM   7166  O OD1 . ASN C 1 209 ? 24.530  68.709  214.834 1.00 59.74  ? 209 ASN C OD1 1 
ATOM   7167  N ND2 . ASN C 1 209 ? 26.549  69.570  215.390 1.00 65.48  ? 209 ASN C ND2 1 
ATOM   7168  N N   . PRO C 1 210 ? 24.869  66.789  212.033 1.00 43.43  ? 210 PRO C N   1 
ATOM   7169  C CA  . PRO C 1 210 ? 24.929  67.102  210.611 1.00 46.87  ? 210 PRO C CA  1 
ATOM   7170  C C   . PRO C 1 210 ? 25.743  68.319  210.376 1.00 50.83  ? 210 PRO C C   1 
ATOM   7171  O O   . PRO C 1 210 ? 25.988  68.715  209.237 1.00 57.84  ? 210 PRO C O   1 
ATOM   7172  C CB  . PRO C 1 210 ? 23.479  67.351  210.265 1.00 46.23  ? 210 PRO C CB  1 
ATOM   7173  C CG  . PRO C 1 210 ? 22.798  66.426  211.225 1.00 51.43  ? 210 PRO C CG  1 
ATOM   7174  C CD  . PRO C 1 210 ? 23.483  66.819  212.479 1.00 44.77  ? 210 PRO C CD  1 
ATOM   7175  N N   . ILE C 1 211 ? 26.109  68.964  211.462 1.00 49.98  ? 211 ILE C N   1 
ATOM   7176  C CA  . ILE C 1 211 ? 26.924  70.134  211.360 1.00 51.49  ? 211 ILE C CA  1 
ATOM   7177  C C   . ILE C 1 211 ? 28.312  69.606  211.484 1.00 48.00  ? 211 ILE C C   1 
ATOM   7178  O O   . ILE C 1 211 ? 29.157  69.826  210.629 1.00 50.65  ? 211 ILE C O   1 
ATOM   7179  C CB  . ILE C 1 211 ? 26.697  71.045  212.527 1.00 56.01  ? 211 ILE C CB  1 
ATOM   7180  C CG1 . ILE C 1 211 ? 25.268  71.572  212.514 1.00 65.51  ? 211 ILE C CG1 1 
ATOM   7181  C CG2 . ILE C 1 211 ? 27.626  72.206  212.425 1.00 64.34  ? 211 ILE C CG2 1 
ATOM   7182  C CD1 . ILE C 1 211 ? 24.180  70.513  212.640 1.00 73.20  ? 211 ILE C CD1 1 
ATOM   7183  N N   . SER C 1 212 ? 28.507  68.883  212.571 1.00 46.10  ? 212 SER C N   1 
ATOM   7184  C CA  . SER C 1 212 ? 29.770  68.290  212.918 1.00 46.88  ? 212 SER C CA  1 
ATOM   7185  C C   . SER C 1 212 ? 30.281  67.310  211.873 1.00 47.24  ? 212 SER C C   1 
ATOM   7186  O O   . SER C 1 212 ? 30.480  66.124  212.132 1.00 46.31  ? 212 SER C O   1 
ATOM   7187  C CB  . SER C 1 212 ? 29.623  67.631  214.278 1.00 50.30  ? 212 SER C CB  1 
ATOM   7188  O OG  . SER C 1 212 ? 29.056  68.567  215.179 1.00 53.48  ? 212 SER C OG  1 
ATOM   7189  N N   . LYS C 1 213 ? 30.556  67.834  210.695 1.00 48.76  ? 213 LYS C N   1 
ATOM   7190  C CA  . LYS C 1 213 ? 31.054  67.032  209.613 1.00 53.78  ? 213 LYS C CA  1 
ATOM   7191  C C   . LYS C 1 213 ? 32.318  67.735  209.192 1.00 54.40  ? 213 LYS C C   1 
ATOM   7192  O O   . LYS C 1 213 ? 32.337  68.956  209.050 1.00 52.58  ? 213 LYS C O   1 
ATOM   7193  C CB  . LYS C 1 213 ? 30.055  67.015  208.451 1.00 57.61  ? 213 LYS C CB  1 
ATOM   7194  C CG  . LYS C 1 213 ? 28.755  66.275  208.724 1.00 58.20  ? 213 LYS C CG  1 
ATOM   7195  C CD  . LYS C 1 213 ? 27.890  66.253  207.470 1.00 55.86  ? 213 LYS C CD  1 
ATOM   7196  C CE  . LYS C 1 213 ? 26.577  65.511  207.682 1.00 56.50  ? 213 LYS C CE  1 
ATOM   7197  N NZ  . LYS C 1 213 ? 26.718  64.023  207.781 1.00 61.11  ? 213 LYS C NZ  1 
ATOM   7198  N N   . ALA C 1 214 ? 33.382  66.974  209.019 1.00 57.11  ? 214 ALA C N   1 
ATOM   7199  C CA  . ALA C 1 214 ? 34.631  67.570  208.597 1.00 61.57  ? 214 ALA C CA  1 
ATOM   7200  C C   . ALA C 1 214 ? 35.293  66.754  207.478 1.00 62.45  ? 214 ALA C C   1 
ATOM   7201  O O   . ALA C 1 214 ? 34.661  65.852  206.897 1.00 65.02  ? 214 ALA C O   1 
ATOM   7202  C CB  . ALA C 1 214 ? 35.540  67.710  209.778 1.00 61.47  ? 214 ALA C CB  1 
ATOM   7203  N N   . LYS C 1 215 ? 36.537  67.100  207.144 1.00 59.88  ? 215 LYS C N   1 
ATOM   7204  C CA  . LYS C 1 215 ? 37.262  66.389  206.112 1.00 57.05  ? 215 LYS C CA  1 
ATOM   7205  C C   . LYS C 1 215 ? 38.563  65.822  206.605 1.00 53.75  ? 215 LYS C C   1 
ATOM   7206  O O   . LYS C 1 215 ? 38.978  66.094  207.718 1.00 52.51  ? 215 LYS C O   1 
ATOM   7207  C CB  . LYS C 1 215 ? 37.520  67.296  204.935 1.00 62.22  ? 215 LYS C CB  1 
ATOM   7208  C CG  . LYS C 1 215 ? 36.359  67.310  203.993 1.00 79.08  ? 215 LYS C CG  1 
ATOM   7209  C CD  . LYS C 1 215 ? 36.775  67.827  202.626 1.00 93.67  ? 215 LYS C CD  1 
ATOM   7210  C CE  . LYS C 1 215 ? 35.775  67.434  201.507 1.00 103.95 ? 215 LYS C CE  1 
ATOM   7211  N NZ  . LYS C 1 215 ? 35.718  65.961  201.129 1.00 110.94 ? 215 LYS C NZ  1 
ATOM   7212  N N   . LEU C 1 216 ? 39.158  64.950  205.809 1.00 48.77  ? 216 LEU C N   1 
ATOM   7213  C CA  . LEU C 1 216 ? 40.434  64.383  206.177 1.00 44.10  ? 216 LEU C CA  1 
ATOM   7214  C C   . LEU C 1 216 ? 41.572  65.308  205.767 1.00 46.01  ? 216 LEU C C   1 
ATOM   7215  O O   . LEU C 1 216 ? 42.667  64.853  205.467 1.00 41.30  ? 216 LEU C O   1 
ATOM   7216  C CB  . LEU C 1 216 ? 40.612  63.049  205.501 1.00 36.49  ? 216 LEU C CB  1 
ATOM   7217  C CG  . LEU C 1 216 ? 40.620  61.993  206.586 1.00 35.95  ? 216 LEU C CG  1 
ATOM   7218  C CD1 . LEU C 1 216 ? 41.430  60.852  206.065 1.00 40.97  ? 216 LEU C CD1 1 
ATOM   7219  C CD2 . LEU C 1 216 ? 41.244  62.485  207.875 1.00 28.78  ? 216 LEU C CD2 1 
ATOM   7220  N N   . ASP C 1 217 ? 41.318  66.612  205.784 1.00 51.78  ? 217 ASP C N   1 
ATOM   7221  C CA  . ASP C 1 217 ? 42.317  67.565  205.358 1.00 55.81  ? 217 ASP C CA  1 
ATOM   7222  C C   . ASP C 1 217 ? 43.639  67.356  206.022 1.00 53.21  ? 217 ASP C C   1 
ATOM   7223  O O   . ASP C 1 217 ? 44.645  67.404  205.366 1.00 52.92  ? 217 ASP C O   1 
ATOM   7224  C CB  . ASP C 1 217 ? 41.829  69.039  205.401 1.00 69.87  ? 217 ASP C CB  1 
ATOM   7225  C CG  . ASP C 1 217 ? 40.952  69.381  206.637 1.00 85.55  ? 217 ASP C CG  1 
ATOM   7226  O OD1 . ASP C 1 217 ? 41.528  69.798  207.671 1.00 91.64  ? 217 ASP C OD1 1 
ATOM   7227  O OD2 . ASP C 1 217 ? 39.689  69.318  206.567 1.00 94.73  ? 217 ASP C OD2 1 
ATOM   7228  N N   . LYS C 1 218 ? 43.650  67.055  207.304 1.00 53.73  ? 218 LYS C N   1 
ATOM   7229  C CA  . LYS C 1 218 ? 44.921  66.820  207.979 1.00 57.88  ? 218 LYS C CA  1 
ATOM   7230  C C   . LYS C 1 218 ? 45.160  65.323  208.115 1.00 55.97  ? 218 LYS C C   1 
ATOM   7231  O O   . LYS C 1 218 ? 44.563  64.552  207.386 1.00 53.82  ? 218 LYS C O   1 
ATOM   7232  C CB  . LYS C 1 218 ? 44.956  67.511  209.351 1.00 66.26  ? 218 LYS C CB  1 
ATOM   7233  C CG  . LYS C 1 218 ? 45.974  68.660  209.468 1.00 75.53  ? 218 LYS C CG  1 
ATOM   7234  C CD  . LYS C 1 218 ? 45.636  69.842  208.554 1.00 89.63  ? 218 LYS C CD  1 
ATOM   7235  C CE  . LYS C 1 218 ? 44.610  70.765  209.197 1.00 99.58  ? 218 LYS C CE  1 
ATOM   7236  N NZ  . LYS C 1 218 ? 43.710  71.405  208.191 1.00 111.89 ? 218 LYS C NZ  1 
ATOM   7237  N N   . ASP C 1 219 ? 46.032  64.921  209.035 1.00 57.29  ? 219 ASP C N   1 
ATOM   7238  C CA  . ASP C 1 219 ? 46.327  63.513  209.257 1.00 63.12  ? 219 ASP C CA  1 
ATOM   7239  C C   . ASP C 1 219 ? 46.892  63.210  210.636 1.00 66.93  ? 219 ASP C C   1 
ATOM   7240  O O   . ASP C 1 219 ? 47.759  63.945  211.128 1.00 68.84  ? 219 ASP C O   1 
ATOM   7241  C CB  . ASP C 1 219 ? 47.341  62.998  208.247 1.00 63.19  ? 219 ASP C CB  1 
ATOM   7242  C CG  . ASP C 1 219 ? 48.167  61.836  208.804 1.00 65.66  ? 219 ASP C CG  1 
ATOM   7243  O OD1 . ASP C 1 219 ? 49.202  62.107  209.446 1.00 66.40  ? 219 ASP C OD1 1 
ATOM   7244  O OD2 . ASP C 1 219 ? 47.768  60.656  208.671 1.00 63.49  ? 219 ASP C OD2 1 
ATOM   7245  N N   . GLY C 1 220 ? 46.539  62.027  211.156 1.00 68.13  ? 220 GLY C N   1 
ATOM   7246  C CA  . GLY C 1 220 ? 47.001  61.593  212.469 1.00 65.93  ? 220 GLY C CA  1 
ATOM   7247  C C   . GLY C 1 220 ? 46.551  62.696  213.389 1.00 65.57  ? 220 GLY C C   1 
ATOM   7248  O O   . GLY C 1 220 ? 47.197  63.052  214.390 1.00 63.50  ? 220 GLY C O   1 
ATOM   7249  N N   . MET C 1 221 ? 45.391  63.227  213.035 1.00 65.27  ? 221 MET C N   1 
ATOM   7250  C CA  . MET C 1 221 ? 44.871  64.342  213.761 1.00 65.26  ? 221 MET C CA  1 
ATOM   7251  C C   . MET C 1 221 ? 43.464  64.123  214.158 1.00 60.89  ? 221 MET C C   1 
ATOM   7252  O O   . MET C 1 221 ? 43.039  64.484  215.244 1.00 62.36  ? 221 MET C O   1 
ATOM   7253  C CB  . MET C 1 221 ? 44.946  65.584  212.896 1.00 69.64  ? 221 MET C CB  1 
ATOM   7254  C CG  . MET C 1 221 ? 45.219  66.790  213.727 1.00 75.94  ? 221 MET C CG  1 
ATOM   7255  S SD  . MET C 1 221 ? 46.711  66.492  214.684 1.00 79.90  ? 221 MET C SD  1 
ATOM   7256  C CE  . MET C 1 221 ? 47.849  67.442  213.645 1.00 79.46  ? 221 MET C CE  1 
ATOM   7257  N N   . TYR C 1 222 ? 42.696  63.585  213.253 1.00 53.97  ? 222 TYR C N   1 
ATOM   7258  C CA  . TYR C 1 222 ? 41.345  63.385  213.633 1.00 48.89  ? 222 TYR C CA  1 
ATOM   7259  C C   . TYR C 1 222 ? 41.356  62.142  214.458 1.00 45.94  ? 222 TYR C C   1 
ATOM   7260  O O   . TYR C 1 222 ? 41.773  61.095  214.014 1.00 45.83  ? 222 TYR C O   1 
ATOM   7261  C CB  . TYR C 1 222 ? 40.517  63.249  212.403 1.00 52.09  ? 222 TYR C CB  1 
ATOM   7262  C CG  . TYR C 1 222 ? 40.708  64.408  211.457 1.00 55.15  ? 222 TYR C CG  1 
ATOM   7263  C CD1 . TYR C 1 222 ? 41.852  64.507  210.651 1.00 54.44  ? 222 TYR C CD1 1 
ATOM   7264  C CD2 . TYR C 1 222 ? 39.714  65.386  211.326 1.00 55.25  ? 222 TYR C CD2 1 
ATOM   7265  C CE1 . TYR C 1 222 ? 41.978  65.557  209.730 1.00 53.64  ? 222 TYR C CE1 1 
ATOM   7266  C CE2 . TYR C 1 222 ? 39.842  66.436  210.414 1.00 50.04  ? 222 TYR C CE2 1 
ATOM   7267  C CZ  . TYR C 1 222 ? 40.961  66.515  209.625 1.00 48.06  ? 222 TYR C CZ  1 
ATOM   7268  O OH  . TYR C 1 222 ? 41.053  67.544  208.738 1.00 40.13  ? 222 TYR C OH  1 
ATOM   7269  N N   . PRO C 1 223 ? 41.078  62.286  215.736 1.00 45.00  ? 223 PRO C N   1 
ATOM   7270  C CA  . PRO C 1 223 ? 41.069  61.116  216.589 1.00 45.04  ? 223 PRO C CA  1 
ATOM   7271  C C   . PRO C 1 223 ? 39.930  60.297  216.116 1.00 47.35  ? 223 PRO C C   1 
ATOM   7272  O O   . PRO C 1 223 ? 38.857  60.812  215.765 1.00 41.67  ? 223 PRO C O   1 
ATOM   7273  C CB  . PRO C 1 223 ? 40.760  61.700  217.934 1.00 45.86  ? 223 PRO C CB  1 
ATOM   7274  C CG  . PRO C 1 223 ? 39.814  62.786  217.571 1.00 44.85  ? 223 PRO C CG  1 
ATOM   7275  C CD  . PRO C 1 223 ? 40.527  63.446  216.437 1.00 45.11  ? 223 PRO C CD  1 
ATOM   7276  N N   . VAL C 1 224 ? 40.160  59.008  216.116 1.00 51.41  ? 224 VAL C N   1 
ATOM   7277  C CA  . VAL C 1 224 ? 39.136  58.119  215.667 1.00 56.86  ? 224 VAL C CA  1 
ATOM   7278  C C   . VAL C 1 224 ? 38.021  58.190  216.636 1.00 57.20  ? 224 VAL C C   1 
ATOM   7279  O O   . VAL C 1 224 ? 36.863  57.984  216.283 1.00 57.27  ? 224 VAL C O   1 
ATOM   7280  C CB  . VAL C 1 224 ? 39.578  56.727  215.725 1.00 59.88  ? 224 VAL C CB  1 
ATOM   7281  C CG1 . VAL C 1 224 ? 38.559  55.871  215.003 1.00 63.54  ? 224 VAL C CG1 1 
ATOM   7282  C CG2 . VAL C 1 224 ? 40.949  56.615  215.146 1.00 62.49  ? 224 VAL C CG2 1 
ATOM   7283  N N   . GLU C 1 225 ? 38.401  58.392  217.886 1.00 56.01  ? 225 GLU C N   1 
ATOM   7284  C CA  . GLU C 1 225 ? 37.443  58.483  218.958 1.00 58.57  ? 225 GLU C CA  1 
ATOM   7285  C C   . GLU C 1 225 ? 36.215  59.369  218.633 1.00 57.33  ? 225 GLU C C   1 
ATOM   7286  O O   . GLU C 1 225 ? 35.083  59.077  219.068 1.00 51.42  ? 225 GLU C O   1 
ATOM   7287  C CB  . GLU C 1 225 ? 38.185  58.970  220.203 1.00 62.30  ? 225 GLU C CB  1 
ATOM   7288  C CG  . GLU C 1 225 ? 37.290  59.341  221.387 1.00 67.21  ? 225 GLU C CG  1 
ATOM   7289  C CD  . GLU C 1 225 ? 38.041  59.344  222.708 1.00 68.93  ? 225 GLU C CD  1 
ATOM   7290  O OE1 . GLU C 1 225 ? 38.883  58.422  222.917 1.00 70.11  ? 225 GLU C OE1 1 
ATOM   7291  O OE2 . GLU C 1 225 ? 37.781  60.262  223.530 1.00 64.55  ? 225 GLU C OE2 1 
ATOM   7292  N N   . ILE C 1 226 ? 36.433  60.338  217.739 1.00 57.93  ? 226 ILE C N   1 
ATOM   7293  C CA  . ILE C 1 226 ? 35.424  61.327  217.335 1.00 58.68  ? 226 ILE C CA  1 
ATOM   7294  C C   . ILE C 1 226 ? 34.830  61.261  215.929 1.00 56.73  ? 226 ILE C C   1 
ATOM   7295  O O   . ILE C 1 226 ? 33.623  61.466  215.676 1.00 50.16  ? 226 ILE C O   1 
ATOM   7296  C CB  . ILE C 1 226 ? 36.073  62.671  217.374 1.00 60.86  ? 226 ILE C CB  1 
ATOM   7297  C CG1 . ILE C 1 226 ? 36.606  62.922  218.773 1.00 61.55  ? 226 ILE C CG1 1 
ATOM   7298  C CG2 . ILE C 1 226 ? 35.110  63.735  216.864 1.00 66.11  ? 226 ILE C CG2 1 
ATOM   7299  C CD1 . ILE C 1 226 ? 37.206  64.275  218.940 1.00 64.77  ? 226 ILE C CD1 1 
ATOM   7300  N N   . TRP C 1 227 ? 35.761  61.141  215.013 1.00 55.54  ? 227 TRP C N   1 
ATOM   7301  C CA  . TRP C 1 227 ? 35.486  61.124  213.615 1.00 55.79  ? 227 TRP C CA  1 
ATOM   7302  C C   . TRP C 1 227 ? 35.138  59.811  212.974 1.00 53.25  ? 227 TRP C C   1 
ATOM   7303  O O   . TRP C 1 227 ? 35.730  58.768  213.279 1.00 53.32  ? 227 TRP C O   1 
ATOM   7304  C CB  . TRP C 1 227 ? 36.683  61.723  212.967 1.00 62.78  ? 227 TRP C CB  1 
ATOM   7305  C CG  . TRP C 1 227 ? 36.835  63.075  213.460 1.00 66.08  ? 227 TRP C CG  1 
ATOM   7306  C CD1 . TRP C 1 227 ? 37.833  63.567  214.244 1.00 66.31  ? 227 TRP C CD1 1 
ATOM   7307  C CD2 . TRP C 1 227 ? 35.953  64.153  213.189 1.00 68.68  ? 227 TRP C CD2 1 
ATOM   7308  N NE1 . TRP C 1 227 ? 37.632  64.907  214.468 1.00 68.47  ? 227 TRP C NE1 1 
ATOM   7309  C CE2 . TRP C 1 227 ? 36.479  65.293  213.831 1.00 68.86  ? 227 TRP C CE2 1 
ATOM   7310  C CE3 . TRP C 1 227 ? 34.761  64.270  212.451 1.00 71.41  ? 227 TRP C CE3 1 
ATOM   7311  C CZ2 . TRP C 1 227 ? 35.863  66.534  213.764 1.00 72.67  ? 227 TRP C CZ2 1 
ATOM   7312  C CZ3 . TRP C 1 227 ? 34.145  65.494  212.375 1.00 72.84  ? 227 TRP C CZ3 1 
ATOM   7313  C CH2 . TRP C 1 227 ? 34.696  66.617  213.030 1.00 76.88  ? 227 TRP C CH2 1 
ATOM   7314  N N   . HIS C 1 228 ? 34.171  59.876  212.063 1.00 49.28  ? 228 HIS C N   1 
ATOM   7315  C CA  . HIS C 1 228 ? 33.710  58.695  211.355 1.00 46.39  ? 228 HIS C CA  1 
ATOM   7316  C C   . HIS C 1 228 ? 33.444  58.935  209.916 1.00 40.90  ? 228 HIS C C   1 
ATOM   7317  O O   . HIS C 1 228 ? 33.165  60.044  209.483 1.00 34.54  ? 228 HIS C O   1 
ATOM   7318  C CB  . HIS C 1 228 ? 32.431  58.136  211.963 1.00 51.29  ? 228 HIS C CB  1 
ATOM   7319  C CG  . HIS C 1 228 ? 32.450  58.136  213.445 1.00 60.89  ? 228 HIS C CG  1 
ATOM   7320  N ND1 . HIS C 1 228 ? 32.655  56.993  214.184 1.00 64.73  ? 228 HIS C ND1 1 
ATOM   7321  C CD2 . HIS C 1 228 ? 32.397  59.165  214.327 1.00 61.51  ? 228 HIS C CD2 1 
ATOM   7322  C CE1 . HIS C 1 228 ? 32.737  57.323  215.464 1.00 72.47  ? 228 HIS C CE1 1 
ATOM   7323  N NE2 . HIS C 1 228 ? 32.583  58.631  215.575 1.00 68.93  ? 228 HIS C NE2 1 
ATOM   7324  N N   . PRO C 1 229 ? 33.541  57.867  209.146 1.00 39.38  ? 229 PRO C N   1 
ATOM   7325  C CA  . PRO C 1 229 ? 33.304  57.916  207.722 1.00 41.29  ? 229 PRO C CA  1 
ATOM   7326  C C   . PRO C 1 229 ? 31.836  58.205  207.664 1.00 41.64  ? 229 PRO C C   1 
ATOM   7327  O O   . PRO C 1 229 ? 31.009  57.427  208.163 1.00 40.31  ? 229 PRO C O   1 
ATOM   7328  C CB  . PRO C 1 229 ? 33.630  56.494  207.285 1.00 43.02  ? 229 PRO C CB  1 
ATOM   7329  C CG  . PRO C 1 229 ? 33.243  55.690  208.471 1.00 44.46  ? 229 PRO C CG  1 
ATOM   7330  C CD  . PRO C 1 229 ? 33.840  56.496  209.574 1.00 40.19  ? 229 PRO C CD  1 
ATOM   7331  N N   . ASP C 1 230 ? 31.552  59.416  207.226 1.00 41.00  ? 230 ASP C N   1 
ATOM   7332  C CA  . ASP C 1 230 ? 30.189  59.882  207.113 1.00 44.13  ? 230 ASP C CA  1 
ATOM   7333  C C   . ASP C 1 230 ? 29.640  59.420  205.809 1.00 41.68  ? 230 ASP C C   1 
ATOM   7334  O O   . ASP C 1 230 ? 30.365  59.505  204.818 1.00 43.38  ? 230 ASP C O   1 
ATOM   7335  C CB  . ASP C 1 230 ? 30.178  61.416  207.119 1.00 50.81  ? 230 ASP C CB  1 
ATOM   7336  C CG  . ASP C 1 230 ? 28.932  62.032  206.449 1.00 55.06  ? 230 ASP C CG  1 
ATOM   7337  O OD1 . ASP C 1 230 ? 27.806  61.456  206.500 1.00 53.71  ? 230 ASP C OD1 1 
ATOM   7338  O OD2 . ASP C 1 230 ? 29.094  63.154  205.907 1.00 58.77  ? 230 ASP C OD2 1 
ATOM   7339  N N   . PRO C 1 231 ? 28.462  58.746  205.812 1.00 38.53  ? 231 PRO C N   1 
ATOM   7340  C CA  . PRO C 1 231 ? 27.948  58.344  204.498 1.00 39.77  ? 231 PRO C CA  1 
ATOM   7341  C C   . PRO C 1 231 ? 27.247  59.572  203.938 1.00 43.23  ? 231 PRO C C   1 
ATOM   7342  O O   . PRO C 1 231 ? 26.050  59.780  204.136 1.00 38.51  ? 231 PRO C O   1 
ATOM   7343  C CB  . PRO C 1 231 ? 26.993  57.190  204.801 1.00 32.92  ? 231 PRO C CB  1 
ATOM   7344  C CG  . PRO C 1 231 ? 26.639  57.421  206.215 1.00 33.54  ? 231 PRO C CG  1 
ATOM   7345  C CD  . PRO C 1 231 ? 27.887  57.898  206.866 1.00 32.34  ? 231 PRO C CD  1 
ATOM   7346  N N   . ALA C 1 232 ? 28.055  60.475  203.378 1.00 48.26  ? 232 ALA C N   1 
ATOM   7347  C CA  . ALA C 1 232 ? 27.520  61.664  202.761 1.00 47.91  ? 232 ALA C CA  1 
ATOM   7348  C C   . ALA C 1 232 ? 26.606  61.056  201.678 1.00 52.05  ? 232 ALA C C   1 
ATOM   7349  O O   . ALA C 1 232 ? 26.672  59.859  201.330 1.00 54.74  ? 232 ALA C O   1 
ATOM   7350  C CB  . ALA C 1 232 ? 28.677  62.563  202.129 1.00 34.44  ? 232 ALA C CB  1 
ATOM   7351  N N   . LYS C 1 233 ? 25.611  61.825  201.308 1.00 54.40  ? 233 LYS C N   1 
ATOM   7352  C CA  . LYS C 1 233 ? 24.720  61.432  200.254 1.00 55.84  ? 233 LYS C CA  1 
ATOM   7353  C C   . LYS C 1 233 ? 25.616  61.060  199.136 1.00 59.14  ? 233 LYS C C   1 
ATOM   7354  O O   . LYS C 1 233 ? 25.327  60.176  198.367 1.00 55.66  ? 233 LYS C O   1 
ATOM   7355  C CB  . LYS C 1 233 ? 23.992  62.658  199.766 1.00 59.74  ? 233 LYS C CB  1 
ATOM   7356  C CG  . LYS C 1 233 ? 24.891  63.905  199.742 1.00 69.78  ? 233 LYS C CG  1 
ATOM   7357  C CD  . LYS C 1 233 ? 24.831  64.624  198.453 1.00 79.81  ? 233 LYS C CD  1 
ATOM   7358  C CE  . LYS C 1 233 ? 24.011  63.840  197.502 1.00 85.44  ? 233 LYS C CE  1 
ATOM   7359  N NZ  . LYS C 1 233 ? 23.350  64.761  196.588 1.00 99.63  ? 233 LYS C NZ  1 
ATOM   7360  N N   . ASN C 1 234 ? 26.685  61.845  199.035 1.00 72.26  ? 234 ASN C N   1 
ATOM   7361  C CA  . ASN C 1 234 ? 27.714  61.739  198.008 1.00 85.43  ? 234 ASN C CA  1 
ATOM   7362  C C   . ASN C 1 234 ? 29.033  61.198  198.549 1.00 80.90  ? 234 ASN C C   1 
ATOM   7363  O O   . ASN C 1 234 ? 29.477  61.629  199.620 1.00 79.53  ? 234 ASN C O   1 
ATOM   7364  C CB  . ASN C 1 234 ? 27.980  63.132  197.377 1.00 104.95 ? 234 ASN C CB  1 
ATOM   7365  C CG  . ASN C 1 234 ? 27.071  63.441  196.139 1.00 118.69 ? 234 ASN C CG  1 
ATOM   7366  O OD1 . ASN C 1 234 ? 26.687  62.539  195.369 1.00 124.84 ? 234 ASN C OD1 1 
ATOM   7367  N ND2 . ASN C 1 234 ? 26.746  64.729  195.948 1.00 120.31 ? 234 ASN C ND2 1 
ATOM   7368  N N   . GLU C 1 235 ? 29.686  60.368  197.721 1.00 73.98  ? 235 GLU C N   1 
ATOM   7369  C CA  . GLU C 1 235 ? 30.964  59.737  198.035 1.00 64.87  ? 235 GLU C CA  1 
ATOM   7370  C C   . GLU C 1 235 ? 31.710  59.209  196.790 1.00 60.98  ? 235 GLU C C   1 
ATOM   7371  O O   . GLU C 1 235 ? 31.119  58.654  195.843 1.00 55.67  ? 235 GLU C O   1 
ATOM   7372  C CB  . GLU C 1 235 ? 30.762  58.602  199.049 1.00 59.25  ? 235 GLU C CB  1 
ATOM   7373  C CG  . GLU C 1 235 ? 31.838  58.534  200.114 1.00 50.52  ? 235 GLU C CG  1 
ATOM   7374  C CD  . GLU C 1 235 ? 31.759  59.655  201.171 1.00 48.94  ? 235 GLU C CD  1 
ATOM   7375  O OE1 . GLU C 1 235 ? 30.701  60.338  201.257 1.00 38.47  ? 235 GLU C OE1 1 
ATOM   7376  O OE2 . GLU C 1 235 ? 32.759  59.810  201.943 1.00 46.08  ? 235 GLU C OE2 1 
ATOM   7377  N N   . ASN C 1 236 ? 33.014  59.466  196.793 1.00 59.70  ? 236 ASN C N   1 
ATOM   7378  C CA  . ASN C 1 236 ? 33.931  59.027  195.740 1.00 61.14  ? 236 ASN C CA  1 
ATOM   7379  C C   . ASN C 1 236 ? 35.089  58.292  196.453 1.00 60.51  ? 236 ASN C C   1 
ATOM   7380  O O   . ASN C 1 236 ? 36.214  58.204  195.940 1.00 63.24  ? 236 ASN C O   1 
ATOM   7381  C CB  . ASN C 1 236 ? 34.433  60.220  194.883 1.00 62.03  ? 236 ASN C CB  1 
ATOM   7382  C CG  . ASN C 1 236 ? 35.429  59.811  193.746 1.00 64.11  ? 236 ASN C CG  1 
ATOM   7383  O OD1 . ASN C 1 236 ? 35.263  58.797  193.050 1.00 61.67  ? 236 ASN C OD1 1 
ATOM   7384  N ND2 . ASN C 1 236 ? 36.444  60.645  193.544 1.00 64.29  ? 236 ASN C ND2 1 
ATOM   7385  N N   . THR C 1 237 ? 34.799  57.754  197.639 1.00 55.94  ? 237 THR C N   1 
ATOM   7386  C CA  . THR C 1 237 ? 35.778  56.982  198.408 1.00 51.40  ? 237 THR C CA  1 
ATOM   7387  C C   . THR C 1 237 ? 35.087  55.634  198.721 1.00 47.70  ? 237 THR C C   1 
ATOM   7388  O O   . THR C 1 237 ? 33.877  55.482  198.493 1.00 46.98  ? 237 THR C O   1 
ATOM   7389  C CB  . THR C 1 237 ? 36.149  57.710  199.740 1.00 53.97  ? 237 THR C CB  1 
ATOM   7390  O OG1 . THR C 1 237 ? 36.032  59.129  199.567 1.00 55.58  ? 237 THR C OG1 1 
ATOM   7391  C CG2 . THR C 1 237 ? 37.599  57.385  200.173 1.00 55.93  ? 237 THR C CG2 1 
ATOM   7392  N N   . ARG C 1 238 ? 35.848  54.627  199.125 1.00 41.94  ? 238 ARG C N   1 
ATOM   7393  C CA  . ARG C 1 238 ? 35.245  53.356  199.479 1.00 35.75  ? 238 ARG C CA  1 
ATOM   7394  C C   . ARG C 1 238 ? 35.848  53.107  200.803 1.00 30.27  ? 238 ARG C C   1 
ATOM   7395  O O   . ARG C 1 238 ? 37.072  53.097  200.931 1.00 31.50  ? 238 ARG C O   1 
ATOM   7396  C CB  . ARG C 1 238 ? 35.700  52.243  198.566 1.00 40.94  ? 238 ARG C CB  1 
ATOM   7397  C CG  . ARG C 1 238 ? 35.361  52.455  197.140 1.00 52.29  ? 238 ARG C CG  1 
ATOM   7398  C CD  . ARG C 1 238 ? 33.880  52.294  196.843 1.00 55.47  ? 238 ARG C CD  1 
ATOM   7399  N NE  . ARG C 1 238 ? 33.681  52.546  195.418 1.00 60.97  ? 238 ARG C NE  1 
ATOM   7400  C CZ  . ARG C 1 238 ? 33.301  53.718  194.916 1.00 65.07  ? 238 ARG C CZ  1 
ATOM   7401  N NH1 . ARG C 1 238 ? 33.053  54.729  195.745 1.00 69.02  ? 238 ARG C NH1 1 
ATOM   7402  N NH2 . ARG C 1 238 ? 33.255  53.908  193.594 1.00 63.31  ? 238 ARG C NH2 1 
ATOM   7403  N N   . TYR C 1 239 ? 35.011  52.985  201.806 1.00 23.73  ? 239 TYR C N   1 
ATOM   7404  C CA  . TYR C 1 239 ? 35.536  52.722  203.114 1.00 22.10  ? 239 TYR C CA  1 
ATOM   7405  C C   . TYR C 1 239 ? 34.921  51.490  203.669 1.00 20.03  ? 239 TYR C C   1 
ATOM   7406  O O   . TYR C 1 239 ? 33.841  51.085  203.278 1.00 18.22  ? 239 TYR C O   1 
ATOM   7407  C CB  . TYR C 1 239 ? 35.229  53.862  204.044 1.00 27.12  ? 239 TYR C CB  1 
ATOM   7408  C CG  . TYR C 1 239 ? 33.759  54.022  204.383 1.00 31.66  ? 239 TYR C CG  1 
ATOM   7409  C CD1 . TYR C 1 239 ? 33.094  53.129  205.225 1.00 37.63  ? 239 TYR C CD1 1 
ATOM   7410  C CD2 . TYR C 1 239 ? 33.069  55.135  203.961 1.00 33.00  ? 239 TYR C CD2 1 
ATOM   7411  C CE1 . TYR C 1 239 ? 31.795  53.371  205.637 1.00 38.64  ? 239 TYR C CE1 1 
ATOM   7412  C CE2 . TYR C 1 239 ? 31.787  55.381  204.367 1.00 36.51  ? 239 TYR C CE2 1 
ATOM   7413  C CZ  . TYR C 1 239 ? 31.153  54.510  205.202 1.00 38.02  ? 239 TYR C CZ  1 
ATOM   7414  O OH  . TYR C 1 239 ? 29.896  54.849  205.628 1.00 47.33  ? 239 TYR C OH  1 
ATOM   7415  N N   . PHE C 1 240 ? 35.625  50.871  204.583 1.00 20.80  ? 240 PHE C N   1 
ATOM   7416  C CA  . PHE C 1 240 ? 35.102  49.686  205.194 1.00 28.62  ? 240 PHE C CA  1 
ATOM   7417  C C   . PHE C 1 240 ? 35.826  49.567  206.477 1.00 33.84  ? 240 PHE C C   1 
ATOM   7418  O O   . PHE C 1 240 ? 37.027  49.887  206.566 1.00 31.38  ? 240 PHE C O   1 
ATOM   7419  C CB  . PHE C 1 240 ? 35.464  48.447  204.413 1.00 33.77  ? 240 PHE C CB  1 
ATOM   7420  C CG  . PHE C 1 240 ? 35.574  48.662  202.968 1.00 37.50  ? 240 PHE C CG  1 
ATOM   7421  C CD1 . PHE C 1 240 ? 36.520  49.524  202.465 1.00 41.66  ? 240 PHE C CD1 1 
ATOM   7422  C CD2 . PHE C 1 240 ? 34.681  48.061  202.114 1.00 39.36  ? 240 PHE C CD2 1 
ATOM   7423  C CE1 . PHE C 1 240 ? 36.557  49.794  201.139 1.00 48.75  ? 240 PHE C CE1 1 
ATOM   7424  C CE2 . PHE C 1 240 ? 34.713  48.322  200.782 1.00 44.15  ? 240 PHE C CE2 1 
ATOM   7425  C CZ  . PHE C 1 240 ? 35.645  49.192  200.283 1.00 46.29  ? 240 PHE C CZ  1 
ATOM   7426  N N   . GLY C 1 241 ? 35.127  49.012  207.448 1.00 41.05  ? 241 GLY C N   1 
ATOM   7427  C CA  . GLY C 1 241 ? 35.742  48.823  208.731 1.00 52.08  ? 241 GLY C CA  1 
ATOM   7428  C C   . GLY C 1 241 ? 34.760  48.248  209.705 1.00 57.36  ? 241 GLY C C   1 
ATOM   7429  O O   . GLY C 1 241 ? 33.558  48.138  209.401 1.00 57.34  ? 241 GLY C O   1 
ATOM   7430  N N   . ASN C 1 242 ? 35.275  47.927  210.891 1.00 61.67  ? 242 ASN C N   1 
ATOM   7431  C CA  . ASN C 1 242 ? 34.454  47.361  211.949 1.00 66.36  ? 242 ASN C CA  1 
ATOM   7432  C C   . ASN C 1 242 ? 34.930  47.631  213.393 1.00 63.62  ? 242 ASN C C   1 
ATOM   7433  O O   . ASN C 1 242 ? 36.148  47.761  213.678 1.00 62.71  ? 242 ASN C O   1 
ATOM   7434  C CB  . ASN C 1 242 ? 34.350  45.864  211.758 1.00 77.77  ? 242 ASN C CB  1 
ATOM   7435  C CG  . ASN C 1 242 ? 35.347  45.128  212.590 1.00 90.22  ? 242 ASN C CG  1 
ATOM   7436  O OD1 . ASN C 1 242 ? 35.001  44.556  213.631 1.00 99.91  ? 242 ASN C OD1 1 
ATOM   7437  N ND2 . ASN C 1 242 ? 36.618  45.210  212.197 1.00 98.55  ? 242 ASN C ND2 1 
ATOM   7438  N N   . TYR C 1 243 ? 33.954  47.649  214.300 1.00 56.98  ? 243 TYR C N   1 
ATOM   7439  C CA  . TYR C 1 243 ? 34.213  47.878  215.700 1.00 49.70  ? 243 TYR C CA  1 
ATOM   7440  C C   . TYR C 1 243 ? 33.890  46.598  216.405 1.00 46.90  ? 243 TYR C C   1 
ATOM   7441  O O   . TYR C 1 243 ? 32.838  45.996  216.175 1.00 42.70  ? 243 TYR C O   1 
ATOM   7442  C CB  . TYR C 1 243 ? 33.336  48.996  216.243 1.00 47.39  ? 243 TYR C CB  1 
ATOM   7443  C CG  . TYR C 1 243 ? 33.365  49.021  217.727 1.00 46.20  ? 243 TYR C CG  1 
ATOM   7444  C CD1 . TYR C 1 243 ? 34.571  49.178  218.412 1.00 46.55  ? 243 TYR C CD1 1 
ATOM   7445  C CD2 . TYR C 1 243 ? 32.203  48.818  218.458 1.00 45.22  ? 243 TYR C CD2 1 
ATOM   7446  C CE1 . TYR C 1 243 ? 34.616  49.135  219.820 1.00 52.10  ? 243 TYR C CE1 1 
ATOM   7447  C CE2 . TYR C 1 243 ? 32.221  48.762  219.858 1.00 47.18  ? 243 TYR C CE2 1 
ATOM   7448  C CZ  . TYR C 1 243 ? 33.427  48.923  220.553 1.00 52.51  ? 243 TYR C CZ  1 
ATOM   7449  O OH  . TYR C 1 243 ? 33.442  48.857  221.963 1.00 47.49  ? 243 TYR C OH  1 
ATOM   7450  N N   . THR C 1 244 ? 34.794  46.225  217.291 1.00 46.78  ? 244 THR C N   1 
ATOM   7451  C CA  . THR C 1 244 ? 34.687  45.015  218.078 1.00 49.87  ? 244 THR C CA  1 
ATOM   7452  C C   . THR C 1 244 ? 34.996  45.528  219.457 1.00 52.11  ? 244 THR C C   1 
ATOM   7453  O O   . THR C 1 244 ? 36.161  45.792  219.793 1.00 49.42  ? 244 THR C O   1 
ATOM   7454  C CB  . THR C 1 244 ? 35.797  44.057  217.695 1.00 50.88  ? 244 THR C CB  1 
ATOM   7455  O OG1 . THR C 1 244 ? 36.657  44.727  216.769 1.00 55.83  ? 244 THR C OG1 1 
ATOM   7456  C CG2 . THR C 1 244 ? 35.266  42.775  217.066 1.00 49.97  ? 244 THR C CG2 1 
ATOM   7457  N N   . GLY C 1 245 ? 33.943  45.710  220.239 1.00 56.98  ? 245 GLY C N   1 
ATOM   7458  C CA  . GLY C 1 245 ? 34.079  46.232  221.589 1.00 62.63  ? 245 GLY C CA  1 
ATOM   7459  C C   . GLY C 1 245 ? 34.496  45.280  222.671 1.00 63.80  ? 245 GLY C C   1 
ATOM   7460  O O   . GLY C 1 245 ? 34.677  44.104  222.423 1.00 63.81  ? 245 GLY C O   1 
ATOM   7461  N N   . GLY C 1 246 ? 34.684  45.782  223.877 1.00 66.10  ? 246 GLY C N   1 
ATOM   7462  C CA  . GLY C 1 246 ? 35.070  44.872  224.931 1.00 68.57  ? 246 GLY C CA  1 
ATOM   7463  C C   . GLY C 1 246 ? 36.271  45.299  225.733 1.00 69.66  ? 246 GLY C C   1 
ATOM   7464  O O   . GLY C 1 246 ? 37.065  46.172  225.343 1.00 71.29  ? 246 GLY C O   1 
ATOM   7465  N N   . THR C 1 247 ? 36.453  44.586  226.828 1.00 69.76  ? 247 THR C N   1 
ATOM   7466  C CA  . THR C 1 247 ? 37.523  44.875  227.752 1.00 69.94  ? 247 THR C CA  1 
ATOM   7467  C C   . THR C 1 247 ? 38.657  43.861  227.723 1.00 68.99  ? 247 THR C C   1 
ATOM   7468  O O   . THR C 1 247 ? 39.810  44.196  227.958 1.00 64.71  ? 247 THR C O   1 
ATOM   7469  C CB  . THR C 1 247 ? 36.907  44.944  229.152 1.00 73.62  ? 247 THR C CB  1 
ATOM   7470  O OG1 . THR C 1 247 ? 36.126  43.757  229.392 1.00 79.71  ? 247 THR C OG1 1 
ATOM   7471  C CG2 . THR C 1 247 ? 35.967  46.124  229.218 1.00 72.75  ? 247 THR C CG2 1 
ATOM   7472  N N   . THR C 1 248 ? 38.305  42.631  227.381 1.00 71.31  ? 248 THR C N   1 
ATOM   7473  C CA  . THR C 1 248 ? 39.220  41.496  227.347 1.00 77.10  ? 248 THR C CA  1 
ATOM   7474  C C   . THR C 1 248 ? 39.213  40.838  225.999 1.00 76.45  ? 248 THR C C   1 
ATOM   7475  O O   . THR C 1 248 ? 39.800  39.773  225.797 1.00 78.58  ? 248 THR C O   1 
ATOM   7476  C CB  . THR C 1 248 ? 38.675  40.423  228.223 1.00 84.99  ? 248 THR C CB  1 
ATOM   7477  O OG1 . THR C 1 248 ? 37.237  40.461  228.146 1.00 93.46  ? 248 THR C OG1 1 
ATOM   7478  C CG2 . THR C 1 248 ? 39.141  40.606  229.624 1.00 92.71  ? 248 THR C CG2 1 
ATOM   7479  N N   . THR C 1 249 ? 38.359  41.375  225.153 1.00 74.29  ? 249 THR C N   1 
ATOM   7480  C CA  . THR C 1 249 ? 38.169  40.892  223.808 1.00 68.45  ? 249 THR C CA  1 
ATOM   7481  C C   . THR C 1 249 ? 39.475  40.571  223.070 1.00 58.18  ? 249 THR C C   1 
ATOM   7482  O O   . THR C 1 249 ? 40.346  41.424  222.886 1.00 55.96  ? 249 THR C O   1 
ATOM   7483  C CB  . THR C 1 249 ? 37.349  41.909  223.074 1.00 76.15  ? 249 THR C CB  1 
ATOM   7484  O OG1 . THR C 1 249 ? 36.253  42.317  223.922 1.00 80.29  ? 249 THR C OG1 1 
ATOM   7485  C CG2 . THR C 1 249 ? 36.845  41.318  221.792 1.00 83.20  ? 249 THR C CG2 1 
ATOM   7486  N N   . PRO C 1 250 ? 39.604  39.326  222.626 1.00 48.47  ? 250 PRO C N   1 
ATOM   7487  C CA  . PRO C 1 250 ? 40.740  38.762  221.915 1.00 42.33  ? 250 PRO C CA  1 
ATOM   7488  C C   . PRO C 1 250 ? 40.855  39.257  220.519 1.00 40.78  ? 250 PRO C C   1 
ATOM   7489  O O   . PRO C 1 250 ? 39.874  39.349  219.794 1.00 42.16  ? 250 PRO C O   1 
ATOM   7490  C CB  . PRO C 1 250 ? 40.425  37.281  221.888 1.00 42.30  ? 250 PRO C CB  1 
ATOM   7491  C CG  . PRO C 1 250 ? 39.385  37.111  222.939 1.00 50.20  ? 250 PRO C CG  1 
ATOM   7492  C CD  . PRO C 1 250 ? 38.558  38.318  222.766 1.00 48.56  ? 250 PRO C CD  1 
ATOM   7493  N N   . PRO C 1 251 ? 42.077  39.559  220.109 1.00 41.78  ? 251 PRO C N   1 
ATOM   7494  C CA  . PRO C 1 251 ? 42.359  40.052  218.762 1.00 41.90  ? 251 PRO C CA  1 
ATOM   7495  C C   . PRO C 1 251 ? 42.252  38.958  217.689 1.00 43.01  ? 251 PRO C C   1 
ATOM   7496  O O   . PRO C 1 251 ? 42.368  37.756  217.978 1.00 41.46  ? 251 PRO C O   1 
ATOM   7497  C CB  . PRO C 1 251 ? 43.783  40.581  218.893 1.00 43.16  ? 251 PRO C CB  1 
ATOM   7498  C CG  . PRO C 1 251 ? 43.901  40.904  220.376 1.00 41.99  ? 251 PRO C CG  1 
ATOM   7499  C CD  . PRO C 1 251 ? 43.245  39.723  220.989 1.00 39.60  ? 251 PRO C CD  1 
ATOM   7500  N N   . VAL C 1 252 ? 42.027  39.394  216.452 1.00 42.80  ? 252 VAL C N   1 
ATOM   7501  C CA  . VAL C 1 252 ? 41.909  38.497  215.305 1.00 41.83  ? 252 VAL C CA  1 
ATOM   7502  C C   . VAL C 1 252 ? 42.274  39.173  214.014 1.00 43.87  ? 252 VAL C C   1 
ATOM   7503  O O   . VAL C 1 252 ? 41.853  40.307  213.768 1.00 48.81  ? 252 VAL C O   1 
ATOM   7504  C CB  . VAL C 1 252 ? 40.515  38.015  215.115 1.00 38.05  ? 252 VAL C CB  1 
ATOM   7505  C CG1 . VAL C 1 252 ? 40.458  36.570  215.500 1.00 41.83  ? 252 VAL C CG1 1 
ATOM   7506  C CG2 . VAL C 1 252 ? 39.528  38.908  215.896 1.00 40.17  ? 252 VAL C CG2 1 
ATOM   7507  N N   . LEU C 1 253 ? 42.979  38.452  213.152 1.00 42.95  ? 253 LEU C N   1 
ATOM   7508  C CA  . LEU C 1 253 ? 43.390  39.038  211.901 1.00 43.53  ? 253 LEU C CA  1 
ATOM   7509  C C   . LEU C 1 253 ? 43.412  38.120  210.725 1.00 45.14  ? 253 LEU C C   1 
ATOM   7510  O O   . LEU C 1 253 ? 43.071  36.968  210.864 1.00 46.37  ? 253 LEU C O   1 
ATOM   7511  C CB  . LEU C 1 253 ? 44.734  39.685  212.060 1.00 45.28  ? 253 LEU C CB  1 
ATOM   7512  C CG  . LEU C 1 253 ? 44.394  41.142  211.795 1.00 51.95  ? 253 LEU C CG  1 
ATOM   7513  C CD1 . LEU C 1 253 ? 44.543  41.945  213.097 1.00 53.13  ? 253 LEU C CD1 1 
ATOM   7514  C CD2 . LEU C 1 253 ? 45.234  41.692  210.626 1.00 54.00  ? 253 LEU C CD2 1 
ATOM   7515  N N   . GLN C 1 254 ? 43.883  38.613  209.582 1.00 48.41  ? 254 GLN C N   1 
ATOM   7516  C CA  . GLN C 1 254 ? 43.910  37.820  208.356 1.00 52.48  ? 254 GLN C CA  1 
ATOM   7517  C C   . GLN C 1 254 ? 45.134  37.945  207.502 1.00 49.15  ? 254 GLN C C   1 
ATOM   7518  O O   . GLN C 1 254 ? 45.132  38.568  206.429 1.00 46.62  ? 254 GLN C O   1 
ATOM   7519  C CB  . GLN C 1 254 ? 42.712  38.172  207.510 1.00 68.05  ? 254 GLN C CB  1 
ATOM   7520  C CG  . GLN C 1 254 ? 41.405  37.903  208.216 1.00 86.84  ? 254 GLN C CG  1 
ATOM   7521  C CD  . GLN C 1 254 ? 41.247  36.440  208.600 1.00 94.76  ? 254 GLN C CD  1 
ATOM   7522  O OE1 . GLN C 1 254 ? 41.822  35.549  207.961 1.00 100.31 ? 254 GLN C OE1 1 
ATOM   7523  N NE2 . GLN C 1 254 ? 40.462  36.184  209.648 1.00 102.33 ? 254 GLN C NE2 1 
ATOM   7524  N N   . PHE C 1 255 ? 46.196  37.367  208.001 1.00 45.55  ? 255 PHE C N   1 
ATOM   7525  C CA  . PHE C 1 255 ? 47.397  37.386  207.262 1.00 46.00  ? 255 PHE C CA  1 
ATOM   7526  C C   . PHE C 1 255 ? 47.165  36.776  205.883 1.00 44.73  ? 255 PHE C C   1 
ATOM   7527  O O   . PHE C 1 255 ? 47.055  35.542  205.793 1.00 51.10  ? 255 PHE C O   1 
ATOM   7528  C CB  . PHE C 1 255 ? 48.455  36.596  208.012 1.00 47.70  ? 255 PHE C CB  1 
ATOM   7529  C CG  . PHE C 1 255 ? 49.261  37.438  208.902 1.00 66.81  ? 255 PHE C CG  1 
ATOM   7530  C CD1 . PHE C 1 255 ? 49.812  38.646  208.419 1.00 80.00  ? 255 PHE C CD1 1 
ATOM   7531  C CD2 . PHE C 1 255 ? 49.490  37.075  210.223 1.00 77.32  ? 255 PHE C CD2 1 
ATOM   7532  C CE1 . PHE C 1 255 ? 50.610  39.512  209.255 1.00 86.35  ? 255 PHE C CE1 1 
ATOM   7533  C CE2 . PHE C 1 255 ? 50.288  37.924  211.086 1.00 88.78  ? 255 PHE C CE2 1 
ATOM   7534  C CZ  . PHE C 1 255 ? 50.848  39.150  210.590 1.00 87.87  ? 255 PHE C CZ  1 
ATOM   7535  N N   . THR C 1 256 ? 46.873  37.616  204.872 1.00 34.79  ? 256 THR C N   1 
ATOM   7536  C CA  . THR C 1 256 ? 46.802  37.143  203.468 1.00 26.80  ? 256 THR C CA  1 
ATOM   7537  C C   . THR C 1 256 ? 46.732  38.023  202.218 1.00 31.62  ? 256 THR C C   1 
ATOM   7538  O O   . THR C 1 256 ? 45.948  38.973  202.079 1.00 29.96  ? 256 THR C O   1 
ATOM   7539  C CB  . THR C 1 256 ? 45.989  35.918  203.247 1.00 18.72  ? 256 THR C CB  1 
ATOM   7540  O OG1 . THR C 1 256 ? 46.104  35.540  201.875 1.00 5.16   ? 256 THR C OG1 1 
ATOM   7541  C CG2 . THR C 1 256 ? 44.616  36.176  203.603 1.00 24.01  ? 256 THR C CG2 1 
ATOM   7542  N N   . ASN C 1 257 ? 47.535  37.558  201.266 1.00 36.50  ? 257 ASN C N   1 
ATOM   7543  C CA  . ASN C 1 257 ? 47.774  38.163  199.964 1.00 38.02  ? 257 ASN C CA  1 
ATOM   7544  C C   . ASN C 1 257 ? 46.990  37.440  198.898 1.00 34.53  ? 257 ASN C C   1 
ATOM   7545  O O   . ASN C 1 257 ? 47.436  37.271  197.761 1.00 32.14  ? 257 ASN C O   1 
ATOM   7546  C CB  . ASN C 1 257 ? 49.250  37.982  199.620 1.00 49.35  ? 257 ASN C CB  1 
ATOM   7547  C CG  . ASN C 1 257 ? 49.590  36.530  199.245 1.00 64.37  ? 257 ASN C CG  1 
ATOM   7548  O OD1 . ASN C 1 257 ? 50.193  36.269  198.201 1.00 79.51  ? 257 ASN C OD1 1 
ATOM   7549  N ND2 . ASN C 1 257 ? 49.164  35.581  200.076 1.00 72.01  ? 257 ASN C ND2 1 
ATOM   7550  N N   . THR C 1 258 ? 45.821  36.970  199.228 1.00 34.45  ? 258 THR C N   1 
ATOM   7551  C CA  . THR C 1 258 ? 45.152  36.279  198.177 1.00 40.53  ? 258 THR C CA  1 
ATOM   7552  C C   . THR C 1 258 ? 44.071  37.067  197.484 1.00 46.36  ? 258 THR C C   1 
ATOM   7553  O O   . THR C 1 258 ? 44.153  37.255  196.241 1.00 45.23  ? 258 THR C O   1 
ATOM   7554  C CB  . THR C 1 258 ? 44.667  34.956  198.641 1.00 41.43  ? 258 THR C CB  1 
ATOM   7555  O OG1 . THR C 1 258 ? 45.417  34.586  199.804 1.00 36.27  ? 258 THR C OG1 1 
ATOM   7556  C CG2 . THR C 1 258 ? 44.863  33.928  197.514 1.00 45.36  ? 258 THR C CG2 1 
ATOM   7557  N N   . LEU C 1 259 ? 43.062  37.536  198.228 1.00 49.87  ? 259 LEU C N   1 
ATOM   7558  C CA  . LEU C 1 259 ? 42.055  38.272  197.504 1.00 56.55  ? 259 LEU C CA  1 
ATOM   7559  C C   . LEU C 1 259 ? 42.152  39.798  197.583 1.00 57.39  ? 259 LEU C C   1 
ATOM   7560  O O   . LEU C 1 259 ? 42.860  40.381  198.423 1.00 64.23  ? 259 LEU C O   1 
ATOM   7561  C CB  . LEU C 1 259 ? 40.599  37.643  197.571 1.00 64.89  ? 259 LEU C CB  1 
ATOM   7562  C CG  . LEU C 1 259 ? 39.692  36.952  196.411 1.00 85.42  ? 259 LEU C CG  1 
ATOM   7563  C CD1 . LEU C 1 259 ? 38.442  37.838  195.909 1.00 87.23  ? 259 LEU C CD1 1 
ATOM   7564  C CD2 . LEU C 1 259 ? 40.477  36.315  195.187 1.00 92.32  ? 259 LEU C CD2 1 
ATOM   7565  N N   . THR C 1 260 ? 41.654  40.346  196.478 1.00 53.61  ? 260 THR C N   1 
ATOM   7566  C CA  . THR C 1 260 ? 41.569  41.740  196.097 1.00 50.28  ? 260 THR C CA  1 
ATOM   7567  C C   . THR C 1 260 ? 40.164  42.246  196.294 1.00 44.74  ? 260 THR C C   1 
ATOM   7568  O O   . THR C 1 260 ? 39.204  41.465  196.205 1.00 45.41  ? 260 THR C O   1 
ATOM   7569  C CB  . THR C 1 260 ? 41.750  41.809  194.579 1.00 55.27  ? 260 THR C CB  1 
ATOM   7570  O OG1 . THR C 1 260 ? 42.227  40.535  194.119 1.00 63.69  ? 260 THR C OG1 1 
ATOM   7571  C CG2 . THR C 1 260 ? 42.715  42.952  194.143 1.00 63.04  ? 260 THR C CG2 1 
ATOM   7572  N N   . THR C 1 261 ? 40.041  43.568  196.407 1.00 41.37  ? 261 THR C N   1 
ATOM   7573  C CA  . THR C 1 261 ? 38.743  44.205  196.561 1.00 35.51  ? 261 THR C CA  1 
ATOM   7574  C C   . THR C 1 261 ? 38.444  45.296  195.584 1.00 33.92  ? 261 THR C C   1 
ATOM   7575  O O   . THR C 1 261 ? 39.251  46.229  195.382 1.00 30.92  ? 261 THR C O   1 
ATOM   7576  C CB  . THR C 1 261 ? 38.582  44.835  197.865 1.00 33.35  ? 261 THR C CB  1 
ATOM   7577  O OG1 . THR C 1 261 ? 38.939  43.893  198.879 1.00 40.72  ? 261 THR C OG1 1 
ATOM   7578  C CG2 . THR C 1 261 ? 37.137  45.239  198.009 1.00 30.55  ? 261 THR C CG2 1 
ATOM   7579  N N   . VAL C 1 262 ? 37.209  45.265  195.108 1.00 30.45  ? 262 VAL C N   1 
ATOM   7580  C CA  . VAL C 1 262 ? 36.819  46.253  194.143 1.00 31.35  ? 262 VAL C CA  1 
ATOM   7581  C C   . VAL C 1 262 ? 36.150  47.489  194.604 1.00 33.66  ? 262 VAL C C   1 
ATOM   7582  O O   . VAL C 1 262 ? 35.020  47.513  195.114 1.00 35.88  ? 262 VAL C O   1 
ATOM   7583  C CB  . VAL C 1 262 ? 35.997  45.731  193.063 1.00 27.86  ? 262 VAL C CB  1 
ATOM   7584  C CG1 . VAL C 1 262 ? 36.641  46.115  191.762 1.00 26.43  ? 262 VAL C CG1 1 
ATOM   7585  C CG2 . VAL C 1 262 ? 35.818  44.281  193.241 1.00 33.76  ? 262 VAL C CG2 1 
ATOM   7586  N N   . LEU C 1 263 ? 36.854  48.535  194.253 1.00 33.21  ? 263 LEU C N   1 
ATOM   7587  C CA  . LEU C 1 263 ? 36.469  49.874  194.528 1.00 34.08  ? 263 LEU C CA  1 
ATOM   7588  C C   . LEU C 1 263 ? 35.520  50.244  193.428 1.00 35.61  ? 263 LEU C C   1 
ATOM   7589  O O   . LEU C 1 263 ? 35.016  51.366  193.402 1.00 37.50  ? 263 LEU C O   1 
ATOM   7590  C CB  . LEU C 1 263 ? 37.711  50.724  194.443 1.00 32.07  ? 263 LEU C CB  1 
ATOM   7591  C CG  . LEU C 1 263 ? 38.705  49.910  195.247 1.00 28.62  ? 263 LEU C CG  1 
ATOM   7592  C CD1 . LEU C 1 263 ? 40.097  50.387  194.998 1.00 32.36  ? 263 LEU C CD1 1 
ATOM   7593  C CD2 . LEU C 1 263 ? 38.299  49.980  196.693 1.00 26.72  ? 263 LEU C CD2 1 
ATOM   7594  N N   . LEU C 1 264 ? 35.277  49.321  192.503 1.00 35.63  ? 264 LEU C N   1 
ATOM   7595  C CA  . LEU C 1 264 ? 34.377  49.653  191.432 1.00 38.94  ? 264 LEU C CA  1 
ATOM   7596  C C   . LEU C 1 264 ? 33.047  50.022  191.954 1.00 42.72  ? 264 LEU C C   1 
ATOM   7597  O O   . LEU C 1 264 ? 32.541  49.377  192.856 1.00 47.36  ? 264 LEU C O   1 
ATOM   7598  C CB  . LEU C 1 264 ? 34.276  48.579  190.393 1.00 35.36  ? 264 LEU C CB  1 
ATOM   7599  C CG  . LEU C 1 264 ? 34.940  49.423  189.320 1.00 38.27  ? 264 LEU C CG  1 
ATOM   7600  C CD1 . LEU C 1 264 ? 36.422  49.508  189.673 1.00 38.13  ? 264 LEU C CD1 1 
ATOM   7601  C CD2 . LEU C 1 264 ? 34.721  48.905  187.916 1.00 39.56  ? 264 LEU C CD2 1 
ATOM   7602  N N   . ASP C 1 265 ? 32.529  51.124  191.435 1.00 47.56  ? 265 ASP C N   1 
ATOM   7603  C CA  . ASP C 1 265 ? 31.258  51.638  191.888 1.00 55.54  ? 265 ASP C CA  1 
ATOM   7604  C C   . ASP C 1 265 ? 30.047  50.897  191.306 1.00 59.50  ? 265 ASP C C   1 
ATOM   7605  O O   . ASP C 1 265 ? 30.212  49.959  190.532 1.00 58.97  ? 265 ASP C O   1 
ATOM   7606  C CB  . ASP C 1 265 ? 31.207  53.156  191.678 1.00 55.93  ? 265 ASP C CB  1 
ATOM   7607  C CG  . ASP C 1 265 ? 30.311  53.559  190.550 1.00 62.67  ? 265 ASP C CG  1 
ATOM   7608  O OD1 . ASP C 1 265 ? 30.378  52.922  189.473 1.00 59.05  ? 265 ASP C OD1 1 
ATOM   7609  O OD2 . ASP C 1 265 ? 29.529  54.515  190.749 1.00 68.97  ? 265 ASP C OD2 1 
ATOM   7610  N N   . GLU C 1 266 ? 28.845  51.339  191.679 1.00 65.12  ? 266 GLU C N   1 
ATOM   7611  C CA  . GLU C 1 266 ? 27.578  50.727  191.254 1.00 68.94  ? 266 GLU C CA  1 
ATOM   7612  C C   . GLU C 1 266 ? 27.435  50.682  189.759 1.00 63.63  ? 266 GLU C C   1 
ATOM   7613  O O   . GLU C 1 266 ? 26.846  49.769  189.219 1.00 60.41  ? 266 GLU C O   1 
ATOM   7614  C CB  . GLU C 1 266 ? 26.374  51.487  191.849 1.00 82.20  ? 266 GLU C CB  1 
ATOM   7615  C CG  . GLU C 1 266 ? 26.373  51.624  193.410 1.00 106.86 ? 266 GLU C CG  1 
ATOM   7616  C CD  . GLU C 1 266 ? 25.372  52.687  193.979 1.00 120.10 ? 266 GLU C CD  1 
ATOM   7617  O OE1 . GLU C 1 266 ? 25.197  53.779  193.372 1.00 129.46 ? 266 GLU C OE1 1 
ATOM   7618  O OE2 . GLU C 1 266 ? 24.795  52.455  195.080 1.00 127.49 ? 266 GLU C OE2 1 
ATOM   7619  N N   . ASN C 1 267 ? 28.006  51.666  189.093 1.00 62.80  ? 267 ASN C N   1 
ATOM   7620  C CA  . ASN C 1 267 ? 27.915  51.762  187.651 1.00 64.13  ? 267 ASN C CA  1 
ATOM   7621  C C   . ASN C 1 267 ? 29.175  51.330  186.953 1.00 60.11  ? 267 ASN C C   1 
ATOM   7622  O O   . ASN C 1 267 ? 29.351  51.538  185.746 1.00 60.10  ? 267 ASN C O   1 
ATOM   7623  C CB  . ASN C 1 267 ? 27.583  53.190  187.277 1.00 71.61  ? 267 ASN C CB  1 
ATOM   7624  C CG  . ASN C 1 267 ? 26.213  53.600  187.750 1.00 78.19  ? 267 ASN C CG  1 
ATOM   7625  O OD1 . ASN C 1 267 ? 25.198  53.066  187.272 1.00 80.98  ? 267 ASN C OD1 1 
ATOM   7626  N ND2 . ASN C 1 267 ? 26.161  54.555  188.694 1.00 81.45  ? 267 ASN C ND2 1 
ATOM   7627  N N   . GLY C 1 268 ? 30.062  50.738  187.731 1.00 57.66  ? 268 GLY C N   1 
ATOM   7628  C CA  . GLY C 1 268 ? 31.312  50.255  187.187 1.00 55.09  ? 268 GLY C CA  1 
ATOM   7629  C C   . GLY C 1 268 ? 32.245  51.411  187.049 1.00 47.45  ? 268 GLY C C   1 
ATOM   7630  O O   . GLY C 1 268 ? 32.821  51.660  185.985 1.00 51.06  ? 268 GLY C O   1 
ATOM   7631  N N   . VAL C 1 269 ? 32.496  52.045  188.169 1.00 38.11  ? 269 VAL C N   1 
ATOM   7632  C CA  . VAL C 1 269 ? 33.310  53.186  188.091 1.00 33.99  ? 269 VAL C CA  1 
ATOM   7633  C C   . VAL C 1 269 ? 34.453  53.278  189.024 1.00 34.36  ? 269 VAL C C   1 
ATOM   7634  O O   . VAL C 1 269 ? 35.570  53.533  188.613 1.00 37.65  ? 269 VAL C O   1 
ATOM   7635  C CB  . VAL C 1 269 ? 32.442  54.365  188.201 1.00 32.01  ? 269 VAL C CB  1 
ATOM   7636  C CG1 . VAL C 1 269 ? 33.214  55.561  188.662 1.00 38.14  ? 269 VAL C CG1 1 
ATOM   7637  C CG2 . VAL C 1 269 ? 31.768  54.582  186.879 1.00 32.53  ? 269 VAL C CG2 1 
ATOM   7638  N N   . GLY C 1 270 ? 34.206  53.131  190.299 1.00 32.83  ? 270 GLY C N   1 
ATOM   7639  C CA  . GLY C 1 270 ? 35.357  53.243  191.150 1.00 30.26  ? 270 GLY C CA  1 
ATOM   7640  C C   . GLY C 1 270 ? 35.712  54.696  191.268 1.00 27.17  ? 270 GLY C C   1 
ATOM   7641  O O   . GLY C 1 270 ? 35.118  55.596  190.675 1.00 21.27  ? 270 GLY C O   1 
ATOM   7642  N N   . PRO C 1 271 ? 36.670  54.944  192.123 1.00 27.67  ? 271 PRO C N   1 
ATOM   7643  C CA  . PRO C 1 271 ? 37.102  56.311  192.352 1.00 26.61  ? 271 PRO C CA  1 
ATOM   7644  C C   . PRO C 1 271 ? 37.896  56.833  191.221 1.00 28.70  ? 271 PRO C C   1 
ATOM   7645  O O   . PRO C 1 271 ? 38.614  56.114  190.520 1.00 25.78  ? 271 PRO C O   1 
ATOM   7646  C CB  . PRO C 1 271 ? 37.927  56.214  193.628 1.00 23.67  ? 271 PRO C CB  1 
ATOM   7647  C CG  . PRO C 1 271 ? 37.471  54.869  194.250 1.00 24.32  ? 271 PRO C CG  1 
ATOM   7648  C CD  . PRO C 1 271 ? 37.318  54.001  193.039 1.00 22.83  ? 271 PRO C CD  1 
ATOM   7649  N N   . LEU C 1 272 ? 37.786  58.133  191.097 1.00 31.16  ? 272 LEU C N   1 
ATOM   7650  C CA  . LEU C 1 272 ? 38.455  58.852  190.059 1.00 34.90  ? 272 LEU C CA  1 
ATOM   7651  C C   . LEU C 1 272 ? 39.138  59.896  190.846 1.00 39.30  ? 272 LEU C C   1 
ATOM   7652  O O   . LEU C 1 272 ? 38.510  60.679  191.551 1.00 37.72  ? 272 LEU C O   1 
ATOM   7653  C CB  . LEU C 1 272 ? 37.435  59.471  189.156 1.00 33.27  ? 272 LEU C CB  1 
ATOM   7654  C CG  . LEU C 1 272 ? 36.365  58.404  189.035 1.00 32.56  ? 272 LEU C CG  1 
ATOM   7655  C CD1 . LEU C 1 272 ? 35.225  58.599  190.048 1.00 37.44  ? 272 LEU C CD1 1 
ATOM   7656  C CD2 . LEU C 1 272 ? 35.883  58.457  187.659 1.00 33.71  ? 272 LEU C CD2 1 
ATOM   7657  N N   . CYS C 1 273 ? 40.446  59.794  190.829 1.00 44.95  ? 273 CYS C N   1 
ATOM   7658  C CA  . CYS C 1 273 ? 41.286  60.697  191.550 1.00 50.01  ? 273 CYS C CA  1 
