data_1SKR
# 
_entry.id   1SKR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SKR         
NDB   PD0522       
RCSB  RCSB021796   
WWPDB D_1000021796 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1T7P 'T7 DNA POLYMERASE COMPLEXED TO DNA PRIMER/TEMPLATE, A NUCLEOSIDE TRIPHOSPHATE, AND ITS PROCESSIVITY FACTOR THIOREDOXIN' 
unspecified 
PDB 1SKS 
;Binary 3' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn thymine dimer on the template
;
unspecified 
PDB 1SKW 
;Binary 3' complex of T7 DNA polymerase with a DNA primer/template containing a disordered cis-syn thymine dimer on the template
;
unspecified 
PDB 1SL0 
;Ternary 3' complex of T7 DNA polymerase with a DNA primer/template containing a disordered cis-syn thymine dimer on the template and an incoming nucleotide
;
unspecified 
PDB 1SL1 
;Binary 5' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn thymine dimer on the template
;
unspecified 
PDB 1SL2 
;Ternary 5' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn thymine dimer on the template and an incoming nucleotide
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SKR 
_pdbx_database_status.recvd_initial_deposition_date   2004-03-05 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, Y.'          1 
'Dutta, S.'       2 
'Doublie, S.'     3 
'Bdour, H.M.'     4 
'Taylor, J.S.'    5 
'Ellenberger, T.' 6 
# 
_citation.id                        primary 
_citation.title                     
'Nucleotide insertion opposite a cis-syn thymine dimer by a replicative DNA polymerase from bacteriophage T7.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            11 
_citation.page_first                784 
_citation.page_last                 790 
_citation.year                      2004 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15235589 
_citation.pdbx_database_id_DOI      10.1038/nsmb792 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, Y.'          1 
primary 'Dutta, S.'       2 
primary 'Doublie, S.'     3 
primary 'Bdour, H.M.'     4 
primary 'Taylor, J.S.'    5 
primary 'Ellenberger, T.' 6 
# 
_cell.entry_id           1SKR 
_cell.length_a           105.506 
_cell.length_b           214.020 
_cell.length_c           52.036 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SKR 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*CP*GP*AP*AP*AP*AP*CP*GP*AP*C*GP*GP*CP*CP*AP*GP*TP*GP*CP*CP*AP*(2DA))-3'"          6748.397  1   ?       ? 
? 'DNA primer'   
2 polymer     syn "5'-D(*CP*CP*CP*TP*TP*TP*GP*GP*CP*AP*CP*TP*GP*GP*CP*CP*GP*TP*CP*GP*TP*TP*TP*TP*CP*G)-3'" 7913.062  1   ?       ? 
? 'DNA template' 
3 polymer     man 'DNA polymerase'                                                                         79089.789 1   2.7.7.7 
'DEL(118-123)' ? ?              
4 polymer     man 'Thioredoxin 1'                                                                          11687.388 1   ?       ? 
? ?              
5 non-polymer syn 'MAGNESIUM ION'                                                                          24.305    3   ?       ? 
? ?              
6 non-polymer syn "2',3'-DIDEOXYADENOSINE-5'-TRIPHOSPHATE"                                                 475.182   1   ?       ? 
? ?              
7 water       nat water                                                                                    18.015    381 ?       ? 
? ?              
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 'T7 DNA polymerase' 
4 'TRX1, TRX'         
# 
_entity_name_sys.entity_id   3 
_entity_name_sys.name        2.7.7.7 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes 
;(DC)(DG)(DA)(DA)(DA)(DA)(DC)(DG)(DA)(DC)(DG)(DG)(DC)(DC)(DA)(DG)(DT)(DG)(DC)(DC)
(DA)(2DA)
;
CGAAAACGACGGCCAGTGCCAA P ? 
2 polydeoxyribonucleotide no no  
;(DC)(DC)(DC)(DT)(DT)(DT)(DG)(DG)(DC)(DA)(DC)(DT)(DG)(DG)(DC)(DC)(DG)(DT)(DC)(DG)
(DT)(DT)(DT)(DT)(DC)(DG)
;
CCCTTTGGCACTGGCCGTCGTTTTCG T ? 
3 'polypeptide(L)'        no no  
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFNEE
MMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIEELYVEL
AARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREYVAGAPY
TPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSAEGDKAW
LRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAH
FMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTPAIAALR
ESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKHGWDGDF
AYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFNEE
MMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIEELYVEL
AARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREYVAGAPY
TPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSAEGDKAW
LRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAH
FMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTPAIAALR
ESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKHGWDGDF
AYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
A ? 
4 'polypeptide(L)'        no no  
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DG  n 
1 3   DA  n 
1 4   DA  n 
1 5   DA  n 
1 6   DA  n 
1 7   DC  n 
1 8   DG  n 
1 9   DA  n 
1 10  DC  n 
1 11  DG  n 
1 12  DG  n 
1 13  DC  n 
1 14  DC  n 
1 15  DA  n 
1 16  DG  n 
1 17  DT  n 
1 18  DG  n 
1 19  DC  n 
1 20  DC  n 
1 21  DA  n 
1 22  2DA n 
2 1   DC  n 
2 2   DC  n 
2 3   DC  n 
2 4   DT  n 
2 5   DT  n 
2 6   DT  n 
2 7   DG  n 
2 8   DG  n 
2 9   DC  n 
2 10  DA  n 
2 11  DC  n 
2 12  DT  n 
2 13  DG  n 
2 14  DG  n 
2 15  DC  n 
2 16  DC  n 
2 17  DG  n 
2 18  DT  n 
2 19  DC  n 
2 20  DG  n 
2 21  DT  n 
2 22  DT  n 
2 23  DT  n 
2 24  DT  n 
2 25  DC  n 
2 26  DG  n 
3 1   MET n 
3 2   ILE n 
3 3   VAL n 
3 4   SER n 
3 5   ASP n 
3 6   ILE n 
3 7   GLU n 
3 8   ALA n 
3 9   ASN n 
3 10  ALA n 
3 11  LEU n 
3 12  LEU n 
3 13  GLU n 
3 14  SER n 
3 15  VAL n 
3 16  THR n 
3 17  LYS n 
3 18  PHE n 
3 19  HIS n 
3 20  CYS n 
3 21  GLY n 
3 22  VAL n 
3 23  ILE n 
3 24  TYR n 
3 25  ASP n 
3 26  TYR n 
3 27  SER n 
3 28  THR n 
3 29  ALA n 
3 30  GLU n 
3 31  TYR n 
3 32  VAL n 
3 33  SER n 
3 34  TYR n 
3 35  ARG n 
3 36  PRO n 
3 37  SER n 
3 38  ASP n 
3 39  PHE n 
3 40  GLY n 
3 41  ALA n 
3 42  TYR n 
3 43  LEU n 
3 44  ASP n 
3 45  ALA n 
3 46  LEU n 
3 47  GLU n 
3 48  ALA n 
3 49  GLU n 
3 50  VAL n 
3 51  ALA n 
3 52  ARG n 
3 53  GLY n 
3 54  GLY n 
3 55  LEU n 
3 56  ILE n 
3 57  VAL n 
3 58  PHE n 
3 59  HIS n 
3 60  ASN n 
3 61  GLY n 
3 62  HIS n 
3 63  LYS n 
3 64  TYR n 
3 65  ASP n 
3 66  VAL n 
3 67  PRO n 
3 68  ALA n 
3 69  LEU n 
3 70  THR n 
3 71  LYS n 
3 72  LEU n 
3 73  ALA n 
3 74  LYS n 
3 75  LEU n 
3 76  GLN n 
3 77  LEU n 
3 78  ASN n 
3 79  ARG n 
3 80  GLU n 
3 81  PHE n 
3 82  HIS n 
3 83  LEU n 
3 84  PRO n 
3 85  ARG n 
3 86  GLU n 
3 87  ASN n 
3 88  CYS n 
3 89  ILE n 
3 90  ASP n 
3 91  THR n 
3 92  LEU n 
3 93  VAL n 
3 94  LEU n 
3 95  SER n 
3 96  ARG n 
3 97  LEU n 
3 98  ILE n 
3 99  HIS n 
3 100 SER n 
3 101 ASN n 
3 102 LEU n 
3 103 LYS n 
3 104 ASP n 
3 105 THR n 
3 106 ASP n 
3 107 MET n 
3 108 GLY n 
3 109 LEU n 
3 110 LEU n 
3 111 ARG n 
3 112 SER n 
3 113 GLY n 
3 114 LYS n 
3 115 LEU n 
3 116 PRO n 
3 117 GLY n 
3 118 ALA n 
3 119 LEU n 
3 120 GLU n 
3 121 ALA n 
3 122 TRP n 
3 123 GLY n 
3 124 TYR n 
3 125 ARG n 
3 126 LEU n 
3 127 GLY n 
3 128 GLU n 
3 129 MET n 
3 130 LYS n 
3 131 GLY n 
3 132 GLU n 
3 133 TYR n 
3 134 LYS n 
3 135 ASP n 
3 136 ASP n 
3 137 PHE n 
3 138 LYS n 
3 139 ARG n 
3 140 MET n 
3 141 LEU n 
3 142 GLU n 
3 143 GLU n 
3 144 GLN n 
3 145 GLY n 
3 146 GLU n 
3 147 GLU n 
3 148 TYR n 
3 149 VAL n 
3 150 ASP n 
3 151 GLY n 
3 152 MET n 
3 153 GLU n 
3 154 TRP n 
3 155 TRP n 
3 156 ASN n 
3 157 PHE n 
3 158 ASN n 
3 159 GLU n 
3 160 GLU n 
3 161 MET n 
3 162 MET n 
3 163 ASP n 
3 164 TYR n 
3 165 ASN n 
3 166 VAL n 
3 167 GLN n 
3 168 ASP n 
3 169 VAL n 
3 170 VAL n 
3 171 VAL n 
3 172 THR n 
3 173 LYS n 
3 174 ALA n 
3 175 LEU n 
3 176 LEU n 
3 177 GLU n 
3 178 LYS n 
3 179 LEU n 
3 180 LEU n 
3 181 SER n 
3 182 ASP n 
3 183 LYS n 
3 184 HIS n 
3 185 TYR n 
3 186 PHE n 
3 187 PRO n 
3 188 PRO n 
3 189 GLU n 
3 190 ILE n 
3 191 ASP n 
3 192 PHE n 
3 193 THR n 
3 194 ASP n 
3 195 VAL n 
3 196 GLY n 
3 197 TYR n 
3 198 THR n 
3 199 THR n 
3 200 PHE n 
3 201 TRP n 
3 202 SER n 
3 203 GLU n 
3 204 SER n 
3 205 LEU n 
3 206 GLU n 
3 207 ALA n 
3 208 VAL n 
3 209 ASP n 
3 210 ILE n 
3 211 GLU n 
3 212 HIS n 
3 213 ARG n 
3 214 ALA n 
3 215 ALA n 
3 216 TRP n 
3 217 LEU n 
3 218 LEU n 
3 219 ALA n 
3 220 LYS n 
3 221 GLN n 
3 222 GLU n 
3 223 ARG n 
3 224 ASN n 
3 225 GLY n 
3 226 PHE n 
3 227 PRO n 
3 228 PHE n 
3 229 ASP n 
3 230 THR n 
3 231 LYS n 
3 232 ALA n 
3 233 ILE n 
3 234 GLU n 
3 235 GLU n 
3 236 LEU n 
3 237 TYR n 
3 238 VAL n 
3 239 GLU n 
3 240 LEU n 
3 241 ALA n 
3 242 ALA n 
3 243 ARG n 
3 244 ARG n 
3 245 SER n 
3 246 GLU n 
3 247 LEU n 
3 248 LEU n 
3 249 ARG n 
3 250 LYS n 
3 251 LEU n 
3 252 THR n 
3 253 GLU n 
3 254 THR n 
3 255 PHE n 
3 256 GLY n 
3 257 SER n 
3 258 TRP n 
3 259 TYR n 
3 260 GLN n 
3 261 PRO n 
3 262 LYS n 
3 263 GLY n 
3 264 GLY n 
3 265 THR n 
3 266 GLU n 
3 267 MET n 
3 268 PHE n 
3 269 CYS n 
3 270 HIS n 
3 271 PRO n 
3 272 ARG n 
3 273 THR n 
3 274 GLY n 
3 275 LYS n 
3 276 PRO n 
3 277 LEU n 
3 278 PRO n 
3 279 LYS n 
3 280 TYR n 
3 281 PRO n 
3 282 ARG n 
3 283 ILE n 
3 284 LYS n 
3 285 THR n 
3 286 PRO n 
3 287 LYS n 
3 288 VAL n 
3 289 GLY n 
3 290 GLY n 
3 291 ILE n 
3 292 PHE n 
3 293 LYS n 
3 294 LYS n 
3 295 PRO n 
3 296 LYS n 
3 297 ASN n 
3 298 LYS n 
3 299 ALA n 
3 300 GLN n 
3 301 ARG n 
3 302 GLU n 
3 303 GLY n 
3 304 ARG n 
3 305 GLU n 
3 306 PRO n 
3 307 CYS n 
3 308 GLU n 
3 309 LEU n 
3 310 ASP n 
3 311 THR n 
3 312 ARG n 
3 313 GLU n 
3 314 TYR n 
3 315 VAL n 
3 316 ALA n 
3 317 GLY n 
3 318 ALA n 
3 319 PRO n 
3 320 TYR n 
3 321 THR n 
3 322 PRO n 
3 323 VAL n 
3 324 GLU n 
3 325 HIS n 
3 326 VAL n 
3 327 VAL n 
3 328 PHE n 
3 329 ASN n 
3 330 PRO n 
3 331 SER n 
3 332 SER n 
3 333 ARG n 
3 334 ASP n 
3 335 HIS n 
3 336 ILE n 
3 337 GLN n 
3 338 LYS n 
3 339 LYS n 
3 340 LEU n 
3 341 GLN n 
3 342 GLU n 
3 343 ALA n 
3 344 GLY n 
3 345 TRP n 
3 346 VAL n 
3 347 PRO n 
3 348 THR n 
3 349 LYS n 
3 350 TYR n 
3 351 THR n 
3 352 ASP n 
3 353 LYS n 
3 354 GLY n 
3 355 ALA n 
3 356 PRO n 
3 357 VAL n 
3 358 VAL n 
3 359 ASP n 
3 360 ASP n 
3 361 GLU n 
3 362 VAL n 
3 363 LEU n 
3 364 GLU n 
3 365 GLY n 
3 366 VAL n 
3 367 ARG n 
3 368 VAL n 
3 369 ASP n 
3 370 ASP n 
3 371 PRO n 
3 372 GLU n 
3 373 LYS n 
3 374 GLN n 
3 375 ALA n 
3 376 ALA n 
3 377 ILE n 
3 378 ASP n 
3 379 LEU n 
3 380 ILE n 
3 381 LYS n 
3 382 GLU n 
3 383 TYR n 
3 384 LEU n 
3 385 MET n 
3 386 ILE n 
3 387 GLN n 
3 388 LYS n 
3 389 ARG n 
3 390 ILE n 
3 391 GLY n 
3 392 GLN n 
3 393 SER n 
3 394 ALA n 
3 395 GLU n 
3 396 GLY n 
3 397 ASP n 
3 398 LYS n 
3 399 ALA n 
3 400 TRP n 
3 401 LEU n 
3 402 ARG n 
3 403 TYR n 
3 404 VAL n 
3 405 ALA n 
3 406 GLU n 
3 407 ASP n 
3 408 GLY n 
3 409 LYS n 
3 410 ILE n 
3 411 HIS n 
3 412 GLY n 
3 413 SER n 
3 414 VAL n 
3 415 ASN n 
3 416 PRO n 
3 417 ASN n 
3 418 GLY n 
3 419 ALA n 
3 420 VAL n 
3 421 THR n 
3 422 GLY n 
3 423 ARG n 
3 424 ALA n 
3 425 THR n 
3 426 HIS n 
3 427 ALA n 
3 428 PHE n 
3 429 PRO n 
3 430 ASN n 
3 431 LEU n 
3 432 ALA n 
3 433 GLN n 
3 434 ILE n 
3 435 PRO n 
3 436 GLY n 
3 437 VAL n 
3 438 ARG n 
3 439 SER n 
3 440 PRO n 
3 441 TYR n 
3 442 GLY n 
3 443 GLU n 
3 444 GLN n 
3 445 CYS n 
3 446 ARG n 
3 447 ALA n 
3 448 ALA n 
3 449 PHE n 
3 450 GLY n 
3 451 ALA n 
3 452 GLU n 
3 453 HIS n 
3 454 HIS n 
3 455 LEU n 
3 456 ASP n 
3 457 GLY n 
3 458 ILE n 
3 459 THR n 
3 460 GLY n 
3 461 LYS n 
3 462 PRO n 
3 463 TRP n 
3 464 VAL n 
3 465 GLN n 
3 466 ALA n 
3 467 GLY n 
3 468 ILE n 
3 469 ASP n 
3 470 ALA n 
3 471 SER n 
3 472 GLY n 
3 473 LEU n 
3 474 GLU n 
3 475 LEU n 
3 476 ARG n 
3 477 CYS n 
3 478 LEU n 
3 479 ALA n 
3 480 HIS n 
3 481 PHE n 
3 482 MET n 
3 483 ALA n 
3 484 ARG n 
3 485 PHE n 
3 486 ASP n 
3 487 ASN n 
3 488 GLY n 
3 489 GLU n 
3 490 TYR n 
3 491 ALA n 
3 492 HIS n 
3 493 GLU n 
3 494 ILE n 
3 495 LEU n 
3 496 ASN n 
3 497 GLY n 
3 498 ASP n 
3 499 ILE n 
3 500 HIS n 
3 501 THR n 
3 502 LYS n 
3 503 ASN n 
3 504 GLN n 
3 505 ILE n 
3 506 ALA n 
3 507 ALA n 
3 508 GLU n 
3 509 LEU n 
3 510 PRO n 
3 511 THR n 
3 512 ARG n 
3 513 ASP n 
3 514 ASN n 
3 515 ALA n 
3 516 LYS n 
3 517 THR n 
3 518 PHE n 
3 519 ILE n 
3 520 TYR n 
3 521 GLY n 
3 522 PHE n 
3 523 LEU n 
3 524 TYR n 
3 525 GLY n 
3 526 ALA n 
3 527 GLY n 
3 528 ASP n 
3 529 GLU n 
3 530 LYS n 
3 531 ILE n 
3 532 GLY n 
3 533 GLN n 
3 534 ILE n 
3 535 VAL n 
3 536 GLY n 
3 537 ALA n 
3 538 GLY n 
3 539 LYS n 
3 540 GLU n 
3 541 ARG n 
3 542 GLY n 
3 543 LYS n 
3 544 GLU n 
3 545 LEU n 
3 546 LYS n 
3 547 LYS n 
3 548 LYS n 
3 549 PHE n 
3 550 LEU n 
3 551 GLU n 
3 552 ASN n 
3 553 THR n 
3 554 PRO n 
3 555 ALA n 
3 556 ILE n 
3 557 ALA n 
3 558 ALA n 
3 559 LEU n 
3 560 ARG n 
3 561 GLU n 
3 562 SER n 
3 563 ILE n 
3 564 GLN n 
3 565 GLN n 
3 566 THR n 
3 567 LEU n 
3 568 VAL n 
3 569 GLU n 
3 570 SER n 
3 571 SER n 
3 572 GLN n 
3 573 TRP n 
3 574 VAL n 
3 575 ALA n 
3 576 GLY n 
3 577 GLU n 
3 578 GLN n 
3 579 GLN n 
3 580 VAL n 
3 581 LYS n 
3 582 TRP n 
3 583 LYS n 
3 584 ARG n 
3 585 ARG n 
3 586 TRP n 
3 587 ILE n 
3 588 LYS n 
3 589 GLY n 
3 590 LEU n 
3 591 ASP n 
3 592 GLY n 
3 593 ARG n 
3 594 LYS n 
3 595 VAL n 
3 596 HIS n 
3 597 VAL n 
3 598 ARG n 
3 599 SER n 
3 600 PRO n 
3 601 HIS n 
3 602 ALA n 
3 603 ALA n 
3 604 LEU n 
3 605 ASN n 
3 606 THR n 
3 607 LEU n 
3 608 LEU n 
3 609 GLN n 
3 610 SER n 
3 611 ALA n 
3 612 GLY n 
3 613 ALA n 
3 614 LEU n 
3 615 ILE n 
3 616 CYS n 
3 617 LYS n 
3 618 LEU n 
3 619 TRP n 
3 620 ILE n 
3 621 ILE n 
3 622 LYS n 
3 623 THR n 
3 624 GLU n 
3 625 GLU n 
3 626 MET n 
3 627 LEU n 
3 628 VAL n 
3 629 GLU n 
3 630 LYS n 
3 631 GLY n 
3 632 LEU n 
3 633 LYS n 
3 634 HIS n 
3 635 GLY n 
3 636 TRP n 
3 637 ASP n 
3 638 GLY n 
3 639 ASP n 
3 640 PHE n 
3 641 ALA n 
3 642 TYR n 
3 643 MET n 
3 644 ALA n 
3 645 TRP n 
3 646 VAL n 
3 647 HIS n 
3 648 ASP n 
3 649 GLU n 
3 650 ILE n 
3 651 GLN n 
3 652 VAL n 
3 653 GLY n 
3 654 CYS n 
3 655 ARG n 
3 656 THR n 
3 657 GLU n 
3 658 GLU n 
3 659 ILE n 
3 660 ALA n 
3 661 GLN n 
3 662 VAL n 
3 663 VAL n 
3 664 ILE n 
3 665 GLU n 
3 666 THR n 
3 667 ALA n 
3 668 GLN n 
3 669 GLU n 
3 670 ALA n 
3 671 MET n 
3 672 ARG n 
3 673 TRP n 
3 674 VAL n 
3 675 GLY n 
3 676 ASP n 
3 677 HIS n 
3 678 TRP n 
3 679 ASN n 
3 680 PHE n 
3 681 ARG n 
3 682 CYS n 
3 683 LEU n 
3 684 LEU n 
3 685 ASP n 
3 686 THR n 
3 687 GLU n 
3 688 GLY n 
3 689 LYS n 
3 690 MET n 
3 691 GLY n 
3 692 PRO n 
3 693 ASN n 
3 694 TRP n 
3 695 ALA n 
3 696 ILE n 
3 697 CYS n 
3 698 HIS n 
4 1   SER n 
4 2   ASP n 
4 3   LYS n 
4 4   ILE n 
4 5   ILE n 
4 6   HIS n 
4 7   LEU n 
4 8   THR n 
4 9   ASP n 
4 10  ASP n 
4 11  SER n 
4 12  PHE n 
4 13  ASP n 
4 14  THR n 
4 15  ASP n 
4 16  VAL n 
4 17  LEU n 
4 18  LYS n 
4 19  ALA n 
4 20  ASP n 
4 21  GLY n 
4 22  ALA n 
4 23  ILE n 
4 24  LEU n 
4 25  VAL n 
4 26  ASP n 
4 27  PHE n 
4 28  TRP n 
4 29  ALA n 
4 30  GLU n 
4 31  TRP n 
4 32  CYS n 
4 33  GLY n 
4 34  PRO n 
4 35  CYS n 
4 36  LYS n 
4 37  MET n 
4 38  ILE n 
4 39  ALA n 
4 40  PRO n 
4 41  ILE n 
4 42  LEU n 
4 43  ASP n 
4 44  GLU n 
4 45  ILE n 
4 46  ALA n 
4 47  ASP n 
4 48  GLU n 
4 49  TYR n 
4 50  GLN n 
4 51  GLY n 
4 52  LYS n 
4 53  LEU n 
4 54  THR n 
4 55  VAL n 
4 56  ALA n 
4 57  LYS n 
4 58  LEU n 
4 59  ASN n 
4 60  ILE n 
4 61  ASP n 
4 62  GLN n 
4 63  ASN n 
4 64  PRO n 
4 65  GLY n 
4 66  THR n 
4 67  ALA n 
4 68  PRO n 
4 69  LYS n 
4 70  TYR n 
4 71  GLY n 
4 72  ILE n 
4 73  ARG n 
4 74  GLY n 
4 75  ILE n 
4 76  PRO n 
4 77  THR n 
4 78  LEU n 
4 79  LEU n 
4 80  LEU n 
4 81  PHE n 
4 82  LYS n 
4 83  ASN n 
4 84  GLY n 
4 85  GLU n 
4 86  VAL n 
4 87  ALA n 
4 88  ALA n 
4 89  THR n 
4 90  LYS n 
4 91  VAL n 
4 92  GLY n 
4 93  ALA n 
4 94  LEU n 
4 95  SER n 
4 96  LYS n 
4 97  GLY n 
4 98  GLN n 
4 99  LEU n 
4 100 LYS n 
4 101 GLU n 
4 102 PHE n 
4 103 LEU n 
4 104 ASP n 
4 105 ALA n 
4 106 ASN n 
4 107 LEU n 
4 108 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample ? ? ? ? 'T7-like viruses' 5 ? ? ? ? ? ? 'Enterobacteria phage T7' 10760 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? ? Escherichia       
'TRXA, TSNC, FIPA, B3781, C4701, Z5291, ECS4714, STM3915, STMD1.75, STY3639, T3381, SF3854, S3905' ? ? ? ? ? ? 'Escherichia coli' 
562   ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOL_BPT7  P00581 3 
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGKRFGSHALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEW
WNFNEEMMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIE
ELYVELAARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREY
VAGAPYTPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSA
EGDKAWLRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLE
LRCLAHFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTP
AIAALRESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKH
GWDGDFAYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
1 ? 
2 UNP THIO_ECOLI P0AA25 4 
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
1 ? 
3 PDB 1SKR       1SKR   1 ? ? ? 
4 PDB 1SKR       1SKR   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1SKR A 1 ? 698 ? P00581 1 ? 704 ? 1 704 
2 2 1SKR B 1 ? 108 ? P0AA25 1 ? 108 ? 1 108 
3 3 1SKR P 1 ? 22  ? 1SKR   1 ? 22  ? 1 22  
4 4 1SKR T 1 ? 26  ? 1SKR   1 ? 26  ? 1 26  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1SKR ? A ? ? UNP P00581 LYS 118 DELETION ? 1 
1 1SKR ? A ? ? UNP P00581 ARG 119 DELETION ? 2 
1 1SKR ? A ? ? UNP P00581 PHE 120 DELETION ? 3 
1 1SKR ? A ? ? UNP P00581 GLY 121 DELETION ? 4 
1 1SKR ? A ? ? UNP P00581 SER 122 DELETION ? 5 
1 1SKR ? A ? ? UNP P00581 HIS 123 DELETION ? 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2DA 'DNA linking'       n "2',3'-DIDEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O5 P'   315.222 
ALA 'L-peptide linking' y ALANINE                                   ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                  ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                           ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                  ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"      ? 'C10 H14 N5 O6 P'   331.222 
DAD non-polymer         . "2',3'-DIDEOXYADENOSINE-5'-TRIPHOSPHATE"  ? 'C10 H16 N5 O11 P3' 475.182 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"       ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"      ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"              ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                                 ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                           ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                   ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                 ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                     ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                   ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                    ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                           ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                             ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                   ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                    ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                 ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                  ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                    ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1SKR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   58.57 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      2.99 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'PEG 8000, ammonium sulfate, aces, ethylene glycol, DTT , pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 294K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 8000'         ? ? ? 
1 2 1 'ammonium sulfate' ? ? ? 
1 3 1 aces               ? ? ? 
1 4 1 'ethylene glycol'  ? ? ? 
1 5 1 DTT                ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1998-03-12 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        SIEMENS 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54 
# 
_reflns.entry_id                     1SKR 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.4 
_reflns.d_resolution_low             20 
_reflns.number_all                   ? 
_reflns.number_obs                   44960 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_k_min                  ? 
_reflns.observed_criterion_F_min     ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.4 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1SKR 
_refine.ls_d_res_high                            2.4 
_refine.ls_d_res_low                             20 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     47023 
_refine.ls_number_reflns_obs                     44960 
_refine.ls_number_reflns_R_free                  2253 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.2255 
_refine.ls_R_factor_R_free                       0.2696 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6110 
_refine_hist.pdbx_number_atoms_nucleic_acid   489 
_refine_hist.pdbx_number_atoms_ligand         32 
_refine_hist.number_atoms_solvent             381 
_refine_hist.number_atoms_total               7012 
_refine_hist.d_res_high                       2.4 
_refine_hist.d_res_low                        20 
# 
_struct.entry_id                  1SKR 
_struct.title                     'T7 DNA Polymerase Complexed To DNA Primer/Template and ddATP' 
_struct.pdbx_descriptor           'DNA polymerase (E.C.2.7.7.7)/Thioredoxin 1/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SKR 
_struct_keywords.pdbx_keywords   'TRANSFERASE/ELECTRON TRANSPORT/DNA' 
_struct_keywords.text            'DNA polymerase, uv-lesion, replication, open, close, TRANSFERASE-ELECTRON TRANSPORT-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 6 ? 
I N N 7 ? 
J N N 7 ? 
K N N 7 ? 
L N N 7 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG C 35  ? SER C 37  ? ARG A 35  SER A 37  5 ? 3  
HELX_P HELX_P2  2  ASP C 38  ? ARG C 52  ? ASP A 38  ARG A 52  1 ? 15 
HELX_P HELX_P3  3  TYR C 64  ? ASN C 78  ? TYR A 64  ASN A 78  1 ? 15 
HELX_P HELX_P4  4  PRO C 84  ? GLU C 86  ? PRO A 84  GLU A 86  5 ? 3  
HELX_P HELX_P5  5  THR C 91  ? HIS C 99  ? THR A 91  HIS A 99  1 ? 9  
HELX_P HELX_P6  6  ARG C 111 ? LEU C 115 ? ARG A 111 LEU A 115 5 ? 5  
HELX_P HELX_P7  7  GLU C 120 ? GLU C 143 ? GLU A 126 GLU A 149 1 ? 24 
HELX_P HELX_P8  8  GLY C 151 ? TRP C 155 ? GLY A 157 TRP A 161 5 ? 5  
HELX_P HELX_P9  9  ASN C 158 ? SER C 181 ? ASN A 164 SER A 187 1 ? 24 
HELX_P HELX_P10 10 GLY C 196 ? SER C 204 ? GLY A 202 SER A 210 1 ? 9  
HELX_P HELX_P11 11 LEU C 205 ? GLY C 225 ? LEU A 211 GLY A 231 1 ? 21 
HELX_P HELX_P12 12 ASP C 229 ? PHE C 255 ? ASP A 235 PHE A 261 1 ? 27 
HELX_P HELX_P13 13 SER C 332 ? GLU C 342 ? SER A 338 GLU A 348 1 ? 11 
HELX_P HELX_P14 14 ASP C 359 ? VAL C 366 ? ASP A 365 VAL A 372 1 ? 8  
HELX_P HELX_P15 15 ASP C 370 ? ALA C 394 ? ASP A 376 ALA A 400 1 ? 25 
HELX_P HELX_P16 16 ALA C 399 ? VAL C 404 ? ALA A 405 VAL A 410 1 ? 6  
HELX_P HELX_P17 17 ASN C 430 ? ILE C 434 ? ASN A 436 ILE A 440 5 ? 5  
HELX_P HELX_P18 18 TYR C 441 ? ALA C 448 ? TYR A 447 ALA A 454 1 ? 8  
HELX_P HELX_P19 19 PHE C 449 ? PHE C 449 ? PHE A 455 PHE A 455 5 ? 1  
HELX_P HELX_P20 20 GLY C 450 ? HIS C 454 ? GLY A 456 HIS A 460 5 ? 5  
HELX_P HELX_P21 21 GLY C 472 ? ASN C 487 ? GLY A 478 ASN A 493 1 ? 16 
HELX_P HELX_P22 22 GLY C 488 ? ILE C 494 ? GLY A 494 ILE A 500 1 ? 7  
HELX_P HELX_P23 23 ASP C 498 ? GLU C 508 ? ASP A 504 GLU A 514 1 ? 11 
HELX_P HELX_P24 24 THR C 511 ? TYR C 524 ? THR A 517 TYR A 530 1 ? 14 
HELX_P HELX_P25 25 GLY C 527 ? GLY C 536 ? GLY A 533 GLY A 542 1 ? 10 
HELX_P HELX_P26 26 GLY C 538 ? ASN C 552 ? GLY A 544 ASN A 558 1 ? 15 
HELX_P HELX_P27 27 PRO C 554 ? VAL C 568 ? PRO A 560 VAL A 574 1 ? 15 
HELX_P HELX_P28 28 SER C 599 ? HIS C 601 ? SER A 605 HIS A 607 5 ? 3  
HELX_P HELX_P29 29 ALA C 602 ? LYS C 630 ? ALA A 608 LYS A 636 1 ? 29 
HELX_P HELX_P30 30 THR C 656 ? TRP C 678 ? THR A 662 TRP A 684 1 ? 23 
HELX_P HELX_P31 31 SER D 11  ? VAL D 16  ? SER B 11  VAL B 16  1 ? 6  
HELX_P HELX_P32 32 CYS D 32  ? TYR D 49  ? CYS B 32  TYR B 49  1 ? 18 
HELX_P HELX_P33 33 THR D 66  ? GLY D 71  ? THR B 66  GLY B 71  5 ? 6  
HELX_P HELX_P34 34 SER D 95  ? LEU D 107 ? SER B 95  LEU B 107 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E MG  .  MG    ? ? ? 1_555 C ALA 470 O   ? ? A MG  4001 A ALA 476  1_555 ? ? ? ? ? ? ?            2.171 ? 
metalc2  metalc ? ? E MG  .  MG    ? ? ? 1_555 C ASP 469 OD1 ? ? A MG  4001 A ASP 475  1_555 ? ? ? ? ? ? ?            2.254 ? 
metalc3  metalc ? ? E MG  .  MG    ? ? ? 1_555 C ASP 648 OD2 ? ? A MG  4001 A ASP 654  1_555 ? ? ? ? ? ? ?            2.329 ? 
metalc4  metalc ? ? E MG  .  MG    ? ? ? 1_555 H DAD .   O1G ? ? A MG  4001 A DAD 4004 1_555 ? ? ? ? ? ? ?            2.279 ? 
metalc5  metalc ? ? E MG  .  MG    ? ? ? 1_555 H DAD .   O2B ? ? A MG  4001 A DAD 4004 1_555 ? ? ? ? ? ? ?            2.378 ? 
metalc6  metalc ? ? E MG  .  MG    ? ? ? 1_555 H DAD .   O1A ? ? A MG  4001 A DAD 4004 1_555 ? ? ? ? ? ? ?            2.344 ? 
metalc7  metalc ? ? F MG  .  MG    ? ? ? 1_555 K HOH .   O   ? ? A MG  4002 A HOH 5017 1_555 ? ? ? ? ? ? ?            2.548 ? 
metalc8  metalc ? ? F MG  .  MG    ? ? ? 1_555 C ASP 469 OD1 ? ? A MG  4002 A ASP 475  1_555 ? ? ? ? ? ? ?            3.119 ? 
metalc9  metalc ? ? F MG  .  MG    ? ? ? 1_555 C ASP 469 OD2 ? ? A MG  4002 A ASP 475  1_555 ? ? ? ? ? ? ?            2.470 ? 
metalc10 metalc ? ? F MG  .  MG    ? ? ? 1_555 C ASP 648 OD1 ? ? A MG  4002 A ASP 654  1_555 ? ? ? ? ? ? ?            2.439 ? 
metalc11 metalc ? ? F MG  .  MG    ? ? ? 1_555 H DAD .   O1A ? ? A MG  4002 A DAD 4004 1_555 ? ? ? ? ? ? ?            2.724 ? 
metalc12 metalc ? ? F MG  .  MG    ? ? ? 1_555 K HOH .   O   ? ? A MG  4002 A HOH 5442 1_555 ? ? ? ? ? ? ?            2.700 ? 
metalc13 metalc ? ? G MG  .  MG    ? ? ? 1_555 K HOH .   O   ? ? A MG  4003 A HOH 5031 1_555 ? ? ? ? ? ? ?            2.491 ? 
metalc14 metalc ? ? G MG  .  MG    ? ? ? 1_555 K HOH .   O   ? ? A MG  4003 A HOH 5433 1_555 ? ? ? ? ? ? ?            2.458 ? 
metalc15 metalc ? ? G MG  .  MG    ? ? ? 1_555 C ASP 5   OD1 ? ? A MG  4003 A ASP 5    1_555 ? ? ? ? ? ? ?            2.571 ? 
metalc16 metalc ? ? G MG  .  MG    ? ? ? 1_555 K HOH .   O   ? ? A MG  4003 A HOH 5044 1_555 ? ? ? ? ? ? ?            2.574 ? 
metalc17 metalc ? ? G MG  .  MG    ? ? ? 1_555 K HOH .   O   ? ? A MG  4003 A HOH 5432 1_555 ? ? ? ? ? ? ?            2.386 ? 
covale1  covale ? ? A DA  21 "O3'" ? ? ? 1_555 A 2DA 22  P   ? ? P DA  21   P 2DA 22   1_555 ? ? ? ? ? ? ?            1.610 ? 
hydrog1  hydrog ? ? A DG  12 N2    ? ? ? 1_555 B DC  15  O2  ? ? P DG  12   T DC  15   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog2  hydrog ? ? A DC  13 N3    ? ? ? 1_555 B DG  14  N1  ? ? P DC  13   T DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DC  13 N4    ? ? ? 1_555 B DG  14  O6  ? ? P DC  13   T DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DC  13 O2    ? ? ? 1_555 B DG  14  N2  ? ? P DC  13   T DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DC  14 N3    ? ? ? 1_555 B DG  13  N1  ? ? P DC  14   T DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DC  14 N4    ? ? ? 1_555 B DG  13  O6  ? ? P DC  14   T DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DC  14 O2    ? ? ? 1_555 B DG  13  N2  ? ? P DC  14   T DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DA  15 N1    ? ? ? 1_555 B DT  12  N3  ? ? P DA  15   T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DA  15 N6    ? ? ? 1_555 B DT  12  O4  ? ? P DA  15   T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DG  16 N1    ? ? ? 1_555 B DC  11  N3  ? ? P DG  16   T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG  16 N2    ? ? ? 1_555 B DC  11  O2  ? ? P DG  16   T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG  16 O6    ? ? ? 1_555 B DC  11  N4  ? ? P DG  16   T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DT  17 N3    ? ? ? 1_555 B DA  10  N1  ? ? P DT  17   T DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DT  17 O4    ? ? ? 1_555 B DA  10  N6  ? ? P DT  17   T DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DG  18 N1    ? ? ? 1_555 B DC  9   N3  ? ? P DG  18   T DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DG  18 N2    ? ? ? 1_555 B DC  9   O2  ? ? P DG  18   T DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DG  18 O6    ? ? ? 1_555 B DC  9   N4  ? ? P DG  18   T DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DC  19 N3    ? ? ? 1_555 B DG  8   N1  ? ? P DC  19   T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DC  19 N4    ? ? ? 1_555 B DG  8   O6  ? ? P DC  19   T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DC  19 O2    ? ? ? 1_555 B DG  8   N2  ? ? P DC  19   T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DC  20 N3    ? ? ? 1_555 B DG  7   N1  ? ? P DC  20   T DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DC  20 N4    ? ? ? 1_555 B DG  7   O6  ? ? P DC  20   T DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DC  20 O2    ? ? ? 1_555 B DG  7   N2  ? ? P DC  20   T DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DA  21 N1    ? ? ? 1_555 B DT  6   N3  ? ? P DA  21   T DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DA  21 N6    ? ? ? 1_555 B DT  6   O4  ? ? P DA  21   T DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A 2DA 22 N1    ? ? ? 1_555 B DT  5   N3  ? ? P 2DA 22   T DT  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A 2DA 22 N6    ? ? ? 1_555 B DT  5   O4  ? ? P 2DA 22   T DT  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 428 C . ? PHE 434 A PRO 429 C ? PRO 435 A 1 -0.64 
2 ILE 75  D . ? ILE 75  B PRO 76  D ? PRO 76  B 1 0.28  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 3 ? 
D ? 2 ? 
E ? 4 ? 
F ? 2 ? 
G ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU C 30  ? TYR C 34  ? GLU A 30  TYR A 34  
A 2 PHE C 18  ? ASP C 25  ? PHE A 18  ASP A 25  
A 3 ILE C 2   ? ALA C 8   ? ILE A 2   ALA A 8   
A 4 ILE C 56  ? PHE C 58  ? ILE A 56  PHE A 58  
A 5 CYS C 88  ? ASP C 90  ? CYS A 88  ASP A 90  
B 1 PHE C 226 ? PRO C 227 ? PHE A 232 PRO A 233 
B 2 LYS C 409 ? ILE C 410 ? LYS A 415 ILE A 416 
C 1 TRP C 258 ? PRO C 261 ? TRP A 264 PRO A 267 
C 2 THR C 321 ? VAL C 326 ? THR A 327 VAL A 332 
C 3 GLY D 74  ? ILE D 75  ? GLY B 74  ILE B 75  
D 1 SER C 413 ? ASN C 415 ? SER A 419 ASN A 421 
D 2 THR C 425 ? ALA C 427 ? THR A 431 ALA A 433 
E 1 PHE C 640 ? TRP C 645 ? PHE A 646 TRP A 651 
E 2 GLU C 649 ? CYS C 654 ? GLU A 655 CYS A 660 
E 3 VAL C 464 ? ALA C 470 ? VAL A 470 ALA A 476 
E 4 THR C 686 ? GLY C 691 ? THR A 692 GLY A 697 
F 1 TRP C 586 ? LYS C 588 ? TRP A 592 LYS A 594 
F 2 LYS C 594 ? HIS C 596 ? LYS A 600 HIS A 602 
G 1 ILE D 5   ? HIS D 6   ? ILE B 5   HIS B 6   
G 2 THR D 54  ? ASN D 59  ? THR B 54  ASN B 59  
G 3 ALA D 22  ? TRP D 28  ? ALA B 22  TRP B 28  
G 4 THR D 77  ? LYS D 82  ? THR B 77  LYS B 82  
G 5 GLU D 85  ? VAL D 91  ? GLU B 85  VAL B 91  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR C 34  ? O TYR A 34  N GLY C 21  ? N GLY A 21  
A 2 3 O TYR C 24  ? O TYR A 24  N VAL C 3   ? N VAL A 3   
A 3 4 N ILE C 2   ? N ILE A 2   O VAL C 57  ? O VAL A 57  
A 4 5 N PHE C 58  ? N PHE A 58  O ILE C 89  ? O ILE A 89  
B 1 2 N PHE C 226 ? N PHE A 232 O ILE C 410 ? O ILE A 416 
C 1 2 N TRP C 258 ? N TRP A 264 O VAL C 326 ? O VAL A 332 
C 2 3 N THR C 321 ? N THR A 327 O ILE D 75  ? O ILE B 75  
D 1 2 N SER C 413 ? N SER A 419 O ALA C 427 ? O ALA A 433 
E 1 2 N ALA C 641 ? N ALA A 647 O GLY C 653 ? O GLY A 659 
E 2 3 O CYS C 654 ? O CYS A 660 N VAL C 464 ? N VAL A 470 
E 3 4 N GLY C 467 ? N GLY A 473 O LYS C 689 ? O LYS A 695 
F 1 2 N ILE C 587 ? N ILE A 593 O VAL C 595 ? O VAL A 601 
G 1 2 N ILE D 5   ? N ILE B 5   O LYS D 57  ? O LYS B 57  
G 2 3 O THR D 54  ? O THR B 54  N LEU D 24  ? N LEU B 24  
G 3 4 N VAL D 25  ? N VAL B 25  O LEU D 79  ? O LEU B 79  
G 4 5 N LEU D 78  ? N LEU B 78  O LYS D 90  ? O LYS B 90  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 4001'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 4002'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 4003'  
AC4 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE DAD A 4004' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  ASP C 469 ? ASP A 475  . ? 1_555 ? 