ATOM   7659  C C   . CYS C 1 273 ? 41.061  62.065  191.014 1.00 54.25  ? 273 CYS C C   1 
ATOM   7660  O O   . CYS C 1 273 ? 41.531  62.373  189.919 1.00 56.14  ? 273 CYS C O   1 
ATOM   7661  C CB  . CYS C 1 273 ? 42.702  60.264  191.313 1.00 51.44  ? 273 CYS C CB  1 
ATOM   7662  S SG  . CYS C 1 273 ? 42.747  58.488  191.502 1.00 57.61  ? 273 CYS C SG  1 
ATOM   7663  N N   . LYS C 1 274 ? 40.184  62.808  191.686 1.00 59.26  ? 274 LYS C N   1 
ATOM   7664  C CA  . LYS C 1 274 ? 39.929  64.180  191.288 1.00 66.18  ? 274 LYS C CA  1 
ATOM   7665  C C   . LYS C 1 274 ? 41.164  64.873  191.826 1.00 66.35  ? 274 LYS C C   1 
ATOM   7666  O O   . LYS C 1 274 ? 41.777  64.440  192.823 1.00 61.42  ? 274 LYS C O   1 
ATOM   7667  C CB  . LYS C 1 274 ? 38.596  64.752  191.810 1.00 76.04  ? 274 LYS C CB  1 
ATOM   7668  C CG  . LYS C 1 274 ? 38.455  65.017  193.311 1.00 86.40  ? 274 LYS C CG  1 
ATOM   7669  C CD  . LYS C 1 274 ? 37.053  65.605  193.667 1.00 90.64  ? 274 LYS C CD  1 
ATOM   7670  C CE  . LYS C 1 274 ? 35.881  64.672  193.243 1.00 91.70  ? 274 LYS C CE  1 
ATOM   7671  N NZ  . LYS C 1 274 ? 34.540  65.151  193.719 1.00 92.02  ? 274 LYS C NZ  1 
ATOM   7672  N N   . GLY C 1 275 ? 41.542  65.964  191.179 1.00 70.01  ? 275 GLY C N   1 
ATOM   7673  C CA  . GLY C 1 275 ? 42.820  66.555  191.537 1.00 74.54  ? 275 GLY C CA  1 
ATOM   7674  C C   . GLY C 1 275 ? 43.578  65.449  190.829 1.00 74.81  ? 275 GLY C C   1 
ATOM   7675  O O   . GLY C 1 275 ? 43.002  64.828  189.925 1.00 80.70  ? 275 GLY C O   1 
ATOM   7676  N N   . GLU C 1 276 ? 44.830  65.175  191.118 1.00 71.10  ? 276 GLU C N   1 
ATOM   7677  C CA  . GLU C 1 276 ? 45.355  64.019  190.397 1.00 70.89  ? 276 GLU C CA  1 
ATOM   7678  C C   . GLU C 1 276 ? 45.810  63.059  191.470 1.00 67.84  ? 276 GLU C C   1 
ATOM   7679  O O   . GLU C 1 276 ? 46.740  62.252  191.291 1.00 67.27  ? 276 GLU C O   1 
ATOM   7680  C CB  . GLU C 1 276 ? 46.433  64.410  189.387 1.00 75.99  ? 276 GLU C CB  1 
ATOM   7681  C CG  . GLU C 1 276 ? 45.935  65.410  188.301 1.00 86.57  ? 276 GLU C CG  1 
ATOM   7682  C CD  . GLU C 1 276 ? 44.716  64.933  187.442 1.00 92.44  ? 276 GLU C CD  1 
ATOM   7683  O OE1 . GLU C 1 276 ? 44.265  63.762  187.582 1.00 93.65  ? 276 GLU C OE1 1 
ATOM   7684  O OE2 . GLU C 1 276 ? 44.217  65.749  186.606 1.00 95.17  ? 276 GLU C OE2 1 
ATOM   7685  N N   . GLY C 1 277 ? 45.052  63.124  192.572 1.00 64.27  ? 277 GLY C N   1 
ATOM   7686  C CA  . GLY C 1 277 ? 45.345  62.359  193.765 1.00 54.81  ? 277 GLY C CA  1 
ATOM   7687  C C   . GLY C 1 277 ? 44.543  61.145  194.131 1.00 46.23  ? 277 GLY C C   1 
ATOM   7688  O O   . GLY C 1 277 ? 43.362  61.006  193.836 1.00 41.68  ? 277 GLY C O   1 
ATOM   7689  N N   . LEU C 1 278 ? 45.229  60.280  194.849 1.00 39.13  ? 278 LEU C N   1 
ATOM   7690  C CA  . LEU C 1 278 ? 44.668  59.049  195.294 1.00 32.23  ? 278 LEU C CA  1 
ATOM   7691  C C   . LEU C 1 278 ? 44.766  59.136  196.785 1.00 31.64  ? 278 LEU C C   1 
ATOM   7692  O O   . LEU C 1 278 ? 45.851  59.282  197.338 1.00 30.89  ? 278 LEU C O   1 
ATOM   7693  C CB  . LEU C 1 278 ? 45.530  57.925  194.800 1.00 29.09  ? 278 LEU C CB  1 
ATOM   7694  C CG  . LEU C 1 278 ? 44.769  56.626  194.725 1.00 29.80  ? 278 LEU C CG  1 
ATOM   7695  C CD1 . LEU C 1 278 ? 45.768  55.501  194.539 1.00 33.77  ? 278 LEU C CD1 1 
ATOM   7696  C CD2 . LEU C 1 278 ? 43.957  56.412  195.993 1.00 31.80  ? 278 LEU C CD2 1 
ATOM   7697  N N   . TYR C 1 279 ? 43.639  58.937  197.439 1.00 32.90  ? 279 TYR C N   1 
ATOM   7698  C CA  . TYR C 1 279 ? 43.589  59.047  198.879 1.00 34.45  ? 279 TYR C CA  1 
ATOM   7699  C C   . TYR C 1 279 ? 43.319  57.764  199.702 1.00 31.79  ? 279 TYR C C   1 
ATOM   7700  O O   . TYR C 1 279 ? 42.204  57.193  199.758 1.00 24.27  ? 279 TYR C O   1 
ATOM   7701  C CB  . TYR C 1 279 ? 42.618  60.170  199.276 1.00 43.50  ? 279 TYR C CB  1 
ATOM   7702  C CG  . TYR C 1 279 ? 42.891  61.584  198.742 1.00 43.64  ? 279 TYR C CG  1 
ATOM   7703  C CD1 . TYR C 1 279 ? 42.668  61.903  197.412 1.00 47.48  ? 279 TYR C CD1 1 
ATOM   7704  C CD2 . TYR C 1 279 ? 43.190  62.632  199.618 1.00 46.87  ? 279 TYR C CD2 1 
ATOM   7705  C CE1 . TYR C 1 279 ? 42.711  63.239  196.960 1.00 57.45  ? 279 TYR C CE1 1 
ATOM   7706  C CE2 . TYR C 1 279 ? 43.235  63.972  199.188 1.00 55.34  ? 279 TYR C CE2 1 
ATOM   7707  C CZ  . TYR C 1 279 ? 42.989  64.281  197.852 1.00 61.47  ? 279 TYR C CZ  1 
ATOM   7708  O OH  . TYR C 1 279 ? 42.990  65.617  197.415 1.00 63.18  ? 279 TYR C OH  1 
ATOM   7709  N N   . LEU C 1 280 ? 44.370  57.379  200.405 1.00 29.43  ? 280 LEU C N   1 
ATOM   7710  C CA  . LEU C 1 280 ? 44.357  56.215  201.260 1.00 31.59  ? 280 LEU C CA  1 
ATOM   7711  C C   . LEU C 1 280 ? 44.165  56.668  202.678 1.00 33.16  ? 280 LEU C C   1 
ATOM   7712  O O   . LEU C 1 280 ? 44.920  57.513  203.157 1.00 37.19  ? 280 LEU C O   1 
ATOM   7713  C CB  . LEU C 1 280 ? 45.691  55.530  201.144 1.00 27.99  ? 280 LEU C CB  1 
ATOM   7714  C CG  . LEU C 1 280 ? 45.779  55.163  199.688 1.00 27.38  ? 280 LEU C CG  1 
ATOM   7715  C CD1 . LEU C 1 280 ? 47.044  54.401  199.452 1.00 23.23  ? 280 LEU C CD1 1 
ATOM   7716  C CD2 . LEU C 1 280 ? 44.519  54.335  199.353 1.00 29.36  ? 280 LEU C CD2 1 
ATOM   7717  N N   . SER C 1 281 ? 43.250  56.022  203.384 1.00 30.83  ? 281 SER C N   1 
ATOM   7718  C CA  . SER C 1 281 ? 42.952  56.404  204.747 1.00 26.30  ? 281 SER C CA  1 
ATOM   7719  C C   . SER C 1 281 ? 42.570  55.134  205.481 1.00 28.10  ? 281 SER C C   1 
ATOM   7720  O O   . SER C 1 281 ? 41.888  54.293  204.899 1.00 26.83  ? 281 SER C O   1 
ATOM   7721  C CB  . SER C 1 281 ? 41.775  57.373  204.692 1.00 24.77  ? 281 SER C CB  1 
ATOM   7722  O OG  . SER C 1 281 ? 41.313  57.550  203.341 1.00 26.52  ? 281 SER C OG  1 
ATOM   7723  N N   . CYS C 1 282 ? 43.042  54.956  206.717 1.00 30.89  ? 282 CYS C N   1 
ATOM   7724  C CA  . CYS C 1 282 ? 42.715  53.755  207.510 1.00 34.07  ? 282 CYS C CA  1 
ATOM   7725  C C   . CYS C 1 282 ? 43.142  53.851  208.972 1.00 34.94  ? 282 CYS C C   1 
ATOM   7726  O O   . CYS C 1 282 ? 43.905  54.747  209.332 1.00 33.11  ? 282 CYS C O   1 
ATOM   7727  C CB  . CYS C 1 282 ? 43.420  52.536  206.939 1.00 37.58  ? 282 CYS C CB  1 
ATOM   7728  S SG  . CYS C 1 282 ? 45.147  52.480  207.442 1.00 44.79  ? 282 CYS C SG  1 
ATOM   7729  N N   . VAL C 1 283 ? 42.727  52.867  209.779 1.00 38.61  ? 283 VAL C N   1 
ATOM   7730  C CA  . VAL C 1 283 ? 43.061  52.788  211.221 1.00 40.21  ? 283 VAL C CA  1 
ATOM   7731  C C   . VAL C 1 283 ? 43.003  51.371  211.717 1.00 38.84  ? 283 VAL C C   1 
ATOM   7732  O O   . VAL C 1 283 ? 42.046  50.636  211.430 1.00 32.55  ? 283 VAL C O   1 
ATOM   7733  C CB  . VAL C 1 283 ? 42.071  53.522  212.092 1.00 43.73  ? 283 VAL C CB  1 
ATOM   7734  C CG1 . VAL C 1 283 ? 42.350  55.024  212.028 1.00 47.86  ? 283 VAL C CG1 1 
ATOM   7735  C CG2 . VAL C 1 283 ? 40.626  53.148  211.664 1.00 43.65  ? 283 VAL C CG2 1 
ATOM   7736  N N   . ASP C 1 284 ? 43.932  51.028  212.595 1.00 40.24  ? 284 ASP C N   1 
ATOM   7737  C CA  . ASP C 1 284 ? 43.957  49.650  213.061 1.00 42.91  ? 284 ASP C CA  1 
ATOM   7738  C C   . ASP C 1 284 ? 44.205  49.352  214.550 1.00 42.19  ? 284 ASP C C   1 
ATOM   7739  O O   . ASP C 1 284 ? 45.253  48.833  214.951 1.00 43.45  ? 284 ASP C O   1 
ATOM   7740  C CB  . ASP C 1 284 ? 44.927  48.877  212.169 1.00 43.17  ? 284 ASP C CB  1 
ATOM   7741  C CG  . ASP C 1 284 ? 44.509  48.905  210.721 1.00 41.59  ? 284 ASP C CG  1 
ATOM   7742  O OD1 . ASP C 1 284 ? 43.454  48.278  210.429 1.00 33.60  ? 284 ASP C OD1 1 
ATOM   7743  O OD2 . ASP C 1 284 ? 45.192  49.592  209.910 1.00 39.60  ? 284 ASP C OD2 1 
ATOM   7744  N N   . ILE C 1 285 ? 43.201  49.599  215.366 1.00 39.24  ? 285 ILE C N   1 
ATOM   7745  C CA  . ILE C 1 285 ? 43.345  49.352  216.768 1.00 37.83  ? 285 ILE C CA  1 
ATOM   7746  C C   . ILE C 1 285 ? 43.313  47.891  217.004 1.00 37.20  ? 285 ILE C C   1 
ATOM   7747  O O   . ILE C 1 285 ? 42.396  47.206  216.581 1.00 34.82  ? 285 ILE C O   1 
ATOM   7748  C CB  . ILE C 1 285 ? 42.213  49.906  217.511 1.00 41.96  ? 285 ILE C CB  1 
ATOM   7749  C CG1 . ILE C 1 285 ? 42.261  51.417  217.414 1.00 44.60  ? 285 ILE C CG1 1 
ATOM   7750  C CG2 . ILE C 1 285 ? 42.202  49.343  218.916 1.00 48.33  ? 285 ILE C CG2 1 
ATOM   7751  C CD1 . ILE C 1 285 ? 41.741  51.925  216.106 1.00 50.71  ? 285 ILE C CD1 1 
ATOM   7752  N N   . MET C 1 286 ? 44.255  47.432  217.791 1.00 37.80  ? 286 MET C N   1 
ATOM   7753  C CA  . MET C 1 286 ? 44.317  46.035  218.088 1.00 41.37  ? 286 MET C CA  1 
ATOM   7754  C C   . MET C 1 286 ? 43.830  45.732  219.476 1.00 45.61  ? 286 MET C C   1 
ATOM   7755  O O   . MET C 1 286 ? 43.333  44.640  219.746 1.00 46.69  ? 286 MET C O   1 
ATOM   7756  C CB  . MET C 1 286 ? 45.728  45.558  217.866 1.00 40.97  ? 286 MET C CB  1 
ATOM   7757  C CG  . MET C 1 286 ? 46.063  45.654  216.410 1.00 39.40  ? 286 MET C CG  1 
ATOM   7758  S SD  . MET C 1 286 ? 45.568  44.164  215.533 1.00 42.20  ? 286 MET C SD  1 
ATOM   7759  C CE  . MET C 1 286 ? 43.820  43.923  215.908 1.00 42.65  ? 286 MET C CE  1 
ATOM   7760  N N   . GLY C 1 287 ? 43.890  46.742  220.328 1.00 48.28  ? 287 GLY C N   1 
ATOM   7761  C CA  . GLY C 1 287 ? 43.464  46.577  221.703 1.00 51.18  ? 287 GLY C CA  1 
ATOM   7762  C C   . GLY C 1 287 ? 44.545  47.178  222.571 1.00 52.52  ? 287 GLY C C   1 
ATOM   7763  O O   . GLY C 1 287 ? 45.544  47.670  222.027 1.00 52.56  ? 287 GLY C O   1 
ATOM   7764  N N   . TRP C 1 288 ? 44.394  47.114  223.892 1.00 52.25  ? 288 TRP C N   1 
ATOM   7765  C CA  . TRP C 1 288 ? 45.382  47.695  224.771 1.00 54.55  ? 288 TRP C CA  1 
ATOM   7766  C C   . TRP C 1 288 ? 46.417  46.767  225.345 1.00 60.17  ? 288 TRP C C   1 
ATOM   7767  O O   . TRP C 1 288 ? 46.216  45.546  225.542 1.00 59.34  ? 288 TRP C O   1 
ATOM   7768  C CB  . TRP C 1 288 ? 44.742  48.507  225.886 1.00 56.95  ? 288 TRP C CB  1 
ATOM   7769  C CG  . TRP C 1 288 ? 43.296  48.297  225.972 1.00 62.69  ? 288 TRP C CG  1 
ATOM   7770  C CD1 . TRP C 1 288 ? 42.642  47.214  226.494 1.00 67.49  ? 288 TRP C CD1 1 
ATOM   7771  C CD2 . TRP C 1 288 ? 42.303  49.116  225.388 1.00 69.90  ? 288 TRP C CD2 1 
ATOM   7772  N NE1 . TRP C 1 288 ? 41.288  47.301  226.244 1.00 67.71  ? 288 TRP C NE1 1 
ATOM   7773  C CE2 . TRP C 1 288 ? 41.055  48.459  225.561 1.00 73.53  ? 288 TRP C CE2 1 
ATOM   7774  C CE3 . TRP C 1 288 ? 42.342  50.340  224.714 1.00 74.24  ? 288 TRP C CE3 1 
ATOM   7775  C CZ2 . TRP C 1 288 ? 39.872  48.978  225.078 1.00 81.46  ? 288 TRP C CZ2 1 
ATOM   7776  C CZ3 . TRP C 1 288 ? 41.166  50.866  224.227 1.00 74.83  ? 288 TRP C CZ3 1 
ATOM   7777  C CH2 . TRP C 1 288 ? 39.942  50.184  224.409 1.00 82.17  ? 288 TRP C CH2 1 
ATOM   7778  N N   . ARG C 1 289 ? 47.576  47.343  225.491 1.00 64.10  ? 289 ARG C N   1 
ATOM   7779  C CA  . ARG C 1 289 ? 48.734  46.734  226.097 1.00 71.56  ? 289 ARG C CA  1 
ATOM   7780  C C   . ARG C 1 289 ? 48.548  47.353  227.466 1.00 73.84  ? 289 ARG C C   1 
ATOM   7781  O O   . ARG C 1 289 ? 48.301  48.594  227.502 1.00 76.16  ? 289 ARG C O   1 
ATOM   7782  C CB  . ARG C 1 289 ? 50.007  47.293  225.445 1.00 77.36  ? 289 ARG C CB  1 
ATOM   7783  C CG  . ARG C 1 289 ? 51.246  47.045  226.266 1.00 83.35  ? 289 ARG C CG  1 
ATOM   7784  C CD  . ARG C 1 289 ? 52.277  48.123  226.085 1.00 88.89  ? 289 ARG C CD  1 
ATOM   7785  N NE  . ARG C 1 289 ? 53.063  48.290  227.307 1.00 95.42  ? 289 ARG C NE  1 
ATOM   7786  C CZ  . ARG C 1 289 ? 54.323  48.734  227.355 1.00 103.55 ? 289 ARG C CZ  1 
ATOM   7787  N NH1 . ARG C 1 289 ? 54.979  49.057  226.231 1.00 104.65 ? 289 ARG C NH1 1 
ATOM   7788  N NH2 . ARG C 1 289 ? 54.918  48.897  228.542 1.00 108.11 ? 289 ARG C NH2 1 
ATOM   7789  N N   . VAL C 1 290 ? 48.569  46.511  228.515 1.00 78.31  ? 290 VAL C N   1 
ATOM   7790  C CA  . VAL C 1 290 ? 48.444  46.921  229.908 1.00 85.58  ? 290 VAL C CA  1 
ATOM   7791  C C   . VAL C 1 290 ? 49.675  46.874  230.683 1.00 91.52  ? 290 VAL C C   1 
ATOM   7792  O O   . VAL C 1 290 ? 50.121  45.823  230.954 1.00 94.53  ? 290 VAL C O   1 
ATOM   7793  C CB  . VAL C 1 290 ? 47.527  46.045  230.699 1.00 84.95  ? 290 VAL C CB  1 
ATOM   7794  C CG1 . VAL C 1 290 ? 46.915  46.928  231.813 1.00 87.99  ? 290 VAL C CG1 1 
ATOM   7795  C CG2 . VAL C 1 290 ? 46.524  45.398  229.804 1.00 86.39  ? 290 VAL C CG2 1 
ATOM   7796  N N   . THR C 1 291 ? 50.152  47.992  231.191 1.00 96.71  ? 291 THR C N   1 
ATOM   7797  C CA  . THR C 1 291 ? 51.415  47.942  231.946 1.00 102.06 ? 291 THR C CA  1 
ATOM   7798  C C   . THR C 1 291 ? 51.341  47.143  233.247 1.00 109.61 ? 291 THR C C   1 
ATOM   7799  O O   . THR C 1 291 ? 50.436  47.318  234.076 1.00 108.93 ? 291 THR C O   1 
ATOM   7800  C CB  . THR C 1 291 ? 51.907  49.309  232.375 1.00 97.53  ? 291 THR C CB  1 
ATOM   7801  O OG1 . THR C 1 291 ? 50.782  50.152  232.619 1.00 91.62  ? 291 THR C OG1 1 
ATOM   7802  C CG2 . THR C 1 291 ? 52.797  49.893  231.329 1.00 96.71  ? 291 THR C CG2 1 
ATOM   7803  N N   . ARG C 1 292 ? 52.318  46.247  233.418 1.00 121.87 ? 292 ARG C N   1 
ATOM   7804  C CA  . ARG C 1 292 ? 52.455  45.518  234.652 1.00 134.55 ? 292 ARG C CA  1 
ATOM   7805  C C   . ARG C 1 292 ? 53.188  46.606  235.384 1.00 136.13 ? 292 ARG C C   1 
ATOM   7806  O O   . ARG C 1 292 ? 54.386  46.821  235.151 1.00 137.88 ? 292 ARG C O   1 
ATOM   7807  C CB  . ARG C 1 292 ? 53.373  44.313  234.485 1.00 145.65 ? 292 ARG C CB  1 
ATOM   7808  C CG  . ARG C 1 292 ? 53.658  43.550  235.758 1.00 160.69 ? 292 ARG C CG  1 
ATOM   7809  C CD  . ARG C 1 292 ? 54.767  44.229  236.522 1.00 174.62 ? 292 ARG C CD  1 
ATOM   7810  N NE  . ARG C 1 292 ? 55.596  43.299  237.294 1.00 190.19 ? 292 ARG C NE  1 
ATOM   7811  C CZ  . ARG C 1 292 ? 56.926  43.393  237.394 1.00 198.04 ? 292 ARG C CZ  1 
ATOM   7812  N NH1 . ARG C 1 292 ? 57.561  44.374  236.758 1.00 201.93 ? 292 ARG C NH1 1 
ATOM   7813  N NH2 . ARG C 1 292 ? 57.627  42.529  238.142 1.00 203.40 ? 292 ARG C NH2 1 
ATOM   7814  N N   . ASN C 1 293 ? 52.410  47.429  236.062 1.00 137.50 ? 293 ASN C N   1 
ATOM   7815  C CA  . ASN C 1 293 ? 52.938  48.536  236.830 1.00 141.85 ? 293 ASN C CA  1 
ATOM   7816  C C   . ASN C 1 293 ? 51.730  48.881  237.633 1.00 142.35 ? 293 ASN C C   1 
ATOM   7817  O O   . ASN C 1 293 ? 51.651  48.623  238.836 1.00 144.59 ? 293 ASN C O   1 
ATOM   7818  C CB  . ASN C 1 293 ? 53.310  49.701  235.883 1.00 144.06 ? 293 ASN C CB  1 
ATOM   7819  C CG  . ASN C 1 293 ? 53.022  51.084  236.482 1.00 144.44 ? 293 ASN C CG  1 
ATOM   7820  O OD1 . ASN C 1 293 ? 51.925  51.616  236.335 1.00 140.48 ? 293 ASN C OD1 1 
ATOM   7821  N ND2 . ASN C 1 293 ? 54.012  51.671  237.145 1.00 147.26 ? 293 ASN C ND2 1 
ATOM   7822  N N   . TYR C 1 294 ? 50.744  49.357  236.898 1.00 141.88 ? 294 TYR C N   1 
ATOM   7823  C CA  . TYR C 1 294 ? 49.491  49.743  237.458 1.00 139.77 ? 294 TYR C CA  1 
ATOM   7824  C C   . TYR C 1 294 ? 48.510  49.237  236.457 1.00 131.46 ? 294 TYR C C   1 
ATOM   7825  O O   . TYR C 1 294 ? 48.650  48.115  235.970 1.00 131.90 ? 294 TYR C O   1 
ATOM   7826  C CB  . TYR C 1 294 ? 49.423  51.246  237.555 1.00 149.81 ? 294 TYR C CB  1 
ATOM   7827  C CG  . TYR C 1 294 ? 48.938  51.645  238.891 1.00 166.53 ? 294 TYR C CG  1 
ATOM   7828  C CD1 . TYR C 1 294 ? 47.581  51.566  239.197 1.00 174.29 ? 294 TYR C CD1 1 
ATOM   7829  C CD2 . TYR C 1 294 ? 49.834  52.029  239.898 1.00 174.19 ? 294 TYR C CD2 1 
ATOM   7830  C CE1 . TYR C 1 294 ? 47.113  51.850  240.481 1.00 183.76 ? 294 TYR C CE1 1 
ATOM   7831  C CE2 . TYR C 1 294 ? 49.385  52.318  241.197 1.00 184.31 ? 294 TYR C CE2 1 
ATOM   7832  C CZ  . TYR C 1 294 ? 48.017  52.228  241.486 1.00 186.96 ? 294 TYR C CZ  1 
ATOM   7833  O OH  . TYR C 1 294 ? 47.545  52.509  242.765 1.00 190.89 ? 294 TYR C OH  1 
ATOM   7834  N N   . ASP C 1 295 ? 47.529  50.052  236.126 1.00 118.87 ? 295 ASP C N   1 
ATOM   7835  C CA  . ASP C 1 295 ? 46.593  49.617  235.146 1.00 108.52 ? 295 ASP C CA  1 
ATOM   7836  C C   . ASP C 1 295 ? 46.509  50.654  234.096 1.00 103.32 ? 295 ASP C C   1 
ATOM   7837  O O   . ASP C 1 295 ? 45.458  51.197  233.776 1.00 104.34 ? 295 ASP C O   1 
ATOM   7838  C CB  . ASP C 1 295 ? 45.264  49.272  235.759 1.00 106.19 ? 295 ASP C CB  1 
ATOM   7839  C CG  . ASP C 1 295 ? 45.151  47.793  236.050 1.00 105.06 ? 295 ASP C CG  1 
ATOM   7840  O OD1 . ASP C 1 295 ? 46.018  47.242  236.777 1.00 102.15 ? 295 ASP C OD1 1 
ATOM   7841  O OD2 . ASP C 1 295 ? 44.209  47.159  235.521 1.00 103.64 ? 295 ASP C OD2 1 
ATOM   7842  N N   . VAL C 1 296 ? 47.667  50.936  233.544 1.00 98.42  ? 296 VAL C N   1 
ATOM   7843  C CA  . VAL C 1 296 ? 47.723  51.910  232.497 1.00 96.23  ? 296 VAL C CA  1 
ATOM   7844  C C   . VAL C 1 296 ? 47.680  51.139  231.222 1.00 90.24  ? 296 VAL C C   1 
ATOM   7845  O O   . VAL C 1 296 ? 48.650  50.460  230.879 1.00 91.62  ? 296 VAL C O   1 
ATOM   7846  C CB  . VAL C 1 296 ? 49.024  52.663  232.456 1.00 100.88 ? 296 VAL C CB  1 
ATOM   7847  C CG1 . VAL C 1 296 ? 48.752  54.111  232.106 1.00 104.76 ? 296 VAL C CG1 1 
ATOM   7848  C CG2 . VAL C 1 296 ? 49.771  52.522  233.758 1.00 105.86 ? 296 VAL C CG2 1 
ATOM   7849  N N   . HIS C 1 297 ? 46.528  51.111  230.583 1.00 82.95  ? 297 HIS C N   1 
ATOM   7850  C CA  . HIS C 1 297 ? 46.482  50.438  229.316 1.00 79.33  ? 297 HIS C CA  1 
ATOM   7851  C C   . HIS C 1 297 ? 46.904  51.541  228.397 1.00 77.45  ? 297 HIS C C   1 
ATOM   7852  O O   . HIS C 1 297 ? 46.886  52.705  228.773 1.00 80.32  ? 297 HIS C O   1 
ATOM   7853  C CB  . HIS C 1 297 ? 45.067  50.100  228.876 1.00 80.47  ? 297 HIS C CB  1 
ATOM   7854  C CG  . HIS C 1 297 ? 44.301  49.276  229.862 1.00 82.17  ? 297 HIS C CG  1 
ATOM   7855  N ND1 . HIS C 1 297 ? 44.116  49.653  231.164 1.00 85.52  ? 297 HIS C ND1 1 
ATOM   7856  C CD2 . HIS C 1 297 ? 43.635  48.111  229.692 1.00 84.76  ? 297 HIS C CD2 1 
ATOM   7857  C CE1 . HIS C 1 297 ? 43.377  48.749  231.775 1.00 90.55  ? 297 HIS C CE1 1 
ATOM   7858  N NE2 . HIS C 1 297 ? 43.070  47.797  230.905 1.00 89.84  ? 297 HIS C NE2 1 
ATOM   7859  N N   . HIS C 1 298 ? 47.489  51.181  227.287 1.00 73.17  ? 298 HIS C N   1 
ATOM   7860  C CA  . HIS C 1 298 ? 47.748  52.177  226.299 1.00 72.27  ? 298 HIS C CA  1 
ATOM   7861  C C   . HIS C 1 298 ? 47.972  51.306  225.124 1.00 66.77  ? 298 HIS C C   1 
ATOM   7862  O O   . HIS C 1 298 ? 48.757  50.362  225.139 1.00 60.41  ? 298 HIS C O   1 
ATOM   7863  C CB  . HIS C 1 298 ? 48.810  53.198  226.656 1.00 77.94  ? 298 HIS C CB  1 
ATOM   7864  C CG  . HIS C 1 298 ? 50.044  52.617  227.246 1.00 82.25  ? 298 HIS C CG  1 
ATOM   7865  N ND1 . HIS C 1 298 ? 50.841  51.727  226.579 1.00 85.21  ? 298 HIS C ND1 1 
ATOM   7866  C CD2 . HIS C 1 298 ? 50.654  52.894  228.420 1.00 84.48  ? 298 HIS C CD2 1 
ATOM   7867  C CE1 . HIS C 1 298 ? 51.909  51.477  227.312 1.00 89.50  ? 298 HIS C CE1 1 
ATOM   7868  N NE2 . HIS C 1 298 ? 51.823  52.166  228.433 1.00 89.49  ? 298 HIS C NE2 1 
ATOM   7869  N N   . TRP C 1 299 ? 46.946  51.426  224.307 1.00 63.00  ? 299 TRP C N   1 
ATOM   7870  C CA  . TRP C 1 299 ? 46.793  50.605  223.166 1.00 58.73  ? 299 TRP C CA  1 
ATOM   7871  C C   . TRP C 1 299 ? 47.617  50.681  221.946 1.00 53.15  ? 299 TRP C C   1 
ATOM   7872  O O   . TRP C 1 299 ? 48.303  51.655  221.725 1.00 51.02  ? 299 TRP C O   1 
ATOM   7873  C CB  . TRP C 1 299 ? 45.321  50.302  222.893 1.00 70.29  ? 299 TRP C CB  1 
ATOM   7874  C CG  . TRP C 1 299 ? 44.245  51.278  222.411 1.00 77.04  ? 299 TRP C CG  1 
ATOM   7875  C CD1 . TRP C 1 299 ? 43.153  50.888  221.690 1.00 83.34  ? 299 TRP C CD1 1 
ATOM   7876  C CD2 . TRP C 1 299 ? 43.946  52.609  222.848 1.00 77.98  ? 299 TRP C CD2 1 
ATOM   7877  N NE1 . TRP C 1 299 ? 42.186  51.843  221.690 1.00 84.11  ? 299 TRP C NE1 1 
ATOM   7878  C CE2 . TRP C 1 299 ? 42.640  52.916  222.386 1.00 78.60  ? 299 TRP C CE2 1 
ATOM   7879  C CE3 . TRP C 1 299 ? 44.616  53.550  223.604 1.00 85.29  ? 299 TRP C CE3 1 
ATOM   7880  C CZ2 . TRP C 1 299 ? 42.019  54.119  222.631 1.00 83.05  ? 299 TRP C CZ2 1 
ATOM   7881  C CZ3 . TRP C 1 299 ? 43.998  54.759  223.846 1.00 92.54  ? 299 TRP C CZ3 1 
ATOM   7882  C CH2 . TRP C 1 299 ? 42.704  55.029  223.368 1.00 90.34  ? 299 TRP C CH2 1 
ATOM   7883  N N   . ARG C 1 300 ? 47.671  49.533  221.271 1.00 49.32  ? 300 ARG C N   1 
ATOM   7884  C CA  . ARG C 1 300 ? 48.462  49.340  220.061 1.00 49.01  ? 300 ARG C CA  1 
ATOM   7885  C C   . ARG C 1 300 ? 47.668  49.146  218.826 1.00 47.12  ? 300 ARG C C   1 
ATOM   7886  O O   . ARG C 1 300 ? 46.552  48.604  218.849 1.00 48.54  ? 300 ARG C O   1 
ATOM   7887  C CB  . ARG C 1 300 ? 49.380  48.118  220.170 1.00 52.62  ? 300 ARG C CB  1 
ATOM   7888  C CG  . ARG C 1 300 ? 50.253  47.869  218.931 1.00 50.69  ? 300 ARG C CG  1 
ATOM   7889  C CD  . ARG C 1 300 ? 51.426  46.960  219.255 1.00 55.68  ? 300 ARG C CD  1 
ATOM   7890  N NE  . ARG C 1 300 ? 52.347  46.743  218.135 1.00 57.06  ? 300 ARG C NE  1 
ATOM   7891  C CZ  . ARG C 1 300 ? 52.923  47.713  217.422 1.00 61.64  ? 300 ARG C CZ  1 
ATOM   7892  N NH1 . ARG C 1 300 ? 52.673  48.996  217.707 1.00 63.89  ? 300 ARG C NH1 1 
ATOM   7893  N NH2 . ARG C 1 300 ? 53.772  47.396  216.436 1.00 58.90  ? 300 ARG C NH2 1 
ATOM   7894  N N   . GLY C 1 301 ? 48.356  49.455  217.736 1.00 43.48  ? 301 GLY C N   1 
ATOM   7895  C CA  . GLY C 1 301 ? 47.800  49.329  216.418 1.00 41.48  ? 301 GLY C CA  1 
ATOM   7896  C C   . GLY C 1 301 ? 48.915  48.916  215.492 1.00 38.70  ? 301 GLY C C   1 
ATOM   7897  O O   . GLY C 1 301 ? 50.097  49.067  215.831 1.00 38.29  ? 301 GLY C O   1 
ATOM   7898  N N   . LEU C 1 302 ? 48.519  48.425  214.320 1.00 36.61  ? 302 LEU C N   1 
ATOM   7899  C CA  . LEU C 1 302 ? 49.416  47.955  213.273 1.00 31.43  ? 302 LEU C CA  1 
ATOM   7900  C C   . LEU C 1 302 ? 49.266  48.710  211.965 1.00 31.97  ? 302 LEU C C   1 
ATOM   7901  O O   . LEU C 1 302 ? 48.279  49.435  211.735 1.00 33.80  ? 302 LEU C O   1 
ATOM   7902  C CB  . LEU C 1 302 ? 49.129  46.500  212.997 1.00 27.05  ? 302 LEU C CB  1 
ATOM   7903  C CG  . LEU C 1 302 ? 49.480  45.684  214.204 1.00 24.26  ? 302 LEU C CG  1 
ATOM   7904  C CD1 . LEU C 1 302 ? 48.968  44.283  214.053 1.00 27.71  ? 302 LEU C CD1 1 
ATOM   7905  C CD2 . LEU C 1 302 ? 50.973  45.689  214.282 1.00 35.61  ? 302 LEU C CD2 1 
ATOM   7906  N N   . PRO C 1 303 ? 50.252  48.549  211.081 1.00 29.51  ? 303 PRO C N   1 
ATOM   7907  C CA  . PRO C 1 303 ? 50.258  49.206  209.773 1.00 28.82  ? 303 PRO C CA  1 
ATOM   7908  C C   . PRO C 1 303 ? 49.523  48.418  208.720 1.00 27.48  ? 303 PRO C C   1 
ATOM   7909  O O   . PRO C 1 303 ? 49.455  47.160  208.747 1.00 23.09  ? 303 PRO C O   1 
ATOM   7910  C CB  . PRO C 1 303 ? 51.743  49.305  209.442 1.00 27.97  ? 303 PRO C CB  1 
ATOM   7911  C CG  . PRO C 1 303 ? 52.248  48.007  209.976 1.00 35.78  ? 303 PRO C CG  1 
ATOM   7912  C CD  . PRO C 1 303 ? 51.528  47.861  211.332 1.00 30.50  ? 303 PRO C CD  1 
ATOM   7913  N N   . ARG C 1 304 ? 49.031  49.182  207.758 1.00 27.04  ? 304 ARG C N   1 
ATOM   7914  C CA  . ARG C 1 304 ? 48.290  48.621  206.664 1.00 25.65  ? 304 ARG C CA  1 
ATOM   7915  C C   . ARG C 1 304 ? 48.896  48.942  205.312 1.00 22.56  ? 304 ARG C C   1 
ATOM   7916  O O   . ARG C 1 304 ? 49.308  50.067  205.016 1.00 18.68  ? 304 ARG C O   1 
ATOM   7917  C CB  . ARG C 1 304 ? 46.853  49.078  206.720 1.00 24.33  ? 304 ARG C CB  1 
ATOM   7918  C CG  . ARG C 1 304 ? 46.117  48.661  205.512 1.00 29.60  ? 304 ARG C CG  1 
ATOM   7919  C CD  . ARG C 1 304 ? 44.756  49.307  205.465 1.00 41.20  ? 304 ARG C CD  1 
ATOM   7920  N NE  . ARG C 1 304 ? 43.736  48.313  205.722 1.00 47.62  ? 304 ARG C NE  1 
ATOM   7921  C CZ  . ARG C 1 304 ? 43.184  48.135  206.908 1.00 53.50  ? 304 ARG C CZ  1 
ATOM   7922  N NH1 . ARG C 1 304 ? 43.548  48.915  207.924 1.00 52.84  ? 304 ARG C NH1 1 
ATOM   7923  N NH2 . ARG C 1 304 ? 42.375  47.097  207.093 1.00 57.31  ? 304 ARG C NH2 1 
ATOM   7924  N N   . TYR C 1 305 ? 48.946  47.912  204.497 1.00 21.09  ? 305 TYR C N   1 
ATOM   7925  C CA  . TYR C 1 305 ? 49.503  48.003  203.175 1.00 22.75  ? 305 TYR C CA  1 
ATOM   7926  C C   . TYR C 1 305 ? 48.338  48.119  202.258 1.00 22.73  ? 305 TYR C C   1 
ATOM   7927  O O   . TYR C 1 305 ? 47.258  47.633  202.576 1.00 21.83  ? 305 TYR C O   1 
ATOM   7928  C CB  . TYR C 1 305 ? 50.248  46.713  202.877 1.00 26.18  ? 305 TYR C CB  1 
ATOM   7929  C CG  . TYR C 1 305 ? 50.309  46.268  201.433 1.00 31.68  ? 305 TYR C CG  1 
ATOM   7930  C CD1 . TYR C 1 305 ? 49.240  45.610  200.837 1.00 35.67  ? 305 TYR C CD1 1 
ATOM   7931  C CD2 . TYR C 1 305 ? 51.498  46.345  200.718 1.00 40.45  ? 305 TYR C CD2 1 
ATOM   7932  C CE1 . TYR C 1 305 ? 49.366  45.015  199.570 1.00 42.83  ? 305 TYR C CE1 1 
ATOM   7933  C CE2 . TYR C 1 305 ? 51.643  45.747  199.448 1.00 47.49  ? 305 TYR C CE2 1 
ATOM   7934  C CZ  . TYR C 1 305 ? 50.579  45.071  198.889 1.00 48.05  ? 305 TYR C CZ  1 
ATOM   7935  O OH  . TYR C 1 305 ? 50.774  44.333  197.738 1.00 46.92  ? 305 TYR C OH  1 
ATOM   7936  N N   . PHE C 1 306 ? 48.602  48.659  201.077 1.00 22.11  ? 306 PHE C N   1 
ATOM   7937  C CA  . PHE C 1 306 ? 47.601  48.834  200.058 1.00 21.25  ? 306 PHE C CA  1 
ATOM   7938  C C   . PHE C 1 306 ? 48.224  48.575  198.712 1.00 21.74  ? 306 PHE C C   1 
ATOM   7939  O O   . PHE C 1 306 ? 49.369  48.945  198.459 1.00 19.34  ? 306 PHE C O   1 
ATOM   7940  C CB  . PHE C 1 306 ? 47.137  50.262  200.034 1.00 24.83  ? 306 PHE C CB  1 
ATOM   7941  C CG  . PHE C 1 306 ? 46.483  50.707  201.273 1.00 28.41  ? 306 PHE C CG  1 
ATOM   7942  C CD1 . PHE C 1 306 ? 47.231  50.965  202.408 1.00 34.67  ? 306 PHE C CD1 1 
ATOM   7943  C CD2 . PHE C 1 306 ? 45.111  50.958  201.284 1.00 30.52  ? 306 PHE C CD2 1 
ATOM   7944  C CE1 . PHE C 1 306 ? 46.618  51.476  203.542 1.00 42.69  ? 306 PHE C CE1 1 
ATOM   7945  C CE2 . PHE C 1 306 ? 44.474  51.473  202.408 1.00 34.54  ? 306 PHE C CE2 1 
ATOM   7946  C CZ  . PHE C 1 306 ? 45.219  51.736  203.539 1.00 40.34  ? 306 PHE C CZ  1 
ATOM   7947  N N   . LYS C 1 307 ? 47.453  47.965  197.837 1.00 23.20  ? 307 LYS C N   1 
ATOM   7948  C CA  . LYS C 1 307 ? 47.915  47.713  196.499 1.00 26.57  ? 307 LYS C CA  1 
ATOM   7949  C C   . LYS C 1 307 ? 46.788  48.124  195.581 1.00 25.61  ? 307 LYS C C   1 
ATOM   7950  O O   . LYS C 1 307 ? 45.847  47.351  195.279 1.00 28.11  ? 307 LYS C O   1 
ATOM   7951  C CB  . LYS C 1 307 ? 48.253  46.251  196.265 1.00 35.01  ? 307 LYS C CB  1 
ATOM   7952  C CG  . LYS C 1 307 ? 48.808  46.022  194.848 1.00 45.92  ? 307 LYS C CG  1 
ATOM   7953  C CD  . LYS C 1 307 ? 48.634  44.584  194.354 1.00 58.36  ? 307 LYS C CD  1 
ATOM   7954  C CE  . LYS C 1 307 ? 49.449  44.295  193.080 1.00 63.77  ? 307 LYS C CE  1 
ATOM   7955  N NZ  . LYS C 1 307 ? 49.312  42.876  192.553 1.00 72.00  ? 307 LYS C NZ  1 
ATOM   7956  N N   . ILE C 1 308 ? 46.882  49.353  195.126 1.00 21.22  ? 308 ILE C N   1 
ATOM   7957  C CA  . ILE C 1 308 ? 45.857  49.845  194.255 1.00 21.91  ? 308 ILE C CA  1 
ATOM   7958  C C   . ILE C 1 308 ? 46.156  49.620  192.797 1.00 22.87  ? 308 ILE C C   1 
ATOM   7959  O O   . ILE C 1 308 ? 47.279  49.828  192.301 1.00 19.05  ? 308 ILE C O   1 
ATOM   7960  C CB  . ILE C 1 308 ? 45.612  51.301  194.433 1.00 20.27  ? 308 ILE C CB  1 
ATOM   7961  C CG1 . ILE C 1 308 ? 45.516  51.616  195.913 1.00 17.32  ? 308 ILE C CG1 1 
ATOM   7962  C CG2 . ILE C 1 308 ? 44.380  51.697  193.636 1.00 24.90  ? 308 ILE C CG2 1 
ATOM   7963  C CD1 . ILE C 1 308 ? 46.866  51.715  196.555 1.00 22.69  ? 308 ILE C CD1 1 
ATOM   7964  N N   . THR C 1 309 ? 45.079  49.317  192.104 1.00 24.91  ? 309 THR C N   1 
ATOM   7965  C CA  . THR C 1 309 ? 45.112  49.052  190.699 1.00 25.59  ? 309 THR C CA  1 
ATOM   7966  C C   . THR C 1 309 ? 44.252  50.178  190.129 1.00 25.81  ? 309 THR C C   1 
ATOM   7967  O O   . THR C 1 309 ? 43.098  50.384  190.569 1.00 21.57  ? 309 THR C O   1 
ATOM   7968  C CB  . THR C 1 309 ? 44.524  47.661  190.490 1.00 29.20  ? 309 THR C CB  1 
ATOM   7969  O OG1 . THR C 1 309 ? 44.586  46.934  191.746 1.00 38.18  ? 309 THR C OG1 1 
ATOM   7970  C CG2 . THR C 1 309 ? 45.335  46.900  189.472 1.00 26.30  ? 309 THR C CG2 1 
ATOM   7971  N N   . LEU C 1 310 ? 44.894  51.007  189.297 1.00 27.28  ? 310 LEU C N   1 
ATOM   7972  C CA  . LEU C 1 310 ? 44.252  52.160  188.655 1.00 27.05  ? 310 LEU C CA  1 
ATOM   7973  C C   . LEU C 1 310 ? 44.405  52.102  187.163 1.00 28.12  ? 310 LEU C C   1 
ATOM   7974  O O   . LEU C 1 310 ? 45.441  51.634  186.668 1.00 23.78  ? 310 LEU C O   1 
ATOM   7975  C CB  . LEU C 1 310 ? 44.889  53.464  189.065 1.00 25.19  ? 310 LEU C CB  1 
ATOM   7976  C CG  . LEU C 1 310 ? 45.284  53.586  190.507 1.00 30.07  ? 310 LEU C CG  1 
ATOM   7977  C CD1 . LEU C 1 310 ? 46.593  52.864  190.750 1.00 29.56  ? 310 LEU C CD1 1 
ATOM   7978  C CD2 . LEU C 1 310 ? 45.451  55.043  190.745 1.00 35.02  ? 310 LEU C CD2 1 
ATOM   7979  N N   . ARG C 1 311 ? 43.366  52.590  186.473 1.00 31.63  ? 311 ARG C N   1 
ATOM   7980  C CA  . ARG C 1 311 ? 43.299  52.663  185.010 1.00 37.15  ? 311 ARG C CA  1 
ATOM   7981  C C   . ARG C 1 311 ? 43.018  54.094  184.641 1.00 41.75  ? 311 ARG C C   1 
ATOM   7982  O O   . ARG C 1 311 ? 42.721  54.967  185.495 1.00 41.11  ? 311 ARG C O   1 
ATOM   7983  C CB  . ARG C 1 311 ? 42.170  51.824  184.424 1.00 39.33  ? 311 ARG C CB  1 
ATOM   7984  C CG  . ARG C 1 311 ? 40.775  52.271  184.875 1.00 53.85  ? 311 ARG C CG  1 
ATOM   7985  C CD  . ARG C 1 311 ? 39.642  51.402  184.284 1.00 67.88  ? 311 ARG C CD  1 
ATOM   7986  N NE  . ARG C 1 311 ? 38.320  51.746  184.839 1.00 82.76  ? 311 ARG C NE  1 
ATOM   7987  C CZ  . ARG C 1 311 ? 37.255  50.929  184.894 1.00 89.22  ? 311 ARG C CZ  1 
ATOM   7988  N NH1 . ARG C 1 311 ? 37.319  49.678  184.425 1.00 92.23  ? 311 ARG C NH1 1 
ATOM   7989  N NH2 . ARG C 1 311 ? 36.127  51.345  185.470 1.00 89.92  ? 311 ARG C NH2 1 
ATOM   7990  N N   . LYS C 1 312 ? 43.033  54.320  183.343 1.00 46.05  ? 312 LYS C N   1 
ATOM   7991  C CA  . LYS C 1 312 ? 42.817  55.655  182.863 1.00 52.63  ? 312 LYS C CA  1 
ATOM   7992  C C   . LYS C 1 312 ? 41.426  55.771  182.301 1.00 55.34  ? 312 LYS C C   1 
ATOM   7993  O O   . LYS C 1 312 ? 41.061  55.017  181.379 1.00 55.34  ? 312 LYS C O   1 
ATOM   7994  C CB  . LYS C 1 312 ? 43.835  55.956  181.774 1.00 58.70  ? 312 LYS C CB  1 
ATOM   7995  C CG  . LYS C 1 312 ? 45.299  55.745  182.167 1.00 62.21  ? 312 LYS C CG  1 
ATOM   7996  C CD  . LYS C 1 312 ? 46.184  55.967  180.954 1.00 65.94  ? 312 LYS C CD  1 
ATOM   7997  C CE  . LYS C 1 312 ? 47.621  56.220  181.307 1.00 67.93  ? 312 LYS C CE  1 
ATOM   7998  N NZ  . LYS C 1 312 ? 48.292  56.973  180.189 1.00 68.00  ? 312 LYS C NZ  1 
ATOM   7999  N N   . ARG C 1 313 ? 40.619  56.663  182.873 1.00 57.43  ? 313 ARG C N   1 
ATOM   8000  C CA  . ARG C 1 313 ? 39.286  56.806  182.323 1.00 62.09  ? 313 ARG C CA  1 
ATOM   8001  C C   . ARG C 1 313 ? 38.870  58.135  181.778 1.00 61.19  ? 313 ARG C C   1 
ATOM   8002  O O   . ARG C 1 313 ? 39.235  59.203  182.266 1.00 59.87  ? 313 ARG C O   1 
ATOM   8003  C CB  . ARG C 1 313 ? 38.169  56.276  183.219 1.00 65.58  ? 313 ARG C CB  1 
ATOM   8004  C CG  . ARG C 1 313 ? 36.931  55.939  182.365 1.00 69.15  ? 313 ARG C CG  1 
ATOM   8005  C CD  . ARG C 1 313 ? 35.655  56.186  183.087 1.00 68.35  ? 313 ARG C CD  1 
ATOM   8006  N NE  . ARG C 1 313 ? 35.467  55.207  184.144 1.00 68.62  ? 313 ARG C NE  1 
ATOM   8007  C CZ  . ARG C 1 313 ? 34.646  54.162  184.065 1.00 73.10  ? 313 ARG C CZ  1 
ATOM   8008  N NH1 . ARG C 1 313 ? 33.922  53.932  182.964 1.00 75.07  ? 313 ARG C NH1 1 
ATOM   8009  N NH2 . ARG C 1 313 ? 34.534  53.359  185.111 1.00 73.02  ? 313 ARG C NH2 1 
ATOM   8010  N N   . TRP C 1 314 ? 38.017  58.003  180.782 1.00 61.80  ? 314 TRP C N   1 
ATOM   8011  C CA  . TRP C 1 314 ? 37.445  59.078  180.051 1.00 61.80  ? 314 TRP C CA  1 
ATOM   8012  C C   . TRP C 1 314 ? 36.166  59.572  180.670 1.00 59.19  ? 314 TRP C C   1 
ATOM   8013  O O   . TRP C 1 314 ? 35.251  58.787  180.943 1.00 57.50  ? 314 TRP C O   1 
ATOM   8014  C CB  . TRP C 1 314 ? 37.179  58.533  178.689 1.00 70.60  ? 314 TRP C CB  1 
ATOM   8015  C CG  . TRP C 1 314 ? 38.413  58.444  177.899 1.00 80.30  ? 314 TRP C CG  1 
ATOM   8016  C CD1 . TRP C 1 314 ? 38.909  57.346  177.257 1.00 83.47  ? 314 TRP C CD1 1 
ATOM   8017  C CD2 . TRP C 1 314 ? 39.263  59.537  177.549 1.00 81.99  ? 314 TRP C CD2 1 
ATOM   8018  N NE1 . TRP C 1 314 ? 40.009  57.699  176.505 1.00 85.96  ? 314 TRP C NE1 1 
ATOM   8019  C CE2 . TRP C 1 314 ? 40.245  59.039  176.670 1.00 84.37  ? 314 TRP C CE2 1 
ATOM   8020  C CE3 . TRP C 1 314 ? 39.281  60.896  177.884 1.00 82.56  ? 314 TRP C CE3 1 
ATOM   8021  C CZ2 . TRP C 1 314 ? 41.232  59.851  176.123 1.00 86.10  ? 314 TRP C CZ2 1 
ATOM   8022  C CZ3 . TRP C 1 314 ? 40.261  61.703  177.337 1.00 85.02  ? 314 TRP C CZ3 1 
ATOM   8023  C CH2 . TRP C 1 314 ? 41.223  61.179  176.466 1.00 86.52  ? 314 TRP C CH2 1 
ATOM   8024  N N   . VAL C 1 315 ? 36.092  60.880  180.844 1.00 55.47  ? 315 VAL C N   1 
ATOM   8025  C CA  . VAL C 1 315 ? 34.935  61.512  181.440 1.00 58.77  ? 315 VAL C CA  1 
ATOM   8026  C C   . VAL C 1 315 ? 34.652  62.757  180.653 1.00 66.42  ? 315 VAL C C   1 
ATOM   8027  O O   . VAL C 1 315 ? 35.380  63.080  179.719 1.00 68.86  ? 315 VAL C O   1 
ATOM   8028  C CB  . VAL C 1 315 ? 35.222  61.949  182.866 1.00 52.19  ? 315 VAL C CB  1 
ATOM   8029  C CG1 . VAL C 1 315 ? 35.877  60.852  183.589 1.00 53.60  ? 315 VAL C CG1 1 
ATOM   8030  C CG2 . VAL C 1 315 ? 36.115  63.143  182.889 1.00 52.18  ? 315 VAL C CG2 1 
ATOM   8031  N N   . LYS C 1 316 ? 33.606  63.470  181.038 1.00 75.23  ? 316 LYS C N   1 
ATOM   8032  C CA  . LYS C 1 316 ? 33.263  64.703  180.371 1.00 85.08  ? 316 LYS C CA  1 
ATOM   8033  C C   . LYS C 1 316 ? 34.047  65.701  181.125 1.00 87.70  ? 316 LYS C C   1 
ATOM   8034  O O   . LYS C 1 316 ? 34.292  65.523  182.310 1.00 83.63  ? 316 LYS C O   1 
ATOM   8035  C CB  . LYS C 1 316 ? 31.802  65.035  180.550 1.00 95.15  ? 316 LYS C CB  1 
ATOM   8036  C CG  . LYS C 1 316 ? 30.883  64.368  179.566 1.00 110.68 ? 316 LYS C CG  1 
ATOM   8037  C CD  . LYS C 1 316 ? 29.446  64.722  179.939 1.00 125.47 ? 316 LYS C CD  1 
ATOM   8038  C CE  . LYS C 1 316 ? 28.433  64.335  178.852 1.00 135.12 ? 316 LYS C CE  1 
ATOM   8039  N NZ  . LYS C 1 316 ? 27.028  64.763  179.206 1.00 141.40 ? 316 LYS C NZ  1 
ATOM   8040  N N   . ASN C 1 317 ? 34.410  66.775  180.459 1.00 97.19  ? 317 ASN C N   1 
ATOM   8041  C CA  . ASN C 1 317 ? 35.190  67.793  181.124 1.00 111.23 ? 317 ASN C CA  1 
ATOM   8042  C C   . ASN C 1 317 ? 34.440  68.489  182.255 1.00 116.44 ? 317 ASN C C   1 
ATOM   8043  O O   . ASN C 1 317 ? 33.249  68.790  182.130 1.00 117.61 ? 317 ASN C O   1 
ATOM   8044  C CB  . ASN C 1 317 ? 35.687  68.831  180.122 1.00 121.24 ? 317 ASN C CB  1 
ATOM   8045  C CG  . ASN C 1 317 ? 36.463  69.968  180.791 1.00 130.19 ? 317 ASN C CG  1 
ATOM   8046  O OD1 . ASN C 1 317 ? 35.878  70.990  181.171 1.00 135.37 ? 317 ASN C OD1 1 
ATOM   8047  N ND2 . ASN C 1 317 ? 37.780  69.789  180.954 1.00 134.92 ? 317 ASN C ND2 1 
ATOM   8048  N N   . PRO C 1 318 ? 35.116  68.670  183.405 1.00 121.96 ? 318 PRO C N   1 
ATOM   8049  C CA  . PRO C 1 318 ? 34.619  69.322  184.632 1.00 129.07 ? 318 PRO C CA  1 
ATOM   8050  C C   . PRO C 1 318 ? 35.042  70.805  184.863 1.00 134.25 ? 318 PRO C C   1 
ATOM   8051  O O   . PRO C 1 318 ? 34.284  71.598  185.450 1.00 136.15 ? 318 PRO C O   1 
ATOM   8052  C CB  . PRO C 1 318 ? 35.193  68.426  185.728 1.00 127.58 ? 318 PRO C CB  1 
ATOM   8053  C CG  . PRO C 1 318 ? 36.530  68.055  185.174 1.00 124.67 ? 318 PRO C CG  1 
ATOM   8054  C CD  . PRO C 1 318 ? 36.251  67.773  183.712 1.00 121.56 ? 318 PRO C CD  1 
ATOM   8055  N N   . TYR C 1 319 ? 36.259  71.138  184.413 1.00 137.74 ? 319 TYR C N   1 
ATOM   8056  C CA  . TYR C 1 319 ? 36.905  72.459  184.548 1.00 138.79 ? 319 TYR C CA  1 
ATOM   8057  C C   . TYR C 1 319 ? 36.474  73.537  183.509 1.00 138.95 ? 319 TYR C C   1 
ATOM   8058  O O   . TYR C 1 319 ? 36.990  73.544  182.390 1.00 140.05 ? 319 TYR C O   1 
ATOM   8059  C CB  . TYR C 1 319 ? 38.446  72.263  184.463 1.00 139.66 ? 319 TYR C CB  1 
ATOM   8060  C CG  . TYR C 1 319 ? 39.065  71.293  185.484 1.00 144.44 ? 319 TYR C CG  1 
ATOM   8061  C CD1 . TYR C 1 319 ? 38.494  71.112  186.762 1.00 147.99 ? 319 TYR C CD1 1 
ATOM   8062  C CD2 . TYR C 1 319 ? 40.236  70.569  185.184 1.00 145.46 ? 319 TYR C CD2 1 
ATOM   8063  C CE1 . TYR C 1 319 ? 39.073  70.228  187.731 1.00 150.66 ? 319 TYR C CE1 1 
ATOM   8064  C CE2 . TYR C 1 319 ? 40.830  69.679  186.147 1.00 148.43 ? 319 TYR C CE2 1 
ATOM   8065  C CZ  . TYR C 1 319 ? 40.238  69.516  187.418 1.00 150.49 ? 319 TYR C CZ  1 
ATOM   8066  O OH  . TYR C 1 319 ? 40.773  68.646  188.363 1.00 147.67 ? 319 TYR C OH  1 
ATOM   8067  N N   . PRO C 1 320 ? 35.547  74.465  183.866 1.00 137.74 ? 320 PRO C N   1 
ATOM   8068  C CA  . PRO C 1 320 ? 35.126  75.501  182.902 1.00 134.36 ? 320 PRO C CA  1 
ATOM   8069  C C   . PRO C 1 320 ? 36.112  76.666  182.883 1.00 131.11 ? 320 PRO C C   1 
ATOM   8070  O O   . PRO C 1 320 ? 36.157  77.460  183.824 1.00 127.77 ? 320 PRO C O   1 
ATOM   8071  C CB  . PRO C 1 320 ? 33.768  75.966  183.449 1.00 135.20 ? 320 PRO C CB  1 
ATOM   8072  C CG  . PRO C 1 320 ? 33.344  74.847  184.393 1.00 138.01 ? 320 PRO C CG  1 
ATOM   8073  C CD  . PRO C 1 320 ? 34.656  74.480  185.034 1.00 137.04 ? 320 PRO C CD  1 
ATOM   8074  N N   . MET C 1 321 ? 36.873  76.779  181.798 1.00 130.48 ? 321 MET C N   1 
ATOM   8075  C CA  . MET C 1 321 ? 37.880  77.828  181.640 1.00 129.32 ? 321 MET C CA  1 
ATOM   8076  C C   . MET C 1 321 ? 37.284  79.194  181.807 1.00 125.81 ? 321 MET C C   1 
ATOM   8077  O O   . MET C 1 321 ? 37.996  80.161  182.059 1.00 123.48 ? 321 MET C O   1 
ATOM   8078  C CB  . MET C 1 321 ? 38.547  77.747  180.275 1.00 134.81 ? 321 MET C CB  1 
ATOM   8079  C CG  . MET C 1 321 ? 39.613  76.669  180.144 1.00 142.32 ? 321 MET C CG  1 
ATOM   8080  S SD  . MET C 1 321 ? 39.020  74.997  180.496 1.00 153.59 ? 321 MET C SD  1 
ATOM   8081  C CE  . MET C 1 321 ? 37.891  74.690  179.056 1.00 151.69 ? 321 MET C CE  1 
ATOM   8082  N N   . ALA C 1 322 ? 35.978  79.272  181.599 1.00 124.64 ? 322 ALA C N   1 
ATOM   8083  C CA  . ALA C 1 322 ? 35.245  80.510  181.766 1.00 122.73 ? 322 ALA C CA  1 
ATOM   8084  C C   . ALA C 1 322 ? 35.355  80.898  183.234 1.00 120.85 ? 322 ALA C C   1 
ATOM   8085  O O   . ALA C 1 322 ? 35.432  82.067  183.559 1.00 118.67 ? 322 ALA C O   1 
ATOM   8086  C CB  . ALA C 1 322 ? 33.799  80.313  181.387 1.00 124.73 ? 322 ALA C CB  1 
ATOM   8087  N N   . SER C 1 323 ? 35.325  79.917  184.125 1.00 118.66 ? 323 SER C N   1 
ATOM   8088  C CA  . SER C 1 323 ? 35.459  80.196  185.547 1.00 117.82 ? 323 SER C CA  1 
ATOM   8089  C C   . SER C 1 323 ? 36.807  80.876  185.728 1.00 115.64 ? 323 SER C C   1 
ATOM   8090  O O   . SER C 1 323 ? 36.892  82.001  186.203 1.00 110.26 ? 323 SER C O   1 
ATOM   8091  C CB  . SER C 1 323 ? 35.434  78.884  186.344 1.00 121.01 ? 323 SER C CB  1 
ATOM   8092  O OG  . SER C 1 323 ? 35.742  79.082  187.721 1.00 125.25 ? 323 SER C OG  1 
ATOM   8093  N N   . LEU C 1 324 ? 37.843  80.190  185.258 1.00 118.83 ? 324 LEU C N   1 
ATOM   8094  C CA  . LEU C 1 324 ? 39.223  80.648  185.335 1.00 122.78 ? 324 LEU C CA  1 
ATOM   8095  C C   . LEU C 1 324 ? 39.359  82.066  184.875 1.00 125.12 ? 324 LEU C C   1 
ATOM   8096  O O   . LEU C 1 324 ? 39.880  82.919  185.590 1.00 122.47 ? 324 LEU C O   1 
ATOM   8097  C CB  . LEU C 1 324 ? 40.105  79.795  184.431 1.00 126.36 ? 324 LEU C CB  1 
ATOM   8098  C CG  . LEU C 1 324 ? 40.495  78.399  184.905 1.00 131.56 ? 324 LEU C CG  1 
ATOM   8099  C CD1 . LEU C 1 324 ? 41.136  77.643  183.742 1.00 132.58 ? 324 LEU C CD1 1 
ATOM   8100  C CD2 . LEU C 1 324 ? 41.442  78.490  186.121 1.00 133.90 ? 324 LEU C CD2 1 
ATOM   8101  N N   . ILE C 1 325 ? 38.938  82.282  183.635 1.00 131.71 ? 325 ILE C N   1 
ATOM   8102  C CA  . ILE C 1 325 ? 38.997  83.591  182.992 1.00 139.41 ? 325 ILE C CA  1 
ATOM   8103  C C   . ILE C 1 325 ? 38.011  84.604  183.644 1.00 142.08 ? 325 ILE C C   1 
ATOM   8104  O O   . ILE C 1 325 ? 38.336  85.796  183.800 1.00 139.93 ? 325 ILE C O   1 
ATOM   8105  C CB  . ILE C 1 325 ? 38.841  83.442  181.399 1.00 140.20 ? 325 ILE C CB  1 
ATOM   8106  C CG1 . ILE C 1 325 ? 39.199  84.748  180.675 1.00 141.06 ? 325 ILE C CG1 1 
ATOM   8107  C CG2 . ILE C 1 325 ? 37.430  82.963  180.996 1.00 140.71 ? 325 ILE C CG2 1 
ATOM   8108  C CD1 . ILE C 1 325 ? 40.623  85.255  180.930 1.00 140.68 ? 325 ILE C CD1 1 
ATOM   8109  N N   . SER C 1 326 ? 36.862  84.110  184.114 1.00 145.43 ? 326 SER C N   1 
ATOM   8110  C CA  . SER C 1 326 ? 35.863  84.966  184.760 1.00 147.96 ? 326 SER C CA  1 
ATOM   8111  C C   . SER C 1 326 ? 36.024  84.993  186.287 1.00 149.28 ? 326 SER C C   1 
ATOM   8112  O O   . SER C 1 326 ? 35.172  85.498  187.039 1.00 148.05 ? 326 SER C O   1 
ATOM   8113  C CB  . SER C 1 326 ? 34.442  84.635  184.289 1.00 149.54 ? 326 SER C CB  1 
ATOM   8114  O OG  . SER C 1 326 ? 34.293  85.005  182.916 1.00 148.98 ? 326 SER C OG  1 
ATOM   8115  N N   . SER C 1 327 ? 37.156  84.439  186.717 1.00 151.48 ? 327 SER C N   1 
ATOM   8116  C CA  . SER C 1 327 ? 37.593  84.464  188.106 1.00 154.49 ? 327 SER C CA  1 
ATOM   8117  C C   . SER C 1 327 ? 38.118  85.924  188.131 1.00 154.07 ? 327 SER C C   1 
ATOM   8118  O O   . SER C 1 327 ? 38.071  86.611  189.160 1.00 154.20 ? 327 SER C O   1 
ATOM   8119  C CB  . SER C 1 327 ? 38.749  83.452  188.299 1.00 154.88 ? 327 SER C CB  1 
ATOM   8120  O OG  . SER C 1 327 ? 39.190  83.322  189.647 1.00 158.44 ? 327 SER C OG  1 
ATOM   8121  N N   . LEU C 1 328 ? 38.531  86.384  186.937 1.00 154.41 ? 328 LEU C N   1 
ATOM   8122  C CA  . LEU C 1 328 ? 39.055  87.731  186.647 1.00 153.62 ? 328 LEU C CA  1 
ATOM   8123  C C   . LEU C 1 328 ? 37.934  88.746  186.275 1.00 151.50 ? 328 LEU C C   1 
ATOM   8124  O O   . LEU C 1 328 ? 38.207  89.927  185.999 1.00 150.70 ? 328 LEU C O   1 
ATOM   8125  C CB  . LEU C 1 328 ? 40.116  87.651  185.512 1.00 155.05 ? 328 LEU C CB  1 
ATOM   8126  C CG  . LEU C 1 328 ? 41.588  87.212  185.757 1.00 156.37 ? 328 LEU C CG  1 
ATOM   8127  C CD1 . LEU C 1 328 ? 41.695  85.950  186.628 1.00 156.53 ? 328 LEU C CD1 1 
ATOM   8128  C CD2 . LEU C 1 328 ? 42.324  87.002  184.417 1.00 154.26 ? 328 LEU C CD2 1 
ATOM   8129  N N   . PHE C 1 329 ? 36.680  88.284  186.288 1.00 149.46 ? 329 PHE C N   1 
ATOM   8130  C CA  . PHE C 1 329 ? 35.529  89.136  185.981 1.00 146.91 ? 329 PHE C CA  1 
ATOM   8131  C C   . PHE C 1 329 ? 35.102  89.835  187.257 1.00 144.78 ? 329 PHE C C   1 
ATOM   8132  O O   . PHE C 1 329 ? 34.673  90.983  187.222 1.00 139.79 ? 329 PHE C O   1 
ATOM   8133  C CB  . PHE C 1 329 ? 34.357  88.320  185.417 1.00 147.91 ? 329 PHE C CB  1 
ATOM   8134  C CG  . PHE C 1 329 ? 33.836  88.826  184.085 1.00 148.98 ? 329 PHE C CG  1 
ATOM   8135  C CD1 . PHE C 1 329 ? 34.089  90.136  183.668 1.00 148.32 ? 329 PHE C CD1 1 
ATOM   8136  C CD2 . PHE C 1 329 ? 33.129  87.975  183.228 1.00 148.12 ? 329 PHE C CD2 1 
ATOM   8137  C CE1 . PHE C 1 329 ? 33.649  90.587  182.425 1.00 147.75 ? 329 PHE C CE1 1 
ATOM   8138  C CE2 . PHE C 1 329 ? 32.685  88.420  181.984 1.00 146.85 ? 329 PHE C CE2 1 
ATOM   8139  C CZ  . PHE C 1 329 ? 32.950  89.729  181.581 1.00 146.72 ? 329 PHE C CZ  1 
ATOM   8140  N N   . ASN C 1 330 ? 35.244  89.142  188.387 1.00 146.76 ? 330 ASN C N   1 
ATOM   8141  C CA  . ASN C 1 330 ? 34.903  89.707  189.697 1.00 151.81 ? 330 ASN C CA  1 
ATOM   8142  C C   . ASN C 1 330 ? 36.081  90.599  190.125 1.00 152.47 ? 330 ASN C C   1 
ATOM   8143  O O   . ASN C 1 330 ? 36.314  90.846  191.315 1.00 152.65 ? 330 ASN C O   1 
ATOM   8144  C CB  . ASN C 1 330 ? 34.647  88.590  190.738 1.00 153.70 ? 330 ASN C CB  1 
ATOM   8145  C CG  . ASN C 1 330 ? 33.669  89.017  191.868 1.00 154.79 ? 330 ASN C CG  1 
ATOM   8146  O OD1 . ASN C 1 330 ? 32.607  88.401  192.047 1.00 155.63 ? 330 ASN C OD1 1 
ATOM   8147  N ND2 . ASN C 1 330 ? 34.038  90.044  192.637 1.00 153.89 ? 330 ASN C ND2 1 
ATOM   8148  N N   . ASN C 1 331 ? 36.851  91.035  189.132 1.00 153.64 ? 331 ASN C N   1 
ATOM   8149  C CA  . ASN C 1 331 ? 37.988  91.907  189.351 1.00 156.43 ? 331 ASN C CA  1 
ATOM   8150  C C   . ASN C 1 331 ? 37.859  93.112  188.422 1.00 157.57 ? 331 ASN C C   1 
ATOM   8151  O O   . ASN C 1 331 ? 38.751  93.958  188.299 1.00 158.09 ? 331 ASN C O   1 
ATOM   8152  C CB  . ASN C 1 331 ? 39.282  91.126  189.181 1.00 160.05 ? 331 ASN C CB  1 
ATOM   8153  C CG  . ASN C 1 331 ? 39.455  90.075  190.269 1.00 162.14 ? 331 ASN C CG  1 
ATOM   8154  O OD1 . ASN C 1 331 ? 39.808  88.926  189.997 1.00 162.96 ? 331 ASN C OD1 1 
ATOM   8155  N ND2 . ASN C 1 331 ? 39.166  90.461  191.510 1.00 163.61 ? 331 ASN C ND2 1 
ATOM   8156  N N   . MET C 1 332 ? 36.703  93.147  187.766 1.00 158.53 ? 332 MET C N   1 
ATOM   8157  C CA  . MET C 1 332 ? 36.267  94.240  186.898 1.00 159.65 ? 332 MET C CA  1 
ATOM   8158  C C   . MET C 1 332 ? 35.226  94.952  187.796 1.00 158.47 ? 332 MET C C   1 
ATOM   8159  O O   . MET C 1 332 ? 34.616  95.976  187.421 1.00 161.25 ? 332 MET C O   1 
ATOM   8160  C CB  . MET C 1 332 ? 35.590  93.673  185.645 1.00 160.60 ? 332 MET C CB  1 
ATOM   8161  C CG  . MET C 1 332 ? 36.497  92.746  184.888 1.00 160.88 ? 332 MET C CG  1 
ATOM   8162  S SD  . MET C 1 332 ? 38.067  93.575  184.608 1.00 164.07 ? 332 MET C SD  1 
ATOM   8163  C CE  . MET C 1 332 ? 37.462  94.916  183.511 1.00 161.69 ? 332 MET C CE  1 
ATOM   8164  N N   . LEU C 1 333 ? 35.059  94.358  188.988 1.00 153.06 ? 333 LEU C N   1 
ATOM   8165  C CA  . LEU C 1 333 ? 34.161  94.770  190.059 1.00 142.95 ? 333 LEU C CA  1 
ATOM   8166  C C   . LEU C 1 333 ? 34.794  94.220  191.347 1.00 138.97 ? 333 LEU C C   1 
ATOM   8167  O O   . LEU C 1 333 ? 35.527  93.229  191.319 1.00 136.48 ? 333 LEU C O   1 
ATOM   8168  C CB  . LEU C 1 333 ? 32.762  94.164  189.844 1.00 137.85 ? 333 LEU C CB  1 
ATOM   8169  C CG  . LEU C 1 333 ? 32.591  92.640  189.837 1.00 134.15 ? 333 LEU C CG  1 
ATOM   8170  C CD1 . LEU C 1 333 ? 32.086  92.153  191.197 1.00 131.19 ? 333 LEU C CD1 1 
ATOM   8171  C CD2 . LEU C 1 333 ? 31.613  92.248  188.737 1.00 130.96 ? 333 LEU C CD2 1 
ATOM   8172  N N   . PRO C 1 334 ? 34.607  94.919  192.470 1.00 135.75 ? 334 PRO C N   1 
ATOM   8173  C CA  . PRO C 1 334 ? 35.186  94.441  193.726 1.00 133.95 ? 334 PRO C CA  1 
ATOM   8174  C C   . PRO C 1 334 ? 34.304  93.415  194.446 1.00 130.91 ? 334 PRO C C   1 
ATOM   8175  O O   . PRO C 1 334 ? 33.409  92.792  193.851 1.00 130.07 ? 334 PRO C O   1 
ATOM   8176  C CB  . PRO C 1 334 ? 35.306  95.733  194.539 1.00 134.56 ? 334 PRO C CB  1 
ATOM   8177  C CG  . PRO C 1 334 ? 34.085  96.493  194.114 1.00 131.78 ? 334 PRO C CG  1 
ATOM   8178  C CD  . PRO C 1 334 ? 34.113  96.302  192.611 1.00 133.24 ? 334 PRO C CD  1 
ATOM   8179  N N   . GLN C 1 335 ? 34.587  93.235  195.734 1.00 126.89 ? 335 GLN C N   1 
ATOM   8180  C CA  . GLN C 1 335 ? 33.815  92.321  196.538 1.00 119.96 ? 335 GLN C CA  1 
ATOM   8181  C C   . GLN C 1 335 ? 32.743  92.993  197.354 1.00 112.71 ? 335 GLN C C   1 
ATOM   8182  O O   . GLN C 1 335 ? 32.961  93.957  198.088 1.00 111.04 ? 335 GLN C O   1 
ATOM   8183  C CB  . GLN C 1 335 ? 34.686  91.391  197.374 1.00 124.02 ? 335 GLN C CB  1 
ATOM   8184  C CG  . GLN C 1 335 ? 34.783  90.011  196.733 1.00 131.04 ? 335 GLN C CG  1 
ATOM   8185  C CD  . GLN C 1 335 ? 33.406  89.436  196.342 1.00 134.61 ? 335 GLN C CD  1 
ATOM   8186  O OE1 . GLN C 1 335 ? 32.673  90.010  195.511 1.00 134.68 ? 335 GLN C OE1 1 
ATOM   8187  N NE2 . GLN C 1 335 ? 33.053  88.296  196.943 1.00 136.23 ? 335 GLN C NE2 1 
ATOM   8188  N N   . VAL C 1 336 ? 31.565  92.441  197.195 1.00 105.06 ? 336 VAL C N   1 
ATOM   8189  C CA  . VAL C 1 336 ? 30.397  92.954  197.831 1.00 99.20  ? 336 VAL C CA  1 
ATOM   8190  C C   . VAL C 1 336 ? 29.828  91.911  198.761 1.00 97.35  ? 336 VAL C C   1 
ATOM   8191  O O   . VAL C 1 336 ? 30.042  90.720  198.577 1.00 97.48  ? 336 VAL C O   1 
ATOM   8192  C CB  . VAL C 1 336 ? 29.400  93.322  196.747 1.00 99.80  ? 336 VAL C CB  1 
ATOM   8193  C CG1 . VAL C 1 336 ? 29.683  94.719  196.258 1.00 100.48 ? 336 VAL C CG1 1 
ATOM   8194  C CG2 . VAL C 1 336 ? 29.557  92.353  195.540 1.00 96.95  ? 336 VAL C CG2 1 
ATOM   8195  N N   . GLN C 1 337 ? 29.678  94.361  200.316 1.00 104.78 ? 337 GLN C N   1 
ATOM   8196  C CA  . GLN C 1 337 ? 29.075  93.426  201.248 1.00 107.94 ? 337 GLN C CA  1 
ATOM   8197  C C   . GLN C 1 337 ? 27.679  93.229  200.731 1.00 103.16 ? 337 GLN C C   1 
ATOM   8198  O O   . GLN C 1 337 ? 27.482  92.362  199.902 1.00 103.84 ? 337 GLN C O   1 
ATOM   8199  C CB  . GLN C 1 337 ? 28.999  94.003  202.652 1.00 121.23 ? 337 GLN C CB  1 
ATOM   8200  C CG  . GLN C 1 337 ? 30.276  94.670  203.149 1.00 145.15 ? 337 GLN C CG  1 
ATOM   8201  C CD  . GLN C 1 337 ? 30.009  95.925  204.027 1.00 157.97 ? 337 GLN C CD  1 
ATOM   8202  O OE1 . GLN C 1 337 ? 30.932  96.715  204.300 1.00 163.09 ? 337 GLN C OE1 1 
ATOM   8203  N NE2 . GLN C 1 337 ? 28.750  96.113  204.460 1.00 165.06 ? 337 GLN C NE2 1 
ATOM   8204  N N   . GLY C 1 338 ? 26.727  94.042  201.205 1.00 99.18  ? 338 GLY C N   1 
ATOM   8205  C CA  . GLY C 1 338 ? 25.328  93.950  200.765 1.00 94.71  ? 338 GLY C CA  1 
ATOM   8206  C C   . GLY C 1 338 ? 24.360  92.878  201.298 1.00 88.97  ? 338 GLY C C   1 
ATOM   8207  O O   . GLY C 1 338 ? 24.752  91.726  201.511 1.00 94.88  ? 338 GLY C O   1 
ATOM   8208  N N   . GLN C 1 339 ? 23.083  93.237  201.453 1.00 79.36  ? 339 GLN C N   1 
ATOM   8209  C CA  . GLN C 1 339 ? 22.066  92.312  201.939 1.00 70.92  ? 339 GLN C CA  1 
ATOM   8210  C C   . GLN C 1 339 ? 22.101  90.874  201.361 1.00 68.50  ? 339 GLN C C   1 
ATOM   8211  O O   . GLN C 1 339 ? 22.595  90.632  200.246 1.00 72.45  ? 339 GLN C O   1 
ATOM   8212  C CB  . GLN C 1 339 ? 20.695  92.939  201.770 1.00 71.44  ? 339 GLN C CB  1 
ATOM   8213  C CG  . GLN C 1 339 ? 20.380  93.882  202.886 1.00 78.07  ? 339 GLN C CG  1 
ATOM   8214  C CD  . GLN C 1 339 ? 18.948  94.414  202.852 1.00 86.02  ? 339 GLN C CD  1 
ATOM   8215  O OE1 . GLN C 1 339 ? 18.489  94.934  201.830 1.00 86.74  ? 339 GLN C OE1 1 
ATOM   8216  N NE2 . GLN C 1 339 ? 18.259  94.355  204.003 1.00 89.24  ? 339 GLN C NE2 1 
ATOM   8217  N N   . PRO C 1 340 ? 21.558  89.904  202.120 1.00 62.32  ? 340 PRO C N   1 
ATOM   8218  C CA  . PRO C 1 340 ? 21.427  88.456  201.905 1.00 59.12  ? 340 PRO C CA  1 
ATOM   8219  C C   . PRO C 1 340 ? 20.574  87.941  200.782 1.00 57.77  ? 340 PRO C C   1 
ATOM   8220  O O   . PRO C 1 340 ? 19.371  88.054  200.811 1.00 58.10  ? 340 PRO C O   1 
ATOM   8221  C CB  . PRO C 1 340 ? 20.827  87.996  203.211 1.00 61.45  ? 340 PRO C CB  1 
ATOM   8222  C CG  . PRO C 1 340 ? 19.956  89.147  203.570 1.00 60.74  ? 340 PRO C CG  1 
ATOM   8223  C CD  . PRO C 1 340 ? 20.904  90.271  203.381 1.00 59.37  ? 340 PRO C CD  1 
ATOM   8224  N N   . MET C 1 341 ? 21.179  87.239  199.859 1.00 60.81  ? 341 MET C N   1 
ATOM   8225  C CA  . MET C 1 341 ? 20.418  86.697  198.751 1.00 73.63  ? 341 MET C CA  1 
ATOM   8226  C C   . MET C 1 341 ? 20.946  85.281  198.572 1.00 84.67  ? 341 MET C C   1 
ATOM   8227  O O   . MET C 1 341 ? 21.057  84.731  197.454 1.00 86.81  ? 341 MET C O   1 
ATOM   8228  C CB  . MET C 1 341 ? 20.616  87.560  197.498 1.00 71.07  ? 341 MET C CB  1 
ATOM   8229  C CG  . MET C 1 341 ? 19.983  88.947  197.586 1.00 60.81  ? 341 MET C CG  1 
ATOM   8230  S SD  . MET C 1 341 ? 18.235  88.850  198.020 1.00 53.85  ? 341 MET C SD  1 
ATOM   8231  C CE  . MET C 1 341 ? 17.989  90.369  198.830 1.00 51.72  ? 341 MET C CE  1 
ATOM   8232  N N   . GLU C 1 342 ? 21.200  84.690  199.734 1.00 98.44  ? 342 GLU C N   1 
ATOM   8233  C CA  . GLU C 1 342 ? 21.758  83.354  199.879 1.00 112.96 ? 342 GLU C CA  1 
ATOM   8234  C C   . GLU C 1 342 ? 22.017  83.258  201.396 1.00 114.14 ? 342 GLU C C   1 
ATOM   8235  O O   . GLU C 1 342 ? 22.668  84.141  201.973 1.00 115.46 ? 342 GLU C O   1 
ATOM   8236  C CB  . GLU C 1 342 ? 23.082  83.299  199.099 1.00 127.77 ? 342 GLU C CB  1 
ATOM   8237  C CG  . GLU C 1 342 ? 23.811  81.951  199.051 1.00 146.64 ? 342 GLU C CG  1 
ATOM   8238  C CD  . GLU C 1 342 ? 25.214  82.048  198.399 1.00 155.48 ? 342 GLU C CD  1 
ATOM   8239  O OE1 . GLU C 1 342 ? 26.202  82.293  199.144 1.00 159.98 ? 342 GLU C OE1 1 
ATOM   8240  O OE2 . GLU C 1 342 ? 25.321  81.866  197.152 1.00 158.91 ? 342 GLU C OE2 1 
ATOM   8241  N N   . GLY C 1 343 ? 21.426  82.261  202.053 1.00 113.87 ? 343 GLY C N   1 
ATOM   8242  C CA  . GLY C 1 343 ? 21.601  82.108  203.492 1.00 113.48 ? 343 GLY C CA  1 
ATOM   8243  C C   . GLY C 1 343 ? 20.358  81.592  204.195 1.00 112.46 ? 343 GLY C C   1 
ATOM   8244  O O   . GLY C 1 343 ? 19.724  80.643  203.739 1.00 114.20 ? 343 GLY C O   1 
ATOM   8245  N N   . GLU C 1 344 ? 20.050  82.156  205.350 1.00 111.59 ? 344 GLU C N   1 
ATOM   8246  C CA  . GLU C 1 344 ? 18.857  81.750  206.079 1.00 113.95 ? 344 GLU C CA  1 
ATOM   8247  C C   . GLU C 1 344 ? 18.009  82.975  206.077 1.00 108.92 ? 344 GLU C C   1 
ATOM   8248  O O   . GLU C 1 344 ? 16.965  83.010  206.729 1.00 110.01 ? 344 GLU C O   1 
ATOM   8249  C CB  . GLU C 1 344 ? 19.141  81.483  207.552 1.00 124.76 ? 344 GLU C CB  1 
ATOM   8250  C CG  . GLU C 1 344 ? 19.754  80.152  207.942 1.00 143.10 ? 344 GLU C CG  1 
ATOM   8251  C CD  . GLU C 1 344 ? 19.999  80.070  209.466 1.00 152.34 ? 344 GLU C CD  1 
ATOM   8252  O OE1 . GLU C 1 344 ? 20.372  81.107  210.083 1.00 156.43 ? 344 GLU C OE1 1 
ATOM   8253  O OE2 . GLU C 1 344 ? 19.813  78.971  210.048 1.00 159.40 ? 344 GLU C OE2 1 
ATOM   8254  N N   . ASN C 1 345 ? 18.504  84.024  205.433 1.00 102.64 ? 345 ASN C N   1 
ATOM   8255  C CA  . ASN C 1 345 ? 17.763  85.266  205.432 1.00 100.79 ? 345 ASN C CA  1 
ATOM   8256  C C   . ASN C 1 345 ? 17.624  85.853  204.045 1.00 94.79  ? 345 ASN C C   1 
ATOM   8257  O O   . ASN C 1 345 ? 17.228  87.021  203.895 1.00 95.54  ? 345 ASN C O   1 
ATOM   8258  C CB  . ASN C 1 345 ? 18.424  86.270  206.390 1.00 107.10 ? 345 ASN C CB  1 
ATOM   8259  C CG  . ASN C 1 345 ? 18.847  85.631  207.718 1.00 110.45 ? 345 ASN C CG  1 
ATOM   8260  O OD1 . ASN C 1 345 ? 19.702  84.744  207.732 1.00 114.16 ? 345 ASN C OD1 1 
ATOM   8261  N ND2 . ASN C 1 345 ? 18.256  86.079  208.828 1.00 112.04 ? 345 ASN C ND2 1 
ATOM   8262  N N   . THR C 1 346 ? 17.924  85.026  203.043 1.00 86.01  ? 346 THR C N   1 
ATOM   8263  C CA  . THR C 1 346 ? 17.845  85.420  201.639 1.00 79.69  ? 346 THR C CA  1 
ATOM   8264  C C   . THR C 1 346 ? 16.584  86.233  201.464 1.00 72.66  ? 346 THR C C   1 
ATOM   8265  O O   . THR C 1 346 ? 15.487  85.713  201.597 1.00 75.74  ? 346 THR C O   1 
ATOM   8266  C CB  . THR C 1 346 ? 17.715  84.192  200.733 1.00 81.23  ? 346 THR C CB  1 
ATOM   8267  O OG1 . THR C 1 346 ? 18.708  83.234  201.095 1.00 90.67  ? 346 THR C OG1 1 
ATOM   8268  C CG2 . THR C 1 346 ? 17.927  84.552  199.300 1.00 82.68  ? 346 THR C CG2 1 
ATOM   8269  N N   . GLN C 1 347 ? 16.721  87.507  201.144 1.00 62.77  ? 347 GLN C N   1 
ATOM   8270  C CA  . GLN C 1 347 ? 15.550  88.331  200.983 1.00 52.22  ? 347 GLN C CA  1 
ATOM   8271  C C   . GLN C 1 347 ? 14.974  88.090  199.608 1.00 50.07  ? 347 GLN C C   1 
ATOM   8272  O O   . GLN C 1 347 ? 14.327  88.950  199.010 1.00 47.00  ? 347 GLN C O   1 
ATOM   8273  C CB  . GLN C 1 347 ? 15.931  89.755  201.232 1.00 50.25  ? 347 GLN C CB  1 
ATOM   8274  C CG  . GLN C 1 347 ? 16.834  89.818  202.408 1.00 50.38  ? 347 GLN C CG  1 
ATOM   8275  C CD  . GLN C 1 347 ? 16.834  91.150  203.053 1.00 60.24  ? 347 GLN C CD  1 
ATOM   8276  O OE1 . GLN C 1 347 ? 17.066  91.254  204.257 1.00 65.77  ? 347 GLN C OE1 1 
ATOM   8277  N NE2 . GLN C 1 347 ? 16.554  92.200  202.275 1.00 63.53  ? 347 GLN C NE2 1 
ATOM   8278  N N   . VAL C 1 348 ? 15.267  86.889  199.123 1.00 46.84  ? 348 VAL C N   1 
ATOM   8279  C CA  . VAL C 1 348 ? 14.814  86.372  197.866 1.00 47.70  ? 348 VAL C CA  1 
ATOM   8280  C C   . VAL C 1 348 ? 13.640  85.552  198.289 1.00 47.37  ? 348 VAL C C   1 
ATOM   8281  O O   . VAL C 1 348 ? 13.800  84.494  198.870 1.00 44.97  ? 348 VAL C O   1 
ATOM   8282  C CB  . VAL C 1 348 ? 15.843  85.416  197.269 1.00 48.48  ? 348 VAL C CB  1 
ATOM   8283  C CG1 . VAL C 1 348 ? 15.196  84.422  196.313 1.00 50.93  ? 348 VAL C CG1 1 
ATOM   8284  C CG2 . VAL C 1 348 ? 16.894  86.197  196.561 1.00 54.25  ? 348 VAL C CG2 1 
ATOM   8285  N N   . GLU C 1 349 ? 12.453  86.067  198.047 1.00 51.98  ? 349 GLU C N   1 
ATOM   8286  C CA  . GLU C 1 349 ? 11.258  85.333  198.415 1.00 55.58  ? 349 GLU C CA  1 
ATOM   8287  C C   . GLU C 1 349 ? 10.951  84.240  197.394 1.00 53.72  ? 349 GLU C C   1 
ATOM   8288  O O   . GLU C 1 349 ? 10.328  83.228  197.748 1.00 52.75  ? 349 GLU C O   1 
ATOM   8289  C CB  . GLU C 1 349 ? 10.041  86.260  198.456 1.00 61.11  ? 349 GLU C CB  1 
ATOM   8290  C CG  . GLU C 1 349 ? 10.152  87.516  199.301 1.00 67.26  ? 349 GLU C CG  1 
ATOM   8291  C CD  . GLU C 1 349 ? 8.823   87.842  199.971 1.00 69.76  ? 349 GLU C CD  1 
ATOM   8292  O OE1 . GLU C 1 349 ? 8.113   86.865  200.341 1.00 70.42  ? 349 GLU C OE1 1 
ATOM   8293  O OE2 . GLU C 1 349 ? 8.497   89.054  200.141 1.00 69.58  ? 349 GLU C OE2 1 
ATOM   8294  N N   . GLU C 1 350 ? 11.373  84.451  196.139 1.00 51.72  ? 350 GLU C N   1 
ATOM   8295  C CA  . GLU C 1 350 ? 11.038  83.498  195.105 1.00 50.64  ? 350 GLU C CA  1 
ATOM   8296  C C   . GLU C 1 350 ? 11.604  83.456  193.702 1.00 43.45  ? 350 GLU C C   1 
ATOM   8297  O O   . GLU C 1 350 ? 11.685  84.469  193.005 1.00 45.95  ? 350 GLU C O   1 
ATOM   8298  C CB  . GLU C 1 350 ? 9.541   83.474  194.979 1.00 61.55  ? 350 GLU C CB  1 
ATOM   8299  C CG  . GLU C 1 350 ? 9.040   82.196  195.435 1.00 83.91  ? 350 GLU C CG  1 
ATOM   8300  C CD  . GLU C 1 350 ? 9.843   81.119  194.789 1.00 100.18 ? 350 GLU C CD  1 
ATOM   8301  O OE1 . GLU C 1 350 ? 9.601   80.863  193.585 1.00 104.71 ? 350 GLU C OE1 1 
ATOM   8302  O OE2 . GLU C 1 350 ? 10.784  80.611  195.439 1.00 112.15 ? 350 GLU C OE2 1 
ATOM   8303  N N   . VAL C 1 351 ? 11.774  82.224  193.239 1.00 33.58  ? 351 VAL C N   1 
ATOM   8304  C CA  . VAL C 1 351 ? 12.303  81.926  191.938 1.00 29.84  ? 351 VAL C CA  1 
ATOM   8305  C C   . VAL C 1 351 ? 11.549  80.889  191.153 1.00 28.12  ? 351 VAL C C   1 
ATOM   8306  O O   . VAL C 1 351 ? 11.269  79.830  191.661 1.00 31.19  ? 351 VAL C O   1 
ATOM   8307  C CB  . VAL C 1 351 ? 13.687  81.307  192.099 1.00 32.28  ? 351 VAL C CB  1 
ATOM   8308  C CG1 . VAL C 1 351 ? 14.096  80.538  190.838 1.00 27.99  ? 351 VAL C CG1 1 
ATOM   8309  C CG2 . VAL C 1 351 ? 14.691  82.364  192.467 1.00 34.60  ? 351 VAL C CG2 1 
ATOM   8310  N N   . ARG C 1 352 ? 11.191  81.167  189.921 1.00 26.59  ? 352 ARG C N   1 
ATOM   8311  C CA  . ARG C 1 352 ? 10.638  80.082  189.165 1.00 29.38  ? 352 ARG C CA  1 
ATOM   8312  C C   . ARG C 1 352 ? 11.352  80.117  187.893 1.00 27.79  ? 352 ARG C C   1 
ATOM   8313  O O   . ARG C 1 352 ? 11.827  81.148  187.444 1.00 26.74  ? 352 ARG C O   1 
ATOM   8314  C CB  . ARG C 1 352 ? 9.168   80.135  188.863 1.00 38.56  ? 352 ARG C CB  1 
ATOM   8315  C CG  . ARG C 1 352 ? 8.489   81.353  189.202 1.00 61.05  ? 352 ARG C CG  1 
ATOM   8316  C CD  . ARG C 1 352 ? 8.002   81.260  190.609 1.00 79.51  ? 352 ARG C CD  1 
ATOM   8317  N NE  . ARG C 1 352 ? 7.313   82.492  190.932 1.00 95.46  ? 352 ARG C NE  1 
ATOM   8318  C CZ  . ARG C 1 352 ? 7.891   83.688  190.953 1.00 107.08 ? 352 ARG C CZ  1 
ATOM   8319  N NH1 . ARG C 1 352 ? 9.196   83.830  190.718 1.00 114.26 ? 352 ARG C NH1 1 
ATOM   8320  N NH2 . ARG C 1 352 ? 7.121   84.758  190.971 1.00 111.08 ? 352 ARG C NH2 1 
ATOM   8321  N N   . VAL C 1 353 ? 11.408  78.968  187.286 1.00 29.66  ? 353 VAL C N   1 
ATOM   8322  C CA  . VAL C 1 353 ? 12.072  78.868  186.047 1.00 32.89  ? 353 VAL C CA  1 
ATOM   8323  C C   . VAL C 1 353 ? 11.072  78.241  185.167 1.00 36.24  ? 353 VAL C C   1 
ATOM   8324  O O   . VAL C 1 353 ? 10.364  77.328  185.582 1.00 35.49  ? 353 VAL C O   1 
ATOM   8325  C CB  . VAL C 1 353 ? 13.197  77.940  186.161 1.00 34.70  ? 353 VAL C CB  1 
ATOM   8326  C CG1 . VAL C 1 353 ? 13.963  77.941  184.873 1.00 42.83  ? 353 VAL C CG1 1 
ATOM   8327  C CG2 . VAL C 1 353 ? 14.055  78.321  187.343 1.00 38.85  ? 353 VAL C CG2 1 
ATOM   8328  N N   . TYR C 1 354 ? 10.995  78.762  183.959 1.00 42.58  ? 354 TYR C N   1 
ATOM   8329  C CA  . TYR C 1 354 ? 10.069  78.276  182.965 1.00 50.83  ? 354 TYR C CA  1 
ATOM   8330  C C   . TYR C 1 354 ? 10.875  77.999  181.737 1.00 53.03  ? 354 TYR C C   1 
ATOM   8331  O O   . TYR C 1 354 ? 11.841  78.690  181.473 1.00 51.34  ? 354 TYR C O   1 
ATOM   8332  C CB  . TYR C 1 354 ? 9.106   79.377  182.540 1.00 56.40  ? 354 TYR C CB  1 
ATOM   8333  C CG  . TYR C 1 354 ? 8.311   80.055  183.617 1.00 67.03  ? 354 TYR C CG  1 
ATOM   8334  C CD1 . TYR C 1 354 ? 8.909   80.514  184.781 1.00 72.41  ? 354 TYR C CD1 1 
ATOM   8335  C CD2 . TYR C 1 354 ? 6.945   80.271  183.447 1.00 75.61  ? 354 TYR C CD2 1 
ATOM   8336  C CE1 . TYR C 1 354 ? 8.157   81.176  185.765 1.00 83.23  ? 354 TYR C CE1 1 
ATOM   8337  C CE2 . TYR C 1 354 ? 6.177   80.931  184.412 1.00 84.32  ? 354 TYR C CE2 1 
ATOM   8338  C CZ  . TYR C 1 354 ? 6.780   81.382  185.579 1.00 86.80  ? 354 TYR C CZ  1 
ATOM   8339  O OH  . TYR C 1 354 ? 5.996   81.997  186.559 1.00 90.65  ? 354 TYR C OH  1 
ATOM   8340  N N   . ASP C 1 355 ? 10.486  77.010  180.963 1.00 58.56  ? 355 ASP C N   1 
ATOM   8341  C CA  . ASP C 1 355 ? 11.200  76.812  179.732 1.00 69.62  ? 355 ASP C CA  1 
ATOM   8342  C C   . ASP C 1 355 ? 10.233  76.547  178.615 1.00 72.98  ? 355 ASP C C   1 
ATOM   8343  O O   . ASP C 1 355 ? 10.052  77.386  177.726 1.00 78.27  ? 355 ASP C O   1 
ATOM   8344  C CB  . ASP C 1 355 ? 12.240  75.710  179.801 1.00 78.16  ? 355 ASP C CB  1 
ATOM   8345  C CG  . ASP C 1 355 ? 13.027  75.574  178.488 1.00 88.32  ? 355 ASP C CG  1 
ATOM   8346  O OD1 . ASP C 1 355 ? 13.915  76.419  178.201 1.00 91.24  ? 355 ASP C OD1 1 
ATOM   8347  O OD2 . ASP C 1 355 ? 12.734  74.624  177.727 1.00 98.65  ? 355 ASP C OD2 1 
ATOM   8348  N N   . GLY C 1 356 ? 9.556   75.412  178.688 1.00 74.03  ? 356 GLY C N   1 
ATOM   8349  C CA  . GLY C 1 356 ? 8.621   75.087  177.630 1.00 77.07  ? 356 GLY C CA  1 
ATOM   8350  C C   . GLY C 1 356 ? 7.311   75.873  177.517 1.00 78.28  ? 356 GLY C C   1 
ATOM   8351  O O   . GLY C 1 356 ? 7.243   77.098  177.684 1.00 78.31  ? 356 GLY C O   1 
ATOM   8352  N N   . THR C 1 357 ? 6.245   75.115  177.279 1.00 77.87  ? 357 THR C N   1 
ATOM   8353  C CA  . THR C 1 357 ? 4.911   75.641  177.106 1.00 76.06  ? 357 THR C CA  1 
ATOM   8354  C C   . THR C 1 357 ? 3.892   74.549  177.286 1.00 74.88  ? 357 THR C C   1 
ATOM   8355  O O   . THR C 1 357 ? 3.931   73.523  176.603 1.00 78.75  ? 357 THR C O   1 
ATOM   8356  C CB  . THR C 1 357 ? 4.745   76.121  175.706 1.00 79.41  ? 357 THR C CB  1 
ATOM   8357  O OG1 . THR C 1 357 ? 5.584   77.263  175.509 1.00 85.47  ? 357 THR C OG1 1 
ATOM   8358  C CG2 . THR C 1 357 ? 3.281   76.432  175.421 1.00 84.21  ? 357 THR C CG2 1 
ATOM   8359  N N   . GLU C 1 358 ? 2.955   74.780  178.179 1.00 72.76  ? 358 GLU C N   1 
ATOM   8360  C CA  . GLU C 1 358 ? 1.920   73.806  178.400 1.00 71.14  ? 358 GLU C CA  1 
ATOM   8361  C C   . GLU C 1 358 ? 0.632   74.569  178.315 1.00 68.11  ? 358 GLU C C   1 
ATOM   8362  O O   . GLU C 1 358 ? 0.631   75.794  178.255 1.00 71.71  ? 358 GLU C O   1 
ATOM   8363  C CB  . GLU C 1 358 ? 2.053   73.215  179.788 1.00 72.40  ? 358 GLU C CB  1 
ATOM   8364  C CG  . GLU C 1 358 ? 1.772   74.213  180.881 1.00 77.64  ? 358 GLU C CG  1 
ATOM   8365  C CD  . GLU C 1 358 ? 2.349   73.782  182.207 1.00 83.16  ? 358 GLU C CD  1 
ATOM   8366  O OE1 . GLU C 1 358 ? 2.076   72.631  182.641 1.00 86.52  ? 358 GLU C OE1 1 
ATOM   8367  O OE2 . GLU C 1 358 ? 3.091   74.588  182.814 1.00 83.44  ? 358 GLU C OE2 1 
ATOM   8368  N N   . PRO C 1 359 ? -0.463  73.863  178.080 1.00 63.56  ? 359 PRO C N   1 
ATOM   8369  C CA  . PRO C 1 359 ? -1.664  74.676  178.042 1.00 58.70  ? 359 PRO C CA  1 
ATOM   8370  C C   . PRO C 1 359 ? -1.889  75.089  179.474 1.00 53.31  ? 359 PRO C C   1 
ATOM   8371  O O   . PRO C 1 359 ? -1.302  74.518  180.400 1.00 51.56  ? 359 PRO C O   1 
ATOM   8372  C CB  . PRO C 1 359 ? -2.696  73.697  177.550 1.00 61.86  ? 359 PRO C CB  1 
ATOM   8373  C CG  . PRO C 1 359 ? -1.895  72.946  176.518 1.00 65.74  ? 359 PRO C CG  1 
ATOM   8374  C CD  . PRO C 1 359 ? -0.650  72.628  177.307 1.00 64.90  ? 359 PRO C CD  1 
ATOM   8375  N N   . VAL C 1 360 ? -2.731  76.075  179.671 1.00 48.01  ? 360 VAL C N   1 
ATOM   8376  C CA  . VAL C 1 360 ? -2.955  76.530  181.001 1.00 45.83  ? 360 VAL C CA  1 
ATOM   8377  C C   . VAL C 1 360 ? -3.562  75.518  181.856 1.00 49.61  ? 360 VAL C C   1 
ATOM   8378  O O   . VAL C 1 360 ? -4.538  74.878  181.502 1.00 55.92  ? 360 VAL C O   1 
ATOM   8379  C CB  . VAL C 1 360 ? -3.958  77.555  181.123 1.00 45.47  ? 360 VAL C CB  1 
ATOM   8380  C CG1 . VAL C 1 360 ? -3.344  78.707  181.870 1.00 49.94  ? 360 VAL C CG1 1 
ATOM   8381  C CG2 . VAL C 1 360 ? -4.659  77.826  179.779 1.00 43.13  ? 360 VAL C CG2 1 
ATOM   8382  N N   . PRO C 1 361 ? -3.073  75.456  183.058 1.00 52.21  ? 361 PRO C N   1 
ATOM   8383  C CA  . PRO C 1 361 ? -3.480  74.565  184.135 1.00 59.50  ? 361 PRO C CA  1 
ATOM   8384  C C   . PRO C 1 361 ? -4.457  75.353  184.991 1.00 65.83  ? 361 PRO C C   1 
ATOM   8385  O O   . PRO C 1 361 ? -4.594  76.556  184.793 1.00 67.79  ? 361 PRO C O   1 
ATOM   8386  C CB  . PRO C 1 361 ? -2.186  74.398  184.893 1.00 60.85  ? 361 PRO C CB  1 
ATOM   8387  C CG  . PRO C 1 361 ? -1.613  75.808  184.784 1.00 59.30  ? 361 PRO C CG  1 
ATOM   8388  C CD  . PRO C 1 361 ? -1.792  76.112  183.345 1.00 49.43  ? 361 PRO C CD  1 
ATOM   8389  N N   . GLY C 1 362 ? -5.132  74.697  185.928 1.00 71.13  ? 362 GLY C N   1 
ATOM   8390  C CA  . GLY C 1 362 ? -6.023  75.421  186.818 1.00 81.92  ? 362 GLY C CA  1 
ATOM   8391  C C   . GLY C 1 362 ? -5.078  76.016  187.839 1.00 89.61  ? 362 GLY C C   1 
ATOM   8392  O O   . GLY C 1 362 ? -4.255  76.855  187.486 1.00 89.61  ? 362 GLY C O   1 
ATOM   8393  N N   . ASP C 1 363 ? -5.167  75.581  189.094 1.00 99.36  ? 363 ASP C N   1 
ATOM   8394  C CA  . ASP C 1 363 ? -4.242  76.068  190.125 1.00 108.44 ? 363 ASP C CA  1 
ATOM   8395  C C   . ASP C 1 363 ? -2.917  75.440  189.700 1.00 110.01 ? 363 ASP C C   1 
ATOM   8396  O O   . ASP C 1 363 ? -2.800  74.220  189.611 1.00 109.08 ? 363 ASP C O   1 
ATOM   8397  C CB  . ASP C 1 363 ? -4.636  75.572  191.540 1.00 114.16 ? 363 ASP C CB  1 
ATOM   8398  C CG  . ASP C 1 363 ? -4.003  76.409  192.681 1.00 118.35 ? 363 ASP C CG  1 
ATOM   8399  O OD1 . ASP C 1 363 ? -3.042  77.169  192.421 1.00 118.36 ? 363 ASP C OD1 1 
ATOM   8400  O OD2 . ASP C 1 363 ? -4.505  76.358  193.836 1.00 120.21 ? 363 ASP C OD2 1 
ATOM   8401  N N   . PRO C 1 364 ? -1.951  76.270  189.295 1.00 113.76 ? 364 PRO C N   1 
ATOM   8402  C CA  . PRO C 1 364 ? -0.630  75.812  188.855 1.00 117.04 ? 364 PRO C CA  1 
ATOM   8403  C C   . PRO C 1 364 ? 0.278   75.447  190.018 1.00 119.87 ? 364 PRO C C   1 
ATOM   8404  O O   . PRO C 1 364 ? 1.154   74.579  189.901 1.00 119.83 ? 364 PRO C O   1 
ATOM   8405  C CB  . PRO C 1 364 ? -0.098  77.021  188.104 1.00 117.29 ? 364 PRO C CB  1 
ATOM   8406  C CG  . PRO C 1 364 ? -0.663  78.165  188.898 1.00 119.06 ? 364 PRO C CG  1 
ATOM   8407  C CD  . PRO C 1 364 ? -2.086  77.732  189.157 1.00 115.48 ? 364 PRO C CD  1 
ATOM   8408  N N   . ASP C 1 365 ? 0.072   76.132  191.135 1.00 124.89 ? 365 ASP C N   1 
ATOM   8409  C CA  . ASP C 1 365 ? 0.845   75.901  192.345 1.00 131.74 ? 365 ASP C CA  1 
ATOM   8410  C C   . ASP C 1 365 ? 0.108   74.801  193.108 1.00 133.01 ? 365 ASP C C   1 
ATOM   8411  O O   . ASP C 1 365 ? -0.326  74.979  194.255 1.00 133.91 ? 365 ASP C O   1 
ATOM   8412  C CB  . ASP C 1 365 ? 0.936   77.195  193.191 1.00 136.82 ? 365 ASP C CB  1 
ATOM   8413  C CG  . ASP C 1 365 ? 1.816   78.298  192.543 1.00 140.12 ? 365 ASP C CG  1 
ATOM   8414  O OD1 . ASP C 1 365 ? 1.957   78.337  191.300 1.00 140.59 ? 365 ASP C OD1 1 
ATOM   8415  O OD2 . ASP C 1 365 ? 2.389   79.132  193.294 1.00 140.10 ? 365 ASP C OD2 1 
ATOM   8416  N N   . MET C 1 366 ? -0.038  73.656  192.452 1.00 135.39 ? 366 MET C N   1 
ATOM   8417  C CA  . MET C 1 366 ? -0.732  72.547  193.062 1.00 138.20 ? 366 MET C CA  1 
ATOM   8418  C C   . MET C 1 366 ? 0.081   71.950  194.187 1.00 140.27 ? 366 MET C C   1 
ATOM   8419  O O   . MET C 1 366 ? 1.288   71.719  194.053 1.00 141.69 ? 366 MET C O   1 
ATOM   8420  C CB  . MET C 1 366 ? -1.081  71.467  192.038 1.00 138.90 ? 366 MET C CB  1 
ATOM   8421  C CG  . MET C 1 366 ? -2.157  70.537  192.561 1.00 139.89 ? 366 MET C CG  1 
ATOM   8422  S SD  . MET C 1 366 ? -3.288  71.501  193.608 1.00 140.31 ? 366 MET C SD  1 
ATOM   8423  C CE  . MET C 1 366 ? -4.237  72.410  192.356 1.00 136.20 ? 366 MET C CE  1 
ATOM   8424  N N   . THR C 1 367 ? -0.586  71.738  195.311 1.00 142.30 ? 367 THR C N   1 
ATOM   8425  C CA  . THR C 1 367 ? 0.047   71.152  196.473 1.00 145.56 ? 367 THR C CA  1 
ATOM   8426  C C   . THR C 1 367 ? 0.346   69.701  196.135 1.00 148.35 ? 367 THR C C   1 
ATOM   8427  O O   . THR C 1 367 ? -0.455  68.798  196.388 1.00 149.33 ? 367 THR C O   1 
ATOM   8428  C CB  . THR C 1 367 ? -0.871  71.247  197.674 1.00 144.79 ? 367 THR C CB  1 
ATOM   8429  O OG1 . THR C 1 367 ? -2.212  70.942  197.267 1.00 144.01 ? 367 THR C OG1 1 
ATOM   8430  C CG2 . THR C 1 367 ? -0.808  72.658  198.259 1.00 144.08 ? 367 THR C CG2 1 
ATOM   8431  N N   . ARG C 1 368 ? 1.517   69.504  195.545 1.00 150.65 ? 368 ARG C N   1 
ATOM   8432  C CA  . ARG C 1 368 ? 1.976   68.191  195.110 1.00 152.09 ? 368 ARG C CA  1 
ATOM   8433  C C   . ARG C 1 368 ? 2.119   67.205  196.275 1.00 147.08 ? 368 ARG C C   1 
ATOM   8434  O O   . ARG C 1 368 ? 2.428   66.025  196.099 1.00 145.05 ? 368 ARG C O   1 
ATOM   8435  C CB  . ARG C 1 368 ? 3.290   68.362  194.325 1.00 161.81 ? 368 ARG C CB  1 
ATOM   8436  C CG  . ARG C 1 368 ? 3.580   67.307  193.226 1.00 173.43 ? 368 ARG C CG  1 
ATOM   8437  C CD  . ARG C 1 368 ? 2.370   66.991  192.294 1.00 182.86 ? 368 ARG C CD  1 
ATOM   8438  N NE  . ARG C 1 368 ? 1.819   68.146  191.563 1.00 190.46 ? 368 ARG C NE  1 
ATOM   8439  C CZ  . ARG C 1 368 ? 0.989   68.061  190.513 1.00 192.44 ? 368 ARG C CZ  1 
ATOM   8440  N NH1 . ARG C 1 368 ? 0.609   66.862  190.051 1.00 192.99 ? 368 ARG C NH1 1 
ATOM   8441  N NH2 . ARG C 1 368 ? 0.530   69.178  189.932 1.00 193.39 ? 368 ARG C NH2 1 
ATOM   8442  N N   . TYR C 1 369 ? 1.898   67.695  197.478 1.00 143.14 ? 369 TYR C N   1 
ATOM   8443  C CA  . TYR C 1 369 ? 1.981   66.846  198.625 1.00 141.01 ? 369 TYR C CA  1 
ATOM   8444  C C   . TYR C 1 369 ? 0.561   66.615  199.103 1.00 138.74 ? 369 TYR C C   1 
ATOM   8445  O O   . TYR C 1 369 ? -0.261  67.528  199.125 1.00 134.89 ? 369 TYR C O   1 
ATOM   8446  C CB  . TYR C 1 369 ? 2.879   67.497  199.661 1.00 145.00 ? 369 TYR C CB  1 
ATOM   8447  C CG  . TYR C 1 369 ? 4.345   67.389  199.301 1.00 149.92 ? 369 TYR C CG  1 
ATOM   8448  C CD1 . TYR C 1 369 ? 4.764   66.581  198.244 1.00 150.62 ? 369 TYR C CD1 1 
ATOM   8449  C CD2 . TYR C 1 369 ? 5.324   68.018  200.073 1.00 155.38 ? 369 TYR C CD2 1 
ATOM   8450  C CE1 . TYR C 1 369 ? 6.118   66.386  197.969 1.00 153.69 ? 369 TYR C CE1 1 
ATOM   8451  C CE2 . TYR C 1 369 ? 6.692   67.829  199.807 1.00 159.07 ? 369 TYR C CE2 1 
ATOM   8452  C CZ  . TYR C 1 369 ? 7.079   67.004  198.754 1.00 157.37 ? 369 TYR C CZ  1 
ATOM   8453  O OH  . TYR C 1 369 ? 8.416   66.762  198.513 1.00 158.44 ? 369 TYR C OH  1 
ATOM   8454  N N   . VAL C 1 370 ? 0.272   65.366  199.431 1.00 139.39 ? 370 VAL C N   1 
ATOM   8455  C CA  . VAL C 1 370 ? -1.055  64.948  199.870 1.00 141.51 ? 370 VAL C CA  1 
ATOM   8456  C C   . VAL C 1 370 ? -1.602  65.687  201.088 1.00 142.37 ? 370 VAL C C   1 
ATOM   8457  O O   . VAL C 1 370 ? -2.783  66.030  201.145 1.00 142.94 ? 370 VAL C O   1 
ATOM   8458  C CB  . VAL C 1 370 ? -1.071  63.438  200.203 1.00 144.41 ? 370 VAL C CB  1 
ATOM   8459  C CG1 . VAL C 1 370 ? -2.501  62.910  200.171 1.00 147.72 ? 370 VAL C CG1 1 
ATOM   8460  C CG2 . VAL C 1 370 ? -0.169  62.660  199.254 1.00 144.69 ? 370 VAL C CG2 1 
ATOM   8461  N N   . ASP C 1 371 ? -0.742  65.893  202.074 1.00 148.05 ? 371 ASP C N   1 
ATOM   8462  C CA  . ASP C 1 371 ? -1.135  66.551  203.313 1.00 155.15 ? 371 ASP C CA  1 
ATOM   8463  C C   . ASP C 1 371 ? -1.545  68.029  203.251 1.00 157.81 ? 371 ASP C C   1 
ATOM   8464  O O   . ASP C 1 371 ? -2.237  68.520  204.161 1.00 155.29 ? 371 ASP C O   1 
ATOM   8465  C CB  . ASP C 1 371 ? -0.082  66.316  204.419 1.00 158.61 ? 371 ASP C CB  1 
ATOM   8466  C CG  . ASP C 1 371 ? 1.369   66.304  203.899 1.00 163.57 ? 371 ASP C CG  1 
ATOM   8467  O OD1 . ASP C 1 371 ? 1.745   67.184  203.088 1.00 163.68 ? 371 ASP C OD1 1 
ATOM   8468  O OD2 . ASP C 1 371 ? 2.137   65.406  204.321 1.00 165.60 ? 371 ASP C OD2 1 
ATOM   8469  N N   . ARG C 1 372 ? -1.164  68.734  202.182 1.00 155.31 ? 372 ARG C N   1 
ATOM   8470  C CA  . ARG C 1 372 ? -1.522  70.155  202.040 1.00 153.76 ? 372 ARG C CA  1 
ATOM   8471  C C   . ARG C 1 372 ? -2.966  70.317  201.537 1.00 148.15 ? 372 ARG C C   1 
ATOM   8472  O O   . ARG C 1 372 ? -3.343  71.366  200.991 1.00 145.97 ? 372 ARG C O   1 
ATOM   8473  C CB  . ARG C 1 372 ? -0.554  70.908  201.110 1.00 154.91 ? 372 ARG C CB  1 
ATOM   8474  C CG  . ARG C 1 372 ? 0.696   70.155  200.656 1.00 160.10 ? 372 ARG C CG  1 
ATOM   8475  C CD  . ARG C 1 372 ? 1.747   70.077  201.749 1.00 166.33 ? 372 ARG C CD  1 
ATOM   8476  N NE  . ARG C 1 372 ? 2.970   70.809  201.411 1.00 174.89 ? 372 ARG C NE  1 
ATOM   8477  C CZ  . ARG C 1 372 ? 3.724   71.456  202.302 1.00 178.12 ? 372 ARG C CZ  1 
ATOM   8478  N NH1 . ARG C 1 372 ? 3.377   71.461  203.594 1.00 179.21 ? 372 ARG C NH1 1 
ATOM   8479  N NH2 . ARG C 1 372 ? 4.830   72.091  201.901 1.00 179.58 ? 372 ARG C NH2 1 
ATOM   8480  N N   . PHE C 1 373 ? -3.759  69.265  201.740 1.00 143.95 ? 373 PHE C N   1 
ATOM   8481  C CA  . PHE C 1 373 ? -5.164  69.220  201.353 1.00 138.80 ? 373 PHE C CA  1 
ATOM   8482  C C   . PHE C 1 373 ? -6.041  69.337  202.598 1.00 136.36 ? 373 PHE C C   1 
ATOM   8483  O O   . PHE C 1 373 ? -5.799  68.669  203.613 1.00 136.95 ? 373 PHE C O   1 
ATOM   8484  C CB  . PHE C 1 373 ? -5.474  67.904  200.637 1.00 134.79 ? 373 PHE C CB  1 
ATOM   8485  C CG  . PHE C 1 373 ? -5.099  67.904  199.198 1.00 132.64 ? 373 PHE C CG  1 
ATOM   8486  C CD1 . PHE C 1 373 ? -5.716  68.788  198.318 1.00 132.79 ? 373 PHE C CD1 1 
ATOM   8487  C CD2 . PHE C 1 373 ? -4.134  67.026  198.715 1.00 132.11 ? 373 PHE C CD2 1 
ATOM   8488  C CE1 . PHE C 1 373 ? -5.380  68.799  196.978 1.00 134.05 ? 373 PHE C CE1 1 
ATOM   8489  C CE2 . PHE C 1 373 ? -3.785  67.027  197.370 1.00 133.87 ? 373 PHE C CE2 1 
ATOM   8490  C CZ  . PHE C 1 373 ? -4.409  67.916  196.495 1.00 135.21 ? 373 PHE C CZ  1 
ATOM   8491  N N   . LYS D 1 17  ? 32.514  -1.936  174.124 1.00 202.00 ? 17  LYS D N   1 
ATOM   8492  C CA  . LYS D 1 17  ? 31.819  -3.010  173.406 1.00 200.82 ? 17  LYS D CA  1 
ATOM   8493  C C   . LYS D 1 17  ? 30.788  -3.743  174.306 1.00 196.67 ? 17  LYS D C   1 
ATOM   8494  O O   . LYS D 1 17  ? 29.886  -3.101  174.879 1.00 197.04 ? 17  LYS D O   1 
ATOM   8495  C CB  . LYS D 1 17  ? 32.846  -3.996  172.784 1.00 204.55 ? 17  LYS D CB  1 
ATOM   8496  C CG  . LYS D 1 17  ? 33.659  -3.459  171.563 1.00 206.41 ? 17  LYS D CG  1 
ATOM   8497  C CD  . LYS D 1 17  ? 32.808  -3.336  170.270 1.00 208.80 ? 17  LYS D CD  1 
ATOM   8498  C CE  . LYS D 1 17  ? 33.613  -2.794  169.065 1.00 209.14 ? 17  LYS D CE  1 
ATOM   8499  N NZ  . LYS D 1 17  ? 32.776  -2.580  167.828 1.00 211.12 ? 17  LYS D NZ  1 
ATOM   8500  N N   . ALA D 1 18  ? 30.907  -5.074  174.392 1.00 190.43 ? 18  ALA D N   1 
ATOM   8501  C CA  . ALA D 1 18  ? 30.017  -5.904  175.210 1.00 182.35 ? 18  ALA D CA  1 
ATOM   8502  C C   . ALA D 1 18  ? 30.206  -5.506  176.678 1.00 176.21 ? 18  ALA D C   1 
ATOM   8503  O O   . ALA D 1 18  ? 29.234  -5.295  177.425 1.00 175.89 ? 18  ALA D O   1 
ATOM   8504  C CB  . ALA D 1 18  ? 30.350  -7.406  175.001 1.00 182.51 ? 18  ALA D CB  1 
ATOM   8505  N N   . CYS D 1 19  ? 31.474  -5.371  177.061 1.00 166.61 ? 19  CYS D N   1 
ATOM   8506  C CA  . CYS D 1 19  ? 31.839  -4.995  178.414 1.00 155.39 ? 19  CYS D CA  1 
ATOM   8507  C C   . CYS D 1 19  ? 31.734  -3.490  178.620 1.00 145.61 ? 19  CYS D C   1 
ATOM   8508  O O   . CYS D 1 19  ? 32.420  -2.706  177.955 1.00 145.96 ? 19  CYS D O   1 
ATOM   8509  C CB  . CYS D 1 19  ? 33.256  -5.457  178.726 1.00 157.26 ? 19  CYS D CB  1 
ATOM   8510  S SG  . CYS D 1 19  ? 33.493  -7.260  178.881 1.00 161.20 ? 19  CYS D SG  1 
ATOM   8511  N N   . PRO D 1 20  ? 30.889  -3.071  179.569 1.00 135.31 ? 20  PRO D N   1 
ATOM   8512  C CA  . PRO D 1 20  ? 30.699  -1.653  179.864 1.00 128.00 ? 20  PRO D CA  1 
ATOM   8513  C C   . PRO D 1 20  ? 32.037  -1.113  180.317 1.00 122.75 ? 20  PRO D C   1 
ATOM   8514  O O   . PRO D 1 20  ? 32.668  -1.719  181.170 1.00 123.22 ? 20  PRO D O   1 
ATOM   8515  C CB  . PRO D 1 20  ? 29.730  -1.682  181.045 1.00 128.16 ? 20  PRO D CB  1 
ATOM   8516  C CG  . PRO D 1 20  ? 29.061  -3.023  180.940 1.00 130.34 ? 20  PRO D CG  1 
ATOM   8517  C CD  . PRO D 1 20  ? 30.182  -3.909  180.548 1.00 131.44 ? 20  PRO D CD  1 
ATOM   8518  N N   . ARG D 1 21  ? 32.511  -0.028  179.719 1.00 117.21 ? 21  ARG D N   1 
ATOM   8519  C CA  . ARG D 1 21  ? 33.781  0.533   180.148 1.00 113.87 ? 21  ARG D CA  1 
ATOM   8520  C C   . ARG D 1 21  ? 33.530  1.510   181.274 1.00 102.86 ? 21  ARG D C   1 
ATOM   8521  O O   . ARG D 1 21  ? 32.635  2.350   181.196 1.00 101.22 ? 21  ARG D O   1 
ATOM   8522  C CB  . ARG D 1 21  ? 34.546  1.206   179.005 1.00 128.40 ? 21  ARG D CB  1 
ATOM   8523  C CG  . ARG D 1 21  ? 33.826  2.336   178.287 1.00 148.96 ? 21  ARG D CG  1 
ATOM   8524  C CD  . ARG D 1 21  ? 32.982  1.817   177.106 1.00 168.08 ? 21  ARG D CD  1 
ATOM   8525  N NE  . ARG D 1 21  ? 31.556  1.606   177.421 1.00 186.46 ? 21  ARG D NE  1 
ATOM   8526  C CZ  . ARG D 1 21  ? 30.585  2.504   177.206 1.00 193.50 ? 21  ARG D CZ  1 
ATOM   8527  N NH1 . ARG D 1 21  ? 30.876  3.693   176.671 1.00 198.32 ? 21  ARG D NH1 1 
ATOM   8528  N NH2 . ARG D 1 21  ? 29.315  2.212   177.513 1.00 198.20 ? 21  ARG D NH2 1 
ATOM   8529  N N   . PRO D 1 22  ? 34.267  1.357   182.374 1.00 94.30  ? 22  PRO D N   1 
ATOM   8530  C CA  . PRO D 1 22  ? 34.131  2.220   183.529 1.00 89.40  ? 22  PRO D CA  1 
ATOM   8531  C C   . PRO D 1 22  ? 34.530  3.586   183.104 1.00 85.48  ? 22  PRO D C   1 
ATOM   8532  O O   . PRO D 1 22  ? 35.036  3.814   182.000 1.00 87.02  ? 22  PRO D O   1 
ATOM   8533  C CB  . PRO D 1 22  ? 35.182  1.685   184.485 1.00 88.81  ? 22  PRO D CB  1 
ATOM   8534  C CG  . PRO D 1 22  ? 35.305  0.321   184.123 1.00 92.97  ? 22  PRO D CG  1 
ATOM   8535  C CD  . PRO D 1 22  ? 35.317  0.374   182.628 1.00 94.98  ? 22  PRO D CD  1 
ATOM   8536  N N   . ALA D 1 23  ? 34.415  4.477   184.058 1.00 80.28  ? 23  ALA D N   1 
ATOM   8537  C CA  . ALA D 1 23  ? 34.740  5.847   183.823 1.00 74.13  ? 23  ALA D CA  1 
ATOM   8538  C C   . ALA D 1 23  ? 36.214  6.054   183.675 1.00 68.95  ? 23  ALA D C   1 
ATOM   8539  O O   . ALA D 1 23  ? 37.024  5.231   184.074 1.00 67.96  ? 23  ALA D O   1 
ATOM   8540  C CB  . ALA D 1 23  ? 34.236  6.676   184.974 1.00 84.63  ? 23  ALA D CB  1 
ATOM   8541  N N   . PRO D 1 24  ? 36.573  7.188   183.107 1.00 63.30  ? 24  PRO D N   1 
ATOM   8542  C CA  . PRO D 1 24  ? 37.937  7.618   182.873 1.00 59.52  ? 24  PRO D CA  1 
ATOM   8543  C C   . PRO D 1 24  ? 38.293  8.350   184.117 1.00 55.01  ? 24  PRO D C   1 
ATOM   8544  O O   . PRO D 1 24  ? 37.456  8.927   184.830 1.00 54.51  ? 24  PRO D O   1 
ATOM   8545  C CB  . PRO D 1 24  ? 37.811  8.637   181.761 1.00 63.15  ? 24  PRO D CB  1 
ATOM   8546  C CG  . PRO D 1 24  ? 36.395  8.477   181.289 1.00 70.50  ? 24  PRO D CG  1 
ATOM   8547  C CD  . PRO D 1 24  ? 35.637  8.115   182.482 1.00 63.68  ? 24  PRO D CD  1 
ATOM   8548  N N   . VAL D 1 25  ? 39.576  8.447   184.290 1.00 50.88  ? 25  VAL D N   1 
ATOM   8549  C CA  . VAL D 1 25  ? 40.096  9.066   185.447 1.00 47.37  ? 25  VAL D CA  1 
ATOM   8550  C C   . VAL D 1 25  ? 41.557  9.003   185.094 1.00 49.97  ? 25  VAL D C   1 
ATOM   8551  O O   . VAL D 1 25  ? 41.965  8.238   184.230 1.00 52.16  ? 25  VAL D O   1 
ATOM   8552  C CB  . VAL D 1 25  ? 39.707  8.195   186.656 1.00 41.96  ? 25  VAL D CB  1 
ATOM   8553  C CG1 . VAL D 1 25  ? 39.613  6.738   186.244 1.00 39.62  ? 25  VAL D CG1 1 
ATOM   8554  C CG2 . VAL D 1 25  ? 40.696  8.336   187.765 1.00 45.51  ? 25  VAL D CG2 1 
ATOM   8555  N N   . PRO D 1 26  ? 42.343  9.908   185.631 1.00 51.67  ? 26  PRO D N   1 
ATOM   8556  C CA  . PRO D 1 26  ? 43.770  9.938   185.358 1.00 57.41  ? 26  PRO D CA  1 
ATOM   8557  C C   . PRO D 1 26  ? 44.475  8.627   185.623 1.00 60.86  ? 26  PRO D C   1 
ATOM   8558  O O   . PRO D 1 26  ? 44.218  7.932   186.618 1.00 62.80  ? 26  PRO D O   1 
ATOM   8559  C CB  . PRO D 1 26  ? 44.270  10.997  186.322 1.00 60.06  ? 26  PRO D CB  1 
ATOM   8560  C CG  . PRO D 1 26  ? 43.268  10.916  187.444 1.00 59.39  ? 26  PRO D CG  1 
ATOM   8561  C CD  . PRO D 1 26  ? 42.002  10.903  186.641 1.00 52.92  ? 26  PRO D CD  1 
ATOM   8562  N N   . LYS D 1 27  ? 45.419  8.344   184.741 1.00 60.64  ? 27  LYS D N   1 
ATOM   8563  C CA  . LYS D 1 27  ? 46.212  7.152   184.828 1.00 58.57  ? 27  LYS D CA  1 
ATOM   8564  C C   . LYS D 1 27  ? 47.387  7.438   185.711 1.00 52.30  ? 27  LYS D C   1 
ATOM   8565  O O   . LYS D 1 27  ? 48.216  8.300   185.385 1.00 45.38  ? 27  LYS D O   1 
ATOM   8566  C CB  . LYS D 1 27  ? 46.759  6.785   183.465 1.00 69.67  ? 27  LYS D CB  1 
ATOM   8567  C CG  . LYS D 1 27  ? 46.133  5.586   182.821 1.00 84.61  ? 27  LYS D CG  1 
ATOM   8568  C CD  . LYS D 1 27  ? 46.919  5.187   181.565 1.00 102.31 ? 27  LYS D CD  1 
ATOM   8569  C CE  . LYS D 1 27  ? 48.363  4.753   181.882 1.00 112.01 ? 27  LYS D CE  1 
ATOM   8570  N NZ  . LYS D 1 27  ? 49.187  4.632   180.632 1.00 122.51 ? 27  LYS D NZ  1 
ATOM   8571  N N   . LEU D 1 28  ? 47.431  6.775   186.858 1.00 49.53  ? 28  LEU D N   1 
ATOM   8572  C CA  . LEU D 1 28  ? 48.589  6.954   187.685 1.00 50.74  ? 28  LEU D CA  1 
ATOM   8573  C C   . LEU D 1 28  ? 49.678  6.334   186.857 1.00 50.63  ? 28  LEU D C   1 
ATOM   8574  O O   . LEU D 1 28  ? 49.477  5.368   186.128 1.00 52.07  ? 28  LEU D O   1 
ATOM   8575  C CB  . LEU D 1 28  ? 48.532  6.201   189.007 1.00 50.49  ? 28  LEU D CB  1 
ATOM   8576  C CG  . LEU D 1 28  ? 49.991  6.152   189.522 1.00 48.86  ? 28  LEU D CG  1 
ATOM   8577  C CD1 . LEU D 1 28  ? 50.432  7.471   190.148 1.00 50.19  ? 28  LEU D CD1 1 
ATOM   8578  C CD2 . LEU D 1 28  ? 50.188  5.034   190.474 1.00 53.38  ? 28  LEU D CD2 1 
ATOM   8579  N N   . LEU D 1 29  ? 50.845  6.900   186.955 1.00 50.46  ? 29  LEU D N   1 
ATOM   8580  C CA  . LEU D 1 29  ? 51.915  6.346   186.221 1.00 46.87  ? 29  LEU D CA  1 
ATOM   8581  C C   . LEU D 1 29  ? 52.820  5.664   187.139 1.00 40.39  ? 29  LEU D C   1 
ATOM   8582  O O   . LEU D 1 29  ? 53.355  4.605   186.857 1.00 38.37  ? 29  LEU D O   1 
ATOM   8583  C CB  . LEU D 1 29  ? 52.683  7.444   185.574 1.00 55.68  ? 29  LEU D CB  1 
ATOM   8584  C CG  . LEU D 1 29  ? 52.146  7.286   184.191 1.00 67.42  ? 29  LEU D CG  1 
ATOM   8585  C CD1 . LEU D 1 29  ? 52.785  8.361   183.369 1.00 79.69  ? 29  LEU D CD1 1 
ATOM   8586  C CD2 . LEU D 1 29  ? 52.465  5.847   183.681 1.00 74.03  ? 29  LEU D CD2 1 
ATOM   8587  N N   . ILE D 1 30  ? 52.943  6.257   188.294 1.00 32.81  ? 30  ILE D N   1 
ATOM   8588  C CA  . ILE D 1 30  ? 53.884  5.734   189.184 1.00 28.47  ? 30  ILE D CA  1 
ATOM   8589  C C   . ILE D 1 30  ? 53.677  6.431   190.475 1.00 30.69  ? 30  ILE D C   1 
ATOM   8590  O O   . ILE D 1 30  ? 53.391  7.630   190.530 1.00 30.38  ? 30  ILE D O   1 
ATOM   8591  C CB  . ILE D 1 30  ? 55.221  6.061   188.625 1.00 26.99  ? 30  ILE D CB  1 
ATOM   8592  C CG1 . ILE D 1 30  ? 56.284  5.810   189.653 1.00 30.85  ? 30  ILE D CG1 1 
ATOM   8593  C CG2 . ILE D 1 30  ? 55.228  7.493   188.152 1.00 23.57  ? 30  ILE D CG2 1 
ATOM   8594  C CD1 . ILE D 1 30  ? 57.609  6.388   189.232 1.00 36.90  ? 30  ILE D CD1 1 
ATOM   8595  N N   . LYS D 1 31  ? 53.741  5.627   191.507 1.00 33.52  ? 31  LYS D N   1 
ATOM   8596  C CA  . LYS D 1 31  ? 53.569  6.079   192.842 1.00 38.67  ? 31  LYS D CA  1 
ATOM   8597  C C   . LYS D 1 31  ? 54.906  5.742   193.389 1.00 41.12  ? 31  LYS D C   1 
ATOM   8598  O O   . LYS D 1 31  ? 55.618  4.904   192.831 1.00 38.22  ? 31  LYS D O   1 
ATOM   8599  C CB  . LYS D 1 31  ? 52.490  5.230   193.512 1.00 45.18  ? 31  LYS D CB  1 
ATOM   8600  C CG  . LYS D 1 31  ? 52.211  5.470   195.002 1.00 52.70  ? 31  LYS D CG  1 
ATOM   8601  C CD  . LYS D 1 31  ? 50.739  5.053   195.358 1.00 64.72  ? 31  LYS D CD  1 
ATOM   8602  C CE  . LYS D 1 31  ? 50.612  3.856   196.368 1.00 75.43  ? 31  LYS D CE  1 
ATOM   8603  N NZ  . LYS D 1 31  ? 49.192  3.289   196.566 1.00 76.70  ? 31  LYS D NZ  1 
ATOM   8604  N N   . GLY D 1 32  ? 55.251  6.430   194.460 1.00 47.38  ? 32  GLY D N   1 
ATOM   8605  C CA  . GLY D 1 32  ? 56.507  6.217   195.142 1.00 55.79  ? 32  GLY D CA  1 
ATOM   8606  C C   . GLY D 1 32  ? 56.916  7.520   195.800 1.00 58.97  ? 32  GLY D C   1 
ATOM   8607  O O   . GLY D 1 32  ? 56.058  8.312   196.183 1.00 65.31  ? 32  GLY D O   1 
ATOM   8608  N N   . GLY D 1 33  ? 58.214  7.766   195.903 1.00 58.64  ? 33  GLY D N   1 
ATOM   8609  C CA  . GLY D 1 33  ? 58.685  8.987   196.530 1.00 57.17  ? 33  GLY D CA  1 
ATOM   8610  C C   . GLY D 1 33  ? 59.289  9.962   195.547 1.00 56.23  ? 33  GLY D C   1 
ATOM   8611  O O   . GLY D 1 33  ? 58.975  9.922   194.363 1.00 55.53  ? 33  GLY D O   1 
ATOM   8612  N N   . MET D 1 34  ? 60.196  10.806  196.028 1.00 55.22  ? 34  MET D N   1 
ATOM   8613  C CA  . MET D 1 34  ? 60.824  11.803  195.175 1.00 54.22  ? 34  MET D CA  1 
ATOM   8614  C C   . MET D 1 34  ? 61.484  11.191  193.948 1.00 50.71  ? 34  MET D C   1 
ATOM   8615  O O   . MET D 1 34  ? 61.446  11.743  192.861 1.00 47.59  ? 34  MET D O   1 
ATOM   8616  C CB  . MET D 1 34  ? 61.791  12.656  195.994 1.00 60.81  ? 34  MET D CB  1 
ATOM   8617  C CG  . MET D 1 34  ? 61.072  13.602  196.947 1.00 62.36  ? 34  MET D CG  1 
ATOM   8618  S SD  . MET D 1 34  ? 59.922  14.695  196.041 1.00 64.08  ? 34  MET D SD  1 
ATOM   8619  C CE  . MET D 1 34  ? 61.066  15.982  195.445 1.00 64.45  ? 34  MET D CE  1 
ATOM   8620  N N   . GLU D 1 35  ? 62.039  10.016  194.120 1.00 50.04  ? 35  GLU D N   1 
ATOM   8621  C CA  . GLU D 1 35  ? 62.655  9.325   193.021 1.00 56.21  ? 35  GLU D CA  1 
ATOM   8622  C C   . GLU D 1 35  ? 61.628  9.141   191.901 1.00 57.60  ? 35  GLU D C   1 
ATOM   8623  O O   . GLU D 1 35  ? 61.953  9.153   190.724 1.00 61.10  ? 35  GLU D O   1 
ATOM   8624  C CB  . GLU D 1 35  ? 63.102  7.959   193.489 1.00 62.62  ? 35  GLU D CB  1 
ATOM   8625  C CG  . GLU D 1 35  ? 61.940  6.978   193.717 1.00 72.20  ? 35  GLU D CG  1 
ATOM   8626  C CD  . GLU D 1 35  ? 61.311  7.090   195.092 1.00 77.00  ? 35  GLU D CD  1 
ATOM   8627  O OE1 . GLU D 1 35  ? 61.594  8.080   195.808 1.00 80.33  ? 35  GLU D OE1 1 
ATOM   8628  O OE2 . GLU D 1 35  ? 60.540  6.172   195.466 1.00 80.37  ? 35  GLU D OE2 1 
ATOM   8629  N N   . VAL D 1 36  ? 60.383  8.914   192.272 1.00 58.95  ? 36  VAL D N   1 
ATOM   8630  C CA  . VAL D 1 36  ? 59.343  8.720   191.286 1.00 62.12  ? 36  VAL D CA  1 
ATOM   8631  C C   . VAL D 1 36  ? 59.408  9.815   190.217 1.00 66.79  ? 36  VAL D C   1 
ATOM   8632  O O   . VAL D 1 36  ? 59.307  9.514   189.033 1.00 67.72  ? 36  VAL D O   1 
ATOM   8633  C CB  . VAL D 1 36  ? 57.961  8.643   192.006 1.00 61.29  ? 36  VAL D CB  1 
ATOM   8634  C CG1 . VAL D 1 36  ? 56.795  8.846   191.072 1.00 61.61  ? 36  VAL D CG1 1 
ATOM   8635  C CG2 . VAL D 1 36  ? 57.833  7.318   192.644 1.00 58.82  ? 36  VAL D CG2 1 
ATOM   8636  N N   . LEU D 1 37  ? 59.744  11.036  190.638 1.00 70.02  ? 37  LEU D N   1 
ATOM   8637  C CA  . LEU D 1 37  ? 59.820  12.221  189.774 1.00 77.30  ? 37  LEU D CA  1 
ATOM   8638  C C   . LEU D 1 37  ? 60.545  12.062  188.474 1.00 83.64  ? 37  LEU D C   1 
ATOM   8639  O O   . LEU D 1 37  ? 60.107  12.543  187.417 1.00 87.87  ? 37  LEU D O   1 
ATOM   8640  C CB  . LEU D 1 37  ? 60.559  13.331  190.490 1.00 76.62  ? 37  LEU D CB  1 
ATOM   8641  C CG  . LEU D 1 37  ? 59.807  14.374  191.292 1.00 80.90  ? 37  LEU D CG  1 
ATOM   8642  C CD1 . LEU D 1 37  ? 58.968  13.680  192.321 1.00 84.88  ? 37  LEU D CD1 1 
ATOM   8643  C CD2 . LEU D 1 37  ? 60.812  15.315  191.971 1.00 85.65  ? 37  LEU D CD2 1 
ATOM   8644  N N   . ASP D 1 38  ? 61.736  11.513  188.636 1.00 89.98  ? 38  ASP D N   1 