2  AC1 4  ALA C 470 ? ALA A 476  . ? 1_555 ? 
3  AC1 4  ASP C 648 ? ASP A 654  . ? 1_555 ? 
4  AC1 4  DAD H .   ? DAD A 4004 . ? 1_555 ? 
5  AC2 6  ASP C 469 ? ASP A 475  . ? 1_555 ? 
6  AC2 6  ASP C 648 ? ASP A 654  . ? 1_555 ? 
7  AC2 6  DAD H .   ? DAD A 4004 . ? 1_555 ? 
8  AC2 6  HOH K .   ? HOH A 5017 . ? 1_555 ? 
9  AC2 6  HOH K .   ? HOH A 5442 . ? 1_555 ? 
10 AC2 6  2DA A 22  ? 2DA P 22   . ? 1_555 ? 
11 AC3 5  ASP C 5   ? ASP A 5    . ? 1_555 ? 
12 AC3 5  HOH K .   ? HOH A 5031 . ? 1_555 ? 
13 AC3 5  HOH K .   ? HOH A 5044 . ? 1_555 ? 
14 AC3 5  HOH K .   ? HOH A 5432 . ? 1_555 ? 
15 AC3 5  HOH K .   ? HOH A 5433 . ? 1_555 ? 
16 AC4 22 ARG C 423 ? ARG A 429  . ? 1_555 ? 
17 AC4 22 ASP C 469 ? ASP A 475  . ? 1_555 ? 
18 AC4 22 ALA C 470 ? ALA A 476  . ? 1_555 ? 
19 AC4 22 SER C 471 ? SER A 477  . ? 1_555 ? 
20 AC4 22 GLY C 472 ? GLY A 478  . ? 1_555 ? 
21 AC4 22 LEU C 473 ? LEU A 479  . ? 1_555 ? 
22 AC4 22 GLU C 474 ? GLU A 480  . ? 1_555 ? 
23 AC4 22 HIS C 500 ? HIS A 506  . ? 1_555 ? 
24 AC4 22 ARG C 512 ? ARG A 518  . ? 1_555 ? 
25 AC4 22 LYS C 516 ? LYS A 522  . ? 1_555 ? 
26 AC4 22 TYR C 520 ? TYR A 526  . ? 1_555 ? 
27 AC4 22 ASP C 648 ? ASP A 654  . ? 1_555 ? 
28 AC4 22 MG  E .   ? MG  A 4001 . ? 1_555 ? 
29 AC4 22 MG  F .   ? MG  A 4002 . ? 1_555 ? 
30 AC4 22 HOH K .   ? HOH A 5008 . ? 1_555 ? 
31 AC4 22 HOH K .   ? HOH A 5055 . ? 1_555 ? 
32 AC4 22 HOH K .   ? HOH A 5168 . ? 1_555 ? 
33 AC4 22 HOH K .   ? HOH A 5251 . ? 1_555 ? 
34 AC4 22 HOH K .   ? HOH A 5284 . ? 1_555 ? 
35 AC4 22 2DA A 22  ? 2DA P 22   . ? 1_555 ? 
36 AC4 22 DT  B 4   ? DT  T 4    . ? 1_555 ? 
37 AC4 22 DT  B 5   ? DT  T 5    . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1SKR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SKR 
_atom_sites.fract_transf_matrix[1][1]   0.009478 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004672 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019217 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    P  P     . DG  A 1 12  ? 71.189 50.708  12.129  1.00 77.12 ? 12   DG  P P     1 
ATOM   2    O  OP1   . DG  A 1 12  ? 69.946 51.575  11.969  1.00 76.78 ? 12   DG  P OP1   1 
ATOM   3    O  OP2   . DG  A 1 12  ? 71.737 50.203  10.804  1.00 76.54 ? 12   DG  P OP2   1 
ATOM   4    O  "O5'" . DG  A 1 12  ? 70.727 49.381  12.959  1.00 76.19 ? 12   DG  P "O5'" 1 
ATOM   5    C  "C5'" . DG  A 1 12  ? 71.691 48.593  13.687  1.00 74.91 ? 12   DG  P "C5'" 1 
ATOM   6    C  "C4'" . DG  A 1 12  ? 71.032 47.906  14.862  1.00 74.27 ? 12   DG  P "C4'" 1 
ATOM   7    O  "O4'" . DG  A 1 12  ? 70.292 48.882  15.636  1.00 73.82 ? 12   DG  P "O4'" 1 
ATOM   8    C  "C3'" . DG  A 1 12  ? 70.028 46.808  14.505  1.00 74.86 ? 12   DG  P "C3'" 1 
ATOM   9    O  "O3'" . DG  A 1 12  ? 70.121 45.741  15.463  1.00 75.94 ? 12   DG  P "O3'" 1 
ATOM   10   C  "C2'" . DG  A 1 12  ? 68.687 47.515  14.594  1.00 73.29 ? 12   DG  P "C2'" 1 
ATOM   11   C  "C1'" . DG  A 1 12  ? 68.919 48.512  15.716  1.00 72.87 ? 12   DG  P "C1'" 1 
ATOM   12   N  N9    . DG  A 1 12  ? 68.117 49.730  15.618  1.00 71.33 ? 12   DG  P N9    1 
ATOM   13   C  C8    . DG  A 1 12  ? 68.033 50.586  14.544  1.00 70.54 ? 12   DG  P C8    1 
ATOM   14   N  N7    . DG  A 1 12  ? 67.238 51.600  14.757  1.00 70.29 ? 12   DG  P N7    1 
ATOM   15   C  C5    . DG  A 1 12  ? 66.767 51.404  16.049  1.00 69.51 ? 12   DG  P C5    1 
ATOM   16   C  C6    . DG  A 1 12  ? 65.872 52.182  16.828  1.00 68.70 ? 12   DG  P C6    1 
ATOM   17   O  O6    . DG  A 1 12  ? 65.301 53.235  16.523  1.00 68.25 ? 12   DG  P O6    1 
ATOM   18   N  N1    . DG  A 1 12  ? 65.664 51.619  18.082  1.00 67.79 ? 12   DG  P N1    1 
ATOM   19   C  C2    . DG  A 1 12  ? 66.243 50.459  18.535  1.00 68.18 ? 12   DG  P C2    1 
ATOM   20   N  N2    . DG  A 1 12  ? 65.919 50.082  19.783  1.00 67.28 ? 12   DG  P N2    1 
ATOM   21   N  N3    . DG  A 1 12  ? 67.080 49.723  17.819  1.00 68.91 ? 12   DG  P N3    1 
ATOM   22   C  C4    . DG  A 1 12  ? 67.297 50.252  16.594  1.00 70.06 ? 12   DG  P C4    1 
ATOM   23   P  P     . DC  A 1 13  ? 69.084 44.506  15.406  1.00 77.70 ? 13   DC  P P     1 
ATOM   24   O  OP1   . DC  A 1 13  ? 69.826 43.247  15.697  1.00 76.41 ? 13   DC  P OP1   1 
ATOM   25   O  OP2   . DC  A 1 13  ? 68.287 44.614  14.150  1.00 76.59 ? 13   DC  P OP2   1 
ATOM   26   O  "O5'" . DC  A 1 13  ? 68.106 44.789  16.632  1.00 74.34 ? 13   DC  P "O5'" 1 
ATOM   27   C  "C5'" . DC  A 1 13  ? 68.592 44.763  17.973  1.00 71.39 ? 13   DC  P "C5'" 1 
ATOM   28   C  "C4'" . DC  A 1 13  ? 67.437 44.736  18.947  1.00 70.02 ? 13   DC  P "C4'" 1 
ATOM   29   O  "O4'" . DC  A 1 13  ? 66.745 46.010  18.918  1.00 69.48 ? 13   DC  P "O4'" 1 
ATOM   30   C  "C3'" . DC  A 1 13  ? 66.384 43.666  18.653  1.00 69.59 ? 13   DC  P "C3'" 1 
ATOM   31   O  "O3'" . DC  A 1 13  ? 65.951 43.037  19.866  1.00 68.69 ? 13   DC  P "O3'" 1 
ATOM   32   C  "C2'" . DC  A 1 13  ? 65.255 44.441  17.994  1.00 68.78 ? 13   DC  P "C2'" 1 
ATOM   33   C  "C1'" . DC  A 1 13  ? 65.367 45.822  18.625  1.00 68.02 ? 13   DC  P "C1'" 1 
ATOM   34   N  N1    . DC  A 1 13  ? 64.931 46.929  17.745  1.00 67.19 ? 13   DC  P N1    1 
ATOM   35   C  C2    . DC  A 1 13  ? 63.999 47.868  18.231  1.00 66.28 ? 13   DC  P C2    1 
ATOM   36   O  O2    . DC  A 1 13  ? 63.587 47.770  19.400  1.00 66.12 ? 13   DC  P O2    1 
ATOM   37   N  N3    . DC  A 1 13  ? 63.577 48.860  17.411  1.00 65.82 ? 13   DC  P N3    1 
ATOM   38   C  C4    . DC  A 1 13  ? 64.047 48.945  16.164  1.00 65.40 ? 13   DC  P C4    1 
ATOM   39   N  N4    . DC  A 1 13  ? 63.592 49.932  15.389  1.00 65.05 ? 13   DC  P N4    1 
ATOM   40   C  C5    . DC  A 1 13  ? 65.003 48.019  15.653  1.00 65.62 ? 13   DC  P C5    1 
ATOM   41   C  C6    . DC  A 1 13  ? 65.414 47.039  16.468  1.00 66.45 ? 13   DC  P C6    1 
ATOM   42   P  P     . DC  A 1 14  ? 64.811 41.903  19.816  1.00 68.42 ? 14   DC  P P     1 
ATOM   43   O  OP1   . DC  A 1 14  ? 64.926 41.060  21.038  1.00 69.02 ? 14   DC  P OP1   1 
ATOM   44   O  OP2   . DC  A 1 14  ? 64.841 41.260  18.473  1.00 67.68 ? 14   DC  P OP2   1 
ATOM   45   O  "O5'" . DC  A 1 14  ? 63.468 42.747  19.937  1.00 67.39 ? 14   DC  P "O5'" 1 
ATOM   46   C  "C5'" . DC  A 1 14  ? 63.194 43.502  21.117  1.00 64.26 ? 14   DC  P "C5'" 1 
ATOM   47   C  "C4'" . DC  A 1 14  ? 61.757 43.965  21.120  1.00 61.64 ? 14   DC  P "C4'" 1 
ATOM   48   O  "O4'" . DC  A 1 14  ? 61.585 45.125  20.266  1.00 60.91 ? 14   DC  P "O4'" 1 
ATOM   49   C  "C3'" . DC  A 1 14  ? 60.764 42.915  20.627  1.00 60.46 ? 14   DC  P "C3'" 1 
ATOM   50   O  "O3'" . DC  A 1 14  ? 59.608 42.914  21.454  1.00 58.82 ? 14   DC  P "O3'" 1 
ATOM   51   C  "C2'" . DC  A 1 14  ? 60.402 43.395  19.233  1.00 59.45 ? 14   DC  P "C2'" 1 
ATOM   52   C  "C1'" . DC  A 1 14  ? 60.494 44.904  19.389  1.00 60.10 ? 14   DC  P "C1'" 1 
ATOM   53   N  N1    . DC  A 1 14  ? 60.735 45.669  18.146  1.00 59.76 ? 14   DC  P N1    1 
ATOM   54   C  C2    . DC  A 1 14  ? 60.082 46.905  17.974  1.00 58.95 ? 14   DC  P C2    1 
ATOM   55   O  O2    . DC  A 1 14  ? 59.349 47.337  18.883  1.00 58.24 ? 14   DC  P O2    1 
ATOM   56   N  N3    . DC  A 1 14  ? 60.270 47.596  16.825  1.00 58.93 ? 14   DC  P N3    1 
ATOM   57   C  C4    . DC  A 1 14  ? 61.075 47.110  15.877  1.00 58.90 ? 14   DC  P C4    1 
ATOM   58   N  N4    . DC  A 1 14  ? 61.225 47.823  14.757  1.00 56.91 ? 14   DC  P N4    1 
ATOM   59   C  C5    . DC  A 1 14  ? 61.763 45.869  16.032  1.00 58.37 ? 14   DC  P C5    1 
ATOM   60   C  C6    . DC  A 1 14  ? 61.566 45.189  17.168  1.00 58.61 ? 14   DC  P C6    1 
ATOM   61   P  P     . DA  A 1 15  ? 58.584 41.683  21.381  1.00 59.63 ? 15   DA  P P     1 
ATOM   62   O  OP1   . DA  A 1 15  ? 58.856 40.777  22.529  1.00 59.16 ? 15   DA  P OP1   1 
ATOM   63   O  OP2   . DA  A 1 15  ? 58.609 41.143  19.994  1.00 58.67 ? 15   DA  P OP2   1 
ATOM   64   O  "O5'" . DA  A 1 15  ? 57.177 42.381  21.618  1.00 56.66 ? 15   DA  P "O5'" 1 
ATOM   65   C  "C5'" . DA  A 1 15  ? 57.034 43.391  22.610  1.00 53.81 ? 15   DA  P "C5'" 1 
ATOM   66   C  "C4'" . DA  A 1 15  ? 55.950 44.364  22.214  1.00 51.60 ? 15   DA  P "C4'" 1 
ATOM   67   O  "O4'" . DA  A 1 15  ? 56.384 45.161  21.084  1.00 50.41 ? 15   DA  P "O4'" 1 
ATOM   68   C  "C3'" . DA  A 1 15  ? 54.632 43.709  21.800  1.00 51.23 ? 15   DA  P "C3'" 1 
ATOM   69   O  "O3'" . DA  A 1 15  ? 53.544 44.407  22.414  1.00 51.40 ? 15   DA  P "O3'" 1 
ATOM   70   C  "C2'" . DA  A 1 15  ? 54.627 43.832  20.283  1.00 49.43 ? 15   DA  P "C2'" 1 
ATOM   71   C  "C1'" . DA  A 1 15  ? 55.421 45.107  20.042  1.00 48.78 ? 15   DA  P "C1'" 1 
ATOM   72   N  N9    . DA  A 1 15  ? 56.137 45.180  18.763  1.00 47.13 ? 15   DA  P N9    1 
ATOM   73   C  C8    . DA  A 1 15  ? 57.087 44.313  18.273  1.00 45.78 ? 15   DA  P C8    1 
ATOM   74   N  N7    . DA  A 1 15  ? 57.577 44.666  17.107  1.00 44.30 ? 15   DA  P N7    1 
ATOM   75   C  C5    . DA  A 1 15  ? 56.901 45.839  16.801  1.00 44.41 ? 15   DA  P C5    1 
ATOM   76   C  C6    . DA  A 1 15  ? 56.974 46.719  15.698  1.00 43.11 ? 15   DA  P C6    1 
ATOM   77   N  N6    . DA  A 1 15  ? 57.797 46.544  14.661  1.00 41.63 ? 15   DA  P N6    1 
ATOM   78   N  N1    . DA  A 1 15  ? 56.165 47.800  15.702  1.00 42.21 ? 15   DA  P N1    1 
ATOM   79   C  C2    . DA  A 1 15  ? 55.343 47.981  16.744  1.00 43.21 ? 15   DA  P C2    1 
ATOM   80   N  N3    . DA  A 1 15  ? 55.184 47.232  17.837  1.00 45.47 ? 15   DA  P N3    1 
ATOM   81   C  C4    . DA  A 1 15  ? 56.003 46.164  17.806  1.00 45.74 ? 15   DA  P C4    1 
ATOM   82   P  P     . DG  A 1 16  ? 52.039 43.867  22.239  1.00 52.69 ? 16   DG  P P     1 
ATOM   83   O  OP1   . DG  A 1 16  ? 51.254 44.279  23.431  1.00 51.76 ? 16   DG  P OP1   1 
ATOM   84   O  OP2   . DG  A 1 16  ? 52.071 42.431  21.840  1.00 52.15 ? 16   DG  P OP2   1 
ATOM   85   O  "O5'" . DG  A 1 16  ? 51.514 44.711  20.999  1.00 51.50 ? 16   DG  P "O5'" 1 
ATOM   86   C  "C5'" . DG  A 1 16  ? 51.543 46.137  21.036  1.00 48.42 ? 16   DG  P "C5'" 1 
ATOM   87   C  "C4'" . DG  A 1 16  ? 50.962 46.703  19.762  1.00 46.29 ? 16   DG  P "C4'" 1 
ATOM   88   O  "O4'" . DG  A 1 16  ? 51.924 46.656  18.678  1.00 43.28 ? 16   DG  P "O4'" 1 
ATOM   89   C  "C3'" . DG  A 1 16  ? 49.713 45.977  19.265  1.00 45.11 ? 16   DG  P "C3'" 1 
ATOM   90   O  "O3'" . DG  A 1 16  ? 48.738 46.946  18.874  1.00 45.17 ? 16   DG  P "O3'" 1 
ATOM   91   C  "C2'" . DG  A 1 16  ? 50.230 45.171  18.081  1.00 44.31 ? 16   DG  P "C2'" 1 
ATOM   92   C  "C1'" . DG  A 1 16  ? 51.314 46.085  17.535  1.00 42.84 ? 16   DG  P "C1'" 1 
ATOM   93   N  N9    . DG  A 1 16  ? 52.359 45.457  16.726  1.00 41.42 ? 16   DG  P N9    1 
ATOM   94   C  C8    . DG  A 1 16  ? 53.039 44.291  16.995  1.00 41.57 ? 16   DG  P C8    1 
ATOM   95   N  N7    . DG  A 1 16  ? 53.924 43.988  16.082  1.00 40.66 ? 16   DG  P N7    1 
ATOM   96   C  C5    . DG  A 1 16  ? 53.824 45.011  15.148  1.00 40.14 ? 16   DG  P C5    1 
ATOM   97   C  C6    . DG  A 1 16  ? 54.530 45.222  13.927  1.00 38.57 ? 16   DG  P C6    1 
ATOM   98   O  O6    . DG  A 1 16  ? 55.397 44.518  13.404  1.00 38.89 ? 16   DG  P O6    1 
ATOM   99   N  N1    . DG  A 1 16  ? 54.126 46.392  13.299  1.00 38.87 ? 16   DG  P N1    1 
ATOM   100  C  C2    . DG  A 1 16  ? 53.161 47.248  13.767  1.00 38.22 ? 16   DG  P C2    1 
ATOM   101  N  N2    . DG  A 1 16  ? 52.923 48.330  13.009  1.00 37.59 ? 16   DG  P N2    1 
ATOM   102  N  N3    . DG  A 1 16  ? 52.483 47.060  14.891  1.00 38.04 ? 16   DG  P N3    1 
ATOM   103  C  C4    . DG  A 1 16  ? 52.865 45.930  15.529  1.00 40.33 ? 16   DG  P C4    1 
ATOM   104  P  P     . DT  A 1 17  ? 47.175 46.553  18.844  1.00 47.05 ? 17   DT  P P     1 
ATOM   105  O  OP1   . DT  A 1 17  ? 46.405 47.711  19.371  1.00 46.72 ? 17   DT  P OP1   1 
ATOM   106  O  OP2   . DT  A 1 17  ? 46.993 45.207  19.442  1.00 48.06 ? 17   DT  P OP2   1 
ATOM   107  O  "O5'" . DT  A 1 17  ? 46.868 46.419  17.294  1.00 45.59 ? 17   DT  P "O5'" 1 
ATOM   108  C  "C5'" . DT  A 1 17  ? 47.928 46.138  16.400  1.00 43.06 ? 17   DT  P "C5'" 1 
ATOM   109  C  "C4'" . DT  A 1 17  ? 47.699 46.826  15.081  1.00 39.14 ? 17   DT  P "C4'" 1 
ATOM   110  O  "O4'" . DT  A 1 17  ? 48.897 46.667  14.293  1.00 38.72 ? 17   DT  P "O4'" 1 
ATOM   111  C  "C3'" . DT  A 1 17  ? 46.572 46.186  14.280  1.00 38.03 ? 17   DT  P "C3'" 1 
ATOM   112  O  "O3'" . DT  A 1 17  ? 45.895 47.185  13.519  1.00 34.04 ? 17   DT  P "O3'" 1 
ATOM   113  C  "C2'" . DT  A 1 17  ? 47.291 45.166  13.415  1.00 37.13 ? 17   DT  P "C2'" 1 
ATOM   114  C  "C1'" . DT  A 1 17  ? 48.667 45.793  13.200  1.00 38.21 ? 17   DT  P "C1'" 1 
ATOM   115  N  N1    . DT  A 1 17  ? 49.792 44.832  13.154  1.00 37.55 ? 17   DT  P N1    1 
ATOM   116  C  C2    . DT  A 1 17  ? 50.735 44.984  12.161  1.00 37.19 ? 17   DT  P C2    1 
ATOM   117  O  O2    . DT  A 1 17  ? 50.705 45.889  11.347  1.00 36.65 ? 17   DT  P O2    1 
ATOM   118  N  N3    . DT  A 1 17  ? 51.726 44.033  12.162  1.00 38.10 ? 17   DT  P N3    1 
ATOM   119  C  C4    . DT  A 1 17  ? 51.872 42.974  13.043  1.00 37.86 ? 17   DT  P C4    1 
ATOM   120  O  O4    . DT  A 1 17  ? 52.817 42.193  12.914  1.00 37.82 ? 17   DT  P O4    1 
ATOM   121  C  C5    . DT  A 1 17  ? 50.855 42.886  14.072  1.00 37.40 ? 17   DT  P C5    1 
ATOM   122  C  C7    . DT  A 1 17  ? 50.925 41.779  15.079  1.00 35.39 ? 17   DT  P C7    1 
ATOM   123  C  C6    . DT  A 1 17  ? 49.884 43.807  14.074  1.00 36.05 ? 17   DT  P C6    1 
ATOM   124  P  P     . DG  A 1 18  ? 44.506 46.831  12.801  1.00 36.68 ? 18   DG  P P     1 
ATOM   125  O  OP1   . DG  A 1 18  ? 43.755 48.102  12.618  1.00 36.32 ? 18   DG  P OP1   1 
ATOM   126  O  OP2   . DG  A 1 18  ? 43.873 45.700  13.524  1.00 34.56 ? 18   DG  P OP2   1 
ATOM   127  O  "O5'" . DG  A 1 18  ? 44.964 46.308  11.371  1.00 36.73 ? 18   DG  P "O5'" 1 
ATOM   128  C  "C5'" . DG  A 1 18  ? 45.787 47.127  10.550  1.00 36.38 ? 18   DG  P "C5'" 1 
ATOM   129  C  "C4'" . DG  A 1 18  ? 46.301 46.345  9.366   1.00 37.57 ? 18   DG  P "C4'" 1 
ATOM   130  O  "O4'" . DG  A 1 18  ? 47.486 45.578  9.699   1.00 36.56 ? 18   DG  P "O4'" 1 
ATOM   131  C  "C3'" . DG  A 1 18  ? 45.308 45.366  8.733   1.00 37.09 ? 18   DG  P "C3'" 1 
ATOM   132  O  "O3'" . DG  A 1 18  ? 45.300 45.580  7.328   1.00 37.17 ? 18   DG  P "O3'" 1 
ATOM   133  C  "C2'" . DG  A 1 18  ? 45.910 44.005  9.037   1.00 36.08 ? 18   DG  P "C2'" 1 
ATOM   134  C  "C1'" . DG  A 1 18  ? 47.393 44.326  9.052   1.00 36.49 ? 18   DG  P "C1'" 1 
ATOM   135  N  N9    . DG  A 1 18  ? 48.243 43.368  9.756   1.00 35.05 ? 18   DG  P N9    1 
ATOM   136  C  C8    . DG  A 1 18  ? 47.970 42.708  10.932  1.00 34.12 ? 18   DG  P C8    1 
ATOM   137  N  N7    . DG  A 1 18  ? 48.901 41.858  11.272  1.00 32.92 ? 18   DG  P N7    1 
ATOM   138  C  C5    . DG  A 1 18  ? 49.853 41.972  10.267  1.00 34.02 ? 18   DG  P C5    1 
ATOM   139  C  C6    . DG  A 1 18  ? 51.081 41.281  10.081  1.00 33.70 ? 18   DG  P C6    1 
ATOM   140  O  O6    . DG  A 1 18  ? 51.577 40.387  10.782  1.00 33.18 ? 18   DG  P O6    1 
ATOM   141  N  N1    . DG  A 1 18  ? 51.746 41.715  8.937   1.00 30.72 ? 18   DG  P N1    1 
ATOM   142  C  C2    . DG  A 1 18  ? 51.287 42.681  8.075   1.00 32.43 ? 18   DG  P C2    1 
ATOM   143  N  N2    . DG  A 1 18  ? 52.081 42.965  7.031   1.00 30.49 ? 18   DG  P N2    1 
ATOM   144  N  N3    . DG  A 1 18  ? 50.134 43.322  8.227   1.00 33.16 ? 18   DG  P N3    1 
ATOM   145  C  C4    . DG  A 1 18  ? 49.474 42.919  9.337   1.00 34.26 ? 18   DG  P C4    1 
ATOM   146  P  P     . DC  A 1 19  ? 44.182 44.887  6.410   1.00 35.84 ? 19   DC  P P     1 
ATOM   147  O  OP1   . DC  A 1 19  ? 43.275 45.958  5.937   1.00 36.86 ? 19   DC  P OP1   1 
ATOM   148  O  OP2   . DC  A 1 19  ? 43.615 43.701  7.095   1.00 37.14 ? 19   DC  P OP2   1 
ATOM   149  O  "O5'" . DC  A 1 19  ? 45.057 44.388  5.179   1.00 34.85 ? 19   DC  P "O5'" 1 
ATOM   150  C  "C5'" . DC  A 1 19  ? 46.048 45.246  4.614   1.00 31.50 ? 19   DC  P "C5'" 1 
ATOM   151  C  "C4'" . DC  A 1 19  ? 47.010 44.458  3.760   1.00 30.99 ? 19   DC  P "C4'" 1 
ATOM   152  O  "O4'" . DC  A 1 19  ? 47.949 43.723  4.583   1.00 30.59 ? 19   DC  P "O4'" 1 
ATOM   153  C  "C3'" . DC  A 1 19  ? 46.343 43.434  2.843   1.00 32.42 ? 19   DC  P "C3'" 1 
ATOM   154  O  "O3'" . DC  A 1 19  ? 46.953 43.478  1.554   1.00 33.02 ? 19   DC  P "O3'" 1 
ATOM   155  C  "C2'" . DC  A 1 19  ? 46.616 42.107  3.533   1.00 30.75 ? 19   DC  P "C2'" 1 
ATOM   156  C  "C1'" . DC  A 1 19  ? 47.968 42.360  4.184   1.00 30.27 ? 19   DC  P "C1'" 1 
ATOM   157  N  N1    . DC  A 1 19  ? 48.284 41.528  5.369   1.00 29.95 ? 19   DC  P N1    1 
ATOM   158  C  C2    . DC  A 1 19  ? 49.550 40.912  5.448   1.00 28.38 ? 19   DC  P C2    1 
ATOM   159  O  O2    . DC  A 1 19  ? 50.373 41.104  4.542   1.00 29.33 ? 19   DC  P O2    1 
ATOM   160  N  N3    . DC  A 1 19  ? 49.840 40.127  6.512   1.00 27.28 ? 19   DC  P N3    1 
ATOM   161  C  C4    . DC  A 1 19  ? 48.936 39.951  7.478   1.00 28.61 ? 19   DC  P C4    1 
ATOM   162  N  N4    . DC  A 1 19  ? 49.263 39.158  8.504   1.00 26.70 ? 19   DC  P N4    1 
ATOM   163  C  C5    . DC  A 1 19  ? 47.651 40.578  7.435   1.00 29.08 ? 19   DC  P C5    1 
ATOM   164  C  C6    . DC  A 1 19  ? 47.370 41.346  6.372   1.00 29.61 ? 19   DC  P C6    1 
ATOM   165  P  P     . DC  A 1 20  ? 46.330 42.625  0.348   1.00 37.50 ? 20   DC  P P     1 
ATOM   166  O  OP1   . DC  A 1 20  ? 46.320 43.503  -0.856  1.00 37.13 ? 20   DC  P OP1   1 
ATOM   167  O  OP2   . DC  A 1 20  ? 45.068 41.968  0.798   1.00 33.30 ? 20   DC  P OP2   1 
ATOM   168  O  "O5'" . DC  A 1 20  ? 47.415 41.484  0.113   1.00 34.19 ? 20   DC  P "O5'" 1 
ATOM   169  C  "C5'" . DC  A 1 20  ? 48.671 41.785  -0.496  1.00 32.37 ? 20   DC  P "C5'" 1 
ATOM   170  C  "C4'" . DC  A 1 20  ? 49.421 40.509  -0.791  1.00 30.64 ? 20   DC  P "C4'" 1 
ATOM   171  O  "O4'" . DC  A 1 20  ? 50.117 40.128  0.426   1.00 32.46 ? 20   DC  P "O4'" 1 
ATOM   172  C  "C3'" . DC  A 1 20  ? 48.462 39.362  -1.107  1.00 30.45 ? 20   DC  P "C3'" 1 
ATOM   173  O  "O3'" . DC  A 1 20  ? 48.464 38.828  -2.408  1.00 29.21 ? 20   DC  P "O3'" 1 
ATOM   174  C  "C2'" . DC  A 1 20  ? 48.845 38.235  -0.178  1.00 31.45 ? 20   DC  P "C2'" 1 
ATOM   175  C  "C1'" . DC  A 1 20  ? 50.000 38.728  0.653   1.00 30.25 ? 20   DC  P "C1'" 1 
ATOM   176  N  N1    . DC  A 1 20  ? 49.569 38.495  2.040   1.00 27.88 ? 20   DC  P N1    1 
ATOM   177  C  C2    . DC  A 1 20  ? 50.153 37.443  2.757   1.00 25.92 ? 20   DC  P C2    1 
ATOM   178  O  O2    . DC  A 1 20  ? 51.126 36.858  2.274   1.00 26.50 ? 20   DC  P O2    1 
ATOM   179  N  N3    . DC  A 1 20  ? 49.636 37.096  3.953   1.00 24.40 ? 20   DC  P N3    1 
ATOM   180  C  C4    . DC  A 1 20  ? 48.591 37.763  4.447   1.00 25.63 ? 20   DC  P C4    1 
ATOM   181  N  N4    . DC  A 1 20  ? 48.066 37.340  5.598   1.00 26.24 ? 20   DC  P N4    1 
ATOM   182  C  C5    . DC  A 1 20  ? 48.028 38.885  3.776   1.00 26.39 ? 20   DC  P C5    1 
ATOM   183  C  C6    . DC  A 1 20  ? 48.553 39.225  2.594   1.00 25.82 ? 20   DC  P C6    1 
ATOM   184  P  P     . DA  A 1 21  ? 47.271 37.825  -2.809  1.00 27.33 ? 21   DA  P P     1 
ATOM   185  O  OP1   . DA  A 1 21  ? 46.963 38.014  -4.247  1.00 31.90 ? 21   DA  P OP1   1 
ATOM   186  O  OP2   . DA  A 1 21  ? 46.192 38.001  -1.808  1.00 26.43 ? 21   DA  P OP2   1 
ATOM   187  O  "O5'" . DA  A 1 21  ? 47.900 36.377  -2.560  1.00 27.65 ? 21   DA  P "O5'" 1 
ATOM   188  C  "C5'" . DA  A 1 21  ? 49.192 36.037  -3.072  1.00 24.30 ? 21   DA  P "C5'" 1 
ATOM   189  C  "C4'" . DA  A 1 21  ? 49.687 34.739  -2.468  1.00 23.57 ? 21   DA  P "C4'" 1 
ATOM   190  O  "O4'" . DA  A 1 21  ? 50.001 34.913  -1.062  1.00 24.47 ? 21   DA  P "O4'" 1 
ATOM   191  C  "C3'" . DA  A 1 21  ? 48.724 33.564  -2.509  1.00 23.13 ? 21   DA  P "C3'" 1 
ATOM   192  O  "O3'" . DA  A 1 21  ? 48.834 32.936  -3.783  1.00 24.44 ? 21   DA  P "O3'" 1 
ATOM   193  C  "C2'" . DA  A 1 21  ? 49.247 32.665  -1.388  1.00 21.99 ? 21   DA  P "C2'" 1 
ATOM   194  C  "C1'" . DA  A 1 21  ? 49.807 33.683  -0.386  1.00 22.02 ? 21   DA  P "C1'" 1 
ATOM   195  N  N9    . DA  A 1 21  ? 48.966 33.920  0.790   1.00 22.49 ? 21   DA  P N9    1 
ATOM   196  C  C8    . DA  A 1 21  ? 48.068 34.941  1.005   1.00 23.45 ? 21   DA  P C8    1 
ATOM   197  N  N7    . DA  A 1 21  ? 47.493 34.901  2.181   1.00 20.99 ? 21   DA  P N7    1 
ATOM   198  C  C5    . DA  A 1 21  ? 48.038 33.778  2.779   1.00 21.61 ? 21   DA  P C5    1 
ATOM   199  C  C6    . DA  A 1 21  ? 47.839 33.189  4.037   1.00 22.70 ? 21   DA  P C6    1 
ATOM   200  N  N6    . DA  A 1 21  ? 47.014 33.679  4.962   1.00 22.26 ? 21   DA  P N6    1 
ATOM   201  N  N1    . DA  A 1 21  ? 48.531 32.064  4.319   1.00 21.59 ? 21   DA  P N1    1 
ATOM   202  C  C2    . DA  A 1 21  ? 49.363 31.579  3.397   1.00 21.07 ? 21   DA  P C2    1 
ATOM   203  N  N3    . DA  A 1 21  ? 49.638 32.041  2.182   1.00 21.60 ? 21   DA  P N3    1 
ATOM   204  C  C4    . DA  A 1 21  ? 48.937 33.157  1.931   1.00 22.16 ? 21   DA  P C4    1 
HETATM 205  P  P     . 2DA A 1 22  ? 47.681 31.937  -4.296  1.00 24.22 ? 22   2DA P P     1 
HETATM 206  O  OP1   . 2DA A 1 22  ? 48.025 31.553  -5.689  1.00 26.72 ? 22   2DA P OP1   1 
HETATM 207  O  OP2   . 2DA A 1 22  ? 46.368 32.560  -4.011  1.00 26.94 ? 22   2DA P OP2   1 
HETATM 208  O  "O5'" . 2DA A 1 22  ? 47.838 30.648  -3.367  1.00 23.88 ? 22   2DA P "O5'" 1 
HETATM 209  C  "C5'" . 2DA A 1 22  ? 48.968 29.786  -3.495  1.00 22.27 ? 22   2DA P "C5'" 1 
HETATM 210  C  "C4'" . 2DA A 1 22  ? 48.919 28.681  -2.455  1.00 24.23 ? 22   2DA P "C4'" 1 
HETATM 211  O  "O4'" . 2DA A 1 22  ? 49.121 29.236  -1.127  1.00 25.63 ? 22   2DA P "O4'" 1 
HETATM 212  C  "C3'" . 2DA A 1 22  ? 47.616 27.900  -2.356  1.00 24.28 ? 22   2DA P "C3'" 1 
HETATM 213  C  "C2'" . 2DA A 1 22  ? 47.664 27.362  -0.928  1.00 23.81 ? 22   2DA P "C2'" 1 
HETATM 214  C  "C1'" . 2DA A 1 22  ? 48.358 28.505  -0.183  1.00 23.67 ? 22   2DA P "C1'" 1 
HETATM 215  N  N9    . 2DA A 1 22  ? 47.427 29.426  0.467   1.00 24.60 ? 22   2DA P N9    1 
HETATM 216  C  C8    . 2DA A 1 22  ? 46.816 30.530  -0.070  1.00 24.57 ? 22   2DA P C8    1 
HETATM 217  N  N7    . 2DA A 1 22  ? 46.019 31.153  0.766   1.00 25.41 ? 22   2DA P N7    1 
HETATM 218  C  C5    . 2DA A 1 22  ? 46.109 30.408  1.932   1.00 27.95 ? 22   2DA P C5    1 
HETATM 219  C  C6    . 2DA A 1 22  ? 45.493 30.540  3.194   1.00 28.30 ? 22   2DA P C6    1 
HETATM 220  N  N6    . 2DA A 1 22  ? 44.616 31.499  3.494   1.00 29.37 ? 22   2DA P N6    1 
HETATM 221  N  N1    . 2DA A 1 22  ? 45.808 29.634  4.145   1.00 29.25 ? 22   2DA P N1    1 
HETATM 222  C  C2    . 2DA A 1 22  ? 46.673 28.658  3.838   1.00 29.15 ? 22   2DA P C2    1 
HETATM 223  N  N3    . 2DA A 1 22  ? 47.310 28.423  2.688   1.00 28.72 ? 22   2DA P N3    1 
HETATM 224  C  C4    . 2DA A 1 22  ? 46.980 29.345  1.766   1.00 26.31 ? 22   2DA P C4    1 
ATOM   225  P  P     . DC  B 2 3   ? 32.379 30.129  16.912  1.00 59.97 ? 3    DC  T P     1 
ATOM   226  O  OP1   . DC  B 2 3   ? 31.883 31.437  17.519  1.00 59.56 ? 3    DC  T OP1   1 
ATOM   227  O  OP2   . DC  B 2 3   ? 32.476 28.980  17.914  1.00 58.89 ? 3    DC  T OP2   1 
ATOM   228  O  "O5'" . DC  B 2 3   ? 33.909 30.430  16.443  1.00 58.62 ? 3    DC  T "O5'" 1 
ATOM   229  C  "C5'" . DC  B 2 3   ? 35.005 30.203  17.343  1.00 55.45 ? 3    DC  T "C5'" 1 
ATOM   230  C  "C4'" . DC  B 2 3   ? 36.090 31.227  17.112  1.00 52.79 ? 3    DC  T "C4'" 1 
ATOM   231  O  "O4'" . DC  B 2 3   ? 37.079 31.101  18.153  1.00 52.96 ? 3    DC  T "O4'" 1 
ATOM   232  C  "C3'" . DC  B 2 3   ? 36.848 31.071  15.799  1.00 50.65 ? 3    DC  T "C3'" 1 
ATOM   233  O  "O3'" . DC  B 2 3   ? 37.289 32.361  15.356  1.00 48.13 ? 3    DC  T "O3'" 1 
ATOM   234  C  "C2'" . DC  B 2 3   ? 38.006 30.162  16.177  1.00 51.04 ? 3    DC  T "C2'" 1 
ATOM   235  C  "C1'" . DC  B 2 3   ? 38.264 30.500  17.648  1.00 53.68 ? 3    DC  T "C1'" 1 
ATOM   236  N  N1    . DC  B 2 3   ? 38.561 29.345  18.518  1.00 54.22 ? 3    DC  T N1    1 
ATOM   237  C  C2    . DC  B 2 3   ? 39.767 29.325  19.243  1.00 54.97 ? 3    DC  T C2    1 
ATOM   238  O  O2    . DC  B 2 3   ? 40.580 30.259  19.098  1.00 55.27 ? 3    DC  T O2    1 
ATOM   239  N  N3    . DC  B 2 3   ? 40.016 28.289  20.080  1.00 54.73 ? 3    DC  T N3    1 
ATOM   240  C  C4    . DC  B 2 3   ? 39.128 27.296  20.199  1.00 55.96 ? 3    DC  T C4    1 
ATOM   241  N  N4    . DC  B 2 3   ? 39.416 26.296  21.039  1.00 57.34 ? 3    DC  T N4    1 
ATOM   242  C  C5    . DC  B 2 3   ? 37.905 27.282  19.461  1.00 55.59 ? 3    DC  T C5    1 
ATOM   243  C  C6    . DC  B 2 3   ? 37.667 28.313  18.639  1.00 54.89 ? 3    DC  T C6    1 
ATOM   244  P  P     . DT  B 2 4   ? 37.182 32.753  13.800  1.00 43.99 ? 4    DT  T P     1 
ATOM   245  O  OP1   . DT  B 2 4   ? 37.414 34.214  13.699  1.00 43.95 ? 4    DT  T OP1   1 
ATOM   246  O  OP2   . DT  B 2 4   ? 35.927 32.175  13.266  1.00 44.73 ? 4    DT  T OP2   1 
ATOM   247  O  "O5'" . DT  B 2 4   ? 38.431 31.995  13.158  1.00 44.14 ? 4    DT  T "O5'" 1 
ATOM   248  C  "C5'" . DT  B 2 4   ? 38.430 31.591  11.801  1.00 38.06 ? 4    DT  T "C5'" 1 
ATOM   249  C  "C4'" . DT  B 2 4   ? 39.070 30.226  11.649  1.00 37.39 ? 4    DT  T "C4'" 1 
ATOM   250  O  "O4'" . DT  B 2 4   ? 38.680 29.717  10.350  1.00 36.15 ? 4    DT  T "O4'" 1 
ATOM   251  C  "C3'" . DT  B 2 4   ? 40.602 30.141  11.706  1.00 36.40 ? 4    DT  T "C3'" 1 
ATOM   252  O  "O3'" . DT  B 2 4   ? 41.064 29.852  13.039  1.00 33.66 ? 4    DT  T "O3'" 1 
ATOM   253  C  "C2'" . DT  B 2 4   ? 40.902 28.974  10.765  1.00 36.29 ? 4    DT  T "C2'" 1 
ATOM   254  C  "C1'" . DT  B 2 4   ? 39.783 29.101  9.725   1.00 35.69 ? 4    DT  T "C1'" 1 
ATOM   255  N  N1    . DT  B 2 4   ? 40.111 29.883  8.508   1.00 35.28 ? 4    DT  T N1    1 
ATOM   256  C  C2    . DT  B 2 4   ? 40.794 29.252  7.493   1.00 34.03 ? 4    DT  T C2    1 
ATOM   257  O  O2    . DT  B 2 4   ? 41.172 28.095  7.562   1.00 34.12 ? 4    DT  T O2    1 
ATOM   258  N  N3    . DT  B 2 4   ? 41.022 30.029  6.387   1.00 34.04 ? 4    DT  T N3    1 
ATOM   259  C  C4    . DT  B 2 4   ? 40.654 31.346  6.195   1.00 34.72 ? 4    DT  T C4    1 
ATOM   260  O  O4    . DT  B 2 4   ? 40.916 31.905  5.127   1.00 33.55 ? 4    DT  T O4    1 
ATOM   261  C  C5    . DT  B 2 4   ? 39.960 31.959  7.312   1.00 34.52 ? 4    DT  T C5    1 
ATOM   262  C  C7    . DT  B 2 4   ? 39.538 33.392  7.211   1.00 33.78 ? 4    DT  T C7    1 
ATOM   263  C  C6    . DT  B 2 4   ? 39.726 31.207  8.394   1.00 33.92 ? 4    DT  T C6    1 
ATOM   264  P  P     . DT  B 2 5   ? 42.615 30.098  13.446  1.00 32.36 ? 5    DT  T P     1 
ATOM   265  O  OP1   . DT  B 2 5   ? 42.784 29.699  14.869  1.00 32.26 ? 5    DT  T OP1   1 
ATOM   266  O  OP2   . DT  B 2 5   ? 43.016 31.466  13.025  1.00 31.02 ? 5    DT  T OP2   1 
ATOM   267  O  "O5'" . DT  B 2 5   ? 43.435 29.074  12.535  1.00 31.66 ? 5    DT  T "O5'" 1 
ATOM   268  C  "C5'" . DT  B 2 5   ? 43.517 27.681  12.852  1.00 29.24 ? 5    DT  T "C5'" 1 
ATOM   269  C  "C4'" . DT  B 2 5   ? 44.351 26.961  11.814  1.00 28.20 ? 5    DT  T "C4'" 1 
ATOM   270  O  "O4'" . DT  B 2 5   ? 43.729 27.154  10.516  1.00 26.72 ? 5    DT  T "O4'" 1 
ATOM   271  C  "C3'" . DT  B 2 5   ? 45.777 27.473  11.631  1.00 26.86 ? 5    DT  T "C3'" 1 
ATOM   272  O  "O3'" . DT  B 2 5   ? 46.678 26.843  12.545  1.00 25.96 ? 5    DT  T "O3'" 1 
ATOM   273  C  "C2'" . DT  B 2 5   ? 46.089 27.072  10.195  1.00 26.66 ? 5    DT  T "C2'" 1 
ATOM   274  C  "C1'" . DT  B 2 5   ? 44.730 27.253  9.519   1.00 28.94 ? 5    DT  T "C1'" 1 
ATOM   275  N  N1    . DT  B 2 5   ? 44.556 28.531  8.773   1.00 28.81 ? 5    DT  T N1    1 
ATOM   276  C  C2    . DT  B 2 5   ? 45.049 28.584  7.488   1.00 27.92 ? 5    DT  T C2    1 
ATOM   277  O  O2    . DT  B 2 5   ? 45.669 27.672  6.977   1.00 30.12 ? 5    DT  T O2    1 
ATOM   278  N  N3    . DT  B 2 5   ? 44.792 29.753  6.820   1.00 28.18 ? 5    DT  T N3    1 
ATOM   279  C  C4    . DT  B 2 5   ? 44.119 30.861  7.296   1.00 27.61 ? 5    DT  T C4    1 
ATOM   280  O  O4    . DT  B 2 5   ? 43.933 31.827  6.557   1.00 26.62 ? 5    DT  T O4    1 
ATOM   281  C  C5    . DT  B 2 5   ? 43.673 30.763  8.671   1.00 28.84 ? 5    DT  T C5    1 
ATOM   282  C  C7    . DT  B 2 5   ? 42.980 31.937  9.298   1.00 27.15 ? 5    DT  T C7    1 
ATOM   283  C  C6    . DT  B 2 5   ? 43.907 29.614  9.330   1.00 27.81 ? 5    DT  T C6    1 
ATOM   284  P  P     . DT  B 2 6   ? 48.128 27.490  12.811  1.00 24.01 ? 6    DT  T P     1 
ATOM   285  O  OP1   . DT  B 2 6   ? 48.815 26.754  13.902  1.00 24.89 ? 6    DT  T OP1   1 
ATOM   286  O  OP2   . DT  B 2 6   ? 47.944 28.959  12.926  1.00 26.99 ? 6    DT  T OP2   1 
ATOM   287  O  "O5'" . DT  B 2 6   ? 48.921 27.237  11.454  1.00 25.37 ? 6    DT  T "O5'" 1 
ATOM   288  C  "C5'" . DT  B 2 6   ? 49.196 25.920  10.985  1.00 21.92 ? 6    DT  T "C5'" 1 
ATOM   289  C  "C4'" . DT  B 2 6   ? 49.925 25.993  9.663   1.00 21.70 ? 6    DT  T "C4'" 1 
ATOM   290  O  "O4'" . DT  B 2 6   ? 49.050 26.568  8.662   1.00 20.68 ? 6    DT  T "O4'" 1 
ATOM   291  C  "C3'" . DT  B 2 6   ? 51.147 26.898  9.657   1.00 21.68 ? 6    DT  T "C3'" 1 
ATOM   292  O  "O3'" . DT  B 2 6   ? 52.288 26.201  10.137  1.00 21.24 ? 6    DT  T "O3'" 1 
ATOM   293  C  "C2'" . DT  B 2 6   ? 51.276 27.281  8.190   1.00 20.24 ? 6    DT  T "C2'" 1 
ATOM   294  C  "C1'" . DT  B 2 6   ? 49.806 27.362  7.767   1.00 22.16 ? 6    DT  T "C1'" 1 
ATOM   295  N  N1    . DT  B 2 6   ? 49.228 28.725  7.746   1.00 23.00 ? 6    DT  T N1    1 
ATOM   296  C  C2    . DT  B 2 6   ? 49.294 29.438  6.562   1.00 25.29 ? 6    DT  T C2    1 
ATOM   297  O  O2    . DT  B 2 6   ? 49.856 29.026  5.560   1.00 26.25 ? 6    DT  T O2    1 
ATOM   298  N  N3    . DT  B 2 6   ? 48.674 30.661  6.594   1.00 25.60 ? 6    DT  T N3    1 
ATOM   299  C  C4    . DT  B 2 6   ? 48.019 31.238  7.663   1.00 26.99 ? 6    DT  T C4    1 
ATOM   300  O  O4    . DT  B 2 6   ? 47.468 32.325  7.523   1.00 27.92 ? 6    DT  T O4    1 
ATOM   301  C  C5    . DT  B 2 6   ? 48.035 30.463  8.890   1.00 26.06 ? 6    DT  T C5    1 
ATOM   302  C  C7    . DT  B 2 6   ? 47.406 31.042  10.122  1.00 26.93 ? 6    DT  T C7    1 
ATOM   303  C  C6    . DT  B 2 6   ? 48.624 29.259  8.867   1.00 22.81 ? 6    DT  T C6    1 
ATOM   304  P  P     . DG  B 2 7   ? 53.475 27.023  10.827  1.00 20.38 ? 7    DG  T P     1 
ATOM   305  O  OP1   . DG  B 2 7   ? 54.424 26.061  11.427  1.00 19.67 ? 7    DG  T OP1   1 
ATOM   306  O  OP2   . DG  B 2 7   ? 52.859 28.076  11.674  1.00 22.06 ? 7    DG  T OP2   1 
ATOM   307  O  "O5'" . DG  B 2 7   ? 54.167 27.733  9.584   1.00 22.73 ? 7    DG  T "O5'" 1 
ATOM   308  C  "C5'" . DG  B 2 7   ? 54.357 29.141  9.543   1.00 21.61 ? 7    DG  T "C5'" 1 
ATOM   309  C  "C4'" . DG  B 2 7   ? 54.676 29.564  8.131   1.00 22.44 ? 7    DG  T "C4'" 1 
ATOM   310  O  "O4'" . DG  B 2 7   ? 53.404 29.776  7.469   1.00 21.58 ? 7    DG  T "O4'" 1 
ATOM   311  C  "C3'" . DG  B 2 7   ? 55.424 30.889  8.041   1.00 22.71 ? 7    DG  T "C3'" 1 
ATOM   312  O  "O3'" . DG  B 2 7   ? 56.758 30.773  7.595   1.00 23.15 ? 7    DG  T "O3'" 1 
ATOM   313  C  "C2'" . DG  B 2 7   ? 54.672 31.718  7.024   1.00 23.81 ? 7    DG  T "C2'" 1 
ATOM   314  C  "C1'" . DG  B 2 7   ? 53.453 30.919  6.627   1.00 24.30 ? 7    DG  T "C1'" 1 
ATOM   315  N  N9    . DG  B 2 7   ? 52.316 31.779  6.938   1.00 26.29 ? 7    DG  T N9    1 
ATOM   316  C  C8    . DG  B 2 7   ? 51.576 31.825  8.096   1.00 26.79 ? 7    DG  T C8    1 
ATOM   317  N  N7    . DG  B 2 7   ? 50.731 32.820  8.120   1.00 25.15 ? 7    DG  T N7    1 
ATOM   318  C  C5    . DG  B 2 7   ? 50.904 33.447  6.894   1.00 25.89 ? 7    DG  T C5    1 
ATOM   319  C  C6    . DG  B 2 7   ? 50.288 34.605  6.356   1.00 26.16 ? 7    DG  T C6    1 
ATOM   320  O  O6    . DG  B 2 7   ? 49.447 35.343  6.881   1.00 23.64 ? 7    DG  T O6    1 
ATOM   321  N  N1    . DG  B 2 7   ? 50.755 34.880  5.075   1.00 24.46 ? 7    DG  T N1    1 
ATOM   322  C  C2    . DG  B 2 7   ? 51.696 34.140  4.400   1.00 25.69 ? 7    DG  T C2    1 
ATOM   323  N  N2    . DG  B 2 7   ? 52.010 34.543  3.157   1.00 25.00 ? 7    DG  T N2    1 
ATOM   324  N  N3    . DG  B 2 7   ? 52.286 33.077  4.899   1.00 26.45 ? 7    DG  T N3    1 
ATOM   325  C  C4    . DG  B 2 7   ? 51.847 32.790  6.140   1.00 26.26 ? 7    DG  T C4    1 
ATOM   326  P  P     . DG  B 2 8   ? 57.791 31.947  7.955   1.00 22.90 ? 8    DG  T P     1 
ATOM   327  O  OP1   . DG  B 2 8   ? 59.171 31.425  7.797   1.00 27.36 ? 8    DG  T OP1   1 
ATOM   328  O  OP2   . DG  B 2 8   ? 57.374 32.549  9.255   1.00 25.83 ? 8    DG  T OP2   1 
ATOM   329  O  "O5'" . DG  B 2 8   ? 57.518 33.067  6.855   1.00 23.57 ? 8    DG  T "O5'" 1 
ATOM   330  C  "C5'" . DG  B 2 8   ? 57.724 32.810  5.477   1.00 22.18 ? 8    DG  T "C5'" 1 
ATOM   331  C  "C4'" . DG  B 2 8   ? 57.759 34.105  4.698   1.00 24.35 ? 8    DG  T "C4'" 1 
ATOM   332  O  "O4'" . DG  B 2 8   ? 56.461 34.750  4.749   1.00 23.52 ? 8    DG  T "O4'" 1 
ATOM   333  C  "C3'" . DG  B 2 8   ? 58.784 35.147  5.154   1.00 23.02 ? 8    DG  T "C3'" 1 
ATOM   334  O  "O3'" . DG  B 2 8   ? 59.399 35.722  3.991   1.00 23.21 ? 8    DG  T "O3'" 1 
ATOM   335  C  "C2'" . DG  B 2 8   ? 57.948 36.151  5.934   1.00 23.32 ? 8    DG  T "C2'" 1 
ATOM   336  C  "C1'" . DG  B 2 8   ? 56.565 36.061  5.293   1.00 22.91 ? 8    DG  T "C1'" 1 
ATOM   337  N  N9    . DG  B 2 8   ? 55.456 36.229  6.231   1.00 23.82 ? 8    DG  T N9    1 
ATOM   338  C  C8    . DG  B 2 8   ? 55.268 35.541  7.408   1.00 24.41 ? 8    DG  T C8    1 
ATOM   339  N  N7    . DG  B 2 8   ? 54.173 35.881  8.033   1.00 22.95 ? 8    DG  T N7    1 
ATOM   340  C  C5    . DG  B 2 8   ? 53.602 36.857  7.231   1.00 21.99 ? 8    DG  T C5    1 
ATOM   341  C  C6    . DG  B 2 8   ? 52.407 37.596  7.404   1.00 24.00 ? 8    DG  T C6    1 
ATOM   342  O  O6    . DG  B 2 8   ? 51.599 37.551  8.346   1.00 25.41 ? 8    DG  T O6    1 
ATOM   343  N  N1    . DG  B 2 8   ? 52.188 38.470  6.341   1.00 20.73 ? 8    DG  T N1    1 
ATOM   344  C  C2    . DG  B 2 8   ? 53.021 38.625  5.266   1.00 21.37 ? 8    DG  T C2    1 
ATOM   345  N  N2    . DG  B 2 8   ? 52.630 39.522  4.344   1.00 21.05 ? 8    DG  T N2    1 
ATOM   346  N  N3    . DG  B 2 8   ? 54.152 37.955  5.103   1.00 22.47 ? 8    DG  T N3    1 
ATOM   347  C  C4    . DG  B 2 8   ? 54.377 37.090  6.113   1.00 23.61 ? 8    DG  T C4    1 
ATOM   348  P  P     . DC  B 2 9   ? 60.566 36.827  4.134   1.00 21.33 ? 9    DC  T P     1 
ATOM   349  O  OP1   . DC  B 2 9   ? 61.214 36.906  2.805   1.00 23.79 ? 9    DC  T OP1   1 
ATOM   350  O  OP2   . DC  B 2 9   ? 61.394 36.581  5.327   1.00 22.61 ? 9    DC  T OP2   1 
ATOM   351  O  "O5'" . DC  B 2 9   ? 59.753 38.178  4.364   1.00 23.11 ? 9    DC  T "O5'" 1 
ATOM   352  C  "C5'" . DC  B 2 9   ? 58.804 38.603  3.396   1.00 25.70 ? 9    DC  T "C5'" 1 
ATOM   353  C  "C4'" . DC  B 2 9   ? 58.126 39.883  3.823   1.00 25.72 ? 9    DC  T "C4'" 1 
ATOM   354  O  "O4'" . DC  B 2 9   ? 57.032 39.627  4.736   1.00 27.27 ? 9    DC  T "O4'" 1 
ATOM   355  C  "C3'" . DC  B 2 9   ? 59.015 40.938  4.484   1.00 27.48 ? 9    DC  T "C3'" 1 
ATOM   356  O  "O3'" . DC  B 2 9   ? 58.825 42.175  3.816   1.00 26.57 ? 9    DC  T "O3'" 1 
ATOM   357  C  "C2'" . DC  B 2 9   ? 58.475 41.029  5.903   1.00 27.90 ? 9    DC  T "C2'" 1 
ATOM   358  C  "C1'" . DC  B 2 9   ? 57.014 40.645  5.712   1.00 26.35 ? 9    DC  T "C1'" 1 
ATOM   359  N  N1    . DC  B 2 9   ? 56.297 40.129  6.899   1.00 26.13 ? 9    DC  T N1    1 
ATOM   360  C  C2    . DC  B 2 9   ? 54.975 40.577  7.148   1.00 25.51 ? 9    DC  T C2    1 
ATOM   361  O  O2    . DC  B 2 9   ? 54.430 41.355  6.346   1.00 26.85 ? 9    DC  T O2    1 
ATOM   362  N  N3    . DC  B 2 9   ? 54.328 40.138  8.248   1.00 24.48 ? 9    DC  T N3    1 
ATOM   363  C  C4    . DC  B 2 9   ? 54.928 39.277  9.078   1.00 25.85 ? 9    DC  T C4    1 
ATOM   364  N  N4    . DC  B 2 9   ? 54.251 38.879  10.157  1.00 24.53 ? 9    DC  T N4    1 
ATOM   365  C  C5    . DC  B 2 9   ? 56.251 38.787  8.839   1.00 23.85 ? 9    DC  T C5    1 
ATOM   366  C  C6    . DC  B 2 9   ? 56.893 39.239  7.752   1.00 23.74 ? 9    DC  T C6    1 
ATOM   367  P  P     . DA  B 2 10  ? 59.960 43.309  3.873   1.00 27.49 ? 10   DA  T P     1 
ATOM   368  O  OP1   . DA  B 2 10  ? 60.690 43.360  2.582   1.00 29.68 ? 10   DA  T OP1   1 
ATOM   369  O  OP2   . DA  B 2 10  ? 60.724 43.188  5.138   1.00 30.37 ? 10   DA  T OP2   1 
ATOM   370  O  "O5'" . DA  B 2 10  ? 59.069 44.615  3.932   1.00 31.09 ? 10   DA  T "O5'" 1 
ATOM   371  C  "C5'" . DA  B 2 10  ? 58.029 44.790  2.979   1.00 30.91 ? 10   DA  T "C5'" 1 
ATOM   372  C  "C4'" . DA  B 2 10  ? 56.960 45.690  3.539   1.00 31.57 ? 10   DA  T "C4'" 1 
ATOM   373  O  "O4'" . DA  B 2 10  ? 56.262 45.045  4.627   1.00 30.78 ? 10   DA  T "O4'" 1 
ATOM   374  C  "C3'" . DA  B 2 10  ? 57.486 47.007  4.093   1.00 33.30 ? 10   DA  T "C3'" 1 
ATOM   375  O  "O3'" . DA  B 2 10  ? 56.535 48.001  3.761   1.00 36.59 ? 10   DA  T "O3'" 1 
ATOM   376  C  "C2'" . DA  B 2 10  ? 57.512 46.776  5.596   1.00 32.23 ? 10   DA  T "C2'" 1 
ATOM   377  C  "C1'" . DA  B 2 10  ? 56.313 45.865  5.785   1.00 31.36 ? 10   DA  T "C1'" 1 
ATOM   378  N  N9    . DA  B 2 10  ? 56.357 44.981  6.947   1.00 30.02 ? 10   DA  T N9    1 
ATOM   379  C  C8    . DA  B 2 10  ? 57.312 44.055  7.291   1.00 30.58 ? 10   DA  T C8    1 
ATOM   380  N  N7    . DA  B 2 10  ? 57.019 43.369  8.369   1.00 29.32 ? 10   DA  T N7    1 
ATOM   381  C  C5    . DA  B 2 10  ? 55.797 43.886  8.768   1.00 29.52 ? 10   DA  T C5    1 
ATOM   382  C  C6    . DA  B 2 10  ? 54.943 43.571  9.832   1.00 29.37 ? 10   DA  T C6    1 
ATOM   383  N  N6    . DA  B 2 10  ? 55.187 42.605  10.716  1.00 30.69 ? 10   DA  T N6    1 
ATOM   384  N  N1    . DA  B 2 10  ? 53.803 44.287  9.955   1.00 29.31 ? 10   DA  T N1    1 
ATOM   385  C  C2    . DA  B 2 10  ? 53.549 45.248  9.056   1.00 28.52 ? 10   DA  T C2    1 
ATOM   386  N  N3    . DA  B 2 10  ? 54.268 45.628  8.004   1.00 28.30 ? 10   DA  T N3    1 
ATOM   387  C  C4    . DA  B 2 10  ? 55.390 44.897  7.913   1.00 30.36 ? 10   DA  T C4    1 
ATOM   388  P  P     . DC  B 2 11  ? 57.020 49.416  3.213   1.00 38.12 ? 11   DC  T P     1 
ATOM   389  O  OP1   . DC  B 2 11  ? 56.200 49.665  2.001   1.00 38.93 ? 11   DC  T OP1   1 
ATOM   390  O  OP2   . DC  B 2 11  ? 58.510 49.459  3.124   1.00 36.16 ? 11   DC  T OP2   1 
ATOM   391  O  "O5'" . DC  B 2 11  ? 56.531 50.398  4.365   1.00 38.16 ? 11   DC  T "O5'" 1 
ATOM   392  C  "C5'" . DC  B 2 11  ? 55.142 50.510  4.654   1.00 38.31 ? 11   DC  T "C5'" 1 
ATOM   393  C  "C4'" . DC  B 2 11  ? 54.919 50.916  6.093   1.00 38.60 ? 11   DC  T "C4'" 1 
ATOM   394  O  "O4'" . DC  B 2 11  ? 54.906 49.782  7.002   1.00 38.02 ? 11   DC  T "O4'" 1 
ATOM   395  C  "C3'" . DC  B 2 11  ? 55.901 51.941  6.669   1.00 36.40 ? 11   DC  T "C3'" 1 
ATOM   396  O  "O3'" . DC  B 2 11  ? 55.162 53.056  7.154   1.00 35.85 ? 11   DC  T "O3'" 1 
ATOM   397  C  "C2'" . DC  B 2 11  ? 56.560 51.201  7.823   1.00 37.16 ? 11   DC  T "C2'" 1 
ATOM   398  C  "C1'" . DC  B 2 11  ? 55.497 50.187  8.226   1.00 37.63 ? 11   DC  T "C1'" 1 
ATOM   399  N  N1    . DC  B 2 11  ? 55.999 48.985  8.939   1.00 35.73 ? 11   DC  T N1    1 
ATOM   400  C  C2    . DC  B 2 11  ? 55.222 48.423  9.985   1.00 35.70 ? 11   DC  T C2    1 
ATOM   401  O  O2    . DC  B 2 11  ? 54.105 48.902  10.251  1.00 33.44 ? 11   DC  T O2    1 
ATOM   402  N  N3    . DC  B 2 11  ? 55.711 47.364  10.673  1.00 36.38 ? 11   DC  T N3    1 
ATOM   403  C  C4    . DC  B 2 11  ? 56.902 46.850  10.356  1.00 36.56 ? 11   DC  T C4    1 
ATOM   404  N  N4    . DC  B 2 11  ? 57.346 45.814  11.075  1.00 36.54 ? 11   DC  T N4    1 
ATOM   405  C  C5    . DC  B 2 11  ? 57.694 47.377  9.290   1.00 36.99 ? 11   DC  T C5    1 
ATOM   406  C  C6    . DC  B 2 11  ? 57.208 48.432  8.614   1.00 36.65 ? 11   DC  T C6    1 
ATOM   407  P  P     . DT  B 2 12  ? 55.919 54.370  7.689   1.00 31.46 ? 12   DT  T P     1 
ATOM   408  O  OP1   . DT  B 2 12  ? 55.408 55.500  6.871   1.00 34.25 ? 12   DT  T OP1   1 
ATOM   409  O  OP2   . DT  B 2 12  ? 57.385 54.154  7.790   1.00 30.93 ? 12   DT  T OP2   1 
ATOM   410  O  "O5'" . DT  B 2 12  ? 55.295 54.501  9.148   1.00 31.76 ? 12   DT  T "O5'" 1 
ATOM   411  C  "C5'" . DT  B 2 12  ? 53.878 54.415  9.309   1.00 33.50 ? 12   DT  T "C5'" 1 
ATOM   412  C  "C4'" . DT  B 2 12  ? 53.497 54.316  10.767  1.00 34.08 ? 12   DT  T "C4'" 1 
ATOM   413  O  "O4'" . DT  B 2 12  ? 53.915 53.042  11.310  1.00 34.11 ? 12   DT  T "O4'" 1 
ATOM   414  C  "C3'" . DT  B 2 12  ? 54.083 55.394  11.674  1.00 34.44 ? 12   DT  T "C3'" 1 
ATOM   415  O  "O3'" . DT  B 2 12  ? 53.057 55.846  12.565  1.00 36.41 ? 12   DT  T "O3'" 1 
ATOM   416  C  "C2'" . DT  B 2 12  ? 55.209 54.676  12.402  1.00 35.30 ? 12   DT  T "C2'" 1 
ATOM   417  C  "C1'" . DT  B 2 12  ? 54.704 53.237  12.470  1.00 34.92 ? 12   DT  T "C1'" 1 
ATOM   418  N  N1    . DT  B 2 12  ? 55.743 52.181  12.482  1.00 34.13 ? 12   DT  T N1    1 
ATOM   419  C  C2    . DT  B 2 12  ? 55.637 51.179  13.426  1.00 35.05 ? 12   DT  T C2    1 
ATOM   420  O  O2    . DT  B 2 12  ? 54.767 51.156  14.287  1.00 34.28 ? 12   DT  T O2    1 
ATOM   421  N  N3    . DT  B 2 12  ? 56.600 50.198  13.331  1.00 35.05 ? 12   DT  T N3    1 
ATOM   422  C  C4    . DT  B 2 12  ? 57.638 50.127  12.419  1.00 34.63 ? 12   DT  T C4    1 
ATOM   423  O  O4    . DT  B 2 12  ? 58.399 49.163  12.433  1.00 33.31 ? 12   DT  T O4    1 
ATOM   424  C  C5    . DT  B 2 12  ? 57.718 51.236  11.489  1.00 34.78 ? 12   DT  T C5    1 
ATOM   425  C  C7    . DT  B 2 12  ? 58.840 51.275  10.496  1.00 32.53 ? 12   DT  T C7    1 
ATOM   426  C  C6    . DT  B 2 12  ? 56.776 52.190  11.564  1.00 34.67 ? 12   DT  T C6    1 
ATOM   427  P  P     . DG  B 2 13  ? 53.252 57.209  13.400  1.00 36.27 ? 13   DG  T P     1 
ATOM   428  O  OP1   . DG  B 2 13  ? 51.891 57.752  13.653  1.00 35.55 ? 13   DG  T OP1   1 
ATOM   429  O  OP2   . DG  B 2 13  ? 54.277 58.063  12.751  1.00 33.62 ? 13   DG  T OP2   1 
ATOM   430  O  "O5'" . DG  B 2 13  ? 53.851 56.686  14.780  1.00 38.87 ? 13   DG  T "O5'" 1 
ATOM   431  C  "C5'" . DG  B 2 13  ? 53.094 55.796  15.599  1.00 40.20 ? 13   DG  T "C5'" 1 
ATOM   432  C  "C4'" . DG  B 2 13  ? 53.950 55.242  16.714  1.00 42.81 ? 13   DG  T "C4'" 1 
ATOM   433  O  "O4'" . DG  B 2 13  ? 54.833 54.187  16.253  1.00 40.66 ? 13   DG  T "O4'" 1 
ATOM   434  C  "C3'" . DG  B 2 13  ? 54.843 56.263  17.424  1.00 44.22 ? 13   DG  T "C3'" 1 
ATOM   435  O  "O3'" . DG  B 2 13  ? 54.815 55.988  18.820  1.00 48.71 ? 13   DG  T "O3'" 1 
ATOM   436  C  "C2'" . DG  B 2 13  ? 56.228 55.930  16.898  1.00 42.23 ? 13   DG  T "C2'" 1 
ATOM   437  C  "C1'" . DG  B 2 13  ? 56.115 54.424  16.798  1.00 40.33 ? 13   DG  T "C1'" 1 
ATOM   438  N  N9    . DG  B 2 13  ? 57.105 53.725  15.988  1.00 39.59 ? 13   DG  T N9    1 
ATOM   439  C  C8    . DG  B 2 13  ? 57.744 54.165  14.853  1.00 39.63 ? 13   DG  T C8    1 
ATOM   440  N  N7    . DG  B 2 13  ? 58.585 53.292  14.369  1.00 39.02 ? 13   DG  T N7    1 
ATOM   441  C  C5    . DG  B 2 13  ? 58.491 52.209  15.235  1.00 38.93 ? 13   DG  T C5    1 
ATOM   442  C  C6    . DG  B 2 13  ? 59.164 50.952  15.222  1.00 38.78 ? 13   DG  T C6    1 
ATOM   443  O  O6    . DG  B 2 13  ? 60.003 50.529  14.411  1.00 37.39 ? 13   DG  T O6    1 
ATOM   444  N  N1    . DG  B 2 13  ? 58.773 50.155  16.292  1.00 37.63 ? 13   DG  T N1    1 
ATOM   445  C  C2    . DG  B 2 13  ? 57.859 50.513  17.253  1.00 38.59 ? 13   DG  T C2    1 
ATOM   446  N  N2    . DG  B 2 13  ? 57.624 49.606  18.213  1.00 39.32 ? 13   DG  T N2    1 
ATOM   447  N  N3    . DG  B 2 13  ? 57.223 51.672  17.274  1.00 38.27 ? 13   DG  T N3    1 
ATOM   448  C  C4    . DG  B 2 13  ? 57.586 52.465  16.240  1.00 39.31 ? 13   DG  T C4    1 
ATOM   449  P  P     . DG  B 2 14  ? 54.938 57.187  19.879  1.00 52.10 ? 14   DG  T P     1 
ATOM   450  O  OP1   . DG  B 2 14  ? 53.553 57.588  20.251  1.00 50.00 ? 14   DG  T OP1   1 
ATOM   451  O  OP2   . DG  B 2 14  ? 55.880 58.207  19.339  1.00 50.97 ? 14   DG  T OP2   1 
ATOM   452  O  "O5'" . DG  B 2 14  ? 55.638 56.471  21.119  1.00 52.79 ? 14   DG  T "O5'" 1 
ATOM   453  C  "C5'" . DG  B 2 14  ? 55.081 55.286  21.691  1.00 54.89 ? 14   DG  T "C5'" 1 
ATOM   454  C  "C4'" . DG  B 2 14  ? 56.169 54.419  22.285  1.00 56.88 ? 14   DG  T "C4'" 1 
ATOM   455  O  "O4'" . DG  B 2 14  ? 56.856 53.657  21.256  1.00 57.38 ? 14   DG  T "O4'" 1 
ATOM   456  C  "C3'" . DG  B 2 14  ? 57.257 55.169  23.061  1.00 59.03 ? 14   DG  T "C3'" 1 
ATOM   457  O  "O3'" . DG  B 2 14  ? 57.564 54.490  24.284  1.00 62.05 ? 14   DG  T "O3'" 1 
ATOM   458  C  "C2'" . DG  B 2 14  ? 58.457 55.103  22.133  1.00 57.79 ? 14   DG  T "C2'" 1 
ATOM   459  C  "C1'" . DG  B 2 14  ? 58.253 53.751  21.475  1.00 56.05 ? 14   DG  T "C1'" 1 
ATOM   460  N  N9    . DG  B 2 14  ? 58.947 53.571  20.201  1.00 54.42 ? 14   DG  T N9    1 
ATOM   461  C  C8    . DG  B 2 14  ? 58.938 54.416  19.115  1.00 53.66 ? 14   DG  T C8    1 
ATOM   462  N  N7    . DG  B 2 14  ? 59.712 54.013  18.144  1.00 53.34 ? 14   DG  T N7    1 
ATOM   463  C  C5    . DG  B 2 14  ? 60.257 52.822  18.607  1.00 53.10 ? 14   DG  T C5    1 
ATOM   464  C  C6    . DG  B 2 14  ? 61.184 51.931  17.996  1.00 52.59 ? 14   DG  T C6    1 
ATOM   465  O  O6    . DG  B 2 14  ? 61.737 52.027  16.894  1.00 52.32 ? 14   DG  T O6    1 
ATOM   466  N  N1    . DG  B 2 14  ? 61.460 50.840  18.814  1.00 53.13 ? 14   DG  T N1    1 
ATOM   467  C  C2    . DG  B 2 14  ? 60.923 50.630  20.060  1.00 53.28 ? 14   DG  T C2    1 
ATOM   468  N  N2    . DG  B 2 14  ? 61.314 49.511  20.688  1.00 53.80 ? 14   DG  T N2    1 
ATOM   469  N  N3    . DG  B 2 14  ? 60.066 51.453  20.646  1.00 53.07 ? 14   DG  T N3    1 
ATOM   470  C  C4    . DG  B 2 14  ? 59.780 52.523  19.868  1.00 53.96 ? 14   DG  T C4    1 
ATOM   471  P  P     . DC  B 2 15  ? 58.450 55.227  25.408  1.00 64.87 ? 15   DC  T P     1 
ATOM   472  O  OP1   . DC  B 2 15  ? 57.758 55.013  26.708  1.00 63.01 ? 15   DC  T OP1   1 
ATOM   473  O  OP2   . DC  B 2 15  ? 58.748 56.616  24.955  1.00 62.58 ? 15   DC  T OP2   1 
ATOM   474  O  "O5'" . DC  B 2 15  ? 59.821 54.409  25.406  1.00 64.37 ? 15   DC  T "O5'" 1 
ATOM   475  C  "C5'" . DC  B 2 15  ? 59.868 53.059  25.884  1.00 65.60 ? 15   DC  T "C5'" 1 
ATOM   476  C  "C4'" . DC  B 2 15  ? 61.265 52.490  25.760  1.00 65.91 ? 15   DC  T "C4'" 1 
ATOM   477  O  "O4'" . DC  B 2 15  ? 61.594 52.312  24.360  1.00 66.08 ? 15   DC  T "O4'" 1 
ATOM   478  C  "C3'" . DC  B 2 15  ? 62.391 53.338  26.364  1.00 66.46 ? 15   DC  T "C3'" 1 
ATOM   479  O  "O3'" . DC  B 2 15  ? 63.356 52.509  27.029  1.00 65.61 ? 15   DC  T "O3'" 1 
ATOM   480  C  "C2'" . DC  B 2 15  ? 63.023 53.995  25.151  1.00 66.00 ? 15   DC  T "C2'" 1 
ATOM   481  C  "C1'" . DC  B 2 15  ? 62.838 52.931  24.078  1.00 66.25 ? 15   DC  T "C1'" 1 
ATOM   482  N  N1    . DC  B 2 15  ? 62.807 53.424  22.684  1.00 66.39 ? 15   DC  T N1    1 
ATOM   483  C  C2    . DC  B 2 15  ? 63.519 52.714  21.697  1.00 65.97 ? 15   DC  T C2    1 
ATOM   484  O  O2    . DC  B 2 15  ? 64.109 51.665  22.012  1.00 65.77 ? 15   DC  T O2    1 
ATOM   485  N  N3    . DC  B 2 15  ? 63.537 53.188  20.427  1.00 65.86 ? 15   DC  T N3    1 
ATOM   486  C  C4    . DC  B 2 15  ? 62.873 54.308  20.121  1.00 66.13 ? 15   DC  T C4    1 
ATOM   487  N  N4    . DC  B 2 15  ? 62.930 54.747  18.859  1.00 64.80 ? 15   DC  T N4    1 
ATOM   488  C  C5    . DC  B 2 15  ? 62.122 55.031  21.095  1.00 65.66 ? 15   DC  T C5    1 
ATOM   489  C  C6    . DC  B 2 15  ? 62.115 54.558  22.349  1.00 66.41 ? 15   DC  T C6    1 
ATOM   490  N  N     . MET C 3 1   ? 79.989 4.527   7.357   1.00 25.56 ? 1    MET A N     1 
ATOM   491  C  CA    . MET C 3 1   ? 79.375 5.873   7.563   1.00 25.30 ? 1    MET A CA    1 
ATOM   492  C  C     . MET C 3 1   ? 80.363 6.894   8.106   1.00 24.97 ? 1    MET A C     1 
ATOM   493  O  O     . MET C 3 1   ? 81.088 6.620   9.066   1.00 25.66 ? 1    MET A O     1 
ATOM   494  C  CB    . MET C 3 1   ? 78.175 5.785   8.520   1.00 25.35 ? 1    MET A CB    1 
ATOM   495  C  CG    . MET C 3 1   ? 77.637 7.157   8.969   1.00 24.92 ? 1    MET A CG    1 
ATOM   496  S  SD    . MET C 3 1   ? 75.952 7.136   9.663   1.00 27.84 ? 1    MET A SD    1 
ATOM   497  C  CE    . MET C 3 1   ? 76.243 7.452   11.249  1.00 26.41 ? 1    MET A CE    1 
ATOM   498  N  N     . ILE C 3 2   ? 80.388 8.070   7.483   1.00 23.53 ? 2    ILE A N     1 
ATOM   499  C  CA    . ILE C 3 2   ? 81.254 9.147   7.929   1.00 24.03 ? 2    ILE A CA    1 
ATOM   500  C  C     . ILE C 3 2   ? 80.450 10.427  8.139   1.00 23.98 ? 2    ILE A C     1 
ATOM   501  O  O     . ILE C 3 2   ? 79.368 10.600  7.580   1.00 24.24 ? 2    ILE A O     1 
ATOM   502  C  CB    . ILE C 3 2   ? 82.378 9.435   6.917   1.00 24.87 ? 2    ILE A CB    1 
ATOM   503  C  CG1   . ILE C 3 2   ? 81.776 9.937   5.606   1.00 23.83 ? 2    ILE A CG1   1 
ATOM   504  C  CG2   . ILE C 3 2   ? 83.212 8.168   6.684   1.00 23.67 ? 2    ILE A CG2   1 
ATOM   505  C  CD1   . ILE C 3 2   ? 82.805 10.440  4.633   1.00 24.38 ? 2    ILE A CD1   1 
ATOM   506  N  N     . VAL C 3 3   ? 80.988 11.312  8.969   1.00 24.03 ? 3    VAL A N     1 
ATOM   507  C  CA    . VAL C 3 3   ? 80.363 12.587  9.268   1.00 22.26 ? 3    VAL A CA    1 
ATOM   508  C  C     . VAL C 3 3   ? 81.379 13.618  8.793   1.00 23.23 ? 3    VAL A C     1 
ATOM   509  O  O     . VAL C 3 3   ? 82.564 13.481  9.076   1.00 24.06 ? 3    VAL A O     1 
ATOM   510  C  CB    . VAL C 3 3   ? 80.121 12.737  10.788  1.00 21.32 ? 3    VAL A CB    1 
ATOM   511  C  CG1   . VAL C 3 3   ? 79.295 13.984  11.079  1.00 18.55 ? 3    VAL A CG1   1 
ATOM   512  C  CG2   . VAL C 3 3   ? 79.415 11.499  11.318  1.00 20.07 ? 3    VAL A CG2   1 
ATOM   513  N  N     . SER C 3 4   ? 80.925 14.637  8.065   1.00 23.55 ? 4    SER A N     1 
ATOM   514  C  CA    . SER C 3 4   ? 81.837 15.647  7.543   1.00 22.16 ? 4    SER A CA    1 
ATOM   515  C  C     . SER C 3 4   ? 81.286 17.074  7.522   1.00 22.34 ? 4    SER A C     1 
ATOM   516  O  O     . SER C 3 4   ? 80.106 17.309  7.765   1.00 21.47 ? 4    SER A O     1 
ATOM   517  C  CB    . SER C 3 4   ? 82.282 15.253  6.130   1.00 21.94 ? 4    SER A CB    1 
ATOM   518  O  OG    . SER C 3 4   ? 83.388 16.034  5.712   1.00 22.22 ? 4    SER A OG    1 
ATOM   519  N  N     . ASP C 3 5   ? 82.169 18.020  7.222   1.00 22.34 ? 5    ASP A N     1 
ATOM   520  C  CA    . ASP C 3 5   ? 81.829 19.436  7.155   1.00 23.73 ? 5    ASP A CA    1 
ATOM   521  C  C     . ASP C 3 5   ? 83.004 20.156  6.505   1.00 24.08 ? 5    ASP A C     1 
ATOM   522  O  O     . ASP C 3 5   ? 84.142 19.713  6.626   1.00 24.41 ? 5    ASP A O     1 
ATOM   523  C  CB    . ASP C 3 5   ? 81.612 19.994  8.562   1.00 23.08 ? 5    ASP A CB    1 
ATOM   524  C  CG    . ASP C 3 5   ? 81.211 21.450  8.555   1.00 23.92 ? 5    ASP A CG    1 
ATOM   525  O  OD1   . ASP C 3 5   ? 80.133 21.764  8.018   1.00 25.34 ? 5    ASP A OD1   1 
ATOM   526  O  OD2   . ASP C 3 5   ? 81.971 22.289  9.088   1.00 25.79 ? 5    ASP A OD2   1 
ATOM   527  N  N     . ILE C 3 6   ? 82.740 21.264  5.825   1.00 23.55 ? 6    ILE A N     1 
ATOM   528  C  CA    . ILE C 3 6   ? 83.824 22.009  5.196   1.00 24.55 ? 6    ILE A CA    1 
ATOM   529  C  C     . ILE C 3 6   ? 83.747 23.489  5.554   1.00 25.88 ? 6    ILE A C     1 
ATOM   530  O  O     . ILE C 3 6   ? 82.733 23.968  6.061   1.00 26.04 ? 6    ILE A O     1 
ATOM   531  C  CB    . ILE C 3 6   ? 83.776 21.892  3.649   1.00 23.83 ? 6    ILE A CB    1 
ATOM   532  C  CG1   . ILE C 3 6   ? 82.655 22.774  3.085   1.00 25.16 ? 6    ILE A CG1   1 
ATOM   533  C  CG2   . ILE C 3 6   ? 83.538 20.440  3.235   1.00 24.03 ? 6    ILE A CG2   1 
ATOM   534  C  CD1   . ILE C 3 6   ? 82.520 22.711  1.563   1.00 24.72 ? 6    ILE A CD1   1 
ATOM   535  N  N     . GLU C 3 7   ? 84.830 24.208  5.295   1.00 26.01 ? 7    GLU A N     1 
ATOM   536  C  CA    . GLU C 3 7   ? 84.866 25.644  5.532   1.00 25.96 ? 7    GLU A CA    1 
ATOM   537  C  C     . GLU C 3 7   ? 85.343 26.230  4.201   1.00 26.09 ? 7    GLU A C     1 
ATOM   538  O  O     . GLU C 3 7   ? 86.334 25.766  3.639   1.00 25.11 ? 7    GLU A O     1 
ATOM   539  C  CB    . GLU C 3 7   ? 85.846 25.987  6.664   1.00 27.63 ? 7    GLU A CB    1 
ATOM   540  C  CG    . GLU C 3 7   ? 85.534 25.323  8.016   1.00 26.93 ? 7    GLU A CG    1 
ATOM   541  C  CD    . GLU C 3 7   ? 84.257 25.839  8.673   1.00 27.85 ? 7    GLU A CD    1 
ATOM   542  O  OE1   . GLU C 3 7   ? 83.605 26.753  8.131   1.00 26.48 ? 7    GLU A OE1   1 
ATOM   543  O  OE2   . GLU C 3 7   ? 83.900 25.329  9.749   1.00 32.65 ? 7    GLU A OE2   1 
ATOM   544  N  N     . ALA C 3 8   ? 84.629 27.227  3.689   1.00 26.07 ? 8    ALA A N     1 
ATOM   545  C  CA    . ALA C 3 8   ? 84.988 27.833  2.414   1.00 26.56 ? 8    ALA A CA    1 
ATOM   546  C  C     . ALA C 3 8   ? 84.943 29.355  2.500   1.00 27.09 ? 8    ALA A C     1 
ATOM   547  O  O     . ALA C 3 8   ? 84.458 29.907  3.490   1.00 27.46 ? 8    ALA A O     1 
ATOM   548  C  CB    . ALA C 3 8   ? 84.054 27.320  1.318   1.00 26.64 ? 8    ALA A CB    1 
ATOM   549  N  N     . ASN C 3 9   ? 85.417 30.029  1.453   1.00 26.97 ? 9    ASN A N     1 
ATOM   550  C  CA    . ASN C 3 9   ? 85.490 31.494  1.452   1.00 27.14 ? 9    ASN A CA    1 
ATOM   551  C  C     . ASN C 3 9   ? 84.217 32.324  1.285   1.00 28.63 ? 9    ASN A C     1 
ATOM   552  O  O     . ASN C 3 9   ? 84.261 33.537  1.479   1.00 30.78 ? 9    ASN A O     1 
ATOM   553  C  CB    . ASN C 3 9   ? 86.542 31.957  0.424   1.00 27.27 ? 9    ASN A CB    1 
ATOM   554  C  CG    . ASN C 3 9   ? 86.051 31.873  -1.027  1.00 28.09 ? 9    ASN A CG    1 
ATOM   555  O  OD1   . ASN C 3 9   ? 85.201 31.053  -1.372  1.00 27.49 ? 9    ASN A OD1   1 
ATOM   556  N  ND2   . ASN C 3 9   ? 86.610 32.723  -1.884  1.00 26.85 ? 9    ASN A ND2   1 
ATOM   557  N  N     . ALA C 3 10  ? 83.087 31.706  0.943   1.00 27.87 ? 10   ALA A N     1 
ATOM   558  C  CA    . ALA C 3 10  ? 81.851 32.475  0.771   1.00 26.25 ? 10   ALA A CA    1 
ATOM   559  C  C     . ALA C 3 10  ? 80.598 31.617  0.598   1.00 27.48 ? 10   ALA A C     1 
ATOM   560  O  O     . ALA C 3 10  ? 80.671 30.387  0.581   1.00 27.27 ? 10   ALA A O     1 
ATOM   561  C  CB    . ALA C 3 10  ? 81.994 33.413  -0.430  1.00 23.67 ? 10   ALA A CB    1 
ATOM   562  N  N     . LEU C 3 11  ? 79.445 32.275  0.480   1.00 27.43 ? 11   LEU A N     1 
ATOM   563  C  CA    . LEU C 3 11  ? 78.193 31.560  0.260   1.00 28.04 ? 11   LEU A CA    1 
ATOM   564  C  C     . LEU C 3 11  ? 78.298 30.868  -1.103  1.00 27.60 ? 11   LEU A C     1 
ATOM   565  O  O     . LEU C 3 11  ? 79.113 31.257  -1.945  1.00 27.19 ? 11   LEU A O     1 
ATOM   566  C  CB    . LEU C 3 11  ? 77.001 32.523  0.271   1.00 29.46 ? 11   LEU A CB    1 
ATOM   567  C  CG    . LEU C 3 11  ? 76.669 33.236  1.592   1.00 33.25 ? 11   LEU A CG    1 