ATOM   8645  C CA  . ASP D 1 38  ? 62.729  11.277  187.598 1.00 96.55  ? 38  ASP D CA  1 
ATOM   8646  C C   . ASP D 1 38  ? 62.358  10.681  186.276 1.00 95.37  ? 38  ASP D C   1 
ATOM   8647  O O   . ASP D 1 38  ? 62.849  11.144  185.240 1.00 97.12  ? 38  ASP D O   1 
ATOM   8648  C CB  . ASP D 1 38  ? 63.875  10.486  188.188 1.00 108.57 ? 38  ASP D CB  1 
ATOM   8649  C CG  . ASP D 1 38  ? 64.472  11.181  189.380 1.00 124.20 ? 38  ASP D CG  1 
ATOM   8650  O OD1 . ASP D 1 38  ? 63.745  11.358  190.395 1.00 134.03 ? 38  ASP D OD1 1 
ATOM   8651  O OD2 . ASP D 1 38  ? 65.649  11.600  189.287 1.00 131.56 ? 38  ASP D OD2 1 
ATOM   8652  N N   . LEU D 1 39  ? 61.579  9.605   186.295 1.00 93.77  ? 39  LEU D N   1 
ATOM   8653  C CA  . LEU D 1 39  ? 61.171  8.985   185.044 1.00 91.54  ? 39  LEU D CA  1 
ATOM   8654  C C   . LEU D 1 39  ? 60.493  10.098  184.246 1.00 87.19  ? 39  LEU D C   1 
ATOM   8655  O O   . LEU D 1 39  ? 59.844  10.984  184.831 1.00 87.88  ? 39  LEU D O   1 
ATOM   8656  C CB  . LEU D 1 39  ? 60.216  7.826   185.307 1.00 97.49  ? 39  LEU D CB  1 
ATOM   8657  C CG  . LEU D 1 39  ? 58.716  8.132   185.251 1.00 102.09 ? 39  LEU D CG  1 
ATOM   8658  C CD1 . LEU D 1 39  ? 58.187  8.160   183.788 1.00 104.58 ? 39  LEU D CD1 1 
ATOM   8659  C CD2 . LEU D 1 39  ? 57.990  7.055   186.043 1.00 108.24 ? 39  LEU D CD2 1 
ATOM   8660  N N   . VAL D 1 40  ? 60.583  10.049  182.922 1.00 83.06  ? 40  VAL D N   1 
ATOM   8661  C CA  . VAL D 1 40  ? 59.992  11.151  182.217 1.00 81.88  ? 40  VAL D CA  1 
ATOM   8662  C C   . VAL D 1 40  ? 58.558  11.303  181.883 1.00 78.64  ? 40  VAL D C   1 
ATOM   8663  O O   . VAL D 1 40  ? 58.014  10.878  180.870 1.00 76.69  ? 40  VAL D O   1 
ATOM   8664  C CB  . VAL D 1 40  ? 60.850  11.750  181.159 1.00 85.62  ? 40  VAL D CB  1 
ATOM   8665  C CG1 . VAL D 1 40  ? 60.301  13.182  180.816 1.00 85.92  ? 40  VAL D CG1 1 
ATOM   8666  C CG2 . VAL D 1 40  ? 62.275  11.840  181.696 1.00 87.77  ? 40  VAL D CG2 1 
ATOM   8667  N N   . THR D 1 41  ? 58.126  12.258  182.662 1.00 78.10  ? 41  THR D N   1 
ATOM   8668  C CA  . THR D 1 41  ? 56.835  12.813  182.734 1.00 76.93  ? 41  THR D CA  1 
ATOM   8669  C C   . THR D 1 41  ? 56.196  12.984  181.330 1.00 71.77  ? 41  THR D C   1 
ATOM   8670  O O   . THR D 1 41  ? 55.437  12.141  180.874 1.00 71.47  ? 41  THR D O   1 
ATOM   8671  C CB  . THR D 1 41  ? 57.026  14.145  183.592 1.00 82.41  ? 41  THR D CB  1 
ATOM   8672  O OG1 . THR D 1 41  ? 58.418  14.564  183.540 1.00 83.92  ? 41  THR D OG1 1 
ATOM   8673  C CG2 . THR D 1 41  ? 56.676  13.894  185.097 1.00 80.10  ? 41  THR D CG2 1 
ATOM   8674  N N   . GLY D 1 42  ? 56.644  13.962  180.576 1.00 67.34  ? 42  GLY D N   1 
ATOM   8675  C CA  . GLY D 1 42  ? 56.013  14.207  179.300 1.00 67.46  ? 42  GLY D CA  1 
ATOM   8676  C C   . GLY D 1 42  ? 55.754  15.694  179.423 1.00 69.31  ? 42  GLY D C   1 
ATOM   8677  O O   . GLY D 1 42  ? 56.717  16.430  179.669 1.00 72.91  ? 42  GLY D O   1 
ATOM   8678  N N   . PRO D 1 43  ? 54.517  16.192  179.257 1.00 68.05  ? 43  PRO D N   1 
ATOM   8679  C CA  . PRO D 1 43  ? 54.330  17.640  179.396 1.00 67.85  ? 43  PRO D CA  1 
ATOM   8680  C C   . PRO D 1 43  ? 53.127  18.034  180.266 1.00 68.80  ? 43  PRO D C   1 
ATOM   8681  O O   . PRO D 1 43  ? 53.140  19.067  180.934 1.00 71.69  ? 43  PRO D O   1 
ATOM   8682  C CB  . PRO D 1 43  ? 54.132  18.073  177.956 1.00 62.48  ? 43  PRO D CB  1 
ATOM   8683  C CG  . PRO D 1 43  ? 53.249  16.966  177.441 1.00 64.80  ? 43  PRO D CG  1 
ATOM   8684  C CD  . PRO D 1 43  ? 53.550  15.684  178.279 1.00 66.34  ? 43  PRO D CD  1 
ATOM   8685  N N   . ASP D 1 44  ? 52.116  17.185  180.331 1.00 67.35  ? 44  ASP D N   1 
ATOM   8686  C CA  . ASP D 1 44  ? 50.943  17.517  181.117 1.00 68.19  ? 44  ASP D CA  1 
ATOM   8687  C C   . ASP D 1 44  ? 50.986  16.704  182.371 1.00 62.83  ? 44  ASP D C   1 
ATOM   8688  O O   . ASP D 1 44  ? 50.156  16.804  183.257 1.00 61.82  ? 44  ASP D O   1 
ATOM   8689  C CB  . ASP D 1 44  ? 49.733  17.209  180.270 1.00 77.97  ? 44  ASP D CB  1 
ATOM   8690  C CG  . ASP D 1 44  ? 49.951  17.619  178.815 1.00 81.10  ? 44  ASP D CG  1 
ATOM   8691  O OD1 . ASP D 1 44  ? 49.943  18.835  178.493 1.00 78.01  ? 44  ASP D OD1 1 
ATOM   8692  O OD2 . ASP D 1 44  ? 50.207  16.715  178.003 1.00 84.50  ? 44  ASP D OD2 1 
ATOM   8693  N N   . SER D 1 45  ? 52.046  15.931  182.420 1.00 60.58  ? 45  SER D N   1 
ATOM   8694  C CA  . SER D 1 45  ? 52.385  15.049  183.500 1.00 61.07  ? 45  SER D CA  1 
ATOM   8695  C C   . SER D 1 45  ? 52.183  15.726  184.826 1.00 56.65  ? 45  SER D C   1 
ATOM   8696  O O   . SER D 1 45  ? 53.054  16.441  185.321 1.00 56.89  ? 45  SER D O   1 
ATOM   8697  C CB  . SER D 1 45  ? 53.852  14.674  183.363 1.00 69.00  ? 45  SER D CB  1 
ATOM   8698  O OG  . SER D 1 45  ? 54.388  15.094  182.101 1.00 76.80  ? 45  SER D OG  1 
ATOM   8699  N N   . VAL D 1 46  ? 51.045  15.464  185.425 1.00 50.22  ? 46  VAL D N   1 
ATOM   8700  C CA  . VAL D 1 46  ? 50.771  16.067  186.694 1.00 44.19  ? 46  VAL D CA  1 
ATOM   8701  C C   . VAL D 1 46  ? 51.442  15.339  187.800 1.00 39.84  ? 46  VAL D C   1 
ATOM   8702  O O   . VAL D 1 46  ? 51.338  14.108  187.909 1.00 38.19  ? 46  VAL D O   1 
ATOM   8703  C CB  . VAL D 1 46  ? 49.365  15.980  187.052 1.00 46.19  ? 46  VAL D CB  1 
ATOM   8704  C CG1 . VAL D 1 46  ? 49.088  17.045  188.077 1.00 50.20  ? 46  VAL D CG1 1 
ATOM   8705  C CG2 . VAL D 1 46  ? 48.496  16.057  185.823 1.00 51.56  ? 46  VAL D CG2 1 
ATOM   8706  N N   . THR D 1 47  ? 51.930  16.116  188.740 1.00 34.57  ? 47  THR D N   1 
ATOM   8707  C CA  . THR D 1 47  ? 52.603  15.520  189.845 1.00 35.33  ? 47  THR D CA  1 
ATOM   8708  C C   . THR D 1 47  ? 52.008  15.908  191.156 1.00 34.67  ? 47  THR D C   1 
ATOM   8709  O O   . THR D 1 47  ? 51.714  17.077  191.399 1.00 35.12  ? 47  THR D O   1 
ATOM   8710  C CB  . THR D 1 47  ? 54.022  15.929  189.841 1.00 38.72  ? 47  THR D CB  1 
ATOM   8711  O OG1 . THR D 1 47  ? 54.609  15.588  188.565 1.00 38.22  ? 47  THR D OG1 1 
ATOM   8712  C CG2 . THR D 1 47  ? 54.737  15.268  191.027 1.00 37.96  ? 47  THR D CG2 1 
ATOM   8713  N N   . GLU D 1 48  ? 51.847  14.922  192.017 1.00 34.63  ? 48  GLU D N   1 
ATOM   8714  C CA  . GLU D 1 48  ? 51.275  15.174  193.323 1.00 38.11  ? 48  GLU D CA  1 
ATOM   8715  C C   . GLU D 1 48  ? 52.333  14.858  194.352 1.00 33.23  ? 48  GLU D C   1 
ATOM   8716  O O   . GLU D 1 48  ? 52.926  13.778  194.343 1.00 35.56  ? 48  GLU D O   1 
ATOM   8717  C CB  . GLU D 1 48  ? 49.988  14.332  193.556 1.00 44.89  ? 48  GLU D CB  1 
ATOM   8718  C CG  . GLU D 1 48  ? 48.704  14.892  192.841 1.00 58.04  ? 48  GLU D CG  1 
ATOM   8719  C CD  . GLU D 1 48  ? 47.371  14.108  193.075 1.00 63.47  ? 48  GLU D CD  1 
ATOM   8720  O OE1 . GLU D 1 48  ? 47.357  13.079  193.801 1.00 65.93  ? 48  GLU D OE1 1 
ATOM   8721  O OE2 . GLU D 1 48  ? 46.312  14.554  192.540 1.00 66.41  ? 48  GLU D OE2 1 
ATOM   8722  N N   . ILE D 1 49  ? 52.607  15.814  195.217 1.00 28.23  ? 49  ILE D N   1 
ATOM   8723  C CA  . ILE D 1 49  ? 53.593  15.571  196.230 1.00 22.99  ? 49  ILE D CA  1 
ATOM   8724  C C   . ILE D 1 49  ? 53.027  15.829  197.584 1.00 22.33  ? 49  ILE D C   1 
ATOM   8725  O O   . ILE D 1 49  ? 52.549  16.931  197.870 1.00 25.44  ? 49  ILE D O   1 
ATOM   8726  C CB  . ILE D 1 49  ? 54.772  16.469  196.057 1.00 24.09  ? 49  ILE D CB  1 
ATOM   8727  C CG1 . ILE D 1 49  ? 55.309  16.327  194.637 1.00 27.36  ? 49  ILE D CG1 1 
ATOM   8728  C CG2 . ILE D 1 49  ? 55.833  16.166  197.124 1.00 19.16  ? 49  ILE D CG2 1 
ATOM   8729  C CD1 . ILE D 1 49  ? 56.586  17.131  194.433 1.00 36.46  ? 49  ILE D CD1 1 
ATOM   8730  N N   . GLU D 1 50  ? 53.044  14.791  198.399 1.00 22.36  ? 50  GLU D N   1 
ATOM   8731  C CA  . GLU D 1 50  ? 52.568  14.892  199.764 1.00 25.31  ? 50  GLU D CA  1 
ATOM   8732  C C   . GLU D 1 50  ? 53.747  15.072  200.677 1.00 22.49  ? 50  GLU D C   1 
ATOM   8733  O O   . GLU D 1 50  ? 54.791  14.456  200.494 1.00 21.49  ? 50  GLU D O   1 
ATOM   8734  C CB  . GLU D 1 50  ? 51.823  13.635  200.195 1.00 35.19  ? 50  GLU D CB  1 
ATOM   8735  C CG  . GLU D 1 50  ? 50.337  13.660  199.915 1.00 45.15  ? 50  GLU D CG  1 
ATOM   8736  C CD  . GLU D 1 50  ? 49.911  12.709  198.798 1.00 54.01  ? 50  GLU D CD  1 
ATOM   8737  O OE1 . GLU D 1 50  ? 50.771  12.265  197.989 1.00 64.13  ? 50  GLU D OE1 1 
ATOM   8738  O OE2 . GLU D 1 50  ? 48.700  12.398  198.735 1.00 52.61  ? 50  GLU D OE2 1 
ATOM   8739  N N   . ALA D 1 51  ? 53.556  15.853  201.717 1.00 19.48  ? 51  ALA D N   1 
ATOM   8740  C CA  . ALA D 1 51  ? 54.630  16.071  202.635 1.00 19.23  ? 51  ALA D CA  1 
ATOM   8741  C C   . ALA D 1 51  ? 54.135  16.812  203.838 1.00 20.38  ? 51  ALA D C   1 
ATOM   8742  O O   . ALA D 1 51  ? 52.941  17.085  203.978 1.00 21.32  ? 51  ALA D O   1 
ATOM   8743  C CB  . ALA D 1 51  ? 55.702  16.841  201.957 1.00 18.20  ? 51  ALA D CB  1 
ATOM   8744  N N   . PHE D 1 52  ? 55.064  17.224  204.674 1.00 21.26  ? 52  PHE D N   1 
ATOM   8745  C CA  . PHE D 1 52  ? 54.655  17.910  205.855 1.00 24.67  ? 52  PHE D CA  1 
ATOM   8746  C C   . PHE D 1 52  ? 55.821  18.575  206.498 1.00 26.97  ? 52  PHE D C   1 
ATOM   8747  O O   . PHE D 1 52  ? 56.962  18.325  206.136 1.00 26.10  ? 52  PHE D O   1 
ATOM   8748  C CB  . PHE D 1 52  ? 54.113  16.883  206.820 1.00 28.16  ? 52  PHE D CB  1 
ATOM   8749  C CG  . PHE D 1 52  ? 55.148  15.908  207.298 1.00 31.26  ? 52  PHE D CG  1 
ATOM   8750  C CD1 . PHE D 1 52  ? 55.931  16.197  208.430 1.00 34.11  ? 52  PHE D CD1 1 
ATOM   8751  C CD2 . PHE D 1 52  ? 55.364  14.718  206.614 1.00 31.88  ? 52  PHE D CD2 1 
ATOM   8752  C CE1 . PHE D 1 52  ? 56.920  15.310  208.875 1.00 33.90  ? 52  PHE D CE1 1 
ATOM   8753  C CE2 . PHE D 1 52  ? 56.356  13.823  207.053 1.00 38.97  ? 52  PHE D CE2 1 
ATOM   8754  C CZ  . PHE D 1 52  ? 57.137  14.120  208.185 1.00 34.37  ? 52  PHE D CZ  1 
ATOM   8755  N N   . LEU D 1 53  ? 55.517  19.343  207.527 1.00 32.29  ? 53  LEU D N   1 
ATOM   8756  C CA  . LEU D 1 53  ? 56.516  20.046  208.295 1.00 41.37  ? 53  LEU D CA  1 
ATOM   8757  C C   . LEU D 1 53  ? 56.207  19.772  209.741 1.00 45.93  ? 53  LEU D C   1 
ATOM   8758  O O   . LEU D 1 53  ? 55.034  19.700  210.145 1.00 47.76  ? 53  LEU D O   1 
ATOM   8759  C CB  . LEU D 1 53  ? 56.414  21.547  208.064 1.00 47.94  ? 53  LEU D CB  1 
ATOM   8760  C CG  . LEU D 1 53  ? 57.111  22.252  206.891 1.00 57.11  ? 53  LEU D CG  1 
ATOM   8761  C CD1 . LEU D 1 53  ? 57.331  21.312  205.721 1.00 57.45  ? 53  LEU D CD1 1 
ATOM   8762  C CD2 . LEU D 1 53  ? 56.327  23.525  206.461 1.00 60.23  ? 53  LEU D CD2 1 
ATOM   8763  N N   . ASN D 1 54  ? 57.260  19.568  210.518 1.00 51.56  ? 54  ASN D N   1 
ATOM   8764  C CA  . ASN D 1 54  ? 57.104  19.331  211.946 1.00 55.74  ? 54  ASN D CA  1 
ATOM   8765  C C   . ASN D 1 54  ? 57.330  20.698  212.572 1.00 53.86  ? 54  ASN D C   1 
ATOM   8766  O O   . ASN D 1 54  ? 58.295  21.380  212.301 1.00 49.55  ? 54  ASN D O   1 
ATOM   8767  C CB  . ASN D 1 54  ? 58.042  18.220  212.484 1.00 63.39  ? 54  ASN D CB  1 
ATOM   8768  C CG  . ASN D 1 54  ? 57.275  16.902  212.815 1.00 66.98  ? 54  ASN D CG  1 
ATOM   8769  O OD1 . ASN D 1 54  ? 57.828  15.789  212.745 1.00 68.02  ? 54  ASN D OD1 1 
ATOM   8770  N ND2 . ASN D 1 54  ? 55.999  17.045  213.180 1.00 62.61  ? 54  ASN D ND2 1 
ATOM   8771  N N   . PRO D 1 55  ? 56.345  21.158  213.314 1.00 57.73  ? 55  PRO D N   1 
ATOM   8772  C CA  . PRO D 1 55  ? 56.210  22.426  214.045 1.00 62.40  ? 55  PRO D CA  1 
ATOM   8773  C C   . PRO D 1 55  ? 57.390  22.870  214.869 1.00 61.42  ? 55  PRO D C   1 
ATOM   8774  O O   . PRO D 1 55  ? 57.336  22.878  216.084 1.00 62.81  ? 55  PRO D O   1 
ATOM   8775  C CB  . PRO D 1 55  ? 54.975  22.183  214.924 1.00 67.67  ? 55  PRO D CB  1 
ATOM   8776  C CG  . PRO D 1 55  ? 54.951  20.655  215.080 1.00 64.77  ? 55  PRO D CG  1 
ATOM   8777  C CD  . PRO D 1 55  ? 55.295  20.204  213.702 1.00 58.78  ? 55  PRO D CD  1 
ATOM   8778  N N   . ARG D 1 56  ? 58.415  23.376  214.234 1.00 63.69  ? 56  ARG D N   1 
ATOM   8779  C CA  . ARG D 1 56  ? 59.563  23.744  215.032 1.00 70.31  ? 56  ARG D CA  1 
ATOM   8780  C C   . ARG D 1 56  ? 59.512  25.119  215.754 1.00 72.04  ? 56  ARG D C   1 
ATOM   8781  O O   . ARG D 1 56  ? 59.937  26.161  215.248 1.00 74.01  ? 56  ARG D O   1 
ATOM   8782  C CB  . ARG D 1 56  ? 60.854  23.374  214.254 1.00 74.82  ? 56  ARG D CB  1 
ATOM   8783  C CG  . ARG D 1 56  ? 60.934  21.792  214.080 1.00 78.80  ? 56  ARG D CG  1 
ATOM   8784  C CD  . ARG D 1 56  ? 61.860  21.233  213.013 1.00 82.30  ? 56  ARG D CD  1 
ATOM   8785  N NE  . ARG D 1 56  ? 61.466  21.724  211.708 1.00 94.43  ? 56  ARG D NE  1 
ATOM   8786  C CZ  . ARG D 1 56  ? 62.192  22.545  210.952 1.00 99.09  ? 56  ARG D CZ  1 
ATOM   8787  N NH1 . ARG D 1 56  ? 63.391  22.979  211.347 1.00 103.83 ? 56  ARG D NH1 1 
ATOM   8788  N NH2 . ARG D 1 56  ? 61.653  23.026  209.841 1.00 100.11 ? 56  ARG D NH2 1 
ATOM   8789  N N   . MET D 1 57  ? 58.936  25.086  216.953 1.00 72.39  ? 57  MET D N   1 
ATOM   8790  C CA  . MET D 1 57  ? 58.771  26.263  217.789 1.00 73.25  ? 57  MET D CA  1 
ATOM   8791  C C   . MET D 1 57  ? 59.263  25.895  219.158 1.00 73.95  ? 57  MET D C   1 
ATOM   8792  O O   . MET D 1 57  ? 58.676  25.056  219.840 1.00 71.59  ? 57  MET D O   1 
ATOM   8793  C CB  . MET D 1 57  ? 57.304  26.626  217.880 1.00 75.89  ? 57  MET D CB  1 
ATOM   8794  C CG  . MET D 1 57  ? 56.449  25.500  218.405 1.00 81.50  ? 57  MET D CG  1 
ATOM   8795  S SD  . MET D 1 57  ? 54.737  25.919  218.499 1.00 87.53  ? 57  MET D SD  1 
ATOM   8796  C CE  . MET D 1 57  ? 54.786  27.113  219.891 1.00 87.85  ? 57  MET D CE  1 
ATOM   8797  N N   . GLY D 1 58  ? 60.389  26.481  219.529 1.00 78.35  ? 58  GLY D N   1 
ATOM   8798  C CA  . GLY D 1 58  ? 60.985  26.203  220.827 1.00 82.95  ? 58  GLY D CA  1 
ATOM   8799  C C   . GLY D 1 58  ? 62.080  25.123  220.890 1.00 83.27  ? 58  GLY D C   1 
ATOM   8800  O O   . GLY D 1 58  ? 63.254  25.369  220.550 1.00 83.93  ? 58  GLY D O   1 
ATOM   8801  N N   . GLN D 1 59  ? 61.700  23.930  221.356 1.00 79.80  ? 59  GLN D N   1 
ATOM   8802  C CA  . GLN D 1 59  ? 62.637  22.826  221.491 1.00 71.98  ? 59  GLN D CA  1 
ATOM   8803  C C   . GLN D 1 59  ? 62.808  22.079  220.229 1.00 67.21  ? 59  GLN D C   1 
ATOM   8804  O O   . GLN D 1 59  ? 61.834  21.561  219.664 1.00 65.93  ? 59  GLN D O   1 
ATOM   8805  C CB  . GLN D 1 59  ? 62.186  21.802  222.504 1.00 73.40  ? 59  GLN D CB  1 
ATOM   8806  C CG  . GLN D 1 59  ? 63.208  20.719  222.691 1.00 77.43  ? 59  GLN D CG  1 
ATOM   8807  C CD  . GLN D 1 59  ? 63.788  20.779  224.062 1.00 86.58  ? 59  GLN D CD  1 
ATOM   8808  O OE1 . GLN D 1 59  ? 64.597  21.657  224.368 1.00 91.09  ? 59  GLN D OE1 1 
ATOM   8809  N NE2 . GLN D 1 59  ? 63.331  19.884  224.932 1.00 89.89  ? 59  GLN D NE2 1 
ATOM   8810  N N   . PRO D 1 60  ? 64.059  21.978  219.794 1.00 65.10  ? 60  PRO D N   1 
ATOM   8811  C CA  . PRO D 1 60  ? 64.519  21.293  218.599 1.00 65.73  ? 60  PRO D CA  1 
ATOM   8812  C C   . PRO D 1 60  ? 64.491  19.812  218.894 1.00 66.45  ? 60  PRO D C   1 
ATOM   8813  O O   . PRO D 1 60  ? 64.499  19.380  220.053 1.00 64.12  ? 60  PRO D O   1 
ATOM   8814  C CB  . PRO D 1 60  ? 65.936  21.809  218.441 1.00 68.10  ? 60  PRO D CB  1 
ATOM   8815  C CG  . PRO D 1 60  ? 66.343  22.049  219.842 1.00 70.36  ? 60  PRO D CG  1 
ATOM   8816  C CD  . PRO D 1 60  ? 65.154  22.729  220.415 1.00 64.68  ? 60  PRO D CD  1 
ATOM   8817  N N   . PRO D 1 61  ? 64.517  19.015  217.842 1.00 69.69  ? 61  PRO D N   1 
ATOM   8818  C CA  . PRO D 1 61  ? 64.488  17.551  217.833 1.00 77.93  ? 61  PRO D CA  1 
ATOM   8819  C C   . PRO D 1 61  ? 65.564  16.857  218.646 1.00 84.58  ? 61  PRO D C   1 
ATOM   8820  O O   . PRO D 1 61  ? 65.271  16.041  219.511 1.00 86.23  ? 61  PRO D O   1 
ATOM   8821  C CB  . PRO D 1 61  ? 64.655  17.234  216.354 1.00 80.32  ? 61  PRO D CB  1 
ATOM   8822  C CG  . PRO D 1 61  ? 65.514  18.410  215.871 1.00 76.55  ? 61  PRO D CG  1 
ATOM   8823  C CD  . PRO D 1 61  ? 64.836  19.555  216.512 1.00 67.65  ? 61  PRO D CD  1 
ATOM   8824  N N   . THR D 1 62  ? 66.807  17.200  218.317 1.00 89.88  ? 62  THR D N   1 
ATOM   8825  C CA  . THR D 1 62  ? 68.039  16.662  218.886 1.00 93.17  ? 62  THR D CA  1 
ATOM   8826  C C   . THR D 1 62  ? 68.096  16.210  220.325 1.00 94.15  ? 62  THR D C   1 
ATOM   8827  O O   . THR D 1 62  ? 68.678  15.161  220.628 1.00 97.89  ? 62  THR D O   1 
ATOM   8828  C CB  . THR D 1 62  ? 69.182  17.619  218.648 1.00 94.15  ? 62  THR D CB  1 
ATOM   8829  O OG1 . THR D 1 62  ? 68.709  18.960  218.833 1.00 98.14  ? 62  THR D OG1 1 
ATOM   8830  C CG2 . THR D 1 62  ? 69.734  17.428  217.232 1.00 96.67  ? 62  THR D CG2 1 
ATOM   8831  N N   . PRO D 1 63  ? 67.658  17.058  221.251 1.00 92.10  ? 63  PRO D N   1 
ATOM   8832  C CA  . PRO D 1 63  ? 67.735  16.543  222.614 1.00 95.10  ? 63  PRO D CA  1 
ATOM   8833  C C   . PRO D 1 63  ? 66.660  15.449  222.640 1.00 98.91  ? 63  PRO D C   1 
ATOM   8834  O O   . PRO D 1 63  ? 65.456  15.717  222.751 1.00 103.53 ? 63  PRO D O   1 
ATOM   8835  C CB  . PRO D 1 63  ? 67.384  17.765  223.447 1.00 94.93  ? 63  PRO D CB  1 
ATOM   8836  C CG  . PRO D 1 63  ? 67.757  18.924  222.507 1.00 93.65  ? 63  PRO D CG  1 
ATOM   8837  C CD  . PRO D 1 63  ? 67.183  18.441  221.237 1.00 87.90  ? 63  PRO D CD  1 
ATOM   8838  N N   . GLU D 1 64  ? 67.136  14.229  222.426 1.00 98.22  ? 64  GLU D N   1 
ATOM   8839  C CA  . GLU D 1 64  ? 66.323  13.046  222.325 1.00 99.49  ? 64  GLU D CA  1 
ATOM   8840  C C   . GLU D 1 64  ? 65.464  12.567  223.458 1.00 101.30 ? 64  GLU D C   1 
ATOM   8841  O O   . GLU D 1 64  ? 64.246  12.666  223.403 1.00 103.45 ? 64  GLU D O   1 
ATOM   8842  C CB  . GLU D 1 64  ? 67.197  11.910  221.846 1.00 103.00 ? 64  GLU D CB  1 
ATOM   8843  C CG  . GLU D 1 64  ? 67.398  11.928  220.352 1.00 114.59 ? 64  GLU D CG  1 
ATOM   8844  C CD  . GLU D 1 64  ? 66.148  11.511  219.579 1.00 122.12 ? 64  GLU D CD  1 
ATOM   8845  O OE1 . GLU D 1 64  ? 65.050  11.401  220.184 1.00 124.64 ? 64  GLU D OE1 1 
ATOM   8846  O OE2 . GLU D 1 64  ? 66.279  11.274  218.357 1.00 127.68 ? 64  GLU D OE2 1 
ATOM   8847  N N   . SER D 1 65  ? 66.084  11.977  224.464 1.00 105.52 ? 65  SER D N   1 
ATOM   8848  C CA  . SER D 1 65  ? 65.312  11.443  225.563 1.00 109.77 ? 65  SER D CA  1 
ATOM   8849  C C   . SER D 1 65  ? 64.569  12.486  226.339 1.00 107.51 ? 65  SER D C   1 
ATOM   8850  O O   . SER D 1 65  ? 65.105  13.512  226.744 1.00 103.62 ? 65  SER D O   1 
ATOM   8851  C CB  . SER D 1 65  ? 66.164  10.592  226.494 1.00 117.36 ? 65  SER D CB  1 
ATOM   8852  O OG  . SER D 1 65  ? 65.338  9.777   227.317 1.00 128.65 ? 65  SER D OG  1 
ATOM   8853  N N   . LEU D 1 66  ? 63.329  12.155  226.616 1.00 110.74 ? 66  LEU D N   1 
ATOM   8854  C CA  . LEU D 1 66  ? 62.451  13.041  227.328 1.00 118.78 ? 66  LEU D CA  1 
ATOM   8855  C C   . LEU D 1 66  ? 62.782  13.125  228.794 1.00 121.27 ? 66  LEU D C   1 
ATOM   8856  O O   . LEU D 1 66  ? 61.899  13.182  229.640 1.00 123.56 ? 66  LEU D O   1 
ATOM   8857  C CB  . LEU D 1 66  ? 61.006  12.604  227.135 1.00 123.89 ? 66  LEU D CB  1 
ATOM   8858  C CG  . LEU D 1 66  ? 60.712  11.119  226.912 1.00 129.25 ? 66  LEU D CG  1 
ATOM   8859  C CD1 . LEU D 1 66  ? 59.220  10.887  227.187 1.00 130.61 ? 66  LEU D CD1 1 
ATOM   8860  C CD2 . LEU D 1 66  ? 61.114  10.658  225.486 1.00 130.88 ? 66  LEU D CD2 1 
ATOM   8861  N N   . THR D 1 67  ? 64.062  13.148  229.098 1.00 124.77 ? 67  THR D N   1 
ATOM   8862  C CA  . THR D 1 67  ? 64.497  13.235  230.467 1.00 131.06 ? 67  THR D CA  1 
ATOM   8863  C C   . THR D 1 67  ? 65.464  14.381  230.460 1.00 133.34 ? 67  THR D C   1 
ATOM   8864  O O   . THR D 1 67  ? 65.371  15.301  231.266 1.00 132.06 ? 67  THR D O   1 
ATOM   8865  C CB  . THR D 1 67  ? 65.237  11.975  230.832 1.00 135.12 ? 67  THR D CB  1 
ATOM   8866  O OG1 . THR D 1 67  ? 66.204  11.701  229.808 1.00 140.10 ? 67  THR D OG1 1 
ATOM   8867  C CG2 . THR D 1 67  ? 64.262  10.801  230.925 1.00 140.55 ? 67  THR D CG2 1 
ATOM   8868  N N   . GLU D 1 68  ? 66.355  14.330  229.478 1.00 137.39 ? 68  GLU D N   1 
ATOM   8869  C CA  . GLU D 1 68  ? 67.380  15.342  229.276 1.00 143.42 ? 68  GLU D CA  1 
ATOM   8870  C C   . GLU D 1 68  ? 66.821  16.506  228.440 1.00 141.43 ? 68  GLU D C   1 
ATOM   8871  O O   . GLU D 1 68  ? 67.099  17.679  228.722 1.00 144.97 ? 68  GLU D O   1 
ATOM   8872  C CB  . GLU D 1 68  ? 68.604  14.703  228.615 1.00 150.86 ? 68  GLU D CB  1 
ATOM   8873  C CG  . GLU D 1 68  ? 68.255  13.714  227.508 1.00 162.53 ? 68  GLU D CG  1 
ATOM   8874  C CD  . GLU D 1 68  ? 69.073  12.431  227.577 1.00 170.39 ? 68  GLU D CD  1 
ATOM   8875  O OE1 . GLU D 1 68  ? 69.110  11.804  228.666 1.00 175.41 ? 68  GLU D OE1 1 
ATOM   8876  O OE2 . GLU D 1 68  ? 69.654  12.043  226.532 1.00 174.91 ? 68  GLU D OE2 1 
ATOM   8877  N N   . GLY D 1 69  ? 66.052  16.175  227.404 1.00 136.41 ? 69  GLY D N   1 
ATOM   8878  C CA  . GLY D 1 69  ? 65.432  17.203  226.590 1.00 129.02 ? 69  GLY D CA  1 
ATOM   8879  C C   . GLY D 1 69  ? 64.039  17.418  227.159 1.00 124.57 ? 69  GLY D C   1 
ATOM   8880  O O   . GLY D 1 69  ? 63.224  18.177  226.608 1.00 123.83 ? 69  GLY D O   1 
ATOM   8881  N N   . GLY D 1 70  ? 63.730  16.622  228.190 1.00 120.34 ? 70  GLY D N   1 
ATOM   8882  C CA  . GLY D 1 70  ? 62.449  16.657  228.883 1.00 111.68 ? 70  GLY D CA  1 
ATOM   8883  C C   . GLY D 1 70  ? 61.295  16.544  227.917 1.00 103.83 ? 70  GLY D C   1 
ATOM   8884  O O   . GLY D 1 70  ? 60.130  16.571  228.308 1.00 106.78 ? 70  GLY D O   1 
ATOM   8885  N N   . GLN D 1 71  ? 61.645  16.295  226.663 1.00 92.00  ? 71  GLN D N   1 
ATOM   8886  C CA  . GLN D 1 71  ? 60.707  16.225  225.598 1.00 78.69  ? 71  GLN D CA  1 
ATOM   8887  C C   . GLN D 1 71  ? 59.529  17.075  225.601 1.00 74.77  ? 71  GLN D C   1 
ATOM   8888  O O   . GLN D 1 71  ? 58.499  16.870  226.261 1.00 70.43  ? 71  GLN D O   1 
ATOM   8889  C CB  . GLN D 1 71  ? 60.640  14.915  224.879 1.00 75.58  ? 71  GLN D CB  1 
ATOM   8890  C CG  . GLN D 1 71  ? 61.847  14.886  223.976 1.00 74.27  ? 71  GLN D CG  1 
ATOM   8891  C CD  . GLN D 1 71  ? 62.617  16.217  223.986 1.00 74.72  ? 71  GLN D CD  1 
ATOM   8892  O OE1 . GLN D 1 71  ? 63.517  16.414  224.778 1.00 69.32  ? 71  GLN D OE1 1 
ATOM   8893  N NE2 . GLN D 1 71  ? 62.175  17.159  223.196 1.00 76.95  ? 71  GLN D NE2 1 
ATOM   8894  N N   . TYR D 1 72  ? 60.044  18.241  225.281 1.00 71.44  ? 72  TYR D N   1 
ATOM   8895  C CA  . TYR D 1 72  ? 59.321  19.436  225.103 1.00 72.59  ? 72  TYR D CA  1 
ATOM   8896  C C   . TYR D 1 72  ? 59.253  19.556  223.573 1.00 70.05  ? 72  TYR D C   1 
ATOM   8897  O O   . TYR D 1 72  ? 58.602  20.457  223.033 1.00 74.40  ? 72  TYR D O   1 
ATOM   8898  C CB  . TYR D 1 72  ? 60.146  20.558  225.734 1.00 76.08  ? 72  TYR D CB  1 
ATOM   8899  C CG  . TYR D 1 72  ? 60.315  20.435  227.233 1.00 80.53  ? 72  TYR D CG  1 
ATOM   8900  C CD1 . TYR D 1 72  ? 59.330  19.820  228.013 1.00 87.56  ? 72  TYR D CD1 1 
ATOM   8901  C CD2 . TYR D 1 72  ? 61.440  20.952  227.878 1.00 83.03  ? 72  TYR D CD2 1 
ATOM   8902  C CE1 . TYR D 1 72  ? 59.454  19.716  229.414 1.00 93.31  ? 72  TYR D CE1 1 
ATOM   8903  C CE2 . TYR D 1 72  ? 61.581  20.860  229.282 1.00 91.58  ? 72  TYR D CE2 1 
ATOM   8904  C CZ  . TYR D 1 72  ? 60.583  20.236  230.044 1.00 94.99  ? 72  TYR D CZ  1 
ATOM   8905  O OH  . TYR D 1 72  ? 60.714  20.119  231.419 1.00 95.99  ? 72  TYR D OH  1 
ATOM   8906  N N   . TYR D 1 73  ? 59.863  18.589  222.883 1.00 64.81  ? 73  TYR D N   1 
ATOM   8907  C CA  . TYR D 1 73  ? 59.892  18.634  221.439 1.00 60.41  ? 73  TYR D CA  1 
ATOM   8908  C C   . TYR D 1 73  ? 58.575  19.076  220.936 1.00 60.50  ? 73  TYR D C   1 
ATOM   8909  O O   . TYR D 1 73  ? 57.548  18.403  221.126 1.00 55.08  ? 73  TYR D O   1 
ATOM   8910  C CB  . TYR D 1 73  ? 60.231  17.314  220.789 1.00 61.41  ? 73  TYR D CB  1 
ATOM   8911  C CG  . TYR D 1 73  ? 60.453  17.464  219.293 1.00 64.87  ? 73  TYR D CG  1 
ATOM   8912  C CD1 . TYR D 1 73  ? 61.245  18.490  218.763 1.00 65.68  ? 73  TYR D CD1 1 
ATOM   8913  C CD2 . TYR D 1 73  ? 59.896  16.559  218.399 1.00 71.82  ? 73  TYR D CD2 1 
ATOM   8914  C CE1 . TYR D 1 73  ? 61.478  18.600  217.346 1.00 67.52  ? 73  TYR D CE1 1 
ATOM   8915  C CE2 . TYR D 1 73  ? 60.120  16.655  216.983 1.00 71.43  ? 73  TYR D CE2 1 
ATOM   8916  C CZ  . TYR D 1 73  ? 60.907  17.667  216.453 1.00 67.70  ? 73  TYR D CZ  1 
ATOM   8917  O OH  . TYR D 1 73  ? 61.090  17.706  215.054 1.00 62.30  ? 73  TYR D OH  1 
ATOM   8918  N N   . GLY D 1 74  ? 58.618  20.284  220.387 1.00 63.00  ? 74  GLY D N   1 
ATOM   8919  C CA  . GLY D 1 74  ? 57.425  20.881  219.837 1.00 66.43  ? 74  GLY D CA  1 
ATOM   8920  C C   . GLY D 1 74  ? 56.648  21.486  220.962 1.00 66.36  ? 74  GLY D C   1 
ATOM   8921  O O   . GLY D 1 74  ? 55.506  21.120  221.265 1.00 62.43  ? 74  GLY D O   1 
ATOM   8922  N N   . TRP D 1 75  ? 57.309  22.433  221.584 1.00 67.55  ? 75  TRP D N   1 
ATOM   8923  C CA  . TRP D 1 75  ? 56.738  23.124  222.694 1.00 71.52  ? 75  TRP D CA  1 
ATOM   8924  C C   . TRP D 1 75  ? 57.755  24.163  223.033 1.00 74.77  ? 75  TRP D C   1 
ATOM   8925  O O   . TRP D 1 75  ? 58.941  23.893  222.984 1.00 72.56  ? 75  TRP D O   1 
ATOM   8926  C CB  . TRP D 1 75  ? 56.572  22.163  223.858 1.00 70.77  ? 75  TRP D CB  1 
ATOM   8927  C CG  . TRP D 1 75  ? 55.180  21.684  224.075 1.00 73.42  ? 75  TRP D CG  1 
ATOM   8928  C CD1 . TRP D 1 75  ? 54.077  22.452  224.344 1.00 78.81  ? 75  TRP D CD1 1 
ATOM   8929  C CD2 . TRP D 1 75  ? 54.754  20.335  224.182 1.00 74.05  ? 75  TRP D CD2 1 
ATOM   8930  N NE1 . TRP D 1 75  ? 52.989  21.660  224.634 1.00 73.44  ? 75  TRP D NE1 1 
ATOM   8931  C CE2 . TRP D 1 75  ? 53.374  20.356  224.543 1.00 74.71  ? 75  TRP D CE2 1 
ATOM   8932  C CE3 . TRP D 1 75  ? 55.399  19.111  224.030 1.00 77.00  ? 75  TRP D CE3 1 
ATOM   8933  C CZ2 . TRP D 1 75  ? 52.635  19.195  224.754 1.00 77.90  ? 75  TRP D CZ2 1 
ATOM   8934  C CZ3 . TRP D 1 75  ? 54.661  17.948  224.247 1.00 83.57  ? 75  TRP D CZ3 1 
ATOM   8935  C CH2 . TRP D 1 75  ? 53.286  18.001  224.606 1.00 81.65  ? 75  TRP D CH2 1 
ATOM   8936  N N   . SER D 1 76  ? 57.293  25.386  223.240 1.00 83.02  ? 76  SER D N   1 
ATOM   8937  C CA  . SER D 1 76  ? 58.162  26.491  223.605 1.00 91.65  ? 76  SER D CA  1 
ATOM   8938  C C   . SER D 1 76  ? 58.728  25.911  224.864 1.00 91.76  ? 76  SER D C   1 
ATOM   8939  O O   . SER D 1 76  ? 57.973  25.320  225.625 1.00 95.09  ? 76  SER D O   1 
ATOM   8940  C CB  . SER D 1 76  ? 57.306  27.698  223.941 1.00 97.40  ? 76  SER D CB  1 
ATOM   8941  O OG  . SER D 1 76  ? 56.051  27.613  223.277 1.00 107.66 ? 76  SER D OG  1 
ATOM   8942  N N   . ARG D 1 77  ? 60.026  26.025  225.098 1.00 91.79  ? 77  ARG D N   1 
ATOM   8943  C CA  . ARG D 1 77  ? 60.528  25.385  226.292 1.00 91.96  ? 77  ARG D CA  1 
ATOM   8944  C C   . ARG D 1 77  ? 59.930  25.885  227.551 1.00 91.01  ? 77  ARG D C   1 
ATOM   8945  O O   . ARG D 1 77  ? 59.360  25.121  228.305 1.00 90.71  ? 77  ARG D O   1 
ATOM   8946  C CB  . ARG D 1 77  ? 62.040  25.321  226.379 1.00 90.92  ? 77  ARG D CB  1 
ATOM   8947  C CG  . ARG D 1 77  ? 62.482  23.898  226.178 1.00 94.18  ? 77  ARG D CG  1 
ATOM   8948  C CD  . ARG D 1 77  ? 63.854  23.664  226.638 1.00 102.07 ? 77  ARG D CD  1 
ATOM   8949  N NE  . ARG D 1 77  ? 63.890  23.163  227.999 1.00 117.85 ? 77  ARG D NE  1 
ATOM   8950  C CZ  . ARG D 1 77  ? 64.821  22.328  228.441 1.00 128.41 ? 77  ARG D CZ  1 
ATOM   8951  N NH1 . ARG D 1 77  ? 65.775  21.898  227.612 1.00 135.13 ? 77  ARG D NH1 1 
ATOM   8952  N NH2 . ARG D 1 77  ? 64.835  21.965  229.720 1.00 135.30 ? 77  ARG D NH2 1 
ATOM   8953  N N   . GLY D 1 78  ? 59.923  27.178  227.733 1.00 90.98  ? 78  GLY D N   1 
ATOM   8954  C CA  . GLY D 1 78  ? 59.355  27.662  228.954 1.00 94.04  ? 78  GLY D CA  1 
ATOM   8955  C C   . GLY D 1 78  ? 59.255  29.098  228.671 1.00 94.45  ? 78  GLY D C   1 
ATOM   8956  O O   . GLY D 1 78  ? 60.100  29.643  227.978 1.00 100.45 ? 78  GLY D O   1 
ATOM   8957  N N   . ILE D 1 79  ? 58.180  29.706  229.106 1.00 89.89  ? 79  ILE D N   1 
ATOM   8958  C CA  . ILE D 1 79  ? 58.099  31.092  228.828 1.00 89.46  ? 79  ILE D CA  1 
ATOM   8959  C C   . ILE D 1 79  ? 59.017  31.839  229.729 1.00 93.75  ? 79  ILE D C   1 
ATOM   8960  O O   . ILE D 1 79  ? 58.892  31.815  230.940 1.00 98.26  ? 79  ILE D O   1 
ATOM   8961  C CB  . ILE D 1 79  ? 56.710  31.586  228.859 1.00 87.18  ? 79  ILE D CB  1 
ATOM   8962  C CG1 . ILE D 1 79  ? 56.089  31.269  227.508 1.00 85.59  ? 79  ILE D CG1 1 
ATOM   8963  C CG2 . ILE D 1 79  ? 56.709  33.088  229.054 1.00 90.12  ? 79  ILE D CG2 1 
ATOM   8964  C CD1 . ILE D 1 79  ? 56.855  31.922  226.382 1.00 79.34  ? 79  ILE D CD1 1 
ATOM   8965  N N   . ASN D 1 80  ? 60.018  32.406  229.096 1.00 99.16  ? 80  ASN D N   1 
ATOM   8966  C CA  . ASN D 1 80  ? 61.036  33.169  229.763 1.00 106.22 ? 80  ASN D CA  1 
ATOM   8967  C C   . ASN D 1 80  ? 60.570  34.606  229.830 1.00 103.30 ? 80  ASN D C   1 
ATOM   8968  O O   . ASN D 1 80  ? 60.378  35.222  228.792 1.00 104.56 ? 80  ASN D O   1 
ATOM   8969  C CB  . ASN D 1 80  ? 62.303  33.087  228.925 1.00 121.82 ? 80  ASN D CB  1 
ATOM   8970  C CG  . ASN D 1 80  ? 63.475  33.784  229.567 1.00 136.19 ? 80  ASN D CG  1 
ATOM   8971  O OD1 . ASN D 1 80  ? 64.195  34.564  228.922 1.00 145.86 ? 80  ASN D OD1 1 
ATOM   8972  N ND2 . ASN D 1 80  ? 63.706  33.479  230.843 1.00 145.24 ? 80  ASN D ND2 1 
ATOM   8973  N N   . LEU D 1 81  ? 60.385  35.145  231.033 1.00 101.44 ? 81  LEU D N   1 
ATOM   8974  C CA  . LEU D 1 81  ? 59.929  36.527  231.178 1.00 100.30 ? 81  LEU D CA  1 
ATOM   8975  C C   . LEU D 1 81  ? 60.981  37.646  231.100 1.00 100.64 ? 81  LEU D C   1 
ATOM   8976  O O   . LEU D 1 81  ? 62.069  37.472  230.555 1.00 101.31 ? 81  LEU D O   1 
ATOM   8977  C CB  . LEU D 1 81  ? 59.088  36.672  232.434 1.00 100.02 ? 81  LEU D CB  1 
ATOM   8978  C CG  . LEU D 1 81  ? 57.681  37.080  232.017 1.00 100.77 ? 81  LEU D CG  1 
ATOM   8979  C CD1 . LEU D 1 81  ? 56.667  36.023  232.424 1.00 101.12 ? 81  LEU D CD1 1 
ATOM   8980  C CD2 . LEU D 1 81  ? 57.357  38.432  232.602 1.00 103.19 ? 81  LEU D CD2 1 
ATOM   8981  N N   . ALA D 1 82  ? 60.650  38.816  231.618 1.00 98.89  ? 82  ALA D N   1 
ATOM   8982  C CA  . ALA D 1 82  ? 61.603  39.888  231.549 1.00 99.93  ? 82  ALA D CA  1 
ATOM   8983  C C   . ALA D 1 82  ? 61.796  40.527  232.888 1.00 102.62 ? 82  ALA D C   1 
ATOM   8984  O O   . ALA D 1 82  ? 61.057  40.262  233.829 1.00 103.38 ? 82  ALA D O   1 
ATOM   8985  C CB  . ALA D 1 82  ? 61.153  40.895  230.566 1.00 96.10  ? 82  ALA D CB  1 
ATOM   8986  N N   . THR D 1 83  ? 62.834  41.344  232.962 1.00 106.90 ? 83  THR D N   1 
ATOM   8987  C CA  . THR D 1 83  ? 63.185  42.088  234.156 1.00 111.72 ? 83  THR D CA  1 
ATOM   8988  C C   . THR D 1 83  ? 62.129  43.146  234.333 1.00 113.57 ? 83  THR D C   1 
ATOM   8989  O O   . THR D 1 83  ? 61.452  43.185  235.352 1.00 115.80 ? 83  THR D O   1 
ATOM   8990  C CB  . THR D 1 83  ? 64.517  42.800  233.950 1.00 114.02 ? 83  THR D CB  1 
ATOM   8991  O OG1 . THR D 1 83  ? 65.574  41.837  234.006 1.00 117.78 ? 83  THR D OG1 1 
ATOM   8992  C CG2 . THR D 1 83  ? 64.723  43.925  234.977 1.00 116.35 ? 83  THR D CG2 1 
ATOM   8993  N N   . SER D 1 84  ? 62.050  44.028  233.338 1.00 115.49 ? 84  SER D N   1 
ATOM   8994  C CA  . SER D 1 84  ? 61.097  45.127  233.279 1.00 114.99 ? 84  SER D CA  1 
ATOM   8995  C C   . SER D 1 84  ? 61.610  46.124  232.279 1.00 112.04 ? 84  SER D C   1 
ATOM   8996  O O   . SER D 1 84  ? 62.805  46.372  232.231 1.00 107.99 ? 84  SER D O   1 
ATOM   8997  C CB  . SER D 1 84  ? 60.939  45.843  234.611 1.00 118.77 ? 84  SER D CB  1 
ATOM   8998  O OG  . SER D 1 84  ? 59.891  46.796  234.508 1.00 124.76 ? 84  SER D OG  1 
ATOM   8999  N N   . ASP D 1 85  ? 60.663  46.749  231.582 1.00 110.49 ? 85  ASP D N   1 
ATOM   9000  C CA  . ASP D 1 85  ? 60.877  47.741  230.534 1.00 109.76 ? 85  ASP D CA  1 
ATOM   9001  C C   . ASP D 1 85  ? 62.283  47.786  229.994 1.00 111.01 ? 85  ASP D C   1 
ATOM   9002  O O   . ASP D 1 85  ? 62.520  47.427  228.857 1.00 112.55 ? 85  ASP D O   1 
ATOM   9003  C CB  . ASP D 1 85  ? 60.422  49.124  230.993 1.00 107.69 ? 85  ASP D CB  1 
ATOM   9004  C CG  . ASP D 1 85  ? 59.651  49.873  229.913 1.00 107.89 ? 85  ASP D CG  1 
ATOM   9005  O OD1 . ASP D 1 85  ? 58.464  49.569  229.666 1.00 110.83 ? 85  ASP D OD1 1 
ATOM   9006  O OD2 . ASP D 1 85  ? 60.226  50.781  229.301 1.00 106.50 ? 85  ASP D OD2 1 
ATOM   9007  N N   . THR D 1 86  ? 63.220  48.194  230.823 1.00 113.60 ? 86  THR D N   1 
ATOM   9008  C CA  . THR D 1 86  ? 64.625  48.258  230.435 1.00 118.32 ? 86  THR D CA  1 
ATOM   9009  C C   . THR D 1 86  ? 65.189  46.924  229.965 1.00 116.70 ? 86  THR D C   1 
ATOM   9010  O O   . THR D 1 86  ? 66.036  46.885  229.084 1.00 114.48 ? 86  THR D O   1 
ATOM   9011  C CB  . THR D 1 86  ? 65.513  48.719  231.630 1.00 125.80 ? 86  THR D CB  1 
ATOM   9012  O OG1 . THR D 1 86  ? 66.904  48.701  231.236 1.00 131.77 ? 86  THR D OG1 1 
ATOM   9013  C CG2 . THR D 1 86  ? 65.312  47.783  232.872 1.00 128.94 ? 86  THR D CG2 1 
ATOM   9014  N N   . GLU D 1 87  ? 64.758  45.838  230.597 1.00 112.34 ? 87  GLU D N   1 
ATOM   9015  C CA  . GLU D 1 87  ? 65.306  44.532  230.271 1.00 123.53 ? 87  GLU D CA  1 
ATOM   9016  C C   . GLU D 1 87  ? 64.289  43.469  229.892 1.00 121.88 ? 87  GLU D C   1 
ATOM   9017  O O   . GLU D 1 87  ? 63.466  43.017  230.719 1.00 111.63 ? 87  GLU D O   1 
ATOM   9018  C CB  . GLU D 1 87  ? 66.195  44.036  231.373 1.00 112.12 ? 87  GLU D CB  1 
ATOM   9019  C CG  . GLU D 1 87  ? 66.803  42.708  231.052 1.00 113.94 ? 87  GLU D CG  1 
ATOM   9020  C CD  . GLU D 1 87  ? 68.167  42.569  231.677 1.00 128.10 ? 87  GLU D CD  1 
ATOM   9021  O OE1 . GLU D 1 87  ? 68.625  43.560  232.323 1.00 134.47 ? 87  GLU D OE1 1 
ATOM   9022  O OE2 . GLU D 1 87  ? 68.785  41.487  231.515 1.00 136.02 ? 87  GLU D OE2 1 
ATOM   9023  N N   . ASP D 1 88  ? 64.397  43.044  228.637 1.00 110.84 ? 88  ASP D N   1 
ATOM   9024  C CA  . ASP D 1 88  ? 63.594  41.969  228.102 1.00 103.90 ? 88  ASP D CA  1 
ATOM   9025  C C   . ASP D 1 88  ? 64.516  41.091  227.331 1.00 97.58  ? 88  ASP D C   1 
ATOM   9026  O O   . ASP D 1 88  ? 64.966  41.441  226.240 1.00 94.18  ? 88  ASP D O   1 
ATOM   9027  C CB  . ASP D 1 88  ? 62.513  42.417  227.110 1.00 106.45 ? 88  ASP D CB  1 
ATOM   9028  C CG  . ASP D 1 88  ? 61.816  41.218  226.404 1.00 107.49 ? 88  ASP D CG  1 
ATOM   9029  O OD1 . ASP D 1 88  ? 62.042  40.046  226.804 1.00 104.38 ? 88  ASP D OD1 1 
ATOM   9030  O OD2 . ASP D 1 88  ? 61.037  41.441  225.463 1.00 107.35 ? 88  ASP D OD2 1 
ATOM   9031  N N   . SER D 1 89  ? 64.830  39.976  227.906 1.00 92.86  ? 89  SER D N   1 
ATOM   9032  C CA  . SER D 1 89  ? 65.640  39.072  227.184 1.00 90.04  ? 89  SER D CA  1 
ATOM   9033  C C   . SER D 1 89  ? 64.704  37.921  227.015 1.00 87.21  ? 89  SER D C   1 
ATOM   9034  O O   . SER D 1 89  ? 64.052  37.495  227.952 1.00 90.18  ? 89  SER D O   1 
ATOM   9035  C CB  . SER D 1 89  ? 66.871  38.667  227.938 1.00 94.00  ? 89  SER D CB  1 
ATOM   9036  O OG  . SER D 1 89  ? 67.618  37.826  227.082 1.00 100.34 ? 89  SER D OG  1 
ATOM   9037  N N   . PRO D 1 90  ? 64.529  37.500  225.777 1.00 82.72  ? 90  PRO D N   1 
ATOM   9038  C CA  . PRO D 1 90  ? 63.684  36.415  225.312 1.00 79.91  ? 90  PRO D CA  1 
ATOM   9039  C C   . PRO D 1 90  ? 64.010  35.035  225.794 1.00 76.13  ? 90  PRO D C   1 
ATOM   9040  O O   . PRO D 1 90  ? 63.291  34.497  226.606 1.00 74.29  ? 90  PRO D O   1 
ATOM   9041  C CB  . PRO D 1 90  ? 63.839  36.507  223.813 1.00 83.65  ? 90  PRO D CB  1 
ATOM   9042  C CG  . PRO D 1 90  ? 63.892  37.952  223.618 1.00 87.52  ? 90  PRO D CG  1 
ATOM   9043  C CD  . PRO D 1 90  ? 64.862  38.394  224.665 1.00 83.59  ? 90  PRO D CD  1 
ATOM   9044  N N   . GLY D 1 91  ? 65.045  34.437  225.214 1.00 74.10  ? 91  GLY D N   1 
ATOM   9045  C CA  . GLY D 1 91  ? 65.424  33.074  225.558 1.00 73.89  ? 91  GLY D CA  1 
ATOM   9046  C C   . GLY D 1 91  ? 65.203  32.337  224.250 1.00 72.13  ? 91  GLY D C   1 
ATOM   9047  O O   . GLY D 1 91  ? 64.076  32.101  223.821 1.00 67.52  ? 91  GLY D O   1 
ATOM   9048  N N   . ASN D 1 92  ? 66.280  31.904  223.633 1.00 73.40  ? 92  ASN D N   1 
ATOM   9049  C CA  . ASN D 1 92  ? 66.137  31.307  222.330 1.00 80.14  ? 92  ASN D CA  1 
ATOM   9050  C C   . ASN D 1 92  ? 65.167  30.172  222.047 1.00 81.01  ? 92  ASN D C   1 
ATOM   9051  O O   . ASN D 1 92  ? 64.776  29.959  220.908 1.00 82.72  ? 92  ASN D O   1 
ATOM   9052  C CB  . ASN D 1 92  ? 67.505  31.067  221.706 1.00 87.72  ? 92  ASN D CB  1 
ATOM   9053  C CG  . ASN D 1 92  ? 67.913  32.213  220.774 1.00 93.82  ? 92  ASN D CG  1 
ATOM   9054  O OD1 . ASN D 1 92  ? 67.346  33.314  220.842 1.00 98.19  ? 92  ASN D OD1 1 
ATOM   9055  N ND2 . ASN D 1 92  ? 68.866  31.955  219.888 1.00 95.25  ? 92  ASN D ND2 1 
ATOM   9056  N N   . ASN D 1 93  ? 64.696  29.501  223.078 1.00 80.89  ? 93  ASN D N   1 
ATOM   9057  C CA  . ASN D 1 93  ? 63.765  28.388  222.879 1.00 81.27  ? 93  ASN D CA  1 
ATOM   9058  C C   . ASN D 1 93  ? 62.440  28.795  223.495 1.00 78.06  ? 93  ASN D C   1 
ATOM   9059  O O   . ASN D 1 93  ? 61.579  27.980  223.825 1.00 78.08  ? 93  ASN D O   1 
ATOM   9060  C CB  . ASN D 1 93  ? 64.324  27.149  223.546 1.00 91.41  ? 93  ASN D CB  1 
ATOM   9061  C CG  . ASN D 1 93  ? 65.153  27.498  224.759 1.00 105.46 ? 93  ASN D CG  1 
ATOM   9062  O OD1 . ASN D 1 93  ? 66.277  27.029  224.919 1.00 114.28 ? 93  ASN D OD1 1 
ATOM   9063  N ND2 . ASN D 1 93  ? 64.631  28.398  225.590 1.00 113.74 ? 93  ASN D ND2 1 
ATOM   9064  N N   . THR D 1 94  ? 62.327  30.085  223.717 1.00 72.26  ? 94  THR D N   1 
ATOM   9065  C CA  . THR D 1 94  ? 61.135  30.665  224.255 1.00 71.09  ? 94  THR D CA  1 
ATOM   9066  C C   . THR D 1 94  ? 60.461  31.180  223.025 1.00 68.87  ? 94  THR D C   1 
ATOM   9067  O O   . THR D 1 94  ? 59.401  31.788  223.082 1.00 71.98  ? 94  THR D O   1 
ATOM   9068  C CB  . THR D 1 94  ? 61.523  31.869  225.051 1.00 73.57  ? 94  THR D CB  1 
ATOM   9069  O OG1 . THR D 1 94  ? 62.406  31.444  226.082 1.00 79.14  ? 94  THR D OG1 1 
ATOM   9070  C CG2 . THR D 1 94  ? 60.313  32.591  225.631 1.00 77.49  ? 94  THR D CG2 1 
ATOM   9071  N N   . LEU D 1 95  ? 61.067  30.919  221.885 1.00 64.81  ? 95  LEU D N   1 
ATOM   9072  C CA  . LEU D 1 95  ? 60.531  31.476  220.692 1.00 61.91  ? 95  LEU D CA  1 
ATOM   9073  C C   . LEU D 1 95  ? 60.171  30.625  219.553 1.00 59.39  ? 95  LEU D C   1 
ATOM   9074  O O   . LEU D 1 95  ? 60.990  29.934  218.974 1.00 62.51  ? 95  LEU D O   1 
ATOM   9075  C CB  . LEU D 1 95  ? 61.449  32.575  220.219 1.00 64.91  ? 95  LEU D CB  1 
ATOM   9076  C CG  . LEU D 1 95  ? 61.344  33.642  221.289 1.00 70.47  ? 95  LEU D CG  1 
ATOM   9077  C CD1 . LEU D 1 95  ? 62.554  34.562  221.326 1.00 67.80  ? 95  LEU D CD1 1 
ATOM   9078  C CD2 . LEU D 1 95  ? 60.008  34.350  221.047 1.00 75.70  ? 95  LEU D CD2 1 
ATOM   9079  N N   . PRO D 1 96  ? 58.889  30.551  219.303 1.00 57.97  ? 96  PRO D N   1 
ATOM   9080  C CA  . PRO D 1 96  ? 58.387  29.770  218.186 1.00 55.60  ? 96  PRO D CA  1 
ATOM   9081  C C   . PRO D 1 96  ? 58.901  30.514  216.946 1.00 50.58  ? 96  PRO D C   1 
ATOM   9082  O O   . PRO D 1 96  ? 58.891  31.769  216.859 1.00 49.17  ? 96  PRO D O   1 
ATOM   9083  C CB  . PRO D 1 96  ? 56.870  29.832  218.373 1.00 57.44  ? 96  PRO D CB  1 
ATOM   9084  C CG  . PRO D 1 96  ? 56.662  30.924  219.413 1.00 62.02  ? 96  PRO D CG  1 
ATOM   9085  C CD  . PRO D 1 96  ? 57.840  30.806  220.290 1.00 58.91  ? 96  PRO D CD  1 
ATOM   9086  N N   . THR D 1 97  ? 59.342  29.712  215.995 1.00 45.32  ? 97  THR D N   1 
ATOM   9087  C CA  . THR D 1 97  ? 59.964  30.196  214.792 1.00 44.48  ? 97  THR D CA  1 
ATOM   9088  C C   . THR D 1 97  ? 59.384  29.621  213.531 1.00 44.23  ? 97  THR D C   1 
ATOM   9089  O O   . THR D 1 97  ? 58.896  28.492  213.517 1.00 44.50  ? 97  THR D O   1 
ATOM   9090  C CB  . THR D 1 97  ? 61.379  29.751  214.846 1.00 46.95  ? 97  THR D CB  1 
ATOM   9091  O OG1 . THR D 1 97  ? 61.490  28.734  215.859 1.00 51.38  ? 97  THR D OG1 1 
ATOM   9092  C CG2 . THR D 1 97  ? 62.258  30.873  215.209 1.00 51.19  ? 97  THR D CG2 1 
ATOM   9093  N N   . TRP D 1 98  ? 59.449  30.404  212.466 1.00 45.35  ? 98  TRP D N   1 
ATOM   9094  C CA  . TRP D 1 98  ? 58.956  29.991  211.163 1.00 48.57  ? 98  TRP D CA  1 
ATOM   9095  C C   . TRP D 1 98  ? 59.476  28.631  210.781 1.00 49.29  ? 98  TRP D C   1 
ATOM   9096  O O   . TRP D 1 98  ? 60.678  28.431  210.830 1.00 56.03  ? 98  TRP D O   1 
ATOM   9097  C CB  . TRP D 1 98  ? 59.395  31.008  210.103 1.00 49.90  ? 98  TRP D CB  1 
ATOM   9098  C CG  . TRP D 1 98  ? 58.388  32.099  209.913 1.00 45.87  ? 98  TRP D CG  1 
ATOM   9099  C CD1 . TRP D 1 98  ? 58.382  33.345  210.492 1.00 40.27  ? 98  TRP D CD1 1 
ATOM   9100  C CD2 . TRP D 1 98  ? 57.170  31.987  209.188 1.00 45.46  ? 98  TRP D CD2 1 
ATOM   9101  N NE1 . TRP D 1 98  ? 57.219  34.005  210.181 1.00 39.85  ? 98  TRP D NE1 1 
ATOM   9102  C CE2 . TRP D 1 98  ? 56.454  33.197  209.379 1.00 44.47  ? 98  TRP D CE2 1 
ATOM   9103  C CE3 . TRP D 1 98  ? 56.599  30.970  208.405 1.00 46.69  ? 98  TRP D CE3 1 
ATOM   9104  C CZ2 . TRP D 1 98  ? 55.197  33.420  208.821 1.00 46.45  ? 98  TRP D CZ2 1 
ATOM   9105  C CZ3 . TRP D 1 98  ? 55.351  31.183  207.853 1.00 49.77  ? 98  TRP D CZ3 1 
ATOM   9106  C CH2 . TRP D 1 98  ? 54.661  32.404  208.064 1.00 50.12  ? 98  TRP D CH2 1 
ATOM   9107  N N   . SER D 1 99  ? 58.588  27.717  210.386 1.00 46.96  ? 99  SER D N   1 
ATOM   9108  C CA  . SER D 1 99  ? 58.978  26.360  209.981 1.00 47.92  ? 99  SER D CA  1 
ATOM   9109  C C   . SER D 1 99  ? 58.889  26.310  208.477 1.00 46.96  ? 99  SER D C   1 
ATOM   9110  O O   . SER D 1 99  ? 57.919  26.817  207.895 1.00 48.96  ? 99  SER D O   1 
ATOM   9111  C CB  . SER D 1 99  ? 58.019  25.307  210.544 1.00 50.85  ? 99  SER D CB  1 
ATOM   9112  O OG  . SER D 1 99  ? 57.597  25.619  211.871 1.00 61.53  ? 99  SER D OG  1 
ATOM   9113  N N   . MET D 1 100 ? 59.866  25.673  207.839 1.00 47.05  ? 100 MET D N   1 
ATOM   9114  C CA  . MET D 1 100 ? 59.863  25.600  206.370 1.00 50.19  ? 100 MET D CA  1 
ATOM   9115  C C   . MET D 1 100 ? 60.823  24.568  205.758 1.00 48.91  ? 100 MET D C   1 
ATOM   9116  O O   . MET D 1 100 ? 61.729  24.070  206.445 1.00 52.33  ? 100 MET D O   1 
ATOM   9117  C CB  . MET D 1 100 ? 60.245  26.959  205.801 1.00 54.82  ? 100 MET D CB  1 
ATOM   9118  C CG  . MET D 1 100 ? 61.768  27.190  205.794 1.00 58.08  ? 100 MET D CG  1 
ATOM   9119  S SD  . MET D 1 100 ? 62.650  26.303  204.476 1.00 57.58  ? 100 MET D SD  1 
ATOM   9120  C CE  . MET D 1 100 ? 63.477  27.688  203.682 1.00 62.61  ? 100 MET D CE  1 
ATOM   9121  N N   . ALA D 1 101 ? 60.682  24.342  204.446 1.00 45.62  ? 101 ALA D N   1 
ATOM   9122  C CA  . ALA D 1 101 ? 61.523  23.405  203.698 1.00 44.98  ? 101 ALA D CA  1 
ATOM   9123  C C   . ALA D 1 101 ? 61.418  23.656  202.191 1.00 44.66  ? 101 ALA D C   1 
ATOM   9124  O O   . ALA D 1 101 ? 60.537  24.396  201.733 1.00 44.53  ? 101 ALA D O   1 
ATOM   9125  C CB  . ALA D 1 101 ? 61.114  21.981  204.014 1.00 43.26  ? 101 ALA D CB  1 
ATOM   9126  N N   . LYS D 1 102 ? 62.306  23.038  201.419 1.00 43.69  ? 102 LYS D N   1 
ATOM   9127  C CA  . LYS D 1 102 ? 62.263  23.205  199.980 1.00 44.31  ? 102 LYS D CA  1 
ATOM   9128  C C   . LYS D 1 102 ? 62.312  21.888  199.283 1.00 39.59  ? 102 LYS D C   1 
ATOM   9129  O O   . LYS D 1 102 ? 63.238  21.112  199.464 1.00 39.15  ? 102 LYS D O   1 
ATOM   9130  C CB  . LYS D 1 102 ? 63.412  24.061  199.482 1.00 55.46  ? 102 LYS D CB  1 
ATOM   9131  C CG  . LYS D 1 102 ? 63.545  24.048  197.964 1.00 68.89  ? 102 LYS D CG  1 
ATOM   9132  C CD  . LYS D 1 102 ? 64.646  25.021  197.427 1.00 86.77  ? 102 LYS D CD  1 
ATOM   9133  C CE  . LYS D 1 102 ? 66.068  24.390  197.209 1.00 97.70  ? 102 LYS D CE  1 
ATOM   9134  N NZ  . LYS D 1 102 ? 67.002  25.210  196.314 1.00 103.88 ? 102 LYS D NZ  1 
ATOM   9135  N N   . LEU D 1 103 ? 61.280  21.621  198.515 1.00 37.56  ? 103 LEU D N   1 
ATOM   9136  C CA  . LEU D 1 103 ? 61.218  20.395  197.762 1.00 42.03  ? 103 LEU D CA  1 
ATOM   9137  C C   . LEU D 1 103 ? 62.037  20.626  196.561 1.00 44.36  ? 103 LEU D C   1 