ATOM   568  C  CD1   . LEU C 3 11  ? 75.621 34.304  1.337   1.00 32.37 ? 11   LEU A CD1   1 
ATOM   569  C  CD2   . LEU C 3 11  ? 76.171 32.233  2.635   1.00 32.66 ? 11   LEU A CD2   1 
ATOM   570  N  N     . LEU C 3 12  ? 77.468 29.848  -1.311  1.00 27.64 ? 12   LEU A N     1 
ATOM   571  C  CA    . LEU C 3 12  ? 77.476 29.062  -2.540  1.00 27.12 ? 12   LEU A CA    1 
ATOM   572  C  C     . LEU C 3 12  ? 77.551 29.862  -3.829  1.00 27.49 ? 12   LEU A C     1 
ATOM   573  O  O     . LEU C 3 12  ? 78.291 29.501  -4.740  1.00 27.61 ? 12   LEU A O     1 
ATOM   574  C  CB    . LEU C 3 12  ? 76.242 28.157  -2.587  1.00 25.22 ? 12   LEU A CB    1 
ATOM   575  C  CG    . LEU C 3 12  ? 76.032 27.364  -3.882  1.00 24.76 ? 12   LEU A CG    1 
ATOM   576  C  CD1   . LEU C 3 12  ? 77.172 26.357  -4.067  1.00 24.52 ? 12   LEU A CD1   1 
ATOM   577  C  CD2   . LEU C 3 12  ? 74.683 26.645  -3.828  1.00 22.78 ? 12   LEU A CD2   1 
ATOM   578  N  N     . GLU C 3 13  ? 76.785 30.945  -3.899  1.00 29.59 ? 13   GLU A N     1 
ATOM   579  C  CA    . GLU C 3 13  ? 76.724 31.785  -5.090  1.00 31.99 ? 13   GLU A CA    1 
ATOM   580  C  C     . GLU C 3 13  ? 78.068 32.309  -5.583  1.00 31.64 ? 13   GLU A C     1 
ATOM   581  O  O     . GLU C 3 13  ? 78.297 32.393  -6.784  1.00 31.04 ? 13   GLU A O     1 
ATOM   582  C  CB    . GLU C 3 13  ? 75.782 32.980  -4.852  1.00 35.50 ? 13   GLU A CB    1 
ATOM   583  C  CG    . GLU C 3 13  ? 74.404 32.601  -4.321  1.00 41.29 ? 13   GLU A CG    1 
ATOM   584  C  CD    . GLU C 3 13  ? 74.386 32.340  -2.812  1.00 44.40 ? 13   GLU A CD    1 
ATOM   585  O  OE1   . GLU C 3 13  ? 74.449 33.327  -2.041  1.00 48.13 ? 13   GLU A OE1   1 
ATOM   586  O  OE2   . GLU C 3 13  ? 74.309 31.159  -2.398  1.00 41.60 ? 13   GLU A OE2   1 
ATOM   587  N  N     . SER C 3 14  ? 78.958 32.661  -4.667  1.00 30.02 ? 14   SER A N     1 
ATOM   588  C  CA    . SER C 3 14  ? 80.240 33.197  -5.078  1.00 30.61 ? 14   SER A CA    1 
ATOM   589  C  C     . SER C 3 14  ? 81.446 32.477  -4.495  1.00 30.96 ? 14   SER A C     1 
ATOM   590  O  O     . SER C 3 14  ? 82.564 32.988  -4.588  1.00 31.73 ? 14   SER A O     1 
ATOM   591  C  CB    . SER C 3 14  ? 80.309 34.679  -4.710  1.00 31.09 ? 14   SER A CB    1 
ATOM   592  O  OG    . SER C 3 14  ? 80.008 34.874  -3.336  1.00 32.93 ? 14   SER A OG    1 
ATOM   593  N  N     . VAL C 3 15  ? 81.241 31.296  -3.910  1.00 29.91 ? 15   VAL A N     1 
ATOM   594  C  CA    . VAL C 3 15  ? 82.362 30.578  -3.307  1.00 28.51 ? 15   VAL A CA    1 
ATOM   595  C  C     . VAL C 3 15  ? 83.397 30.233  -4.367  1.00 28.60 ? 15   VAL A C     1 
ATOM   596  O  O     . VAL C 3 15  ? 83.043 29.823  -5.471  1.00 28.92 ? 15   VAL A O     1 
ATOM   597  C  CB    . VAL C 3 15  ? 81.897 29.291  -2.564  1.00 26.96 ? 15   VAL A CB    1 
ATOM   598  C  CG1   . VAL C 3 15  ? 81.412 28.244  -3.553  1.00 26.85 ? 15   VAL A CG1   1 
ATOM   599  C  CG2   . VAL C 3 15  ? 83.033 28.745  -1.711  1.00 23.87 ? 15   VAL A CG2   1 
ATOM   600  N  N     . THR C 3 16  ? 84.674 30.425  -4.032  1.00 28.32 ? 16   THR A N     1 
ATOM   601  C  CA    . THR C 3 16  ? 85.764 30.142  -4.959  1.00 29.37 ? 16   THR A CA    1 
ATOM   602  C  C     . THR C 3 16  ? 86.928 29.390  -4.320  1.00 29.26 ? 16   THR A C     1 
ATOM   603  O  O     . THR C 3 16  ? 87.843 28.961  -5.016  1.00 31.96 ? 16   THR A O     1 
ATOM   604  C  CB    . THR C 3 16  ? 86.348 31.436  -5.561  1.00 29.72 ? 16   THR A CB    1 
ATOM   605  O  OG1   . THR C 3 16  ? 86.843 32.264  -4.502  1.00 32.79 ? 16   THR A OG1   1 
ATOM   606  C  CG2   . THR C 3 16  ? 85.296 32.197  -6.355  1.00 29.58 ? 16   THR A CG2   1 
ATOM   607  N  N     . LYS C 3 17  ? 86.904 29.224  -3.006  1.00 28.97 ? 17   LYS A N     1 
ATOM   608  C  CA    . LYS C 3 17  ? 88.002 28.540  -2.338  1.00 29.79 ? 17   LYS A CA    1 
ATOM   609  C  C     . LYS C 3 17  ? 87.602 27.603  -1.218  1.00 28.61 ? 17   LYS A C     1 
ATOM   610  O  O     . LYS C 3 17  ? 86.749 27.922  -0.402  1.00 28.90 ? 17   LYS A O     1 
ATOM   611  C  CB    . LYS C 3 17  ? 88.992 29.548  -1.742  1.00 32.32 ? 17   LYS A CB    1 
ATOM   612  C  CG    . LYS C 3 17  ? 89.968 30.188  -2.703  1.00 36.79 ? 17   LYS A CG    1 
ATOM   613  C  CD    . LYS C 3 17  ? 90.921 31.102  -1.925  1.00 40.15 ? 17   LYS A CD    1 
ATOM   614  C  CE    . LYS C 3 17  ? 92.051 31.637  -2.800  1.00 42.05 ? 17   LYS A CE    1 
ATOM   615  N  NZ    . LYS C 3 17  ? 92.846 30.524  -3.403  1.00 43.11 ? 17   LYS A NZ    1 
ATOM   616  N  N     . PHE C 3 18  ? 88.261 26.452  -1.184  1.00 29.07 ? 18   PHE A N     1 
ATOM   617  C  CA    . PHE C 3 18  ? 88.064 25.447  -0.149  1.00 27.65 ? 18   PHE A CA    1 
ATOM   618  C  C     . PHE C 3 18  ? 89.147 25.799  0.864   1.00 27.71 ? 18   PHE A C     1 
ATOM   619  O  O     . PHE C 3 18  ? 90.329 25.854  0.512   1.00 28.10 ? 18   PHE A O     1 
ATOM   620  C  CB    . PHE C 3 18  ? 88.329 24.043  -0.719  1.00 25.03 ? 18   PHE A CB    1 
ATOM   621  C  CG    . PHE C 3 18  ? 88.378 22.947  0.318   1.00 24.04 ? 18   PHE A CG    1 
ATOM   622  C  CD1   . PHE C 3 18  ? 87.209 22.298  0.733   1.00 24.45 ? 18   PHE A CD1   1 
ATOM   623  C  CD2   . PHE C 3 18  ? 89.597 22.529  0.850   1.00 23.64 ? 18   PHE A CD2   1 
ATOM   624  C  CE1   . PHE C 3 18  ? 87.253 21.235  1.664   1.00 21.36 ? 18   PHE A CE1   1 
ATOM   625  C  CE2   . PHE C 3 18  ? 89.657 21.474  1.777   1.00 24.30 ? 18   PHE A CE2   1 
ATOM   626  C  CZ    . PHE C 3 18  ? 88.476 20.823  2.184   1.00 22.25 ? 18   PHE A CZ    1 
ATOM   627  N  N     . HIS C 3 19  ? 88.755 26.067  2.105   1.00 26.54 ? 19   HIS A N     1 
ATOM   628  C  CA    . HIS C 3 19  ? 89.737 26.386  3.130   1.00 26.38 ? 19   HIS A CA    1 
ATOM   629  C  C     . HIS C 3 19  ? 90.151 25.093  3.836   1.00 26.51 ? 19   HIS A C     1 
ATOM   630  O  O     . HIS C 3 19  ? 91.338 24.768  3.902   1.00 24.59 ? 19   HIS A O     1 
ATOM   631  C  CB    . HIS C 3 19  ? 89.165 27.395  4.142   1.00 27.24 ? 19   HIS A CB    1 
ATOM   632  C  CG    . HIS C 3 19  ? 89.040 28.791  3.603   1.00 28.17 ? 19   HIS A CG    1 
ATOM   633  N  ND1   . HIS C 3 19  ? 90.052 29.412  2.899   1.00 28.00 ? 19   HIS A ND1   1 
ATOM   634  C  CD2   . HIS C 3 19  ? 88.040 29.699  3.699   1.00 28.37 ? 19   HIS A CD2   1 
ATOM   635  C  CE1   . HIS C 3 19  ? 89.681 30.641  2.588   1.00 27.22 ? 19   HIS A CE1   1 
ATOM   636  N  NE2   . HIS C 3 19  ? 88.465 30.841  3.063   1.00 28.05 ? 19   HIS A NE2   1 
ATOM   637  N  N     . CYS C 3 20  ? 89.166 24.355  4.348   1.00 26.33 ? 20   CYS A N     1 
ATOM   638  C  CA    . CYS C 3 20  ? 89.426 23.094  5.040   1.00 26.45 ? 20   CYS A CA    1 
ATOM   639  C  C     . CYS C 3 20  ? 88.186 22.210  5.190   1.00 26.41 ? 20   CYS A C     1 
ATOM   640  O  O     . CYS C 3 20  ? 87.059 22.626  4.908   1.00 26.15 ? 20   CYS A O     1 
ATOM   641  C  CB    . CYS C 3 20  ? 90.025 23.361  6.428   1.00 24.52 ? 20   CYS A CB    1 
ATOM   642  S  SG    . CYS C 3 20  ? 89.016 24.405  7.511   1.00 26.72 ? 20   CYS A SG    1 
ATOM   643  N  N     . GLY C 3 21  ? 88.421 20.982  5.643   1.00 28.33 ? 21   GLY A N     1 
ATOM   644  C  CA    . GLY C 3 21  ? 87.353 20.024  5.855   1.00 27.25 ? 21   GLY A CA    1 
ATOM   645  C  C     . GLY C 3 21  ? 87.753 18.999  6.902   1.00 27.21 ? 21   GLY A C     1 
ATOM   646  O  O     . GLY C 3 21  ? 88.942 18.763  7.114   1.00 28.23 ? 21   GLY A O     1 
ATOM   647  N  N     . VAL C 3 22  ? 86.764 18.392  7.554   1.00 25.81 ? 22   VAL A N     1 
ATOM   648  C  CA    . VAL C 3 22  ? 87.004 17.383  8.580   1.00 24.95 ? 22   VAL A CA    1 
ATOM   649  C  C     . VAL C 3 22  ? 86.122 16.154  8.339   1.00 25.53 ? 22   VAL A C     1 
ATOM   650  O  O     . VAL C 3 22  ? 84.953 16.284  7.958   1.00 27.95 ? 22   VAL A O     1 
ATOM   651  C  CB    . VAL C 3 22  ? 86.704 17.948  9.993   1.00 24.21 ? 22   VAL A CB    1 
ATOM   652  C  CG1   . VAL C 3 22  ? 86.803 16.840  11.037  1.00 21.23 ? 22   VAL A CG1   1 
ATOM   653  C  CG2   . VAL C 3 22  ? 87.678 19.074  10.319  1.00 22.50 ? 22   VAL A CG2   1 
ATOM   654  N  N     . ILE C 3 23  ? 86.684 14.968  8.557   1.00 24.61 ? 23   ILE A N     1 
ATOM   655  C  CA    . ILE C 3 23  ? 85.949 13.725  8.365   1.00 26.05 ? 23   ILE A CA    1 
ATOM   656  C  C     . ILE C 3 23  ? 86.090 12.775  9.546   1.00 28.21 ? 23   ILE A C     1 
ATOM   657  O  O     . ILE C 3 23  ? 87.204 12.397  9.917   1.00 28.70 ? 23   ILE A O     1 
ATOM   658  C  CB    . ILE C 3 23  ? 86.436 12.936  7.122   1.00 24.63 ? 23   ILE A CB    1 
ATOM   659  C  CG1   . ILE C 3 23  ? 86.277 13.764  5.850   1.00 23.37 ? 23   ILE A CG1   1 
ATOM   660  C  CG2   . ILE C 3 23  ? 85.650 11.639  6.995   1.00 23.54 ? 23   ILE A CG2   1 
ATOM   661  C  CD1   . ILE C 3 23  ? 86.634 12.989  4.588   1.00 22.12 ? 23   ILE A CD1   1 
ATOM   662  N  N     . TYR C 3 24  ? 84.963 12.398  10.141  1.00 29.54 ? 24   TYR A N     1 
ATOM   663  C  CA    . TYR C 3 24  ? 84.981 11.435  11.232  1.00 30.20 ? 24   TYR A CA    1 
ATOM   664  C  C     . TYR C 3 24  ? 84.477 10.138  10.612  1.00 30.63 ? 24   TYR A C     1 
ATOM   665  O  O     . TYR C 3 24  ? 83.397 10.103  10.024  1.00 31.24 ? 24   TYR A O     1 
ATOM   666  C  CB    . TYR C 3 24  ? 84.043 11.840  12.370  1.00 30.49 ? 24   TYR A CB    1 
ATOM   667  C  CG    . TYR C 3 24  ? 83.850 10.725  13.375  1.00 31.67 ? 24   TYR A CG    1 
ATOM   668  C  CD1   . TYR C 3 24  ? 84.780 10.502  14.392  1.00 32.29 ? 24   TYR A CD1   1 
ATOM   669  C  CD2   . TYR C 3 24  ? 82.768 9.846   13.268  1.00 32.50 ? 24   TYR A CD2   1 
ATOM   670  C  CE1   . TYR C 3 24  ? 84.639 9.426   15.276  1.00 32.55 ? 24   TYR A CE1   1 
ATOM   671  C  CE2   . TYR C 3 24  ? 82.617 8.770   14.140  1.00 33.03 ? 24   TYR A CE2   1 
ATOM   672  C  CZ    . TYR C 3 24  ? 83.556 8.562   15.141  1.00 33.26 ? 24   TYR A CZ    1 
ATOM   673  O  OH    . TYR C 3 24  ? 83.423 7.478   15.985  1.00 32.02 ? 24   TYR A OH    1 
ATOM   674  N  N     . ASP C 3 25  ? 85.258 9.074   10.743  1.00 31.30 ? 25   ASP A N     1 
ATOM   675  C  CA    . ASP C 3 25  ? 84.886 7.785   10.183  1.00 29.71 ? 25   ASP A CA    1 
ATOM   676  C  C     . ASP C 3 25  ? 84.483 6.823   11.302  1.00 31.52 ? 25   ASP A C     1 
ATOM   677  O  O     . ASP C 3 25  ? 85.278 6.534   12.194  1.00 31.10 ? 25   ASP A O     1 
ATOM   678  C  CB    . ASP C 3 25  ? 86.062 7.204   9.401   1.00 28.02 ? 25   ASP A CB    1 
ATOM   679  C  CG    . ASP C 3 25  ? 85.650 6.072   8.494   1.00 28.96 ? 25   ASP A CG    1 
ATOM   680  O  OD1   . ASP C 3 25  ? 84.732 5.307   8.863   1.00 30.03 ? 25   ASP A OD1   1 
ATOM   681  O  OD2   . ASP C 3 25  ? 86.252 5.935   7.410   1.00 32.24 ? 25   ASP A OD2   1 
ATOM   682  N  N     . TYR C 3 26  ? 83.251 6.325   11.248  1.00 31.73 ? 26   TYR A N     1 
ATOM   683  C  CA    . TYR C 3 26  ? 82.751 5.402   12.263  1.00 31.80 ? 26   TYR A CA    1 
ATOM   684  C  C     . TYR C 3 26  ? 83.509 4.085   12.349  1.00 32.97 ? 26   TYR A C     1 
ATOM   685  O  O     . TYR C 3 26  ? 83.627 3.514   13.434  1.00 32.78 ? 26   TYR A O     1 
ATOM   686  C  CB    . TYR C 3 26  ? 81.272 5.100   12.027  1.00 30.44 ? 26   TYR A CB    1 
ATOM   687  C  CG    . TYR C 3 26  ? 80.332 6.039   12.743  1.00 31.00 ? 26   TYR A CG    1 
ATOM   688  C  CD1   . TYR C 3 26  ? 80.059 5.888   14.106  1.00 29.31 ? 26   TYR A CD1   1 
ATOM   689  C  CD2   . TYR C 3 26  ? 79.732 7.097   12.064  1.00 28.78 ? 26   TYR A CD2   1 
ATOM   690  C  CE1   . TYR C 3 26  ? 79.210 6.775   14.767  1.00 28.10 ? 26   TYR A CE1   1 
ATOM   691  C  CE2   . TYR C 3 26  ? 78.892 7.983   12.715  1.00 26.52 ? 26   TYR A CE2   1 
ATOM   692  C  CZ    . TYR C 3 26  ? 78.632 7.823   14.058  1.00 27.96 ? 26   TYR A CZ    1 
ATOM   693  O  OH    . TYR C 3 26  ? 77.802 8.730   14.684  1.00 26.62 ? 26   TYR A OH    1 
ATOM   694  N  N     . SER C 3 27  ? 84.013 3.592   11.222  1.00 33.82 ? 27   SER A N     1 
ATOM   695  C  CA    . SER C 3 27  ? 84.739 2.325   11.233  1.00 35.84 ? 27   SER A CA    1 
ATOM   696  C  C     . SER C 3 27  ? 86.107 2.422   11.915  1.00 36.95 ? 27   SER A C     1 
ATOM   697  O  O     . SER C 3 27  ? 86.592 1.438   12.475  1.00 38.28 ? 27   SER A O     1 
ATOM   698  C  CB    . SER C 3 27  ? 84.894 1.784   9.809   1.00 34.25 ? 27   SER A CB    1 
ATOM   699  O  OG    . SER C 3 27  ? 85.522 2.731   8.969   1.00 37.51 ? 27   SER A OG    1 
ATOM   700  N  N     . THR C 3 28  ? 86.725 3.600   11.875  1.00 36.82 ? 28   THR A N     1 
ATOM   701  C  CA    . THR C 3 28  ? 88.028 3.790   12.513  1.00 36.95 ? 28   THR A CA    1 
ATOM   702  C  C     . THR C 3 28  ? 87.856 4.568   13.808  1.00 36.78 ? 28   THR A C     1 
ATOM   703  O  O     . THR C 3 28  ? 88.686 4.478   14.706  1.00 37.47 ? 28   THR A O     1 
ATOM   704  C  CB    . THR C 3 28  ? 89.005 4.588   11.615  1.00 36.42 ? 28   THR A CB    1 
ATOM   705  O  OG1   . THR C 3 28  ? 88.472 5.898   11.372  1.00 35.94 ? 28   THR A OG1   1 
ATOM   706  C  CG2   . THR C 3 28  ? 89.224 3.876   10.294  1.00 35.20 ? 28   THR A CG2   1 
ATOM   707  N  N     . ALA C 3 29  ? 86.771 5.334   13.883  1.00 36.77 ? 29   ALA A N     1 
ATOM   708  C  CA    . ALA C 3 29  ? 86.448 6.159   15.041  1.00 36.66 ? 29   ALA A CA    1 
ATOM   709  C  C     . ALA C 3 29  ? 87.436 7.315   15.225  1.00 37.36 ? 29   ALA A C     1 
ATOM   710  O  O     . ALA C 3 29  ? 87.684 7.763   16.346  1.00 38.72 ? 29   ALA A O     1 
ATOM   711  C  CB    . ALA C 3 29  ? 86.393 5.302   16.309  1.00 37.05 ? 29   ALA A CB    1 
ATOM   712  N  N     . GLU C 3 30  ? 87.987 7.815   14.125  1.00 37.41 ? 30   GLU A N     1 
ATOM   713  C  CA    . GLU C 3 30  ? 88.936 8.920   14.217  1.00 37.88 ? 30   GLU A CA    1 
ATOM   714  C  C     . GLU C 3 30  ? 88.546 10.119  13.358  1.00 36.69 ? 30   GLU A C     1 
ATOM   715  O  O     . GLU C 3 30  ? 87.814 9.983   12.370  1.00 34.37 ? 30   GLU A O     1 
ATOM   716  C  CB    . GLU C 3 30  ? 90.328 8.447   13.801  1.00 39.64 ? 30   GLU A CB    1 
ATOM   717  C  CG    . GLU C 3 30  ? 90.654 7.048   14.280  1.00 44.29 ? 30   GLU A CG    1 
ATOM   718  C  CD    . GLU C 3 30  ? 91.981 6.551   13.755  1.00 47.58 ? 30   GLU A CD    1 
ATOM   719  O  OE1   . GLU C 3 30  ? 92.327 6.889   12.597  1.00 49.63 ? 30   GLU A OE1   1 
ATOM   720  O  OE2   . GLU C 3 30  ? 92.670 5.811   14.494  1.00 48.57 ? 30   GLU A OE2   1 
ATOM   721  N  N     . TYR C 3 31  ? 89.030 11.292  13.762  1.00 34.78 ? 31   TYR A N     1 
ATOM   722  C  CA    . TYR C 3 31  ? 88.796 12.527  13.027  1.00 34.14 ? 31   TYR A CA    1 
ATOM   723  C  C     . TYR C 3 31  ? 90.064 12.827  12.233  1.00 34.10 ? 31   TYR A C     1 
ATOM   724  O  O     . TYR C 3 31  ? 91.171 12.714  12.762  1.00 34.57 ? 31   TYR A O     1 
ATOM   725  C  CB    . TYR C 3 31  ? 88.542 13.703  13.972  1.00 33.81 ? 31   TYR A CB    1 
ATOM   726  C  CG    . TYR C 3 31  ? 87.278 13.615  14.790  1.00 34.31 ? 31   TYR A CG    1 
ATOM   727  C  CD1   . TYR C 3 31  ? 87.236 12.876  15.975  1.00 34.15 ? 31   TYR A CD1   1 
ATOM   728  C  CD2   . TYR C 3 31  ? 86.126 14.293  14.393  1.00 33.92 ? 31   TYR A CD2   1 
ATOM   729  C  CE1   . TYR C 3 31  ? 86.071 12.823  16.751  1.00 33.96 ? 31   TYR A CE1   1 
ATOM   730  C  CE2   . TYR C 3 31  ? 84.961 14.242  15.153  1.00 34.20 ? 31   TYR A CE2   1 
ATOM   731  C  CZ    . TYR C 3 31  ? 84.940 13.509  16.333  1.00 34.93 ? 31   TYR A CZ    1 
ATOM   732  O  OH    . TYR C 3 31  ? 83.796 13.482  17.098  1.00 36.26 ? 31   TYR A OH    1 
ATOM   733  N  N     . VAL C 3 32  ? 89.899 13.217  10.973  1.00 33.18 ? 32   VAL A N     1 
ATOM   734  C  CA    . VAL C 3 32  ? 91.025 13.557  10.103  1.00 30.69 ? 32   VAL A CA    1 
ATOM   735  C  C     . VAL C 3 32  ? 90.803 14.939  9.491   1.00 30.84 ? 32   VAL A C     1 
ATOM   736  O  O     . VAL C 3 32  ? 89.768 15.192  8.867   1.00 29.82 ? 32   VAL A O     1 
ATOM   737  C  CB    . VAL C 3 32  ? 91.173 12.534  8.964   1.00 29.93 ? 32   VAL A CB    1 
ATOM   738  C  CG1   . VAL C 3 32  ? 92.346 12.917  8.076   1.00 30.01 ? 32   VAL A CG1   1 
ATOM   739  C  CG2   . VAL C 3 32  ? 91.367 11.128  9.545   1.00 29.27 ? 32   VAL A CG2   1 
ATOM   740  N  N     . SER C 3 33  ? 91.774 15.831  9.669   1.00 30.40 ? 33   SER A N     1 
ATOM   741  C  CA    . SER C 3 33  ? 91.673 17.185  9.143   1.00 29.67 ? 33   SER A CA    1 
ATOM   742  C  C     . SER C 3 33  ? 92.293 17.317  7.766   1.00 29.12 ? 33   SER A C     1 
ATOM   743  O  O     . SER C 3 33  ? 93.284 16.663  7.459   1.00 27.51 ? 33   SER A O     1 
ATOM   744  C  CB    . SER C 3 33  ? 92.355 18.177  10.086  1.00 30.04 ? 33   SER A CB    1 
ATOM   745  O  OG    . SER C 3 33  ? 91.663 18.276  11.314  1.00 31.27 ? 33   SER A OG    1 
ATOM   746  N  N     . TYR C 3 34  ? 91.699 18.171  6.941   1.00 28.67 ? 34   TYR A N     1 
ATOM   747  C  CA    . TYR C 3 34  ? 92.205 18.417  5.596   1.00 29.72 ? 34   TYR A CA    1 
ATOM   748  C  C     . TYR C 3 34  ? 92.338 19.920  5.411   1.00 30.46 ? 34   TYR A C     1 
ATOM   749  O  O     . TYR C 3 34  ? 91.338 20.646  5.394   1.00 28.98 ? 34   TYR A O     1 
ATOM   750  C  CB    . TYR C 3 34  ? 91.251 17.863  4.546   1.00 29.33 ? 34   TYR A CB    1 
ATOM   751  C  CG    . TYR C 3 34  ? 91.020 16.377  4.646   1.00 30.91 ? 34   TYR A CG    1 
ATOM   752  C  CD1   . TYR C 3 34  ? 90.234 15.841  5.668   1.00 30.45 ? 34   TYR A CD1   1 
ATOM   753  C  CD2   . TYR C 3 34  ? 91.557 15.506  3.701   1.00 29.91 ? 34   TYR A CD2   1 
ATOM   754  C  CE1   . TYR C 3 34  ? 89.986 14.477  5.742   1.00 29.70 ? 34   TYR A CE1   1 
ATOM   755  C  CE2   . TYR C 3 34  ? 91.316 14.140  3.766   1.00 30.02 ? 34   TYR A CE2   1 
ATOM   756  C  CZ    . TYR C 3 34  ? 90.530 13.632  4.789   1.00 30.18 ? 34   TYR A CZ    1 
ATOM   757  O  OH    . TYR C 3 34  ? 90.299 12.276  4.866   1.00 31.33 ? 34   TYR A OH    1 
ATOM   758  N  N     . ARG C 3 35  ? 93.576 20.388  5.281   1.00 31.69 ? 35   ARG A N     1 
ATOM   759  C  CA    . ARG C 3 35  ? 93.830 21.815  5.114   1.00 31.68 ? 35   ARG A CA    1 
ATOM   760  C  C     . ARG C 3 35  ? 93.786 22.197  3.634   1.00 30.92 ? 35   ARG A C     1 
ATOM   761  O  O     . ARG C 3 35  ? 93.588 21.330  2.783   1.00 31.83 ? 35   ARG A O     1 
ATOM   762  C  CB    . ARG C 3 35  ? 95.161 22.158  5.781   1.00 32.69 ? 35   ARG A CB    1 
ATOM   763  C  CG    . ARG C 3 35  ? 95.102 21.930  7.290   1.00 35.68 ? 35   ARG A CG    1 
ATOM   764  C  CD    . ARG C 3 35  ? 96.409 22.254  8.010   1.00 38.91 ? 35   ARG A CD    1 
ATOM   765  N  NE    . ARG C 3 35  ? 96.242 22.216  9.464   1.00 39.47 ? 35   ARG A NE    1 
ATOM   766  C  CZ    . ARG C 3 35  ? 95.997 21.111  10.164  1.00 40.25 ? 35   ARG A CZ    1 
ATOM   767  N  NH1   . ARG C 3 35  ? 95.895 19.936  9.551   1.00 40.60 ? 35   ARG A NH1   1 
ATOM   768  N  NH2   . ARG C 3 35  ? 95.838 21.183  11.478  1.00 41.19 ? 35   ARG A NH2   1 
ATOM   769  N  N     . PRO C 3 36  ? 93.966 23.490  3.304   1.00 29.89 ? 36   PRO A N     1 
ATOM   770  C  CA    . PRO C 3 36  ? 93.928 23.959  1.915   1.00 30.30 ? 36   PRO A CA    1 
ATOM   771  C  C     . PRO C 3 36  ? 94.499 23.055  0.824   1.00 30.31 ? 36   PRO A C     1 
ATOM   772  O  O     . PRO C 3 36  ? 93.847 22.820  -0.190  1.00 31.62 ? 36   PRO A O     1 
ATOM   773  C  CB    . PRO C 3 36  ? 94.648 25.302  1.990   1.00 30.06 ? 36   PRO A CB    1 
ATOM   774  C  CG    . PRO C 3 36  ? 94.228 25.808  3.319   1.00 29.00 ? 36   PRO A CG    1 
ATOM   775  C  CD    . PRO C 3 36  ? 94.389 24.588  4.196   1.00 29.72 ? 36   PRO A CD    1 
ATOM   776  N  N     . SER C 3 37  ? 95.709 22.550  1.019   1.00 30.76 ? 37   SER A N     1 
ATOM   777  C  CA    . SER C 3 37  ? 96.320 21.698  0.009   1.00 30.78 ? 37   SER A CA    1 
ATOM   778  C  C     . SER C 3 37  ? 95.864 20.239  0.062   1.00 30.87 ? 37   SER A C     1 
ATOM   779  O  O     . SER C 3 37  ? 96.321 19.423  -0.743  1.00 30.80 ? 37   SER A O     1 
ATOM   780  C  CB    . SER C 3 37  ? 97.845 21.767  0.122   1.00 31.23 ? 37   SER A CB    1 
ATOM   781  O  OG    . SER C 3 37  ? 98.281 21.421  1.428   1.00 34.37 ? 37   SER A OG    1 
ATOM   782  N  N     . ASP C 3 38  ? 94.971 19.906  0.996   1.00 29.13 ? 38   ASP A N     1 
ATOM   783  C  CA    . ASP C 3 38  ? 94.479 18.530  1.112   1.00 28.89 ? 38   ASP A CA    1 
ATOM   784  C  C     . ASP C 3 38  ? 93.132 18.343  0.432   1.00 29.04 ? 38   ASP A C     1 
ATOM   785  O  O     . ASP C 3 38  ? 92.515 17.286  0.542   1.00 29.95 ? 38   ASP A O     1 
ATOM   786  C  CB    . ASP C 3 38  ? 94.342 18.123  2.580   1.00 28.83 ? 38   ASP A CB    1 
ATOM   787  C  CG    . ASP C 3 38  ? 95.656 18.208  3.335   1.00 28.45 ? 38   ASP A CG    1 
ATOM   788  O  OD1   . ASP C 3 38  ? 96.668 17.719  2.807   1.00 28.47 ? 38   ASP A OD1   1 
ATOM   789  O  OD2   . ASP C 3 38  ? 95.675 18.757  4.458   1.00 28.75 ? 38   ASP A OD2   1 
ATOM   790  N  N     . PHE C 3 39  ? 92.682 19.371  -0.276  1.00 29.14 ? 39   PHE A N     1 
ATOM   791  C  CA    . PHE C 3 39  ? 91.389 19.331  -0.942  1.00 28.56 ? 39   PHE A CA    1 
ATOM   792  C  C     . PHE C 3 39  ? 91.178 18.095  -1.820  1.00 28.52 ? 39   PHE A C     1 
ATOM   793  O  O     . PHE C 3 39  ? 90.128 17.463  -1.766  1.00 29.21 ? 39   PHE A O     1 
ATOM   794  C  CB    . PHE C 3 39  ? 91.198 20.622  -1.750  1.00 27.70 ? 39   PHE A CB    1 
ATOM   795  C  CG    . PHE C 3 39  ? 89.838 20.759  -2.371  1.00 26.25 ? 39   PHE A CG    1 
ATOM   796  C  CD1   . PHE C 3 39  ? 88.704 20.268  -1.722  1.00 25.33 ? 39   PHE A CD1   1 
ATOM   797  C  CD2   . PHE C 3 39  ? 89.683 21.396  -3.599  1.00 25.00 ? 39   PHE A CD2   1 
ATOM   798  C  CE1   . PHE C 3 39  ? 87.440 20.409  -2.290  1.00 24.10 ? 39   PHE A CE1   1 
ATOM   799  C  CE2   . PHE C 3 39  ? 88.419 21.543  -4.177  1.00 24.55 ? 39   PHE A CE2   1 
ATOM   800  C  CZ    . PHE C 3 39  ? 87.296 21.047  -3.520  1.00 24.12 ? 39   PHE A CZ    1 
ATOM   801  N  N     . GLY C 3 40  ? 92.173 17.742  -2.622  1.00 29.17 ? 40   GLY A N     1 
ATOM   802  C  CA    . GLY C 3 40  ? 92.028 16.576  -3.472  1.00 28.22 ? 40   GLY A CA    1 
ATOM   803  C  C     . GLY C 3 40  ? 91.815 15.332  -2.632  1.00 29.23 ? 40   GLY A C     1 
ATOM   804  O  O     . GLY C 3 40  ? 90.952 14.502  -2.919  1.00 29.78 ? 40   GLY A O     1 
ATOM   805  N  N     . ALA C 3 41  ? 92.616 15.210  -1.582  1.00 28.63 ? 41   ALA A N     1 
ATOM   806  C  CA    . ALA C 3 41  ? 92.535 14.076  -0.678  1.00 28.24 ? 41   ALA A CA    1 
ATOM   807  C  C     . ALA C 3 41  ? 91.161 14.045  -0.014  1.00 27.63 ? 41   ALA A C     1 
ATOM   808  O  O     . ALA C 3 41  ? 90.546 12.985  0.117   1.00 27.10 ? 41   ALA A O     1 
ATOM   809  C  CB    . ALA C 3 41  ? 93.636 14.176  0.382   1.00 26.73 ? 41   ALA A CB    1 
ATOM   810  N  N     . TYR C 3 42  ? 90.687 15.212  0.412   1.00 26.36 ? 42   TYR A N     1 
ATOM   811  C  CA    . TYR C 3 42  ? 89.378 15.300  1.053   1.00 26.82 ? 42   TYR A CA    1 
ATOM   812  C  C     . TYR C 3 42  ? 88.310 14.680  0.154   1.00 26.82 ? 42   TYR A C     1 
ATOM   813  O  O     . TYR C 3 42  ? 87.497 13.867  0.598   1.00 27.26 ? 42   TYR A O     1 
ATOM   814  C  CB    . TYR C 3 42  ? 89.016 16.754  1.339   1.00 24.52 ? 42   TYR A CB    1 
ATOM   815  C  CG    . TYR C 3 42  ? 87.628 16.912  1.895   1.00 23.41 ? 42   TYR A CG    1 
ATOM   816  C  CD1   . TYR C 3 42  ? 87.299 16.405  3.153   1.00 23.30 ? 42   TYR A CD1   1 
ATOM   817  C  CD2   . TYR C 3 42  ? 86.630 17.539  1.150   1.00 21.72 ? 42   TYR A CD2   1 
ATOM   818  C  CE1   . TYR C 3 42  ? 86.008 16.518  3.653   1.00 23.93 ? 42   TYR A CE1   1 
ATOM   819  C  CE2   . TYR C 3 42  ? 85.334 17.659  1.638   1.00 22.61 ? 42   TYR A CE2   1 
ATOM   820  C  CZ    . TYR C 3 42  ? 85.026 17.149  2.885   1.00 22.95 ? 42   TYR A CZ    1 
ATOM   821  O  OH    . TYR C 3 42  ? 83.743 17.263  3.361   1.00 19.95 ? 42   TYR A OH    1 
ATOM   822  N  N     . LEU C 3 43  ? 88.319 15.074  -1.114  1.00 27.20 ? 43   LEU A N     1 
ATOM   823  C  CA    . LEU C 3 43  ? 87.367 14.551  -2.084  1.00 26.96 ? 43   LEU A CA    1 
ATOM   824  C  C     . LEU C 3 43  ? 87.499 13.034  -2.238  1.00 26.66 ? 43   LEU A C     1 
ATOM   825  O  O     . LEU C 3 43  ? 86.500 12.325  -2.255  1.00 25.95 ? 43   LEU A O     1 
ATOM   826  C  CB    . LEU C 3 43  ? 87.572 15.227  -3.446  1.00 25.69 ? 43   LEU A CB    1 
ATOM   827  C  CG    . LEU C 3 43  ? 87.324 16.740  -3.518  1.00 27.70 ? 43   LEU A CG    1 
ATOM   828  C  CD1   . LEU C 3 43  ? 87.695 17.247  -4.910  1.00 25.78 ? 43   LEU A CD1   1 
ATOM   829  C  CD2   . LEU C 3 43  ? 85.864 17.053  -3.200  1.00 25.66 ? 43   LEU A CD2   1 
ATOM   830  N  N     . ASP C 3 44  ? 88.729 12.537  -2.349  1.00 27.52 ? 44   ASP A N     1 
ATOM   831  C  CA    . ASP C 3 44  ? 88.933 11.101  -2.514  1.00 28.26 ? 44   ASP A CA    1 
ATOM   832  C  C     . ASP C 3 44  ? 88.302 10.321  -1.367  1.00 27.82 ? 44   ASP A C     1 
ATOM   833  O  O     . ASP C 3 44  ? 87.687 9.267   -1.583  1.00 27.36 ? 44   ASP A O     1 
ATOM   834  C  CB    . ASP C 3 44  ? 90.430 10.757  -2.609  1.00 29.68 ? 44   ASP A CB    1 
ATOM   835  C  CG    . ASP C 3 44  ? 91.101 11.356  -3.843  1.00 31.27 ? 44   ASP A CG    1 
ATOM   836  O  OD1   . ASP C 3 44  ? 90.432 11.501  -4.891  1.00 31.75 ? 44   ASP A OD1   1 
ATOM   837  O  OD2   . ASP C 3 44  ? 92.309 11.664  -3.766  1.00 31.22 ? 44   ASP A OD2   1 
ATOM   838  N  N     . ALA C 3 45  ? 88.450 10.841  -0.150  1.00 27.16 ? 45   ALA A N     1 
ATOM   839  C  CA    . ALA C 3 45  ? 87.895 10.181  1.026   1.00 26.51 ? 45   ALA A CA    1 
ATOM   840  C  C     . ALA C 3 45  ? 86.374 10.057  0.895   1.00 26.83 ? 45   ALA A C     1 
ATOM   841  O  O     . ALA C 3 45  ? 85.801 9.009   1.209   1.00 27.18 ? 45   ALA A O     1 
ATOM   842  C  CB    . ALA C 3 45  ? 88.262 10.954  2.289   1.00 23.56 ? 45   ALA A CB    1 
ATOM   843  N  N     . LEU C 3 46  ? 85.727 11.120  0.419   1.00 25.59 ? 46   LEU A N     1 
ATOM   844  C  CA    . LEU C 3 46  ? 84.279 11.096  0.254   1.00 25.05 ? 46   LEU A CA    1 
ATOM   845  C  C     . LEU C 3 46  ? 83.866 10.098  -0.832  1.00 24.72 ? 46   LEU A C     1 
ATOM   846  O  O     . LEU C 3 46  ? 82.917 9.331   -0.649  1.00 24.81 ? 46   LEU A O     1 
ATOM   847  C  CB    . LEU C 3 46  ? 83.746 12.499  -0.072  1.00 23.30 ? 46   LEU A CB    1 
ATOM   848  C  CG    . LEU C 3 46  ? 84.020 13.611  0.956   1.00 25.78 ? 46   LEU A CG    1 
ATOM   849  C  CD1   . LEU C 3 46  ? 83.239 14.856  0.566   1.00 24.96 ? 46   LEU A CD1   1 
ATOM   850  C  CD2   . LEU C 3 46  ? 83.609 13.169  2.363   1.00 25.47 ? 46   LEU A CD2   1 
ATOM   851  N  N     . GLU C 3 47  ? 84.568 10.095  -1.960  1.00 24.35 ? 47   GLU A N     1 
ATOM   852  C  CA    . GLU C 3 47  ? 84.223 9.152   -3.021  1.00 26.58 ? 47   GLU A CA    1 
ATOM   853  C  C     . GLU C 3 47  ? 84.499 7.706   -2.599  1.00 27.44 ? 47   GLU A C     1 
ATOM   854  O  O     . GLU C 3 47  ? 83.814 6.786   -3.050  1.00 26.73 ? 47   GLU A O     1 
ATOM   855  C  CB    . GLU C 3 47  ? 84.987 9.470   -4.312  1.00 27.25 ? 47   GLU A CB    1 
ATOM   856  C  CG    . GLU C 3 47  ? 84.569 10.782  -4.961  1.00 28.62 ? 47   GLU A CG    1 
ATOM   857  C  CD    . GLU C 3 47  ? 85.305 11.066  -6.257  1.00 31.03 ? 47   GLU A CD    1 
ATOM   858  O  OE1   . GLU C 3 47  ? 86.537 10.836  -6.312  1.00 30.07 ? 47   GLU A OE1   1 
ATOM   859  O  OE2   . GLU C 3 47  ? 84.652 11.534  -7.216  1.00 30.23 ? 47   GLU A OE2   1 
ATOM   860  N  N     . ALA C 3 48  ? 85.498 7.502   -1.742  1.00 27.51 ? 48   ALA A N     1 
ATOM   861  C  CA    . ALA C 3 48  ? 85.815 6.153   -1.281  1.00 29.55 ? 48   ALA A CA    1 
ATOM   862  C  C     . ALA C 3 48  ? 84.611 5.593   -0.522  1.00 29.46 ? 48   ALA A C     1 
ATOM   863  O  O     . ALA C 3 48  ? 84.192 4.457   -0.763  1.00 31.20 ? 48   ALA A O     1 
ATOM   864  C  CB    . ALA C 3 48  ? 87.068 6.159   -0.375  1.00 27.01 ? 48   ALA A CB    1 
ATOM   865  N  N     . GLU C 3 49  ? 84.060 6.394   0.389   1.00 28.75 ? 49   GLU A N     1 
ATOM   866  C  CA    . GLU C 3 49  ? 82.893 5.985   1.163   1.00 29.16 ? 49   GLU A CA    1 
ATOM   867  C  C     . GLU C 3 49  ? 81.760 5.644   0.193   1.00 28.49 ? 49   GLU A C     1 
ATOM   868  O  O     . GLU C 3 49  ? 81.005 4.701   0.428   1.00 28.99 ? 49   GLU A O     1 
ATOM   869  C  CB    . GLU C 3 49  ? 82.462 7.106   2.127   1.00 28.03 ? 49   GLU A CB    1 
ATOM   870  C  CG    . GLU C 3 49  ? 81.251 6.791   3.022   1.00 28.67 ? 49   GLU A CG    1 
ATOM   871  C  CD    . GLU C 3 49  ? 81.496 5.669   4.050   1.00 30.44 ? 49   GLU A CD    1 
ATOM   872  O  OE1   . GLU C 3 49  ? 82.664 5.296   4.289   1.00 28.79 ? 49   GLU A OE1   1 
ATOM   873  O  OE2   . GLU C 3 49  ? 80.505 5.169   4.637   1.00 28.88 ? 49   GLU A OE2   1 
ATOM   874  N  N     . VAL C 3 50  ? 81.640 6.404   -0.894  1.00 28.09 ? 50   VAL A N     1 
ATOM   875  C  CA    . VAL C 3 50  ? 80.603 6.122   -1.886  1.00 26.92 ? 50   VAL A CA    1 
ATOM   876  C  C     . VAL C 3 50  ? 80.879 4.750   -2.517  1.00 28.01 ? 50   VAL A C     1 
ATOM   877  O  O     . VAL C 3 50  ? 79.959 3.959   -2.743  1.00 27.76 ? 50   VAL A O     1 
ATOM   878  C  CB    . VAL C 3 50  ? 80.569 7.190   -3.019  1.00 26.26 ? 50   VAL A CB    1 
ATOM   879  C  CG1   . VAL C 3 50  ? 79.596 6.758   -4.117  1.00 24.99 ? 50   VAL A CG1   1 
ATOM   880  C  CG2   . VAL C 3 50  ? 80.141 8.540   -2.463  1.00 23.15 ? 50   VAL A CG2   1 
ATOM   881  N  N     . ALA C 3 51  ? 82.151 4.470   -2.790  1.00 28.34 ? 51   ALA A N     1 
ATOM   882  C  CA    . ALA C 3 51  ? 82.542 3.194   -3.397  1.00 30.31 ? 51   ALA A CA    1 
ATOM   883  C  C     . ALA C 3 51  ? 82.178 1.982   -2.537  1.00 30.94 ? 51   ALA A C     1 
ATOM   884  O  O     . ALA C 3 51  ? 81.985 0.892   -3.068  1.00 32.12 ? 51   ALA A O     1 
ATOM   885  C  CB    . ALA C 3 51  ? 84.052 3.188   -3.709  1.00 28.61 ? 51   ALA A CB    1 
ATOM   886  N  N     . ARG C 3 52  ? 82.079 2.168   -1.221  1.00 31.65 ? 52   ARG A N     1 
ATOM   887  C  CA    . ARG C 3 52  ? 81.720 1.073   -0.316  1.00 31.67 ? 52   ARG A CA    1 
ATOM   888  C  C     . ARG C 3 52  ? 80.215 0.904   -0.163  1.00 30.88 ? 52   ARG A C     1 
ATOM   889  O  O     . ARG C 3 52  ? 79.766 -0.028  0.499   1.00 32.29 ? 52   ARG A O     1 
ATOM   890  C  CB    . ARG C 3 52  ? 82.273 1.308   1.087   1.00 32.59 ? 52   ARG A CB    1 
ATOM   891  C  CG    . ARG C 3 52  ? 83.764 1.262   1.213   1.00 33.74 ? 52   ARG A CG    1 
ATOM   892  C  CD    . ARG C 3 52  ? 84.172 1.886   2.528   1.00 34.92 ? 52   ARG A CD    1 
ATOM   893  N  NE    . ARG C 3 52  ? 85.442 2.570   2.358   1.00 39.03 ? 52   ARG A NE    1 
ATOM   894  C  CZ    . ARG C 3 52  ? 85.780 3.700   2.964   1.00 40.17 ? 52   ARG A CZ    1 
ATOM   895  N  NH1   . ARG C 3 52  ? 84.946 4.300   3.803   1.00 40.67 ? 52   ARG A NH1   1 
ATOM   896  N  NH2   . ARG C 3 52  ? 86.961 4.236   2.713   1.00 43.10 ? 52   ARG A NH2   1 
ATOM   897  N  N     . GLY C 3 53  ? 79.439 1.800   -0.759  1.00 29.68 ? 53   GLY A N     1 
ATOM   898  C  CA    . GLY C 3 53  ? 77.997 1.724   -0.610  1.00 27.32 ? 53   GLY A CA    1 
ATOM   899  C  C     . GLY C 3 53  ? 77.676 2.335   0.742   1.00 27.17 ? 53   GLY A C     1 
ATOM   900  O  O     . GLY C 3 53  ? 76.651 2.030   1.354   1.00 29.69 ? 53   GLY A O     1 
ATOM   901  N  N     . GLY C 3 54  ? 78.570 3.215   1.197   1.00 24.61 ? 54   GLY A N     1 
ATOM   902  C  CA    . GLY C 3 54  ? 78.424 3.872   2.481   1.00 22.74 ? 54   GLY A CA    1 
ATOM   903  C  C     . GLY C 3 54  ? 77.551 5.116   2.532   1.00 23.08 ? 54   GLY A C     1 
ATOM   904  O  O     . GLY C 3 54  ? 76.709 5.350   1.664   1.00 22.76 ? 54   GLY A O     1 
ATOM   905  N  N     . LEU C 3 55  ? 77.765 5.924   3.566   1.00 22.47 ? 55   LEU A N     1 
ATOM   906  C  CA    . LEU C 3 55  ? 76.987 7.137   3.778   1.00 23.22 ? 55   LEU A CA    1 
ATOM   907  C  C     . LEU C 3 55  ? 77.822 8.301   4.306   1.00 22.84 ? 55   LEU A C     1 
ATOM   908  O  O     . LEU C 3 55  ? 78.754 8.114   5.088   1.00 22.46 ? 55   LEU A O     1 
ATOM   909  C  CB    . LEU C 3 55  ? 75.846 6.848   4.759   1.00 23.26 ? 55   LEU A CB    1 
ATOM   910  C  CG    . LEU C 3 55  ? 74.742 5.934   4.228   1.00 24.55 ? 55   LEU A CG    1 
ATOM   911  C  CD1   . LEU C 3 55  ? 74.094 5.169   5.376   1.00 24.97 ? 55   LEU A CD1   1 
ATOM   912  C  CD2   . LEU C 3 55  ? 73.718 6.783   3.462   1.00 22.11 ? 55   LEU A CD2   1 
ATOM   913  N  N     . ILE C 3 56  ? 77.457 9.505   3.880   1.00 23.38 ? 56   ILE A N     1 
ATOM   914  C  CA    . ILE C 3 56  ? 78.143 10.720  4.297   1.00 21.88 ? 56   ILE A CA    1 
ATOM   915  C  C     . ILE C 3 56  ? 77.150 11.658  4.957   1.00 21.53 ? 56   ILE A C     1 
ATOM   916  O  O     . ILE C 3 56  ? 76.181 12.088  4.324   1.00 20.84 ? 56   ILE A O     1 
ATOM   917  C  CB    . ILE C 3 56  ? 78.765 11.439  3.091   1.00 22.11 ? 56   ILE A CB    1 
ATOM   918  C  CG1   . ILE C 3 56  ? 79.705 10.482  2.362   1.00 22.30 ? 56   ILE A CG1   1 
ATOM   919  C  CG2   . ILE C 3 56  ? 79.514 12.680  3.551   1.00 19.28 ? 56   ILE A CG2   1 
ATOM   920  C  CD1   . ILE C 3 56  ? 80.174 10.994  1.027   1.00 24.66 ? 56   ILE A CD1   1 
ATOM   921  N  N     . VAL C 3 57  ? 77.390 11.980  6.224   1.00 20.38 ? 57   VAL A N     1 
ATOM   922  C  CA    . VAL C 3 57  ? 76.504 12.876  6.948   1.00 19.48 ? 57   VAL A CA    1 
ATOM   923  C  C     . VAL C 3 57  ? 77.030 14.312  7.020   1.00 22.03 ? 57   VAL A C     1 
ATOM   924  O  O     . VAL C 3 57  ? 78.163 14.553  7.447   1.00 21.06 ? 57   VAL A O     1 
ATOM   925  C  CB    . VAL C 3 57  ? 76.278 12.406  8.398   1.00 20.69 ? 57   VAL A CB    1 
ATOM   926  C  CG1   . VAL C 3 57  ? 75.331 13.381  9.100   1.00 18.18 ? 57   VAL A CG1   1 
ATOM   927  C  CG2   . VAL C 3 57  ? 75.721 10.971  8.422   1.00 18.59 ? 57   VAL A CG2   1 
ATOM   928  N  N     . PHE C 3 58  ? 76.189 15.255  6.600   1.00 20.83 ? 58   PHE A N     1 
ATOM   929  C  CA    . PHE C 3 58  ? 76.508 16.674  6.644   1.00 19.86 ? 58   PHE A CA    1 
ATOM   930  C  C     . PHE C 3 58  ? 75.363 17.343  7.393   1.00 19.55 ? 58   PHE A C     1 
ATOM   931  O  O     . PHE C 3 58  ? 74.267 16.785  7.500   1.00 19.05 ? 58   PHE A O     1 
ATOM   932  C  CB    . PHE C 3 58  ? 76.527 17.293  5.240   1.00 19.76 ? 58   PHE A CB    1 
ATOM   933  C  CG    . PHE C 3 58  ? 77.757 16.997  4.430   1.00 19.85 ? 58   PHE A CG    1 
ATOM   934  C  CD1   . PHE C 3 58  ? 78.970 17.614  4.725   1.00 19.32 ? 58   PHE A CD1   1 
ATOM   935  C  CD2   . PHE C 3 58  ? 77.683 16.155  3.319   1.00 19.79 ? 58   PHE A CD2   1 
ATOM   936  C  CE1   . PHE C 3 58  ? 80.088 17.408  3.929   1.00 18.37 ? 58   PHE A CE1   1 
ATOM   937  C  CE2   . PHE C 3 58  ? 78.798 15.941  2.513   1.00 19.33 ? 58   PHE A CE2   1 
ATOM   938  C  CZ    . PHE C 3 58  ? 80.006 16.572  2.821   1.00 18.35 ? 58   PHE A CZ    1 
ATOM   939  N  N     . HIS C 3 59  ? 75.617 18.530  7.926   1.00 20.01 ? 59   HIS A N     1 
ATOM   940  C  CA    . HIS C 3 59  ? 74.551 19.292  8.556   1.00 21.12 ? 59   HIS A CA    1 
ATOM   941  C  C     . HIS C 3 59  ? 74.350 20.412  7.539   1.00 21.40 ? 59   HIS A C     1 
ATOM   942  O  O     . HIS C 3 59  ? 75.203 21.281  7.400   1.00 21.83 ? 59   HIS A O     1 
ATOM   943  C  CB    . HIS C 3 59  ? 74.963 19.873  9.902   1.00 20.42 ? 59   HIS A CB    1 
ATOM   944  C  CG    . HIS C 3 59  ? 73.869 20.653  10.564  1.00 23.40 ? 59   HIS A CG    1 
ATOM   945  N  ND1   . HIS C 3 59  ? 72.746 20.055  11.097  1.00 23.61 ? 59   HIS A ND1   1 
ATOM   946  C  CD2   . HIS C 3 59  ? 73.697 21.987  10.726  1.00 22.71 ? 59   HIS A CD2   1 
ATOM   947  C  CE1   . HIS C 3 59  ? 71.931 20.986  11.558  1.00 23.11 ? 59   HIS A CE1   1 
ATOM   948  N  NE2   . HIS C 3 59  ? 72.483 22.167  11.345  1.00 21.89 ? 59   HIS A NE2   1 
ATOM   949  N  N     . ASN C 3 60  ? 73.241 20.359  6.803   1.00 23.25 ? 60   ASN A N     1 
ATOM   950  C  CA    . ASN C 3 60  ? 72.922 21.338  5.755   1.00 24.49 ? 60   ASN A CA    1 
ATOM   951  C  C     . ASN C 3 60  ? 73.812 21.138  4.520   1.00 23.92 ? 60   ASN A C     1 
ATOM   952  O  O     . ASN C 3 60  ? 74.044 22.064  3.737   1.00 23.06 ? 60   ASN A O     1 
ATOM   953  C  CB    . ASN C 3 60  ? 73.054 22.783  6.273   1.00 24.45 ? 60   ASN A CB    1 
ATOM   954  C  CG    . ASN C 3 60  ? 72.487 23.815  5.292   1.00 25.04 ? 60   ASN A CG    1 
ATOM   955  O  OD1   . ASN C 3 60  ? 71.361 23.675  4.800   1.00 25.12 ? 60   ASN A OD1   1 
ATOM   956  N  ND2   . ASN C 3 60  ? 73.263 24.854  5.012   1.00 25.21 ? 60   ASN A ND2   1 
ATOM   957  N  N     . GLY C 3 61  ? 74.303 19.915  4.348   1.00 25.05 ? 61   GLY A N     1 
ATOM   958  C  CA    . GLY C 3 61  ? 75.141 19.617  3.204   1.00 23.64 ? 61   GLY A CA    1 
ATOM   959  C  C     . GLY C 3 61  ? 74.346 19.603  1.911   1.00 24.65 ? 61   GLY A C     1 
ATOM   960  O  O     . GLY C 3 61  ? 74.880 19.912  0.849   1.00 25.07 ? 61   GLY A O     1 
ATOM   961  N  N     . HIS C 3 62  ? 73.067 19.251  1.993   1.00 23.98 ? 62   HIS A N     1 
ATOM   962  C  CA    . HIS C 3 62  ? 72.218 19.196  0.803   1.00 23.89 ? 62   HIS A CA    1 
ATOM   963  C  C     . HIS C 3 62  ? 72.150 20.535  0.069   1.00 23.61 ? 62   HIS A C     1 
ATOM   964  O  O     . HIS C 3 62  ? 72.151 20.574  -1.154  1.00 23.51 ? 62   HIS A O     1 
ATOM   965  C  CB    . HIS C 3 62  ? 70.808 18.727  1.182   1.00 22.84 ? 62   HIS A CB    1 
ATOM   966  C  CG    . HIS C 3 62  ? 70.649 17.237  1.195   1.00 22.16 ? 62   HIS A CG    1 
ATOM   967  N  ND1   . HIS C 3 62  ? 71.596 16.390  1.730   1.00 22.88 ? 62   HIS A ND1   1 
ATOM   968  C  CD2   . HIS C 3 62  ? 69.645 16.443  0.753   1.00 21.81 ? 62   HIS A CD2   1 
ATOM   969  C  CE1   . HIS C 3 62  ? 71.184 15.141  1.619   1.00 20.56 ? 62   HIS A CE1   1 
ATOM   970  N  NE2   . HIS C 3 62  ? 70.003 15.145  1.031   1.00 20.87 ? 62   HIS A NE2   1 
ATOM   971  N  N     . LYS C 3 63  ? 72.089 21.631  0.817   1.00 23.54 ? 63   LYS A N     1 
ATOM   972  C  CA    . LYS C 3 63  ? 72.028 22.950  0.208   1.00 23.56 ? 63   LYS A CA    1 
ATOM   973  C  C     . LYS C 3 63  ? 73.393 23.603  0.058   1.00 22.42 ? 63   LYS A C     1 
ATOM   974  O  O     . LYS C 3 63  ? 73.615 24.355  -0.888  1.00 22.75 ? 63   LYS A O     1 
ATOM   975  C  CB    . LYS C 3 63  ? 71.112 23.881  1.009   1.00 24.92 ? 63   LYS A CB    1 
ATOM   976  C  CG    . LYS C 3 63  ? 69.633 23.537  0.892   1.00 27.43 ? 63   LYS A CG    1 
ATOM   977  C  CD    . LYS C 3 63  ? 68.749 24.443  1.750   1.00 27.33 ? 63   LYS A CD    1 
ATOM   978  C  CE    . LYS C 3 63  ? 68.856 25.897  1.334   1.00 28.73 ? 63   LYS A CE    1 
ATOM   979  N  NZ    . LYS C 3 63  ? 67.761 26.711  1.937   1.00 29.90 ? 63   LYS A NZ    1 
ATOM   980  N  N     . TYR C 3 64  ? 74.317 23.324  0.969   1.00 20.92 ? 64   TYR A N     1 
ATOM   981  C  CA    . TYR C 3 64  ? 75.626 23.958  0.854   1.00 21.20 ? 64   TYR A CA    1 
ATOM   982  C  C     . TYR C 3 64  ? 76.831 23.078  0.483   1.00 21.51 ? 64   TYR A C     1 
ATOM   983  O  O     . TYR C 3 64  ? 77.322 23.145  -0.644  1.00 22.25 ? 64   TYR A O     1 
ATOM   984  C  CB    . TYR C 3 64  ? 75.951 24.743  2.131   1.00 20.17 ? 64   TYR A CB    1 
ATOM   985  C  CG    . TYR C 3 64  ? 77.238 25.529  2.003   1.00 22.03 ? 64   TYR A CG    1 
ATOM   986  C  CD1   . TYR C 3 64  ? 77.309 26.646  1.169   1.00 21.63 ? 64   TYR A CD1   1 
ATOM   987  C  CD2   . TYR C 3 64  ? 78.403 25.121  2.664   1.00 19.49 ? 64   TYR A CD2   1 
ATOM   988  C  CE1   . TYR C 3 64  ? 78.501 27.338  0.991   1.00 21.72 ? 64   TYR A CE1   1 
ATOM   989  C  CE2   . TYR C 3 64  ? 79.602 25.805  2.494   1.00 20.63 ? 64   TYR A CE2   1 
ATOM   990  C  CZ    . TYR C 3 64  ? 79.647 26.915  1.654   1.00 21.23 ? 64   TYR A CZ    1 
ATOM   991  O  OH    . TYR C 3 64  ? 80.828 27.602  1.470   1.00 22.43 ? 64   TYR A OH    1 
ATOM   992  N  N     . ASP C 3 65  ? 77.307 22.263  1.419   1.00 18.81 ? 65   ASP A N     1 
ATOM   993  C  CA    . ASP C 3 65  ? 78.493 21.426  1.184   1.00 20.78 ? 65   ASP A CA    1 
ATOM   994  C  C     . ASP C 3 65  ? 78.586 20.621  -0.112  1.00 19.44 ? 65   ASP A C     1 
ATOM   995  O  O     . ASP C 3 65  ? 79.575 20.727  -0.825  1.00 20.52 ? 65   ASP A O     1 
ATOM   996  C  CB    . ASP C 3 65  ? 78.710 20.480  2.367   1.00 20.03 ? 65   ASP A CB    1 
ATOM   997  C  CG    . ASP C 3 65  ? 78.728 21.213  3.685   1.00 22.23 ? 65   ASP A CG    1 
ATOM   998  O  OD1   . ASP C 3 65  ? 77.680 21.789  4.041   1.00 21.75 ? 65   ASP A OD1   1 
ATOM   999  O  OD2   . ASP C 3 65  ? 79.783 21.226  4.355   1.00 25.38 ? 65   ASP A OD2   1 
ATOM   1000 N  N     . VAL C 3 66  ? 77.569 19.818  -0.406  1.00 19.14 ? 66   VAL A N     1 
ATOM   1001 C  CA    . VAL C 3 66  ? 77.563 18.983  -1.598  1.00 18.74 ? 66   VAL A CA    1 
ATOM   1002 C  C     . VAL C 3 66  ? 77.664 19.793  -2.890  1.00 19.67 ? 66   VAL A C     1 
ATOM   1003 O  O     . VAL C 3 66  ? 78.557 19.560  -3.698  1.00 20.85 ? 66   VAL A O     1 
ATOM   1004 C  CB    . VAL C 3 66  ? 76.306 18.076  -1.618  1.00 18.58 ? 66   VAL A CB    1 
ATOM   1005 C  CG1   . VAL C 3 66  ? 76.251 17.272  -2.908  1.00 17.01 ? 66   VAL A CG1   1 
ATOM   1006 C  CG2   . VAL C 3 66  ? 76.341 17.137  -0.413  1.00 17.70 ? 66   VAL A CG2   1 
ATOM   1007 N  N     . PRO C 3 67  ? 76.750 20.751  -3.107  1.00 19.88 ? 67   PRO A N     1 
ATOM   1008 C  CA    . PRO C 3 67  ? 76.870 21.525  -4.348  1.00 20.45 ? 67   PRO A CA    1 
ATOM   1009 C  C     . PRO C 3 67  ? 78.113 22.437  -4.346  1.00 21.53 ? 67   PRO A C     1 
ATOM   1010 O  O     . PRO C 3 67  ? 78.661 22.768  -5.400  1.00 22.97 ? 67   PRO A O     1 
ATOM   1011 C  CB    . PRO C 3 67  ? 75.557 22.310  -4.402  1.00 18.95 ? 67   PRO A CB    1 
ATOM   1012 C  CG    . PRO C 3 67  ? 75.157 22.425  -2.940  1.00 20.56 ? 67   PRO A CG    1 
ATOM   1013 C  CD    . PRO C 3 67  ? 75.502 21.071  -2.387  1.00 18.05 ? 67   PRO A CD    1 
ATOM   1014 N  N     . ALA C 3 68  ? 78.563 22.835  -3.164  1.00 20.13 ? 68   ALA A N     1 
ATOM   1015 C  CA    . ALA C 3 68  ? 79.741 23.687  -3.082  1.00 20.09 ? 68   ALA A CA    1 
ATOM   1016 C  C     . ALA C 3 68  ? 80.970 22.871  -3.480  1.00 21.56 ? 68   ALA A C     1 
ATOM   1017 O  O     . ALA C 3 68  ? 81.850 23.364  -4.193  1.00 20.79 ? 68   ALA A O     1 
ATOM   1018 C  CB    . ALA C 3 68  ? 79.900 24.239  -1.674  1.00 19.66 ? 68   ALA A CB    1 
ATOM   1019 N  N     . LEU C 3 69  ? 81.021 21.614  -3.037  1.00 21.73 ? 69   LEU A N     1 
ATOM   1020 C  CA    . LEU C 3 69  ? 82.147 20.752  -3.366  1.00 21.71 ? 69   LEU A CA    1 
ATOM   1021 C  C     . LEU C 3 69  ? 82.209 20.481  -4.867  1.00 23.82 ? 69   LEU A C     1 
ATOM   1022 O  O     . LEU C 3 69  ? 83.299 20.434  -5.448  1.00 25.01 ? 69   LEU A O     1 
ATOM   1023 C  CB    . LEU C 3 69  ? 82.064 19.441  -2.582  1.00 22.95 ? 69   LEU A CB    1 
ATOM   1024 C  CG    . LEU C 3 69  ? 82.353 19.581  -1.085  1.00 23.28 ? 69   LEU A CG    1 
ATOM   1025 C  CD1   . LEU C 3 69  ? 81.895 18.317  -0.360  1.00 22.46 ? 69   LEU A CD1   1 
ATOM   1026 C  CD2   . LEU C 3 69  ? 83.854 19.848  -0.867  1.00 22.01 ? 69   LEU A CD2   1 
ATOM   1027 N  N     . THR C 3 70  ? 81.046 20.303  -5.494  1.00 22.35 ? 70   THR A N     1 
ATOM   1028 C  CA    . THR C 3 70  ? 80.998 20.080  -6.936  1.00 23.10 ? 70   THR A CA    1 
ATOM   1029 C  C     . THR C 3 70  ? 81.565 21.298  -7.664  1.00 23.42 ? 70   THR A C     1 
ATOM   1030 O  O     . THR C 3 70  ? 82.317 21.166  -8.623  1.00 24.39 ? 70   THR A O     1 
ATOM   1031 C  CB    . THR C 3 70  ? 79.559 19.879  -7.444  1.00 23.00 ? 70   THR A CB    1 
ATOM   1032 O  OG1   . THR C 3 70  ? 79.080 18.600  -7.033  1.00 22.00 ? 70   THR A OG1   1 
ATOM   1033 C  CG2   . THR C 3 70  ? 79.511 19.973  -8.965  1.00 20.82 ? 70   THR A CG2   1 
ATOM   1034 N  N     . LYS C 3 71  ? 81.183 22.481  -7.196  1.00 22.26 ? 71   LYS A N     1 
ATOM   1035 C  CA    . LYS C 3 71  ? 81.626 23.735  -7.789  1.00 24.49 ? 71   LYS A CA    1 
ATOM   1036 C  C     . LYS C 3 71  ? 83.127 23.977  -7.577  1.00 25.04 ? 71   LYS A C     1 
ATOM   1037 O  O     . LYS C 3 71  ? 83.855 24.282  -8.519  1.00 24.32 ? 71   LYS A O     1 
ATOM   1038 C  CB    . LYS C 3 71  ? 80.813 24.895  -7.198  1.00 25.06 ? 71   LYS A CB    1 
ATOM   1039 C  CG    . LYS C 3 71  ? 81.157 26.266  -7.764  1.00 29.69 ? 71   LYS A CG    1 
ATOM   1040 C  CD    . LYS C 3 71  ? 80.247 27.358  -7.198  1.00 30.38 ? 71   LYS A CD    1 
ATOM   1041 C  CE    . LYS C 3 71  ? 80.638 28.733  -7.706  1.00 32.70 ? 71   LYS A CE    1 
ATOM   1042 N  NZ    . LYS C 3 71  ? 79.815 29.822  -7.084  1.00 34.08 ? 71   LYS A NZ    1 
ATOM   1043 N  N     . LEU C 3 72  ? 83.580 23.833  -6.337  1.00 24.11 ? 72   LEU A N     1 
ATOM   1044 C  CA    . LEU C 3 72  ? 84.982 24.038  -6.008  1.00 24.46 ? 72   LEU A CA    1 
ATOM   1045 C  C     . LEU C 3 72  ? 85.896 22.994  -6.651  1.00 25.29 ? 72   LEU A C     1 
ATOM   1046 O  O     . LEU C 3 72  ? 87.056 23.288  -6.949  1.00 26.84 ? 72   LEU A O     1 
ATOM   1047 C  CB    . LEU C 3 72  ? 85.176 24.020  -4.485  1.00 23.91 ? 72   LEU A CB    1 
ATOM   1048 C  CG    . LEU C 3 72  ? 84.531 25.172  -3.708  1.00 23.63 ? 72   LEU A CG    1 
ATOM   1049 C  CD1   . LEU C 3 72  ? 84.585 24.899  -2.207  1.00 23.20 ? 72   LEU A CD1   1 
ATOM   1050 C  CD2   . LEU C 3 72  ? 85.252 26.463  -4.040  1.00 23.57 ? 72   LEU A CD2   1 
ATOM   1051 N  N     . ALA C 3 73  ? 85.387 21.783  -6.868  1.00 24.36 ? 73   ALA A N     1 
ATOM   1052 C  CA    . ALA C 3 73  ? 86.209 20.742  -7.474  1.00 24.75 ? 73   ALA A CA    1 
ATOM   1053 C  C     . ALA C 3 73  ? 86.520 21.101  -8.923  1.00 25.58 ? 73   ALA A C     1 
ATOM   1054 O  O     . ALA C 3 73  ? 87.612 20.829  -9.418  1.00 23.66 ? 73   ALA A O     1 
ATOM   1055 C  CB    . ALA C 3 73  ? 85.505 19.378  -7.399  1.00 24.01 ? 73   ALA A CB    1 
ATOM   1056 N  N     . LYS C 3 74  ? 85.555 21.719  -9.595  1.00 27.58 ? 74   LYS A N     1 
ATOM   1057 C  CA    . LYS C 3 74  ? 85.739 22.114  -10.985 1.00 29.87 ? 74   LYS A CA    1 
ATOM   1058 C  C     . LYS C 3 74  ? 86.678 23.307  -11.070 1.00 30.47 ? 74   LYS A C     1 
ATOM   1059 O  O     . LYS C 3 74  ? 87.634 23.293  -11.838 1.00 31.70 ? 74   LYS A O     1 
ATOM   1060 C  CB    . LYS C 3 74  ? 84.399 22.488  -11.628 1.00 30.97 ? 74   LYS A CB    1 
ATOM   1061 C  CG    . LYS C 3 74  ? 84.464 22.636  -13.133 1.00 32.98 ? 74   LYS A CG    1 
ATOM   1062 C  CD    . LYS C 3 74  ? 84.761 21.289  -13.779 1.00 38.37 ? 74   LYS A CD    1 
ATOM   1063 C  CE    . LYS C 3 74  ? 84.925 21.386  -15.295 1.00 41.16 ? 74   LYS A CE    1 
ATOM   1064 N  NZ    . LYS C 3 74  ? 85.285 20.055  -15.891 1.00 42.97 ? 74   LYS A NZ    1 
ATOM   1065 N  N     . LEU C 3 75  ? 86.403 24.333  -10.269 1.00 30.16 ? 75   LEU A N     1 
ATOM   1066 C  CA    . LEU C 3 75  ? 87.211 25.548  -10.267 1.00 29.65 ? 75   LEU A CA    1 
ATOM   1067 C  C     . LEU C 3 75  ? 88.656 25.365  -9.828  1.00 29.68 ? 75   LEU A C     1 
ATOM   1068 O  O     . LEU C 3 75  ? 89.572 25.781  -10.532 1.00 28.96 ? 75   LEU A O     1 
ATOM   1069 C  CB    . LEU C 3 75  ? 86.564 26.622  -9.386  1.00 30.32 ? 75   LEU A CB    1 
ATOM   1070 C  CG    . LEU C 3 75  ? 85.338 27.369  -9.922  1.00 33.59 ? 75   LEU A CG    1 
ATOM   1071 C  CD1   . LEU C 3 75  ? 84.812 28.328  -8.857  1.00 34.26 ? 75   LEU A CD1   1 
ATOM   1072 C  CD2   . LEU C 3 75  ? 85.713 28.144  -11.184 1.00 34.13 ? 75   LEU A CD2   1 
ATOM   1073 N  N     . GLN C 3 76  ? 88.864 24.743  -8.673  1.00 30.17 ? 76   GLN A N     1 
ATOM   1074 C  CA    . GLN C 3 76  ? 90.213 24.564  -8.148  1.00 30.79 ? 76   GLN A CA    1 
ATOM   1075 C  C     . GLN C 3 76  ? 91.050 23.424  -8.723  1.00 30.51 ? 76   GLN A C     1 
ATOM   1076 O  O     . GLN C 3 76  ? 92.244 23.592  -8.955  1.00 29.75 ? 76   GLN A O     1 
ATOM   1077 C  CB    . GLN C 3 76  ? 90.162 24.440  -6.618  1.00 32.11 ? 76   GLN A CB    1 
ATOM   1078 C  CG    . GLN C 3 76  ? 89.737 25.729  -5.918  1.00 32.42 ? 76   GLN A CG    1 
ATOM   1079 C  CD    . GLN C 3 76  ? 89.733 25.614  -4.399  1.00 34.12 ? 76   GLN A CD    1 
ATOM   1080 O  OE1   . GLN C 3 76  ? 88.868 24.967  -3.813  1.00 33.66 ? 76   GLN A OE1   1 
ATOM   1081 N  NE2   . GLN C 3 76  ? 90.706 26.248  -3.757  1.00 36.80 ? 76   GLN A NE2   1 
ATOM   1082 N  N     . LEU C 3 77  ? 90.437 22.272  -8.964  1.00 30.60 ? 77   LEU A N     1 
ATOM   1083 C  CA    . LEU C 3 77  ? 91.179 21.118  -9.470  1.00 29.01 ? 77   LEU A CA    1 
ATOM   1084 C  C     . LEU C 3 77  ? 90.720 20.665  -10.839 1.00 29.25 ? 77   LEU A C     1 
ATOM   1085 O  O     . LEU C 3 77  ? 91.256 19.709  -11.389 1.00 28.61 ? 77   LEU A O     1 
ATOM   1086 C  CB    . LEU C 3 77  ? 91.026 19.942  -8.508  1.00 28.75 ? 77   LEU A CB    1 
ATOM   1087 C  CG    . LEU C 3 77  ? 91.463 20.118  -7.056  1.00 28.97 ? 77   LEU A CG    1 
ATOM   1088 C  CD1   . LEU C 3 77  ? 90.937 18.936  -6.225  1.00 27.29 ? 77   LEU A CD1   1 
ATOM   1089 C  CD2   . LEU C 3 77  ? 92.987 20.213  -6.985  1.00 26.76 ? 77   LEU A CD2   1 
ATOM   1090 N  N     . ASN C 3 78  ? 89.723 21.345  -11.385 1.00 31.14 ? 78   ASN A N     1 
ATOM   1091 C  CA    . ASN C 3 78  ? 89.176 20.968  -12.678 1.00 33.14 ? 78   ASN A CA    1 
ATOM   1092 C  C     . ASN C 3 78  ? 88.764 19.487  -12.635 1.00 34.04 ? 78   ASN A C     1 
ATOM   1093 O  O     . ASN C 3 78  ? 89.022 18.720  -13.566 1.00 34.93 ? 78   ASN A O     1 
ATOM   1094 C  CB    . ASN C 3 78  ? 90.205 21.230  -13.784 1.00 33.82 ? 78   ASN A CB    1 
ATOM   1095 C  CG    . ASN C 3 78  ? 89.688 20.859  -15.151 1.00 36.38 ? 78   ASN A CG    1 
ATOM   1096 O  OD1   . ASN C 3 78  ? 88.551 21.181  -15.509 1.00 38.29 ? 78   ASN A OD1   1 
ATOM   1097 N  ND2   . ASN C 3 78  ? 90.520 20.179  -15.932 1.00 37.00 ? 78   ASN A ND2   1 
ATOM   1098 N  N     . ARG C 3 79  ? 88.122 19.100  -11.532 1.00 33.47 ? 79   ARG A N     1 
ATOM   1099 C  CA    . ARG C 3 79  ? 87.651 17.735  -11.337 1.00 32.11 ? 79   ARG A CA    1 
ATOM   1100 C  C     . ARG C 3 79  ? 86.123 17.675  -11.368 1.00 31.66 ? 79   ARG A C     1 
ATOM   1101 O  O     . ARG C 3 79  ? 85.439 18.633  -10.997 1.00 32.07 ? 79   ARG A O     1 
ATOM   1102 C  CB    . ARG C 3 79  ? 88.117 17.172  -9.977  1.00 31.65 ? 79   ARG A CB    1 
ATOM   1103 C  CG    . ARG C 3 79  ? 87.746 15.702  -9.801  1.00 31.07 ? 79   ARG A CG    1 
ATOM   1104 C  CD    . ARG C 3 79  ? 87.674 15.183  -8.359  1.00 31.88 ? 79   ARG A CD    1 
ATOM   1105 N  NE    . ARG C 3 79  ? 88.958 15.099  -7.675  1.00 28.93 ? 79   ARG A NE    1 
ATOM   1106 C  CZ    . ARG C 3 79  ? 89.268 14.182  -6.759  1.00 28.06 ? 79   ARG A CZ    1 
ATOM   1107 N  NH1   . ARG C 3 79  ? 88.395 13.240  -6.409  1.00 23.25 ? 79   ARG A NH1   1 
ATOM   1108 N  NH2   . ARG C 3 79  ? 90.448 14.231  -6.157  1.00 27.59 ? 79   ARG A NH2   1 
ATOM   1109 N  N     . GLU C 3 80  ? 85.592 16.542  -11.809 1.00 30.70 ? 80   GLU A N     1 
ATOM   1110 C  CA    . GLU C 3 80  ? 84.146 16.337  -11.825 1.00 30.07 ? 80   GLU A CA    1 
ATOM   1111 C  C     . GLU C 3 80  ? 83.820 15.601  -10.518 1.00 28.68 ? 80   GLU A C     1 
ATOM   1112 O  O     . GLU C 3 80  ? 84.244 14.463  -10.319 1.00 27.76 ? 80   GLU A O     1 
ATOM   1113 C  CB    . GLU C 3 80  ? 83.733 15.487  -13.029 1.00 28.50 ? 80   GLU A CB    1 
ATOM   1114 C  CG    . GLU C 3 80  ? 83.812 16.210  -14.369 1.00 32.12 ? 80   GLU A CG    1 
ATOM   1115 C  CD    . GLU C 3 80  ? 82.884 17.418  -14.437 1.00 35.26 ? 80   GLU A CD    1 
ATOM   1116 O  OE1   . GLU C 3 80  ? 81.835 17.400  -13.760 1.00 37.16 ? 80   GLU A OE1   1 
ATOM   1117 O  OE2   . GLU C 3 80  ? 83.190 18.382  -15.175 1.00 37.85 ? 80   GLU A OE2   1 
ATOM   1118 N  N     . PHE C 3 81  ? 83.085 16.264  -9.630  1.00 25.90 ? 81   PHE A N     1 
ATOM   1119 C  CA    . PHE C 3 81  ? 82.718 15.692  -8.334  1.00 24.89 ? 81   PHE A CA    1 
ATOM   1120 C  C     . PHE C 3 81  ? 81.204 15.817  -8.158  1.00 24.78 ? 81   PHE A C     1 
ATOM   1121 O  O     . PHE C 3 81  ? 80.647 16.915  -8.207  1.00 24.20 ? 81   PHE A O     1 
ATOM   1122 C  CB    . PHE C 3 81  ? 83.445 16.449  -7.221  1.00 24.87 ? 81   PHE A CB    1 
ATOM   1123 C  CG    . PHE C 3 81  ? 83.252 15.862  -5.855  1.00 24.86 ? 81   PHE A CG    1 
ATOM   1124 C  CD1   . PHE C 3 81  ? 83.951 14.723  -5.467  1.00 25.42 ? 81   PHE A CD1   1 
ATOM   1125 C  CD2   . PHE C 3 81  ? 82.378 16.455  -4.950  1.00 24.97 ? 81   PHE A CD2   1 
ATOM   1126 C  CE1   . PHE C 3 81  ? 83.788 14.184  -4.197  1.00 26.93 ? 81   PHE A CE1   1 
ATOM   1127 C  CE2   . PHE C 3 81  ? 82.201 15.925  -3.673  1.00 26.44 ? 81   PHE A CE2   1 
ATOM   1128 C  CZ    . PHE C 3 81  ? 82.909 14.787  -3.294  1.00 26.89 ? 81   PHE A CZ    1 
ATOM   1129 N  N     . HIS C 3 82  ? 80.541 14.686  -7.953  1.00 25.27 ? 82   HIS A N     1 
ATOM   1130 C  CA    . HIS C 3 82  ? 79.089 14.663  -7.817  1.00 23.91 ? 82   HIS A CA    1 
ATOM   1131 C  C     . HIS C 3 82  ? 78.650 13.549  -6.878  1.00 23.63 ? 82   HIS A C     1 
ATOM   1132 O  O     . HIS C 3 82  ? 78.454 12.413  -7.313  1.00 24.01 ? 82   HIS A O     1 
ATOM   1133 C  CB    . HIS C 3 82  ? 78.451 14.418  -9.188  1.00 25.27 ? 82   HIS A CB    1 
ATOM   1134 C  CG    . HIS C 3 82  ? 78.882 15.386  -10.244 1.00 26.43 ? 82   HIS A CG    1 
ATOM   1135 N  ND1   . HIS C 3 82  ? 78.275 16.612  -10.425 1.00 28.24 ? 82   HIS A ND1   1 
ATOM   1136 C  CD2   . HIS C 3 82  ? 79.873 15.319  -11.165 1.00 26.62 ? 82   HIS A CD2   1 
ATOM   1137 C  CE1   . HIS C 3 82  ? 78.874 17.259  -11.410 1.00 27.78 ? 82   HIS A CE1   1 
ATOM   1138 N  NE2   . HIS C 3 82  ? 79.847 16.495  -11.876 1.00 28.39 ? 82   HIS A NE2   1 
ATOM   1139 N  N     . LEU C 3 83  ? 78.496 13.861  -5.597  1.00 22.69 ? 83   LEU A N     1 
ATOM   1140 C  CA    . LEU C 3 83  ? 78.060 12.849  -4.638  1.00 21.98 ? 83   LEU A CA    1 
ATOM   1141 C  C     . LEU C 3 83  ? 76.630 12.430  -4.948  1.00 20.12 ? 83   LEU A C     1 
ATOM   1142 O  O     . LEU C 3 83  ? 75.773 13.268  -5.161  1.00 19.38 ? 83   LEU A O     1 
ATOM   1143 C  CB    . LEU C 3 83  ? 78.134 13.395  -3.209  1.00 21.14 ? 83   LEU A CB    1 
ATOM   1144 C  CG    . LEU C 3 83  ? 79.542 13.639  -2.679  1.00 21.31 ? 83   LEU A CG    1 
ATOM   1145 C  CD1   . LEU C 3 83  ? 79.466 14.186  -1.263  1.00 20.46 ? 83   LEU A CD1   1 
ATOM   1146 C  CD2   . LEU C 3 83  ? 80.339 12.331  -2.725  1.00 19.38 ? 83   LEU A CD2   1 
ATOM   1147 N  N     . PRO C 3 84  ? 76.357 11.120  -4.983  1.00 21.60 ? 84   PRO A N     1 
ATOM   1148 C  CA    . PRO C 3 84  ? 74.980 10.701  -5.278  1.00 22.20 ? 84   PRO A CA    1 
ATOM   1149 C  C     . PRO C 3 84  ? 74.032 11.013  -4.109  1.00 23.23 ? 84   PRO A C     1 
ATOM   1150 O  O     . PRO C 3 84  ? 74.399 10.892  -2.937  1.00 23.56 ? 84   PRO A O     1 
ATOM   1151 C  CB    . PRO C 3 84  ? 75.111 9.196   -5.531  1.00 22.25 ? 84   PRO A CB    1 
ATOM   1152 C  CG    . PRO C 3 84  ? 76.574 9.005   -5.884  1.00 21.56 ? 84   PRO A CG    1 
ATOM   1153 C  CD    . PRO C 3 84  ? 77.268 9.965   -4.950  1.00 21.02 ? 84   PRO A CD    1 
ATOM   1154 N  N     . ARG C 3 85  ? 72.819 11.426  -4.442  1.00 22.90 ? 85   ARG A N     1 
ATOM   1155 C  CA    . ARG C 3 85  ? 71.814 11.749  -3.442  1.00 23.58 ? 85   ARG A CA    1 