ATOM   9138  O O   . LEU D 1 103 ? 61.910  21.673  195.915 1.00 43.35  ? 103 LEU D O   1 
ATOM   9139  C CB  . LEU D 1 103 ? 59.824  20.133  197.249 1.00 44.42  ? 103 LEU D CB  1 
ATOM   9140  C CG  . LEU D 1 103 ? 58.947  19.418  198.230 1.00 45.51  ? 103 LEU D CG  1 
ATOM   9141  C CD1 . LEU D 1 103 ? 59.414  17.998  198.348 1.00 46.77  ? 103 LEU D CD1 1 
ATOM   9142  C CD2 . LEU D 1 103 ? 59.021  20.177  199.537 1.00 43.21  ? 103 LEU D CD2 1 
ATOM   9143  N N   . GLN D 1 104 ? 62.784  19.608  196.179 1.00 46.36  ? 104 GLN D N   1 
ATOM   9144  C CA  . GLN D 1 104 ? 63.596  19.758  195.001 1.00 49.70  ? 104 GLN D CA  1 
ATOM   9145  C C   . GLN D 1 104 ? 63.102  18.983  193.794 1.00 46.94  ? 104 GLN D C   1 
ATOM   9146  O O   . GLN D 1 104 ? 63.226  17.750  193.699 1.00 47.04  ? 104 GLN D O   1 
ATOM   9147  C CB  . GLN D 1 104 ? 65.032  19.424  195.326 1.00 58.29  ? 104 GLN D CB  1 
ATOM   9148  C CG  . GLN D 1 104 ? 65.960  19.485  194.124 1.00 70.23  ? 104 GLN D CG  1 
ATOM   9149  C CD  . GLN D 1 104 ? 66.023  20.841  193.451 1.00 73.29  ? 104 GLN D CD  1 
ATOM   9150  O OE1 . GLN D 1 104 ? 66.891  21.684  193.758 1.00 78.40  ? 104 GLN D OE1 1 
ATOM   9151  N NE2 . GLN D 1 104 ? 65.138  21.047  192.492 1.00 76.75  ? 104 GLN D NE2 1 
ATOM   9152  N N   . LEU D 1 105 ? 62.539  19.723  192.858 1.00 45.10  ? 105 LEU D N   1 
ATOM   9153  C CA  . LEU D 1 105 ? 62.039  19.099  191.665 1.00 46.26  ? 105 LEU D CA  1 
ATOM   9154  C C   . LEU D 1 105 ? 63.167  18.786  190.695 1.00 50.11  ? 105 LEU D C   1 
ATOM   9155  O O   . LEU D 1 105 ? 64.320  19.104  190.945 1.00 50.84  ? 105 LEU D O   1 
ATOM   9156  C CB  . LEU D 1 105 ? 60.942  19.954  191.062 1.00 41.89  ? 105 LEU D CB  1 
ATOM   9157  C CG  . LEU D 1 105 ? 59.683  19.556  191.824 1.00 40.15  ? 105 LEU D CG  1 
ATOM   9158  C CD1 . LEU D 1 105 ? 59.737  20.040  193.265 1.00 36.43  ? 105 LEU D CD1 1 
ATOM   9159  C CD2 . LEU D 1 105 ? 58.477  20.083  191.127 1.00 37.51  ? 105 LEU D CD2 1 
ATOM   9160  N N   . PRO D 1 106 ? 62.871  18.059  189.627 1.00 54.12  ? 106 PRO D N   1 
ATOM   9161  C CA  . PRO D 1 106 ? 63.880  17.700  188.636 1.00 60.33  ? 106 PRO D CA  1 
ATOM   9162  C C   . PRO D 1 106 ? 63.900  18.822  187.652 1.00 64.50  ? 106 PRO D C   1 
ATOM   9163  O O   . PRO D 1 106 ? 63.017  19.651  187.714 1.00 67.13  ? 106 PRO D O   1 
ATOM   9164  C CB  . PRO D 1 106 ? 63.265  16.481  187.948 1.00 63.88  ? 106 PRO D CB  1 
ATOM   9165  C CG  . PRO D 1 106 ? 61.955  16.225  188.661 1.00 63.84  ? 106 PRO D CG  1 
ATOM   9166  C CD  . PRO D 1 106 ? 61.567  17.539  189.226 1.00 58.49  ? 106 PRO D CD  1 
ATOM   9167  N N   . MET D 1 107 ? 64.825  18.795  186.693 1.00 70.60  ? 107 MET D N   1 
ATOM   9168  C CA  . MET D 1 107 ? 64.901  19.841  185.665 1.00 78.08  ? 107 MET D CA  1 
ATOM   9169  C C   . MET D 1 107 ? 64.032  19.440  184.474 1.00 76.39  ? 107 MET D C   1 
ATOM   9170  O O   . MET D 1 107 ? 63.847  18.249  184.212 1.00 79.59  ? 107 MET D O   1 
ATOM   9171  C CB  . MET D 1 107 ? 66.350  20.069  185.230 1.00 90.20  ? 107 MET D CB  1 
ATOM   9172  C CG  . MET D 1 107 ? 66.658  21.515  184.774 1.00 104.82 ? 107 MET D CG  1 
ATOM   9173  S SD  . MET D 1 107 ? 68.462  21.926  184.512 1.00 121.10 ? 107 MET D SD  1 
ATOM   9174  C CE  . MET D 1 107 ? 68.958  22.522  186.215 1.00 117.56 ? 107 MET D CE  1 
ATOM   9175  N N   . LEU D 1 108 ? 63.477  20.418  183.767 1.00 75.44  ? 108 LEU D N   1 
ATOM   9176  C CA  . LEU D 1 108 ? 62.599  20.099  182.650 1.00 80.02  ? 108 LEU D CA  1 
ATOM   9177  C C   . LEU D 1 108 ? 63.211  20.285  181.263 1.00 84.85  ? 108 LEU D C   1 
ATOM   9178  O O   . LEU D 1 108 ? 64.431  20.273  181.134 1.00 88.37  ? 108 LEU D O   1 
ATOM   9179  C CB  . LEU D 1 108 ? 61.249  20.807  182.831 1.00 77.52  ? 108 LEU D CB  1 
ATOM   9180  C CG  . LEU D 1 108 ? 60.193  20.045  183.675 1.00 75.74  ? 108 LEU D CG  1 
ATOM   9181  C CD1 . LEU D 1 108 ? 60.812  19.213  184.771 1.00 77.00  ? 108 LEU D CD1 1 
ATOM   9182  C CD2 . LEU D 1 108 ? 59.171  20.969  184.285 1.00 72.91  ? 108 LEU D CD2 1 
ATOM   9183  N N   . ASN D 1 109 ? 62.387  20.375  180.219 1.00 90.18  ? 109 ASN D N   1 
ATOM   9184  C CA  . ASN D 1 109 ? 62.903  20.522  178.848 1.00 95.86  ? 109 ASN D CA  1 
ATOM   9185  C C   . ASN D 1 109 ? 62.856  21.966  178.387 1.00 95.97  ? 109 ASN D C   1 
ATOM   9186  O O   . ASN D 1 109 ? 62.280  22.833  179.056 1.00 97.25  ? 109 ASN D O   1 
ATOM   9187  C CB  . ASN D 1 109 ? 62.102  19.669  177.849 1.00 104.11 ? 109 ASN D CB  1 
ATOM   9188  C CG  . ASN D 1 109 ? 61.672  18.320  178.428 1.00 114.17 ? 109 ASN D CG  1 
ATOM   9189  O OD1 . ASN D 1 109 ? 60.498  17.919  178.320 1.00 118.05 ? 109 ASN D OD1 1 
ATOM   9190  N ND2 . ASN D 1 109 ? 62.612  17.622  179.065 1.00 119.32 ? 109 ASN D ND2 1 
ATOM   9191  N N   . GLU D 1 110 ? 63.418  22.212  177.212 1.00 95.31  ? 110 GLU D N   1 
ATOM   9192  C CA  . GLU D 1 110 ? 63.445  23.554  176.648 1.00 95.24  ? 110 GLU D CA  1 
ATOM   9193  C C   . GLU D 1 110 ? 63.364  23.470  175.137 1.00 95.18  ? 110 GLU D C   1 
ATOM   9194  O O   . GLU D 1 110 ? 63.213  22.378  174.567 1.00 94.56  ? 110 GLU D O   1 
ATOM   9195  C CB  . GLU D 1 110 ? 64.728  24.294  177.065 1.00 95.79  ? 110 GLU D CB  1 
ATOM   9196  C CG  . GLU D 1 110 ? 66.024  23.460  176.945 1.00 94.01  ? 110 GLU D CG  1 
ATOM   9197  C CD  . GLU D 1 110 ? 67.298  24.260  177.210 1.00 91.80  ? 110 GLU D CD  1 
ATOM   9198  O OE1 . GLU D 1 110 ? 67.273  25.239  177.992 1.00 88.78  ? 110 GLU D OE1 1 
ATOM   9199  O OE2 . GLU D 1 110 ? 68.337  23.899  176.623 1.00 91.68  ? 110 GLU D OE2 1 
ATOM   9200  N N   . ASP D 1 111 ? 63.476  24.634  174.505 1.00 95.92  ? 111 ASP D N   1 
ATOM   9201  C CA  . ASP D 1 111 ? 63.424  24.770  173.054 1.00 95.78  ? 111 ASP D CA  1 
ATOM   9202  C C   . ASP D 1 111 ? 64.010  26.152  172.776 1.00 94.97  ? 111 ASP D C   1 
ATOM   9203  O O   . ASP D 1 111 ? 63.297  27.153  172.660 1.00 91.75  ? 111 ASP D O   1 
ATOM   9204  C CB  . ASP D 1 111 ? 61.966  24.659  172.595 1.00 96.12  ? 111 ASP D CB  1 
ATOM   9205  C CG  . ASP D 1 111 ? 61.808  24.715  171.097 1.00 97.44  ? 111 ASP D CG  1 
ATOM   9206  O OD1 . ASP D 1 111 ? 62.347  25.664  170.502 1.00 98.57  ? 111 ASP D OD1 1 
ATOM   9207  O OD2 . ASP D 1 111 ? 61.110  23.839  170.528 1.00 97.89  ? 111 ASP D OD2 1 
ATOM   9208  N N   . LEU D 1 112 ? 65.338  26.188  172.741 1.00 98.96  ? 112 LEU D N   1 
ATOM   9209  C CA  . LEU D 1 112 ? 66.118  27.415  172.523 1.00 105.44 ? 112 LEU D CA  1 
ATOM   9210  C C   . LEU D 1 112 ? 65.706  28.082  171.242 1.00 106.09 ? 112 LEU D C   1 
ATOM   9211  O O   . LEU D 1 112 ? 66.028  29.251  171.008 1.00 107.51 ? 112 LEU D O   1 
ATOM   9212  C CB  . LEU D 1 112 ? 67.625  27.121  172.437 1.00 111.09 ? 112 LEU D CB  1 
ATOM   9213  C CG  . LEU D 1 112 ? 68.268  26.114  173.405 1.00 116.56 ? 112 LEU D CG  1 
ATOM   9214  C CD1 . LEU D 1 112 ? 67.980  24.669  172.939 1.00 120.16 ? 112 LEU D CD1 1 
ATOM   9215  C CD2 . LEU D 1 112 ? 69.777  26.347  173.483 1.00 118.84 ? 112 LEU D CD2 1 
ATOM   9216  N N   . THR D 1 113 ? 65.062  27.295  170.390 1.00 106.29 ? 113 THR D N   1 
ATOM   9217  C CA  . THR D 1 113 ? 64.583  27.762  169.106 1.00 106.64 ? 113 THR D CA  1 
ATOM   9218  C C   . THR D 1 113 ? 63.467  28.761  169.354 1.00 103.86 ? 113 THR D C   1 
ATOM   9219  O O   . THR D 1 113 ? 63.428  29.827  168.741 1.00 107.70 ? 113 THR D O   1 
ATOM   9220  C CB  . THR D 1 113 ? 64.005  26.597  168.293 1.00 108.95 ? 113 THR D CB  1 
ATOM   9221  O OG1 . THR D 1 113 ? 64.727  25.397  168.611 1.00 115.62 ? 113 THR D OG1 1 
ATOM   9222  C CG2 . THR D 1 113 ? 64.093  26.879  166.797 1.00 109.10 ? 113 THR D CG2 1 
ATOM   9223  N N   . CYS D 1 114 ? 62.592  28.439  170.296 1.00 96.86  ? 114 CYS D N   1 
ATOM   9224  C CA  . CYS D 1 114 ? 61.475  29.307  170.589 1.00 90.34  ? 114 CYS D CA  1 
ATOM   9225  C C   . CYS D 1 114 ? 61.654  30.038  171.897 1.00 82.36  ? 114 CYS D C   1 
ATOM   9226  O O   . CYS D 1 114 ? 60.680  30.564  172.438 1.00 82.77  ? 114 CYS D O   1 
ATOM   9227  C CB  . CYS D 1 114 ? 60.208  28.476  170.623 1.00 97.89  ? 114 CYS D CB  1 
ATOM   9228  S SG  . CYS D 1 114 ? 60.076  27.281  169.254 1.00 105.76 ? 114 CYS D SG  1 
ATOM   9229  N N   . ASP D 1 115 ? 62.891  30.063  172.400 1.00 73.62  ? 115 ASP D N   1 
ATOM   9230  C CA  . ASP D 1 115 ? 63.232  30.720  173.663 1.00 66.08  ? 115 ASP D CA  1 
ATOM   9231  C C   . ASP D 1 115 ? 62.153  30.348  174.679 1.00 59.90  ? 115 ASP D C   1 
ATOM   9232  O O   . ASP D 1 115 ? 61.679  31.126  175.508 1.00 52.01  ? 115 ASP D O   1 
ATOM   9233  C CB  . ASP D 1 115 ? 63.301  32.225  173.453 1.00 69.45  ? 115 ASP D CB  1 
ATOM   9234  C CG  . ASP D 1 115 ? 64.431  32.862  174.222 1.00 72.47  ? 115 ASP D CG  1 
ATOM   9235  O OD1 . ASP D 1 115 ? 65.589  32.675  173.791 1.00 76.99  ? 115 ASP D OD1 1 
ATOM   9236  O OD2 . ASP D 1 115 ? 64.163  33.551  175.236 1.00 72.74  ? 115 ASP D OD2 1 
ATOM   9237  N N   . THR D 1 116 ? 61.696  29.133  174.525 1.00 56.71  ? 116 THR D N   1 
ATOM   9238  C CA  . THR D 1 116 ? 60.675  28.656  175.379 1.00 55.87  ? 116 THR D CA  1 
ATOM   9239  C C   . THR D 1 116 ? 61.315  27.697  176.362 1.00 53.23  ? 116 THR D C   1 
ATOM   9240  O O   . THR D 1 116 ? 62.066  26.765  176.033 1.00 51.55  ? 116 THR D O   1 
ATOM   9241  C CB  . THR D 1 116 ? 59.559  28.040  174.565 1.00 59.21  ? 116 THR D CB  1 
ATOM   9242  O OG1 . THR D 1 116 ? 58.700  27.305  175.425 1.00 64.25  ? 116 THR D OG1 1 
ATOM   9243  C CG2 . THR D 1 116 ? 60.105  27.108  173.542 1.00 66.00  ? 116 THR D CG2 1 
ATOM   9244  N N   . LEU D 1 117 ? 61.013  27.970  177.602 1.00 50.82  ? 117 LEU D N   1 
ATOM   9245  C CA  . LEU D 1 117 ? 61.557  27.223  178.676 1.00 47.64  ? 117 LEU D CA  1 
ATOM   9246  C C   . LEU D 1 117 ? 60.389  26.596  179.346 1.00 44.94  ? 117 LEU D C   1 
ATOM   9247  O O   . LEU D 1 117 ? 59.293  27.142  179.333 1.00 45.31  ? 117 LEU D O   1 
ATOM   9248  C CB  . LEU D 1 117 ? 62.186  28.225  179.598 1.00 55.90  ? 117 LEU D CB  1 
ATOM   9249  C CG  . LEU D 1 117 ? 63.413  27.694  180.287 1.00 65.27  ? 117 LEU D CG  1 
ATOM   9250  C CD1 . LEU D 1 117 ? 64.299  28.884  180.718 1.00 67.07  ? 117 LEU D CD1 1 
ATOM   9251  C CD2 . LEU D 1 117 ? 62.976  26.784  181.454 1.00 70.77  ? 117 LEU D CD2 1 
ATOM   9252  N N   . GLN D 1 118 ? 60.608  25.459  179.961 1.00 42.10  ? 118 GLN D N   1 
ATOM   9253  C CA  . GLN D 1 118 ? 59.510  24.799  180.628 1.00 43.98  ? 118 GLN D CA  1 
ATOM   9254  C C   . GLN D 1 118 ? 59.823  24.757  182.102 1.00 44.71  ? 118 GLN D C   1 
ATOM   9255  O O   . GLN D 1 118 ? 60.923  24.336  182.453 1.00 50.85  ? 118 GLN D O   1 
ATOM   9256  C CB  . GLN D 1 118 ? 59.437  23.389  180.094 1.00 43.53  ? 118 GLN D CB  1 
ATOM   9257  C CG  . GLN D 1 118 ? 58.152  22.682  180.314 1.00 49.95  ? 118 GLN D CG  1 
ATOM   9258  C CD  . GLN D 1 118 ? 58.195  21.272  179.739 1.00 57.31  ? 118 GLN D CD  1 
ATOM   9259  O OE1 . GLN D 1 118 ? 57.322  20.875  178.960 1.00 61.62  ? 118 GLN D OE1 1 
ATOM   9260  N NE2 . GLN D 1 118 ? 59.216  20.501  180.128 1.00 59.69  ? 118 GLN D NE2 1 
ATOM   9261  N N   . MET D 1 119 ? 58.942  25.261  182.965 1.00 42.99  ? 119 MET D N   1 
ATOM   9262  C CA  . MET D 1 119 ? 59.217  25.167  184.394 1.00 44.15  ? 119 MET D CA  1 
ATOM   9263  C C   . MET D 1 119 ? 58.096  24.647  185.266 1.00 44.68  ? 119 MET D C   1 
ATOM   9264  O O   . MET D 1 119 ? 56.941  24.533  184.822 1.00 42.61  ? 119 MET D O   1 
ATOM   9265  C CB  . MET D 1 119 ? 59.806  26.438  184.962 1.00 47.23  ? 119 MET D CB  1 
ATOM   9266  C CG  . MET D 1 119 ? 59.131  27.682  184.526 1.00 52.79  ? 119 MET D CG  1 
ATOM   9267  S SD  . MET D 1 119 ? 59.834  29.027  185.487 1.00 66.66  ? 119 MET D SD  1 
ATOM   9268  C CE  . MET D 1 119 ? 60.723  30.047  184.239 1.00 53.91  ? 119 MET D CE  1 
ATOM   9269  N N   . TRP D 1 120 ? 58.470  24.267  186.492 1.00 45.76  ? 120 TRP D N   1 
ATOM   9270  C CA  . TRP D 1 120 ? 57.526  23.683  187.451 1.00 47.66  ? 120 TRP D CA  1 
ATOM   9271  C C   . TRP D 1 120 ? 56.549  24.695  188.014 1.00 45.14  ? 120 TRP D C   1 
ATOM   9272  O O   . TRP D 1 120 ? 56.963  25.707  188.597 1.00 44.59  ? 120 TRP D O   1 
ATOM   9273  C CB  . TRP D 1 120 ? 58.260  22.939  188.589 1.00 48.99  ? 120 TRP D CB  1 
ATOM   9274  C CG  . TRP D 1 120 ? 58.724  21.511  188.235 1.00 50.65  ? 120 TRP D CG  1 
ATOM   9275  C CD1 . TRP D 1 120 ? 60.006  21.083  188.099 1.00 50.97  ? 120 TRP D CD1 1 
ATOM   9276  C CD2 . TRP D 1 120 ? 57.901  20.377  187.932 1.00 50.84  ? 120 TRP D CD2 1 
ATOM   9277  N NE1 . TRP D 1 120 ? 60.037  19.770  187.716 1.00 45.75  ? 120 TRP D NE1 1 
ATOM   9278  C CE2 . TRP D 1 120 ? 58.759  19.312  187.605 1.00 48.60  ? 120 TRP D CE2 1 
ATOM   9279  C CE3 . TRP D 1 120 ? 56.525  20.161  187.908 1.00 55.18  ? 120 TRP D CE3 1 
ATOM   9280  C CZ2 . TRP D 1 120 ? 58.290  18.054  187.253 1.00 55.82  ? 120 TRP D CZ2 1 
ATOM   9281  C CZ3 . TRP D 1 120 ? 56.059  18.897  187.558 1.00 59.13  ? 120 TRP D CZ3 1 
ATOM   9282  C CH2 . TRP D 1 120 ? 56.941  17.861  187.233 1.00 57.71  ? 120 TRP D CH2 1 
ATOM   9283  N N   . GLU D 1 121 ? 55.258  24.398  187.867 1.00 40.25  ? 121 GLU D N   1 
ATOM   9284  C CA  . GLU D 1 121 ? 54.209  25.295  188.332 1.00 34.23  ? 121 GLU D CA  1 
ATOM   9285  C C   . GLU D 1 121 ? 53.281  24.659  189.349 1.00 31.52  ? 121 GLU D C   1 
ATOM   9286  O O   . GLU D 1 121 ? 52.665  23.613  189.093 1.00 28.98  ? 121 GLU D O   1 
ATOM   9287  C CB  . GLU D 1 121 ? 53.385  25.750  187.143 1.00 36.30  ? 121 GLU D CB  1 
ATOM   9288  C CG  . GLU D 1 121 ? 52.549  26.963  187.400 1.00 38.34  ? 121 GLU D CG  1 
ATOM   9289  C CD  . GLU D 1 121 ? 51.297  26.983  186.546 1.00 41.94  ? 121 GLU D CD  1 
ATOM   9290  O OE1 . GLU D 1 121 ? 50.304  26.407  187.014 1.00 45.95  ? 121 GLU D OE1 1 
ATOM   9291  O OE2 . GLU D 1 121 ? 51.277  27.543  185.415 1.00 38.22  ? 121 GLU D OE2 1 
ATOM   9292  N N   . ALA D 1 122 ? 53.194  25.286  190.514 1.00 27.58  ? 122 ALA D N   1 
ATOM   9293  C CA  . ALA D 1 122 ? 52.324  24.778  191.561 1.00 22.54  ? 122 ALA D CA  1 
ATOM   9294  C C   . ALA D 1 122 ? 50.964  25.326  191.297 1.00 19.28  ? 122 ALA D C   1 
ATOM   9295  O O   . ALA D 1 122 ? 50.801  26.519  191.012 1.00 17.50  ? 122 ALA D O   1 
ATOM   9296  C CB  . ALA D 1 122 ? 52.777  25.209  192.886 1.00 22.42  ? 122 ALA D CB  1 
ATOM   9297  N N   . VAL D 1 123 ? 49.988  24.473  191.535 1.00 14.31  ? 123 VAL D N   1 
ATOM   9298  C CA  . VAL D 1 123 ? 48.624  24.818  191.264 1.00 14.81  ? 123 VAL D CA  1 
ATOM   9299  C C   . VAL D 1 123 ? 47.722  24.979  192.453 1.00 17.60  ? 123 VAL D C   1 
ATOM   9300  O O   . VAL D 1 123 ? 47.231  26.065  192.760 1.00 17.39  ? 123 VAL D O   1 
ATOM   9301  C CB  . VAL D 1 123 ? 48.028  23.768  190.390 1.00 10.64  ? 123 VAL D CB  1 
ATOM   9302  C CG1 . VAL D 1 123 ? 46.521  23.972  190.273 1.00 11.84  ? 123 VAL D CG1 1 
ATOM   9303  C CG2 . VAL D 1 123 ? 48.713  23.822  189.052 1.00 13.15  ? 123 VAL D CG2 1 
ATOM   9304  N N   . SER D 1 124 ? 47.383  23.854  193.031 1.00 18.47  ? 124 SER D N   1 
ATOM   9305  C CA  . SER D 1 124 ? 46.521  23.852  194.158 1.00 20.59  ? 124 SER D CA  1 
ATOM   9306  C C   . SER D 1 124 ? 47.334  23.179  195.196 1.00 21.64  ? 124 SER D C   1 
ATOM   9307  O O   . SER D 1 124 ? 48.465  22.748  194.953 1.00 21.63  ? 124 SER D O   1 
ATOM   9308  C CB  . SER D 1 124 ? 45.332  22.990  193.843 1.00 27.34  ? 124 SER D CB  1 
ATOM   9309  O OG  . SER D 1 124 ? 45.768  21.775  193.258 1.00 38.80  ? 124 SER D OG  1 
ATOM   9310  N N   . VAL D 1 125 ? 46.716  22.978  196.329 1.00 23.86  ? 125 VAL D N   1 
ATOM   9311  C CA  . VAL D 1 125 ? 47.407  22.342  197.394 1.00 28.90  ? 125 VAL D CA  1 
ATOM   9312  C C   . VAL D 1 125 ? 46.375  22.171  198.448 1.00 34.60  ? 125 VAL D C   1 
ATOM   9313  O O   . VAL D 1 125 ? 45.482  23.016  198.605 1.00 37.59  ? 125 VAL D O   1 
ATOM   9314  C CB  . VAL D 1 125 ? 48.499  23.281  197.989 1.00 26.43  ? 125 VAL D CB  1 
ATOM   9315  C CG1 . VAL D 1 125 ? 47.860  24.479  198.671 1.00 18.78  ? 125 VAL D CG1 1 
ATOM   9316  C CG2 . VAL D 1 125 ? 49.385  22.529  198.975 1.00 27.68  ? 125 VAL D CG2 1 
ATOM   9317  N N   . LYS D 1 126 ? 46.413  21.019  199.086 1.00 39.13  ? 126 LYS D N   1 
ATOM   9318  C CA  . LYS D 1 126 ? 45.543  20.805  200.220 1.00 43.25  ? 126 LYS D CA  1 
ATOM   9319  C C   . LYS D 1 126 ? 46.544  20.797  201.372 1.00 43.45  ? 126 LYS D C   1 
ATOM   9320  O O   . LYS D 1 126 ? 47.718  20.386  201.217 1.00 43.31  ? 126 LYS D O   1 
ATOM   9321  C CB  . LYS D 1 126 ? 44.882  19.432  200.208 1.00 48.54  ? 126 LYS D CB  1 
ATOM   9322  C CG  . LYS D 1 126 ? 44.218  18.952  198.934 1.00 56.95  ? 126 LYS D CG  1 
ATOM   9323  C CD  . LYS D 1 126 ? 43.423  17.667  199.305 1.00 66.00  ? 126 LYS D CD  1 
ATOM   9324  C CE  . LYS D 1 126 ? 42.625  17.041  198.140 1.00 73.01  ? 126 LYS D CE  1 
ATOM   9325  N NZ  . LYS D 1 126 ? 41.650  15.949  198.569 1.00 76.20  ? 126 LYS D NZ  1 
ATOM   9326  N N   . THR D 1 127 ? 46.113  21.261  202.524 1.00 41.12  ? 127 THR D N   1 
ATOM   9327  C CA  . THR D 1 127 ? 47.005  21.204  203.656 1.00 43.63  ? 127 THR D CA  1 
ATOM   9328  C C   . THR D 1 127 ? 46.124  20.830  204.813 1.00 44.63  ? 127 THR D C   1 
ATOM   9329  O O   . THR D 1 127 ? 44.889  20.859  204.670 1.00 50.95  ? 127 THR D O   1 
ATOM   9330  C CB  . THR D 1 127 ? 47.724  22.529  203.917 1.00 45.28  ? 127 THR D CB  1 
ATOM   9331  O OG1 . THR D 1 127 ? 48.659  22.332  204.979 1.00 49.46  ? 127 THR D OG1 1 
ATOM   9332  C CG2 . THR D 1 127 ? 46.750  23.644  204.319 1.00 45.10  ? 127 THR D CG2 1 
ATOM   9333  N N   . GLU D 1 128 ? 46.730  20.460  205.942 1.00 43.27  ? 128 GLU D N   1 
ATOM   9334  C CA  . GLU D 1 128 ? 45.941  20.090  207.108 1.00 42.49  ? 128 GLU D CA  1 
ATOM   9335  C C   . GLU D 1 128 ? 46.811  20.017  208.317 1.00 40.42  ? 128 GLU D C   1 
ATOM   9336  O O   . GLU D 1 128 ? 47.970  19.603  208.245 1.00 39.52  ? 128 GLU D O   1 
ATOM   9337  C CB  . GLU D 1 128 ? 45.325  18.744  206.875 1.00 48.58  ? 128 GLU D CB  1 
ATOM   9338  C CG  . GLU D 1 128 ? 44.195  18.394  207.749 1.00 57.29  ? 128 GLU D CG  1 
ATOM   9339  C CD  . GLU D 1 128 ? 43.785  16.974  207.472 1.00 65.09  ? 128 GLU D CD  1 
ATOM   9340  O OE1 . GLU D 1 128 ? 43.617  16.625  206.273 1.00 69.78  ? 128 GLU D OE1 1 
ATOM   9341  O OE2 . GLU D 1 128 ? 43.678  16.190  208.440 1.00 67.98  ? 128 GLU D OE2 1 
ATOM   9342  N N   . VAL D 1 129 ? 46.294  20.504  209.424 1.00 38.78  ? 129 VAL D N   1 
ATOM   9343  C CA  . VAL D 1 129 ? 47.106  20.436  210.601 1.00 41.91  ? 129 VAL D CA  1 
ATOM   9344  C C   . VAL D 1 129 ? 46.511  19.351  211.392 1.00 43.54  ? 129 VAL D C   1 
ATOM   9345  O O   . VAL D 1 129 ? 45.354  19.418  211.800 1.00 46.62  ? 129 VAL D O   1 
ATOM   9346  C CB  . VAL D 1 129 ? 47.092  21.676  211.449 1.00 43.63  ? 129 VAL D CB  1 
ATOM   9347  C CG1 . VAL D 1 129 ? 47.833  21.376  212.744 1.00 48.02  ? 129 VAL D CG1 1 
ATOM   9348  C CG2 . VAL D 1 129 ? 47.779  22.822  210.726 1.00 49.31  ? 129 VAL D CG2 1 
ATOM   9349  N N   . VAL D 1 130 ? 47.341  18.384  211.697 1.00 43.66  ? 130 VAL D N   1 
ATOM   9350  C CA  . VAL D 1 130 ? 46.857  17.252  212.420 1.00 40.97  ? 130 VAL D CA  1 
ATOM   9351  C C   . VAL D 1 130 ? 47.318  17.285  213.804 1.00 40.31  ? 130 VAL D C   1 
ATOM   9352  O O   . VAL D 1 130 ? 48.397  17.821  214.103 1.00 39.03  ? 130 VAL D O   1 
ATOM   9353  C CB  . VAL D 1 130 ? 47.407  16.022  211.828 1.00 40.91  ? 130 VAL D CB  1 
ATOM   9354  C CG1 . VAL D 1 130 ? 46.436  15.509  210.782 1.00 44.02  ? 130 VAL D CG1 1 
ATOM   9355  C CG2 . VAL D 1 130 ? 48.814  16.335  211.243 1.00 31.21  ? 130 VAL D CG2 1 
ATOM   9356  N N   . GLY D 1 131 ? 46.510  16.670  214.648 1.00 36.61  ? 131 GLY D N   1 
ATOM   9357  C CA  . GLY D 1 131 ? 46.907  16.587  216.036 1.00 39.62  ? 131 GLY D CA  1 
ATOM   9358  C C   . GLY D 1 131 ? 45.962  17.307  216.939 1.00 37.22  ? 131 GLY D C   1 
ATOM   9359  O O   . GLY D 1 131 ? 46.125  17.366  218.157 1.00 33.90  ? 131 GLY D O   1 
ATOM   9360  N N   . SER D 1 132 ? 44.927  17.820  216.325 1.00 36.05  ? 132 SER D N   1 
ATOM   9361  C CA  . SER D 1 132 ? 43.944  18.524  217.079 1.00 40.06  ? 132 SER D CA  1 
ATOM   9362  C C   . SER D 1 132 ? 43.516  17.629  218.234 1.00 41.44  ? 132 SER D C   1 
ATOM   9363  O O   . SER D 1 132 ? 43.532  18.067  219.381 1.00 40.56  ? 132 SER D O   1 
ATOM   9364  C CB  . SER D 1 132 ? 42.832  18.846  216.132 1.00 42.53  ? 132 SER D CB  1 
ATOM   9365  O OG  . SER D 1 132 ? 43.455  19.064  214.873 1.00 42.94  ? 132 SER D OG  1 
ATOM   9366  N N   . GLY D 1 133 ? 43.269  16.347  217.951 1.00 40.24  ? 133 GLY D N   1 
ATOM   9367  C CA  . GLY D 1 133 ? 42.884  15.408  219.013 1.00 44.35  ? 133 GLY D CA  1 
ATOM   9368  C C   . GLY D 1 133 ? 43.815  15.366  220.239 1.00 44.96  ? 133 GLY D C   1 
ATOM   9369  O O   . GLY D 1 133 ? 43.390  15.133  221.387 1.00 41.17  ? 133 GLY D O   1 
ATOM   9370  N N   . SER D 1 134 ? 45.091  15.637  219.994 1.00 46.54  ? 134 SER D N   1 
ATOM   9371  C CA  . SER D 1 134 ? 46.098  15.645  221.039 1.00 49.58  ? 134 SER D CA  1 
ATOM   9372  C C   . SER D 1 134 ? 45.695  16.598  222.149 1.00 51.41  ? 134 SER D C   1 
ATOM   9373  O O   . SER D 1 134 ? 46.094  16.439  223.292 1.00 54.01  ? 134 SER D O   1 
ATOM   9374  C CB  . SER D 1 134 ? 47.449  16.084  220.450 1.00 48.81  ? 134 SER D CB  1 
ATOM   9375  O OG  . SER D 1 134 ? 48.266  16.778  221.387 1.00 48.56  ? 134 SER D OG  1 
ATOM   9376  N N   . LEU D 1 135 ? 44.862  17.568  221.832 1.00 51.60  ? 135 LEU D N   1 
ATOM   9377  C CA  . LEU D 1 135 ? 44.500  18.528  222.849 1.00 55.64  ? 135 LEU D CA  1 
ATOM   9378  C C   . LEU D 1 135 ? 43.467  18.055  223.835 1.00 56.37  ? 135 LEU D C   1 
ATOM   9379  O O   . LEU D 1 135 ? 43.091  18.799  224.750 1.00 57.30  ? 135 LEU D O   1 
ATOM   9380  C CB  . LEU D 1 135 ? 44.070  19.838  222.204 1.00 58.63  ? 135 LEU D CB  1 
ATOM   9381  C CG  . LEU D 1 135 ? 45.187  20.528  221.422 1.00 57.04  ? 135 LEU D CG  1 
ATOM   9382  C CD1 . LEU D 1 135 ? 46.491  20.338  222.183 1.00 59.39  ? 135 LEU D CD1 1 
ATOM   9383  C CD2 . LEU D 1 135 ? 45.320  19.951  220.021 1.00 57.64  ? 135 LEU D CD2 1 
ATOM   9384  N N   . LEU D 1 136 ? 43.072  16.798  223.686 1.00 56.23  ? 136 LEU D N   1 
ATOM   9385  C CA  . LEU D 1 136 ? 42.063  16.202  224.544 1.00 62.48  ? 136 LEU D CA  1 
ATOM   9386  C C   . LEU D 1 136 ? 42.553  15.500  225.827 1.00 67.63  ? 136 LEU D C   1 
ATOM   9387  O O   . LEU D 1 136 ? 41.755  15.134  226.723 1.00 63.08  ? 136 LEU D O   1 
ATOM   9388  C CB  . LEU D 1 136 ? 41.221  15.276  223.700 1.00 63.21  ? 136 LEU D CB  1 
ATOM   9389  C CG  . LEU D 1 136 ? 40.519  16.074  222.614 1.00 62.32  ? 136 LEU D CG  1 
ATOM   9390  C CD1 . LEU D 1 136 ? 39.638  15.144  221.765 1.00 58.89  ? 136 LEU D CD1 1 
ATOM   9391  C CD2 . LEU D 1 136 ? 39.709  17.192  223.287 1.00 61.45  ? 136 LEU D CD2 1 
ATOM   9392  N N   . ASP D 1 137 ? 43.870  15.319  225.903 1.00 75.68  ? 137 ASP D N   1 
ATOM   9393  C CA  . ASP D 1 137 ? 44.525  14.710  227.063 1.00 80.05  ? 137 ASP D CA  1 
ATOM   9394  C C   . ASP D 1 137 ? 44.521  15.747  228.180 1.00 80.61  ? 137 ASP D C   1 
ATOM   9395  O O   . ASP D 1 137 ? 45.291  16.724  228.150 1.00 82.01  ? 137 ASP D O   1 
ATOM   9396  C CB  . ASP D 1 137 ? 45.973  14.326  226.732 1.00 83.10  ? 137 ASP D CB  1 
ATOM   9397  C CG  . ASP D 1 137 ? 46.722  13.808  227.940 1.00 84.56  ? 137 ASP D CG  1 
ATOM   9398  O OD1 . ASP D 1 137 ? 47.074  14.617  228.831 1.00 85.77  ? 137 ASP D OD1 1 
ATOM   9399  O OD2 . ASP D 1 137 ? 46.942  12.583  228.015 1.00 88.53  ? 137 ASP D OD2 1 
ATOM   9400  N N   . VAL D 1 138 ? 43.670  15.519  229.172 1.00 79.30  ? 138 VAL D N   1 
ATOM   9401  C CA  . VAL D 1 138 ? 43.559  16.458  230.270 1.00 78.78  ? 138 VAL D CA  1 
ATOM   9402  C C   . VAL D 1 138 ? 44.116  16.075  231.619 1.00 82.75  ? 138 VAL D C   1 
ATOM   9403  O O   . VAL D 1 138 ? 43.712  16.661  232.636 1.00 80.00  ? 138 VAL D O   1 
ATOM   9404  C CB  . VAL D 1 138 ? 42.167  16.924  230.411 1.00 74.50  ? 138 VAL D CB  1 
ATOM   9405  C CG1 . VAL D 1 138 ? 41.991  18.101  229.536 1.00 73.68  ? 138 VAL D CG1 1 
ATOM   9406  C CG2 . VAL D 1 138 ? 41.222  15.828  229.990 1.00 77.08  ? 138 VAL D CG2 1 
ATOM   9407  N N   . HIS D 1 139 ? 44.971  15.039  231.620 1.00 88.17  ? 139 HIS D N   1 
ATOM   9408  C CA  . HIS D 1 139 ? 45.686  14.576  232.820 1.00 91.43  ? 139 HIS D CA  1 
ATOM   9409  C C   . HIS D 1 139 ? 47.021  15.319  232.767 1.00 95.76  ? 139 HIS D C   1 
ATOM   9410  O O   . HIS D 1 139 ? 47.065  16.448  232.279 1.00 100.95 ? 139 HIS D O   1 
ATOM   9411  C CB  . HIS D 1 139 ? 45.936  13.058  232.850 1.00 86.43  ? 139 HIS D CB  1 
ATOM   9412  C CG  . HIS D 1 139 ? 45.733  12.357  231.542 1.00 87.00  ? 139 HIS D CG  1 
ATOM   9413  N ND1 . HIS D 1 139 ? 44.515  12.319  230.898 1.00 85.15  ? 139 HIS D ND1 1 
ATOM   9414  C CD2 . HIS D 1 139 ? 46.560  11.563  230.822 1.00 86.48  ? 139 HIS D CD2 1 
ATOM   9415  C CE1 . HIS D 1 139 ? 44.600  11.525  229.846 1.00 86.30  ? 139 HIS D CE1 1 
ATOM   9416  N NE2 . HIS D 1 139 ? 45.831  11.054  229.777 1.00 84.80  ? 139 HIS D NE2 1 
ATOM   9417  N N   . GLY D 1 140 ? 48.107  14.704  233.233 1.00 98.06  ? 140 GLY D N   1 
ATOM   9418  C CA  . GLY D 1 140 ? 49.415  15.372  233.203 1.00 97.12  ? 140 GLY D CA  1 
ATOM   9419  C C   . GLY D 1 140 ? 49.544  16.563  234.143 1.00 93.29  ? 140 GLY D C   1 
ATOM   9420  O O   . GLY D 1 140 ? 48.560  16.940  234.769 1.00 89.67  ? 140 GLY D O   1 
ATOM   9421  N N   . PHE D 1 141 ? 50.729  17.146  234.308 1.00 93.09  ? 141 PHE D N   1 
ATOM   9422  C CA  . PHE D 1 141 ? 50.725  18.270  235.214 1.00 94.18  ? 141 PHE D CA  1 
ATOM   9423  C C   . PHE D 1 141 ? 50.692  19.695  234.797 1.00 90.74  ? 141 PHE D C   1 
ATOM   9424  O O   . PHE D 1 141 ? 51.681  20.426  234.883 1.00 93.48  ? 141 PHE D O   1 
ATOM   9425  C CB  . PHE D 1 141 ? 51.512  18.075  236.499 1.00 100.19 ? 141 PHE D CB  1 
ATOM   9426  C CG  . PHE D 1 141 ? 50.607  18.013  237.675 1.00 104.45 ? 141 PHE D CG  1 
ATOM   9427  C CD1 . PHE D 1 141 ? 49.393  18.722  237.636 1.00 104.71 ? 141 PHE D CD1 1 
ATOM   9428  C CD2 . PHE D 1 141 ? 50.841  17.147  238.725 1.00 106.29 ? 141 PHE D CD2 1 
ATOM   9429  C CE1 . PHE D 1 141 ? 48.421  18.568  238.615 1.00 105.39 ? 141 PHE D CE1 1 
ATOM   9430  C CE2 . PHE D 1 141 ? 49.866  16.975  239.726 1.00 110.99 ? 141 PHE D CE2 1 
ATOM   9431  C CZ  . PHE D 1 141 ? 48.647  17.689  239.665 1.00 109.20 ? 141 PHE D CZ  1 
ATOM   9432  N N   . ASN D 1 142 ? 49.495  20.066  234.370 1.00 83.01  ? 142 ASN D N   1 
ATOM   9433  C CA  . ASN D 1 142 ? 49.151  21.411  233.967 1.00 76.74  ? 142 ASN D CA  1 
ATOM   9434  C C   . ASN D 1 142 ? 48.377  21.901  235.167 1.00 73.68  ? 142 ASN D C   1 
ATOM   9435  O O   . ASN D 1 142 ? 47.954  21.090  235.997 1.00 70.93  ? 142 ASN D O   1 
ATOM   9436  C CB  . ASN D 1 142 ? 48.228  21.388  232.749 1.00 75.47  ? 142 ASN D CB  1 
ATOM   9437  C CG  . ASN D 1 142 ? 48.879  20.755  231.546 1.00 77.61  ? 142 ASN D CG  1 
ATOM   9438  O OD1 . ASN D 1 142 ? 48.397  19.764  231.009 1.00 77.39  ? 142 ASN D OD1 1 
ATOM   9439  N ND2 . ASN D 1 142 ? 50.004  21.309  231.131 1.00 77.40  ? 142 ASN D ND2 1 
ATOM   9440  N N   . LYS D 1 143 ? 48.249  23.213  235.321 1.00 72.41  ? 143 LYS D N   1 
ATOM   9441  C CA  . LYS D 1 143 ? 47.480  23.722  236.442 1.00 75.64  ? 143 LYS D CA  1 
ATOM   9442  C C   . LYS D 1 143 ? 46.171  23.028  236.302 1.00 74.63  ? 143 LYS D C   1 
ATOM   9443  O O   . LYS D 1 143 ? 45.772  22.657  235.200 1.00 76.08  ? 143 LYS D O   1 
ATOM   9444  C CB  . LYS D 1 143 ? 47.248  25.230  236.374 1.00 82.81  ? 143 LYS D CB  1 
ATOM   9445  C CG  . LYS D 1 143 ? 48.450  26.074  236.825 1.00 93.79  ? 143 LYS D CG  1 
ATOM   9446  C CD  . LYS D 1 143 ? 48.077  27.556  237.099 1.00 98.77  ? 143 LYS D CD  1 
ATOM   9447  C CE  . LYS D 1 143 ? 49.251  28.347  237.710 1.00 100.46 ? 143 LYS D CE  1 
ATOM   9448  N NZ  . LYS D 1 143 ? 48.866  29.760  237.992 1.00 102.15 ? 143 LYS D NZ  1 
ATOM   9449  N N   . PRO D 1 144 ? 45.560  22.690  237.412 1.00 74.35  ? 144 PRO D N   1 
ATOM   9450  C CA  . PRO D 1 144 ? 44.314  22.028  237.101 1.00 76.80  ? 144 PRO D CA  1 
ATOM   9451  C C   . PRO D 1 144 ? 43.196  22.977  237.313 1.00 79.62  ? 144 PRO D C   1 
ATOM   9452  O O   . PRO D 1 144 ? 43.384  24.082  237.826 1.00 78.34  ? 144 PRO D O   1 
ATOM   9453  C CB  . PRO D 1 144 ? 44.274  20.886  238.098 1.00 77.88  ? 144 PRO D CB  1 
ATOM   9454  C CG  . PRO D 1 144 ? 45.721  20.737  238.507 1.00 81.00  ? 144 PRO D CG  1 
ATOM   9455  C CD  . PRO D 1 144 ? 46.095  22.168  238.660 1.00 76.49  ? 144 PRO D CD  1 
ATOM   9456  N N   . THR D 1 145 ? 42.055  22.543  236.812 1.00 82.98  ? 145 THR D N   1 
ATOM   9457  C CA  . THR D 1 145 ? 40.804  23.244  236.890 1.00 87.65  ? 145 THR D CA  1 
ATOM   9458  C C   . THR D 1 145 ? 40.716  23.900  238.248 1.00 96.28  ? 145 THR D C   1 
ATOM   9459  O O   . THR D 1 145 ? 40.741  25.126  238.364 1.00 98.31  ? 145 THR D O   1 
ATOM   9460  C CB  . THR D 1 145 ? 39.723  22.220  236.823 1.00 83.82  ? 145 THR D CB  1 
ATOM   9461  O OG1 . THR D 1 145 ? 40.025  21.303  235.765 1.00 80.37  ? 145 THR D OG1 1 
ATOM   9462  C CG2 . THR D 1 145 ? 38.380  22.879  236.620 1.00 88.78  ? 145 THR D CG2 1 
ATOM   9463  N N   . ASP D 1 146 ? 40.585  23.054  239.267 1.00 104.43 ? 146 ASP D N   1 
ATOM   9464  C CA  . ASP D 1 146 ? 40.511  23.477  240.654 1.00 109.33 ? 146 ASP D CA  1 
ATOM   9465  C C   . ASP D 1 146 ? 41.930  23.370  241.127 1.00 113.18 ? 146 ASP D C   1 
ATOM   9466  O O   . ASP D 1 146 ? 42.520  22.296  241.155 1.00 112.33 ? 146 ASP D O   1 
ATOM   9467  C CB  . ASP D 1 146 ? 39.633  22.535  241.469 1.00 109.92 ? 146 ASP D CB  1 
ATOM   9468  C CG  . ASP D 1 146 ? 39.837  22.698  242.949 1.00 110.61 ? 146 ASP D CG  1 
ATOM   9469  O OD1 . ASP D 1 146 ? 39.255  23.630  243.536 1.00 112.08 ? 146 ASP D OD1 1 
ATOM   9470  O OD2 . ASP D 1 146 ? 40.601  21.900  243.524 1.00 110.93 ? 146 ASP D OD2 1 
ATOM   9471  N N   . THR D 1 147 ? 42.496  24.509  241.448 1.00 119.30 ? 147 THR D N   1 
ATOM   9472  C CA  . THR D 1 147 ? 43.870  24.559  241.896 1.00 127.53 ? 147 THR D CA  1 
ATOM   9473  C C   . THR D 1 147 ? 43.938  24.319  243.390 1.00 129.39 ? 147 THR D C   1 
ATOM   9474  O O   . THR D 1 147 ? 44.848  23.653  243.907 1.00 131.31 ? 147 THR D O   1 
ATOM   9475  C CB  . THR D 1 147 ? 44.428  25.935  241.589 1.00 130.46 ? 147 THR D CB  1 
ATOM   9476  O OG1 . THR D 1 147 ? 43.481  26.930  242.022 1.00 131.16 ? 147 THR D OG1 1 
ATOM   9477  C CG2 . THR D 1 147 ? 44.654  26.064  240.081 1.00 134.13 ? 147 THR D CG2 1 
ATOM   9478  N N   . VAL D 1 148 ? 42.944  24.898  244.054 1.00 129.81 ? 148 VAL D N   1 
ATOM   9479  C CA  . VAL D 1 148 ? 42.755  24.858  245.495 1.00 128.37 ? 148 VAL D CA  1 
ATOM   9480  C C   . VAL D 1 148 ? 43.094  23.499  246.079 1.00 126.58 ? 148 VAL D C   1 
ATOM   9481  O O   . VAL D 1 148 ? 44.141  23.288  246.707 1.00 128.08 ? 148 VAL D O   1 
ATOM   9482  C CB  . VAL D 1 148 ? 41.271  25.130  245.832 1.00 129.09 ? 148 VAL D CB  1 
ATOM   9483  C CG1 . VAL D 1 148 ? 41.118  25.468  247.299 1.00 133.66 ? 148 VAL D CG1 1 
ATOM   9484  C CG2 . VAL D 1 148 ? 40.690  26.219  244.922 1.00 131.01 ? 148 VAL D CG2 1 
ATOM   9485  N N   . ASN D 1 149 ? 42.188  22.573  245.812 1.00 122.05 ? 149 ASN D N   1 
ATOM   9486  C CA  . ASN D 1 149 ? 42.278  21.216  246.286 1.00 116.64 ? 149 ASN D CA  1 
ATOM   9487  C C   . ASN D 1 149 ? 42.970  20.394  245.213 1.00 109.40 ? 149 ASN D C   1 
ATOM   9488  O O   . ASN D 1 149 ? 42.709  19.203  245.057 1.00 106.62 ? 149 ASN D O   1 
ATOM   9489  C CB  . ASN D 1 149 ? 40.862  20.717  246.562 1.00 122.01 ? 149 ASN D CB  1 
ATOM   9490  C CG  . ASN D 1 149 ? 40.013  21.749  247.334 1.00 125.29 ? 149 ASN D CG  1 
ATOM   9491  O OD1 . ASN D 1 149 ? 40.325  22.101  248.482 1.00 126.92 ? 149 ASN D OD1 1 
ATOM   9492  N ND2 . ASN D 1 149 ? 38.947  22.244  246.698 1.00 127.31 ? 149 ASN D ND2 1 
ATOM   9493  N N   . THR D 1 150 ? 43.820  21.073  244.450 1.00 103.30 ? 150 THR D N   1 
ATOM   9494  C CA  . THR D 1 150 ? 44.602  20.472  243.394 1.00 99.48  ? 150 THR D CA  1 
ATOM   9495  C C   . THR D 1 150 ? 43.802  19.443  242.626 1.00 98.60  ? 150 THR D C   1 
ATOM   9496  O O   . THR D 1 150 ? 44.274  18.314  242.429 1.00 98.43  ? 150 THR D O   1 
ATOM   9497  C CB  . THR D 1 150 ? 45.800  19.770  244.002 1.00 98.38  ? 150 THR D CB  1 
ATOM   9498  O OG1 . THR D 1 150 ? 46.393  20.620  244.994 1.00 100.27 ? 150 THR D OG1 1 
ATOM   9499  C CG2 . THR D 1 150 ? 46.807  19.412  242.920 1.00 97.50  ? 150 THR D CG2 1 
ATOM   9500  N N   . LYS D 1 151 ? 42.603  19.814  242.190 1.00 99.30  ? 151 LYS D N   1 
ATOM   9501  C CA  . LYS D 1 151 ? 41.754  18.869  241.476 1.00 101.21 ? 151 LYS D CA  1 
ATOM   9502  C C   . LYS D 1 151 ? 41.164  19.298  240.120 1.00 96.11  ? 151 LYS D C   1 
ATOM   9503  O O   . LYS D 1 151 ? 41.452  20.382  239.600 1.00 97.59  ? 151 LYS D O   1 
ATOM   9504  C CB  . LYS D 1 151 ? 40.652  18.389  242.426 1.00 108.12 ? 151 LYS D CB  1 
ATOM   9505  C CG  . LYS D 1 151 ? 40.565  16.870  242.551 1.00 122.06 ? 151 LYS D CG  1 
ATOM   9506  C CD  . LYS D 1 151 ? 41.950  16.190  242.665 1.00 133.47 ? 151 LYS D CD  1 
ATOM   9507  C CE  . LYS D 1 151 ? 42.629  16.361  244.031 1.00 137.04 ? 151 LYS D CE  1 
ATOM   9508  N NZ  . LYS D 1 151 ? 44.082  15.984  243.985 1.00 138.79 ? 151 LYS D NZ  1 
ATOM   9509  N N   . GLY D 1 152 ? 40.427  18.384  239.496 1.00 89.74  ? 152 GLY D N   1 
ATOM   9510  C CA  . GLY D 1 152 ? 39.796  18.685  238.229 1.00 80.38  ? 152 GLY D CA  1 
ATOM   9511  C C   . GLY D 1 152 ? 40.416  18.091  236.995 1.00 74.03  ? 152 GLY D C   1 
ATOM   9512  O O   . GLY D 1 152 ? 40.428  16.886  236.790 1.00 72.24  ? 152 GLY D O   1 
ATOM   9513  N N   . ILE D 1 153 ? 40.913  18.980  236.159 1.00 70.37  ? 153 ILE D N   1 
ATOM   9514  C CA  . ILE D 1 153 ? 41.522  18.619  234.899 1.00 65.58  ? 153 ILE D CA  1 
ATOM   9515  C C   . ILE D 1 153 ? 42.778  19.406  234.791 1.00 66.25  ? 153 ILE D C   1 
ATOM   9516  O O   . ILE D 1 153 ? 42.786  20.587  235.147 1.00 63.62  ? 153 ILE D O   1 
ATOM   9517  C CB  . ILE D 1 153 ? 40.693  19.119  233.733 1.00 62.89  ? 153 ILE D CB  1 
ATOM   9518  C CG1 . ILE D 1 153 ? 39.511  18.222  233.505 1.00 62.03  ? 153 ILE D CG1 1 
ATOM   9519  C CG2 . ILE D 1 153 ? 41.519  19.156  232.500 1.00 60.37  ? 153 ILE D CG2 1 
ATOM   9520  C CD1 . ILE D 1 153 ? 39.941  16.836  233.332 1.00 73.06  ? 153 ILE D CD1 1 
ATOM   9521  N N   . SER D 1 154 ? 43.813  18.785  234.240 1.00 67.75  ? 154 SER D N   1 
ATOM   9522  C CA  . SER D 1 154 ? 45.063  19.492  234.039 1.00 69.01  ? 154 SER D CA  1 
ATOM   9523  C C   . SER D 1 154 ? 44.818  20.272  232.781 1.00 66.80  ? 154 SER D C   1 
ATOM   9524  O O   . SER D 1 154 ? 44.824  19.735  231.675 1.00 62.55  ? 154 SER D O   1 
ATOM   9525  C CB  . SER D 1 154 ? 46.260  18.564  233.878 1.00 70.89  ? 154 SER D CB  1 
ATOM   9526  O OG  . SER D 1 154 ? 47.272  18.905  234.816 1.00 69.50  ? 154 SER D OG  1 
ATOM   9527  N N   . THR D 1 155 ? 44.340  21.478  233.050 1.00 64.97  ? 155 THR D N   1 
ATOM   9528  C CA  . THR D 1 155 ? 43.997  22.490  232.087 1.00 63.07  ? 155 THR D CA  1 
ATOM   9529  C C   . THR D 1 155 ? 44.675  22.306  230.770 1.00 61.32  ? 155 THR D C   1 
ATOM   9530  O O   . THR D 1 155 ? 45.899  22.439  230.698 1.00 60.34  ? 155 THR D O   1 
ATOM   9531  C CB  . THR D 1 155 ? 44.425  23.826  232.629 1.00 64.36  ? 155 THR D CB  1 
ATOM   9532  O OG1 . THR D 1 155 ? 43.577  24.179  233.732 1.00 68.37  ? 155 THR D OG1 1 
ATOM   9533  C CG2 . THR D 1 155 ? 44.411  24.898  231.534 1.00 71.54  ? 155 THR D CG2 1 
ATOM   9534  N N   . PRO D 1 156 ? 43.878  22.136  229.695 1.00 59.96  ? 156 PRO D N   1 
ATOM   9535  C CA  . PRO D 1 156 ? 44.325  21.936  228.313 1.00 62.78  ? 156 PRO D CA  1 
ATOM   9536  C C   . PRO D 1 156 ? 45.022  23.165  227.760 1.00 65.20  ? 156 PRO D C   1 
ATOM   9537  O O   . PRO D 1 156 ? 45.357  24.127  228.494 1.00 68.17  ? 156 PRO D O   1 
ATOM   9538  C CB  . PRO D 1 156 ? 43.024  21.695  227.566 1.00 61.70  ? 156 PRO D CB  1 
ATOM   9539  C CG  . PRO D 1 156 ? 42.108  22.640  228.268 1.00 62.47  ? 156 PRO D CG  1 
ATOM   9540  C CD  . PRO D 1 156 ? 42.423  22.339  229.724 1.00 57.37  ? 156 PRO D CD  1 
ATOM   9541  N N   . VAL D 1 157 ? 45.268  23.128  226.461 1.00 62.98  ? 157 VAL D N   1 
ATOM   9542  C CA  . VAL D 1 157 ? 45.919  24.261  225.866 1.00 62.11  ? 157 VAL D CA  1 
ATOM   9543  C C   . VAL D 1 157 ? 44.861  25.306  225.681 1.00 64.75  ? 157 VAL D C   1 
ATOM   9544  O O   . VAL D 1 157 ? 43.677  24.994  225.456 1.00 64.73  ? 157 VAL D O   1 
ATOM   9545  C CB  . VAL D 1 157 ? 46.530  23.931  224.548 1.00 61.18  ? 157 VAL D CB  1 
ATOM   9546  C CG1 . VAL D 1 157 ? 47.535  24.990  224.181 1.00 59.66  ? 157 VAL D CG1 1 
ATOM   9547  C CG2 . VAL D 1 157 ? 47.158  22.577  224.612 1.00 61.13  ? 157 VAL D CG2 1 
ATOM   9548  N N   . GLU D 1 158 ? 45.290  26.546  225.834 1.00 67.70  ? 158 GLU D N   1 
ATOM   9549  C CA  . GLU D 1 158 ? 44.417  27.696  225.706 1.00 71.69  ? 158 GLU D CA  1 
ATOM   9550  C C   . GLU D 1 158 ? 45.335  28.843  225.265 1.00 69.16  ? 158 GLU D C   1 
ATOM   9551  O O   . GLU D 1 158 ? 46.550  28.644  225.159 1.00 69.23  ? 158 GLU D O   1 
ATOM   9552  C CB  . GLU D 1 158 ? 43.734  28.005  227.073 1.00 77.50  ? 158 GLU D CB  1 
ATOM   9553  C CG  . GLU D 1 158 ? 42.820  26.864  227.649 1.00 79.38  ? 158 GLU D CG  1 
ATOM   9554  C CD  . GLU D 1 158 ? 41.548  27.358  228.376 1.00 83.27  ? 158 GLU D CD  1 
ATOM   9555  O OE1 . GLU D 1 158 ? 41.661  28.142  229.347 1.00 85.24  ? 158 GLU D OE1 1 
ATOM   9556  O OE2 . GLU D 1 158 ? 40.425  26.930  227.995 1.00 85.43  ? 158 GLU D OE2 1 
ATOM   9557  N N   . GLY D 1 159 ? 44.751  29.998  224.937 1.00 65.44  ? 159 GLY D N   1 
ATOM   9558  C CA  . GLY D 1 159 ? 45.524  31.165  224.539 1.00 58.38  ? 159 GLY D CA  1 
ATOM   9559  C C   . GLY D 1 159 ? 45.643  31.472  223.059 1.00 55.57  ? 159 GLY D C   1 
ATOM   9560  O O   . GLY D 1 159 ? 45.045  30.813  222.190 1.00 54.68  ? 159 GLY D O   1 
ATOM   9561  N N   . SER D 1 160 ? 46.434  32.497  222.769 1.00 51.84  ? 160 SER D N   1 
ATOM   9562  C CA  . SER D 1 160 ? 46.648  32.911  221.390 1.00 47.74  ? 160 SER D CA  1 
ATOM   9563  C C   . SER D 1 160 ? 47.086  31.766  220.481 1.00 45.18  ? 160 SER D C   1 
ATOM   9564  O O   . SER D 1 160 ? 47.985  30.981  220.799 1.00 42.20  ? 160 SER D O   1 
ATOM   9565  C CB  . SER D 1 160 ? 47.700  34.030  221.301 1.00 43.48  ? 160 SER D CB  1 
ATOM   9566  O OG  . SER D 1 160 ? 47.336  35.188  222.027 1.00 40.05  ? 160 SER D OG  1 
ATOM   9567  N N   . GLN D 1 161 ? 46.405  31.638  219.364 1.00 42.58  ? 161 GLN D N   1 
ATOM   9568  C CA  . GLN D 1 161 ? 46.806  30.649  218.397 1.00 41.05  ? 161 GLN D CA  1 
ATOM   9569  C C   . GLN D 1 161 ? 47.162  31.425  217.123 1.00 38.68  ? 161 GLN D C   1 
ATOM   9570  O O   . GLN D 1 161 ? 46.819  32.609  216.966 1.00 38.12  ? 161 GLN D O   1 
ATOM   9571  C CB  . GLN D 1 161 ? 45.724  29.599  218.201 1.00 41.29  ? 161 GLN D CB  1 
ATOM   9572  C CG  . GLN D 1 161 ? 44.344  30.123  218.386 1.00 47.11  ? 161 GLN D CG  1 
ATOM   9573  C CD  . GLN D 1 161 ? 43.394  29.059  218.842 1.00 51.49  ? 161 GLN D CD  1 
ATOM   9574  O OE1 . GLN D 1 161 ? 42.888  28.235  218.045 1.00 53.23  ? 161 GLN D OE1 1 
ATOM   9575  N NE2 . GLN D 1 161 ? 43.153  29.046  220.141 1.00 51.25  ? 161 GLN D NE2 1 
ATOM   9576  N N   . TYR D 1 162 ? 47.915  30.789  216.248 1.00 36.18  ? 162 TYR D N   1 
ATOM   9577  C CA  . TYR D 1 162 ? 48.341  31.444  215.036 1.00 37.52  ? 162 TYR D CA  1 
ATOM   9578  C C   . TYR D 1 162 ? 48.731  30.359  214.091 1.00 39.71  ? 162 TYR D C   1 
ATOM   9579  O O   . TYR D 1 162 ? 49.405  29.393  214.468 1.00 40.00  ? 162 TYR D O   1 
ATOM   9580  C CB  . TYR D 1 162 ? 49.580  32.257  215.340 1.00 35.92  ? 162 TYR D CB  1 
ATOM   9581  C CG  . TYR D 1 162 ? 50.177  33.066  214.208 1.00 38.07  ? 162 TYR D CG  1 
ATOM   9582  C CD1 . TYR D 1 162 ? 50.990  32.492  213.233 1.00 37.66  ? 162 TYR D CD1 1 
ATOM   9583  C CD2 . TYR D 1 162 ? 50.094  34.452  214.236 1.00 44.02  ? 162 TYR D CD2 1 
ATOM   9584  C CE1 . TYR D 1 162 ? 51.738  33.310  212.324 1.00 41.73  ? 162 TYR D CE1 1 
ATOM   9585  C CE2 . TYR D 1 162 ? 50.830  35.280  213.346 1.00 43.11  ? 162 TYR D CE2 1 
ATOM   9586  C CZ  . TYR D 1 162 ? 51.666  34.724  212.403 1.00 41.23  ? 162 TYR D CZ  1 
ATOM   9587  O OH  . TYR D 1 162 ? 52.507  35.612  211.698 1.00 34.22  ? 162 TYR D OH  1 
ATOM   9588  N N   . HIS D 1 163 ? 48.265  30.480  212.867 1.00 41.15  ? 163 HIS D N   1 
ATOM   9589  C CA  . HIS D 1 163 ? 48.621  29.505  211.859 1.00 44.07  ? 163 HIS D CA  1 
ATOM   9590  C C   . HIS D 1 163 ? 48.695  30.295  210.584 1.00 39.98  ? 163 HIS D C   1 
ATOM   9591  O O   . HIS D 1 163 ? 47.790  31.068  210.277 1.00 41.82  ? 163 HIS D O   1 
ATOM   9592  C CB  . HIS D 1 163 ? 47.555  28.434  211.684 1.00 49.92  ? 163 HIS D CB  1 
ATOM   9593  C CG  . HIS D 1 163 ? 47.017  27.888  212.957 1.00 55.71  ? 163 HIS D CG  1 
ATOM   9594  N ND1 . HIS D 1 163 ? 47.528  26.756  213.549 1.00 58.52  ? 163 HIS D ND1 1 
ATOM   9595  C CD2 . HIS D 1 163 ? 45.980  28.289  213.734 1.00 59.95  ? 163 HIS D CD2 1 
ATOM   9596  C CE1 . HIS D 1 163 ? 46.827  26.481  214.635 1.00 68.95  ? 163 HIS D CE1 1 
ATOM   9597  N NE2 . HIS D 1 163 ? 45.880  27.396  214.770 1.00 65.53  ? 163 HIS D NE2 1 
ATOM   9598  N N   . VAL D 1 164 ? 49.773  30.111  209.851 1.00 33.75  ? 164 VAL D N   1 
ATOM   9599  C CA  . VAL D 1 164 ? 49.961  30.793  208.604 1.00 28.55  ? 164 VAL D CA  1 
ATOM   9600  C C   . VAL D 1 164 ? 50.749  29.770  207.843 1.00 27.25  ? 164 VAL D C   1 
ATOM   9601  O O   . VAL D 1 164 ? 51.355  28.889  208.446 1.00 26.10  ? 164 VAL D O   1 
ATOM   9602  C CB  . VAL D 1 164 ? 50.835  32.080  208.788 1.00 27.54  ? 164 VAL D CB  1 
ATOM   9603  C CG1 . VAL D 1 164 ? 51.652  32.303  207.576 1.00 29.66  ? 164 VAL D CG1 1 
ATOM   9604  C CG2 . VAL D 1 164 ? 49.975  33.353  208.998 1.00 31.41  ? 164 VAL D CG2 1 
ATOM   9605  N N   . PHE D 1 165 ? 50.690  29.840  206.524 1.00 27.84  ? 165 PHE D N   1 
ATOM   9606  C CA  . PHE D 1 165 ? 51.477  28.949  205.687 1.00 28.17  ? 165 PHE D CA  1 
ATOM   9607  C C   . PHE D 1 165 ? 51.519  29.514  204.283 1.00 25.92  ? 165 PHE D C   1 
ATOM   9608  O O   . PHE D 1 165 ? 50.636  30.294  203.875 1.00 26.23  ? 165 PHE D O   1 
ATOM   9609  C CB  . PHE D 1 165 ? 50.847  27.607  205.589 1.00 26.37  ? 165 PHE D CB  1 
ATOM   9610  C CG  . PHE D 1 165 ? 49.722  27.601  204.669 1.00 31.37  ? 165 PHE D CG  1 
ATOM   9611  C CD1 . PHE D 1 165 ? 48.541  28.231  205.024 1.00 31.80  ? 165 PHE D CD1 1 
ATOM   9612  C CD2 . PHE D 1 165 ? 49.819  26.962  203.443 1.00 35.46  ? 165 PHE D CD2 1 
ATOM   9613  C CE1 . PHE D 1 165 ? 47.455  28.209  204.166 1.00 36.51  ? 165 PHE D CE1 1 
ATOM   9614  C CE2 . PHE D 1 165 ? 48.735  26.933  202.573 1.00 35.48  ? 165 PHE D CE2 1 
ATOM   9615  C CZ  . PHE D 1 165 ? 47.545  27.554  202.935 1.00 33.05  ? 165 PHE D CZ  1 
ATOM   9616  N N   . ALA D 1 166 ? 52.408  28.943  203.488 1.00 22.77  ? 166 ALA D N   1 
ATOM   9617  C CA  . ALA D 1 166 ? 52.579  29.424  202.151 1.00 19.89  ? 166 ALA D CA  1 
ATOM   9618  C C   . ALA D 1 166 ? 53.240  28.443  201.254 1.00 19.56  ? 166 ALA D C   1 
ATOM   9619  O O   . ALA D 1 166 ? 54.104  27.655  201.643 1.00 16.21  ? 166 ALA D O   1 
ATOM   9620  C CB  . ALA D 1 166 ? 53.397  30.686  202.175 1.00 22.46  ? 166 ALA D CB  1 
ATOM   9621  N N   . VAL D 1 167 ? 52.952  28.626  199.996 1.00 20.38  ? 167 VAL D N   1 
ATOM   9622  C CA  . VAL D 1 167 ? 53.511  27.763  199.023 1.00 24.48  ? 167 VAL D CA  1 
ATOM   9623  C C   . VAL D 1 167 ? 54.131  28.656  197.997 1.00 30.90  ? 167 VAL D C   1 
ATOM   9624  O O   . VAL D 1 167 ? 53.429  29.495  197.423 1.00 36.40  ? 167 VAL D O   1 
ATOM   9625  C CB  . VAL D 1 167 ? 52.410  26.992  198.402 1.00 23.39  ? 167 VAL D CB  1 
ATOM   9626  C CG1 . VAL D 1 167 ? 52.973  25.936  197.532 1.00 22.04  ? 167 VAL D CG1 1 
ATOM   9627  C CG2 . VAL D 1 167 ? 51.555  26.394  199.491 1.00 25.04  ? 167 VAL D CG2 1 
ATOM   9628  N N   . GLY D 1 168 ? 55.437  28.505  197.785 1.00 33.93  ? 168 GLY D N   1 
ATOM   9629  C CA  . GLY D 1 168 ? 56.137  29.330  196.801 1.00 39.33  ? 168 GLY D CA  1 