ATOM   1156 C  C     . ARG C 3 85  ? 71.590 10.610  -2.447  1.00 24.49 ? 85   ARG A C     1 
ATOM   1157 O  O     . ARG C 3 85  ? 71.448 10.849  -1.242  1.00 24.17 ? 85   ARG A O     1 
ATOM   1158 C  CB    . ARG C 3 85  ? 70.494 12.080  -4.139  1.00 25.35 ? 85   ARG A CB    1 
ATOM   1159 C  CG    . ARG C 3 85  ? 69.331 12.371  -3.219  1.00 27.42 ? 85   ARG A CG    1 
ATOM   1160 C  CD    . ARG C 3 85  ? 68.166 11.459  -3.562  1.00 30.96 ? 85   ARG A CD    1 
ATOM   1161 N  NE    . ARG C 3 85  ? 68.131 10.301  -2.677  1.00 33.52 ? 85   ARG A NE    1 
ATOM   1162 C  CZ    . ARG C 3 85  ? 67.956 9.046   -3.075  1.00 32.52 ? 85   ARG A CZ    1 
ATOM   1163 N  NH1   . ARG C 3 85  ? 67.799 8.761   -4.363  1.00 31.90 ? 85   ARG A NH1   1 
ATOM   1164 N  NH2   . ARG C 3 85  ? 67.934 8.075   -2.175  1.00 32.63 ? 85   ARG A NH2   1 
ATOM   1165 N  N     . GLU C 3 86  ? 71.564 9.373   -2.941  1.00 24.47 ? 86   GLU A N     1 
ATOM   1166 C  CA    . GLU C 3 86  ? 71.327 8.231   -2.057  1.00 24.47 ? 86   GLU A CA    1 
ATOM   1167 C  C     . GLU C 3 86  ? 72.430 7.974   -1.031  1.00 23.19 ? 86   GLU A C     1 
ATOM   1168 O  O     . GLU C 3 86  ? 72.226 7.215   -0.090  1.00 22.29 ? 86   GLU A O     1 
ATOM   1169 C  CB    . GLU C 3 86  ? 71.079 6.949   -2.859  1.00 25.36 ? 86   GLU A CB    1 
ATOM   1170 C  CG    . GLU C 3 86  ? 72.227 6.535   -3.734  1.00 29.15 ? 86   GLU A CG    1 
ATOM   1171 C  CD    . GLU C 3 86  ? 72.054 6.996   -5.163  1.00 34.02 ? 86   GLU A CD    1 
ATOM   1172 O  OE1   . GLU C 3 86  ? 71.686 8.181   -5.376  1.00 32.82 ? 86   GLU A OE1   1 
ATOM   1173 O  OE2   . GLU C 3 86  ? 72.295 6.163   -6.071  1.00 35.37 ? 86   GLU A OE2   1 
ATOM   1174 N  N     . ASN C 3 87  ? 73.593 8.599   -1.194  1.00 20.95 ? 87   ASN A N     1 
ATOM   1175 C  CA    . ASN C 3 87  ? 74.665 8.387   -0.223  1.00 20.42 ? 87   ASN A CA    1 
ATOM   1176 C  C     . ASN C 3 87  ? 74.766 9.494   0.830   1.00 19.30 ? 87   ASN A C     1 
ATOM   1177 O  O     . ASN C 3 87  ? 75.592 9.406   1.742   1.00 18.39 ? 87   ASN A O     1 
ATOM   1178 C  CB    . ASN C 3 87  ? 76.025 8.251   -0.924  1.00 22.17 ? 87   ASN A CB    1 
ATOM   1179 C  CG    . ASN C 3 87  ? 76.086 7.068   -1.877  1.00 20.66 ? 87   ASN A CG    1 
ATOM   1180 O  OD1   . ASN C 3 87  ? 75.870 7.213   -3.083  1.00 21.70 ? 87   ASN A OD1   1 
ATOM   1181 N  ND2   . ASN C 3 87  ? 76.376 5.885   -1.334  1.00 22.39 ? 87   ASN A ND2   1 
ATOM   1182 N  N     . CYS C 3 88  ? 73.918 10.516  0.731   1.00 18.11 ? 88   CYS A N     1 
ATOM   1183 C  CA    . CYS C 3 88  ? 73.997 11.630  1.670   1.00 17.28 ? 88   CYS A CA    1 
ATOM   1184 C  C     . CYS C 3 88  ? 72.875 11.757  2.688   1.00 17.88 ? 88   CYS A C     1 
ATOM   1185 O  O     . CYS C 3 88  ? 71.704 11.551  2.385   1.00 18.23 ? 88   CYS A O     1 
ATOM   1186 C  CB    . CYS C 3 88  ? 74.106 12.958  0.907   1.00 18.37 ? 88   CYS A CB    1 
ATOM   1187 S  SG    . CYS C 3 88  ? 75.401 13.028  -0.358  1.00 21.34 ? 88   CYS A SG    1 
ATOM   1188 N  N     . ILE C 3 89  ? 73.265 12.123  3.903   1.00 18.59 ? 89   ILE A N     1 
ATOM   1189 C  CA    . ILE C 3 89  ? 72.338 12.337  5.000   1.00 18.96 ? 89   ILE A CA    1 
ATOM   1190 C  C     . ILE C 3 89  ? 72.532 13.780  5.461   1.00 18.94 ? 89   ILE A C     1 
ATOM   1191 O  O     . ILE C 3 89  ? 73.640 14.315  5.406   1.00 20.35 ? 89   ILE A O     1 
ATOM   1192 C  CB    . ILE C 3 89  ? 72.620 11.345  6.158   1.00 22.02 ? 89   ILE A CB    1 
ATOM   1193 C  CG1   . ILE C 3 89  ? 72.300 9.917   5.693   1.00 20.74 ? 89   ILE A CG1   1 
ATOM   1194 C  CG2   . ILE C 3 89  ? 71.786 11.708  7.397   1.00 20.17 ? 89   ILE A CG2   1 
ATOM   1195 C  CD1   . ILE C 3 89  ? 72.594 8.846   6.738   1.00 22.32 ? 89   ILE A CD1   1 
ATOM   1196 N  N     . ASP C 3 90  ? 71.460 14.423  5.895   1.00 18.80 ? 90   ASP A N     1 
ATOM   1197 C  CA    . ASP C 3 90  ? 71.559 15.812  6.329   1.00 20.18 ? 90   ASP A CA    1 
ATOM   1198 C  C     . ASP C 3 90  ? 70.892 15.966  7.697   1.00 20.76 ? 90   ASP A C     1 
ATOM   1199 O  O     . ASP C 3 90  ? 69.671 15.840  7.816   1.00 20.38 ? 90   ASP A O     1 
ATOM   1200 C  CB    . ASP C 3 90  ? 70.877 16.720  5.292   1.00 21.20 ? 90   ASP A CB    1 
ATOM   1201 C  CG    . ASP C 3 90  ? 71.138 18.200  5.534   1.00 22.00 ? 90   ASP A CG    1 
ATOM   1202 O  OD1   . ASP C 3 90  ? 71.028 18.649  6.699   1.00 22.97 ? 90   ASP A OD1   1 
ATOM   1203 O  OD2   . ASP C 3 90  ? 71.440 18.916  4.550   1.00 21.64 ? 90   ASP A OD2   1 
ATOM   1204 N  N     . THR C 3 91  ? 71.692 16.232  8.726   1.00 21.50 ? 91   THR A N     1 
ATOM   1205 C  CA    . THR C 3 91  ? 71.141 16.388  10.068  1.00 21.29 ? 91   THR A CA    1 
ATOM   1206 C  C     . THR C 3 91  ? 70.164 17.549  10.182  1.00 21.73 ? 91   THR A C     1 
ATOM   1207 O  O     . THR C 3 91  ? 69.276 17.512  11.026  1.00 22.82 ? 91   THR A O     1 
ATOM   1208 C  CB    . THR C 3 91  ? 72.251 16.544  11.145  1.00 20.85 ? 91   THR A CB    1 
ATOM   1209 O  OG1   . THR C 3 91  ? 73.250 17.474  10.698  1.00 20.53 ? 91   THR A OG1   1 
ATOM   1210 C  CG2   . THR C 3 91  ? 72.892 15.194  11.435  1.00 22.08 ? 91   THR A CG2   1 
ATOM   1211 N  N     . LEU C 3 92  ? 70.308 18.578  9.348   1.00 21.60 ? 92   LEU A N     1 
ATOM   1212 C  CA    . LEU C 3 92  ? 69.371 19.703  9.419   1.00 21.93 ? 92   LEU A CA    1 
ATOM   1213 C  C     . LEU C 3 92  ? 68.006 19.223  8.933   1.00 22.73 ? 92   LEU A C     1 
ATOM   1214 O  O     . LEU C 3 92  ? 66.980 19.507  9.557   1.00 23.17 ? 92   LEU A O     1 
ATOM   1215 C  CB    . LEU C 3 92  ? 69.844 20.889  8.564   1.00 21.02 ? 92   LEU A CB    1 
ATOM   1216 C  CG    . LEU C 3 92  ? 68.914 22.117  8.496   1.00 22.25 ? 92   LEU A CG    1 
ATOM   1217 C  CD1   . LEU C 3 92  ? 68.584 22.652  9.902   1.00 22.00 ? 92   LEU A CD1   1 
ATOM   1218 C  CD2   . LEU C 3 92  ? 69.585 23.209  7.681   1.00 23.76 ? 92   LEU A CD2   1 
ATOM   1219 N  N     . VAL C 3 93  ? 68.005 18.494  7.817   1.00 23.14 ? 93   VAL A N     1 
ATOM   1220 C  CA    . VAL C 3 93  ? 66.780 17.946  7.243   1.00 22.11 ? 93   VAL A CA    1 
ATOM   1221 C  C     . VAL C 3 93  ? 66.131 17.008  8.260   1.00 22.80 ? 93   VAL A C     1 
ATOM   1222 O  O     . VAL C 3 93  ? 64.924 17.038  8.464   1.00 22.89 ? 93   VAL A O     1 
ATOM   1223 C  CB    . VAL C 3 93  ? 67.075 17.144  5.946   1.00 23.40 ? 93   VAL A CB    1 
ATOM   1224 C  CG1   . VAL C 3 93  ? 65.843 16.357  5.525   1.00 21.14 ? 93   VAL A CG1   1 
ATOM   1225 C  CG2   . VAL C 3 93  ? 67.510 18.089  4.824   1.00 21.98 ? 93   VAL A CG2   1 
ATOM   1226 N  N     . LEU C 3 94  ? 66.946 16.173  8.890   1.00 22.95 ? 94   LEU A N     1 
ATOM   1227 C  CA    . LEU C 3 94  ? 66.462 15.235  9.883   1.00 23.31 ? 94   LEU A CA    1 
ATOM   1228 C  C     . LEU C 3 94  ? 65.867 15.918  11.126  1.00 24.25 ? 94   LEU A C     1 
ATOM   1229 O  O     . LEU C 3 94  ? 64.817 15.505  11.623  1.00 23.53 ? 94   LEU A O     1 
ATOM   1230 C  CB    . LEU C 3 94  ? 67.596 14.312  10.323  1.00 24.94 ? 94   LEU A CB    1 
ATOM   1231 C  CG    . LEU C 3 94  ? 67.491 12.815  10.048  1.00 26.71 ? 94   LEU A CG    1 
ATOM   1232 C  CD1   . LEU C 3 94  ? 68.577 12.111  10.843  1.00 26.99 ? 94   LEU A CD1   1 
ATOM   1233 C  CD2   . LEU C 3 94  ? 66.127 12.284  10.447  1.00 27.40 ? 94   LEU A CD2   1 
ATOM   1234 N  N     . SER C 3 95  ? 66.526 16.953  11.638  1.00 23.48 ? 95   SER A N     1 
ATOM   1235 C  CA    . SER C 3 95  ? 66.000 17.609  12.830  1.00 25.21 ? 95   SER A CA    1 
ATOM   1236 C  C     . SER C 3 95  ? 64.719 18.364  12.514  1.00 24.30 ? 95   SER A C     1 
ATOM   1237 O  O     . SER C 3 95  ? 63.848 18.504  13.373  1.00 22.09 ? 95   SER A O     1 
ATOM   1238 C  CB    . SER C 3 95  ? 67.044 18.548  13.463  1.00 26.57 ? 95   SER A CB    1 
ATOM   1239 O  OG    . SER C 3 95  ? 67.220 19.742  12.727  1.00 30.52 ? 95   SER A OG    1 
ATOM   1240 N  N     . ARG C 3 96  ? 64.598 18.833  11.275  1.00 22.90 ? 96   ARG A N     1 
ATOM   1241 C  CA    . ARG C 3 96  ? 63.404 19.555  10.868  1.00 22.83 ? 96   ARG A CA    1 
ATOM   1242 C  C     . ARG C 3 96  ? 62.228 18.591  10.738  1.00 23.57 ? 96   ARG A C     1 
ATOM   1243 O  O     . ARG C 3 96  ? 61.062 19.010  10.754  1.00 23.57 ? 96   ARG A O     1 
ATOM   1244 C  CB    . ARG C 3 96  ? 63.652 20.302  9.554   1.00 21.50 ? 96   ARG A CB    1 
ATOM   1245 C  CG    . ARG C 3 96  ? 64.468 21.562  9.761   1.00 20.77 ? 96   ARG A CG    1 
ATOM   1246 C  CD    . ARG C 3 96  ? 64.858 22.264  8.463   1.00 21.63 ? 96   ARG A CD    1 
ATOM   1247 N  NE    . ARG C 3 96  ? 65.294 23.636  8.736   1.00 22.67 ? 96   ARG A NE    1 
ATOM   1248 C  CZ    . ARG C 3 96  ? 65.681 24.505  7.804   1.00 23.01 ? 96   ARG A CZ    1 
ATOM   1249 N  NH1   . ARG C 3 96  ? 65.700 24.148  6.524   1.00 21.89 ? 96   ARG A NH1   1 
ATOM   1250 N  NH2   . ARG C 3 96  ? 66.018 25.739  8.149   1.00 19.56 ? 96   ARG A NH2   1 
ATOM   1251 N  N     . LEU C 3 97  ? 62.538 17.304  10.608  1.00 22.84 ? 97   LEU A N     1 
ATOM   1252 C  CA    . LEU C 3 97  ? 61.504 16.280  10.517  1.00 25.26 ? 97   LEU A CA    1 
ATOM   1253 C  C     . LEU C 3 97  ? 61.154 15.807  11.923  1.00 26.80 ? 97   LEU A C     1 
ATOM   1254 O  O     . LEU C 3 97  ? 59.987 15.759  12.289  1.00 29.24 ? 97   LEU A O     1 
ATOM   1255 C  CB    . LEU C 3 97  ? 61.972 15.076  9.685   1.00 23.77 ? 97   LEU A CB    1 
ATOM   1256 C  CG    . LEU C 3 97  ? 61.103 13.806  9.835   1.00 21.75 ? 97   LEU A CG    1 
ATOM   1257 C  CD1   . LEU C 3 97  ? 59.659 14.102  9.419   1.00 19.57 ? 97   LEU A CD1   1 
ATOM   1258 C  CD2   . LEU C 3 97  ? 61.678 12.673  9.001   1.00 18.92 ? 97   LEU A CD2   1 
ATOM   1259 N  N     . ILE C 3 98  ? 62.172 15.462  12.707  1.00 29.96 ? 98   ILE A N     1 
ATOM   1260 C  CA    . ILE C 3 98  ? 61.970 14.986  14.074  1.00 32.90 ? 98   ILE A CA    1 
ATOM   1261 C  C     . ILE C 3 98  ? 61.345 16.040  14.986  1.00 34.92 ? 98   ILE A C     1 
ATOM   1262 O  O     . ILE C 3 98  ? 60.339 15.778  15.648  1.00 35.80 ? 98   ILE A O     1 
ATOM   1263 C  CB    . ILE C 3 98  ? 63.290 14.537  14.723  1.00 32.01 ? 98   ILE A CB    1 
ATOM   1264 C  CG1   . ILE C 3 98  ? 64.012 13.533  13.825  1.00 31.68 ? 98   ILE A CG1   1 
ATOM   1265 C  CG2   . ILE C 3 98  ? 63.007 13.910  16.074  1.00 33.23 ? 98   ILE A CG2   1 
ATOM   1266 C  CD1   . ILE C 3 98  ? 63.185 12.359  13.396  1.00 29.79 ? 98   ILE A CD1   1 
ATOM   1267 N  N     . HIS C 3 99  ? 61.949 17.225  15.015  1.00 36.98 ? 99   HIS A N     1 
ATOM   1268 C  CA    . HIS C 3 99  ? 61.472 18.337  15.841  1.00 37.91 ? 99   HIS A CA    1 
ATOM   1269 C  C     . HIS C 3 99  ? 60.734 19.368  14.987  1.00 38.63 ? 99   HIS A C     1 
ATOM   1270 O  O     . HIS C 3 99  ? 61.026 20.563  15.056  1.00 38.34 ? 99   HIS A O     1 
ATOM   1271 C  CB    . HIS C 3 99  ? 62.662 19.012  16.534  1.00 38.73 ? 99   HIS A CB    1 
ATOM   1272 C  CG    . HIS C 3 99  ? 63.572 18.051  17.231  1.00 40.17 ? 99   HIS A CG    1 
ATOM   1273 N  ND1   . HIS C 3 99  ? 63.157 17.263  18.283  1.00 40.99 ? 99   HIS A ND1   1 
ATOM   1274 C  CD2   . HIS C 3 99  ? 64.867 17.726  17.005  1.00 41.16 ? 99   HIS A CD2   1 
ATOM   1275 C  CE1   . HIS C 3 99  ? 64.155 16.492  18.675  1.00 41.08 ? 99   HIS A CE1   1 
ATOM   1276 N  NE2   . HIS C 3 99  ? 65.204 16.753  17.915  1.00 42.51 ? 99   HIS A NE2   1 
ATOM   1277 N  N     . SER C 3 100 ? 59.779 18.901  14.190  1.00 39.29 ? 100  SER A N     1 
ATOM   1278 C  CA    . SER C 3 100 ? 59.011 19.773  13.306  1.00 40.26 ? 100  SER A CA    1 
ATOM   1279 C  C     . SER C 3 100 ? 58.175 20.808  14.056  1.00 40.98 ? 100  SER A C     1 
ATOM   1280 O  O     . SER C 3 100 ? 57.660 21.757  13.454  1.00 41.11 ? 100  SER A O     1 
ATOM   1281 C  CB    . SER C 3 100 ? 58.103 18.931  12.406  1.00 40.16 ? 100  SER A CB    1 
ATOM   1282 O  OG    . SER C 3 100 ? 57.239 18.118  13.174  1.00 41.68 ? 100  SER A OG    1 
ATOM   1283 N  N     . ASN C 3 101 ? 58.043 20.621  15.366  1.00 41.47 ? 101  ASN A N     1 
ATOM   1284 C  CA    . ASN C 3 101 ? 57.283 21.538  16.211  1.00 43.30 ? 101  ASN A CA    1 
ATOM   1285 C  C     . ASN C 3 101 ? 58.127 22.734  16.658  1.00 42.98 ? 101  ASN A C     1 
ATOM   1286 O  O     . ASN C 3 101 ? 57.602 23.688  17.238  1.00 44.12 ? 101  ASN A O     1 
ATOM   1287 C  CB    . ASN C 3 101 ? 56.760 20.804  17.446  1.00 45.31 ? 101  ASN A CB    1 
ATOM   1288 C  CG    . ASN C 3 101 ? 57.851 20.029  18.167  1.00 47.24 ? 101  ASN A CG    1 
ATOM   1289 O  OD1   . ASN C 3 101 ? 58.433 19.096  17.609  1.00 49.22 ? 101  ASN A OD1   1 
ATOM   1290 N  ND2   . ASN C 3 101 ? 58.135 20.413  19.408  1.00 47.39 ? 101  ASN A ND2   1 
ATOM   1291 N  N     . LEU C 3 102 ? 59.429 22.685  16.384  1.00 40.99 ? 102  LEU A N     1 
ATOM   1292 C  CA    . LEU C 3 102 ? 60.326 23.770  16.774  1.00 40.17 ? 102  LEU A CA    1 
ATOM   1293 C  C     . LEU C 3 102 ? 60.786 24.621  15.585  1.00 40.01 ? 102  LEU A C     1 
ATOM   1294 O  O     . LEU C 3 102 ? 60.750 24.189  14.431  1.00 37.84 ? 102  LEU A O     1 
ATOM   1295 C  CB    . LEU C 3 102 ? 61.565 23.211  17.494  1.00 39.26 ? 102  LEU A CB    1 
ATOM   1296 C  CG    . LEU C 3 102 ? 61.397 22.274  18.699  1.00 39.24 ? 102  LEU A CG    1 
ATOM   1297 C  CD1   . LEU C 3 102 ? 62.769 21.855  19.216  1.00 37.38 ? 102  LEU A CD1   1 
ATOM   1298 C  CD2   . LEU C 3 102 ? 60.609 22.966  19.799  1.00 38.08 ? 102  LEU A CD2   1 
ATOM   1299 N  N     . LYS C 3 103 ? 61.219 25.839  15.889  1.00 40.63 ? 103  LYS A N     1 
ATOM   1300 C  CA    . LYS C 3 103 ? 61.731 26.766  14.883  1.00 41.56 ? 103  LYS A CA    1 
ATOM   1301 C  C     . LYS C 3 103 ? 63.252 26.627  14.885  1.00 42.14 ? 103  LYS A C     1 
ATOM   1302 O  O     . LYS C 3 103 ? 63.814 25.942  15.744  1.00 42.40 ? 103  LYS A O     1 
ATOM   1303 C  CB    . LYS C 3 103 ? 61.370 28.212  15.258  1.00 41.83 ? 103  LYS A CB    1 
ATOM   1304 C  CG    . LYS C 3 103 ? 59.933 28.636  14.983  1.00 42.20 ? 103  LYS A CG    1 
ATOM   1305 C  CD    . LYS C 3 103 ? 59.706 28.821  13.492  1.00 43.15 ? 103  LYS A CD    1 
ATOM   1306 C  CE    . LYS C 3 103 ? 58.440 29.613  13.191  1.00 45.47 ? 103  LYS A CE    1 
ATOM   1307 N  NZ    . LYS C 3 103 ? 57.204 28.942  13.668  1.00 46.90 ? 103  LYS A NZ    1 
ATOM   1308 N  N     . ASP C 3 104 ? 63.910 27.256  13.913  1.00 41.26 ? 104  ASP A N     1 
ATOM   1309 C  CA    . ASP C 3 104 ? 65.371 27.267  13.843  1.00 40.26 ? 104  ASP A CA    1 
ATOM   1310 C  C     . ASP C 3 104 ? 65.774 28.545  13.113  1.00 40.25 ? 104  ASP A C     1 
ATOM   1311 O  O     . ASP C 3 104 ? 64.948 29.165  12.439  1.00 39.78 ? 104  ASP A O     1 
ATOM   1312 C  CB    . ASP C 3 104 ? 65.941 26.010  13.153  1.00 39.40 ? 104  ASP A CB    1 
ATOM   1313 C  CG    . ASP C 3 104 ? 65.522 25.879  11.700  1.00 39.51 ? 104  ASP A CG    1 
ATOM   1314 O  OD1   . ASP C 3 104 ? 65.712 26.835  10.926  1.00 38.57 ? 104  ASP A OD1   1 
ATOM   1315 O  OD2   . ASP C 3 104 ? 65.015 24.802  11.327  1.00 38.63 ? 104  ASP A OD2   1 
ATOM   1316 N  N     . THR C 3 105 ? 67.031 28.946  13.265  1.00 40.32 ? 105  THR A N     1 
ATOM   1317 C  CA    . THR C 3 105 ? 67.532 30.179  12.658  1.00 40.63 ? 105  THR A CA    1 
ATOM   1318 C  C     . THR C 3 105 ? 67.905 30.070  11.184  1.00 41.62 ? 105  THR A C     1 
ATOM   1319 O  O     . THR C 3 105 ? 68.522 30.985  10.625  1.00 41.62 ? 105  THR A O     1 
ATOM   1320 C  CB    . THR C 3 105 ? 68.772 30.697  13.415  1.00 39.09 ? 105  THR A CB    1 
ATOM   1321 O  OG1   . THR C 3 105 ? 69.816 29.718  13.334  1.00 37.10 ? 105  THR A OG1   1 
ATOM   1322 C  CG2   . THR C 3 105 ? 68.431 30.978  14.875  1.00 35.74 ? 105  THR A CG2   1 
ATOM   1323 N  N     . ASP C 3 106 ? 67.529 28.957  10.560  1.00 42.15 ? 106  ASP A N     1 
ATOM   1324 C  CA    . ASP C 3 106 ? 67.834 28.723  9.152   1.00 42.94 ? 106  ASP A CA    1 
ATOM   1325 C  C     . ASP C 3 106 ? 69.316 29.017  8.913   1.00 42.88 ? 106  ASP A C     1 
ATOM   1326 O  O     . ASP C 3 106 ? 69.686 29.804  8.031   1.00 42.94 ? 106  ASP A O     1 
ATOM   1327 C  CB    . ASP C 3 106 ? 66.950 29.609  8.267   1.00 42.55 ? 106  ASP A CB    1 
ATOM   1328 C  CG    . ASP C 3 106 ? 67.017 29.218  6.805   1.00 43.48 ? 106  ASP A CG    1 
ATOM   1329 O  OD1   . ASP C 3 106 ? 67.243 28.020  6.530   1.00 40.90 ? 106  ASP A OD1   1 
ATOM   1330 O  OD2   . ASP C 3 106 ? 66.832 30.096  5.935   1.00 43.57 ? 106  ASP A OD2   1 
ATOM   1331 N  N     . MET C 3 107 ? 70.149 28.366  9.724   1.00 42.03 ? 107  MET A N     1 
ATOM   1332 C  CA    . MET C 3 107 ? 71.597 28.515  9.678   1.00 43.09 ? 107  MET A CA    1 
ATOM   1333 C  C     . MET C 3 107 ? 72.055 29.956  9.919   1.00 44.01 ? 107  MET A C     1 
ATOM   1334 O  O     . MET C 3 107 ? 72.917 30.481  9.211   1.00 44.04 ? 107  MET A O     1 
ATOM   1335 C  CB    . MET C 3 107 ? 72.149 27.989  8.349   1.00 42.55 ? 107  MET A CB    1 
ATOM   1336 C  CG    . MET C 3 107 ? 72.124 26.468  8.240   1.00 40.79 ? 107  MET A CG    1 
ATOM   1337 S  SD    . MET C 3 107 ? 72.976 25.658  9.631   1.00 38.16 ? 107  MET A SD    1 
ATOM   1338 C  CE    . MET C 3 107 ? 74.668 25.577  9.036   1.00 34.77 ? 107  MET A CE    1 
ATOM   1339 N  N     . GLY C 3 108 ? 71.464 30.590  10.926  1.00 44.49 ? 108  GLY A N     1 
ATOM   1340 C  CA    . GLY C 3 108 ? 71.838 31.948  11.269  1.00 44.65 ? 108  GLY A CA    1 
ATOM   1341 C  C     . GLY C 3 108 ? 71.339 33.050  10.357  1.00 44.47 ? 108  GLY A C     1 
ATOM   1342 O  O     . GLY C 3 108 ? 71.772 34.192  10.493  1.00 43.57 ? 108  GLY A O     1 
ATOM   1343 N  N     . LEU C 3 109 ? 70.448 32.727  9.424   1.00 44.56 ? 109  LEU A N     1 
ATOM   1344 C  CA    . LEU C 3 109 ? 69.912 33.746  8.528   1.00 44.23 ? 109  LEU A CA    1 
ATOM   1345 C  C     . LEU C 3 109 ? 68.841 34.548  9.253   1.00 44.18 ? 109  LEU A C     1 
ATOM   1346 O  O     . LEU C 3 109 ? 68.504 35.663  8.857   1.00 45.35 ? 109  LEU A O     1 
ATOM   1347 C  CB    . LEU C 3 109 ? 69.324 33.107  7.268   1.00 42.96 ? 109  LEU A CB    1 
ATOM   1348 C  CG    . LEU C 3 109 ? 70.356 32.520  6.298   1.00 42.70 ? 109  LEU A CG    1 
ATOM   1349 C  CD1   . LEU C 3 109 ? 69.651 31.881  5.115   1.00 42.45 ? 109  LEU A CD1   1 
ATOM   1350 C  CD2   . LEU C 3 109 ? 71.303 33.622  5.830   1.00 42.17 ? 109  LEU A CD2   1 
ATOM   1351 N  N     . LEU C 3 110 ? 68.311 33.966  10.321  1.00 44.68 ? 110  LEU A N     1 
ATOM   1352 C  CA    . LEU C 3 110 ? 67.285 34.610  11.121  1.00 45.06 ? 110  LEU A CA    1 
ATOM   1353 C  C     . LEU C 3 110 ? 67.842 34.882  12.509  1.00 46.33 ? 110  LEU A C     1 
ATOM   1354 O  O     . LEU C 3 110 ? 68.667 34.120  13.024  1.00 45.85 ? 110  LEU A O     1 
ATOM   1355 C  CB    . LEU C 3 110 ? 66.046 33.717  11.226  1.00 44.51 ? 110  LEU A CB    1 
ATOM   1356 C  CG    . LEU C 3 110 ? 65.281 33.436  9.928   1.00 44.92 ? 110  LEU A CG    1 
ATOM   1357 C  CD1   . LEU C 3 110 ? 64.213 32.380  10.178  1.00 45.00 ? 110  LEU A CD1   1 
ATOM   1358 C  CD2   . LEU C 3 110 ? 64.657 34.724  9.409   1.00 44.31 ? 110  LEU A CD2   1 
ATOM   1359 N  N     . ARG C 3 111 ? 67.392 35.985  13.096  1.00 47.41 ? 111  ARG A N     1 
ATOM   1360 C  CA    . ARG C 3 111 ? 67.806 36.398  14.432  1.00 49.21 ? 111  ARG A CA    1 
ATOM   1361 C  C     . ARG C 3 111 ? 67.117 35.451  15.415  1.00 48.61 ? 111  ARG A C     1 
ATOM   1362 O  O     . ARG C 3 111 ? 65.887 35.425  15.499  1.00 48.53 ? 111  ARG A O     1 
ATOM   1363 C  CB    . ARG C 3 111 ? 67.355 37.842  14.695  1.00 51.97 ? 111  ARG A CB    1 
ATOM   1364 C  CG    . ARG C 3 111 ? 67.178 38.705  13.430  1.00 55.86 ? 111  ARG A CG    1 
ATOM   1365 C  CD    . ARG C 3 111 ? 66.000 38.214  12.559  1.00 58.35 ? 111  ARG A CD    1 
ATOM   1366 N  NE    . ARG C 3 111 ? 65.801 39.021  11.356  1.00 60.42 ? 111  ARG A NE    1 
ATOM   1367 C  CZ    . ARG C 3 111 ? 65.404 40.293  11.365  1.00 62.51 ? 111  ARG A CZ    1 
ATOM   1368 N  NH1   . ARG C 3 111 ? 65.160 40.906  12.519  1.00 62.52 ? 111  ARG A NH1   1 
ATOM   1369 N  NH2   . ARG C 3 111 ? 65.255 40.957  10.223  1.00 62.48 ? 111  ARG A NH2   1 
ATOM   1370 N  N     . SER C 3 112 ? 67.907 34.675  16.151  1.00 47.80 ? 112  SER A N     1 
ATOM   1371 C  CA    . SER C 3 112 ? 67.363 33.710  17.108  1.00 48.17 ? 112  SER A CA    1 
ATOM   1372 C  C     . SER C 3 112 ? 66.453 34.333  18.164  1.00 47.54 ? 112  SER A C     1 
ATOM   1373 O  O     . SER C 3 112 ? 65.412 33.770  18.506  1.00 46.21 ? 112  SER A O     1 
ATOM   1374 C  CB    . SER C 3 112 ? 68.504 32.957  17.800  1.00 47.68 ? 112  SER A CB    1 
ATOM   1375 O  OG    . SER C 3 112 ? 69.338 33.849  18.519  1.00 48.28 ? 112  SER A OG    1 
ATOM   1376 N  N     . GLY C 3 113 ? 66.849 35.494  18.676  1.00 48.46 ? 113  GLY A N     1 
ATOM   1377 C  CA    . GLY C 3 113 ? 66.055 36.162  19.693  1.00 49.65 ? 113  GLY A CA    1 
ATOM   1378 C  C     . GLY C 3 113 ? 64.679 36.598  19.220  1.00 50.18 ? 113  GLY A C     1 
ATOM   1379 O  O     . GLY C 3 113 ? 63.850 37.028  20.023  1.00 50.47 ? 113  GLY A O     1 
ATOM   1380 N  N     . LYS C 3 114 ? 64.433 36.481  17.918  1.00 50.74 ? 114  LYS A N     1 
ATOM   1381 C  CA    . LYS C 3 114 ? 63.155 36.873  17.329  1.00 50.63 ? 114  LYS A CA    1 
ATOM   1382 C  C     . LYS C 3 114 ? 62.193 35.692  17.176  1.00 49.91 ? 114  LYS A C     1 
ATOM   1383 O  O     . LYS C 3 114 ? 60.974 35.875  17.114  1.00 50.72 ? 114  LYS A O     1 
ATOM   1384 C  CB    . LYS C 3 114 ? 63.398 37.523  15.960  1.00 52.02 ? 114  LYS A CB    1 
ATOM   1385 C  CG    . LYS C 3 114 ? 62.138 37.994  15.246  1.00 53.55 ? 114  LYS A CG    1 
ATOM   1386 C  CD    . LYS C 3 114 ? 62.455 38.546  13.863  1.00 53.50 ? 114  LYS A CD    1 
ATOM   1387 C  CE    . LYS C 3 114 ? 61.188 38.970  13.126  1.00 55.98 ? 114  LYS A CE    1 
ATOM   1388 N  NZ    . LYS C 3 114 ? 60.239 37.835  12.899  1.00 55.99 ? 114  LYS A NZ    1 
ATOM   1389 N  N     . LEU C 3 115 ? 62.744 34.482  17.116  1.00 47.87 ? 115  LEU A N     1 
ATOM   1390 C  CA    . LEU C 3 115 ? 61.940 33.270  16.954  1.00 45.87 ? 115  LEU A CA    1 
ATOM   1391 C  C     . LEU C 3 115 ? 61.203 32.879  18.237  1.00 44.65 ? 115  LEU A C     1 
ATOM   1392 O  O     . LEU C 3 115 ? 61.721 33.052  19.344  1.00 44.34 ? 115  LEU A O     1 
ATOM   1393 C  CB    . LEU C 3 115 ? 62.834 32.107  16.513  1.00 45.20 ? 115  LEU A CB    1 
ATOM   1394 C  CG    . LEU C 3 115 ? 63.750 32.354  15.305  1.00 45.41 ? 115  LEU A CG    1 
ATOM   1395 C  CD1   . LEU C 3 115 ? 64.684 31.167  15.127  1.00 42.95 ? 115  LEU A CD1   1 
ATOM   1396 C  CD2   . LEU C 3 115 ? 62.912 32.595  14.049  1.00 44.06 ? 115  LEU A CD2   1 
ATOM   1397 N  N     . PRO C 3 116 ? 59.969 32.365  18.103  1.00 43.69 ? 116  PRO A N     1 
ATOM   1398 C  CA    . PRO C 3 116 ? 59.188 31.952  19.276  1.00 42.40 ? 116  PRO A CA    1 
ATOM   1399 C  C     . PRO C 3 116 ? 59.507 30.501  19.661  1.00 41.38 ? 116  PRO A C     1 
ATOM   1400 O  O     . PRO C 3 116 ? 60.034 29.738  18.845  1.00 40.51 ? 116  PRO A O     1 
ATOM   1401 C  CB    . PRO C 3 116 ? 57.749 32.129  18.804  1.00 41.93 ? 116  PRO A CB    1 
ATOM   1402 C  CG    . PRO C 3 116 ? 57.843 31.745  17.358  1.00 43.03 ? 116  PRO A CG    1 
ATOM   1403 C  CD    . PRO C 3 116 ? 59.112 32.448  16.905  1.00 42.67 ? 116  PRO A CD    1 
ATOM   1404 N  N     . GLY C 3 117 ? 59.200 30.129  20.904  1.00 39.77 ? 117  GLY A N     1 
ATOM   1405 C  CA    . GLY C 3 117 ? 59.467 28.773  21.361  1.00 38.52 ? 117  GLY A CA    1 
ATOM   1406 C  C     . GLY C 3 117 ? 60.937 28.488  21.628  1.00 37.72 ? 117  GLY A C     1 
ATOM   1407 O  O     . GLY C 3 117 ? 61.780 29.386  21.567  1.00 39.32 ? 117  GLY A O     1 
ATOM   1408 N  N     . ALA C 3 118 ? 61.252 27.233  21.925  1.00 35.97 ? 124  ALA A N     1 
ATOM   1409 C  CA    . ALA C 3 118 ? 62.629 26.840  22.205  1.00 34.67 ? 124  ALA A CA    1 
ATOM   1410 C  C     . ALA C 3 118 ? 63.351 26.350  20.946  1.00 34.40 ? 124  ALA A C     1 
ATOM   1411 O  O     . ALA C 3 118 ? 62.729 26.086  19.917  1.00 34.79 ? 124  ALA A O     1 
ATOM   1412 C  CB    . ALA C 3 118 ? 62.649 25.754  23.276  1.00 31.49 ? 124  ALA A CB    1 
ATOM   1413 N  N     . LEU C 3 119 ? 64.671 26.233  21.032  1.00 34.65 ? 125  LEU A N     1 
ATOM   1414 C  CA    . LEU C 3 119 ? 65.469 25.766  19.902  1.00 34.15 ? 125  LEU A CA    1 
ATOM   1415 C  C     . LEU C 3 119 ? 66.333 24.601  20.348  1.00 32.86 ? 125  LEU A C     1 
ATOM   1416 O  O     . LEU C 3 119 ? 66.864 24.599  21.457  1.00 32.56 ? 125  LEU A O     1 
ATOM   1417 C  CB    . LEU C 3 119 ? 66.368 26.891  19.363  1.00 32.99 ? 125  LEU A CB    1 
ATOM   1418 C  CG    . LEU C 3 119 ? 65.697 28.222  19.013  1.00 33.27 ? 125  LEU A CG    1 
ATOM   1419 C  CD1   . LEU C 3 119 ? 66.755 29.230  18.592  1.00 33.28 ? 125  LEU A CD1   1 
ATOM   1420 C  CD2   . LEU C 3 119 ? 64.667 28.016  17.909  1.00 34.04 ? 125  LEU A CD2   1 
ATOM   1421 N  N     . GLU C 3 120 ? 66.471 23.610  19.476  1.00 32.97 ? 126  GLU A N     1 
ATOM   1422 C  CA    . GLU C 3 120 ? 67.285 22.439  19.777  1.00 32.56 ? 126  GLU A CA    1 
ATOM   1423 C  C     . GLU C 3 120 ? 68.735 22.918  19.937  1.00 31.61 ? 126  GLU A C     1 
ATOM   1424 O  O     . GLU C 3 120 ? 69.266 23.626  19.084  1.00 32.52 ? 126  GLU A O     1 
ATOM   1425 C  CB    . GLU C 3 120 ? 67.135 21.421  18.641  1.00 33.14 ? 126  GLU A CB    1 
ATOM   1426 C  CG    . GLU C 3 120 ? 67.658 20.033  18.954  1.00 33.05 ? 126  GLU A CG    1 
ATOM   1427 C  CD    . GLU C 3 120 ? 69.156 19.967  18.885  1.00 32.25 ? 126  GLU A CD    1 
ATOM   1428 O  OE1   . GLU C 3 120 ? 69.704 20.360  17.838  1.00 31.19 ? 126  GLU A OE1   1 
ATOM   1429 O  OE2   . GLU C 3 120 ? 69.784 19.523  19.866  1.00 34.21 ? 126  GLU A OE2   1 
ATOM   1430 N  N     . ALA C 3 121 ? 69.355 22.532  21.047  1.00 31.33 ? 127  ALA A N     1 
ATOM   1431 C  CA    . ALA C 3 121 ? 70.715 22.934  21.401  1.00 29.44 ? 127  ALA A CA    1 
ATOM   1432 C  C     . ALA C 3 121 ? 71.816 22.695  20.372  1.00 29.96 ? 127  ALA A C     1 
ATOM   1433 O  O     . ALA C 3 121 ? 72.526 23.628  19.995  1.00 29.76 ? 127  ALA A O     1 
ATOM   1434 C  CB    . ALA C 3 121 ? 71.106 22.280  22.727  1.00 28.20 ? 127  ALA A CB    1 
ATOM   1435 N  N     . TRP C 3 122 ? 71.983 21.449  19.942  1.00 29.58 ? 128  TRP A N     1 
ATOM   1436 C  CA    . TRP C 3 122 ? 73.023 21.119  18.975  1.00 29.85 ? 128  TRP A CA    1 
ATOM   1437 C  C     . TRP C 3 122 ? 72.871 21.926  17.691  1.00 29.17 ? 128  TRP A C     1 
ATOM   1438 O  O     . TRP C 3 122 ? 73.848 22.473  17.171  1.00 26.63 ? 128  TRP A O     1 
ATOM   1439 C  CB    . TRP C 3 122 ? 72.985 19.624  18.655  1.00 31.34 ? 128  TRP A CB    1 
ATOM   1440 C  CG    . TRP C 3 122 ? 73.347 18.754  19.818  1.00 32.24 ? 128  TRP A CG    1 
ATOM   1441 C  CD1   . TRP C 3 122 ? 72.666 17.657  20.260  1.00 33.17 ? 128  TRP A CD1   1 
ATOM   1442 C  CD2   . TRP C 3 122 ? 74.503 18.872  20.653  1.00 31.77 ? 128  TRP A CD2   1 
ATOM   1443 N  NE1   . TRP C 3 122 ? 73.326 17.082  21.316  1.00 33.94 ? 128  TRP A NE1   1 
ATOM   1444 C  CE2   . TRP C 3 122 ? 74.459 17.807  21.579  1.00 32.91 ? 128  TRP A CE2   1 
ATOM   1445 C  CE3   . TRP C 3 122 ? 75.574 19.773  20.709  1.00 33.63 ? 128  TRP A CE3   1 
ATOM   1446 C  CZ2   . TRP C 3 122 ? 75.446 17.614  22.551  1.00 33.52 ? 128  TRP A CZ2   1 
ATOM   1447 C  CZ3   . TRP C 3 122 ? 76.559 19.581  21.677  1.00 33.85 ? 128  TRP A CZ3   1 
ATOM   1448 C  CH2   . TRP C 3 122 ? 76.487 18.509  22.584  1.00 33.56 ? 128  TRP A CH2   1 
ATOM   1449 N  N     . GLY C 3 123 ? 71.641 21.989  17.189  1.00 29.48 ? 129  GLY A N     1 
ATOM   1450 C  CA    . GLY C 3 123 ? 71.364 22.731  15.973  1.00 29.53 ? 129  GLY A CA    1 
ATOM   1451 C  C     . GLY C 3 123 ? 71.565 24.221  16.179  1.00 29.98 ? 129  GLY A C     1 
ATOM   1452 O  O     . GLY C 3 123 ? 71.937 24.950  15.249  1.00 27.99 ? 129  GLY A O     1 
ATOM   1453 N  N     . TYR C 3 124 ? 71.307 24.686  17.395  1.00 29.04 ? 130  TYR A N     1 
ATOM   1454 C  CA    . TYR C 3 124 ? 71.497 26.098  17.683  1.00 31.73 ? 130  TYR A CA    1 
ATOM   1455 C  C     . TYR C 3 124 ? 72.986 26.414  17.564  1.00 32.17 ? 130  TYR A C     1 
ATOM   1456 O  O     . TYR C 3 124 ? 73.369 27.407  16.945  1.00 32.45 ? 130  TYR A O     1 
ATOM   1457 C  CB    . TYR C 3 124 ? 71.016 26.450  19.091  1.00 31.88 ? 130  TYR A CB    1 
ATOM   1458 C  CG    . TYR C 3 124 ? 71.332 27.880  19.441  1.00 33.29 ? 130  TYR A CG    1 
ATOM   1459 C  CD1   . TYR C 3 124 ? 70.565 28.932  18.926  1.00 33.91 ? 130  TYR A CD1   1 
ATOM   1460 C  CD2   . TYR C 3 124 ? 72.455 28.194  20.206  1.00 33.18 ? 130  TYR A CD2   1 
ATOM   1461 C  CE1   . TYR C 3 124 ? 70.916 30.261  19.161  1.00 34.59 ? 130  TYR A CE1   1 
ATOM   1462 C  CE2   . TYR C 3 124 ? 72.819 29.520  20.443  1.00 34.97 ? 130  TYR A CE2   1 
ATOM   1463 C  CZ    . TYR C 3 124 ? 72.049 30.545  19.917  1.00 34.86 ? 130  TYR A CZ    1 
ATOM   1464 O  OH    . TYR C 3 124 ? 72.433 31.848  20.126  1.00 36.75 ? 130  TYR A OH    1 
ATOM   1465 N  N     . ARG C 3 125 ? 73.812 25.565  18.171  1.00 33.21 ? 131  ARG A N     1 
ATOM   1466 C  CA    . ARG C 3 125 ? 75.263 25.719  18.136  1.00 35.63 ? 131  ARG A CA    1 
ATOM   1467 C  C     . ARG C 3 125 ? 75.717 25.819  16.685  1.00 35.84 ? 131  ARG A C     1 
ATOM   1468 O  O     . ARG C 3 125 ? 76.406 26.764  16.290  1.00 37.19 ? 131  ARG A O     1 
ATOM   1469 C  CB    . ARG C 3 125 ? 75.942 24.503  18.772  1.00 37.79 ? 131  ARG A CB    1 
ATOM   1470 C  CG    . ARG C 3 125 ? 75.547 24.219  20.214  1.00 43.11 ? 131  ARG A CG    1 
ATOM   1471 C  CD    . ARG C 3 125 ? 76.410 24.985  21.214  1.00 47.46 ? 131  ARG A CD    1 
ATOM   1472 N  NE    . ARG C 3 125 ? 76.452 26.416  20.930  1.00 50.61 ? 131  ARG A NE    1 
ATOM   1473 C  CZ    . ARG C 3 125 ? 76.897 27.336  21.782  1.00 52.84 ? 131  ARG A CZ    1 
ATOM   1474 N  NH1   . ARG C 3 125 ? 77.339 26.974  22.982  1.00 53.71 ? 131  ARG A NH1   1 
ATOM   1475 N  NH2   . ARG C 3 125 ? 76.900 28.619  21.434  1.00 53.47 ? 131  ARG A NH2   1 
ATOM   1476 N  N     . LEU C 3 126 ? 75.318 24.828  15.894  1.00 34.45 ? 132  LEU A N     1 
ATOM   1477 C  CA    . LEU C 3 126 ? 75.685 24.767  14.492  1.00 32.97 ? 132  LEU A CA    1 
ATOM   1478 C  C     . LEU C 3 126 ? 75.316 26.016  13.695  1.00 33.27 ? 132  LEU A C     1 
ATOM   1479 O  O     . LEU C 3 126 ? 76.149 26.552  12.962  1.00 32.34 ? 132  LEU A O     1 
ATOM   1480 C  CB    . LEU C 3 126 ? 75.065 23.518  13.852  1.00 30.88 ? 132  LEU A CB    1 
ATOM   1481 C  CG    . LEU C 3 126 ? 75.584 22.199  14.443  1.00 30.97 ? 132  LEU A CG    1 
ATOM   1482 C  CD1   . LEU C 3 126 ? 74.834 21.015  13.851  1.00 29.66 ? 132  LEU A CD1   1 
ATOM   1483 C  CD2   . LEU C 3 126 ? 77.080 22.081  14.183  1.00 28.61 ? 132  LEU A CD2   1 
ATOM   1484 N  N     . GLY C 3 127 ? 74.078 26.481  13.844  1.00 33.16 ? 133  GLY A N     1 
ATOM   1485 C  CA    . GLY C 3 127 ? 73.634 27.657  13.115  1.00 33.21 ? 133  GLY A CA    1 
ATOM   1486 C  C     . GLY C 3 127 ? 74.312 28.955  13.517  1.00 34.96 ? 133  GLY A C     1 
ATOM   1487 O  O     . GLY C 3 127 ? 74.322 29.918  12.751  1.00 34.72 ? 133  GLY A O     1 
ATOM   1488 N  N     . GLU C 3 128 ? 74.888 28.977  14.716  1.00 36.66 ? 134  GLU A N     1 
ATOM   1489 C  CA    . GLU C 3 128 ? 75.559 30.157  15.244  1.00 37.99 ? 134  GLU A CA    1 
ATOM   1490 C  C     . GLU C 3 128 ? 77.076 30.140  15.056  1.00 39.83 ? 134  GLU A C     1 
ATOM   1491 O  O     . GLU C 3 128 ? 77.741 31.145  15.312  1.00 39.12 ? 134  GLU A O     1 
ATOM   1492 C  CB    . GLU C 3 128 ? 75.269 30.299  16.746  1.00 39.24 ? 134  GLU A CB    1 
ATOM   1493 C  CG    . GLU C 3 128 ? 73.816 30.531  17.119  1.00 41.60 ? 134  GLU A CG    1 
ATOM   1494 C  CD    . GLU C 3 128 ? 73.242 31.791  16.492  1.00 43.30 ? 134  GLU A CD    1 
ATOM   1495 O  OE1   . GLU C 3 128 ? 73.880 32.861  16.614  1.00 44.11 ? 134  GLU A OE1   1 
ATOM   1496 O  OE2   . GLU C 3 128 ? 72.151 31.713  15.884  1.00 44.25 ? 134  GLU A OE2   1 
ATOM   1497 N  N     . MET C 3 129 ? 77.626 29.009  14.623  1.00 40.31 ? 135  MET A N     1 
ATOM   1498 C  CA    . MET C 3 129 ? 79.073 28.890  14.456  1.00 42.24 ? 135  MET A CA    1 
ATOM   1499 C  C     . MET C 3 129 ? 79.759 30.035  13.710  1.00 41.79 ? 135  MET A C     1 
ATOM   1500 O  O     . MET C 3 129 ? 80.757 30.559  14.188  1.00 41.39 ? 135  MET A O     1 
ATOM   1501 C  CB    . MET C 3 129 ? 79.429 27.552  13.795  1.00 44.41 ? 135  MET A CB    1 
ATOM   1502 C  CG    . MET C 3 129 ? 79.176 26.324  14.683  1.00 48.80 ? 135  MET A CG    1 
ATOM   1503 S  SD    . MET C 3 129 ? 80.249 26.174  16.160  1.00 52.12 ? 135  MET A SD    1 
ATOM   1504 C  CE    . MET C 3 129 ? 79.205 26.889  17.421  1.00 51.54 ? 135  MET A CE    1 
ATOM   1505 N  N     . LYS C 3 130 ? 79.232 30.426  12.553  1.00 42.46 ? 136  LYS A N     1 
ATOM   1506 C  CA    . LYS C 3 130 ? 79.829 31.511  11.770  1.00 42.98 ? 136  LYS A CA    1 
ATOM   1507 C  C     . LYS C 3 130 ? 79.870 32.836  12.533  1.00 43.59 ? 136  LYS A C     1 
ATOM   1508 O  O     . LYS C 3 130 ? 80.843 33.589  12.436  1.00 43.40 ? 136  LYS A O     1 
ATOM   1509 C  CB    . LYS C 3 130 ? 79.066 31.702  10.452  1.00 43.30 ? 136  LYS A CB    1 
ATOM   1510 C  CG    . LYS C 3 130 ? 79.192 30.527  9.493   1.00 43.46 ? 136  LYS A CG    1 
ATOM   1511 C  CD    . LYS C 3 130 ? 78.267 30.674  8.296   1.00 43.91 ? 136  LYS A CD    1 
ATOM   1512 C  CE    . LYS C 3 130 ? 78.711 31.780  7.356   1.00 44.22 ? 136  LYS A CE    1 
ATOM   1513 N  NZ    . LYS C 3 130 ? 77.696 31.997  6.290   1.00 43.33 ? 136  LYS A NZ    1 
ATOM   1514 N  N     . GLY C 3 131 ? 78.807 33.118  13.281  1.00 43.51 ? 137  GLY A N     1 
ATOM   1515 C  CA    . GLY C 3 131 ? 78.746 34.347  14.053  1.00 42.40 ? 137  GLY A CA    1 
ATOM   1516 C  C     . GLY C 3 131 ? 79.709 34.324  15.228  1.00 42.12 ? 137  GLY A C     1 
ATOM   1517 O  O     . GLY C 3 131 ? 80.267 35.354  15.605  1.00 41.91 ? 137  GLY A O     1 
ATOM   1518 N  N     . GLU C 3 132 ? 79.904 33.148  15.813  1.00 41.39 ? 138  GLU A N     1 
ATOM   1519 C  CA    . GLU C 3 132 ? 80.815 33.010  16.941  1.00 40.94 ? 138  GLU A CA    1 
ATOM   1520 C  C     . GLU C 3 132 ? 82.230 33.185  16.415  1.00 40.56 ? 138  GLU A C     1 
ATOM   1521 O  O     . GLU C 3 132 ? 83.033 33.908  16.997  1.00 40.55 ? 138  GLU A O     1 
ATOM   1522 C  CB    . GLU C 3 132 ? 80.658 31.633  17.583  1.00 42.16 ? 138  GLU A CB    1 
ATOM   1523 C  CG    . GLU C 3 132 ? 79.212 31.300  17.944  1.00 46.57 ? 138  GLU A CG    1 
ATOM   1524 C  CD    . GLU C 3 132 ? 79.032 29.870  18.426  1.00 48.17 ? 138  GLU A CD    1 
ATOM   1525 O  OE1   . GLU C 3 132 ? 77.884 29.366  18.381  1.00 48.81 ? 138  GLU A OE1   1 
ATOM   1526 O  OE2   . GLU C 3 132 ? 80.033 29.252  18.856  1.00 49.53 ? 138  GLU A OE2   1 
ATOM   1527 N  N     . TYR C 3 133 ? 82.520 32.529  15.294  1.00 39.17 ? 139  TYR A N     1 
ATOM   1528 C  CA    . TYR C 3 133 ? 83.830 32.613  14.666  1.00 38.35 ? 139  TYR A CA    1 
ATOM   1529 C  C     . TYR C 3 133 ? 84.149 34.069  14.343  1.00 38.72 ? 139  TYR A C     1 
ATOM   1530 O  O     . TYR C 3 133 ? 85.233 34.559  14.650  1.00 37.87 ? 139  TYR A O     1 
ATOM   1531 C  CB    . TYR C 3 133 ? 83.850 31.764  13.392  1.00 37.49 ? 139  TYR A CB    1 
ATOM   1532 C  CG    . TYR C 3 133 ? 85.054 31.988  12.501  1.00 37.74 ? 139  TYR A CG    1 
ATOM   1533 C  CD1   . TYR C 3 133 ? 86.351 31.712  12.949  1.00 36.38 ? 139  TYR A CD1   1 
ATOM   1534 C  CD2   . TYR C 3 133 ? 84.895 32.488  11.208  1.00 36.74 ? 139  TYR A CD2   1 
ATOM   1535 C  CE1   . TYR C 3 133 ? 87.457 31.933  12.127  1.00 35.67 ? 139  TYR A CE1   1 
ATOM   1536 C  CE2   . TYR C 3 133 ? 85.988 32.713  10.379  1.00 37.29 ? 139  TYR A CE2   1 
ATOM   1537 C  CZ    . TYR C 3 133 ? 87.267 32.437  10.841  1.00 37.67 ? 139  TYR A CZ    1 
ATOM   1538 O  OH    . TYR C 3 133 ? 88.344 32.682  10.015  1.00 37.31 ? 139  TYR A OH    1 
ATOM   1539 N  N     . LYS C 3 134 ? 83.193 34.757  13.729  1.00 39.41 ? 140  LYS A N     1 
ATOM   1540 C  CA    . LYS C 3 134 ? 83.366 36.158  13.376  1.00 40.80 ? 140  LYS A CA    1 
ATOM   1541 C  C     . LYS C 3 134 ? 83.741 36.987  14.600  1.00 42.70 ? 140  LYS A C     1 
ATOM   1542 O  O     . LYS C 3 134 ? 84.561 37.898  14.504  1.00 43.94 ? 140  LYS A O     1 
ATOM   1543 C  CB    . LYS C 3 134 ? 82.083 36.718  12.763  1.00 41.16 ? 140  LYS A CB    1 
ATOM   1544 C  CG    . LYS C 3 134 ? 82.156 38.200  12.430  1.00 41.18 ? 140  LYS A CG    1 
ATOM   1545 C  CD    . LYS C 3 134 ? 80.809 38.738  11.975  1.00 42.96 ? 140  LYS A CD    1 
ATOM   1546 C  CE    . LYS C 3 134 ? 80.864 40.242  11.730  1.00 44.53 ? 140  LYS A CE    1 
ATOM   1547 N  NZ    . LYS C 3 134 ? 79.534 40.786  11.339  1.00 45.02 ? 140  LYS A NZ    1 
ATOM   1548 N  N     . ASP C 3 135 ? 83.139 36.680  15.746  1.00 43.95 ? 141  ASP A N     1 
ATOM   1549 C  CA    . ASP C 3 135 ? 83.443 37.413  16.971  1.00 45.39 ? 141  ASP A CA    1 
ATOM   1550 C  C     . ASP C 3 135 ? 84.871 37.149  17.459  1.00 45.67 ? 141  ASP A C     1 
ATOM   1551 O  O     . ASP C 3 135 ? 85.589 38.087  17.820  1.00 45.65 ? 141  ASP A O     1 
ATOM   1552 C  CB    . ASP C 3 135 ? 82.440 37.067  18.078  1.00 46.58 ? 141  ASP A CB    1 
ATOM   1553 C  CG    . ASP C 3 135 ? 81.056 37.636  17.810  1.00 47.27 ? 141  ASP A CG    1 
ATOM   1554 O  OD1   . ASP C 3 135 ? 80.968 38.780  17.320  1.00 48.59 ? 141  ASP A OD1   1 
ATOM   1555 O  OD2   . ASP C 3 135 ? 80.052 36.949  18.100  1.00 49.93 ? 141  ASP A OD2   1 
ATOM   1556 N  N     . ASP C 3 136 ? 85.283 35.883  17.474  1.00 44.88 ? 142  ASP A N     1 
ATOM   1557 C  CA    . ASP C 3 136 ? 86.636 35.537  17.907  1.00 46.51 ? 142  ASP A CA    1 
ATOM   1558 C  C     . ASP C 3 136 ? 87.654 36.257  17.020  1.00 46.40 ? 142  ASP A C     1 
ATOM   1559 O  O     . ASP C 3 136 ? 88.683 36.747  17.500  1.00 45.24 ? 142  ASP A O     1 
ATOM   1560 C  CB    . ASP C 3 136 ? 86.871 34.026  17.809  1.00 49.22 ? 142  ASP A CB    1 
ATOM   1561 C  CG    . ASP C 3 136 ? 85.990 33.233  18.752  1.00 51.94 ? 142  ASP A CG    1 
ATOM   1562 O  OD1   . ASP C 3 136 ? 84.768 33.487  18.774  1.00 54.94 ? 142  ASP A OD1   1 
ATOM   1563 O  OD2   . ASP C 3 136 ? 86.513 32.346  19.465  1.00 54.05 ? 142  ASP A OD2   1 
ATOM   1564 N  N     . PHE C 3 137 ? 87.353 36.311  15.724  1.00 45.55 ? 143  PHE A N     1 
ATOM   1565 C  CA    . PHE C 3 137 ? 88.218 36.959  14.745  1.00 45.02 ? 143  PHE A CA    1 
ATOM   1566 C  C     . PHE C 3 137 ? 88.366 38.454  15.053  1.00 46.27 ? 143  PHE A C     1 
ATOM   1567 O  O     . PHE C 3 137 ? 89.484 38.955  15.181  1.00 45.88 ? 143  PHE A O     1 
ATOM   1568 C  CB    . PHE C 3 137 ? 87.642 36.777  13.336  1.00 42.50 ? 143  PHE A CB    1 
ATOM   1569 C  CG    . PHE C 3 137 ? 88.650 36.949  12.239  1.00 38.32 ? 143  PHE A CG    1 
ATOM   1570 C  CD1   . PHE C 3 137 ? 89.515 35.913  11.907  1.00 36.68 ? 143  PHE A CD1   1 
ATOM   1571 C  CD2   . PHE C 3 137 ? 88.742 38.148  11.543  1.00 37.51 ? 143  PHE A CD2   1 
ATOM   1572 C  CE1   . PHE C 3 137 ? 90.461 36.065  10.893  1.00 37.65 ? 143  PHE A CE1   1 
ATOM   1573 C  CE2   . PHE C 3 137 ? 89.683 38.319  10.525  1.00 37.84 ? 143  PHE A CE2   1 
ATOM   1574 C  CZ    . PHE C 3 137 ? 90.546 37.273  10.197  1.00 37.67 ? 143  PHE A CZ    1 
ATOM   1575 N  N     . LYS C 3 138 ? 87.239 39.155  15.170  1.00 47.85 ? 144  LYS A N     1 
ATOM   1576 C  CA    . LYS C 3 138 ? 87.245 40.589  15.466  1.00 50.65 ? 144  LYS A CA    1 
ATOM   1577 C  C     . LYS C 3 138 ? 87.957 40.880  16.777  1.00 52.35 ? 144  LYS A C     1 
ATOM   1578 O  O     . LYS C 3 138 ? 88.744 41.821  16.873  1.00 53.25 ? 144  LYS A O     1 
ATOM   1579 C  CB    . LYS C 3 138 ? 85.816 41.135  15.553  1.00 50.61 ? 144  LYS A CB    1 
ATOM   1580 C  CG    . LYS C 3 138 ? 85.116 41.278  14.219  1.00 52.17 ? 144  LYS A CG    1 
ATOM   1581 C  CD    . LYS C 3 138 ? 83.650 41.666  14.385  1.00 53.53 ? 144  LYS A CD    1 
ATOM   1582 C  CE    . LYS C 3 138 ? 83.480 43.027  15.050  1.00 54.00 ? 144  LYS A CE    1 
ATOM   1583 N  NZ    . LYS C 3 138 ? 82.032 43.376  15.203  1.00 54.45 ? 144  LYS A NZ    1 
ATOM   1584 N  N     . ARG C 3 139 ? 87.667 40.071  17.787  1.00 54.07 ? 145  ARG A N     1 
ATOM   1585 C  CA    . ARG C 3 139 ? 88.278 40.235  19.097  1.00 55.91 ? 145  ARG A CA    1 
ATOM   1586 C  C     . ARG C 3 139 ? 89.794 40.211  18.954  1.00 56.90 ? 145  ARG A C     1 
ATOM   1587 O  O     . ARG C 3 139 ? 90.481 41.169  19.315  1.00 57.48 ? 145  ARG A O     1 
ATOM   1588 C  CB    . ARG C 3 139 ? 87.841 39.100  20.021  1.00 56.58 ? 145  ARG A CB    1 
ATOM   1589 C  CG    . ARG C 3 139 ? 88.088 39.353  21.498  1.00 57.77 ? 145  ARG A CG    1 
ATOM   1590 C  CD    . ARG C 3 139 ? 87.862 38.089  22.326  1.00 59.34 ? 145  ARG A CD    1 
ATOM   1591 N  NE    . ARG C 3 139 ? 86.769 37.255  21.817  1.00 61.10 ? 145  ARG A NE    1 
ATOM   1592 C  CZ    . ARG C 3 139 ? 85.543 37.694  21.532  1.00 62.36 ? 145  ARG A CZ    1 
ATOM   1593 N  NH1   . ARG C 3 139 ? 85.232 38.975  21.699  1.00 61.60 ? 145  ARG A NH1   1 
ATOM   1594 N  NH2   . ARG C 3 139 ? 84.622 36.847  21.085  1.00 61.75 ? 145  ARG A NH2   1 
ATOM   1595 N  N     . MET C 3 140 ? 90.302 39.109  18.412  1.00 57.96 ? 146  MET A N     1 
ATOM   1596 C  CA    . MET C 3 140 ? 91.733 38.925  18.220  1.00 59.60 ? 146  MET A CA    1 
ATOM   1597 C  C     . MET C 3 140 ? 92.371 40.041  17.403  1.00 59.93 ? 146  MET A C     1 
ATOM   1598 O  O     . MET C 3 140 ? 93.543 40.367  17.604  1.00 59.67 ? 146  MET A O     1 
ATOM   1599 C  CB    . MET C 3 140 ? 91.994 37.569  17.565  1.00 61.11 ? 146  MET A CB    1 
ATOM   1600 C  CG    . MET C 3 140 ? 91.433 36.406  18.374  1.00 63.85 ? 146  MET A CG    1 
ATOM   1601 S  SD    . MET C 3 140 ? 91.805 34.786  17.681  1.00 66.68 ? 146  MET A SD    1 
ATOM   1602 C  CE    . MET C 3 140 ? 93.289 34.357  18.624  1.00 66.17 ? 146  MET A CE    1 
ATOM   1603 N  N     . LEU C 3 141 ? 91.612 40.628  16.483  1.00 60.28 ? 147  LEU A N     1 
ATOM   1604 C  CA    . LEU C 3 141 ? 92.144 41.724  15.679  1.00 61.67 ? 147  LEU A CA    1 
ATOM   1605 C  C     . LEU C 3 141 ? 92.304 42.974  16.540  1.00 62.05 ? 147  LEU A C     1 
ATOM   1606 O  O     . LEU C 3 141 ? 93.366 43.597  16.550  1.00 61.82 ? 147  LEU A O     1 
ATOM   1607 C  CB    . LEU C 3 141 ? 91.231 42.041  14.489  1.00 61.42 ? 147  LEU A CB    1 
ATOM   1608 C  CG    . LEU C 3 141 ? 91.319 41.154  13.244  1.00 61.20 ? 147  LEU A CG    1 
ATOM   1609 C  CD1   . LEU C 3 141 ? 90.561 41.825  12.105  1.00 60.98 ? 147  LEU A CD1   1 
ATOM   1610 C  CD2   . LEU C 3 141 ? 92.772 40.952  12.842  1.00 61.31 ? 147  LEU A CD2   1 
ATOM   1611 N  N     . GLU C 3 142 ? 91.246 43.335  17.263  1.00 62.84 ? 148  GLU A N     1 
ATOM   1612 C  CA    . GLU C 3 142 ? 91.283 44.512  18.126  1.00 63.80 ? 148  GLU A CA    1 
ATOM   1613 C  C     . GLU C 3 142 ? 92.391 44.401  19.170  1.00 63.76 ? 148  GLU A C     1 
ATOM   1614 O  O     . GLU C 3 142 ? 92.916 45.413  19.635  1.00 64.14 ? 148  GLU A O     1 
ATOM   1615 C  CB    . GLU C 3 142 ? 89.933 44.713  18.824  1.00 64.44 ? 148  GLU A CB    1 
ATOM   1616 C  CG    . GLU C 3 142 ? 88.896 45.465  17.988  1.00 65.74 ? 148  GLU A CG    1 
ATOM   1617 C  CD    . GLU C 3 142 ? 87.726 44.593  17.554  1.00 66.71 ? 148  GLU A CD    1 
ATOM   1618 O  OE1   . GLU C 3 142 ? 87.078 43.974  18.431  1.00 67.04 ? 148  GLU A OE1   1 
ATOM   1619 O  OE2   . GLU C 3 142 ? 87.450 44.537  16.335  1.00 66.23 ? 148  GLU A OE2   1 
ATOM   1620 N  N     . GLU C 3 143 ? 92.741 43.169  19.531  1.00 63.30 ? 149  GLU A N     1 
ATOM   1621 C  CA    . GLU C 3 143 ? 93.792 42.922  20.513  1.00 63.14 ? 149  GLU A CA    1 
ATOM   1622 C  C     . GLU C 3 143 ? 95.171 43.161  19.900  1.00 63.15 ? 149  GLU A C     1 
ATOM   1623 O  O     . GLU C 3 143 ? 96.161 43.313  20.620  1.00 63.52 ? 149  GLU A O     1 
ATOM   1624 C  CB    . GLU C 3 143 ? 93.709 41.482  21.034  1.00 63.08 ? 149  GLU A CB    1 
ATOM   1625 C  CG    . GLU C 3 143 ? 92.365 41.120  21.653  1.00 63.86 ? 149  GLU A CG    1 
ATOM   1626 C  CD    . GLU C 3 143 ? 92.348 39.725  22.260  1.00 64.27 ? 149  GLU A CD    1 
ATOM   1627 O  OE1   . GLU C 3 143 ? 92.673 38.750  21.546  1.00 64.72 ? 149  GLU A OE1   1 
ATOM   1628 O  OE2   . GLU C 3 143 ? 92.001 39.604  23.454  1.00 64.18 ? 149  GLU A OE2   1 
ATOM   1629 N  N     . GLN C 3 144 ? 95.232 43.193  18.571  1.00 62.74 ? 150  GLN A N     1 
ATOM   1630 C  CA    . GLN C 3 144 ? 96.492 43.413  17.868  1.00 62.27 ? 150  GLN A CA    1 
ATOM   1631 C  C     . GLN C 3 144 ? 96.532 44.747  17.109  1.00 61.89 ? 150  GLN A C     1 
ATOM   1632 O  O     . GLN C 3 144 ? 97.449 44.996  16.322  1.00 61.18 ? 150  GLN A O     1 
ATOM   1633 C  CB    . GLN C 3 144 ? 96.769 42.251  16.907  1.00 62.46 ? 150  GLN A CB    1 
ATOM   1634 C  CG    . GLN C 3 144 ? 96.963 40.905  17.589  1.00 63.03 ? 150  GLN A CG    1 
ATOM   1635 C  CD    . GLN C 3 144 ? 98.152 40.892  18.538  1.00 63.57 ? 150  GLN A CD    1 
ATOM   1636 O  OE1   . GLN C 3 144 ? 99.292 41.121  18.129  1.00 63.54 ? 150  GLN A OE1   1 
ATOM   1637 N  NE2   . GLN C 3 144 ? 97.888 40.620  19.814  1.00 63.94 ? 150  GLN A NE2   1 
ATOM   1638 N  N     . GLY C 3 145 ? 95.532 45.594  17.341  1.00 61.74 ? 151  GLY A N     1 
ATOM   1639 C  CA    . GLY C 3 145 ? 95.495 46.900  16.699  1.00 60.76 ? 151  GLY A CA    1 
ATOM   1640 C  C     . GLY C 3 145 ? 94.976 47.029  15.274  1.00 60.69 ? 151  GLY A C     1 
ATOM   1641 O  O     . GLY C 3 145 ? 94.914 48.146  14.753  1.00 60.56 ? 151  GLY A O     1 
ATOM   1642 N  N     . GLU C 3 146 ? 94.605 45.921  14.632  1.00 60.21 ? 152  GLU A N     1 
ATOM   1643 C  CA    . GLU C 3 146 ? 94.101 45.996  13.258  1.00 58.54 ? 152  GLU A CA    1 
ATOM   1644 C  C     . GLU C 3 146 ? 92.613 46.310  13.203  1.00 57.41 ? 152  GLU A C     1 
ATOM   1645 O  O     . GLU C 3 146 ? 91.859 45.978  14.117  1.00 57.59 ? 152  GLU A O     1 
ATOM   1646 C  CB    . GLU C 3 146 ? 94.357 44.689  12.496  1.00 58.91 ? 152  GLU A CB    1 
ATOM   1647 C  CG    . GLU C 3 146 ? 95.814 44.281  12.423  1.00 60.04 ? 152  GLU A CG    1 
ATOM   1648 C  CD    . GLU C 3 146 ? 96.176 43.283  13.499  1.00 60.84 ? 152  GLU A CD    1 
ATOM   1649 O  OE1   . GLU C 3 146 ? 95.638 43.412  14.618  1.00 61.01 ? 152  GLU A OE1   1 
ATOM   1650 O  OE2   . GLU C 3 146 ? 96.996 42.376  13.230  1.00 61.42 ? 152  GLU A OE2   1 
ATOM   1651 N  N     . GLU C 3 147 ? 92.199 46.951  12.119  1.00 56.47 ? 153  GLU A N     1 
ATOM   1652 C  CA    . GLU C 3 147 ? 90.801 47.301  11.925  1.00 56.53 ? 153  GLU A CA    1 
ATOM   1653 C  C     . GLU C 3 147 ? 90.069 46.138  11.255  1.00 55.53 ? 153  GLU A C     1 
ATOM   1654 O  O     . GLU C 3 147 ? 90.656 45.391  10.468  1.00 55.54 ? 153  GLU A O     1 
ATOM   1655 C  CB    . GLU C 3 147 ? 90.703 48.566  11.074  1.00 57.85 ? 153  GLU A CB    1 
ATOM   1656 C  CG    . GLU C 3 147 ? 91.266 49.794  11.774  1.00 60.88 ? 153  GLU A CG    1 
ATOM   1657 C  CD    . GLU C 3 147 ? 91.467 50.970  10.835  1.00 63.53 ? 153  GLU A CD    1 
ATOM   1658 O  OE1   . GLU C 3 147 ? 92.348 50.879  9.950   1.00 64.15 ? 153  GLU A OE1   1 
ATOM   1659 O  OE2   . GLU C 3 147 ? 90.745 51.982  10.980  1.00 64.76 ? 153  GLU A OE2   1 
ATOM   1660 N  N     . TYR C 3 148 ? 88.789 45.982  11.580  1.00 53.69 ? 154  TYR A N     1 
ATOM   1661 C  CA    . TYR C 3 148 ? 87.983 44.902  11.023  1.00 51.99 ? 154  TYR A CA    1 
ATOM   1662 C  C     . TYR C 3 148 ? 87.181 45.338  9.799   1.00 52.46 ? 154  TYR A C     1 
ATOM   1663 O  O     . TYR C 3 148 ? 86.535 46.389  9.802   1.00 52.50 ? 154  TYR A O     1 
ATOM   1664 C  CB    . TYR C 3 148 ? 87.022 44.358  12.082  1.00 49.36 ? 154  TYR A CB    1 
ATOM   1665 C  CG    . TYR C 3 148 ? 86.107 43.277  11.556  1.00 46.15 ? 154  TYR A CG    1 
ATOM   1666 C  CD1   . TYR C 3 148 ? 86.597 42.006  11.268  1.00 44.68 ? 154  TYR A CD1   1 
ATOM   1667 C  CD2   . TYR C 3 148 ? 84.758 43.535  11.319  1.00 43.42 ? 154  TYR A CD2   1 
ATOM   1668 C  CE1   . TYR C 3 148 ? 85.769 41.016  10.757  1.00 42.99 ? 154  TYR A CE1   1 
ATOM   1669 C  CE2   . TYR C 3 148 ? 83.922 42.555  10.807  1.00 42.78 ? 154  TYR A CE2   1 
ATOM   1670 C  CZ    . TYR C 3 148 ? 84.435 41.295  10.527  1.00 43.06 ? 154  TYR A CZ    1 
ATOM   1671 O  OH    . TYR C 3 148 ? 83.617 40.318  10.010  1.00 41.53 ? 154  TYR A OH    1 
ATOM   1672 N  N     . VAL C 3 149 ? 87.216 44.509  8.761   1.00 52.78 ? 155  VAL A N     1 
ATOM   1673 C  CA    . VAL C 3 149 ? 86.497 44.792  7.528   1.00 52.40 ? 155  VAL A CA    1 
ATOM   1674 C  C     . VAL C 3 149 ? 85.371 43.784  7.311   1.00 52.94 ? 155  VAL A C     1 
ATOM   1675 O  O     . VAL C 3 149 ? 85.480 42.629  7.721   1.00 52.57 ? 155  VAL A O     1 
ATOM   1676 C  CB    . VAL C 3 149 ? 87.446 44.741  6.317   1.00 52.09 ? 155  VAL A CB    1 
ATOM   1677 C  CG1   . VAL C 3 149 ? 86.688 45.097  5.046   1.00 52.49 ? 155  VAL A CG1   1 
ATOM   1678 C  CG2   . VAL C 3 149 ? 88.606 45.692  6.530   1.00 51.68 ? 155  VAL A CG2   1 
ATOM   1679 N  N     . ASP C 3 150 ? 84.299 44.245  6.666   1.00 53.66 ? 156  ASP A N     1 
ATOM   1680 C  CA    . ASP C 3 150 ? 83.115 43.439  6.344   1.00 53.36 ? 156  ASP A CA    1 
ATOM   1681 C  C     . ASP C 3 150 ? 83.097 42.079  7.029   1.00 51.76 ? 156  ASP A C     1 
ATOM   1682 O  O     . ASP C 3 150 ? 82.655 41.942  8.174   1.00 52.66 ? 156  ASP A O     1 
ATOM   1683 C  CB    . ASP C 3 150 ? 83.023 43.213  4.829   1.00 55.26 ? 156  ASP A CB    1 
ATOM   1684 C  CG    . ASP C 3 150 ? 83.317 44.469  4.027   1.00 57.71 ? 156  ASP A CG    1 
ATOM   1685 O  OD1   . ASP C 3 150 ? 82.631 45.496  4.237   1.00 59.56 ? 156  ASP A OD1   1 
ATOM   1686 O  OD2   . ASP C 3 150 ? 84.237 44.425  3.181   1.00 57.39 ? 156  ASP A OD2   1 
ATOM   1687 N  N     . GLY C 3 151 ? 83.570 41.076  6.296   1.00 48.49 ? 157  GLY A N     1 
ATOM   1688 C  CA    . GLY C 3 151 ? 83.635 39.716  6.800   1.00 45.25 ? 157  GLY A CA    1 
ATOM   1689 C  C     . GLY C 3 151 ? 84.916 39.087  6.288   1.00 43.09 ? 157  GLY A C     1 
ATOM   1690 O  O     . GLY C 3 151 ? 84.900 38.090  5.566   1.00 40.97 ? 157  GLY A O     1 
ATOM   1691 N  N     . MET C 3 152 ? 86.034 39.699  6.660   1.00 41.55 ? 158  MET A N     1 
ATOM   1692 C  CA    . MET C 3 152 ? 87.348 39.237  6.246   1.00 39.97 ? 158  MET A CA    1 
ATOM   1693 C  C     . MET C 3 152 ? 87.705 37.892  6.869   1.00 38.44 ? 158  MET A C     1 
ATOM   1694 O  O     . MET C 3 152 ? 88.632 37.222  6.408   1.00 38.57 ? 158  MET A O     1 
ATOM   1695 C  CB    . MET C 3 152 ? 88.405 40.284  6.613   1.00 38.82 ? 158  MET A CB    1 
ATOM   1696 C  CG    . MET C 3 152 ? 88.496 40.577  8.095   1.00 39.46 ? 158  MET A CG    1 
ATOM   1697 S  SD    . MET C 3 152 ? 89.522 42.019  8.462   1.00 42.64 ? 158  MET A SD    1 
ATOM   1698 C  CE    . MET C 3 152 ? 91.165 41.284  8.529   1.00 42.30 ? 158  MET A CE    1 
ATOM   1699 N  N     . GLU C 3 153 ? 86.970 37.500  7.908   1.00 36.36 ? 159  GLU A N     1 
ATOM   1700 C  CA    . GLU C 3 153 ? 87.227 36.231  8.586   1.00 34.65 ? 159  GLU A CA    1 
ATOM   1701 C  C     . GLU C 3 153 ? 87.131 35.043  7.626   1.00 33.69 ? 159  GLU A C     1 
ATOM   1702 O  O     . GLU C 3 153 ? 87.672 33.970  7.900   1.00 33.64 ? 159  GLU A O     1 
ATOM   1703 C  CB    . GLU C 3 153 ? 86.252 36.027  9.761   1.00 34.66 ? 159  GLU A CB    1 
ATOM   1704 C  CG    . GLU C 3 153 ? 84.779 35.888  9.378   1.00 34.59 ? 159  GLU A CG    1 
ATOM   1705 C  CD    . GLU C 3 153 ? 84.066 37.227  9.234   1.00 36.48 ? 159  GLU A CD    1 
ATOM   1706 O  OE1   . GLU C 3 153 ? 84.756 38.251  9.035   1.00 36.01 ? 159  GLU A OE1   1 
ATOM   1707 O  OE2   . GLU C 3 153 ? 82.814 37.255  9.306   1.00 35.59 ? 159  GLU A OE2   1 
ATOM   1708 N  N     . TRP C 3 154 ? 86.457 35.233  6.497   1.00 31.98 ? 160  TRP A N     1 
ATOM   1709 C  CA    . TRP C 3 154 ? 86.308 34.147  5.527   1.00 33.18 ? 160  TRP A CA    1 
ATOM   1710 C  C     . TRP C 3 154 ? 87.245 34.217  4.321   1.00 33.45 ? 160  TRP A C     1 
ATOM   1711 O  O     . TRP C 3 154 ? 87.256 33.305  3.494   1.00 32.86 ? 160  TRP A O     1 
ATOM   1712 C  CB    . TRP C 3 154 ? 84.852 34.072  5.037   1.00 32.19 ? 160  TRP A CB    1 
ATOM   1713 C  CG    . TRP C 3 154 ? 83.891 33.699  6.130   1.00 31.87 ? 160  TRP A CG    1 
ATOM   1714 C  CD1   . TRP C 3 154 ? 82.915 34.486  6.673   1.00 31.04 ? 160  TRP A CD1   1 
ATOM   1715 C  CD2   . TRP C 3 154 ? 83.881 32.476  6.871   1.00 31.31 ? 160  TRP A CD2   1 
ATOM   1716 N  NE1   . TRP C 3 154 ? 82.301 33.830  7.713   1.00 31.18 ? 160  TRP A NE1   1 
ATOM   1717 C  CE2   . TRP C 3 154 ? 82.875 32.594  7.858   1.00 32.00 ? 160  TRP A CE2   1 
ATOM   1718 C  CE3   . TRP C 3 154 ? 84.627 31.291  6.801   1.00 30.94 ? 160  TRP A CE3   1 
ATOM   1719 C  CZ2   . TRP C 3 154 ? 82.595 31.569  8.772   1.00 32.21 ? 160  TRP A CZ2   1 
ATOM   1720 C  CZ3   . TRP C 3 154 ? 84.353 30.272  7.708   1.00 31.80 ? 160  TRP A CZ3   1 
ATOM   1721 C  CH2   . TRP C 3 154 ? 83.343 30.418  8.683   1.00 31.29 ? 160  TRP A CH2   1 
ATOM   1722 N  N     . TRP C 3 155 ? 88.045 35.278  4.226   1.00 34.16 ? 161  TRP A N     1 
ATOM   1723 C  CA    . TRP C 3 155 ? 88.950 35.427  3.088   1.00 34.90 ? 161  TRP A CA    1 
ATOM   1724 C  C     . TRP C 3 155 ? 90.106 34.428  3.058   1.00 34.15 ? 161  TRP A C     1 
ATOM   1725 O  O     . TRP C 3 155 ? 90.463 33.922  1.996   1.00 34.63 ? 161  TRP A O     1 
ATOM   1726 C  CB    . TRP C 3 155 ? 89.521 36.853  3.021   1.00 34.94 ? 161  TRP A CB    1 
ATOM   1727 C  CG    . TRP C 3 155 ? 88.490 37.947  2.880   1.00 37.78 ? 161  TRP A CG    1 
ATOM   1728 C  CD1   . TRP C 3 155 ? 87.179 37.810  2.496   1.00 37.38 ? 161  TRP A CD1   1 
ATOM   1729 C  CD2   . TRP C 3 155 ? 88.693 39.351  3.109   1.00 37.59 ? 161  TRP A CD2   1 
ATOM   1730 N  NE1   . TRP C 3 155 ? 86.561 39.039  2.475   1.00 36.67 ? 161  TRP A NE1   1 
ATOM   1731 C  CE2   . TRP C 3 155 ? 87.465 40.000  2.846   1.00 37.17 ? 161  TRP A CE2   1 
ATOM   1732 C  CE3   . TRP C 3 155 ? 89.795 40.121  3.510   1.00 37.84 ? 161  TRP A CE3   1 
ATOM   1733 C  CZ2   . TRP C 3 155 ? 87.305 41.392  2.972   1.00 38.67 ? 161  TRP A CZ2   1 
ATOM   1734 C  CZ3   . TRP C 3 155 ? 89.636 41.508  3.635   1.00 38.68 ? 161  TRP A CZ3   1 
ATOM   1735 C  CH2   . TRP C 3 155 ? 88.398 42.125  3.366   1.00 37.42 ? 161  TRP A CH2   1 
ATOM   1736 N  N     . ASN C 3 156 ? 90.682 34.130  4.215   1.00 33.15 ? 162  ASN A N     1 
ATOM   1737 C  CA    . ASN C 3 156 ? 91.814 33.214  4.257   1.00 34.18 ? 162  ASN A CA    1 
ATOM   1738 C  C     . ASN C 3 156 ? 91.684 32.127  5.309   1.00 33.99 ? 162  ASN A C     1 
ATOM   1739 O  O     . ASN C 3 156 ? 91.080 32.328  6.361   1.00 34.55 ? 162  ASN A O     1 
ATOM   1740 C  CB    . ASN C 3 156 ? 93.108 34.002  4.504   1.00 34.06 ? 162  ASN A CB    1 
ATOM   1741 C  CG    . ASN C 3 156 ? 93.406 34.993  3.393   1.00 35.72 ? 162  ASN A CG    1 
ATOM   1742 O  OD1   . ASN C 3 156 ? 93.770 34.604  2.283   1.00 37.17 ? 162  ASN A OD1   1 
ATOM   1743 N  ND2   . ASN C 3 156 ? 93.238 36.280  3.682   1.00 37.29 ? 162  ASN A ND2   1 