ATOM   9630  C C   . GLY D 1 168 ? 57.192  28.713  195.873 1.00 41.35  ? 168 GLY D C   1 
ATOM   9631  O O   . GLY D 1 168 ? 57.667  27.591  196.073 1.00 47.38  ? 168 GLY D O   1 
ATOM   9632  N N   . GLY D 1 169 ? 57.566  29.461  194.842 1.00 41.04  ? 169 GLY D N   1 
ATOM   9633  C CA  . GLY D 1 169 ? 58.566  28.991  193.901 1.00 37.33  ? 169 GLY D CA  1 
ATOM   9634  C C   . GLY D 1 169 ? 59.896  29.667  194.155 1.00 34.91  ? 169 GLY D C   1 
ATOM   9635  O O   . GLY D 1 169 ? 60.724  29.766  193.275 1.00 35.28  ? 169 GLY D O   1 
ATOM   9636  N N   . GLU D 1 170 ? 60.040  30.219  195.342 1.00 31.78  ? 170 GLU D N   1 
ATOM   9637  C CA  . GLU D 1 170 ? 61.243  30.889  195.795 1.00 31.99  ? 170 GLU D CA  1 
ATOM   9638  C C   . GLU D 1 170 ? 60.874  31.044  197.227 1.00 33.80  ? 170 GLU D C   1 
ATOM   9639  O O   . GLU D 1 170 ? 59.684  30.963  197.581 1.00 34.62  ? 170 GLU D O   1 
ATOM   9640  C CB  . GLU D 1 170 ? 61.445  32.254  195.155 1.00 34.42  ? 170 GLU D CB  1 
ATOM   9641  C CG  . GLU D 1 170 ? 60.225  33.127  195.154 1.00 43.90  ? 170 GLU D CG  1 
ATOM   9642  C CD  . GLU D 1 170 ? 60.359  34.353  194.243 1.00 50.99  ? 170 GLU D CD  1 
ATOM   9643  O OE1 . GLU D 1 170 ? 60.913  35.379  194.728 1.00 54.92  ? 170 GLU D OE1 1 
ATOM   9644  O OE2 . GLU D 1 170 ? 59.915  34.283  193.054 1.00 47.56  ? 170 GLU D OE2 1 
ATOM   9645  N N   . PRO D 1 171 ? 61.863  31.280  198.088 1.00 36.24  ? 171 PRO D N   1 
ATOM   9646  C CA  . PRO D 1 171 ? 61.548  31.427  199.513 1.00 39.57  ? 171 PRO D CA  1 
ATOM   9647  C C   . PRO D 1 171 ? 60.558  32.539  199.758 1.00 41.82  ? 171 PRO D C   1 
ATOM   9648  O O   . PRO D 1 171 ? 60.369  33.420  198.929 1.00 39.22  ? 171 PRO D O   1 
ATOM   9649  C CB  . PRO D 1 171 ? 62.895  31.744  200.127 1.00 34.90  ? 171 PRO D CB  1 
ATOM   9650  C CG  . PRO D 1 171 ? 63.490  32.550  199.069 1.00 39.03  ? 171 PRO D CG  1 
ATOM   9651  C CD  . PRO D 1 171 ? 63.206  31.782  197.809 1.00 33.45  ? 171 PRO D CD  1 
ATOM   9652  N N   . LEU D 1 172 ? 59.928  32.473  200.909 1.00 44.64  ? 172 LEU D N   1 
ATOM   9653  C CA  . LEU D 1 172 ? 58.959  33.458  201.289 1.00 47.93  ? 172 LEU D CA  1 
ATOM   9654  C C   . LEU D 1 172 ? 59.647  34.762  201.718 1.00 49.56  ? 172 LEU D C   1 
ATOM   9655  O O   . LEU D 1 172 ? 60.573  34.745  202.545 1.00 47.24  ? 172 LEU D O   1 
ATOM   9656  C CB  . LEU D 1 172 ? 58.162  32.869  202.437 1.00 52.45  ? 172 LEU D CB  1 
ATOM   9657  C CG  . LEU D 1 172 ? 56.992  33.632  203.038 1.00 57.52  ? 172 LEU D CG  1 
ATOM   9658  C CD1 . LEU D 1 172 ? 57.256  33.864  204.506 1.00 57.46  ? 172 LEU D CD1 1 
ATOM   9659  C CD2 . LEU D 1 172 ? 56.686  34.951  202.261 1.00 66.29  ? 172 LEU D CD2 1 
ATOM   9660  N N   . ASP D 1 173 ? 59.197  35.884  201.157 1.00 53.10  ? 173 ASP D N   1 
ATOM   9661  C CA  . ASP D 1 173 ? 59.755  37.195  201.506 1.00 56.59  ? 173 ASP D CA  1 
ATOM   9662  C C   . ASP D 1 173 ? 58.964  37.688  202.678 1.00 53.08  ? 173 ASP D C   1 
ATOM   9663  O O   . ASP D 1 173 ? 57.728  37.590  202.712 1.00 52.01  ? 173 ASP D O   1 
ATOM   9664  C CB  . ASP D 1 173 ? 59.597  38.227  200.399 1.00 67.95  ? 173 ASP D CB  1 
ATOM   9665  C CG  . ASP D 1 173 ? 59.788  37.649  199.020 1.00 79.02  ? 173 ASP D CG  1 
ATOM   9666  O OD1 . ASP D 1 173 ? 59.087  36.662  198.655 1.00 84.47  ? 173 ASP D OD1 1 
ATOM   9667  O OD2 . ASP D 1 173 ? 60.653  38.198  198.298 1.00 87.16  ? 173 ASP D OD2 1 
ATOM   9668  N N   . LEU D 1 174 ? 59.649  38.381  203.562 1.00 48.43  ? 174 LEU D N   1 
ATOM   9669  C CA  . LEU D 1 174 ? 58.976  38.816  204.749 1.00 45.94  ? 174 LEU D CA  1 
ATOM   9670  C C   . LEU D 1 174 ? 59.508  40.050  205.370 1.00 43.47  ? 174 LEU D C   1 
ATOM   9671  O O   . LEU D 1 174 ? 60.710  40.341  205.300 1.00 38.65  ? 174 LEU D O   1 
ATOM   9672  C CB  . LEU D 1 174 ? 59.033  37.720  205.803 1.00 45.94  ? 174 LEU D CB  1 
ATOM   9673  C CG  . LEU D 1 174 ? 60.107  36.648  205.633 1.00 44.20  ? 174 LEU D CG  1 
ATOM   9674  C CD1 . LEU D 1 174 ? 61.414  37.195  205.199 1.00 43.92  ? 174 LEU D CD1 1 
ATOM   9675  C CD2 . LEU D 1 174 ? 60.277  35.985  206.955 1.00 51.40  ? 174 LEU D CD2 1 
ATOM   9676  N N   . GLN D 1 175 ? 58.586  40.741  206.031 1.00 40.77  ? 175 GLN D N   1 
ATOM   9677  C CA  . GLN D 1 175 ? 58.934  41.923  206.742 1.00 37.52  ? 175 GLN D CA  1 
ATOM   9678  C C   . GLN D 1 175 ? 58.830  41.743  208.206 1.00 36.08  ? 175 GLN D C   1 
ATOM   9679  O O   . GLN D 1 175 ? 58.032  40.955  208.711 1.00 35.74  ? 175 GLN D O   1 
ATOM   9680  C CB  . GLN D 1 175 ? 58.141  43.125  206.369 1.00 33.62  ? 175 GLN D CB  1 
ATOM   9681  C CG  . GLN D 1 175 ? 59.096  44.212  206.550 1.00 38.96  ? 175 GLN D CG  1 
ATOM   9682  C CD  . GLN D 1 175 ? 58.482  45.483  206.894 1.00 43.10  ? 175 GLN D CD  1 
ATOM   9683  O OE1 . GLN D 1 175 ? 57.864  46.134  206.036 1.00 48.14  ? 175 GLN D OE1 1 
ATOM   9684  N NE2 . GLN D 1 175 ? 58.669  45.907  208.150 1.00 39.37  ? 175 GLN D NE2 1 
ATOM   9685  N N   . GLY D 1 176 ? 59.720  42.439  208.929 1.00 35.66  ? 176 GLY D N   1 
ATOM   9686  C CA  . GLY D 1 176 ? 59.747  42.319  210.355 1.00 38.28  ? 176 GLY D CA  1 
ATOM   9687  C C   . GLY D 1 176 ? 59.237  43.543  211.038 1.00 42.95  ? 176 GLY D C   1 
ATOM   9688  O O   . GLY D 1 176 ? 59.439  44.676  210.498 1.00 40.38  ? 176 GLY D O   1 
ATOM   9689  N N   . LEU D 1 177 ? 58.310  43.278  211.999 1.00 39.23  ? 177 LEU D N   1 
ATOM   9690  C CA  . LEU D 1 177 ? 57.738  44.284  212.957 1.00 36.16  ? 177 LEU D CA  1 
ATOM   9691  C C   . LEU D 1 177 ? 57.748  43.542  214.229 1.00 40.21  ? 177 LEU D C   1 
ATOM   9692  O O   . LEU D 1 177 ? 57.583  42.313  214.246 1.00 38.57  ? 177 LEU D O   1 
ATOM   9693  C CB  . LEU D 1 177 ? 56.240  44.609  212.838 1.00 37.67  ? 177 LEU D CB  1 
ATOM   9694  C CG  . LEU D 1 177 ? 56.105  45.301  211.523 1.00 38.26  ? 177 LEU D CG  1 
ATOM   9695  C CD1 . LEU D 1 177 ? 56.656  44.394  210.217 1.00 39.12  ? 177 LEU D CD1 1 
ATOM   9696  C CD2 . LEU D 1 177 ? 54.587  45.774  211.565 1.00 41.99  ? 177 LEU D CD2 1 
ATOM   9697  N N   . VAL D 1 178 ? 57.872  44.314  215.301 1.00 58.76  ? 178 VAL D N   1 
ATOM   9698  C CA  . VAL D 1 178 ? 57.960  43.732  216.593 1.00 62.03  ? 178 VAL D CA  1 
ATOM   9699  C C   . VAL D 1 178 ? 57.152  44.670  217.451 1.00 64.85  ? 178 VAL D C   1 
ATOM   9700  O O   . VAL D 1 178 ? 56.477  45.593  216.958 1.00 68.15  ? 178 VAL D O   1 
ATOM   9701  C CB  . VAL D 1 178 ? 59.376  43.762  217.007 1.00 61.89  ? 178 VAL D CB  1 
ATOM   9702  C CG1 . VAL D 1 178 ? 59.848  45.207  217.007 1.00 56.06  ? 178 VAL D CG1 1 
ATOM   9703  C CG2 . VAL D 1 178 ? 59.535  43.101  218.359 1.00 64.50  ? 178 VAL D CG2 1 
ATOM   9704  N N   . THR D 1 179 ? 57.183  44.351  218.731 1.00 64.49  ? 179 THR D N   1 
ATOM   9705  C CA  . THR D 1 179 ? 56.555  45.145  219.743 1.00 67.63  ? 179 THR D CA  1 
ATOM   9706  C C   . THR D 1 179 ? 57.671  46.039  220.296 1.00 72.43  ? 179 THR D C   1 
ATOM   9707  O O   . THR D 1 179 ? 57.984  47.079  219.725 1.00 76.64  ? 179 THR D O   1 
ATOM   9708  C CB  . THR D 1 179 ? 56.039  44.230  220.793 1.00 64.65  ? 179 THR D CB  1 
ATOM   9709  O OG1 . THR D 1 179 ? 56.617  42.944  220.560 1.00 65.27  ? 179 THR D OG1 1 
ATOM   9710  C CG2 . THR D 1 179 ? 54.564  44.113  220.685 1.00 64.97  ? 179 THR D CG2 1 
ATOM   9711  N N   . ASP D 1 180 ? 58.370  45.600  221.325 1.00 75.39  ? 180 ASP D N   1 
ATOM   9712  C CA  . ASP D 1 180 ? 59.402  46.459  221.852 1.00 74.32  ? 180 ASP D CA  1 
ATOM   9713  C C   . ASP D 1 180 ? 60.654  46.370  221.063 1.00 69.11  ? 180 ASP D C   1 
ATOM   9714  O O   . ASP D 1 180 ? 61.286  45.338  221.015 1.00 64.00  ? 180 ASP D O   1 
ATOM   9715  C CB  . ASP D 1 180 ? 59.707  46.122  223.284 1.00 86.13  ? 180 ASP D CB  1 
ATOM   9716  C CG  . ASP D 1 180 ? 60.114  47.319  224.052 1.00 97.48  ? 180 ASP D CG  1 
ATOM   9717  O OD1 . ASP D 1 180 ? 59.605  48.418  223.713 1.00 101.55 ? 180 ASP D OD1 1 
ATOM   9718  O OD2 . ASP D 1 180 ? 60.933  47.161  224.978 1.00 105.09 ? 180 ASP D OD2 1 
ATOM   9719  N N   . ALA D 1 181 ? 61.055  47.482  220.494 1.00 67.66  ? 181 ALA D N   1 
ATOM   9720  C CA  . ALA D 1 181 ? 62.257  47.487  219.694 1.00 72.72  ? 181 ALA D CA  1 
ATOM   9721  C C   . ALA D 1 181 ? 63.496  47.300  220.544 1.00 77.12  ? 181 ALA D C   1 
ATOM   9722  O O   . ALA D 1 181 ? 64.617  47.262  220.026 1.00 79.64  ? 181 ALA D O   1 
ATOM   9723  C CB  . ALA D 1 181 ? 62.357  48.777  218.928 1.00 73.34  ? 181 ALA D CB  1 
ATOM   9724  N N   . ARG D 1 182 ? 63.310  47.212  221.853 1.00 80.29  ? 182 ARG D N   1 
ATOM   9725  C CA  . ARG D 1 182 ? 64.453  47.062  222.726 1.00 82.64  ? 182 ARG D CA  1 
ATOM   9726  C C   . ARG D 1 182 ? 64.798  45.618  222.992 1.00 84.62  ? 182 ARG D C   1 
ATOM   9727  O O   . ARG D 1 182 ? 65.949  45.294  223.277 1.00 85.56  ? 182 ARG D O   1 
ATOM   9728  C CB  . ARG D 1 182 ? 64.195  47.776  224.027 1.00 81.00  ? 182 ARG D CB  1 
ATOM   9729  C CG  . ARG D 1 182 ? 63.839  49.218  223.847 1.00 82.50  ? 182 ARG D CG  1 
ATOM   9730  C CD  . ARG D 1 182 ? 62.452  49.453  224.381 1.00 92.58  ? 182 ARG D CD  1 
ATOM   9731  N NE  . ARG D 1 182 ? 62.378  50.515  225.385 1.00 103.92 ? 182 ARG D NE  1 
ATOM   9732  C CZ  . ARG D 1 182 ? 61.562  50.522  226.445 1.00 110.38 ? 182 ARG D CZ  1 
ATOM   9733  N NH1 . ARG D 1 182 ? 60.722  49.513  226.678 1.00 112.56 ? 182 ARG D NH1 1 
ATOM   9734  N NH2 . ARG D 1 182 ? 61.554  51.586  227.244 1.00 117.55 ? 182 ARG D NH2 1 
ATOM   9735  N N   . THR D 1 183 ? 63.788  44.764  222.885 1.00 85.84  ? 183 THR D N   1 
ATOM   9736  C CA  . THR D 1 183 ? 63.924  43.332  223.105 1.00 85.13  ? 183 THR D CA  1 
ATOM   9737  C C   . THR D 1 183 ? 65.316  42.811  222.834 1.00 83.16  ? 183 THR D C   1 
ATOM   9738  O O   . THR D 1 183 ? 65.879  42.928  221.745 1.00 80.61  ? 183 THR D O   1 
ATOM   9739  C CB  . THR D 1 183 ? 62.920  42.534  222.264 1.00 86.84  ? 183 THR D CB  1 
ATOM   9740  O OG1 . THR D 1 183 ? 61.598  43.060  222.461 1.00 91.02  ? 183 THR D OG1 1 
ATOM   9741  C CG2 . THR D 1 183 ? 62.944  41.074  222.670 1.00 85.02  ? 183 THR D CG2 1 
ATOM   9742  N N   . LYS D 1 184 ? 65.875  42.241  223.870 1.00 85.48  ? 184 LYS D N   1 
ATOM   9743  C CA  . LYS D 1 184 ? 67.207  41.716  223.807 1.00 90.99  ? 184 LYS D CA  1 
ATOM   9744  C C   . LYS D 1 184 ? 67.282  40.334  223.198 1.00 86.10  ? 184 LYS D C   1 
ATOM   9745  O O   . LYS D 1 184 ? 67.522  39.349  223.891 1.00 85.73  ? 184 LYS D O   1 
ATOM   9746  C CB  . LYS D 1 184 ? 67.799  41.715  225.211 1.00 105.80 ? 184 LYS D CB  1 
ATOM   9747  C CG  . LYS D 1 184 ? 68.208  43.107  225.741 1.00 123.14 ? 184 LYS D CG  1 
ATOM   9748  C CD  . LYS D 1 184 ? 67.030  44.050  226.040 1.00 134.78 ? 184 LYS D CD  1 
ATOM   9749  C CE  . LYS D 1 184 ? 67.522  45.372  226.679 1.00 141.83 ? 184 LYS D CE  1 
ATOM   9750  N NZ  . LYS D 1 184 ? 68.091  45.242  228.080 1.00 145.06 ? 184 LYS D NZ  1 
ATOM   9751  N N   . TYR D 1 185 ? 67.021  40.239  221.906 1.00 81.70  ? 185 TYR D N   1 
ATOM   9752  C CA  . TYR D 1 185 ? 67.104  38.946  221.261 1.00 78.25  ? 185 TYR D CA  1 
ATOM   9753  C C   . TYR D 1 185 ? 68.530  38.514  221.323 1.00 80.81  ? 185 TYR D C   1 
ATOM   9754  O O   . TYR D 1 185 ? 69.435  39.336  221.329 1.00 79.65  ? 185 TYR D O   1 
ATOM   9755  C CB  . TYR D 1 185 ? 66.660  39.043  219.824 1.00 73.07  ? 185 TYR D CB  1 
ATOM   9756  C CG  . TYR D 1 185 ? 65.199  39.263  219.731 1.00 65.84  ? 185 TYR D CG  1 
ATOM   9757  C CD1 . TYR D 1 185 ? 64.339  38.271  220.109 1.00 67.50  ? 185 TYR D CD1 1 
ATOM   9758  C CD2 . TYR D 1 185 ? 64.666  40.471  219.322 1.00 62.59  ? 185 TYR D CD2 1 
ATOM   9759  C CE1 . TYR D 1 185 ? 62.968  38.460  220.092 1.00 67.88  ? 185 TYR D CE1 1 
ATOM   9760  C CE2 . TYR D 1 185 ? 63.291  40.667  219.296 1.00 61.81  ? 185 TYR D CE2 1 
ATOM   9761  C CZ  . TYR D 1 185 ? 62.443  39.648  219.686 1.00 62.87  ? 185 TYR D CZ  1 
ATOM   9762  O OH  . TYR D 1 185 ? 61.069  39.756  219.661 1.00 60.05  ? 185 TYR D OH  1 
ATOM   9763  N N   . LYS D 1 186 ? 68.733  37.218  221.373 1.00 86.89  ? 186 LYS D N   1 
ATOM   9764  C CA  . LYS D 1 186 ? 70.074  36.695  221.443 1.00 98.90  ? 186 LYS D CA  1 
ATOM   9765  C C   . LYS D 1 186 ? 70.456  36.737  220.007 1.00 101.49 ? 186 LYS D C   1 
ATOM   9766  O O   . LYS D 1 186 ? 69.920  35.998  219.212 1.00 102.50 ? 186 LYS D O   1 
ATOM   9767  C CB  . LYS D 1 186 ? 70.050  35.257  221.936 1.00 108.91 ? 186 LYS D CB  1 
ATOM   9768  C CG  . LYS D 1 186 ? 69.271  35.049  223.246 1.00 125.83 ? 186 LYS D CG  1 
ATOM   9769  C CD  . LYS D 1 186 ? 67.741  35.169  223.060 1.00 135.48 ? 186 LYS D CD  1 
ATOM   9770  C CE  . LYS D 1 186 ? 67.149  36.300  223.875 1.00 140.95 ? 186 LYS D CE  1 
ATOM   9771  N NZ  . LYS D 1 186 ? 67.084  36.039  225.349 1.00 145.41 ? 186 LYS D NZ  1 
ATOM   9772  N N   . GLU D 1 187 ? 71.338  37.645  219.653 1.00 107.55 ? 187 GLU D N   1 
ATOM   9773  C CA  . GLU D 1 187 ? 71.742  37.784  218.265 1.00 115.98 ? 187 GLU D CA  1 
ATOM   9774  C C   . GLU D 1 187 ? 72.355  36.530  217.697 1.00 115.51 ? 187 GLU D C   1 
ATOM   9775  O O   . GLU D 1 187 ? 72.715  36.487  216.519 1.00 114.24 ? 187 GLU D O   1 
ATOM   9776  C CB  . GLU D 1 187 ? 72.754  38.888  218.160 1.00 127.42 ? 187 GLU D CB  1 
ATOM   9777  C CG  . GLU D 1 187 ? 73.876  38.705  219.150 1.00 142.55 ? 187 GLU D CG  1 
ATOM   9778  C CD  . GLU D 1 187 ? 74.749  39.925  219.218 1.00 152.80 ? 187 GLU D CD  1 
ATOM   9779  O OE1 . GLU D 1 187 ? 74.429  40.834  220.021 1.00 159.36 ? 187 GLU D OE1 1 
ATOM   9780  O OE2 . GLU D 1 187 ? 75.734  39.986  218.446 1.00 158.71 ? 187 GLU D OE2 1 
ATOM   9781  N N   . GLU D 1 188 ? 72.512  35.529  218.550 1.00 115.36 ? 188 GLU D N   1 
ATOM   9782  C CA  . GLU D 1 188 ? 73.094  34.269  218.143 1.00 117.38 ? 188 GLU D CA  1 
ATOM   9783  C C   . GLU D 1 188 ? 72.058  33.143  218.156 1.00 108.58 ? 188 GLU D C   1 
ATOM   9784  O O   . GLU D 1 188 ? 71.418  32.915  219.175 1.00 107.91 ? 188 GLU D O   1 
ATOM   9785  C CB  . GLU D 1 188 ? 74.233  33.933  219.100 1.00 132.44 ? 188 GLU D CB  1 
ATOM   9786  C CG  . GLU D 1 188 ? 75.209  32.890  218.572 1.00 158.23 ? 188 GLU D CG  1 
ATOM   9787  C CD  . GLU D 1 188 ? 75.991  33.364  217.340 1.00 173.04 ? 188 GLU D CD  1 
ATOM   9788  O OE1 . GLU D 1 188 ? 75.414  33.358  216.219 1.00 182.19 ? 188 GLU D OE1 1 
ATOM   9789  O OE2 . GLU D 1 188 ? 77.188  33.728  217.497 1.00 181.66 ? 188 GLU D OE2 1 
ATOM   9790  N N   . GLY D 1 189 ? 71.897  32.438  217.038 1.00 100.91 ? 189 GLY D N   1 
ATOM   9791  C CA  . GLY D 1 189 ? 70.934  31.341  216.985 1.00 91.36  ? 189 GLY D CA  1 
ATOM   9792  C C   . GLY D 1 189 ? 69.489  31.761  216.748 1.00 84.56  ? 189 GLY D C   1 
ATOM   9793  O O   . GLY D 1 189 ? 68.536  31.165  217.251 1.00 85.00  ? 189 GLY D O   1 
ATOM   9794  N N   . VAL D 1 190 ? 69.327  32.780  215.930 1.00 76.81  ? 190 VAL D N   1 
ATOM   9795  C CA  . VAL D 1 190 ? 68.021  33.294  215.618 1.00 68.28  ? 190 VAL D CA  1 
ATOM   9796  C C   . VAL D 1 190 ? 68.311  34.311  214.547 1.00 65.15  ? 190 VAL D C   1 
ATOM   9797  O O   . VAL D 1 190 ? 69.470  34.584  214.251 1.00 64.01  ? 190 VAL D O   1 
ATOM   9798  C CB  . VAL D 1 190 ? 67.435  34.037  216.811 1.00 65.58  ? 190 VAL D CB  1 
ATOM   9799  C CG1 . VAL D 1 190 ? 68.067  35.416  216.943 1.00 64.49  ? 190 VAL D CG1 1 
ATOM   9800  C CG2 . VAL D 1 190 ? 65.974  34.175  216.642 1.00 67.60  ? 190 VAL D CG2 1 
ATOM   9801  N N   . VAL D 1 191 ? 67.273  34.821  213.909 1.00 60.85  ? 191 VAL D N   1 
ATOM   9802  C CA  . VAL D 1 191 ? 67.484  35.837  212.911 1.00 56.06  ? 191 VAL D CA  1 
ATOM   9803  C C   . VAL D 1 191 ? 66.640  36.963  213.369 1.00 52.15  ? 191 VAL D C   1 
ATOM   9804  O O   . VAL D 1 191 ? 65.419  36.887  213.419 1.00 54.20  ? 191 VAL D O   1 
ATOM   9805  C CB  . VAL D 1 191 ? 66.996  35.484  211.529 1.00 57.27  ? 191 VAL D CB  1 
ATOM   9806  C CG1 . VAL D 1 191 ? 67.745  36.320  210.536 1.00 58.15  ? 191 VAL D CG1 1 
ATOM   9807  C CG2 . VAL D 1 191 ? 67.148  34.032  211.246 1.00 55.69  ? 191 VAL D CG2 1 
ATOM   9808  N N   . THR D 1 192 ? 67.304  37.949  213.882 1.00 47.54  ? 192 THR D N   1 
ATOM   9809  C CA  . THR D 1 192 ? 66.586  39.084  214.308 1.00 45.98  ? 192 THR D CA  1 
ATOM   9810  C C   . THR D 1 192 ? 66.829  40.076  213.239 1.00 42.36  ? 192 THR D C   1 
ATOM   9811  O O   . THR D 1 192 ? 67.564  39.827  212.302 1.00 41.91  ? 192 THR D O   1 
ATOM   9812  C CB  . THR D 1 192 ? 67.154  39.592  215.568 1.00 48.17  ? 192 THR D CB  1 
ATOM   9813  O OG1 . THR D 1 192 ? 68.068  38.611  216.076 1.00 49.09  ? 192 THR D OG1 1 
ATOM   9814  C CG2 . THR D 1 192 ? 66.043  39.831  216.553 1.00 47.34  ? 192 THR D CG2 1 
ATOM   9815  N N   . ILE D 1 193 ? 66.128  41.176  213.348 1.00 43.54  ? 193 ILE D N   1 
ATOM   9816  C CA  . ILE D 1 193 ? 66.291  42.261  212.428 1.00 48.52  ? 193 ILE D CA  1 
ATOM   9817  C C   . ILE D 1 193 ? 67.755  42.625  212.518 1.00 54.18  ? 193 ILE D C   1 
ATOM   9818  O O   . ILE D 1 193 ? 68.380  42.810  211.500 1.00 57.56  ? 193 ILE D O   1 
ATOM   9819  C CB  . ILE D 1 193 ? 65.447  43.493  212.820 1.00 48.37  ? 193 ILE D CB  1 
ATOM   9820  C CG1 . ILE D 1 193 ? 64.726  43.277  214.156 1.00 54.20  ? 193 ILE D CG1 1 
ATOM   9821  C CG2 . ILE D 1 193 ? 64.366  43.719  211.821 1.00 46.40  ? 193 ILE D CG2 1 
ATOM   9822  C CD1 . ILE D 1 193 ? 65.618  42.960  215.387 1.00 50.16  ? 193 ILE D CD1 1 
ATOM   9823  N N   . LYS D 1 194 ? 68.331  42.635  213.721 1.00 58.88  ? 194 LYS D N   1 
ATOM   9824  C CA  . LYS D 1 194 ? 69.748  43.004  213.854 1.00 66.98  ? 194 LYS D CA  1 
ATOM   9825  C C   . LYS D 1 194 ? 70.556  41.993  213.131 1.00 66.13  ? 194 LYS D C   1 
ATOM   9826  O O   . LYS D 1 194 ? 71.472  42.300  212.381 1.00 62.66  ? 194 LYS D O   1 
ATOM   9827  C CB  . LYS D 1 194 ? 70.226  43.044  215.307 1.00 78.37  ? 194 LYS D CB  1 
ATOM   9828  C CG  . LYS D 1 194 ? 69.679  41.944  216.229 1.00 99.64  ? 194 LYS D CG  1 
ATOM   9829  C CD  . LYS D 1 194 ? 68.341  42.391  216.885 1.00 117.70 ? 194 LYS D CD  1 
ATOM   9830  C CE  . LYS D 1 194 ? 68.002  41.744  218.267 1.00 125.08 ? 194 LYS D CE  1 
ATOM   9831  N NZ  . LYS D 1 194 ? 68.616  42.351  219.519 1.00 134.68 ? 194 LYS D NZ  1 
ATOM   9832  N N   . THR D 1 195 ? 70.135  40.761  213.305 1.00 70.38  ? 195 THR D N   1 
ATOM   9833  C CA  . THR D 1 195 ? 70.801  39.662  212.679 1.00 76.03  ? 195 THR D CA  1 
ATOM   9834  C C   . THR D 1 195 ? 70.830  39.891  211.178 1.00 75.26  ? 195 THR D C   1 
ATOM   9835  O O   . THR D 1 195 ? 71.553  39.218  210.466 1.00 76.93  ? 195 THR D O   1 
ATOM   9836  C CB  . THR D 1 195 ? 70.076  38.382  213.024 1.00 79.32  ? 195 THR D CB  1 
ATOM   9837  O OG1 . THR D 1 195 ? 69.803  38.382  214.433 1.00 83.16  ? 195 THR D OG1 1 
ATOM   9838  C CG2 . THR D 1 195 ? 70.927  37.182  212.700 1.00 84.17  ? 195 THR D CG2 1 
ATOM   9839  N N   . ILE D 1 196 ? 70.093  40.882  210.702 1.00 75.00  ? 196 ILE D N   1 
ATOM   9840  C CA  . ILE D 1 196 ? 70.073  41.172  209.289 1.00 76.86  ? 196 ILE D CA  1 
ATOM   9841  C C   . ILE D 1 196 ? 70.434  42.635  208.956 1.00 77.13  ? 196 ILE D C   1 
ATOM   9842  O O   . ILE D 1 196 ? 71.346  42.890  208.163 1.00 77.86  ? 196 ILE D O   1 
ATOM   9843  C CB  . ILE D 1 196 ? 68.769  40.650  208.667 1.00 78.63  ? 196 ILE D CB  1 
ATOM   9844  C CG1 . ILE D 1 196 ? 68.594  41.188  207.261 1.00 84.73  ? 196 ILE D CG1 1 
ATOM   9845  C CG2 . ILE D 1 196 ? 67.601  40.913  209.561 1.00 79.27  ? 196 ILE D CG2 1 
ATOM   9846  C CD1 . ILE D 1 196 ? 69.766  40.871  206.346 1.00 93.25  ? 196 ILE D CD1 1 
ATOM   9847  N N   . THR D 1 197 ? 69.690  43.609  209.455 1.00 79.45  ? 197 THR D N   1 
ATOM   9848  C CA  . THR D 1 197 ? 70.123  44.976  209.219 1.00 85.09  ? 197 THR D CA  1 
ATOM   9849  C C   . THR D 1 197 ? 71.251  44.940  210.194 1.00 91.60  ? 197 THR D C   1 
ATOM   9850  O O   . THR D 1 197 ? 71.066  44.530  211.337 1.00 93.68  ? 197 THR D O   1 
ATOM   9851  C CB  . THR D 1 197 ? 69.131  46.067  209.699 1.00 86.21  ? 197 THR D CB  1 
ATOM   9852  O OG1 . THR D 1 197 ? 69.832  47.314  209.743 1.00 90.27  ? 197 THR D OG1 1 
ATOM   9853  C CG2 . THR D 1 197 ? 68.517  45.783  211.097 1.00 79.58  ? 197 THR D CG2 1 
ATOM   9854  N N   . LYS D 1 198 ? 72.424  45.371  209.801 1.00 98.13  ? 198 LYS D N   1 
ATOM   9855  C CA  . LYS D 1 198 ? 73.478  45.238  210.774 1.00 107.31 ? 198 LYS D CA  1 
ATOM   9856  C C   . LYS D 1 198 ? 73.503  46.152  211.967 1.00 108.19 ? 198 LYS D C   1 
ATOM   9857  O O   . LYS D 1 198 ? 74.525  46.285  212.628 1.00 111.46 ? 198 LYS D O   1 
ATOM   9858  C CB  . LYS D 1 198 ? 74.820  45.135  210.084 1.00 118.77 ? 198 LYS D CB  1 
ATOM   9859  C CG  . LYS D 1 198 ? 74.904  43.815  209.346 1.00 134.88 ? 198 LYS D CG  1 
ATOM   9860  C CD  . LYS D 1 198 ? 74.318  42.684  210.229 1.00 146.19 ? 198 LYS D CD  1 
ATOM   9861  C CE  . LYS D 1 198 ? 73.965  41.399  209.447 1.00 154.68 ? 198 LYS D CE  1 
ATOM   9862  N NZ  . LYS D 1 198 ? 75.148  40.608  208.949 1.00 161.16 ? 198 LYS D NZ  1 
ATOM   9863  N N   . LYS D 1 199 ? 72.350  46.683  212.328 1.00 108.88 ? 199 LYS D N   1 
ATOM   9864  C CA  . LYS D 1 199 ? 72.292  47.594  213.444 1.00 112.28 ? 199 LYS D CA  1 
ATOM   9865  C C   . LYS D 1 199 ? 71.163  47.206  214.335 1.00 108.75 ? 199 LYS D C   1 
ATOM   9866  O O   . LYS D 1 199 ? 70.522  46.190  214.104 1.00 107.66 ? 199 LYS D O   1 
ATOM   9867  C CB  . LYS D 1 199 ? 72.101  49.023  212.940 1.00 124.39 ? 199 LYS D CB  1 
ATOM   9868  C CG  . LYS D 1 199 ? 73.424  49.769  212.658 1.00 140.91 ? 199 LYS D CG  1 
ATOM   9869  C CD  . LYS D 1 199 ? 73.332  50.778  211.484 1.00 154.06 ? 199 LYS D CD  1 
ATOM   9870  C CE  . LYS D 1 199 ? 73.397  50.058  210.122 1.00 163.51 ? 199 LYS D CE  1 
ATOM   9871  N NZ  . LYS D 1 199 ? 73.155  50.917  208.915 1.00 168.98 ? 199 LYS D NZ  1 
ATOM   9872  N N   . ASP D 1 200 ? 70.933  48.016  215.360 1.00 107.63 ? 200 ASP D N   1 
ATOM   9873  C CA  . ASP D 1 200 ? 69.859  47.765  216.299 1.00 107.04 ? 200 ASP D CA  1 
ATOM   9874  C C   . ASP D 1 200 ? 68.559  48.397  215.852 1.00 102.69 ? 200 ASP D C   1 
ATOM   9875  O O   . ASP D 1 200 ? 68.543  49.398  215.130 1.00 103.39 ? 200 ASP D O   1 
ATOM   9876  C CB  . ASP D 1 200 ? 70.231  48.215  217.710 1.00 116.29 ? 200 ASP D CB  1 
ATOM   9877  C CG  . ASP D 1 200 ? 71.209  47.259  218.391 1.00 123.57 ? 200 ASP D CG  1 
ATOM   9878  O OD1 . ASP D 1 200 ? 71.118  46.020  218.174 1.00 129.45 ? 200 ASP D OD1 1 
ATOM   9879  O OD2 . ASP D 1 200 ? 72.070  47.753  219.152 1.00 127.24 ? 200 ASP D OD2 1 
ATOM   9880  N N   . MET D 1 201 ? 67.472  47.780  216.289 1.00 95.40  ? 201 MET D N   1 
ATOM   9881  C CA  . MET D 1 201 ? 66.132  48.195  215.937 1.00 89.30  ? 201 MET D CA  1 
ATOM   9882  C C   . MET D 1 201 ? 65.889  49.614  216.296 1.00 85.05  ? 201 MET D C   1 
ATOM   9883  O O   . MET D 1 201 ? 66.575  50.166  217.154 1.00 86.75  ? 201 MET D O   1 
ATOM   9884  C CB  . MET D 1 201 ? 65.132  47.365  216.692 1.00 90.70  ? 201 MET D CB  1 
ATOM   9885  C CG  . MET D 1 201 ? 65.432  45.932  216.622 1.00 94.27  ? 201 MET D CG  1 
ATOM   9886  S SD  . MET D 1 201 ? 64.383  45.076  217.718 1.00 92.99  ? 201 MET D SD  1 
ATOM   9887  C CE  . MET D 1 201 ? 63.073  44.710  216.654 1.00 95.51  ? 201 MET D CE  1 
ATOM   9888  N N   . VAL D 1 202 ? 64.838  50.160  215.699 1.00 78.81  ? 202 VAL D N   1 
ATOM   9889  C CA  . VAL D 1 202 ? 64.435  51.533  215.924 1.00 74.15  ? 202 VAL D CA  1 
ATOM   9890  C C   . VAL D 1 202 ? 62.936  51.562  216.058 1.00 72.97  ? 202 VAL D C   1 
ATOM   9891  O O   . VAL D 1 202 ? 62.258  50.633  215.621 1.00 72.70  ? 202 VAL D O   1 
ATOM   9892  C CB  . VAL D 1 202 ? 64.753  52.400  214.730 1.00 71.77  ? 202 VAL D CB  1 
ATOM   9893  C CG1 . VAL D 1 202 ? 65.098  53.804  215.205 1.00 72.55  ? 202 VAL D CG1 1 
ATOM   9894  C CG2 . VAL D 1 202 ? 65.844  51.749  213.866 1.00 71.94  ? 202 VAL D CG2 1 
ATOM   9895  N N   . ASN D 1 203 ? 62.407  52.645  216.608 1.00 70.69  ? 203 ASN D N   1 
ATOM   9896  C CA  . ASN D 1 203 ? 60.965  52.758  216.751 1.00 69.55  ? 203 ASN D CA  1 
ATOM   9897  C C   . ASN D 1 203 ? 60.317  52.328  215.449 1.00 66.56  ? 203 ASN D C   1 
ATOM   9898  O O   . ASN D 1 203 ? 59.382  51.555  215.439 1.00 64.91  ? 203 ASN D O   1 
ATOM   9899  C CB  . ASN D 1 203 ? 60.554  54.186  217.107 1.00 69.89  ? 203 ASN D CB  1 
ATOM   9900  C CG  . ASN D 1 203 ? 61.275  55.214  216.283 1.00 74.54  ? 203 ASN D CG  1 
ATOM   9901  O OD1 . ASN D 1 203 ? 62.375  54.951  215.800 1.00 76.65  ? 203 ASN D OD1 1 
ATOM   9902  N ND2 . ASN D 1 203 ? 60.674  56.398  216.120 1.00 73.53  ? 203 ASN D ND2 1 
ATOM   9903  N N   . LYS D 1 204 ? 60.902  52.725  214.339 1.00 66.44  ? 204 LYS D N   1 
ATOM   9904  C CA  . LYS D 1 204 ? 60.340  52.347  213.065 1.00 70.68  ? 204 LYS D CA  1 
ATOM   9905  C C   . LYS D 1 204 ? 60.028  50.851  212.945 1.00 68.29  ? 204 LYS D C   1 
ATOM   9906  O O   . LYS D 1 204 ? 58.896  50.486  212.601 1.00 66.80  ? 204 LYS D O   1 
ATOM   9907  C CB  . LYS D 1 204 ? 61.247  52.821  211.934 1.00 81.91  ? 204 LYS D CB  1 
ATOM   9908  C CG  . LYS D 1 204 ? 61.208  54.343  211.744 1.00 99.54  ? 204 LYS D CG  1 
ATOM   9909  C CD  . LYS D 1 204 ? 62.519  54.942  211.167 1.00 115.01 ? 204 LYS D CD  1 
ATOM   9910  C CE  . LYS D 1 204 ? 62.512  55.232  209.634 1.00 124.74 ? 204 LYS D CE  1 
ATOM   9911  N NZ  . LYS D 1 204 ? 62.888  54.079  208.730 1.00 132.45 ? 204 LYS D NZ  1 
ATOM   9912  N N   . ASP D 1 205 ? 60.993  49.990  213.282 1.00 65.54  ? 205 ASP D N   1 
ATOM   9913  C CA  . ASP D 1 205 ? 60.803  48.536  213.180 1.00 61.73  ? 205 ASP D CA  1 
ATOM   9914  C C   . ASP D 1 205 ? 59.540  48.160  213.943 1.00 60.40  ? 205 ASP D C   1 
ATOM   9915  O O   . ASP D 1 205 ? 58.747  47.330  213.500 1.00 61.02  ? 205 ASP D O   1 
ATOM   9916  C CB  . ASP D 1 205 ? 61.981  47.765  213.789 1.00 64.43  ? 205 ASP D CB  1 
ATOM   9917  C CG  . ASP D 1 205 ? 63.338  48.189  213.249 1.00 67.15  ? 205 ASP D CG  1 
ATOM   9918  O OD1 . ASP D 1 205 ? 63.652  49.396  213.249 1.00 73.59  ? 205 ASP D OD1 1 
ATOM   9919  O OD2 . ASP D 1 205 ? 64.141  47.299  212.897 1.00 68.56  ? 205 ASP D OD2 1 
ATOM   9920  N N   . GLN D 1 206 ? 59.342  48.850  215.060 1.00 57.52  ? 206 GLN D N   1 
ATOM   9921  C CA  . GLN D 1 206 ? 58.212  48.670  215.957 1.00 56.62  ? 206 GLN D CA  1 
ATOM   9922  C C   . GLN D 1 206 ? 56.883  48.853  215.241 1.00 53.16  ? 206 GLN D C   1 
ATOM   9923  O O   . GLN D 1 206 ? 55.822  48.532  215.776 1.00 50.85  ? 206 GLN D O   1 
ATOM   9924  C CB  . GLN D 1 206 ? 58.357  49.674  217.089 1.00 60.10  ? 206 GLN D CB  1 
ATOM   9925  C CG  . GLN D 1 206 ? 57.474  49.510  218.279 1.00 73.56  ? 206 GLN D CG  1 
ATOM   9926  C CD  . GLN D 1 206 ? 57.976  50.327  219.475 1.00 82.49  ? 206 GLN D CD  1 
ATOM   9927  O OE1 . GLN D 1 206 ? 57.826  51.566  219.504 1.00 88.71  ? 206 GLN D OE1 1 
ATOM   9928  N NE2 . GLN D 1 206 ? 58.583  49.642  220.466 1.00 81.26  ? 206 GLN D NE2 1 
ATOM   9929  N N   . VAL D 1 207 ? 56.925  49.386  214.030 1.00 48.09  ? 207 VAL D N   1 
ATOM   9930  C CA  . VAL D 1 207 ? 55.702  49.558  213.275 1.00 43.71  ? 207 VAL D CA  1 
ATOM   9931  C C   . VAL D 1 207 ? 55.859  49.151  211.844 1.00 42.97  ? 207 VAL D C   1 
ATOM   9932  O O   . VAL D 1 207 ? 55.102  48.349  211.379 1.00 50.73  ? 207 VAL D O   1 
ATOM   9933  C CB  . VAL D 1 207 ? 55.147  50.919  213.340 1.00 42.53  ? 207 VAL D CB  1 
ATOM   9934  C CG1 . VAL D 1 207 ? 54.919  51.286  214.791 1.00 45.50  ? 207 VAL D CG1 1 
ATOM   9935  C CG2 . VAL D 1 207 ? 56.051  51.876  212.659 1.00 41.09  ? 207 VAL D CG2 1 
ATOM   9936  N N   . LEU D 1 208 ? 56.762  49.715  211.083 1.00 36.85  ? 208 LEU D N   1 
ATOM   9937  C CA  . LEU D 1 208 ? 56.904  49.185  209.750 1.00 35.04  ? 208 LEU D CA  1 
ATOM   9938  C C   . LEU D 1 208 ? 58.228  49.560  209.186 1.00 38.03  ? 208 LEU D C   1 
ATOM   9939  O O   . LEU D 1 208 ? 58.322  50.492  208.366 1.00 33.54  ? 208 LEU D O   1 
ATOM   9940  C CB  . LEU D 1 208 ? 55.800  49.639  208.783 1.00 28.93  ? 208 LEU D CB  1 
ATOM   9941  C CG  . LEU D 1 208 ? 56.155  49.002  207.433 1.00 23.88  ? 208 LEU D CG  1 
ATOM   9942  C CD1 . LEU D 1 208 ? 55.931  47.570  207.532 1.00 25.02  ? 208 LEU D CD1 1 
ATOM   9943  C CD2 . LEU D 1 208 ? 55.339  49.408  206.291 1.00 18.58  ? 208 LEU D CD2 1 
ATOM   9944  N N   . ASN D 1 209 ? 59.285  48.894  209.622 1.00 43.00  ? 209 ASN D N   1 
ATOM   9945  C CA  . ASN D 1 209 ? 60.551  49.268  209.014 1.00 46.38  ? 209 ASN D CA  1 
ATOM   9946  C C   . ASN D 1 209 ? 60.738  48.518  207.693 1.00 46.24  ? 209 ASN D C   1 
ATOM   9947  O O   . ASN D 1 209 ? 60.998  47.311  207.647 1.00 45.87  ? 209 ASN D O   1 
ATOM   9948  C CB  . ASN D 1 209 ? 61.757  49.103  209.921 1.00 53.62  ? 209 ASN D CB  1 
ATOM   9949  C CG  . ASN D 1 209 ? 62.971  49.773  209.342 1.00 58.80  ? 209 ASN D CG  1 
ATOM   9950  O OD1 . ASN D 1 209 ? 62.829  50.612  208.447 1.00 59.14  ? 209 ASN D OD1 1 
ATOM   9951  N ND2 . ASN D 1 209 ? 64.165  49.385  209.793 1.00 65.06  ? 209 ASN D ND2 1 
ATOM   9952  N N   . PRO D 1 210 ? 60.606  49.240  206.590 1.00 44.89  ? 210 PRO D N   1 
ATOM   9953  C CA  . PRO D 1 210 ? 60.724  48.756  205.221 1.00 45.88  ? 210 PRO D CA  1 
ATOM   9954  C C   . PRO D 1 210 ? 62.082  48.187  204.971 1.00 47.80  ? 210 PRO D C   1 
ATOM   9955  O O   . PRO D 1 210 ? 62.307  47.481  203.990 1.00 53.91  ? 210 PRO D O   1 
ATOM   9956  C CB  . PRO D 1 210 ? 60.524  50.022  204.405 1.00 47.20  ? 210 PRO D CB  1 
ATOM   9957  C CG  . PRO D 1 210 ? 59.696  50.863  205.322 1.00 50.69  ? 210 PRO D CG  1 
ATOM   9958  C CD  . PRO D 1 210 ? 60.425  50.687  206.594 1.00 47.05  ? 210 PRO D CD  1 
ATOM   9959  N N   . ILE D 1 211 ? 63.008  48.526  205.847 1.00 46.11  ? 211 ILE D N   1 
ATOM   9960  C CA  . ILE D 1 211 ? 64.354  48.029  205.703 1.00 46.54  ? 211 ILE D CA  1 
ATOM   9961  C C   . ILE D 1 211 ? 64.411  46.686  206.363 1.00 42.60  ? 211 ILE D C   1 
ATOM   9962  O O   . ILE D 1 211 ? 65.110  45.766  205.933 1.00 41.62  ? 211 ILE D O   1 
ATOM   9963  C CB  . ILE D 1 211 ? 65.319  48.933  206.394 1.00 50.55  ? 211 ILE D CB  1 
ATOM   9964  C CG1 . ILE D 1 211 ? 65.311  50.293  205.700 1.00 59.17  ? 211 ILE D CG1 1 
ATOM   9965  C CG2 . ILE D 1 211 ? 66.701  48.325  206.342 1.00 52.79  ? 211 ILE D CG2 1 
ATOM   9966  C CD1 . ILE D 1 211 ? 63.969  51.055  205.729 1.00 63.09  ? 211 ILE D CD1 1 
ATOM   9967  N N   . SER D 1 212 ? 63.616  46.582  207.402 1.00 39.10  ? 212 SER D N   1 
ATOM   9968  C CA  . SER D 1 212 ? 63.549  45.383  208.162 1.00 40.94  ? 212 SER D CA  1 
ATOM   9969  C C   . SER D 1 212 ? 62.746  44.322  207.451 1.00 40.51  ? 212 SER D C   1 
ATOM   9970  O O   . SER D 1 212 ? 61.722  43.851  207.922 1.00 39.16  ? 212 SER D O   1 
ATOM   9971  C CB  . SER D 1 212 ? 63.026  45.734  209.542 1.00 47.58  ? 212 SER D CB  1 
ATOM   9972  O OG  . SER D 1 212 ? 63.877  46.744  210.083 1.00 48.78  ? 212 SER D OG  1 
ATOM   9973  N N   . LYS D 1 213 ? 63.277  43.927  206.314 1.00 42.63  ? 213 LYS D N   1 
ATOM   9974  C CA  . LYS D 1 213 ? 62.674  42.915  205.493 1.00 51.68  ? 213 LYS D CA  1 
ATOM   9975  C C   . LYS D 1 213 ? 63.772  41.905  205.277 1.00 53.18  ? 213 LYS D C   1 
ATOM   9976  O O   . LYS D 1 213 ? 64.938  42.288  205.183 1.00 53.79  ? 213 LYS D O   1 
ATOM   9977  C CB  . LYS D 1 213 ? 62.298  43.486  204.123 1.00 57.46  ? 213 LYS D CB  1 
ATOM   9978  C CG  . LYS D 1 213 ? 61.205  44.534  204.119 1.00 64.58  ? 213 LYS D CG  1 
ATOM   9979  C CD  . LYS D 1 213 ? 60.718  44.811  202.698 1.00 67.29  ? 213 LYS D CD  1 
ATOM   9980  C CE  . LYS D 1 213 ? 59.543  45.790  202.663 1.00 69.69  ? 213 LYS D CE  1 
ATOM   9981  N NZ  . LYS D 1 213 ? 58.223  45.270  203.203 1.00 72.12  ? 213 LYS D NZ  1 
ATOM   9982  N N   . ALA D 1 214 ? 63.416  40.630  205.161 1.00 53.21  ? 214 ALA D N   1 
ATOM   9983  C CA  . ALA D 1 214 ? 64.422  39.612  204.904 1.00 53.41  ? 214 ALA D CA  1 
ATOM   9984  C C   . ALA D 1 214 ? 63.858  38.535  203.973 1.00 54.09  ? 214 ALA D C   1 
ATOM   9985  O O   . ALA D 1 214 ? 62.892  38.791  203.227 1.00 57.14  ? 214 ALA D O   1 
ATOM   9986  C CB  . ALA D 1 214 ? 64.883  39.018  206.200 1.00 50.62  ? 214 ALA D CB  1 
ATOM   9987  N N   . LYS D 1 215 ? 64.468  37.350  204.005 1.00 53.04  ? 215 LYS D N   1 
ATOM   9988  C CA  . LYS D 1 215 ? 64.031  36.216  203.211 1.00 53.98  ? 215 LYS D CA  1 
ATOM   9989  C C   . LYS D 1 215 ? 63.933  35.015  204.144 1.00 53.84  ? 215 LYS D C   1 
ATOM   9990  O O   . LYS D 1 215 ? 64.354  35.087  205.290 1.00 54.12  ? 215 LYS D O   1 
ATOM   9991  C CB  . LYS D 1 215 ? 65.035  35.957  202.101 1.00 58.82  ? 215 LYS D CB  1 
ATOM   9992  C CG  . LYS D 1 215 ? 64.716  36.674  200.785 1.00 72.10  ? 215 LYS D CG  1 
ATOM   9993  C CD  . LYS D 1 215 ? 63.552  35.997  200.021 1.00 81.67  ? 215 LYS D CD  1 
ATOM   9994  C CE  . LYS D 1 215 ? 63.583  36.303  198.487 1.00 89.80  ? 215 LYS D CE  1 
ATOM   9995  N NZ  . LYS D 1 215 ? 62.580  35.550  197.601 1.00 95.58  ? 215 LYS D NZ  1 
ATOM   9996  N N   . LEU D 1 216 ? 63.373  33.909  203.678 1.00 53.02  ? 216 LEU D N   1 
ATOM   9997  C CA  . LEU D 1 216 ? 63.268  32.729  204.540 1.00 50.69  ? 216 LEU D CA  1 
ATOM   9998  C C   . LEU D 1 216 ? 64.394  31.726  204.435 1.00 52.47  ? 216 LEU D C   1 
ATOM   9999  O O   . LEU D 1 216 ? 64.185  30.563  204.689 1.00 48.59  ? 216 LEU D O   1 
ATOM   10000 C CB  . LEU D 1 216 ? 61.993  31.991  204.228 1.00 47.64  ? 216 LEU D CB  1 
ATOM   10001 C CG  . LEU D 1 216 ? 61.150  31.880  205.488 1.00 49.69  ? 216 LEU D CG  1 
ATOM   10002 C CD1 . LEU D 1 216 ? 60.209  30.715  205.304 1.00 55.59  ? 216 LEU D CD1 1 
ATOM   10003 C CD2 . LEU D 1 216 ? 62.006  31.678  206.738 1.00 47.05  ? 216 LEU D CD2 1 
ATOM   10004 N N   . ASP D 1 217 ? 65.589  32.169  204.087 1.00 59.12  ? 217 ASP D N   1 
ATOM   10005 C CA  . ASP D 1 217 ? 66.681  31.231  203.876 1.00 62.30  ? 217 ASP D CA  1 
ATOM   10006 C C   . ASP D 1 217 ? 66.894  30.110  204.845 1.00 60.84  ? 217 ASP D C   1 
ATOM   10007 O O   . ASP D 1 217 ? 67.110  28.984  204.445 1.00 60.43  ? 217 ASP D O   1 
ATOM   10008 C CB  . ASP D 1 217 ? 67.996  31.911  203.555 1.00 74.68  ? 217 ASP D CB  1 
ATOM   10009 C CG  . ASP D 1 217 ? 68.302  33.044  204.479 1.00 88.70  ? 217 ASP D CG  1 
ATOM   10010 O OD1 . ASP D 1 217 ? 68.521  32.768  205.672 1.00 98.49  ? 217 ASP D OD1 1 
ATOM   10011 O OD2 . ASP D 1 217 ? 68.337  34.219  204.032 1.00 99.30  ? 217 ASP D OD2 1 
ATOM   10012 N N   . LYS D 1 218 ? 66.804  30.393  206.122 1.00 59.74  ? 218 LYS D N   1 
ATOM   10013 C CA  . LYS D 1 218 ? 66.997  29.320  207.045 1.00 64.01  ? 218 LYS D CA  1 
ATOM   10014 C C   . LYS D 1 218 ? 65.703  28.669  207.342 1.00 60.59  ? 218 LYS D C   1 
ATOM   10015 O O   . LYS D 1 218 ? 64.933  28.385  206.452 1.00 56.96  ? 218 LYS D O   1 
ATOM   10016 C CB  . LYS D 1 218 ? 67.654  29.765  208.343 1.00 71.70  ? 218 LYS D CB  1 
ATOM   10017 C CG  . LYS D 1 218 ? 69.132  29.817  208.364 1.00 87.07  ? 218 LYS D CG  1 
ATOM   10018 C CD  . LYS D 1 218 ? 69.655  30.646  207.172 1.00 103.20 ? 218 LYS D CD  1 
ATOM   10019 C CE  . LYS D 1 218 ? 70.876  31.536  207.544 1.00 113.48 ? 218 LYS D CE  1 
ATOM   10020 N NZ  . LYS D 1 218 ? 71.173  32.689  206.590 1.00 124.74 ? 218 LYS D NZ  1 
ATOM   10021 N N   . ASP D 1 219 ? 65.529  28.378  208.619 1.00 61.11  ? 219 ASP D N   1 
ATOM   10022 C CA  . ASP D 1 219 ? 64.314  27.775  209.056 1.00 63.85  ? 219 ASP D CA  1 
ATOM   10023 C C   . ASP D 1 219 ? 64.356  27.801  210.542 1.00 64.96  ? 219 ASP D C   1 
ATOM   10024 O O   . ASP D 1 219 ? 65.366  28.237  211.032 1.00 66.16  ? 219 ASP D O   1 
ATOM   10025 C CB  . ASP D 1 219 ? 64.350  26.384  208.538 1.00 63.13  ? 219 ASP D CB  1 
ATOM   10026 C CG  . ASP D 1 219 ? 63.986  25.409  209.557 1.00 65.61  ? 219 ASP D CG  1 
ATOM   10027 O OD1 . ASP D 1 219 ? 62.796  25.149  209.711 1.00 65.92  ? 219 ASP D OD1 1 
ATOM   10028 O OD2 . ASP D 1 219 ? 64.876  24.902  210.259 1.00 68.58  ? 219 ASP D OD2 1 
ATOM   10029 N N   . GLY D 1 220 ? 63.229  27.529  211.185 1.00 66.67  ? 220 GLY D N   1 
ATOM   10030 C CA  . GLY D 1 220 ? 63.153  27.503  212.633 1.00 65.67  ? 220 GLY D CA  1 
ATOM   10031 C C   . GLY D 1 220 ? 64.199  28.414  213.239 1.00 68.81  ? 220 GLY D C   1 
ATOM   10032 O O   . GLY D 1 220 ? 64.862  28.031  214.189 1.00 70.27  ? 220 GLY D O   1 
ATOM   10033 N N   . MET D 1 221 ? 64.357  29.621  212.695 1.00 69.64  ? 221 MET D N   1 
ATOM   10034 C CA  . MET D 1 221 ? 65.379  30.593  213.134 1.00 71.29  ? 221 MET D CA  1 
ATOM   10035 C C   . MET D 1 221 ? 64.685  31.927  213.090 1.00 66.89  ? 221 MET D C   1 
ATOM   10036 O O   . MET D 1 221 ? 64.986  32.884  213.817 1.00 65.82  ? 221 MET D O   1 
ATOM   10037 C CB  . MET D 1 221 ? 66.532  30.646  212.102 1.00 77.42  ? 221 MET D CB  1 
ATOM   10038 C CG  . MET D 1 221 ? 67.917  30.891  212.716 1.00 84.37  ? 221 MET D CG  1 
ATOM   10039 S SD  . MET D 1 221 ? 68.166  29.578  213.848 1.00 86.49  ? 221 MET D SD  1 
ATOM   10040 C CE  . MET D 1 221 ? 68.444  28.230  212.634 1.00 89.21  ? 221 MET D CE  1 
ATOM   10041 N N   . TYR D 1 222 ? 63.772  32.011  212.159 1.00 59.70  ? 222 TYR D N   1 
ATOM   10042 C CA  . TYR D 1 222 ? 63.066  33.226  212.063 1.00 53.76  ? 222 TYR D CA  1 
ATOM   10043 C C   . TYR D 1 222 ? 61.914  33.053  212.991 1.00 51.70  ? 222 TYR D C   1 
ATOM   10044 O O   . TYR D 1 222 ? 61.126  32.130  212.831 1.00 47.17  ? 222 TYR D O   1 
ATOM   10045 C CB  . TYR D 1 222 ? 62.624  33.362  210.661 1.00 58.32  ? 222 TYR D CB  1 
ATOM   10046 C CG  . TYR D 1 222 ? 63.786  33.444  209.733 1.00 59.66  ? 222 TYR D CG  1 
ATOM   10047 C CD1 . TYR D 1 222 ? 64.336  34.685  209.429 1.00 58.71  ? 222 TYR D CD1 1 
ATOM   10048 C CD2 . TYR D 1 222 ? 64.257  32.309  209.051 1.00 61.64  ? 222 TYR D CD2 1 
ATOM   10049 C CE1 . TYR D 1 222 ? 65.303  34.820  208.464 1.00 54.95  ? 222 TYR D CE1 1 
ATOM   10050 C CE2 . TYR D 1 222 ? 65.242  32.443  208.059 1.00 61.32  ? 222 TYR D CE2 1 
ATOM   10051 C CZ  . TYR D 1 222 ? 65.746  33.719  207.780 1.00 55.05  ? 222 TYR D CZ  1 
ATOM   10052 O OH  . TYR D 1 222 ? 66.655  33.967  206.803 1.00 47.67  ? 222 TYR D OH  1 
ATOM   10053 N N   . PRO D 1 223 ? 61.931  33.795  214.100 1.00 50.48  ? 223 PRO D N   1 
ATOM   10054 C CA  . PRO D 1 223 ? 60.866  33.731  215.095 1.00 52.40  ? 223 PRO D CA  1 
ATOM   10055 C C   . PRO D 1 223 ? 59.673  34.422  214.523 1.00 55.25  ? 223 PRO D C   1 
ATOM   10056 O O   . PRO D 1 223 ? 59.787  35.462  213.865 1.00 53.44  ? 223 PRO D O   1 
ATOM   10057 C CB  . PRO D 1 223 ? 61.438  34.515  216.256 1.00 49.24  ? 223 PRO D CB  1 
ATOM   10058 C CG  . PRO D 1 223 ? 62.277  35.520  215.572 1.00 49.49  ? 223 PRO D CG  1 
ATOM   10059 C CD  . PRO D 1 223 ? 62.977  34.739  214.517 1.00 47.62  ? 223 PRO D CD  1 
ATOM   10060 N N   . VAL D 1 224 ? 58.515  33.877  214.819 1.00 57.37  ? 224 VAL D N   1 
ATOM   10061 C CA  . VAL D 1 224 ? 57.295  34.441  214.294 1.00 61.15  ? 224 VAL D CA  1 
ATOM   10062 C C   . VAL D 1 224 ? 56.900  35.737  214.967 1.00 61.08  ? 224 VAL D C   1 
ATOM   10063 O O   . VAL D 1 224 ? 56.181  36.581  214.426 1.00 57.93  ? 224 VAL D O   1 
ATOM   10064 C CB  . VAL D 1 224 ? 56.232  33.425  214.400 1.00 62.42  ? 224 VAL D CB  1 
ATOM   10065 C CG1 . VAL D 1 224 ? 54.944  33.963  213.828 1.00 67.73  ? 224 VAL D CG1 1 
ATOM   10066 C CG2 . VAL D 1 224 ? 56.700  32.204  213.645 1.00 64.93  ? 224 VAL D CG2 1 
ATOM   10067 N N   . GLU D 1 225 ? 57.438  35.896  216.152 1.00 64.00  ? 225 GLU D N   1 
ATOM   10068 C CA  . GLU D 1 225 ? 57.222  37.073  216.953 1.00 66.93  ? 225 GLU D CA  1 
ATOM   10069 C C   . GLU D 1 225 ? 57.703  38.328  216.210 1.00 62.43  ? 225 GLU D C   1 
ATOM   10070 O O   . GLU D 1 225 ? 57.225  39.452  216.452 1.00 56.35  ? 225 GLU D O   1 
ATOM   10071 C CB  . GLU D 1 225 ? 58.044  36.862  218.219 1.00 73.36  ? 225 GLU D CB  1 
ATOM   10072 C CG  . GLU D 1 225 ? 58.050  37.989  219.210 1.00 78.18  ? 225 GLU D CG  1 
ATOM   10073 C CD  . GLU D 1 225 ? 58.341  37.470  220.592 1.00 78.81  ? 225 GLU D CD  1 
ATOM   10074 O OE1 . GLU D 1 225 ? 57.607  36.527  221.018 1.00 80.67  ? 225 GLU D OE1 1 
ATOM   10075 O OE2 . GLU D 1 225 ? 59.317  37.969  221.217 1.00 75.79  ? 225 GLU D OE2 1 
ATOM   10076 N N   . ILE D 1 226 ? 58.618  38.095  215.273 1.00 60.35  ? 226 ILE D N   1 
ATOM   10077 C CA  . ILE D 1 226 ? 59.263  39.143  214.493 1.00 59.27  ? 226 ILE D CA  1 
ATOM   10078 C C   . ILE D 1 226 ? 58.874  39.262  213.024 1.00 58.64  ? 226 ILE D C   1 
ATOM   10079 O O   . ILE D 1 226 ? 58.442  40.325  212.532 1.00 56.35  ? 226 ILE D O   1 
ATOM   10080 C CB  . ILE D 1 226 ? 60.784  38.918  214.533 1.00 59.35  ? 226 ILE D CB  1 
ATOM   10081 C CG1 . ILE D 1 226 ? 61.281  39.002  215.978 1.00 60.12  ? 226 ILE D CG1 1 
ATOM   10082 C CG2 . ILE D 1 226 ? 61.506  39.903  213.630 1.00 60.25  ? 226 ILE D CG2 1 
ATOM   10083 C CD1 . ILE D 1 226 ? 62.795  38.959  216.108 1.00 58.49  ? 226 ILE D CD1 1 
ATOM   10084 N N   . TRP D 1 227 ? 59.056  38.160  212.319 1.00 58.43  ? 227 TRP D N   1 
ATOM   10085 C CA  . TRP D 1 227 ? 58.800  38.119  210.892 1.00 60.69  ? 227 TRP D CA  1 
ATOM   10086 C C   . TRP D 1 227 ? 57.403  37.791  210.409 1.00 57.66  ? 227 TRP D C   1 
ATOM   10087 O O   . TRP D 1 227 ? 56.683  36.940  210.967 1.00 57.22  ? 227 TRP D O   1 
ATOM   10088 C CB  . TRP D 1 227 ? 59.805  37.184  210.264 1.00 67.94  ? 227 TRP D CB  1 
ATOM   10089 C CG  . TRP D 1 227 ? 61.169  37.565  210.670 1.00 73.51  ? 227 TRP D CG  1 
ATOM   10090 C CD1 . TRP D 1 227 ? 61.930  37.010  211.665 1.00 76.38  ? 227 TRP D CD1 1 
ATOM   10091 C CD2 . TRP D 1 227 ? 61.917  38.652  210.141 1.00 77.73  ? 227 TRP D CD2 1 
ATOM   10092 N NE1 . TRP D 1 227 ? 63.111  37.699  211.791 1.00 78.07  ? 227 TRP D NE1 1 
ATOM   10093 C CE2 . TRP D 1 227 ? 63.132  38.711  210.872 1.00 77.91  ? 227 TRP D CE2 1 
ATOM   10094 C CE3 . TRP D 1 227 ? 61.674  39.590  209.119 1.00 81.09  ? 227 TRP D CE3 1 
ATOM   10095 C CZ2 . TRP D 1 227 ? 64.107  39.673  210.612 1.00 80.75  ? 227 TRP D CZ2 1 
ATOM   10096 C CZ3 . TRP D 1 227 ? 62.635  40.546  208.856 1.00 82.63  ? 227 TRP D CZ3 1 
ATOM   10097 C CH2 . TRP D 1 227 ? 63.844  40.582  209.604 1.00 86.07  ? 227 TRP D CH2 1 
ATOM   10098 N N   . HIS D 1 228 ? 57.001  38.490  209.364 1.00 52.44  ? 228 HIS D N   1 
ATOM   10099 C CA  . HIS D 1 228 ? 55.692  38.236  208.834 1.00 50.72  ? 228 HIS D CA  1 
ATOM   10100 C C   . HIS D 1 228 ? 55.796  38.278  207.377 1.00 45.96  ? 228 HIS D C   1 
ATOM   10101 O O   . HIS D 1 228 ? 56.691  38.908  206.822 1.00 38.97  ? 228 HIS D O   1 
ATOM   10102 C CB  . HIS D 1 228 ? 54.677  39.281  209.250 1.00 54.85  ? 228 HIS D CB  1 
ATOM   10103 C CG  . HIS D 1 228 ? 54.853  39.743  210.646 1.00 62.72  ? 228 HIS D CG  1 
ATOM   10104 N ND1 . HIS D 1 228 ? 54.059  39.299  211.682 1.00 65.36  ? 228 HIS D ND1 1 
ATOM   10105 C CD2 . HIS D 1 228 ? 55.767  40.584  211.190 1.00 63.37  ? 228 HIS D CD2 1 
ATOM   10106 C CE1 . HIS D 1 228 ? 54.480  39.853  212.806 1.00 72.15  ? 228 HIS D CE1 1 
ATOM   10107 N NE2 . HIS D 1 228 ? 55.512  40.636  212.535 1.00 69.12  ? 228 HIS D NE2 1 
ATOM   10108 N N   . PRO D 1 229 ? 54.899  37.549  206.731 1.00 45.28  ? 229 PRO D N   1 
ATOM   10109 C CA  . PRO D 1 229 ? 54.839  37.477  205.288 1.00 45.04  ? 229 PRO D CA  1 
ATOM   10110 C C   . PRO D 1 229 ? 54.598  38.922  204.912 1.00 44.44  ? 229 PRO D C   1 
ATOM   10111 O O   . PRO D 1 229 ? 53.640  39.549  205.405 1.00 43.05  ? 229 PRO D O   1 
ATOM   10112 C CB  . PRO D 1 229 ? 53.610  36.606  205.061 1.00 45.73  ? 229 PRO D CB  1 
ATOM   10113 C CG  . PRO D 1 229 ? 52.759  36.894  206.280 1.00 43.96  ? 229 PRO D CG  1 
ATOM   10114 C CD  . PRO D 1 229 ? 53.784  36.807  207.339 1.00 44.61  ? 229 PRO D CD  1 
ATOM   10115 N N   . ASP D 1 230 ? 55.568  39.478  204.194 1.00 42.75  ? 230 ASP D N   1 
ATOM   10116 C CA  . ASP D 1 230 ? 55.505  40.863  203.757 1.00 43.67  ? 230 ASP D CA  1 
ATOM   10117 C C   . ASP D 1 230 ? 54.857  40.924  202.422 1.00 39.37  ? 230 ASP D C   1 
ATOM   10118 O O   . ASP D 1 230 ? 55.212  40.115  201.582 1.00 43.10  ? 230 ASP D O   1 
ATOM   10119 C CB  . ASP D 1 230 ? 56.919  41.440  203.585 1.00 49.39  ? 230 ASP D CB  1 
ATOM   10120 C CG  . ASP D 1 230 ? 57.002  42.522  202.490 1.00 54.02  ? 230 ASP D CG  1 
ATOM   10121 O OD1 . ASP D 1 230 ? 56.182  43.483  202.469 1.00 55.69  ? 230 ASP D OD1 1 
ATOM   10122 O OD2 . ASP D 1 230 ? 57.930  42.418  201.661 1.00 54.25  ? 230 ASP D OD2 1 
ATOM   10123 N N   . PRO D 1 231 ? 53.810  41.760  202.249 1.00 34.33  ? 231 PRO D N   1 
ATOM   10124 C CA  . PRO D 1 231 ? 53.207  41.829  200.913 1.00 35.02  ? 231 PRO D CA  1 
ATOM   10125 C C   . PRO D 1 231 ? 54.135  42.698  200.016 1.00 38.38  ? 231 PRO D C   1 
ATOM   10126 O O   . PRO D 1 231 ? 54.062  43.949  199.926 1.00 30.41  ? 231 PRO D O   1 
ATOM   10127 C CB  . PRO D 1 231 ? 51.822  42.402  201.174 1.00 31.57  ? 231 PRO D CB  1 
ATOM   10128 C CG  . PRO D 1 231 ? 52.006  43.147  202.456 1.00 31.60  ? 231 PRO D CG  1 
ATOM   10129 C CD  . PRO D 1 231 ? 52.876  42.260  203.265 1.00 28.10  ? 231 PRO D CD  1 
ATOM   10130 N N   . ALA D 1 232 ? 55.140  41.996  199.494 1.00 42.84  ? 232 ALA D N   1 
ATOM   10131 C CA  . ALA D 1 232 ? 56.095  42.609  198.623 1.00 44.53  ? 232 ALA D CA  1 
ATOM   10132 C C   . ALA D 1 232 ? 55.250  42.958  197.432 1.00 49.69  ? 232 ALA D C   1 
ATOM   10133 O O   . ALA D 1 232 ? 54.119  42.467  197.220 1.00 51.02  ? 232 ALA D O   1 
ATOM   10134 C CB  . ALA D 1 232 ? 57.256  41.621  198.203 1.00 28.46  ? 232 ALA D CB  1 
ATOM   10135 N N   . LYS D 1 233 ? 55.765  43.985  196.803 1.00 52.65  ? 233 LYS D N   1 
ATOM   10136 C CA  . LYS D 1 233 ? 55.312  44.534  195.569 1.00 53.18  ? 233 LYS D CA  1 
ATOM   10137 C C   . LYS D 1 233 ? 54.848  43.474  194.606 1.00 54.16  ? 233 LYS D C   1 
ATOM   10138 O O   . LYS D 1 233 ? 53.775  43.522  194.000 1.00 45.96  ? 233 LYS D O   1 
ATOM   10139 C CB  . LYS D 1 233 ? 56.519  45.166  194.977 1.00 59.51  ? 233 LYS D CB  1 
ATOM   10140 C CG  . LYS D 1 233 ? 57.739  44.239  194.981 1.00 86.55  ? 233 LYS D CG  1 
ATOM   10141 C CD  . LYS D 1 233 ? 59.058  44.926  194.692 1.00 102.33 ? 233 LYS D CD  1 
ATOM   10142 C CE  . LYS D 1 233 ? 59.744  44.382  193.413 1.00 109.25 ? 233 LYS D CE  1 
ATOM   10143 N NZ  . LYS D 1 233 ? 60.858  45.303  192.957 1.00 113.49 ? 233 LYS D NZ  1 
ATOM   10144 N N   . ASN D 1 234 ? 55.770  42.523  194.477 1.00 66.92  ? 234 ASN D N   1 
ATOM   10145 C CA  . ASN D 1 234 ? 55.749  41.352  193.606 1.00 74.39  ? 234 ASN D CA  1 
ATOM   10146 C C   . ASN D 1 234 ? 56.037  40.104  194.537 1.00 70.09  ? 234 ASN D C   1 
ATOM   10147 O O   . ASN D 1 234 ? 56.830  40.197  195.516 1.00 64.30  ? 234 ASN D O   1 
ATOM   10148 C CB  . ASN D 1 234 ? 56.821  41.527  192.449 1.00 86.05  ? 234 ASN D CB  1 
ATOM   10149 C CG  . ASN D 1 234 ? 56.529  42.768  191.462 1.00 89.11  ? 234 ASN D CG  1 
ATOM   10150 O OD1 . ASN D 1 234 ? 56.693  42.684  190.211 1.00 85.40  ? 234 ASN D OD1 1 
ATOM   10151 N ND2 . ASN D 1 234 ? 56.163  43.901  192.047 1.00 83.69  ? 234 ASN D ND2 1 
ATOM   10152 N N   . GLU D 1 235 ? 55.399  38.970  194.189 1.00 64.83  ? 235 GLU D N   1 
ATOM   10153 C CA  . GLU D 1 235 ? 55.442  37.710  194.955 1.00 56.97  ? 235 GLU D CA  1 
ATOM   10154 C C   . GLU D 1 235 ? 55.126  36.443  194.135 1.00 53.55  ? 235 GLU D C   1 
ATOM   10155 O O   . GLU D 1 235 ? 54.162  36.437  193.336 1.00 46.55  ? 235 GLU D O   1 
ATOM   10156 C CB  . GLU D 1 235 ? 54.353  37.783  196.025 1.00 51.74  ? 235 GLU D CB  1 
ATOM   10157 C CG  . GLU D 1 235 ? 54.700  37.099  197.278 1.00 44.49  ? 235 GLU D CG  1 
ATOM   10158 C CD  . GLU D 1 235 ? 55.637  37.923  198.121 1.00 43.75  ? 235 GLU D CD  1 
ATOM   10159 O OE1 . GLU D 1 235 ? 55.813  39.153  197.780 1.00 27.67  ? 235 GLU D OE1 1 
ATOM   10160 O OE2 . GLU D 1 235 ? 56.136  37.315  199.130 1.00 37.98  ? 235 GLU D OE2 1 
ATOM   10161 N N   . ASN D 1 236 ? 55.886  35.364  194.384 1.00 51.50  ? 236 ASN D N   1 
ATOM   10162 C CA  . ASN D 1 236 ? 55.663  34.052  193.714 1.00 53.73  ? 236 ASN D CA  1 
ATOM   10163 C C   . ASN D 1 236 ? 55.280  33.029  194.809 1.00 56.04  ? 236 ASN D C   1 
ATOM   10164 O O   . ASN D 1 236 ? 55.524  31.823  194.682 1.00 59.71  ? 236 ASN D O   1 
ATOM   10165 C CB  . ASN D 1 236 ? 56.907  33.564  192.899 1.00 48.43  ? 236 ASN D CB  1 
ATOM   10166 C CG  . ASN D 1 236 ? 56.606  32.366  191.899 1.00 43.76  ? 236 ASN D CG  1 
ATOM   10167 O OD1 . ASN D 1 236 ? 55.481  32.143  191.408 1.00 36.45  ? 236 ASN D OD1 1 
ATOM   10168 N ND2 . ASN D 1 236 ? 57.659  31.647  191.573 1.00 36.20  ? 236 ASN D ND2 1 
ATOM   10169 N N   . THR D 1 237 ? 54.657  33.521  195.880 1.00 55.64  ? 237 THR D N   1 
ATOM   10170 C CA  . THR D 1 237 ? 54.220  32.671  196.985 1.00 52.38  ? 237 THR D CA  1 
ATOM   10171 C C   . THR D 1 237 ? 52.766  33.023  197.334 1.00 44.54  ? 237 THR D C   1 
ATOM   10172 O O   . THR D 1 237 ? 52.289  34.125  197.049 1.00 45.19  ? 237 THR D O   1 
ATOM   10173 C CB  . THR D 1 237 ? 55.114  32.907  198.256 1.00 59.38  ? 237 THR D CB  1 
ATOM   10174 O OG1 . THR D 1 237 ? 56.331  33.586  197.890 1.00 67.99  ? 237 THR D OG1 1 
ATOM   10175 C CG2 . THR D 1 237 ? 55.463  31.574  198.952 1.00 64.60  ? 237 THR D CG2 1 
ATOM   10176 N N   . ARG D 1 238 ? 52.020  32.044  197.808 1.00 35.97  ? 238 ARG D N   1 
ATOM   10177 C CA  . ARG D 1 238 ? 50.661  32.292  198.237 1.00 29.96  ? 238 ARG D CA  1 
ATOM   10178 C C   . ARG D 1 238 ? 50.852  32.083  199.702 1.00 26.93  ? 238 ARG D C   1 
ATOM   10179 O O   . ARG D 1 238 ? 51.674  31.263  200.100 1.00 27.76  ? 238 ARG D O   1 
ATOM   10180 C CB  . ARG D 1 238 ? 49.749  31.204  197.731 1.00 29.58  ? 238 ARG D CB  1 
ATOM   10181 C CG  . ARG D 1 238 ? 49.748  31.114  196.268 1.00 39.12  ? 238 ARG D CG  1 
ATOM   10182 C CD  . ARG D 1 238 ? 49.111  32.358  195.664 1.00 42.42  ? 238 ARG D CD  1 
ATOM   10183 N NE  . ARG D 1 238 ? 49.322  32.379  194.219 1.00 49.69  ? 238 ARG D NE  1 
ATOM   10184 C CZ  . ARG D 1 238 ? 50.388  32.919  193.641 1.00 52.11  ? 238 ARG D CZ  1 
ATOM   10185 N NH1 . ARG D 1 238 ? 51.307  33.490  194.405 1.00 58.07  ? 238 ARG D NH1 1 
ATOM   10186 N NH2 . ARG D 1 238 ? 50.568  32.841  192.323 1.00 52.91  ? 238 ARG D NH2 1 
ATOM   10187 N N   . TYR D 1 239 ? 50.144  32.814  200.525 1.00 21.60  ? 239 TYR D N   1 
ATOM   10188 C CA  . TYR D 1 239 ? 50.305  32.583  201.934 1.00 21.30  ? 239 TYR D CA  1 
ATOM   10189 C C   . TYR D 1 239 ? 49.047  33.010  202.510 1.00 19.51  ? 239 TYR D C   1 
ATOM   10190 O O   . TYR D 1 239 ? 48.282  33.732  201.880 1.00 16.87  ? 239 TYR D O   1 
ATOM   10191 C CB  . TYR D 1 239 ? 51.409  33.390  202.560 1.00 22.58  ? 239 TYR D CB  1 
ATOM   10192 C CG  . TYR D 1 239 ? 51.178  34.881  202.587 1.00 30.22  ? 239 TYR D CG  1 
ATOM   10193 C CD1 . TYR D 1 239 ? 50.314  35.476  203.497 1.00 32.38  ? 239 TYR D CD1 1 
ATOM   10194 C CD2 . TYR D 1 239 ? 51.887  35.706  201.733 1.00 34.56  ? 239 TYR D CD2 1 
ATOM   10195 C CE1 . TYR D 1 239 ? 50.180  36.859  203.543 1.00 39.63  ? 239 TYR D CE1 1 
ATOM   10196 C CE2 . TYR D 1 239 ? 51.762  37.073  201.775 1.00 40.78  ? 239 TYR D CE2 1 
ATOM   10197 C CZ  . TYR D 1 239 ? 50.916  37.652  202.673 1.00 42.67  ? 239 TYR D CZ  1 
ATOM   10198 O OH  . TYR D 1 239 ? 50.842  39.029  202.680 1.00 48.62  ? 239 TYR D OH  1 
ATOM   10199 N N   . PHE D 1 240 ? 48.788  32.497  203.691 1.00 20.92  ? 240 PHE D N   1 
ATOM   10200 C CA  . PHE D 1 240 ? 47.563  32.814  204.359 1.00 25.45  ? 240 PHE D CA  1 
ATOM   10201 C C   . PHE D 1 240 ? 47.774  32.425  205.764 1.00 33.07  ? 240 PHE D C   1 
ATOM   10202 O O   . PHE D 1 240 ? 48.640  31.583  206.077 1.00 34.09  ? 240 PHE D O   1 
ATOM   10203 C CB  . PHE D 1 240 ? 46.422  31.950  203.854 1.00 26.53  ? 240 PHE D CB  1 
ATOM   10204 C CG  . PHE D 1 240 ? 46.665  31.367  202.521 1.00 29.95  ? 240 PHE D CG  1 
ATOM   10205 C CD1 . PHE D 1 240 ? 47.794  30.607  202.282 1.00 33.20  ? 240 PHE D CD1 1 
ATOM   10206 C CD2 . PHE D 1 240 ? 45.835  31.683  201.468 1.00 33.11  ? 240 PHE D CD2 1 
ATOM   10207 C CE1 . PHE D 1 240 ? 48.103  30.202  201.022 1.00 41.38  ? 240 PHE D CE1 1 
ATOM   10208 C CE2 . PHE D 1 240 ? 46.131  31.275  200.200 1.00 35.97  ? 240 PHE D CE2 1 
ATOM   10209 C CZ  . PHE D 1 240 ? 47.267  30.537  199.965 1.00 38.51  ? 240 PHE D CZ  1 
ATOM   10210 N N   . GLY D 1 241 ? 46.901  32.970  206.597 1.00 38.98  ? 241 GLY D N   1 
ATOM   10211 C CA  . GLY D 1 241 ? 46.939  32.654  208.000 1.00 48.37  ? 241 GLY D CA  1 
ATOM   10212 C C   . GLY D 1 241 ? 46.218  33.687  208.804 1.00 50.67  ? 241 GLY D C   1 
ATOM   10213 O O   . GLY D 1 241 ? 45.827  34.732  208.276 1.00 52.67  ? 241 GLY D O   1 
ATOM   10214 N N   . ASN D 1 242 ? 46.060  33.398  210.089 1.00 52.71  ? 242 ASN D N   1 
ATOM   10215 C CA  . ASN D 1 242 ? 45.395  34.326  210.973 1.00 56.26  ? 242 ASN D CA  1 
ATOM   10216 C C   . ASN D 1 242 ? 45.850  34.282  212.429 1.00 54.15  ? 242 ASN D C   1 
ATOM   10217 O O   . ASN D 1 242 ? 46.326  33.247  212.946 1.00 52.64  ? 242 ASN D O   1 
ATOM   10218 C CB  . ASN D 1 242 ? 43.899  34.116  210.919 1.00 65.48  ? 242 ASN D CB  1 
ATOM   10219 C CG  . ASN D 1 242 ? 43.449  33.036  211.845 1.00 77.33  ? 242 ASN D CG  1 
ATOM   10220 O OD1 . ASN D 1 242 ? 42.859  33.306  212.900 1.00 83.06  ? 242 ASN D OD1 1 
ATOM   10221 N ND2 . ASN D 1 242 ? 43.751  31.795  211.482 1.00 85.36  ? 242 ASN D ND2 1 
ATOM   10222 N N   . TYR D 1 243 ? 45.695  35.434  213.072 1.00 50.01  ? 243 TYR D N   1 
ATOM   10223 C CA  . TYR D 1 243 ? 46.056  35.597  214.452 1.00 45.04  ? 243 TYR D CA  1 
ATOM   10224 C C   . TYR D 1 243 ? 44.775  35.548  215.242 1.00 44.71  ? 243 TYR D C   1 
ATOM   10225 O O   . TYR D 1 243 ? 43.748  36.043  214.790 1.00 46.86  ? 243 TYR D O   1 
ATOM   10226 C CB  . TYR D 1 243 ? 46.730  36.935  214.660 1.00 40.50  ? 243 TYR D CB  1 
ATOM   10227 C CG  . TYR D 1 243 ? 46.926  37.205  216.106 1.00 41.66  ? 243 TYR D CG  1 
ATOM   10228 C CD1 . TYR D 1 243 ? 47.499  36.247  216.934 1.00 43.10  ? 243 TYR D CD1 1 
ATOM   10229 C CD2 . TYR D 1 243 ? 46.512  38.400  216.665 1.00 41.96  ? 243 TYR D CD2 1 
ATOM   10230 C CE1 . TYR D 1 243 ? 47.661  36.474  218.303 1.00 48.70  ? 243 TYR D CE1 1 
ATOM   10231 C CE2 . TYR D 1 243 ? 46.662  38.651  218.028 1.00 45.40  ? 243 TYR D CE2 1 
ATOM   10232 C CZ  . TYR D 1 243 ? 47.242  37.688  218.856 1.00 49.43  ? 243 TYR D CZ  1 
ATOM   10233 O OH  . TYR D 1 243 ? 47.392  37.945  220.229 1.00 49.75  ? 243 TYR D OH  1 
ATOM   10234 N N   . THR D 1 244 ? 44.851  35.000  216.441 1.00 42.41  ? 244 THR D N   1 
ATOM   10235 C CA  . THR D 1 244 ? 43.686  34.881  217.289 1.00 40.97  ? 244 THR D CA  1 
ATOM   10236 C C   . THR D 1 244 ? 44.269  35.035  218.670 1.00 39.75  ? 244 THR D C   1 
ATOM   10237 O O   . THR D 1 244 ? 44.765  34.090  219.271 1.00 36.10  ? 244 THR D O   1 
ATOM   10238 C CB  . THR D 1 244 ? 43.074  33.502  217.094 1.00 44.17  ? 244 THR D CB  1 
ATOM   10239 O OG1 . THR D 1 244 ? 43.419  33.033  215.790 1.00 47.37  ? 244 THR D OG1 1 
ATOM   10240 C CG2 . THR D 1 244 ? 41.572  33.552  217.154 1.00 46.00  ? 244 THR D CG2 1 
ATOM   10241 N N   . GLY D 1 245 ? 44.315  36.282  219.100 1.00 43.16  ? 245 GLY D N   1 
ATOM   10242 C CA  . GLY D 1 245 ? 44.899  36.638  220.381 1.00 48.31  ? 245 GLY D CA  1 
ATOM   10243 C C   . GLY D 1 245 ? 44.237  36.145  221.622 1.00 49.14  ? 245 GLY D C   1 
ATOM   10244 O O   . GLY D 1 245 ? 43.350  35.312  221.546 1.00 46.08  ? 245 GLY D O   1 
ATOM   10245 N N   . GLY D 1 246 ? 44.688  36.638  222.768 1.00 51.07  ? 246 GLY D N   1 
ATOM   10246 C CA  . GLY D 1 246 ? 44.063  36.199  223.993 1.00 55.50  ? 246 GLY D CA  1 
ATOM   10247 C C   . GLY D 1 246 ? 44.835  35.287  224.922 1.00 58.08  ? 246 GLY D C   1 
ATOM   10248 O O   . GLY D 1 246 ? 45.755  34.533  224.556 1.00 58.08  ? 246 GLY D O   1 
ATOM   10249 N N   . THR D 1 247 ? 44.351  35.304  226.150 1.00 61.27  ? 247 THR D N   1 
ATOM   10250 C CA  . THR D 1 247 ? 44.929  34.563  227.255 1.00 63.69  ? 247 THR D CA  1 
ATOM   10251 C C   . THR D 1 247 ? 44.370  33.154  227.484 1.00 63.31  ? 247 THR D C   1 
ATOM   10252 O O   . THR D 1 247 ? 45.114  32.210  227.758 1.00 60.11  ? 247 THR D O   1 
ATOM   10253 C CB  . THR D 1 247 ? 44.731  35.396  228.530 1.00 65.05  ? 247 THR D CB  1 
ATOM   10254 O OG1 . THR D 1 247 ? 43.324  35.605  228.743 1.00 71.91  ? 247 THR D OG1 1 
ATOM   10255 C CG2 . THR D 1 247 ? 45.400  36.760  228.372 1.00 62.17  ? 247 THR D CG2 1 
ATOM   10256 N N   . THR D 1 248 ? 43.049  33.052  227.410 1.00 67.23  ? 248 THR D N   1 
ATOM   10257 C CA  . THR D 1 248 ? 42.289  31.812  227.616 1.00 72.25  ? 248 THR D CA  1 
ATOM   10258 C C   . THR D 1 248 ? 41.735  31.248  226.316 1.00 70.77  ? 248 THR D C   1 
ATOM   10259 O O   . THR D 1 248 ? 41.247  30.120  226.251 1.00 72.15  ? 248 THR D O   1 
ATOM   10260 C CB  . THR D 1 248 ? 41.065  32.113  228.443 1.00 78.95  ? 248 THR D CB  1 
ATOM   10261 O OG1 . THR D 1 248 ? 40.729  33.507  228.278 1.00 87.93  ? 248 THR D OG1 1 
ATOM   10262 C CG2 . THR D 1 248 ? 41.297  31.754  229.896 1.00 84.35  ? 248 THR D CG2 1 
ATOM   10263 N N   . THR D 1 249 ? 41.622  32.151  225.359 1.00 67.17  ? 249 THR D N   1 
ATOM   10264 C CA  . THR D 1 249 ? 41.145  31.878  224.028 1.00 59.58  ? 249 THR D CA  1 
ATOM   10265 C C   . THR D 1 249 ? 41.313  30.419  223.587 1.00 52.37  ? 249 THR D C   1 
ATOM   10266 O O   . THR D 1 249 ? 42.420  29.905  223.454 1.00 51.32  ? 249 THR D O   1 
ATOM   10267 C CB  . THR D 1 249 ? 41.886  32.806  223.111 1.00 64.77  ? 249 THR D CB  1 
ATOM   10268 O OG1 . THR D 1 249 ? 41.791  34.143  223.642 1.00 65.65  ? 249 THR D OG1 1 
ATOM   10269 C CG2 . THR D 1 249 ? 41.321  32.729  221.723 1.00 69.61  ? 249 THR D CG2 1 
ATOM   10270 N N   . PRO D 1 250 ? 40.196  29.723  223.416 1.00 47.67  ? 250 PRO D N   1 
ATOM   10271 C CA  . PRO D 1 250 ? 40.136  28.327  223.009 1.00 43.04  ? 250 PRO D CA  1 
ATOM   10272 C C   . PRO D 1 250 ? 40.555  28.061  221.620 1.00 39.11  ? 250 PRO D C   1 
ATOM   10273 O O   . PRO D 1 250 ? 40.347  28.841  220.716 1.00 40.13  ? 250 PRO D O   1 
ATOM   10274 C CB  . PRO D 1 250 ? 38.668  27.979  223.166 1.00 43.34  ? 250 PRO D CB  1 
ATOM   10275 C CG  . PRO D 1 250 ? 38.265  28.830  224.297 1.00 49.88  ? 250 PRO D CG  1 
ATOM   10276 C CD  . PRO D 1 250 ? 38.884  30.158  223.895 1.00 50.86  ? 250 PRO D CD  1 
ATOM   10277 N N   . PRO D 1 251 ? 41.148  26.914  221.436 1.00 38.96  ? 251 PRO D N   1 
ATOM   10278 C CA  . PRO D 1 251 ? 41.662  26.377  220.188 1.00 39.92  ? 251 PRO D CA  1 
ATOM   10279 C C   . PRO D 1 251 ? 40.508  25.897  219.363 1.00 40.65  ? 251 PRO D C   1 
ATOM   10280 O O   . PRO D 1 251 ? 39.448  25.525  219.892 1.00 38.06  ? 251 PRO D O   1 
ATOM   10281 C CB  . PRO D 1 251 ? 42.487  25.197  220.649 1.00 44.31  ? 251 PRO D CB  1 
ATOM   10282 C CG  . PRO D 1 251 ? 42.834  25.561  222.081 1.00 46.36  ? 251 PRO D CG  1 
ATOM   10283 C CD  . PRO D 1 251 ? 41.581  26.114  222.584 1.00 42.54  ? 251 PRO D CD  1 
ATOM   10284 N N   . VAL D 1 252 ? 40.755  25.833  218.066 1.00 42.57  ? 252 VAL D N   1 
ATOM   10285 C CA  . VAL D 1 252 ? 39.756  25.394  217.112 1.00 43.11  ? 252 VAL D CA  1 
ATOM   10286 C C   . VAL D 1 252 ? 40.486  24.963  215.891 1.00 44.37  ? 252 VAL D C   1 
ATOM   10287 O O   . VAL D 1 252 ? 41.521  25.552  215.550 1.00 46.50  ? 252 VAL D O   1 
ATOM   10288 C CB  . VAL D 1 252 ? 38.864  26.514  216.763 1.00 42.50  ? 252 VAL D CB  1 
ATOM   10289 C CG1 . VAL D 1 252 ? 37.626  26.391  217.589 1.00 40.85  ? 252 VAL D CG1 1 
ATOM   10290 C CG2 . VAL D 1 252 ? 39.610  27.866  217.011 1.00 41.34  ? 252 VAL D CG2 1 
ATOM   10291 N N   . LEU D 1 253 ? 39.942  23.995  215.179 1.00 43.52  ? 253 LEU D N   1 
ATOM   10292 C CA  . LEU D 1 253 ? 40.703  23.537  214.058 1.00 49.83  ? 253 LEU D CA  1 
ATOM   10293 C C   . LEU D 1 253 ? 39.959  22.599  213.174 1.00 52.86  ? 253 LEU D C   1 
ATOM   10294 O O   . LEU D 1 253 ? 39.114  21.853  213.655 1.00 53.39  ? 253 LEU D O   1 
ATOM   10295 C CB  . LEU D 1 253 ? 41.899  22.825  214.607 1.00 55.28  ? 253 LEU D CB  1 
ATOM   10296 C CG  . LEU D 1 253 ? 43.152  23.077  213.813 1.00 62.73  ? 253 LEU D CG  1 
ATOM   10297 C CD1 . LEU D 1 253 ? 44.315  23.022  214.793 1.00 65.61  ? 253 LEU D CD1 1 
ATOM   10298 C CD2 . LEU D 1 253 ? 43.278  22.053  212.673 1.00 67.51  ? 253 LEU D CD2 1 
ATOM   10299 N N   . GLN D 1 254 ? 40.393  22.529  211.914 1.00 57.58  ? 254 GLN D N   1 
ATOM   10300 C CA  . GLN D 1 254 ? 39.728  21.713  210.895 1.00 61.84  ? 254 GLN D CA  1 
ATOM   10301 C C   . GLN D 1 254 ? 40.301  20.457  210.362 1.00 55.92  ? 254 GLN D C   1 
ATOM   10302 O O   . GLN D 1 254 ? 41.265  20.428  209.593 1.00 56.90  ? 254 GLN D O   1 
ATOM   10303 C CB  . GLN D 1 254 ? 39.364  22.558  209.683 1.00 79.21  ? 254 GLN D CB  1 
ATOM   10304 C CG  . GLN D 1 254 ? 38.525  23.746  210.041 1.00 97.78  ? 254 GLN D CG  1 
ATOM   10305 C CD  . GLN D 1 254 ? 37.670  23.445  211.237 1.00 105.01 ? 254 GLN D CD  1 
ATOM   10306 O OE1 . GLN D 1 254 ? 37.040  22.384  211.299 1.00 109.39 ? 254 GLN D OE1 1 
ATOM   10307 N NE2 . GLN D 1 254 ? 37.734  24.314  212.251 1.00 111.56 ? 254 GLN D NE2 1 
ATOM   10308 N N   . PHE D 1 255 ? 39.514  19.445  210.537 1.00 51.15  ? 255 PHE D N   1 
ATOM   10309 C CA  . PHE D 1 255 ? 39.955  18.218  210.048 1.00 51.75  ? 255 PHE D CA  1 
ATOM   10310 C C   . PHE D 1 255 ? 39.485  17.913  208.667 1.00 49.25  ? 255 PHE D C   1 
ATOM   10311 O O   . PHE D 1 255 ? 38.337  17.489  208.521 1.00 54.21  ? 255 PHE D O   1 
ATOM   10312 C CB  . PHE D 1 255 ? 39.521  17.135  210.987 1.00 56.43  ? 255 PHE D CB  1 
ATOM   10313 C CG  . PHE D 1 255 ? 40.474  16.913  212.046 1.00 66.45  ? 255 PHE D CG  1 
ATOM   10314 C CD1 . PHE D 1 255 ? 41.840  16.886  211.742 1.00 76.66  ? 255 PHE D CD1 1 
ATOM   10315 C CD2 . PHE D 1 255 ? 40.053  16.702  213.342 1.00 73.59  ? 255 PHE D CD2 1 
ATOM   10316 C CE1 . PHE D 1 255 ? 42.821  16.645  212.739 1.00 88.45  ? 255 PHE D CE1 1 
ATOM   10317 C CE2 . PHE D 1 255 ? 41.002  16.460  214.364 1.00 87.58  ? 255 PHE D CE2 1 
ATOM   10318 C CZ  . PHE D 1 255 ? 42.403  16.427  214.059 1.00 92.45  ? 255 PHE D CZ  1 
ATOM   10319 N N   . THR D 1 256 ? 40.234  18.304  207.638 1.00 40.54  ? 256 THR D N   1 
ATOM   10320 C CA  . THR D 1 256 ? 39.813  17.785  206.350 1.00 36.41  ? 256 THR D CA  1 
ATOM   10321 C C   . THR D 1 256 ? 40.618  17.291  205.191 1.00 40.25  ? 256 THR D C   1 
ATOM   10322 O O   . THR D 1 256 ? 41.462  17.922  204.542 1.00 37.83  ? 256 THR D O   1 
ATOM   10323 C CB  . THR D 1 256 ? 38.437  18.175  205.829 1.00 30.54  ? 256 THR D CB  1 
ATOM   10324 O OG1 . THR D 1 256 ? 37.681  16.971  205.673 1.00 18.89  ? 256 THR D OG1 1 
ATOM   10325 C CG2 . THR D 1 256 ? 38.542  18.718  204.441 1.00 33.00  ? 256 THR D CG2 1 
ATOM   10326 N N   . ASN D 1 257 ? 40.030  16.167  204.858 1.00 42.68  ? 257 ASN D N   1 
ATOM   10327 C CA  . ASN D 1 257 ? 40.336  15.256  203.831 1.00 45.99  ? 257 ASN D CA  1 
ATOM   10328 C C   . ASN D 1 257 ? 39.962  15.902  202.531 1.00 44.44  ? 257 ASN D C   1 
ATOM   10329 O O   . ASN D 1 257 ? 40.780  16.143  201.674 1.00 45.61  ? 257 ASN D O   1 
ATOM   10330 C CB  . ASN D 1 257 ? 39.380  14.118  204.133 1.00 56.33  ? 257 ASN D CB  1 
ATOM   10331 C CG  . ASN D 1 257 ? 39.238  13.151  203.028 1.00 71.39  ? 257 ASN D CG  1 
ATOM   10332 O OD1 . ASN D 1 257 ? 40.186  12.847  202.314 1.00 80.69  ? 257 ASN D OD1 1 
ATOM   10333 N ND2 . ASN D 1 257 ? 38.032  12.646  202.866 1.00 77.39  ? 257 ASN D ND2 1 
ATOM   10334 N N   . THR D 1 258 ? 38.712  16.286  202.470 1.00 43.48  ? 258 THR D N   1 
ATOM   10335 C CA  . THR D 1 258 ? 38.088  16.846  201.296 1.00 49.66  ? 258 THR D CA  1 
ATOM   10336 C C   . THR D 1 258 ? 38.550  18.086  200.536 1.00 53.62  ? 258 THR D C   1 
ATOM   10337 O O   . THR D 1 258 ? 38.413  18.128  199.286 1.00 54.50  ? 258 THR D O   1 
ATOM   10338 C CB  . THR D 1 258 ? 36.633  17.097  201.626 1.00 52.94  ? 258 THR D CB  1 
ATOM   10339 O OG1 . THR D 1 258 ? 36.465  16.991  203.048 1.00 48.48  ? 258 THR D OG1 1 
ATOM   10340 C CG2 . THR D 1 258 ? 35.730  16.113  200.883 1.00 58.75  ? 258 THR D CG2 1 
ATOM   10341 N N   . LEU D 1 259 ? 39.051  19.103  201.249 1.00 56.05  ? 259 LEU D N   1 
ATOM   10342 C CA  . LEU D 1 259 ? 39.380  20.368  200.585 1.00 58.44  ? 259 LEU D CA  1 
ATOM   10343 C C   . LEU D 1 259 ? 40.709  20.935  200.141 1.00 57.69  ? 259 LEU D C   1 
ATOM   10344 O O   . LEU D 1 259 ? 41.634  21.150  200.941 1.00 60.56  ? 259 LEU D O   1 
ATOM   10345 C CB  . LEU D 1 259 ? 38.534  21.479  201.152 1.00 63.97  ? 259 LEU D CB  1 
ATOM   10346 C CG  . LEU D 1 259 ? 37.254  21.401  200.285 1.00 76.59  ? 259 LEU D CG  1 
ATOM   10347 C CD1 . LEU D 1 259 ? 37.523  21.361  198.700 1.00 83.59  ? 259 LEU D CD1 1 
ATOM   10348 C CD2 . LEU D 1 259 ? 36.398  20.183  200.705 1.00 80.64  ? 259 LEU D CD2 1 
ATOM   10349 N N   . THR D 1 260 ? 40.682  21.338  198.863 1.00 52.83  ? 260 THR D N   1 
ATOM   10350 C CA  . THR D 1 260 ? 41.813  21.887  198.116 1.00 51.81  ? 260 THR D CA  1 
ATOM   10351 C C   . THR D 1 260 ? 41.821  23.351  197.930 1.00 46.37  ? 260 THR D C   1 
ATOM   10352 O O   . THR D 1 260 ? 40.785  23.951  197.626 1.00 54.44  ? 260 THR D O   1 
ATOM   10353 C CB  . THR D 1 260 ? 41.814  21.419  196.702 1.00 54.68  ? 260 THR D CB  1 
ATOM   10354 O OG1 . THR D 1 260 ? 41.085  20.189  196.631 1.00 67.43  ? 260 THR D OG1 1 
ATOM   10355 C CG2 . THR D 1 260 ? 43.268  21.254  196.193 1.00 62.65  ? 260 THR D CG2 1 
ATOM   10356 N N   . THR D 1 261 ? 43.036  23.871  197.886 1.00 39.63  ? 261 THR D N   1 
ATOM   10357 C CA  . THR D 1 261 ? 43.229  25.268  197.715 1.00 35.16  ? 261 THR D CA  1 
ATOM   10358 C C   . THR D 1 261 ? 44.118  25.570  196.573 1.00 35.95  ? 261 THR D C   1 
ATOM   10359 O O   . THR D 1 261 ? 45.184  24.962  196.393 1.00 34.77  ? 261 THR D O   1 
ATOM   10360 C CB  . THR D 1 261 ? 43.771  25.878  198.938 1.00 34.40  ? 261 THR D CB  1 
ATOM   10361 O OG1 . THR D 1 261 ? 42.715  25.962  199.895 1.00 42.72  ? 261 THR D OG1 1 
ATOM   10362 C CG2 . THR D 1 261 ? 44.284  27.264  198.643 1.00 37.20  ? 261 THR D CG2 1 
ATOM   10363 N N   . VAL D 1 262 ? 43.716  26.610  195.862 1.00 34.23  ? 262 VAL D N   1 
ATOM   10364 C CA  . VAL D 1 262 ? 44.448  27.014  194.688 1.00 32.06  ? 262 VAL D CA  1 
ATOM   10365 C C   . VAL D 1 262 ? 45.478  28.126  194.734 1.00 35.06  ? 262 VAL D C   1 
ATOM   10366 O O   . VAL D 1 262 ? 45.198  29.337  194.885 1.00 34.95  ? 262 VAL D O   1 
ATOM   10367 C CB  . VAL D 1 262 ? 43.542  27.249  193.528 1.00 27.22  ? 262 VAL D CB  1 
ATOM   10368 C CG1 . VAL D 1 262 ? 44.266  26.805  192.260 1.00 25.79  ? 262 VAL D CG1 1 
ATOM   10369 C CG2 . VAL D 1 262 ? 42.258  26.502  193.740 1.00 17.54  ? 262 VAL D CG2 1 
ATOM   10370 N N   . LEU D 1 263 ? 46.682  27.667  194.484 1.00 33.00  ? 263 LEU D N   1 
ATOM   10371 C CA  . LEU D 1 263 ? 47.820  28.516  194.440 1.00 32.95  ? 263 LEU D CA  1 
ATOM   10372 C C   . LEU D 1 263 ? 47.729  29.291  193.155 1.00 36.38  ? 263 LEU D C   1 
ATOM   10373 O O   . LEU D 1 263 ? 48.563  30.160  192.917 1.00 39.84  ? 263 LEU D O   1 
ATOM   10374 C CB  . LEU D 1 263 ? 49.059  27.655  194.421 1.00 30.63  ? 263 LEU D CB  1 
ATOM   10375 C CG  . LEU D 1 263 ? 48.772  26.569  195.427 1.00 31.44  ? 263 LEU D CG  1 
ATOM   10376 C CD1 . LEU D 1 263 ? 49.840  25.533  195.372 1.00 35.05  ? 263 LEU D CD1 1 
ATOM   10377 C CD2 . LEU D 1 263 ? 48.652  27.229  196.769 1.00 33.25  ? 263 LEU D CD2 1 
ATOM   10378 N N   . LEU D 1 264 ? 46.724  29.017  192.326 1.00 39.37  ? 264 LEU D N   1 
ATOM   10379 C CA  . LEU D 1 264 ? 46.639  29.739  191.070 1.00 43.34  ? 264 LEU D CA  1 
ATOM   10380 C C   . LEU D 1 264 ? 46.580  31.229  191.124 1.00 48.30  ? 264 LEU D C   1 
ATOM   10381 O O   . LEU D 1 264 ? 45.735  31.838  191.784 1.00 50.46  ? 264 LEU D O   1 
ATOM   10382 C CB  . LEU D 1 264 ? 45.603  29.196  190.126 1.00 41.60  ? 264 LEU D CB  1 
ATOM   10383 C CG  . LEU D 1 264 ? 46.475  28.972  188.897 1.00 43.66  ? 264 LEU D CG  1 
ATOM   10384 C CD1 . LEU D 1 264 ? 47.639  28.076  189.288 1.00 49.80  ? 264 LEU D CD1 1 
ATOM   10385 C CD2 . LEU D 1 264 ? 45.711  28.326  187.771 1.00 47.44  ? 264 LEU D CD2 1 
ATOM   10386 N N   . ASP D 1 265 ? 47.542  31.806  190.425 1.00 54.07  ? 265 ASP D N   1 
ATOM   10387 C CA  . ASP D 1 265 ? 47.679  33.238  190.390 1.00 62.44  ? 265 ASP D CA  1 
ATOM   10388 C C   . ASP D 1 265 ? 46.488  33.777  189.624 1.00 65.62  ? 265 ASP D C   1 
ATOM   10389 O O   . ASP D 1 265 ? 45.683  32.988  189.128 1.00 69.86  ? 265 ASP D O   1 
ATOM   10390 C CB  . ASP D 1 265 ? 49.057  33.631  189.810 1.00 64.72  ? 265 ASP D CB  1 
ATOM   10391 C CG  . ASP D 1 265 ? 49.007  34.068  188.369 1.00 70.35  ? 265 ASP D CG  1 
ATOM   10392 O OD1 . ASP D 1 265 ? 48.352  33.391  187.538 1.00 64.05  ? 265 ASP D OD1 1 
ATOM   10393 O OD2 . ASP D 1 265 ? 49.664  35.092  188.080 1.00 75.57  ? 265 ASP D OD2 1 
ATOM   10394 N N   . GLU D 1 266 ? 46.383  35.100  189.528 1.00 67.22  ? 266 GLU D N   1 
ATOM   10395 C CA  . GLU D 1 266 ? 45.273  35.769  188.847 1.00 67.30  ? 266 GLU D CA  1 
ATOM   10396 C C   . GLU D 1 266 ? 45.110  35.545  187.359 1.00 61.44  ? 266 GLU D C   1 
ATOM   10397 O O   . GLU D 1 266 ? 44.127  35.978  186.775 1.00 59.41  ? 266 GLU D O   1 
ATOM   10398 C CB  . GLU D 1 266 ? 45.329  37.264  189.119 1.00 77.61  ? 266 GLU D CB  1 
ATOM   10399 C CG  . GLU D 1 266 ? 44.834  37.615  190.507 1.00 101.87 ? 266 GLU D CG  1 
ATOM   10400 C CD  . GLU D 1 266 ? 45.808  38.465  191.322 1.00 115.01 ? 266 GLU D CD  1 
ATOM   10401 O OE1 . GLU D 1 266 ? 46.318  39.502  190.798 1.00 121.23 ? 266 GLU D OE1 1 
ATOM   10402 O OE2 . GLU D 1 266 ? 46.032  38.100  192.515 1.00 124.57 ? 266 GLU D OE2 1 
ATOM   10403 N N   . ASN D 1 267 ? 46.081  34.899  186.738 1.00 58.91  ? 267 ASN D N   1 
ATOM   10404 C CA  . ASN D 1 267 ? 46.006  34.642  185.320 1.00 60.41  ? 267 ASN D CA  1 
ATOM   10405 C C   . ASN D 1 267 ? 46.160  33.162  185.093 1.00 60.98  ? 267 ASN D C   1 
ATOM   10406 O O   . ASN D 1 267 ? 46.184  32.675  183.950 1.00 64.66  ? 267 ASN D O   1 
ATOM   10407 C CB  . ASN D 1 267 ? 47.104  35.397  184.621 1.00 65.33  ? 267 ASN D CB  1 
ATOM   10408 C CG  . ASN D 1 267 ? 47.157  36.837  185.041 1.00 71.50  ? 267 ASN D CG  1 
ATOM   10409 O OD1 . ASN D 1 267 ? 46.445  37.683  184.502 1.00 76.43  ? 267 ASN D OD1 1 
ATOM   10410 N ND2 . ASN D 1 267 ? 47.994  37.130  186.027 1.00 76.96  ? 267 ASN D ND2 1 
ATOM   10411 N N   . GLY D 1 268 ? 46.274  32.442  186.201 1.00 59.46  ? 268 GLY D N   1 
ATOM   10412 C CA  . GLY D 1 268 ? 46.385  31.005  186.135 1.00 54.53  ? 268 GLY D CA  1 
ATOM   10413 C C   . GLY D 1 268 ? 47.819  30.652  186.036 1.00 47.45  ? 268 GLY D C   1 
ATOM   10414 O O   . GLY D 1 268 ? 48.283  30.203  184.994 1.00 50.73  ? 268 GLY D O   1 
ATOM   10415 N N   . VAL D 1 269 ? 48.508  30.771  187.149 1.00 40.67  ? 269 VAL D N   1 
ATOM   10416 C CA  . VAL D 1 269 ? 49.910  30.494  187.114 1.00 38.28  ? 269 VAL D CA  1 
ATOM   10417 C C   . VAL D 1 269 ? 50.390  29.927  188.407 1.00 36.45  ? 269 VAL D C   1 
ATOM   10418 O O   . VAL D 1 269 ? 51.292  29.094  188.479 1.00 34.67  ? 269 VAL D O   1 
ATOM   10419 C CB  . VAL D 1 269 ? 50.590  31.791  186.825 1.00 39.33  ? 269 VAL D CB  1 
ATOM   10420 C CG1 . VAL D 1 269 ? 51.950  31.899  187.535 1.00 41.16  ? 269 VAL D CG1 1 
ATOM   10421 C CG2 . VAL D 1 269 ? 50.630  32.001  185.318 1.00 39.83  ? 269 VAL D CG2 1 
ATOM   10422 N N   . GLY D 1 270 ? 49.796  30.420  189.461 1.00 34.76  ? 270 GLY D N   1 
ATOM   10423 C CA  . GLY D 1 270 ? 50.226  29.919  190.727 1.00 31.99  ? 270 GLY D CA  1 
ATOM   10424 C C   . GLY D 1 270 ? 51.699  30.199  190.803 1.00 29.96  ? 270 GLY D C   1 
ATOM   10425 O O   . GLY D 1 270 ? 52.229  31.153  190.187 1.00 29.07  ? 270 GLY D O   1 
ATOM   10426 N N   . PRO D 1 271 ? 52.385  29.407  191.605 1.00 26.77  ? 271 PRO D N   1 
ATOM   10427 C CA  . PRO D 1 271 ? 53.796  29.710  191.659 1.00 22.01  ? 271 PRO D CA  1 
ATOM   10428 C C   . PRO D 1 271 ? 54.468  28.871  190.649 1.00 22.17  ? 271 PRO D C   1 
ATOM   10429 O O   . PRO D 1 271 ? 53.870  27.959  190.048 1.00 14.10  ? 271 PRO D O   1 
ATOM   10430 C CB  . PRO D 1 271 ? 54.186  29.289  193.073 1.00 20.53  ? 271 PRO D CB  1 
ATOM   10431 C CG  . PRO D 1 271 ? 52.860  29.278  193.824 1.00 20.56  ? 271 PRO D CG  1 
ATOM   10432 C CD  . PRO D 1 271 ? 51.970  28.655  192.790 1.00 23.22  ? 271 PRO D CD  1 
ATOM   10433 N N   . LEU D 1 272 ? 55.717  29.238  190.439 1.00 25.11  ? 272 LEU D N   1 
ATOM   10434 C CA  . LEU D 1 272 ? 56.579  28.545  189.516 1.00 34.82  ? 272 LEU D CA  1 
ATOM   10435 C C   . LEU D 1 272 ? 57.858  28.460  190.271 1.00 38.91  ? 272 LEU D C   1 
ATOM   10436 O O   . LEU D 1 272 ? 58.332  29.442  190.838 1.00 41.20  ? 272 LEU D O   1 
ATOM   10437 C CB  . LEU D 1 272 ? 56.791  29.344  188.254 1.00 31.11  ? 272 LEU D CB  1 
ATOM   10438 C CG  . LEU D 1 272 ? 55.433  29.856  187.832 1.00 34.82  ? 272 LEU D CG  1 
ATOM   10439 C CD1 . LEU D 1 272 ? 55.104  31.212  188.550 1.00 32.39  ? 272 LEU D CD1 1 
ATOM   10440 C CD2 . LEU D 1 272 ? 55.442  29.951  186.339 1.00 34.06  ? 272 LEU D CD2 1 
ATOM   10441 N N   . CYS D 1 273 ? 58.394  27.266  190.325 1.00 42.56  ? 273 CYS D N   1 
ATOM   10442 C CA  . CYS D 1 273 ? 59.601  27.070  191.044 1.00 43.99  ? 273 CYS D CA  1 
ATOM   10443 C C   . CYS D 1 273 ? 60.762  27.662  190.322 1.00 45.08  ? 273 CYS D C   1 
ATOM   10444 O O   . CYS D 1 273 ? 61.024  27.294  189.184 1.00 44.64  ? 273 CYS D O   1 
ATOM   10445 C CB  . CYS D 1 273 ? 59.779  25.599  191.255 1.00 48.32  ? 273 CYS D CB  1 
ATOM   10446 S SG  . CYS D 1 273 ? 58.298  24.962  192.026 1.00 56.40  ? 273 CYS D SG  1 
ATOM   10447 N N   . LYS D 1 274 ? 61.266  28.749  190.897 1.00 48.98  ? 274 LYS D N   1 
ATOM   10448 C CA  . LYS D 1 274 ? 62.466  29.421  190.416 1.00 56.97  ? 274 LYS D CA  1 
ATOM   10449 C C   . LYS D 1 274 ? 63.472  28.379  190.938 1.00 61.50  ? 274 LYS D C   1 
ATOM   10450 O O   . LYS D 1 274 ? 63.319  27.848  192.060 1.00 60.17  ? 274 LYS D O   1 
ATOM   10451 C CB  . LYS D 1 274 ? 62.692  30.762  191.140 1.00 60.78  ? 274 LYS D CB  1 
ATOM   10452 C CG  . LYS D 1 274 ? 62.117  32.064  190.517 1.00 61.67  ? 274 LYS D CG  1 
ATOM   10453 C CD  . LYS D 1 274 ? 62.816  33.269  191.205 1.00 60.97  ? 274 LYS D CD  1 
ATOM   10454 C CE  . LYS D 1 274 ? 62.458  34.661  190.685 1.00 57.75  ? 274 LYS D CE  1 
ATOM   10455 N NZ  . LYS D 1 274 ? 63.466  35.726  191.121 1.00 55.53  ? 274 LYS D NZ  1 
ATOM   10456 N N   . GLY D 1 275 ? 64.486  28.040  190.147 1.00 64.95  ? 275 GLY D N   1 
ATOM   10457 C CA  . GLY D 1 275 ? 65.367  26.974  190.598 1.00 66.43  ? 275 GLY D CA  1 
ATOM   10458 C C   . GLY D 1 275 ? 64.371  25.838  190.495 1.00 66.78  ? 275 GLY D C   1 
ATOM   10459 O O   . GLY D 1 275 ? 63.249  26.056  190.042 1.00 74.28  ? 275 GLY D O   1 
ATOM   10460 N N   . GLU D 1 276 ? 64.685  24.616  190.852 1.00 63.05  ? 276 GLU D N   1 
ATOM   10461 C CA  . GLU D 1 276 ? 63.590  23.670  190.686 1.00 60.94  ? 276 GLU D CA  1 
ATOM   10462 C C   . GLU D 1 276 ? 62.925  23.550  192.051 1.00 59.06  ? 276 GLU D C   1 
ATOM   10463 O O   . GLU D 1 276 ? 62.294  22.523  192.406 1.00 57.45  ? 276 GLU D O   1 
ATOM   10464 C CB  . GLU D 1 276 ? 64.080  22.353  190.099 1.00 65.86  ? 276 GLU D CB  1 
ATOM   10465 C CG  . GLU D 1 276 ? 65.142  22.513  188.999 1.00 74.06  ? 276 GLU D CG  1 
ATOM   10466 C CD  . GLU D 1 276 ? 65.002  23.803  188.170 1.00 80.97  ? 276 GLU D CD  1 
ATOM   10467 O OE1 . GLU D 1 276 ? 64.062  23.954  187.342 1.00 84.46  ? 276 GLU D OE1 1 
ATOM   10468 O OE2 . GLU D 1 276 ? 65.872  24.680  188.355 1.00 86.55  ? 276 GLU D OE2 1 
ATOM   10469 N N   . GLY D 1 277 ? 62.995  24.684  192.761 1.00 54.90  ? 277 GLY D N   1 
ATOM   10470 C CA  . GLY D 1 277 ? 62.495  24.791  194.115 1.00 50.06  ? 277 GLY D CA  1 
ATOM   10471 C C   . GLY D 1 277 ? 61.042  25.008  194.469 1.00 44.55  ? 277 GLY D C   1 
ATOM   10472 O O   . GLY D 1 277 ? 60.406  25.993  194.082 1.00 46.17  ? 277 GLY D O   1 
ATOM   10473 N N   . LEU D 1 278 ? 60.543  24.120  195.305 1.00 36.73  ? 278 LEU D N   1 
ATOM   10474 C CA  . LEU D 1 278 ? 59.197  24.247  195.753 1.00 30.16  ? 278 LEU D CA  1 
ATOM   10475 C C   . LEU D 1 278 ? 59.310  24.508  197.240 1.00 28.67  ? 278 LEU D C   1 
ATOM   10476 O O   . LEU D 1 278 ? 59.569  23.616  198.033 1.00 29.17  ? 278 LEU D O   1 
ATOM   10477 C CB  . LEU D 1 278 ? 58.465  22.975  195.468 1.00 29.22  ? 278 LEU D CB  1 
ATOM   10478 C CG  . LEU D 1 278 ? 56.963  23.161  195.506 1.00 30.39  ? 278 LEU D CG  1 
ATOM   10479 C CD1 . LEU D 1 278 ? 56.321  21.787  195.460 1.00 34.00  ? 278 LEU D CD1 1 
ATOM   10480 C CD2 . LEU D 1 278 ? 56.527  23.907  196.762 1.00 30.96  ? 278 LEU D CD2 1 
ATOM   10481 N N   . TYR D 1 279 ? 59.038  25.739  197.612 1.00 28.69  ? 279 TYR D N   1 
ATOM   10482 C CA  . TYR D 1 279 ? 59.143  26.174  198.993 1.00 33.29  ? 279 TYR D CA  1 
ATOM   10483 C C   . TYR D 1 279 ? 57.864  26.115  199.857 1.00 32.72  ? 279 TYR D C   1 
ATOM   10484 O O   . TYR D 1 279 ? 56.841  26.790  199.611 1.00 30.84  ? 279 TYR D O   1 
ATOM   10485 C CB  . TYR D 1 279 ? 59.728  27.595  199.028 1.00 39.40  ? 279 TYR D CB  1 
ATOM   10486 C CG  . TYR D 1 279 ? 61.008  27.781  198.227 1.00 41.85  ? 279 TYR D CG  1 
ATOM   10487 C CD1 . TYR D 1 279 ? 61.053  27.516  196.866 1.00 40.00  ? 279 TYR D CD1 1 
ATOM   10488 C CD2 . TYR D 1 279 ? 62.191  28.185  198.858 1.00 46.65  ? 279 TYR D CD2 1 
ATOM   10489 C CE1 . TYR D 1 279 ? 62.254  27.633  196.155 1.00 50.75  ? 279 TYR D CE1 1 
ATOM   10490 C CE2 . TYR D 1 279 ? 63.400  28.313  198.163 1.00 48.57  ? 279 TYR D CE2 1 
ATOM   10491 C CZ  . TYR D 1 279 ? 63.436  28.024  196.812 1.00 52.80  ? 279 TYR D CZ  1 
ATOM   10492 O OH  . TYR D 1 279 ? 64.667  28.023  196.151 1.00 56.82  ? 279 TYR D OH  1 
ATOM   10493 N N   . LEU D 1 280 ? 57.945  25.326  200.910 1.00 30.84  ? 280 LEU D N   1 
ATOM   10494 C CA  . LEU D 1 280 ? 56.831  25.200  201.833 1.00 33.76  ? 280 LEU D CA  1 
ATOM   10495 C C   . LEU D 1 280 ? 57.159  25.951  203.120 1.00 36.45  ? 280 LEU D C   1 
ATOM   10496 O O   . LEU D 1 280 ? 58.283  25.864  203.624 1.00 39.21  ? 280 LEU D O   1 
ATOM   10497 C CB  . LEU D 1 280 ? 56.559  23.730  202.090 1.00 30.53  ? 280 LEU D CB  1 
ATOM   10498 C CG  . LEU D 1 280 ? 55.969  23.259  200.779 1.00 29.28  ? 280 LEU D CG  1 
ATOM   10499 C CD1 . LEU D 1 280 ? 55.786  21.792  200.732 1.00 27.43  ? 280 LEU D CD1 1 
ATOM   10500 C CD2 . LEU D 1 280 ? 54.643  23.971  200.639 1.00 32.46  ? 280 LEU D CD2 1 
ATOM   10501 N N   . SER D 1 281 ? 56.182  26.647  203.686 1.00 35.88  ? 281 SER D N   1 
ATOM   10502 C CA  . SER D 1 281 ? 56.458  27.425  204.880 1.00 32.12  ? 281 SER D CA  1 
ATOM   10503 C C   . SER D 1 281 ? 55.187  27.556  205.692 1.00 34.19  ? 281 SER D C   1 
ATOM   10504 O O   . SER D 1 281 ? 54.095  27.566  205.115 1.00 35.54  ? 281 SER D O   1 
ATOM   10505 C CB  . SER D 1 281 ? 56.947  28.802  204.430 1.00 29.61  ? 281 SER D CB  1 
ATOM   10506 O OG  . SER D 1 281 ? 57.214  28.824  203.018 1.00 32.27  ? 281 SER D OG  1 
ATOM   10507 N N   . CYS D 1 282 ? 55.312  27.642  207.015 1.00 34.95  ? 282 CYS D N   1 
ATOM   10508 C CA  . CYS D 1 282 ? 54.137  27.781  207.879 1.00 38.29  ? 282 CYS D CA  1 
ATOM   10509 C C   . CYS D 1 282 ? 54.513  27.832  209.349 1.00 38.53  ? 282 CYS D C   1 
ATOM   10510 O O   . CYS D 1 282 ? 55.699  27.825  209.673 1.00 41.19  ? 282 CYS D O   1 
ATOM   10511 C CB  . CYS D 1 282 ? 53.210  26.598  207.686 1.00 42.37  ? 282 CYS D CB  1 
ATOM   10512 S SG  . CYS D 1 282 ? 53.954  25.114  208.280 1.00 49.99  ? 282 CYS D SG  1 
ATOM   10513 N N   . VAL D 1 283 ? 53.493  27.821  210.221 1.00 39.34  ? 283 VAL D N   1 
ATOM   10514 C CA  . VAL D 1 283 ? 53.614  27.868  211.701 1.00 37.96  ? 283 VAL D CA  1 
ATOM   10515 C C   . VAL D 1 283 ? 52.262  27.549  212.296 1.00 37.20  ? 283 VAL D C   1 
ATOM   10516 O O   . VAL D 1 283 ? 51.237  27.998  211.775 1.00 40.23  ? 283 VAL D O   1 
ATOM   10517 C CB  . VAL D 1 283 ? 53.907  29.294  212.228 1.00 35.09  ? 283 VAL D CB  1 
ATOM   10518 C CG1 . VAL D 1 283 ? 55.347  29.645  212.014 1.00 36.39  ? 283 VAL D CG1 1 
ATOM   10519 C CG2 . VAL D 1 283 ? 52.999  30.322  211.539 1.00 35.08  ? 283 VAL D CG2 1 
ATOM   10520 N N   . ASP D 1 284 ? 52.223  26.886  213.435 1.00 36.26  ? 284 ASP D N   1 
ATOM   10521 C CA  . ASP D 1 284 ? 50.903  26.592  213.961 1.00 38.40  ? 284 ASP D CA  1 
ATOM   10522 C C   . ASP D 1 284 ? 50.754  26.587  215.460 1.00 37.36  ? 284 ASP D C   1 
ATOM   10523 O O   . ASP D 1 284 ? 50.753  25.545  216.121 1.00 39.33  ? 284 ASP D O   1 
ATOM   10524 C CB  . ASP D 1 284 ? 50.428  25.275  213.388 1.00 41.56  ? 284 ASP D CB  1 
ATOM   10525 C CG  . ASP D 1 284 ? 50.284  25.329  211.911 1.00 44.58  ? 284 ASP D CG  1 
ATOM   10526 O OD1 . ASP D 1 284 ? 49.202  25.825  211.488 1.00 34.99  ? 284 ASP D OD1 1 
ATOM   10527 O OD2 . ASP D 1 284 ? 51.264  24.920  211.207 1.00 45.76  ? 284 ASP D OD2 1 
ATOM   10528 N N   . ILE D 1 285 ? 50.557  27.750  216.021 1.00 33.65  ? 285 ILE D N   1 
ATOM   10529 C CA  . ILE D 1 285 ? 50.435  27.764  217.437 1.00 33.64  ? 285 ILE D CA  1 
ATOM   10530 C C   . ILE D 1 285 ? 49.065  27.446  217.832 1.00 33.23  ? 285 ILE D C   1 
ATOM   10531 O O   . ILE D 1 285 ? 48.100  27.950  217.269 1.00 34.16  ? 285 ILE D O   1 
ATOM   10532 C CB  . ILE D 1 285 ? 50.787  29.079  218.019 1.00 38.19  ? 285 ILE D CB  1 
ATOM   10533 C CG1 . ILE D 1 285 ? 52.274  29.327  217.765 1.00 42.62  ? 285 ILE D CG1 1 
ATOM   10534 C CG2 . ILE D 1 285 ? 50.404  29.118  219.510 1.00 35.62  ? 285 ILE D CG2 1 
ATOM   10535 C CD1 . ILE D 1 285 ? 52.638  29.478  216.280 1.00 43.53  ? 285 ILE D CD1 1 
ATOM   10536 N N   . MET D 1 286 ? 48.986  26.593  218.821 1.00 35.89  ? 286 MET D N   1 
ATOM   10537 C CA  . MET D 1 286 ? 47.716  26.229  219.340 1.00 39.25  ? 286 MET D CA  1 
ATOM   10538 C C   . MET D 1 286 ? 47.486  27.039  220.570 1.00 43.60  ? 286 MET D C   1 
ATOM   10539 O O   . MET D 1 286 ? 46.351  27.332  220.913 1.00 45.25  ? 286 MET D O   1 
ATOM   10540 C CB  . MET D 1 286 ? 47.707  24.761  219.624 1.00 41.14  ? 286 MET D CB  1 
ATOM   10541 C CG  . MET D 1 286 ? 48.047  24.019  218.383 1.00 39.88  ? 286 MET D CG  1 
ATOM   10542 S SD  . MET D 1 286 ? 46.653  23.953  217.251 1.00 39.57  ? 286 MET D SD  1 
ATOM   10543 C CE  . MET D 1 286 ? 45.527  25.446  217.602 1.00 39.45  ? 286 MET D CE  1 
ATOM   10544 N N   . GLY D 1 287 ? 48.578  27.482  221.179 1.00 45.77  ? 287 GLY D N   1 
ATOM   10545 C CA  . GLY D 1 287 ? 48.470  28.274  222.381 1.00 50.55  ? 287 GLY D CA  1 
ATOM   10546 C C   . GLY D 1 287 ? 49.337  27.639  223.439 1.00 54.21  ? 287 GLY D C   1 
ATOM   10547 O O   . GLY D 1 287 ? 50.127  26.751  223.130 1.00 54.76  ? 287 GLY D O   1 
ATOM   10548 N N   . TRP D 1 288 ? 49.158  28.029  224.690 1.00 55.61  ? 288 TRP D N   1 
ATOM   10549 C CA  . TRP D 1 288 ? 49.978  27.483  225.729 1.00 59.18  ? 288 TRP D CA  1 
ATOM   10550 C C   . TRP D 1 288 ? 49.445  26.398  226.575 1.00 67.03  ? 288 TRP D C   1 
ATOM   10551 O O   . TRP D 1 288 ? 48.245  26.276  226.854 1.00 67.00  ? 288 TRP D O   1 
ATOM   10552 C CB  . TRP D 1 288 ? 50.440  28.547  226.679 1.00 60.15  ? 288 TRP D CB  1 
ATOM   10553 C CG  . TRP D 1 288 ? 49.791  29.779  226.465 1.00 66.12  ? 288 TRP D CG  1 
ATOM   10554 C CD1 . TRP D 1 288 ? 48.532  30.147  226.861 1.00 71.72  ? 288 TRP D CD1 1 
ATOM   10555 C CD2 . TRP D 1 288 ? 50.319  30.848  225.721 1.00 68.53  ? 288 TRP D CD2 1 
ATOM   10556 N NE1 . TRP D 1 288 ? 48.239  31.408  226.382 1.00 72.41  ? 288 TRP D NE1 1 
ATOM   10557 C CE2 . TRP D 1 288 ? 49.320  31.859  225.677 1.00 72.87  ? 288 TRP D CE2 1 
ATOM   10558 C CE3 . TRP D 1 288 ? 51.543  31.056  225.078 1.00 64.92  ? 288 TRP D CE3 1 
ATOM   10559 C CZ2 . TRP D 1 288 ? 49.513  33.057  225.009 1.00 78.20  ? 288 TRP D CZ2 1 
ATOM   10560 C CZ3 . TRP D 1 288 ? 51.744  32.231  224.418 1.00 67.90  ? 288 TRP D CZ3 1 
ATOM   10561 C CH2 . TRP D 1 288 ? 50.731  33.228  224.382 1.00 78.69  ? 288 TRP D CH2 1 
ATOM   10562 N N   . ARG D 1 289 ? 50.425  25.644  227.053 1.00 74.68  ? 289 ARG D N   1 
ATOM   10563 C CA  . ARG D 1 289 ? 50.275  24.578  228.009 1.00 80.30  ? 289 ARG D CA  1 
ATOM   10564 C C   . ARG D 1 289 ? 50.790  25.342  229.239 1.00 80.83  ? 289 ARG D C   1 
ATOM   10565 O O   . ARG D 1 289 ? 51.731  26.156  229.074 1.00 78.98  ? 289 ARG D O   1 
ATOM   10566 C CB  . ARG D 1 289 ? 51.235  23.423  227.661 1.00 86.00  ? 289 ARG D CB  1 
ATOM   10567 C CG  . ARG D 1 289 ? 51.532  22.546  228.871 1.00 93.65  ? 289 ARG D CG  1 
ATOM   10568 C CD  . ARG D 1 289 ? 52.709  21.608  228.682 1.00 96.34  ? 289 ARG D CD  1 
ATOM   10569 N NE  . ARG D 1 289 ? 53.236  21.181  229.979 1.00 97.66  ? 289 ARG D NE  1 
ATOM   10570 C CZ  . ARG D 1 289 ? 54.132  20.213  230.159 1.00 102.65 ? 289 ARG D CZ  1 
ATOM   10571 N NH1 . ARG D 1 289 ? 54.621  19.532  229.118 1.00 103.70 ? 289 ARG D NH1 1 
ATOM   10572 N NH2 . ARG D 1 289 ? 54.574  19.958  231.392 1.00 104.31 ? 289 ARG D NH2 1 
ATOM   10573 N N   . VAL D 1 290 ? 50.187  25.101  230.412 1.00 81.43  ? 290 VAL D N   1 
ATOM   10574 C CA  . VAL D 1 290 ? 50.622  25.706  231.662 1.00 86.43  ? 290 VAL D CA  1 
ATOM   10575 C C   . VAL D 1 290 ? 50.934  24.738  232.702 1.00 91.78  ? 290 VAL D C   1 
ATOM   10576 O O   . VAL D 1 290 ? 50.072  24.014  233.054 1.00 93.51  ? 290 VAL D O   1 
ATOM   10577 C CB  . VAL D 1 290 ? 49.583  26.566  232.258 1.00 82.41  ? 290 VAL D CB  1 
ATOM   10578 C CG1 . VAL D 1 290 ? 50.318  27.626  233.124 1.00 83.35  ? 290 VAL D CG1 1 
ATOM   10579 C CG2 . VAL D 1 290 ? 48.723  27.131  231.168 1.00 85.25  ? 290 VAL D CG2 1 
ATOM   10580 N N   . THR D 1 291 ? 52.112  24.782  233.294 1.00 97.99  ? 291 THR D N   1 
ATOM   10581 C CA  . THR D 1 291 ? 52.404  23.745  234.286 1.00 104.85 ? 291 THR D CA  1 
ATOM   10582 C C   . THR D 1 291 ? 51.908  24.030  235.683 1.00 112.28 ? 291 THR D C   1 
ATOM   10583 O O   . THR D 1 291 ? 52.118  25.111  236.255 1.00 110.79 ? 291 THR D O   1 
ATOM   10584 C CB  . THR D 1 291 ? 53.858  23.452  234.463 1.00 102.25 ? 291 THR D CB  1 
ATOM   10585 O OG1 . THR D 1 291 ? 54.520  24.667  234.785 1.00 99.29  ? 291 THR D OG1 1 
ATOM   10586 C CG2 . THR D 1 291 ? 54.415  22.827  233.224 1.00 101.90 ? 291 THR D CG2 1 
ATOM   10587 N N   . ARG D 1 292 ? 51.340  22.964  236.270 1.00 124.17 ? 292 ARG D N   1 
ATOM   10588 C CA  . ARG D 1 292 ? 50.861  22.943  237.630 1.00 134.53 ? 292 ARG D CA  1 
ATOM   10589 C C   . ARG D 1 292 ? 52.200  23.014  238.320 1.00 134.42 ? 292 ARG D C   1 
ATOM   10590 O O   . ARG D 1 292 ? 52.931  22.019  238.425 1.00 135.58 ? 292 ARG D O   1 
ATOM   10591 C CB  . ARG D 1 292 ? 50.197  21.604  237.916 1.00 144.95 ? 292 ARG D CB  1 
ATOM   10592 C CG  . ARG D 1 292 ? 49.310  21.585  239.135 1.00 160.00 ? 292 ARG D CG  1 
ATOM   10593 C CD  . ARG D 1 292 ? 50.095  21.744  240.420 1.00 173.96 ? 292 ARG D CD  1 
ATOM   10594 N NE  . ARG D 1 292 ? 49.712  20.736  241.407 1.00 188.59 ? 292 ARG D NE  1 
ATOM   10595 C CZ  . ARG D 1 292 ? 50.399  19.616  241.650 1.00 195.71 ? 292 ARG D CZ  1 
ATOM   10596 N NH1 . ARG D 1 292 ? 51.524  19.354  240.976 1.00 200.08 ? 292 ARG D NH1 1 
ATOM   10597 N NH2 . ARG D 1 292 ? 49.946  18.744  242.556 1.00 199.48 ? 292 ARG D NH2 1 
ATOM   10598 N N   . ASN D 1 293 ? 52.540  24.225  238.709 1.00 133.50 ? 293 ASN D N   1 
ATOM   10599 C CA  . ASN D 1 293 ? 53.805  24.496  239.324 1.00 136.11 ? 293 ASN D CA  1 
ATOM   10600 C C   . ASN D 1 293 ? 53.630  25.982  239.515 1.00 135.16 ? 293 ASN D C   1 
ATOM   10601 O O   . ASN D 1 293 ? 52.870  26.431  240.377 1.00 136.86 ? 293 ASN D O   1 
ATOM   10602 C CB  . ASN D 1 293 ? 54.883  24.177  238.277 1.00 140.21 ? 293 ASN D CB  1 
ATOM   10603 C CG  . ASN D 1 293 ? 56.261  24.600  238.697 1.00 144.11 ? 293 ASN D CG  1 
ATOM   10604 O OD1 . ASN D 1 293 ? 56.640  25.760  238.532 1.00 144.32 ? 293 ASN D OD1 1 
ATOM   10605 N ND2 . ASN D 1 293 ? 57.044  23.653  239.195 1.00 146.37 ? 293 ASN D ND2 1 
ATOM   10606 N N   . TYR D 1 294 ? 54.239  26.731  238.618 1.00 133.76 ? 294 TYR D N   1 
ATOM   10607 C CA  . TYR D 1 294 ? 54.139  28.158  238.628 1.00 132.66 ? 294 TYR D CA  1 
ATOM   10608 C C   . TYR D 1 294 ? 53.475  28.426  237.337 1.00 126.29 ? 294 TYR D C   1 
ATOM   10609 O O   . TYR D 1 294 ? 52.896  27.530  236.726 1.00 127.22 ? 294 TYR D O   1 
ATOM   10610 C CB  . TYR D 1 294 ? 55.511  28.782  238.607 1.00 142.62 ? 294 TYR D CB  1 
ATOM   10611 C CG  . TYR D 1 294 ? 55.868  29.261  239.960 1.00 160.24 ? 294 TYR D CG  1 
ATOM   10612 C CD1 . TYR D 1 294 ? 55.056  30.184  240.612 1.00 167.82 ? 294 TYR D CD1 1 
ATOM   10613 C CD2 . TYR D 1 294 ? 56.983  28.761  240.629 1.00 168.55 ? 294 TYR D CD2 1 
ATOM   10614 C CE1 . TYR D 1 294 ? 55.344  30.607  241.920 1.00 179.36 ? 294 TYR D CE1 1 
ATOM   10615 C CE2 . TYR D 1 294 ? 57.290  29.172  241.943 1.00 178.03 ? 294 TYR D CE2 1 
ATOM   10616 C CZ  . TYR D 1 294 ? 56.465  30.100  242.588 1.00 182.27 ? 294 TYR D CZ  1 
ATOM   10617 O OH  . TYR D 1 294 ? 56.762  30.527  243.882 1.00 189.46 ? 294 TYR D OH  1 
ATOM   10618 N N   . ASP D 1 295 ? 53.608  29.639  236.864 1.00 117.54 ? 295 ASP D N   1 
ATOM   10619 C CA  . ASP D 1 295 ? 53.001  29.912  235.609 1.00 110.66 ? 295 ASP D CA  1 
ATOM   10620 C C   . ASP D 1 295 ? 54.026  29.795  234.527 1.00 105.70 ? 295 ASP D C   1 
ATOM   10621 O O   . ASP D 1 295 ? 54.356  30.727  233.793 1.00 105.69 ? 295 ASP D O   1 
ATOM   10622 C CB  . ASP D 1 295 ? 52.259  31.208  235.671 1.00 115.15 ? 295 ASP D CB  1 
ATOM   10623 C CG  . ASP D 1 295 ? 51.100  31.118  236.600 1.00 117.19 ? 295 ASP D CG  1 
ATOM   10624 O OD1 . ASP D 1 295 ? 51.318  30.766  237.787 1.00 119.66 ? 295 ASP D OD1 1 
ATOM   10625 O OD2 . ASP D 1 295 ? 49.962  31.316  236.127 1.00 119.83 ? 295 ASP D OD2 1 
ATOM   10626 N N   . VAL D 1 296 ? 54.560  28.590  234.488 1.00 100.88 ? 296 VAL D N   1 
ATOM   10627 C CA  . VAL D 1 296 ? 55.550  28.195  233.523 1.00 100.93 ? 296 VAL D CA  1 
ATOM   10628 C C   . VAL D 1 296 ? 54.605  28.044  232.371 1.00 94.66  ? 296 VAL D C   1 
ATOM   10629 O O   . VAL D 1 296 ? 53.882  27.070  232.264 1.00 96.64  ? 296 VAL D O   1 
ATOM   10630 C CB  . VAL D 1 296 ? 56.143  26.843  233.915 1.00 108.71 ? 296 VAL D CB  1 
ATOM   10631 C CG1 . VAL D 1 296 ? 57.502  26.677  233.286 1.00 115.53 ? 296 VAL D CG1 1 
ATOM   10632 C CG2 . VAL D 1 296 ? 56.242  26.725  235.452 1.00 113.15 ? 296 VAL D CG2 1 
ATOM   10633 N N   . HIS D 1 297 ? 54.570  29.049  231.533 1.00 88.43  ? 297 HIS D N   1 
ATOM   10634 C CA  . HIS D 1 297 ? 53.609  29.042  230.480 1.00 84.59  ? 297 HIS D CA  1 
ATOM   10635 C C   . HIS D 1 297 ? 53.920  28.497  229.131 1.00 84.06  ? 297 HIS D C   1 
ATOM   10636 O O   . HIS D 1 297 ? 53.094  28.663  228.256 1.00 89.20  ? 297 HIS D O   1 
ATOM   10637 C CB  . HIS D 1 297 ? 53.117  30.453  230.300 1.00 81.08  ? 297 HIS D CB  1 
ATOM   10638 C CG  . HIS D 1 297 ? 51.680  30.628  230.620 1.00 84.92  ? 297 HIS D CG  1 
ATOM   10639 N ND1 . HIS D 1 297 ? 51.244  31.421  231.657 1.00 88.47  ? 297 HIS D ND1 1 
ATOM   10640 C CD2 . HIS D 1 297 ? 50.570  30.117  230.042 1.00 88.74  ? 297 HIS D CD2 1 
ATOM   10641 C CE1 . HIS D 1 297 ? 49.925  31.392  231.704 1.00 92.83  ? 297 HIS D CE1 1 
ATOM   10642 N NE2 . HIS D 1 297 ? 49.490  30.608  230.733 1.00 93.15  ? 297 HIS D NE2 1 
ATOM   10643 N N   . HIS D 1 298 ? 55.035  27.810  228.936 1.00 81.39  ? 298 HIS D N   1 
ATOM   10644 C CA  . HIS D 1 298 ? 55.380  27.336  227.575 1.00 79.63  ? 298 HIS D CA  1 
ATOM   10645 C C   . HIS D 1 298 ? 54.328  26.732  226.564 1.00 71.41  ? 298 HIS D C   1 
ATOM   10646 O O   . HIS D 1 298 ? 53.663  25.725  226.836 1.00 67.25  ? 298 HIS D O   1 
ATOM   10647 C CB  . HIS D 1 298 ? 56.665  26.539  227.627 1.00 86.33  ? 298 HIS D CB  1 
ATOM   10648 C CG  . HIS D 1 298 ? 56.611  25.349  228.523 1.00 89.80  ? 298 HIS D CG  1 
ATOM   10649 N ND1 . HIS D 1 298 ? 57.058  24.111  228.126 1.00 93.57  ? 298 HIS D ND1 1 
ATOM   10650 C CD2 . HIS D 1 298 ? 56.206  25.211  229.804 1.00 93.30  ? 298 HIS D CD2 1 
ATOM   10651 C CE1 . HIS D 1 298 ? 56.936  23.256  229.122 1.00 92.42  ? 298 HIS D CE1 1 
ATOM   10652 N NE2 . HIS D 1 298 ? 56.421  23.898  230.154 1.00 93.84  ? 298 HIS D NE2 1 
ATOM   10653 N N   . TRP D 1 299 ? 54.264  27.325  225.363 1.00 62.65  ? 299 TRP D N   1 
ATOM   10654 C CA  . TRP D 1 299 ? 53.267  26.944  224.384 1.00 55.79  ? 299 TRP D CA  1 
ATOM   10655 C C   . TRP D 1 299 ? 53.477  25.886  223.347 1.00 51.57  ? 299 TRP D C   1 
ATOM   10656 O O   . TRP D 1 299 ? 54.598  25.518  223.102 1.00 49.61  ? 299 TRP D O   1 
ATOM   10657 C CB  . TRP D 1 299 ? 52.479  28.168  223.855 1.00 62.41  ? 299 TRP D CB  1 
ATOM   10658 C CG  . TRP D 1 299 ? 52.939  29.367  222.907 1.00 64.94  ? 299 TRP D CG  1 
ATOM   10659 C CD1 . TRP D 1 299 ? 52.051  30.088  222.144 1.00 68.17  ? 299 TRP D CD1 1 
ATOM   10660 C CD2 . TRP D 1 299 ? 54.130  30.181  222.930 1.00 61.65  ? 299 TRP D CD2 1 
ATOM   10661 N NE1 . TRP D 1 299 ? 52.567  31.290  221.765 1.00 62.75  ? 299 TRP D NE1 1 
ATOM   10662 C CE2 . TRP D 1 299 ? 53.841  31.379  222.222 1.00 60.44  ? 299 TRP D CE2 1 
ATOM   10663 C CE3 . TRP D 1 299 ? 55.384  30.034  223.483 1.00 64.86  ? 299 TRP D CE3 1 
ATOM   10664 C CZ2 . TRP D 1 299 ? 54.753  32.408  222.068 1.00 64.39  ? 299 TRP D CZ2 1 
ATOM   10665 C CZ3 . TRP D 1 299 ? 56.301  31.058  223.325 1.00 72.39  ? 299 TRP D CZ3 1 
ATOM   10666 C CH2 . TRP D 1 299 ? 55.979  32.238  222.622 1.00 69.65  ? 299 TRP D CH2 1 
ATOM   10667 N N   . ARG D 1 300 ? 52.374  25.345  222.809 1.00 50.08  ? 300 ARG D N   1 
ATOM   10668 C CA  . ARG D 1 300 ? 52.366  24.247  221.809 1.00 48.94  ? 300 ARG D CA  1 
ATOM   10669 C C   . ARG D 1 300 ? 51.963  24.543  220.398 1.00 47.20  ? 300 ARG D C   1 
ATOM   10670 O O   . ARG D 1 300 ? 51.073  25.366  220.147 1.00 48.94  ? 300 ARG D O   1 
ATOM   10671 C CB  . ARG D 1 300 ? 51.435  23.099  222.242 1.00 50.74  ? 300 ARG D CB  1 
ATOM   10672 C CG  . ARG D 1 300 ? 51.332  21.913  221.235 1.00 48.15  ? 300 ARG D CG  1 
ATOM   10673 C CD  . ARG D 1 300 ? 50.926  20.631  221.957 1.00 52.44  ? 300 ARG D CD  1 
ATOM   10674 N NE  . ARG D 1 300 ? 51.003  19.373  221.197 1.00 51.35  ? 300 ARG D NE  1 
ATOM   10675 C CZ  . ARG D 1 300 ? 52.112  18.856  220.654 1.00 52.79  ? 300 ARG D CZ  1 
ATOM   10676 N NH1 . ARG D 1 300 ? 53.281  19.498  220.747 1.00 56.97  ? 300 ARG D NH1 1 
ATOM   10677 N NH2 . ARG D 1 300 ? 52.076  17.631  220.117 1.00 45.01  ? 300 ARG D NH2 1 
ATOM   10678 N N   . GLY D 1 301 ? 52.492  23.699  219.512 1.00 45.84  ? 301 GLY D N   1 
ATOM   10679 C CA  . GLY D 1 301 ? 52.205  23.781  218.092 1.00 42.04  ? 301 GLY D CA  1 
ATOM   10680 C C   . GLY D 1 301 ? 51.998  22.397  217.513 1.00 36.76  ? 301 GLY D C   1 
ATOM   10681 O O   . GLY D 1 301 ? 52.381  21.410  218.122 1.00 36.81  ? 301 GLY D O   1 
ATOM   10682 N N   . LEU D 1 302 ? 51.381  22.335  216.346 1.00 31.91  ? 302 LEU D N   1 
ATOM   10683 C CA  . LEU D 1 302 ? 51.117  21.088  215.656 1.00 26.49  ? 302 LEU D CA  1 
ATOM   10684 C C   . LEU D 1 302 ? 51.744  21.088  214.273 1.00 25.24  ? 302 LEU D C   1 
ATOM   10685 O O   . LEU D 1 302 ? 52.104  22.132  213.707 1.00 26.29  ? 302 LEU D O   1 
ATOM   10686 C CB  . LEU D 1 302 ? 49.626  20.875  215.524 1.00 27.59  ? 302 LEU D CB  1 
ATOM   10687 C CG  . LEU D 1 302 ? 48.959  20.401  216.791 1.00 30.38  ? 302 LEU D CG  1 
ATOM   10688 C CD1 . LEU D 1 302 ? 47.431  20.308  216.648 1.00 30.93  ? 302 LEU D CD1 1 
ATOM   10689 C CD2 . LEU D 1 302 ? 49.545  19.049  217.027 1.00 34.35  ? 302 LEU D CD2 1 
ATOM   10690 N N   . PRO D 1 303 ? 51.823  19.920  213.670 1.00 24.78  ? 303 PRO D N   1 
ATOM   10691 C CA  . PRO D 1 303 ? 52.420  19.799  212.339 1.00 27.73  ? 303 PRO D CA  1 
ATOM   10692 C C   . PRO D 1 303 ? 51.416  19.899  211.189 1.00 30.15  ? 303 PRO D C   1 
ATOM   10693 O O   . PRO D 1 303 ? 50.213  19.586  211.350 1.00 31.74  ? 303 PRO D O   1 
ATOM   10694 C CB  . PRO D 1 303 ? 53.038  18.419  212.409 1.00 27.61  ? 303 PRO D CB  1 
ATOM   10695 C CG  . PRO D 1 303 ? 51.904  17.658  213.134 1.00 31.33  ? 303 PRO D CG  1 
ATOM   10696 C CD  . PRO D 1 303 ? 51.360  18.623  214.179 1.00 22.00  ? 303 PRO D CD  1 
ATOM   10697 N N   . ARG D 1 304 ? 51.941  20.161  209.996 1.00 28.69  ? 304 ARG D N   1 
ATOM   10698 C CA  . ARG D 1 304 ? 51.084  20.309  208.829 1.00 27.88  ? 304 ARG D CA  1 
ATOM   10699 C C   . ARG D 1 304 ? 51.373  19.474  207.553 1.00 23.24  ? 304 ARG D C   1 
ATOM   10700 O O   . ARG D 1 304 ? 52.517  19.341  207.122 1.00 19.91  ? 304 ARG D O   1 
ATOM   10701 C CB  . ARG D 1 304 ? 51.038  21.794  208.511 1.00 30.44  ? 304 ARG D CB  1 
ATOM   10702 C CG  . ARG D 1 304 ? 50.614  22.115  207.117 1.00 38.19  ? 304 ARG D CG  1 
ATOM   10703 C CD  . ARG D 1 304 ? 50.594  23.613  206.897 1.00 46.28  ? 304 ARG D CD  1 
ATOM   10704 N NE  . ARG D 1 304 ? 49.225  24.112  206.929 1.00 53.26  ? 304 ARG D NE  1 
ATOM   10705 C CZ  . ARG D 1 304 ? 48.720  24.850  207.909 1.00 57.59  ? 304 ARG D CZ  1 
ATOM   10706 N NH1 . ARG D 1 304 ? 49.488  25.190  208.946 1.00 58.53  ? 304 ARG D NH1 1 
ATOM   10707 N NH2 . ARG D 1 304 ? 47.431  25.200  207.863 1.00 60.20  ? 304 ARG D NH2 1 
ATOM   10708 N N   . TYR D 1 305 ? 50.313  18.964  206.936 1.00 20.42  ? 305 TYR D N   1 
ATOM   10709 C CA  . TYR D 1 305 ? 50.398  18.162  205.719 1.00 20.45  ? 305 TYR D CA  1 
ATOM   10710 C C   . TYR D 1 305 ? 50.342  19.075  204.549 1.00 22.90  ? 305 TYR D C   1 
ATOM   10711 O O   . TYR D 1 305 ? 49.807  20.167  204.643 1.00 21.75  ? 305 TYR D O   1 
ATOM   10712 C CB  . TYR D 1 305 ? 49.164  17.302  205.600 1.00 27.62  ? 305 TYR D CB  1 
ATOM   10713 C CG  . TYR D 1 305 ? 48.975  16.521  204.310 1.00 36.69  ? 305 TYR D CG  1 
ATOM   10714 C CD1 . TYR D 1 305 ? 49.805  15.462  204.011 1.00 45.87  ? 305 TYR D CD1 1 
ATOM   10715 C CD2 . TYR D 1 305 ? 47.811  16.650  203.547 1.00 43.41  ? 305 TYR D CD2 1 
ATOM   10716 C CE1 . TYR D 1 305 ? 49.476  14.509  203.014 1.00 52.10  ? 305 TYR D CE1 1 
ATOM   10717 C CE2 . TYR D 1 305 ? 47.467  15.700  202.545 1.00 47.61  ? 305 TYR D CE2 1 
ATOM   10718 C CZ  . TYR D 1 305 ? 48.306  14.617  202.302 1.00 51.02  ? 305 TYR D CZ  1 
ATOM   10719 O OH  . TYR D 1 305 ? 47.948  13.556  201.484 1.00 49.54  ? 305 TYR D OH  1 
ATOM   10720 N N   . PHE D 1 306 ? 50.756  18.557  203.406 1.00 25.46  ? 306 PHE D N   1 
ATOM   10721 C CA  . PHE D 1 306 ? 50.732  19.304  202.164 1.00 26.70  ? 306 PHE D CA  1 
ATOM   10722 C C   . PHE D 1 306 ? 50.572  18.346  201.014 1.00 27.66  ? 306 PHE D C   1 
ATOM   10723 O O   . PHE D 1 306 ? 51.219  17.303  200.968 1.00 29.14  ? 306 PHE D O   1 
ATOM   10724 C CB  . PHE D 1 306 ? 52.050  20.011  201.938 1.00 25.56  ? 306 PHE D CB  1 
ATOM   10725 C CG  . PHE D 1 306 ? 52.327  21.079  202.905 1.00 30.09  ? 306 PHE D CG  1 
ATOM   10726 C CD1 . PHE D 1 306 ? 52.842  20.782  204.147 1.00 34.41  ? 306 PHE D CD1 1 
ATOM   10727 C CD2 . PHE D 1 306 ? 52.118  22.400  202.563 1.00 33.88  ? 306 PHE D CD2 1 
ATOM   10728 C CE1 . PHE D 1 306 ? 53.148  21.801  205.038 1.00 39.74  ? 306 PHE D CE1 1 
ATOM   10729 C CE2 . PHE D 1 306 ? 52.424  23.436  203.450 1.00 36.58  ? 306 PHE D CE2 1 
ATOM   10730 C CZ  . PHE D 1 306 ? 52.938  23.141  204.681 1.00 37.35  ? 306 PHE D CZ  1 
ATOM   10731 N N   . LYS D 1 307 ? 49.673  18.667  200.109 1.00 28.49  ? 307 LYS D N   1 
ATOM   10732 C CA  . LYS D 1 307 ? 49.518  17.863  198.917 1.00 31.39  ? 307 LYS D CA  1 
ATOM   10733 C C   . LYS D 1 307 ? 49.570  18.892  197.785 1.00 30.64  ? 307 LYS D C   1 
ATOM   10734 O O   . LYS D 1 307 ? 48.562  19.540  197.414 1.00 35.55  ? 307 LYS D O   1 
ATOM   10735 C CB  . LYS D 1 307 ? 48.221  17.053  198.914 1.00 38.41  ? 307 LYS D CB  1 
ATOM   10736 C CG  . LYS D 1 307 ? 47.844  16.437  197.521 1.00 46.21  ? 307 LYS D CG  1 
ATOM   10737 C CD  . LYS D 1 307 ? 46.607  15.474  197.613 1.00 56.37  ? 307 LYS D CD  1 
ATOM   10738 C CE  . LYS D 1 307 ? 46.139  14.868  196.256 1.00 59.77  ? 307 LYS D CE  1 
ATOM   10739 N NZ  . LYS D 1 307 ? 45.234  13.637  196.354 1.00 63.06  ? 307 LYS D NZ  1 
ATOM   10740 N N   . ILE D 1 308 ? 50.790  19.134  197.333 1.00 25.31  ? 308 ILE D N   1 
ATOM   10741 C CA  . ILE D 1 308 ? 50.983  20.078  196.271 1.00 20.86  ? 308 ILE D CA  1 
ATOM   10742 C C   . ILE D 1 308 ? 50.772  19.361  194.970 1.00 22.54  ? 308 ILE D C   1 
ATOM   10743 O O   . ILE D 1 308 ? 51.266  18.247  194.748 1.00 16.91  ? 308 ILE D O   1 
ATOM   10744 C CB  . ILE D 1 308 ? 52.361  20.662  196.258 1.00 18.06  ? 308 ILE D CB  1 
ATOM   10745 C CG1 . ILE D 1 308 ? 52.636  21.397  197.572 1.00 16.46  ? 308 ILE D CG1 1 
ATOM   10746 C CG2 . ILE D 1 308 ? 52.487  21.575  195.038 1.00 14.99  ? 308 ILE D CG2 1 
ATOM   10747 C CD1 . ILE D 1 308 ? 52.729  20.510  198.776 1.00 17.57  ? 308 ILE D CD1 1 
ATOM   10748 N N   . THR D 1 309 ? 50.049  20.037  194.105 1.00 25.98  ? 309 THR D N   1 
ATOM   10749 C CA  . THR D 1 309 ? 49.716  19.509  192.815 1.00 30.69  ? 309 THR D CA  1 
ATOM   10750 C C   . THR D 1 309 ? 50.371  20.460  191.868 1.00 32.10  ? 309 THR D C   1 
ATOM   10751 O O   . THR D 1 309 ? 50.029  21.648  191.851 1.00 35.29  ? 309 THR D O   1 
ATOM   10752 C CB  . THR D 1 309 ? 48.221  19.581  192.624 1.00 33.56  ? 309 THR D CB  1 
ATOM   10753 O OG1 . THR D 1 309 ? 47.557  19.554  193.913 1.00 40.09  ? 309 THR D OG1 1 
ATOM   10754 C CG2 . THR D 1 309 ? 47.781  18.412  191.796 1.00 37.34  ? 309 THR D CG2 1 
ATOM   10755 N N   . LEU D 1 310 ? 51.330  19.963  191.101 1.00 33.33  ? 310 LEU D N   1 
ATOM   10756 C CA  . LEU D 1 310 ? 52.068  20.814  190.167 1.00 32.76  ? 310 LEU D CA  1 
ATOM   10757 C C   . LEU D 1 310 ? 52.156  20.253  188.757 1.00 36.19  ? 310 LEU D C   1 
ATOM   10758 O O   . LEU D 1 310 ? 52.142  19.017  188.568 1.00 34.12  ? 310 LEU D O   1 
ATOM   10759 C CB  . LEU D 1 310 ? 53.458  21.097  190.707 1.00 29.19  ? 310 LEU D CB  1 
ATOM   10760 C CG  . LEU D 1 310 ? 53.803  20.293  191.952 1.00 28.23  ? 310 LEU D CG  1 
ATOM   10761 C CD1 . LEU D 1 310 ? 53.985  18.840  191.621 1.00 28.94  ? 310 LEU D CD1 1 
ATOM   10762 C CD2 . LEU D 1 310 ? 55.063  20.822  192.522 1.00 29.98  ? 310 LEU D CD2 1 
ATOM   10763 N N   . ARG D 1 311 ? 52.206  21.169  187.778 1.00 42.07  ? 311 ARG D N   1 
ATOM   10764 C CA  . ARG D 1 311 ? 52.271  20.825  186.345 1.00 50.60  ? 311 ARG D CA  1 
ATOM   10765 C C   . ARG D 1 311 ? 53.494  21.369  185.635 1.00 50.53  ? 311 ARG D C   1 
ATOM   10766 O O   . ARG D 1 311 ? 54.237  22.255  186.123 1.00 46.59  ? 311 ARG D O   1 
ATOM   10767 C CB  . ARG D 1 311 ? 51.041  21.325  185.578 1.00 59.84  ? 311 ARG D CB  1 
ATOM   10768 C CG  . ARG D 1 311 ? 50.956  22.872  185.521 1.00 73.79  ? 311 ARG D CG  1 
ATOM   10769 C CD  . ARG D 1 311 ? 49.605  23.423  185.006 1.00 81.66  ? 311 ARG D CD  1 
ATOM   10770 N NE  . ARG D 1 311 ? 49.601  24.886  184.882 1.00 86.71  ? 311 ARG D NE  1 
ATOM   10771 C CZ  . ARG D 1 311 ? 48.506  25.646  184.881 1.00 91.60  ? 311 ARG D CZ  1 
ATOM   10772 N NH1 . ARG D 1 311 ? 47.299  25.091  185.009 1.00 92.02  ? 311 ARG D NH1 1 
ATOM   10773 N NH2 . ARG D 1 311 ? 48.620  26.969  184.784 1.00 93.35  ? 311 ARG D NH2 1 
ATOM   10774 N N   . LYS D 1 312 ? 53.655  20.867  184.428 1.00 51.48  ? 312 LYS D N   1 
ATOM   10775 C CA  . LYS D 1 312 ? 54.783  21.267  183.645 1.00 55.20  ? 312 LYS D CA  1 
ATOM   10776 C C   . LYS D 1 312 ? 54.370  22.479  182.820 1.00 57.15  ? 312 LYS D C   1 
ATOM   10777 O O   . LYS D 1 312 ? 53.490  22.378  181.937 1.00 61.68  ? 312 LYS D O   1 
ATOM   10778 C CB  . LYS D 1 312 ? 55.238  20.085  182.763 1.00 58.78  ? 312 LYS D CB  1 
ATOM   10779 C CG  . LYS D 1 312 ? 55.854  18.862  183.519 1.00 56.85  ? 312 LYS D CG  1 
ATOM   10780 C CD  . LYS D 1 312 ? 56.297  17.733  182.571 1.00 56.75  ? 312 LYS D CD  1 
ATOM   10781 C CE  . LYS D 1 312 ? 57.808  17.541  182.595 1.00 63.75  ? 312 LYS D CE  1 
ATOM   10782 N NZ  . LYS D 1 312 ? 58.360  16.657  181.517 1.00 68.40  ? 312 LYS D NZ  1 
ATOM   10783 N N   . ARG D 1 313 ? 54.932  23.647  183.132 1.00 53.80  ? 313 ARG D N   1 
ATOM   10784 C CA  . ARG D 1 313 ? 54.546  24.789  182.331 1.00 52.70  ? 313 ARG D CA  1 
ATOM   10785 C C   . ARG D 1 313 ? 55.561  25.544  181.516 1.00 49.89  ? 313 ARG D C   1 
ATOM   10786 O O   . ARG D 1 313 ? 56.704  25.777  181.905 1.00 46.64  ? 313 ARG D O   1 
ATOM   10787 C CB  . ARG D 1 313 ? 53.662  25.763  183.081 1.00 54.69  ? 313 ARG D CB  1 
ATOM   10788 C CG  . ARG D 1 313 ? 52.876  26.618  182.099 1.00 60.04  ? 313 ARG D CG  1 
ATOM   10789 C CD  . ARG D 1 313 ? 53.111  28.094  182.352 1.00 60.31  ? 313 ARG D CD  1 
ATOM   10790 N NE  . ARG D 1 313 ? 52.047  28.643  183.181 1.00 56.67  ? 313 ARG D NE  1 
ATOM   10791 C CZ  . ARG D 1 313 ? 50.833  28.923  182.727 1.00 58.53  ? 313 ARG D CZ  1 
ATOM   10792 N NH1 . ARG D 1 313 ? 50.530  28.709  181.441 1.00 62.71  ? 313 ARG D NH1 1 
ATOM   10793 N NH2 . ARG D 1 313 ? 49.921  29.374  183.568 1.00 55.30  ? 313 ARG D NH2 1 
ATOM   10794 N N   . TRP D 1 314 ? 55.057  25.951  180.366 1.00 48.99  ? 314 TRP D N   1 
ATOM   10795 C CA  . TRP D 1 314 ? 55.786  26.677  179.366 1.00 46.93  ? 314 TRP D CA  1 
ATOM   10796 C C   . TRP D 1 314 ? 55.848  28.162  179.590 1.00 42.36  ? 314 TRP D C   1 
ATOM   10797 O O   . TRP D 1 314 ? 54.831  28.829  179.784 1.00 43.90  ? 314 TRP D O   1 
ATOM   10798 C CB  . TRP D 1 314 ? 55.131  26.391  178.041 1.00 58.00  ? 314 TRP D CB  1 
ATOM   10799 C CG  . TRP D 1 314 ? 55.582  25.096  177.436 1.00 69.48  ? 314 TRP D CG  1 
ATOM   10800 C CD1 . TRP D 1 314 ? 54.792  24.093  176.915 1.00 73.00  ? 314 TRP D CD1 1 
ATOM   10801 C CD2 . TRP D 1 314 ? 56.931  24.736  177.139 1.00 73.80  ? 314 TRP D CD2 1 
ATOM   10802 N NE1 . TRP D 1 314 ? 55.580  23.154  176.285 1.00 72.05  ? 314 TRP D NE1 1 
ATOM   10803 C CE2 . TRP D 1 314 ? 56.890  23.526  176.407 1.00 73.29  ? 314 TRP D CE2 1 
ATOM   10804 C CE3 . TRP D 1 314 ? 58.171  25.330  177.409 1.00 77.91  ? 314 TRP D CE3 1 
ATOM   10805 C CZ2 . TRP D 1 314 ? 58.039  22.908  175.943 1.00 77.59  ? 314 TRP D CZ2 1 
ATOM   10806 C CZ3 . TRP D 1 314 ? 59.318  24.716  176.947 1.00 81.67  ? 314 TRP D CZ3 1 
ATOM   10807 C CH2 . TRP D 1 314 ? 59.244  23.516  176.220 1.00 83.58  ? 314 TRP D CH2 1 
ATOM   10808 N N   . VAL D 1 315 ? 57.047  28.687  179.454 1.00 37.27  ? 315 VAL D N   1 
ATOM   10809 C CA  . VAL D 1 315 ? 57.284  30.094  179.664 1.00 33.39  ? 315 VAL D CA  1 
ATOM   10810 C C   . VAL D 1 315 ? 58.207  30.631  178.586 1.00 37.81  ? 315 VAL D C   1 
ATOM   10811 O O   . VAL D 1 315 ? 58.707  29.917  177.713 1.00 40.08  ? 315 VAL D O   1 
ATOM   10812 C CB  . VAL D 1 315 ? 57.958  30.319  181.026 1.00 27.31  ? 315 VAL D CB  1 
ATOM   10813 C CG1 . VAL D 1 315 ? 57.477  29.298  182.001 1.00 26.65  ? 315 VAL D CG1 1 
ATOM   10814 C CG2 . VAL D 1 315 ? 59.471  30.258  180.914 1.00 20.96  ? 315 VAL D CG2 1 
ATOM   10815 N N   . LYS D 1 316 ? 58.478  31.907  178.674 1.00 41.13  ? 316 LYS D N   1 
ATOM   10816 C CA  . LYS D 1 316 ? 59.362  32.508  177.724 1.00 44.82  ? 316 LYS D CA  1 
ATOM   10817 C C   . LYS D 1 316 ? 60.632  32.724  178.459 1.00 41.68  ? 316 LYS D C   1 
ATOM   10818 O O   . LYS D 1 316 ? 60.624  33.208  179.589 1.00 36.14  ? 316 LYS D O   1 
ATOM   10819 C CB  . LYS D 1 316 ? 58.846  33.882  177.343 1.00 58.04  ? 316 LYS D CB  1 
ATOM   10820 C CG  . LYS D 1 316 ? 59.939  34.874  176.922 1.00 72.91  ? 316 LYS D CG  1 
ATOM   10821 C CD  . LYS D 1 316 ? 59.934  35.053  175.407 1.00 87.89  ? 316 LYS D CD  1 
ATOM   10822 C CE  . LYS D 1 316 ? 59.877  33.695  174.686 1.00 94.66  ? 316 LYS D CE  1 
ATOM   10823 N NZ  . LYS D 1 316 ? 59.544  33.827  173.234 1.00 100.04 ? 316 LYS D NZ  1 
ATOM   10824 N N   . ASN D 1 317 ? 61.740  32.387  177.835 1.00 41.60  ? 317 ASN D N   1 
ATOM   10825 C CA  . ASN D 1 317 ? 62.956  32.681  178.510 1.00 38.56  ? 317 ASN D CA  1 
ATOM   10826 C C   . ASN D 1 317 ? 62.989  34.185  178.436 1.00 36.27  ? 317 ASN D C   1 
ATOM   10827 O O   . ASN D 1 317 ? 63.005  34.805  177.386 1.00 35.14  ? 317 ASN D O   1 
ATOM   10828 C CB  . ASN D 1 317 ? 64.178  32.134  177.848 1.00 40.24  ? 317 ASN D CB  1 
ATOM   10829 C CG  . ASN D 1 317 ? 65.399  32.763  178.406 1.00 43.66  ? 317 ASN D CG  1 
ATOM   10830 O OD1 . ASN D 1 317 ? 66.274  33.182  177.680 1.00 51.56  ? 317 ASN D OD1 1 
ATOM   10831 N ND2 . ASN D 1 317 ? 65.423  32.933  179.727 1.00 40.70  ? 317 ASN D ND2 1 
ATOM   10832 N N   . PRO D 1 318 ? 62.952  34.799  179.578 1.00 37.70  ? 318 PRO D N   1 
ATOM   10833 C CA  . PRO D 1 318 ? 62.965  36.234  179.676 1.00 42.93  ? 318 PRO D CA  1 
ATOM   10834 C C   . PRO D 1 318 ? 64.377  36.731  179.642 1.00 44.15  ? 318 PRO D C   1 
ATOM   10835 O O   . PRO D 1 318 ? 64.656  37.849  180.041 1.00 43.08  ? 318 PRO D O   1 
ATOM   10836 C CB  . PRO D 1 318 ? 62.400  36.443  181.050 1.00 49.09  ? 318 PRO D CB  1 
ATOM   10837 C CG  . PRO D 1 318 ? 63.178  35.418  181.806 1.00 46.58  ? 318 PRO D CG  1 
ATOM   10838 C CD  . PRO D 1 318 ? 63.075  34.194  180.903 1.00 40.37  ? 318 PRO D CD  1 
ATOM   10839 N N   . TYR D 1 319 ? 65.302  35.907  179.230 1.00 46.92  ? 319 TYR D N   1 
ATOM   10840 C CA  . TYR D 1 319 ? 66.611  36.453  179.223 1.00 52.42  ? 319 TYR D CA  1 
ATOM   10841 C C   . TYR D 1 319 ? 67.423  36.281  177.991 1.00 59.30  ? 319 TYR D C   1 
ATOM   10842 O O   . TYR D 1 319 ? 66.968  35.745  176.983 1.00 60.76  ? 319 TYR D O   1 
ATOM   10843 C CB  . TYR D 1 319 ? 67.367  36.076  180.482 1.00 46.42  ? 319 TYR D CB  1 
ATOM   10844 C CG  . TYR D 1 319 ? 66.781  36.785  181.662 1.00 48.20  ? 319 TYR D CG  1 
ATOM   10845 C CD1 . TYR D 1 319 ? 66.781  38.155  181.733 1.00 51.98  ? 319 TYR D CD1 1 
ATOM   10846 C CD2 . TYR D 1 319 ? 66.194  36.089  182.704 1.00 52.17  ? 319 TYR D CD2 1 
ATOM   10847 C CE1 . TYR D 1 319 ? 66.201  38.820  182.833 1.00 59.69  ? 319 TYR D CE1 1 
ATOM   10848 C CE2 . TYR D 1 319 ? 65.617  36.749  183.813 1.00 53.22  ? 319 TYR D CE2 1 
ATOM   10849 C CZ  . TYR D 1 319 ? 65.631  38.108  183.874 1.00 55.57  ? 319 TYR D CZ  1 
ATOM   10850 O OH  . TYR D 1 319 ? 65.167  38.760  184.997 1.00 56.56  ? 319 TYR D OH  1 
ATOM   10851 N N   . PRO D 1 320 ? 68.455  37.082  177.933 1.00 66.32  ? 320 PRO D N   1 
ATOM   10852 C CA  . PRO D 1 320 ? 69.378  37.053  176.810 1.00 69.91  ? 320 PRO D CA  1 
ATOM   10853 C C   . PRO D 1 320 ? 70.504  36.058  177.091 1.00 70.75  ? 320 PRO D C   1 
ATOM   10854 O O   . PRO D 1 320 ? 71.338  36.249  178.001 1.00 66.27  ? 320 PRO D O   1 
ATOM   10855 C CB  . PRO D 1 320 ? 69.862  38.495  176.730 1.00 75.75  ? 320 PRO D CB  1 
ATOM   10856 C CG  . PRO D 1 320 ? 69.633  39.038  178.146 1.00 77.29  ? 320 PRO D CG  1 
ATOM   10857 C CD  . PRO D 1 320 ? 68.345  38.431  178.521 1.00 70.31  ? 320 PRO D CD  1 
ATOM   10858 N N   . MET D 1 321 ? 70.484  34.981  176.308 1.00 73.38  ? 321 MET D N   1 
ATOM   10859 C CA  . MET D 1 321 ? 71.462  33.891  176.393 1.00 74.87  ? 321 MET D CA  1 
ATOM   10860 C C   . MET D 1 321 ? 72.787  34.436  176.864 1.00 68.58  ? 321 MET D C   1 
ATOM   10861 O O   . MET D 1 321 ? 73.106  34.439  178.059 1.00 60.18  ? 321 MET D O   1 
ATOM   10862 C CB  . MET D 1 321 ? 71.658  33.255  175.006 1.00 85.27  ? 321 MET D CB  1 
ATOM   10863 C CG  . MET D 1 321 ? 71.490  31.743  174.969 1.00 97.05  ? 321 MET D CG  1 
ATOM   10864 S SD  . MET D 1 321 ? 69.753  31.207  175.259 1.00 107.66 ? 321 MET D SD  1 
ATOM   10865 C CE  . MET D 1 321 ? 69.922  30.046  176.718 1.00 96.35  ? 321 MET D CE  1 
ATOM   10866 N N   . ALA D 1 322 ? 73.492  34.976  175.880 1.00 66.58  ? 322 ALA D N   1 
ATOM   10867 C CA  . ALA D 1 322 ? 74.780  35.595  176.041 1.00 67.94  ? 322 ALA D CA  1 
ATOM   10868 C C   . ALA D 1 322 ? 75.062  35.924  177.489 1.00 66.56  ? 322 ALA D C   1 
ATOM   10869 O O   . ALA D 1 322 ? 75.629  35.134  178.245 1.00 63.36  ? 322 ALA D O   1 
ATOM   10870 C CB  . ALA D 1 322 ? 74.808  36.882  175.207 1.00 69.48  ? 322 ALA D CB  1 
ATOM   10871 N N   . SER D 1 323 ? 74.506  37.048  177.888 1.00 66.43  ? 323 SER D N   1 
ATOM   10872 C CA  . SER D 1 323 ? 74.689  37.562  179.209 1.00 65.30  ? 323 SER D CA  1 
ATOM   10873 C C   . SER D 1 323 ? 74.418  36.544  180.286 1.00 62.46  ? 323 SER D C   1 
ATOM   10874 O O   . SER D 1 323 ? 75.226  36.405  181.204 1.00 63.64  ? 323 SER D O   1 
ATOM   10875 C CB  . SER D 1 323 ? 73.853  38.820  179.365 1.00 68.42  ? 323 SER D CB  1 
ATOM   10876 O OG  . SER D 1 323 ? 72.773  38.784  178.450 1.00 73.79  ? 323 SER D OG  1 
ATOM   10877 N N   . LEU D 1 324 ? 73.352  35.771  180.166 1.00 57.83  ? 324 LEU D N   1 
ATOM   10878 C CA  . LEU D 1 324 ? 73.138  34.815  181.233 1.00 58.63  ? 324 LEU D CA  1 
ATOM   10879 C C   . LEU D 1 324 ? 74.231  33.734  181.241 1.00 56.97  ? 324 LEU D C   1 
ATOM   10880 O O   . LEU D 1 324 ? 74.590  33.184  182.291 1.00 57.35  ? 324 LEU D O   1 
ATOM   10881 C CB  . LEU D 1 324 ? 71.691  34.279  181.271 1.00 59.33  ? 324 LEU D CB  1 
ATOM   10882 C CG  . LEU D 1 324 ? 70.942  33.539  180.166 1.00 57.98  ? 324 LEU D CG  1 
ATOM   10883 C CD1 . LEU D 1 324 ? 71.525  32.160  180.025 1.00 57.87  ? 324 LEU D CD1 1 
ATOM   10884 C CD2 . LEU D 1 324 ? 69.462  33.431  180.524 1.00 52.48  ? 324 LEU D CD2 1 
ATOM   10885 N N   . ILE D 1 325 ? 74.826  33.497  180.083 1.00 53.80  ? 325 ILE D N   1 
ATOM   10886 C CA  . ILE D 1 325 ? 75.902  32.526  179.994 1.00 52.80  ? 325 ILE D CA  1 
ATOM   10887 C C   . ILE D 1 325 ? 76.986  33.172  180.791 1.00 51.48  ? 325 ILE D C   1 
ATOM   10888 O O   . ILE D 1 325 ? 77.484  32.653  181.771 1.00 49.01  ? 325 ILE D O   1 
ATOM   10889 C CB  . ILE D 1 325 ? 76.385  32.389  178.543 1.00 54.26  ? 325 ILE D CB  1 
ATOM   10890 C CG1 . ILE D 1 325 ? 75.251  31.780  177.707 1.00 59.10  ? 325 ILE D CG1 1 
ATOM   10891 C CG2 . ILE D 1 325 ? 77.688  31.587  178.473 1.00 48.49  ? 325 ILE D CG2 1 
ATOM   10892 C CD1 . ILE D 1 325 ? 75.323  32.018  176.201 1.00 62.77  ? 325 ILE D CD1 1 
ATOM   10893 N N   . SER D 1 326 ? 77.241  34.395  180.409 1.00 55.57  ? 326 SER D N   1 
ATOM   10894 C CA  . SER D 1 326 ? 78.255  35.190  181.036 1.00 64.06  ? 326 SER D CA  1 
ATOM   10895 C C   . SER D 1 326 ? 78.093  35.180  182.536 1.00 60.92  ? 326 SER D C   1 
ATOM   10896 O O   . SER D 1 326 ? 79.059  34.970  183.261 1.00 59.45  ? 326 SER D O   1 
ATOM   10897 C CB  . SER D 1 326 ? 78.168  36.620  180.499 1.00 75.51  ? 326 SER D CB  1 
ATOM   10898 O OG  . SER D 1 326 ? 77.993  36.613  179.077 1.00 88.16  ? 326 SER D OG  1 
ATOM   10899 N N   . SER D 1 327 ? 76.870  35.359  183.010 1.00 60.02  ? 327 SER D N   1 
ATOM   10900 C CA  . SER D 1 327 ? 76.678  35.375  184.442 1.00 62.12  ? 327 SER D CA  1 
ATOM   10901 C C   . SER D 1 327 ? 77.199  34.056  184.951 1.00 62.29  ? 327 SER D C   1 
ATOM   10902 O O   . SER D 1 327 ? 78.132  34.028  185.743 1.00 62.93  ? 327 SER D O   1 
ATOM   10903 C CB  . SER D 1 327 ? 75.212  35.514  184.819 1.00 62.76  ? 327 SER D CB  1 
ATOM   10904 O OG  . SER D 1 327 ? 74.656  34.238  185.099 1.00 66.52  ? 327 SER D OG  1 
ATOM   10905 N N   . LEU D 1 328 ? 76.620  32.964  184.454 1.00 63.59  ? 328 LEU D N   1 
ATOM   10906 C CA  . LEU D 1 328 ? 77.025  31.630  184.876 1.00 66.88  ? 328 LEU D CA  1 
ATOM   10907 C C   . LEU D 1 328 ? 78.517  31.609  185.015 1.00 64.82  ? 328 LEU D C   1 
ATOM   10908 O O   . LEU D 1 328 ? 79.052  31.400  186.104 1.00 64.40  ? 328 LEU D O   1 
ATOM   10909 C CB  . LEU D 1 328 ? 76.635  30.560  183.852 1.00 70.61  ? 328 LEU D CB  1 
ATOM   10910 C CG  . LEU D 1 328 ? 77.553  29.318  183.873 1.00 72.29  ? 328 LEU D CG  1 
ATOM   10911 C CD1 . LEU D 1 328 ? 77.584  28.584  185.245 1.00 74.91  ? 328 LEU D CD1 1 
ATOM   10912 C CD2 . LEU D 1 328 ? 77.111  28.393  182.780 1.00 75.83  ? 328 LEU D CD2 1 
ATOM   10913 N N   . PHE D 1 329 ? 79.172  31.896  183.906 1.00 64.14  ? 329 PHE D N   1 
ATOM   10914 C CA  . PHE D 1 329 ? 80.599  31.898  183.887 1.00 67.33  ? 329 PHE D CA  1 
ATOM   10915 C C   . PHE D 1 329 ? 81.084  32.702  185.080 1.00 69.61  ? 329 PHE D C   1 
ATOM   10916 O O   . PHE D 1 329 ? 81.754  32.174  185.961 1.00 68.05  ? 329 PHE D O   1 
ATOM   10917 C CB  . PHE D 1 329 ? 81.098  32.475  182.562 1.00 70.22  ? 329 PHE D CB  1 
ATOM   10918 C CG  . PHE D 1 329 ? 81.740  31.453  181.654 1.00 75.40  ? 329 PHE D CG  1 
ATOM   10919 C CD1 . PHE D 1 329 ? 82.452  30.368  182.187 1.00 74.64  ? 329 PHE D CD1 1 
ATOM   10920 C CD2 . PHE D 1 329 ? 81.640  31.572  180.272 1.00 77.86  ? 329 PHE D CD2 1 
ATOM   10921 C CE1 . PHE D 1 329 ? 83.052  29.414  181.365 1.00 75.37  ? 329 PHE D CE1 1 
ATOM   10922 C CE2 . PHE D 1 329 ? 82.237  30.623  179.441 1.00 80.39  ? 329 PHE D CE2 1 
ATOM   10923 C CZ  . PHE D 1 329 ? 82.946  29.539  179.993 1.00 79.60  ? 329 PHE D CZ  1 
ATOM   10924 N N   . ASN D 1 330 ? 80.566  33.906  185.222 1.00 74.77  ? 330 ASN D N   1 
ATOM   10925 C CA  . ASN D 1 330 ? 81.009  34.751  186.304 1.00 84.10  ? 330 ASN D CA  1 
ATOM   10926 C C   . ASN D 1 330 ? 80.809  34.198  187.689 1.00 85.70  ? 330 ASN D C   1 
ATOM   10927 O O   . ASN D 1 330 ? 81.652  34.371  188.570 1.00 84.70  ? 330 ASN D O   1 
ATOM   10928 C CB  . ASN D 1 330 ? 80.380  36.121  186.190 1.00 97.02  ? 330 ASN D CB  1 
ATOM   10929 C CG  . ASN D 1 330 ? 81.409  37.183  185.914 1.00 111.78 ? 330 ASN D CG  1 
ATOM   10930 O OD1 . ASN D 1 330 ? 82.314  37.420  186.734 1.00 124.62 ? 330 ASN D OD1 1 
ATOM   10931 N ND2 . ASN D 1 330 ? 81.338  37.786  184.724 1.00 119.53 ? 330 ASN D ND2 1 
ATOM   10932 N N   . ASN D 1 331 ? 79.712  33.485  187.862 1.00 88.58  ? 331 ASN D N   1 
ATOM   10933 C CA  . ASN D 1 331 ? 79.386  32.916  189.152 1.00 93.29  ? 331 ASN D CA  1 
ATOM   10934 C C   . ASN D 1 331 ? 80.248  31.685  189.402 1.00 95.14  ? 331 ASN D C   1 
ATOM   10935 O O   . ASN D 1 331 ? 80.663  31.420  190.534 1.00 99.77  ? 331 ASN D O   1 
ATOM   10936 C CB  . ASN D 1 331 ? 77.897  32.588  189.196 1.00 96.44  ? 331 ASN D CB  1 
ATOM   10937 C CG  . ASN D 1 331 ? 77.030  33.797  188.866 1.00 102.91 ? 331 ASN D CG  1 
ATOM   10938 O OD1 . ASN D 1 331 ? 77.066  34.816  189.565 1.00 107.53 ? 331 ASN D OD1 1 
ATOM   10939 N ND2 . ASN D 1 331 ? 76.263  33.699  187.783 1.00 102.76 ? 331 ASN D ND2 1 
ATOM   10940 N N   . MET D 1 332 ? 80.564  30.970  188.329 1.00 93.50  ? 332 MET D N   1 
ATOM   10941 C CA  . MET D 1 332 ? 81.389  29.772  188.398 1.00 91.00  ? 332 MET D CA  1 
ATOM   10942 C C   . MET D 1 332 ? 82.836  30.186  188.825 1.00 84.67  ? 332 MET D C   1 
ATOM   10943 O O   . MET D 1 332 ? 83.491  29.496  189.616 1.00 82.16  ? 332 MET D O   1 
ATOM   10944 C CB  . MET D 1 332 ? 81.352  29.096  187.007 1.00 100.16 ? 332 MET D CB  1 
ATOM   10945 C CG  . MET D 1 332 ? 81.635  27.576  186.922 1.00 112.33 ? 332 MET D CG  1 
ATOM   10946 S SD  . MET D 1 332 ? 81.834  26.886  185.172 1.00 124.81 ? 332 MET D SD  1 
ATOM   10947 C CE  . MET D 1 332 ? 83.780  26.800  184.933 1.00 115.99 ? 332 MET D CE  1 
ATOM   10948 N N   . LEU D 1 333 ? 83.301  31.346  188.365 1.00 78.97  ? 333 LEU D N   1 
ATOM   10949 C CA  . LEU D 1 333 ? 84.645  31.807  188.694 1.00 73.61  ? 333 LEU D CA  1 
ATOM   10950 C C   . LEU D 1 333 ? 84.772  32.679  189.902 1.00 72.00  ? 333 LEU D C   1 
ATOM   10951 O O   . LEU D 1 333 ? 84.000  33.606  190.102 1.00 71.09  ? 333 LEU D O   1 
ATOM   10952 C CB  . LEU D 1 333 ? 85.277  32.560  187.537 1.00 76.29  ? 333 LEU D CB  1 
ATOM   10953 C CG  . LEU D 1 333 ? 85.797  31.744  186.356 1.00 78.50  ? 333 LEU D CG  1 
ATOM   10954 C CD1 . LEU D 1 333 ? 86.251  30.355  186.809 1.00 80.11  ? 333 LEU D CD1 1 
ATOM   10955 C CD2 . LEU D 1 333 ? 84.717  31.625  185.308 1.00 78.85  ? 333 LEU D CD2 1 
ATOM   10956 N N   . PRO D 1 334 ? 85.829  32.454  190.676 1.00 72.58  ? 334 PRO D N   1 
ATOM   10957 C CA  . PRO D 1 334 ? 86.125  33.201  191.888 1.00 78.52  ? 334 PRO D CA  1 
ATOM   10958 C C   . PRO D 1 334 ? 86.342  34.634  191.600 1.00 84.61  ? 334 PRO D C   1 
ATOM   10959 O O   . PRO D 1 334 ? 86.677  35.063  190.481 1.00 83.74  ? 334 PRO D O   1 
ATOM   10960 C CB  . PRO D 1 334 ? 87.440  32.612  192.362 1.00 71.89  ? 334 PRO D CB  1 
ATOM   10961 C CG  . PRO D 1 334 ? 87.292  31.252  191.977 1.00 74.80  ? 334 PRO D CG  1 
ATOM   10962 C CD  . PRO D 1 334 ? 86.738  31.319  190.565 1.00 70.76  ? 334 PRO D CD  1 
ATOM   10963 N N   . GLN D 1 335 ? 86.134  35.385  192.654 1.00 91.66  ? 335 GLN D N   1 
ATOM   10964 C CA  . GLN D 1 335 ? 86.345  36.780  192.559 1.00 96.39  ? 335 GLN D CA  1 
ATOM   10965 C C   . GLN D 1 335 ? 87.749  36.845  193.063 1.00 90.31  ? 335 GLN D C   1 
ATOM   10966 O O   . GLN D 1 335 ? 88.122  36.116  193.995 1.00 90.50  ? 335 GLN D O   1 
ATOM   10967 C CB  . GLN D 1 335 ? 85.368  37.548  193.449 1.00 110.16 ? 335 GLN D CB  1 
ATOM   10968 C CG  . GLN D 1 335 ? 85.072  38.983  192.943 1.00 132.11 ? 335 GLN D CG  1 
ATOM   10969 C CD  . GLN D 1 335 ? 84.754  39.090  191.416 1.00 143.89 ? 335 GLN D CD  1 
ATOM   10970 O OE1 . GLN D 1 335 ? 84.769  40.197  190.852 1.00 149.63 ? 335 GLN D OE1 1 
ATOM   10971 N NE2 . GLN D 1 335 ? 84.455  37.955  190.763 1.00 150.34 ? 335 GLN D NE2 1 
ATOM   10972 N N   . VAL D 1 336 ? 88.550  37.558  192.293 1.00 82.42  ? 336 VAL D N   1 
ATOM   10973 C CA  . VAL D 1 336 ? 89.951  37.781  192.576 1.00 78.23  ? 336 VAL D CA  1 
ATOM   10974 C C   . VAL D 1 336 ? 90.158  39.168  192.050 1.00 74.72  ? 336 VAL D C   1 
ATOM   10975 O O   . VAL D 1 336 ? 89.317  39.634  191.282 1.00 74.89  ? 336 VAL D O   1 
ATOM   10976 C CB  . VAL D 1 336 ? 90.826  36.829  191.777 1.00 79.38  ? 336 VAL D CB  1 
ATOM   10977 C CG1 . VAL D 1 336 ? 91.115  35.563  192.609 1.00 82.68  ? 336 VAL D CG1 1 
ATOM   10978 C CG2 . VAL D 1 336 ? 90.129  36.491  190.428 1.00 80.05  ? 336 VAL D CG2 1 
ATOM   10979 N N   . GLN D 1 337 ? 94.255  38.647  194.430 1.00 98.92  ? 337 GLN D N   1 
ATOM   10980 C CA  . GLN D 1 337 ? 93.009  39.365  194.324 1.00 103.07 ? 337 GLN D CA  1 
ATOM   10981 C C   . GLN D 1 337 ? 93.005  40.189  193.072 1.00 99.90  ? 337 GLN D C   1 
ATOM   10982 O O   . GLN D 1 337 ? 91.974  40.719  192.659 1.00 98.21  ? 337 GLN D O   1 
ATOM   10983 C CB  . GLN D 1 337 ? 92.799  40.281  195.523 1.00 113.64 ? 337 GLN D CB  1 
ATOM   10984 C CG  . GLN D 1 337 ? 91.417  40.942  195.514 1.00 126.51 ? 337 GLN D CG  1 
ATOM   10985 C CD  . GLN D 1 337 ? 90.271  39.939  195.246 1.00 133.04 ? 337 GLN D CD  1 
ATOM   10986 O OE1 . GLN D 1 337 ? 90.255  39.225  194.228 1.00 134.52 ? 337 GLN D OE1 1 
ATOM   10987 N NE2 . GLN D 1 337 ? 89.312  39.886  196.170 1.00 137.12 ? 337 GLN D NE2 1 
ATOM   10988 N N   . GLY D 1 338 ? 94.195  40.407  192.540 1.00 99.68  ? 338 GLY D N   1 
ATOM   10989 C CA  . GLY D 1 338 ? 94.296  41.141  191.300 1.00 98.08  ? 338 GLY D CA  1 
ATOM   10990 C C   . GLY D 1 338 ? 95.068  42.428  191.312 1.00 94.03  ? 338 GLY D C   1 
ATOM   10991 O O   . GLY D 1 338 ? 94.520  43.460  191.698 1.00 99.99  ? 338 GLY D O   1 
ATOM   10992 N N   . GLN D 1 339 ? 96.338  42.373  190.915 1.00 86.91  ? 339 GLN D N   1 
ATOM   10993 C CA  . GLN D 1 339 ? 97.125  43.572  190.830 1.00 80.10  ? 339 GLN D CA  1 
ATOM   10994 C C   . GLN D 1 339 ? 96.316  44.435  189.847 1.00 78.26  ? 339 GLN D C   1 
ATOM   10995 O O   . GLN D 1 339 ? 95.598  43.929  188.974 1.00 79.23  ? 339 GLN D O   1 
ATOM   10996 C CB  . GLN D 1 339 ? 98.519  43.267  190.315 1.00 80.53  ? 339 GLN D CB  1 
ATOM   10997 C CG  . GLN D 1 339 ? 99.589  43.724  191.272 1.00 88.13  ? 339 GLN D CG  1 
ATOM   10998 C CD  . GLN D 1 339 ? 101.019 43.560  190.730 1.00 93.82  ? 339 GLN D CD  1 
ATOM   10999 O OE1 . GLN D 1 339 ? 101.316 42.630  189.952 1.00 92.29  ? 339 GLN D OE1 1 
ATOM   11000 N NE2 . GLN D 1 339 ? 101.932 44.435  191.198 1.00 95.72  ? 339 GLN D NE2 1 
ATOM   11001 N N   . PRO D 1 340 ? 96.382  45.750  190.003 1.00 75.47  ? 340 PRO D N   1 
ATOM   11002 C CA  . PRO D 1 340 ? 95.674  46.733  189.183 1.00 74.26  ? 340 PRO D CA  1 
ATOM   11003 C C   . PRO D 1 340 ? 95.785  46.692  187.669 1.00 74.06  ? 340 PRO D C   1 
ATOM   11004 O O   . PRO D 1 340 ? 96.764  47.132  187.107 1.00 75.08  ? 340 PRO D O   1 
ATOM   11005 C CB  . PRO D 1 340 ? 96.217  48.043  189.729 1.00 76.79  ? 340 PRO D CB  1 
ATOM   11006 C CG  . PRO D 1 340 ? 97.596  47.692  190.108 1.00 78.02  ? 340 PRO D CG  1 
ATOM   11007 C CD  . PRO D 1 340 ? 97.368  46.420  190.862 1.00 76.82  ? 340 PRO D CD  1 
ATOM   11008 N N   . MET D 1 341 ? 94.752  46.213  187.009 1.00 76.25  ? 341 MET D N   1 
ATOM   11009 C CA  . MET D 1 341 ? 94.755  46.198  185.565 1.00 84.77  ? 341 MET D CA  1 
ATOM   11010 C C   . MET D 1 341 ? 93.563  47.034  185.163 1.00 92.78  ? 341 MET D C   1 
ATOM   11011 O O   . MET D 1 341 ? 92.887  46.804  184.166 1.00 93.14  ? 341 MET D O   1 
ATOM   11012 C CB  . MET D 1 341 ? 94.646  44.771  185.056 1.00 83.89  ? 341 MET D CB  1 
ATOM   11013 C CG  . MET D 1 341 ? 95.958  44.048  185.062 1.00 75.82  ? 341 MET D CG  1 
ATOM   11014 S SD  . MET D 1 341 ? 97.186  45.054  184.193 1.00 70.67  ? 341 MET D SD  1 
ATOM   11015 C CE  . MET D 1 341 ? 98.683  44.376  184.860 1.00 70.34  ? 341 MET D CE  1 
ATOM   11016 N N   . GLU D 1 342 ? 93.395  48.116  185.897 1.00 103.54 ? 342 GLU D N   1 
ATOM   11017 C CA  . GLU D 1 342 ? 92.304  49.057  185.679 1.00 115.53 ? 342 GLU D CA  1 
ATOM   11018 C C   . GLU D 1 342 ? 92.615  50.168  186.684 1.00 114.92 ? 342 GLU D C   1 
ATOM   11019 O O   . GLU D 1 342 ? 93.668  50.226  187.331 1.00 116.16 ? 342 GLU D O   1 
ATOM   11020 C CB  . GLU D 1 342 ? 91.057  48.334  186.171 1.00 128.76 ? 342 GLU D CB  1 
ATOM   11021 C CG  . GLU D 1 342 ? 89.743  48.945  186.006 1.00 151.13 ? 342 GLU D CG  1 
ATOM   11022 C CD  . GLU D 1 342 ? 88.823  48.794  187.205 1.00 165.41 ? 342 GLU D CD  1 
ATOM   11023 O OE1 . GLU D 1 342 ? 89.123  47.899  188.068 1.00 173.44 ? 342 GLU D OE1 1 
ATOM   11024 O OE2 . GLU D 1 342 ? 87.833  49.664  187.309 1.00 174.92 ? 342 GLU D OE2 1 
ATOM   11025 N N   . GLY D 1 343 ? 91.765  51.163  186.665 1.00 114.16 ? 343 GLY D N   1 
ATOM   11026 C CA  . GLY D 1 343 ? 91.852  52.168  187.686 1.00 113.98 ? 343 GLY D CA  1 
ATOM   11027 C C   . GLY D 1 343 ? 92.834  53.294  187.518 1.00 112.79 ? 343 GLY D C   1 
ATOM   11028 O O   . GLY D 1 343 ? 92.749  54.097  186.588 1.00 111.60 ? 343 GLY D O   1 
ATOM   11029 N N   . GLU D 1 344 ? 93.722  53.396  188.494 1.00 112.42 ? 344 GLU D N   1 
ATOM   11030 C CA  . GLU D 1 344 ? 94.680  54.489  188.497 1.00 113.77 ? 344 GLU D CA  1 
ATOM   11031 C C   . GLU D 1 344 ? 96.081  54.067  188.292 1.00 108.18 ? 344 GLU D C   1 
ATOM   11032 O O   . GLU D 1 344 ? 96.904  54.828  187.814 1.00 105.35 ? 344 GLU D O   1 
ATOM   11033 C CB  . GLU D 1 344 ? 94.572  55.230  189.817 1.00 127.86 ? 344 GLU D CB  1 
ATOM   11034 C CG  . GLU D 1 344 ? 93.790  56.534  189.715 1.00 149.37 ? 344 GLU D CG  1 
ATOM   11035 C CD  . GLU D 1 344 ? 94.463  57.567  188.789 1.00 160.68 ? 344 GLU D CD  1 
ATOM   11036 O OE1 . GLU D 1 344 ? 95.516  57.256  188.165 1.00 168.61 ? 344 GLU D OE1 1 
ATOM   11037 O OE2 . GLU D 1 344 ? 93.928  58.703  188.692 1.00 168.41 ? 344 GLU D OE2 1 
ATOM   11038 N N   . ASN D 1 345 ? 96.361  52.826  188.635 1.00 105.37 ? 345 ASN D N   1 
ATOM   11039 C CA  . ASN D 1 345 ? 97.727  52.365  188.498 1.00 106.02 ? 345 ASN D CA  1 
ATOM   11040 C C   . ASN D 1 345 ? 97.798  51.138  187.615 1.00 98.56  ? 345 ASN D C   1 
ATOM   11041 O O   . ASN D 1 345 ? 98.605  50.224  187.838 1.00 96.86  ? 345 ASN D O   1 
ATOM   11042 C CB  . ASN D 1 345 ? 98.304  52.111  189.893 1.00 117.18 ? 345 ASN D CB  1 
ATOM   11043 C CG  . ASN D 1 345 ? 97.905  53.201  190.891 1.00 124.44 ? 345 ASN D CG  1 
ATOM   11044 O OD1 . ASN D 1 345 ? 98.476  54.302  190.906 1.00 130.28 ? 345 ASN D OD1 1 
ATOM   11045 N ND2 . ASN D 1 345 ? 96.894  52.906  191.708 1.00 129.01 ? 345 ASN D ND2 1 
ATOM   11046 N N   . THR D 1 346 ? 96.969  51.155  186.577 1.00 90.11  ? 346 THR D N   1 
ATOM   11047 C CA  . THR D 1 346 ? 96.917  50.056  185.646 1.00 84.78  ? 346 THR D CA  1 
ATOM   11048 C C   . THR D 1 346 ? 98.328  49.712  185.300 1.00 76.76  ? 346 THR D C   1 
ATOM   11049 O O   . THR D 1 346 ? 99.136  50.567  184.948 1.00 77.50  ? 346 THR D O   1 
ATOM   11050 C CB  . THR D 1 346 ? 96.209  50.414  184.342 1.00 90.27  ? 346 THR D CB  1 
ATOM   11051 O OG1 . THR D 1 346 ? 95.230  51.431  184.585 1.00 96.70  ? 346 THR D OG1 1 
ATOM   11052 C CG2 . THR D 1 346 ? 95.522  49.182  183.769 1.00 92.51  ? 346 THR D CG2 1 
ATOM   11053 N N   . GLN D 1 347 ? 98.643  48.454  185.484 1.00 69.36  ? 347 GLN D N   1 
ATOM   11054 C CA  . GLN D 1 347 ? 99.952  47.987  185.158 1.00 63.18  ? 347 GLN D CA  1 
ATOM   11055 C C   . GLN D 1 347 ? 99.837  47.499  183.717 1.00 60.77  ? 347 GLN D C   1 
ATOM   11056 O O   . GLN D 1 347 ? 100.576 46.621  183.245 1.00 59.41  ? 347 GLN D O   1 
ATOM   11057 C CB  . GLN D 1 347 ? 100.329 46.929  186.151 1.00 61.81  ? 347 GLN D CB  1 
ATOM   11058 C CG  . GLN D 1 347 ? 100.101 47.445  187.547 1.00 63.92  ? 347 GLN D CG  1 
ATOM   11059 C CD  . GLN D 1 347 ? 100.787 46.601  188.564 1.00 70.91  ? 347 GLN D CD  1 
ATOM   11060 O OE1 . GLN D 1 347 ? 101.166 47.079  189.648 1.00 74.36  ? 347 GLN D OE1 1 
ATOM   11061 N NE2 . GLN D 1 347 ? 100.994 45.329  188.223 1.00 72.81  ? 347 GLN D NE2 1 
ATOM   11062 N N   . VAL D 1 348 ? 98.865  48.106  183.038 1.00 55.46  ? 348 VAL D N   1 
ATOM   11063 C CA  . VAL D 1 348 ? 98.577  47.866  181.653 1.00 50.98  ? 348 VAL D CA  1 
ATOM   11064 C C   . VAL D 1 348 ? 99.361  48.996  181.071 1.00 54.43  ? 348 VAL D C   1 
ATOM   11065 O O   . VAL D 1 348 ? 99.104  50.150  181.398 1.00 49.78  ? 348 VAL D O   1 
ATOM   11066 C CB  . VAL D 1 348 ? 97.090  48.065  181.353 1.00 45.37  ? 348 VAL D CB  1 
ATOM   11067 C CG1 . VAL D 1 348 ? 96.828  49.257  180.439 1.00 41.46  ? 348 VAL D CG1 1 
ATOM   11068 C CG2 . VAL D 1 348 ? 96.548  46.832  180.737 1.00 47.52  ? 348 VAL D CG2 1 
ATOM   11069 N N   . GLU D 1 349 ? 100.436 48.674  180.374 1.00 62.76  ? 349 GLU D N   1 
ATOM   11070 C CA  . GLU D 1 349 ? 101.197 49.755  179.796 1.00 71.15  ? 349 GLU D CA  1 
ATOM   11071 C C   . GLU D 1 349 ? 100.313 50.266  178.679 1.00 68.40  ? 349 GLU D C   1 
ATOM   11072 O O   . GLU D 1 349 ? 99.756  51.316  178.866 1.00 67.50  ? 349 GLU D O   1 
ATOM   11073 C CB  . GLU D 1 349 ? 102.558 49.307  179.298 1.00 82.97  ? 349 GLU D CB  1 
ATOM   11074 C CG  . GLU D 1 349 ? 103.630 50.393  179.341 1.00 95.07  ? 349 GLU D CG  1 
ATOM   11075 C CD  . GLU D 1 349 ? 104.554 50.251  180.546 1.00 101.11 ? 349 GLU D CD  1 
ATOM   11076 O OE1 . GLU D 1 349 ? 104.825 49.110  181.030 1.00 101.93 ? 349 GLU D OE1 1 
ATOM   11077 O OE2 . GLU D 1 349 ? 105.044 51.302  181.010 1.00 109.36 ? 349 GLU D OE2 1 
ATOM   11078 N N   . GLU D 1 350 ? 100.044 49.484  177.624 1.00 64.48  ? 350 GLU D N   1 
ATOM   11079 C CA  . GLU D 1 350 ? 99.190  49.960  176.528 1.00 60.90  ? 350 GLU D CA  1 
ATOM   11080 C C   . GLU D 1 350 ? 98.335  49.004  175.830 1.00 52.52  ? 350 GLU D C   1 
ATOM   11081 O O   . GLU D 1 350 ? 98.341  47.819  176.111 1.00 48.50  ? 350 GLU D O   1 
ATOM   11082 C CB  . GLU D 1 350 ? 99.995  50.620  175.441 1.00 68.57  ? 350 GLU D CB  1 
ATOM   11083 C CG  . GLU D 1 350 ? 100.669 51.858  175.936 1.00 78.01  ? 350 GLU D CG  1 
ATOM   11084 C CD  . GLU D 1 350 ? 99.692  52.891  176.521 1.00 84.51  ? 350 GLU D CD  1 
ATOM   11085 O OE1 . GLU D 1 350 ? 98.438  52.707  176.292 1.00 92.55  ? 350 GLU D OE1 1 
ATOM   11086 O OE2 . GLU D 1 350 ? 100.197 53.896  177.172 1.00 84.41  ? 350 GLU D OE2 1 
ATOM   11087 N N   . VAL D 1 351 ? 97.610  49.548  174.875 1.00 45.59  ? 351 VAL D N   1 
ATOM   11088 C CA  . VAL D 1 351 ? 96.732  48.743  174.079 1.00 42.31  ? 351 VAL D CA  1 
ATOM   11089 C C   . VAL D 1 351 ? 96.590  49.295  172.685 1.00 45.26  ? 351 VAL D C   1 
ATOM   11090 O O   . VAL D 1 351 ? 96.588  50.503  172.468 1.00 43.01  ? 351 VAL D O   1 
ATOM   11091 C CB  . VAL D 1 351 ? 95.364  48.611  174.726 1.00 36.80  ? 351 VAL D CB  1 
ATOM   11092 C CG1 . VAL D 1 351 ? 94.293  49.195  173.843 1.00 28.85  ? 351 VAL D CG1 1 
ATOM   11093 C CG2 . VAL D 1 351 ? 95.053  47.164  174.936 1.00 38.27  ? 351 VAL D CG2 1 
ATOM   11094 N N   . ARG D 1 352 ? 96.457  48.401  171.727 1.00 51.22  ? 352 ARG D N   1 
ATOM   11095 C CA  . ARG D 1 352 ? 96.350  48.832  170.361 1.00 57.34  ? 352 ARG D CA  1 
ATOM   11096 C C   . ARG D 1 352 ? 95.371  47.950  169.681 1.00 59.12  ? 352 ARG D C   1 
ATOM   11097 O O   . ARG D 1 352 ? 95.224  46.771  170.007 1.00 56.41  ? 352 ARG D O   1 
ATOM   11098 C CB  . ARG D 1 352 ? 97.698  48.693  169.677 1.00 64.32  ? 352 ARG D CB  1 
ATOM   11099 C CG  . ARG D 1 352 ? 98.879  48.697  170.666 1.00 80.14  ? 352 ARG D CG  1 
ATOM   11100 C CD  . ARG D 1 352 ? 99.669  50.007  170.657 1.00 90.05  ? 352 ARG D CD  1 
ATOM   11101 N NE  . ARG D 1 352 ? 100.332 50.234  169.374 1.00 95.51  ? 352 ARG D NE  1 
ATOM   11102 C CZ  . ARG D 1 352 ? 101.280 49.444  168.876 1.00 101.65 ? 352 ARG D CZ  1 
ATOM   11103 N NH1 . ARG D 1 352 ? 101.677 48.372  169.565 1.00 104.56 ? 352 ARG D NH1 1 
ATOM   11104 N NH2 . ARG D 1 352 ? 101.873 49.759  167.722 1.00 104.10 ? 352 ARG D NH2 1 
ATOM   11105 N N   . VAL D 1 353 ? 94.690  48.539  168.727 1.00 64.15  ? 353 VAL D N   1 
ATOM   11106 C CA  . VAL D 1 353 ? 93.720  47.811  167.977 1.00 69.24  ? 353 VAL D CA  1 
ATOM   11107 C C   . VAL D 1 353 ? 93.950  48.025  166.526 1.00 71.59  ? 353 VAL D C   1 
ATOM   11108 O O   . VAL D 1 353 ? 93.903  49.144  166.010 1.00 68.39  ? 353 VAL D O   1 
ATOM   11