ATOM   1744 N  N     . PHE C 3 157 ? 92.260 30.969  5.015   1.00 33.51 ? 163  PHE A N     1 
ATOM   1745 C  CA    . PHE C 3 157 ? 92.229 29.857  5.945   1.00 34.31 ? 163  PHE A CA    1 
ATOM   1746 C  C     . PHE C 3 157 ? 93.092 30.215  7.148   1.00 36.13 ? 163  PHE A C     1 
ATOM   1747 O  O     . PHE C 3 157 ? 94.020 31.015  7.034   1.00 37.47 ? 163  PHE A O     1 
ATOM   1748 C  CB    . PHE C 3 157 ? 92.790 28.594  5.289   1.00 33.62 ? 163  PHE A CB    1 
ATOM   1749 C  CG    . PHE C 3 157 ? 93.209 27.540  6.277   1.00 34.42 ? 163  PHE A CG    1 
ATOM   1750 C  CD1   . PHE C 3 157 ? 92.258 26.812  6.988   1.00 34.10 ? 163  PHE A CD1   1 
ATOM   1751 C  CD2   . PHE C 3 157 ? 94.556 27.314  6.538   1.00 33.80 ? 163  PHE A CD2   1 
ATOM   1752 C  CE1   . PHE C 3 157 ? 92.647 25.877  7.947   1.00 35.51 ? 163  PHE A CE1   1 
ATOM   1753 C  CE2   . PHE C 3 157 ? 94.956 26.380  7.498   1.00 33.92 ? 163  PHE A CE2   1 
ATOM   1754 C  CZ    . PHE C 3 157 ? 94.000 25.663  8.203   1.00 34.63 ? 163  PHE A CZ    1 
ATOM   1755 N  N     . ASN C 3 158 ? 92.776 29.629  8.299   1.00 36.08 ? 164  ASN A N     1 
ATOM   1756 C  CA    . ASN C 3 158 ? 93.547 29.849  9.520   1.00 36.39 ? 164  ASN A CA    1 
ATOM   1757 C  C     . ASN C 3 158 ? 93.159 28.772  10.529  1.00 36.17 ? 164  ASN A C     1 
ATOM   1758 O  O     . ASN C 3 158 ? 92.113 28.138  10.394  1.00 35.09 ? 164  ASN A O     1 
ATOM   1759 C  CB    . ASN C 3 158 ? 93.316 31.264  10.083  1.00 34.80 ? 164  ASN A CB    1 
ATOM   1760 C  CG    . ASN C 3 158 ? 91.940 31.450  10.669  1.00 34.92 ? 164  ASN A CG    1 
ATOM   1761 O  OD1   . ASN C 3 158 ? 91.600 30.846  11.687  1.00 35.03 ? 164  ASN A OD1   1 
ATOM   1762 N  ND2   . ASN C 3 158 ? 91.138 32.294  10.035  1.00 34.36 ? 164  ASN A ND2   1 
ATOM   1763 N  N     . GLU C 3 159 ? 94.007 28.560  11.529  1.00 37.31 ? 165  GLU A N     1 
ATOM   1764 C  CA    . GLU C 3 159 ? 93.766 27.525  12.526  1.00 37.10 ? 165  GLU A CA    1 
ATOM   1765 C  C     . GLU C 3 159 ? 92.551 27.706  13.430  1.00 36.12 ? 165  GLU A C     1 
ATOM   1766 O  O     . GLU C 3 159 ? 92.097 26.746  14.042  1.00 36.69 ? 165  GLU A O     1 
ATOM   1767 C  CB    . GLU C 3 159 ? 95.024 27.313  13.370  1.00 38.18 ? 165  GLU A CB    1 
ATOM   1768 C  CG    . GLU C 3 159 ? 96.198 26.688  12.603  1.00 40.45 ? 165  GLU A CG    1 
ATOM   1769 C  CD    . GLU C 3 159 ? 95.861 25.339  11.956  1.00 43.16 ? 165  GLU A CD    1 
ATOM   1770 O  OE1   . GLU C 3 159 ? 95.268 24.467  12.631  1.00 42.33 ? 165  GLU A OE1   1 
ATOM   1771 O  OE2   . GLU C 3 159 ? 96.207 25.145  10.768  1.00 44.29 ? 165  GLU A OE2   1 
ATOM   1772 N  N     . GLU C 3 160 ? 92.022 28.922  13.528  1.00 36.08 ? 166  GLU A N     1 
ATOM   1773 C  CA    . GLU C 3 160 ? 90.836 29.140  14.352  1.00 34.93 ? 166  GLU A CA    1 
ATOM   1774 C  C     . GLU C 3 160 ? 89.674 28.543  13.560  1.00 34.26 ? 166  GLU A C     1 
ATOM   1775 O  O     . GLU C 3 160 ? 88.777 27.908  14.118  1.00 34.94 ? 166  GLU A O     1 
ATOM   1776 C  CB    . GLU C 3 160 ? 90.605 30.636  14.599  1.00 32.75 ? 166  GLU A CB    1 
ATOM   1777 N  N     . MET C 3 161 ? 89.717 28.740  12.246  1.00 32.60 ? 167  MET A N     1 
ATOM   1778 C  CA    . MET C 3 161 ? 88.700 28.219  11.340  1.00 31.71 ? 167  MET A CA    1 
ATOM   1779 C  C     . MET C 3 161 ? 88.708 26.690  11.400  1.00 30.50 ? 167  MET A C     1 
ATOM   1780 O  O     . MET C 3 161 ? 87.659 26.053  11.482  1.00 29.81 ? 167  MET A O     1 
ATOM   1781 C  CB    . MET C 3 161 ? 89.002 28.686  9.917   1.00 30.08 ? 167  MET A CB    1 
ATOM   1782 C  CG    . MET C 3 161 ? 87.930 28.363  8.888   1.00 25.83 ? 167  MET A CG    1 
ATOM   1783 S  SD    . MET C 3 161 ? 88.462 28.899  7.248   1.00 27.21 ? 167  MET A SD    1 
ATOM   1784 C  CE    . MET C 3 161 ? 88.148 30.682  7.311   1.00 24.92 ? 167  MET A CE    1 
ATOM   1785 N  N     . MET C 3 162 ? 89.909 26.120  11.360  1.00 30.76 ? 168  MET A N     1 
ATOM   1786 C  CA    . MET C 3 162 ? 90.111 24.678  11.417  1.00 29.98 ? 168  MET A CA    1 
ATOM   1787 C  C     . MET C 3 162 ? 89.536 24.082  12.711  1.00 31.84 ? 168  MET A C     1 
ATOM   1788 O  O     . MET C 3 162 ? 88.979 22.980  12.699  1.00 33.43 ? 168  MET A O     1 
ATOM   1789 C  CB    . MET C 3 162 ? 91.610 24.369  11.325  1.00 28.55 ? 168  MET A CB    1 
ATOM   1790 C  CG    . MET C 3 162 ? 91.975 22.887  11.227  1.00 26.74 ? 168  MET A CG    1 
ATOM   1791 S  SD    . MET C 3 162 ? 91.733 22.191  9.566   1.00 30.41 ? 168  MET A SD    1 
ATOM   1792 C  CE    . MET C 3 162 ? 90.095 21.391  9.743   1.00 27.32 ? 168  MET A CE    1 
ATOM   1793 N  N     . ASP C 3 163 ? 89.680 24.797  13.827  1.00 32.07 ? 169  ASP A N     1 
ATOM   1794 C  CA    . ASP C 3 163 ? 89.165 24.313  15.107  1.00 31.76 ? 169  ASP A CA    1 
ATOM   1795 C  C     . ASP C 3 163 ? 87.639 24.302  15.099  1.00 31.17 ? 169  ASP A C     1 
ATOM   1796 O  O     . ASP C 3 163 ? 87.013 23.414  15.677  1.00 31.02 ? 169  ASP A O     1 
ATOM   1797 C  CB    . ASP C 3 163 ? 89.668 25.180  16.274  1.00 33.03 ? 169  ASP A CB    1 
ATOM   1798 C  CG    . ASP C 3 163 ? 91.170 25.056  16.501  1.00 34.91 ? 169  ASP A CG    1 
ATOM   1799 O  OD1   . ASP C 3 163 ? 91.719 23.939  16.379  1.00 36.27 ? 169  ASP A OD1   1 
ATOM   1800 O  OD2   . ASP C 3 163 ? 91.808 26.077  16.828  1.00 38.19 ? 169  ASP A OD2   1 
ATOM   1801 N  N     . TYR C 3 164 ? 87.044 25.299  14.452  1.00 30.44 ? 170  TYR A N     1 
ATOM   1802 C  CA    . TYR C 3 164 ? 85.595 25.377  14.353  1.00 31.30 ? 170  TYR A CA    1 
ATOM   1803 C  C     . TYR C 3 164 ? 85.069 24.286  13.423  1.00 31.08 ? 170  TYR A C     1 
ATOM   1804 O  O     . TYR C 3 164 ? 83.980 23.753  13.633  1.00 31.65 ? 170  TYR A O     1 
ATOM   1805 C  CB    . TYR C 3 164 ? 85.169 26.750  13.837  1.00 32.46 ? 170  TYR A CB    1 
ATOM   1806 C  CG    . TYR C 3 164 ? 84.943 27.775  14.926  1.00 35.72 ? 170  TYR A CG    1 
ATOM   1807 C  CD1   . TYR C 3 164 ? 83.811 27.716  15.739  1.00 36.54 ? 170  TYR A CD1   1 
ATOM   1808 C  CD2   . TYR C 3 164 ? 85.860 28.807  15.145  1.00 37.10 ? 170  TYR A CD2   1 
ATOM   1809 C  CE1   . TYR C 3 164 ? 83.593 28.663  16.744  1.00 37.64 ? 170  TYR A CE1   1 
ATOM   1810 C  CE2   . TYR C 3 164 ? 85.655 29.755  16.146  1.00 37.44 ? 170  TYR A CE2   1 
ATOM   1811 C  CZ    . TYR C 3 164 ? 84.520 29.678  16.941  1.00 37.80 ? 170  TYR A CZ    1 
ATOM   1812 O  OH    . TYR C 3 164 ? 84.308 30.614  17.926  1.00 37.96 ? 170  TYR A OH    1 
ATOM   1813 N  N     . ASN C 3 165 ? 85.848 23.957  12.398  1.00 30.15 ? 171  ASN A N     1 
ATOM   1814 C  CA    . ASN C 3 165 ? 85.464 22.919  11.445  1.00 29.45 ? 171  ASN A CA    1 
ATOM   1815 C  C     . ASN C 3 165 ? 85.395 21.608  12.229  1.00 29.29 ? 171  ASN A C     1 
ATOM   1816 O  O     . ASN C 3 165 ? 84.418 20.859  12.132  1.00 28.10 ? 171  ASN A O     1 
ATOM   1817 C  CB    . ASN C 3 165 ? 86.511 22.834  10.325  1.00 27.82 ? 171  ASN A CB    1 
ATOM   1818 C  CG    . ASN C 3 165 ? 86.061 21.982  9.142   1.00 28.81 ? 171  ASN A CG    1 
ATOM   1819 O  OD1   . ASN C 3 165 ? 86.772 21.884  8.139   1.00 28.01 ? 171  ASN A OD1   1 
ATOM   1820 N  ND2   . ASN C 3 165 ? 84.887 21.363  9.250   1.00 28.08 ? 171  ASN A ND2   1 
ATOM   1821 N  N     . VAL C 3 166 ? 86.428 21.344  13.022  1.00 28.98 ? 172  VAL A N     1 
ATOM   1822 C  CA    . VAL C 3 166 ? 86.464 20.127  13.832  1.00 30.18 ? 172  VAL A CA    1 
ATOM   1823 C  C     . VAL C 3 166 ? 85.275 20.113  14.797  1.00 31.60 ? 172  VAL A C     1 
ATOM   1824 O  O     . VAL C 3 166 ? 84.650 19.071  15.010  1.00 31.40 ? 172  VAL A O     1 
ATOM   1825 C  CB    . VAL C 3 166 ? 87.785 20.023  14.644  1.00 30.98 ? 172  VAL A CB    1 
ATOM   1826 C  CG1   . VAL C 3 166 ? 87.722 18.843  15.615  1.00 30.49 ? 172  VAL A CG1   1 
ATOM   1827 C  CG2   . VAL C 3 166 ? 88.971 19.846  13.695  1.00 28.48 ? 172  VAL A CG2   1 
ATOM   1828 N  N     . GLN C 3 167 ? 84.954 21.271  15.371  1.00 32.58 ? 173  GLN A N     1 
ATOM   1829 C  CA    . GLN C 3 167 ? 83.833 21.344  16.294  1.00 33.35 ? 173  GLN A CA    1 
ATOM   1830 C  C     . GLN C 3 167 ? 82.495 21.086  15.608  1.00 32.06 ? 173  GLN A C     1 
ATOM   1831 O  O     . GLN C 3 167 ? 81.565 20.587  16.235  1.00 31.64 ? 173  GLN A O     1 
ATOM   1832 C  CB    . GLN C 3 167 ? 83.794 22.694  17.018  1.00 35.28 ? 173  GLN A CB    1 
ATOM   1833 C  CG    . GLN C 3 167 ? 84.630 22.743  18.297  1.00 40.07 ? 173  GLN A CG    1 
ATOM   1834 C  CD    . GLN C 3 167 ? 84.363 21.563  19.244  1.00 43.47 ? 173  GLN A CD    1 
ATOM   1835 O  OE1   . GLN C 3 167 ? 84.985 20.500  19.124  1.00 43.90 ? 173  GLN A OE1   1 
ATOM   1836 N  NE2   . GLN C 3 167 ? 83.432 21.750  20.183  1.00 43.39 ? 173  GLN A NE2   1 
ATOM   1837 N  N     . ASP C 3 168 ? 82.391 21.425  14.328  1.00 30.94 ? 174  ASP A N     1 
ATOM   1838 C  CA    . ASP C 3 168 ? 81.146 21.180  13.607  1.00 30.82 ? 174  ASP A CA    1 
ATOM   1839 C  C     . ASP C 3 168 ? 80.845 19.687  13.564  1.00 29.23 ? 174  ASP A C     1 
ATOM   1840 O  O     . ASP C 3 168 ? 79.733 19.260  13.879  1.00 29.50 ? 174  ASP A O     1 
ATOM   1841 C  CB    . ASP C 3 168 ? 81.215 21.698  12.169  1.00 31.68 ? 174  ASP A CB    1 
ATOM   1842 C  CG    . ASP C 3 168 ? 80.978 23.187  12.067  1.00 34.24 ? 174  ASP A CG    1 
ATOM   1843 O  OD1   . ASP C 3 168 ? 80.287 23.760  12.942  1.00 35.74 ? 174  ASP A OD1   1 
ATOM   1844 O  OD2   . ASP C 3 168 ? 81.472 23.785  11.090  1.00 35.90 ? 174  ASP A OD2   1 
ATOM   1845 N  N     . VAL C 3 169 ? 81.844 18.902  13.174  1.00 27.07 ? 175  VAL A N     1 
ATOM   1846 C  CA    . VAL C 3 169 ? 81.686 17.461  13.062  1.00 27.70 ? 175  VAL A CA    1 
ATOM   1847 C  C     . VAL C 3 169 ? 81.390 16.809  14.411  1.00 28.84 ? 175  VAL A C     1 
ATOM   1848 O  O     . VAL C 3 169 ? 80.556 15.910  14.494  1.00 29.31 ? 175  VAL A O     1 
ATOM   1849 C  CB    . VAL C 3 169 ? 82.940 16.806  12.421  1.00 28.14 ? 175  VAL A CB    1 
ATOM   1850 C  CG1   . VAL C 3 169 ? 82.750 15.310  12.306  1.00 24.48 ? 175  VAL A CG1   1 
ATOM   1851 C  CG2   . VAL C 3 169 ? 83.187 17.398  11.033  1.00 28.13 ? 175  VAL A CG2   1 
ATOM   1852 N  N     . VAL C 3 170 ? 82.061 17.253  15.471  1.00 28.90 ? 176  VAL A N     1 
ATOM   1853 C  CA    . VAL C 3 170 ? 81.788 16.674  16.777  1.00 29.26 ? 176  VAL A CA    1 
ATOM   1854 C  C     . VAL C 3 170 ? 80.319 16.935  17.120  1.00 27.75 ? 176  VAL A C     1 
ATOM   1855 O  O     . VAL C 3 170 ? 79.593 16.017  17.494  1.00 28.41 ? 176  VAL A O     1 
ATOM   1856 C  CB    . VAL C 3 170 ? 82.713 17.259  17.890  1.00 29.99 ? 176  VAL A CB    1 
ATOM   1857 C  CG1   . VAL C 3 170 ? 84.095 16.637  17.805  1.00 32.56 ? 176  VAL A CG1   1 
ATOM   1858 C  CG2   . VAL C 3 170 ? 82.845 18.737  17.730  1.00 32.05 ? 176  VAL A CG2   1 
ATOM   1859 N  N     . VAL C 3 171 ? 79.875 18.179  16.969  1.00 26.92 ? 177  VAL A N     1 
ATOM   1860 C  CA    . VAL C 3 171 ? 78.487 18.523  17.264  1.00 27.19 ? 177  VAL A CA    1 
ATOM   1861 C  C     . VAL C 3 171 ? 77.504 17.813  16.327  1.00 26.76 ? 177  VAL A C     1 
ATOM   1862 O  O     . VAL C 3 171 ? 76.467 17.316  16.770  1.00 25.92 ? 177  VAL A O     1 
ATOM   1863 C  CB    . VAL C 3 171 ? 78.263 20.041  17.173  1.00 28.56 ? 177  VAL A CB    1 
ATOM   1864 C  CG1   . VAL C 3 171 ? 76.783 20.371  17.405  1.00 29.33 ? 177  VAL A CG1   1 
ATOM   1865 C  CG2   . VAL C 3 171 ? 79.137 20.750  18.215  1.00 29.83 ? 177  VAL A CG2   1 
ATOM   1866 N  N     . THR C 3 172 ? 77.839 17.758  15.041  1.00 25.76 ? 178  THR A N     1 
ATOM   1867 C  CA    . THR C 3 172 ? 76.987 17.105  14.048  1.00 24.98 ? 178  THR A CA    1 
ATOM   1868 C  C     . THR C 3 172 ? 76.811 15.606  14.338  1.00 26.13 ? 178  THR A C     1 
ATOM   1869 O  O     . THR C 3 172 ? 75.730 15.043  14.128  1.00 24.61 ? 178  THR A O     1 
ATOM   1870 C  CB    . THR C 3 172 ? 77.580 17.285  12.642  1.00 24.65 ? 178  THR A CB    1 
ATOM   1871 O  OG1   . THR C 3 172 ? 77.749 18.681  12.388  1.00 23.10 ? 178  THR A OG1   1 
ATOM   1872 C  CG2   . THR C 3 172 ? 76.663 16.680  11.581  1.00 21.42 ? 178  THR A CG2   1 
ATOM   1873 N  N     . LYS C 3 173 ? 77.876 14.970  14.820  1.00 25.57 ? 179  LYS A N     1 
ATOM   1874 C  CA    . LYS C 3 173 ? 77.841 13.550  15.160  1.00 26.35 ? 179  LYS A CA    1 
ATOM   1875 C  C     . LYS C 3 173 ? 76.890 13.354  16.338  1.00 25.88 ? 179  LYS A C     1 
ATOM   1876 O  O     . LYS C 3 173 ? 76.043 12.459  16.335  1.00 25.81 ? 179  LYS A O     1 
ATOM   1877 C  CB    . LYS C 3 173 ? 79.249 13.066  15.532  1.00 27.56 ? 179  LYS A CB    1 
ATOM   1878 C  CG    . LYS C 3 173 ? 79.345 11.598  15.946  1.00 26.75 ? 179  LYS A CG    1 
ATOM   1879 C  CD    . LYS C 3 173 ? 80.757 11.281  16.437  1.00 28.70 ? 179  LYS A CD    1 
ATOM   1880 C  CE    . LYS C 3 173 ? 80.879 9.858   16.986  1.00 29.78 ? 179  LYS A CE    1 
ATOM   1881 N  NZ    . LYS C 3 173 ? 80.127 9.652   18.260  1.00 30.91 ? 179  LYS A NZ    1 
ATOM   1882 N  N     . ALA C 3 174 ? 77.034 14.207  17.343  1.00 26.08 ? 180  ALA A N     1 
ATOM   1883 C  CA    . ALA C 3 174 ? 76.182 14.137  18.518  1.00 27.49 ? 180  ALA A CA    1 
ATOM   1884 C  C     . ALA C 3 174 ? 74.714 14.348  18.121  1.00 27.48 ? 180  ALA A C     1 
ATOM   1885 O  O     . ALA C 3 174 ? 73.830 13.642  18.610  1.00 28.10 ? 180  ALA A O     1 
ATOM   1886 C  CB    . ALA C 3 174 ? 76.622 15.191  19.549  1.00 27.04 ? 180  ALA A CB    1 
ATOM   1887 N  N     . LEU C 3 175 ? 74.458 15.312  17.236  1.00 26.62 ? 181  LEU A N     1 
ATOM   1888 C  CA    . LEU C 3 175 ? 73.093 15.596  16.784  1.00 26.61 ? 181  LEU A CA    1 
ATOM   1889 C  C     . LEU C 3 175 ? 72.550 14.363  16.081  1.00 26.28 ? 181  LEU A C     1 
ATOM   1890 O  O     . LEU C 3 175 ? 71.420 13.948  16.315  1.00 25.15 ? 181  LEU A O     1 
ATOM   1891 C  CB    . LEU C 3 175 ? 73.069 16.762  15.789  1.00 25.75 ? 181  LEU A CB    1 
ATOM   1892 C  CG    . LEU C 3 175 ? 71.864 17.715  15.785  1.00 26.55 ? 181  LEU A CG    1 
ATOM   1893 C  CD1   . LEU C 3 175 ? 71.879 18.516  14.492  1.00 26.02 ? 181  LEU A CD1   1 
ATOM   1894 C  CD2   . LEU C 3 175 ? 70.561 16.969  15.928  1.00 25.68 ? 181  LEU A CD2   1 
ATOM   1895 N  N     . LEU C 3 176 ? 73.371 13.793  15.205  1.00 26.30 ? 182  LEU A N     1 
ATOM   1896 C  CA    . LEU C 3 176 ? 72.984 12.614  14.454  1.00 26.16 ? 182  LEU A CA    1 
ATOM   1897 C  C     . LEU C 3 176 ? 72.529 11.480  15.366  1.00 27.23 ? 182  LEU A C     1 
ATOM   1898 O  O     . LEU C 3 176 ? 71.424 10.969  15.219  1.00 28.28 ? 182  LEU A O     1 
ATOM   1899 C  CB    . LEU C 3 176 ? 74.147 12.132  13.594  1.00 24.66 ? 182  LEU A CB    1 
ATOM   1900 C  CG    . LEU C 3 176 ? 73.918 10.816  12.850  1.00 22.95 ? 182  LEU A CG    1 
ATOM   1901 C  CD1   . LEU C 3 176 ? 72.876 11.001  11.765  1.00 22.81 ? 182  LEU A CD1   1 
ATOM   1902 C  CD2   . LEU C 3 176 ? 75.231 10.342  12.255  1.00 22.85 ? 182  LEU A CD2   1 
ATOM   1903 N  N     . GLU C 3 177 ? 73.383 11.092  16.306  1.00 28.14 ? 183  GLU A N     1 
ATOM   1904 C  CA    . GLU C 3 177 ? 73.058 10.006  17.227  1.00 29.55 ? 183  GLU A CA    1 
ATOM   1905 C  C     . GLU C 3 177 ? 71.801 10.302  18.020  1.00 28.52 ? 183  GLU A C     1 
ATOM   1906 O  O     . GLU C 3 177 ? 70.991 9.412   18.268  1.00 29.22 ? 183  GLU A O     1 
ATOM   1907 C  CB    . GLU C 3 177 ? 74.235 9.750   18.158  1.00 30.56 ? 183  GLU A CB    1 
ATOM   1908 C  CG    . GLU C 3 177 ? 75.511 9.520   17.375  1.00 35.22 ? 183  GLU A CG    1 
ATOM   1909 C  CD    . GLU C 3 177 ? 76.695 9.210   18.250  1.00 36.58 ? 183  GLU A CD    1 
ATOM   1910 O  OE1   . GLU C 3 177 ? 76.780 9.795   19.355  1.00 39.01 ? 183  GLU A OE1   1 
ATOM   1911 O  OE2   . GLU C 3 177 ? 77.544 8.397   17.818  1.00 36.54 ? 183  GLU A OE2   1 
ATOM   1912 N  N     . LYS C 3 178 ? 71.634 11.560  18.402  1.00 27.20 ? 184  LYS A N     1 
ATOM   1913 C  CA    . LYS C 3 178 ? 70.457 11.967  19.140  1.00 27.39 ? 184  LYS A CA    1 
ATOM   1914 C  C     . LYS C 3 178 ? 69.226 11.723  18.265  1.00 25.78 ? 184  LYS A C     1 
ATOM   1915 O  O     . LYS C 3 178 ? 68.210 11.209  18.731  1.00 24.11 ? 184  LYS A O     1 
ATOM   1916 C  CB    . LYS C 3 178 ? 70.571 13.447  19.508  1.00 30.49 ? 184  LYS A CB    1 
ATOM   1917 C  CG    . LYS C 3 178 ? 69.407 14.013  20.307  1.00 33.09 ? 184  LYS A CG    1 
ATOM   1918 C  CD    . LYS C 3 178 ? 69.632 15.512  20.554  1.00 36.18 ? 184  LYS A CD    1 
ATOM   1919 C  CE    . LYS C 3 178 ? 68.453 16.167  21.258  1.00 35.76 ? 184  LYS A CE    1 
ATOM   1920 N  NZ    . LYS C 3 178 ? 68.644 17.645  21.364  1.00 37.95 ? 184  LYS A NZ    1 
ATOM   1921 N  N     . LEU C 3 179 ? 69.331 12.082  16.988  1.00 25.52 ? 185  LEU A N     1 
ATOM   1922 C  CA    . LEU C 3 179 ? 68.230 11.902  16.046  1.00 24.67 ? 185  LEU A CA    1 
ATOM   1923 C  C     . LEU C 3 179 ? 67.972 10.431  15.748  1.00 24.15 ? 185  LEU A C     1 
ATOM   1924 O  O     . LEU C 3 179 ? 66.825 10.008  15.634  1.00 22.97 ? 185  LEU A O     1 
ATOM   1925 C  CB    . LEU C 3 179 ? 68.525 12.643  14.744  1.00 23.00 ? 185  LEU A CB    1 
ATOM   1926 C  CG    . LEU C 3 179 ? 68.632 14.155  14.888  1.00 24.38 ? 185  LEU A CG    1 
ATOM   1927 C  CD1   . LEU C 3 179 ? 69.218 14.764  13.610  1.00 21.59 ? 185  LEU A CD1   1 
ATOM   1928 C  CD2   . LEU C 3 179 ? 67.254 14.725  15.195  1.00 26.16 ? 185  LEU A CD2   1 
ATOM   1929 N  N     . LEU C 3 180 ? 69.045 9.656   15.628  1.00 24.58 ? 186  LEU A N     1 
ATOM   1930 C  CA    . LEU C 3 180 ? 68.933 8.229   15.343  1.00 27.10 ? 186  LEU A CA    1 
ATOM   1931 C  C     . LEU C 3 180 ? 68.423 7.408   16.532  1.00 28.03 ? 186  LEU A C     1 
ATOM   1932 O  O     . LEU C 3 180 ? 68.148 6.217   16.396  1.00 26.81 ? 186  LEU A O     1 
ATOM   1933 C  CB    . LEU C 3 180 ? 70.293 7.676   14.893  1.00 27.06 ? 186  LEU A CB    1 
ATOM   1934 C  CG    . LEU C 3 180 ? 70.820 8.199   13.553  1.00 27.64 ? 186  LEU A CG    1 
ATOM   1935 C  CD1   . LEU C 3 180 ? 72.147 7.540   13.231  1.00 25.61 ? 186  LEU A CD1   1 
ATOM   1936 C  CD2   . LEU C 3 180 ? 69.794 7.910   12.451  1.00 26.90 ? 186  LEU A CD2   1 
ATOM   1937 N  N     . SER C 3 181 ? 68.297 8.040   17.694  1.00 30.35 ? 187  SER A N     1 
ATOM   1938 C  CA    . SER C 3 181 ? 67.836 7.324   18.881  1.00 32.21 ? 187  SER A CA    1 
ATOM   1939 C  C     . SER C 3 181 ? 66.318 7.400   19.020  1.00 32.97 ? 187  SER A C     1 
ATOM   1940 O  O     . SER C 3 181 ? 65.739 6.838   19.954  1.00 32.94 ? 187  SER A O     1 
ATOM   1941 C  CB    . SER C 3 181 ? 68.507 7.884   20.145  1.00 31.72 ? 187  SER A CB    1 
ATOM   1942 O  OG    . SER C 3 181 ? 68.045 9.189   20.450  1.00 34.71 ? 187  SER A OG    1 
ATOM   1943 N  N     . ASP C 3 182 ? 65.678 8.101   18.090  1.00 31.80 ? 188  ASP A N     1 
ATOM   1944 C  CA    . ASP C 3 182 ? 64.230 8.230   18.108  1.00 31.51 ? 188  ASP A CA    1 
ATOM   1945 C  C     . ASP C 3 182 ? 63.634 6.954   17.506  1.00 31.36 ? 188  ASP A C     1 
ATOM   1946 O  O     . ASP C 3 182 ? 63.575 6.800   16.283  1.00 31.26 ? 188  ASP A O     1 
ATOM   1947 C  CB    . ASP C 3 182 ? 63.808 9.443   17.291  1.00 31.09 ? 188  ASP A CB    1 
ATOM   1948 C  CG    . ASP C 3 182 ? 62.367 9.795   17.499  1.00 31.77 ? 188  ASP A CG    1 
ATOM   1949 O  OD1   . ASP C 3 182 ? 61.509 8.906   17.321  1.00 31.60 ? 188  ASP A OD1   1 
ATOM   1950 O  OD2   . ASP C 3 182 ? 62.095 10.963  17.841  1.00 33.16 ? 188  ASP A OD2   1 
ATOM   1951 N  N     . LYS C 3 183 ? 63.192 6.049   18.377  1.00 31.16 ? 189  LYS A N     1 
ATOM   1952 C  CA    . LYS C 3 183 ? 62.636 4.764   17.965  1.00 30.96 ? 189  LYS A CA    1 
ATOM   1953 C  C     . LYS C 3 183 ? 61.515 4.839   16.943  1.00 29.29 ? 189  LYS A C     1 
ATOM   1954 O  O     . LYS C 3 183 ? 61.343 3.920   16.159  1.00 29.27 ? 189  LYS A O     1 
ATOM   1955 C  CB    . LYS C 3 183 ? 62.158 3.982   19.193  1.00 31.18 ? 189  LYS A CB    1 
ATOM   1956 N  N     . HIS C 3 184 ? 60.756 5.931   16.948  1.00 29.83 ? 190  HIS A N     1 
ATOM   1957 C  CA    . HIS C 3 184 ? 59.652 6.103   16.005  1.00 28.70 ? 190  HIS A CA    1 
ATOM   1958 C  C     . HIS C 3 184 ? 60.125 6.183   14.549  1.00 27.47 ? 190  HIS A C     1 
ATOM   1959 O  O     . HIS C 3 184 ? 59.447 5.691   13.649  1.00 26.70 ? 190  HIS A O     1 
ATOM   1960 C  CB    . HIS C 3 184 ? 58.852 7.370   16.343  1.00 30.10 ? 190  HIS A CB    1 
ATOM   1961 C  CG    . HIS C 3 184 ? 57.714 7.635   15.403  1.00 32.63 ? 190  HIS A CG    1 
ATOM   1962 N  ND1   . HIS C 3 184 ? 56.455 7.104   15.586  1.00 33.59 ? 190  HIS A ND1   1 
ATOM   1963 C  CD2   . HIS C 3 184 ? 57.655 8.353   14.255  1.00 33.84 ? 190  HIS A CD2   1 
ATOM   1964 C  CE1   . HIS C 3 184 ? 55.669 7.485   14.593  1.00 33.61 ? 190  HIS A CE1   1 
ATOM   1965 N  NE2   . HIS C 3 184 ? 56.372 8.244   13.772  1.00 33.05 ? 190  HIS A NE2   1 
ATOM   1966 N  N     . TYR C 3 185 ? 61.281 6.800   14.319  1.00 26.45 ? 191  TYR A N     1 
ATOM   1967 C  CA    . TYR C 3 185 ? 61.808 6.943   12.960  1.00 25.81 ? 191  TYR A CA    1 
ATOM   1968 C  C     . TYR C 3 185 ? 62.895 5.929   12.631  1.00 27.11 ? 191  TYR A C     1 
ATOM   1969 O  O     . TYR C 3 185 ? 63.129 5.612   11.463  1.00 26.13 ? 191  TYR A O     1 
ATOM   1970 C  CB    . TYR C 3 185 ? 62.370 8.357   12.748  1.00 23.42 ? 191  TYR A CB    1 
ATOM   1971 C  CG    . TYR C 3 185 ? 61.336 9.448   12.877  1.00 22.30 ? 191  TYR A CG    1 
ATOM   1972 C  CD1   . TYR C 3 185 ? 60.993 9.969   14.130  1.00 22.81 ? 191  TYR A CD1   1 
ATOM   1973 C  CD2   . TYR C 3 185 ? 60.657 9.925   11.757  1.00 20.76 ? 191  TYR A CD2   1 
ATOM   1974 C  CE1   . TYR C 3 185 ? 59.997 10.931  14.262  1.00 21.66 ? 191  TYR A CE1   1 
ATOM   1975 C  CE2   . TYR C 3 185 ? 59.655 10.885  11.877  1.00 21.09 ? 191  TYR A CE2   1 
ATOM   1976 C  CZ    . TYR C 3 185 ? 59.329 11.380  13.131  1.00 22.27 ? 191  TYR A CZ    1 
ATOM   1977 O  OH    . TYR C 3 185 ? 58.313 12.293  13.259  1.00 23.69 ? 191  TYR A OH    1 
ATOM   1978 N  N     . PHE C 3 186 ? 63.555 5.421   13.667  1.00 27.39 ? 192  PHE A N     1 
ATOM   1979 C  CA    . PHE C 3 186 ? 64.634 4.460   13.483  1.00 28.46 ? 192  PHE A CA    1 
ATOM   1980 C  C     . PHE C 3 186 ? 64.519 3.276   14.459  1.00 29.87 ? 192  PHE A C     1 
ATOM   1981 O  O     . PHE C 3 186 ? 64.730 3.432   15.667  1.00 29.49 ? 192  PHE A O     1 
ATOM   1982 C  CB    . PHE C 3 186 ? 65.981 5.174   13.669  1.00 27.62 ? 192  PHE A CB    1 
ATOM   1983 C  CG    . PHE C 3 186 ? 66.218 6.293   12.681  1.00 26.56 ? 192  PHE A CG    1 
ATOM   1984 C  CD1   . PHE C 3 186 ? 66.715 6.024   11.410  1.00 26.69 ? 192  PHE A CD1   1 
ATOM   1985 C  CD2   . PHE C 3 186 ? 65.907 7.609   13.010  1.00 24.40 ? 192  PHE A CD2   1 
ATOM   1986 C  CE1   . PHE C 3 186 ? 66.897 7.049   10.473  1.00 27.19 ? 192  PHE A CE1   1 
ATOM   1987 C  CE2   . PHE C 3 186 ? 66.085 8.638   12.085  1.00 24.83 ? 192  PHE A CE2   1 
ATOM   1988 C  CZ    . PHE C 3 186 ? 66.582 8.353   10.808  1.00 23.97 ? 192  PHE A CZ    1 
ATOM   1989 N  N     . PRO C 3 187 ? 64.166 2.083   13.940  1.00 31.93 ? 193  PRO A N     1 
ATOM   1990 C  CA    . PRO C 3 187 ? 64.009 0.844   14.716  1.00 33.42 ? 193  PRO A CA    1 
ATOM   1991 C  C     . PRO C 3 187 ? 65.231 0.541   15.583  1.00 34.34 ? 193  PRO A C     1 
ATOM   1992 O  O     . PRO C 3 187 ? 66.357 0.553   15.100  1.00 33.24 ? 193  PRO A O     1 
ATOM   1993 C  CB    . PRO C 3 187 ? 63.789 -0.212  13.632  1.00 33.98 ? 193  PRO A CB    1 
ATOM   1994 C  CG    . PRO C 3 187 ? 63.001 0.550   12.610  1.00 33.32 ? 193  PRO A CG    1 
ATOM   1995 C  CD    . PRO C 3 187 ? 63.765 1.866   12.535  1.00 32.43 ? 193  PRO A CD    1 
ATOM   1996 N  N     . PRO C 3 188 ? 65.012 0.262   16.877  1.00 36.25 ? 194  PRO A N     1 
ATOM   1997 C  CA    . PRO C 3 188 ? 66.040 -0.049  17.880  1.00 37.54 ? 194  PRO A CA    1 
ATOM   1998 C  C     . PRO C 3 188 ? 66.976 -1.230  17.588  1.00 37.16 ? 194  PRO A C     1 
ATOM   1999 O  O     . PRO C 3 188 ? 68.130 -1.218  18.007  1.00 37.16 ? 194  PRO A O     1 
ATOM   2000 C  CB    . PRO C 3 188 ? 65.222 -0.287  19.152  1.00 37.83 ? 194  PRO A CB    1 
ATOM   2001 C  CG    . PRO C 3 188 ? 64.020 0.572   18.948  1.00 39.49 ? 194  PRO A CG    1 
ATOM   2002 C  CD    . PRO C 3 188 ? 63.680 0.300   17.504  1.00 37.71 ? 194  PRO A CD    1 
ATOM   2003 N  N     . GLU C 3 189 ? 66.488 -2.240  16.875  1.00 36.54 ? 195  GLU A N     1 
ATOM   2004 C  CA    . GLU C 3 189 ? 67.308 -3.419  16.584  1.00 37.18 ? 195  GLU A CA    1 
ATOM   2005 C  C     . GLU C 3 189 ? 68.407 -3.153  15.565  1.00 36.54 ? 195  GLU A C     1 
ATOM   2006 O  O     . GLU C 3 189 ? 69.286 -3.993  15.360  1.00 36.44 ? 195  GLU A O     1 
ATOM   2007 C  CB    . GLU C 3 189 ? 66.442 -4.576  16.065  1.00 38.00 ? 195  GLU A CB    1 
ATOM   2008 C  CG    . GLU C 3 189 ? 65.038 -4.632  16.633  1.00 41.88 ? 195  GLU A CG    1 
ATOM   2009 C  CD    . GLU C 3 189 ? 64.179 -3.492  16.126  1.00 44.35 ? 195  GLU A CD    1 
ATOM   2010 O  OE1   . GLU C 3 189 ? 64.023 -3.370  14.889  1.00 45.95 ? 195  GLU A OE1   1 
ATOM   2011 O  OE2   . GLU C 3 189 ? 63.666 -2.718  16.961  1.00 45.82 ? 195  GLU A OE2   1 
ATOM   2012 N  N     . ILE C 3 190 ? 68.366 -1.991  14.925  1.00 35.43 ? 196  ILE A N     1 
ATOM   2013 C  CA    . ILE C 3 190 ? 69.365 -1.682  13.914  1.00 33.51 ? 196  ILE A CA    1 
ATOM   2014 C  C     . ILE C 3 190 ? 70.279 -0.529  14.279  1.00 32.41 ? 196  ILE A C     1 
ATOM   2015 O  O     . ILE C 3 190 ? 69.814 0.532   14.686  1.00 32.05 ? 196  ILE A O     1 
ATOM   2016 C  CB    . ILE C 3 190 ? 68.695 -1.353  12.572  1.00 33.93 ? 196  ILE A CB    1 
ATOM   2017 C  CG1   . ILE C 3 190 ? 67.857 -2.548  12.111  1.00 34.09 ? 196  ILE A CG1   1 
ATOM   2018 C  CG2   . ILE C 3 190 ? 69.753 -1.013  11.537  1.00 33.07 ? 196  ILE A CG2   1 
ATOM   2019 C  CD1   . ILE C 3 190 ? 66.999 -2.270  10.898  1.00 33.29 ? 196  ILE A CD1   1 
ATOM   2020 N  N     . ASP C 3 191 ? 71.583 -0.750  14.144  1.00 31.20 ? 197  ASP A N     1 
ATOM   2021 C  CA    . ASP C 3 191 ? 72.564 0.300   14.413  1.00 31.01 ? 197  ASP A CA    1 
ATOM   2022 C  C     . ASP C 3 191 ? 72.689 1.031   13.076  1.00 29.86 ? 197  ASP A C     1 
ATOM   2023 O  O     . ASP C 3 191 ? 73.371 0.548   12.163  1.00 27.56 ? 197  ASP A O     1 
ATOM   2024 C  CB    . ASP C 3 191 ? 73.927 -0.294  14.789  1.00 30.62 ? 197  ASP A CB    1 
ATOM   2025 C  CG    . ASP C 3 191 ? 74.905 0.762   15.302  1.00 32.72 ? 197  ASP A CG    1 
ATOM   2026 O  OD1   . ASP C 3 191 ? 74.795 1.937   14.883  1.00 32.56 ? 197  ASP A OD1   1 
ATOM   2027 O  OD2   . ASP C 3 191 ? 75.794 0.417   16.114  1.00 32.69 ? 197  ASP A OD2   1 
ATOM   2028 N  N     . PHE C 3 192 ? 72.028 2.181   12.953  1.00 27.72 ? 198  PHE A N     1 
ATOM   2029 C  CA    . PHE C 3 192 ? 72.077 2.921   11.695  1.00 26.57 ? 198  PHE A CA    1 
ATOM   2030 C  C     . PHE C 3 192 ? 73.405 3.599   11.353  1.00 26.81 ? 198  PHE A C     1 
ATOM   2031 O  O     . PHE C 3 192 ? 73.532 4.202   10.291  1.00 27.01 ? 198  PHE A O     1 
ATOM   2032 C  CB    . PHE C 3 192 ? 70.908 3.918   11.615  1.00 22.60 ? 198  PHE A CB    1 
ATOM   2033 C  CG    . PHE C 3 192 ? 69.588 3.255   11.315  1.00 21.22 ? 198  PHE A CG    1 
ATOM   2034 C  CD1   . PHE C 3 192 ? 68.834 2.687   12.329  1.00 21.87 ? 198  PHE A CD1   1 
ATOM   2035 C  CD2   . PHE C 3 192 ? 69.147 3.119   10.003  1.00 21.52 ? 198  PHE A CD2   1 
ATOM   2036 C  CE1   . PHE C 3 192 ? 67.657 1.986   12.041  1.00 25.25 ? 198  PHE A CE1   1 
ATOM   2037 C  CE2   . PHE C 3 192 ? 67.975 2.422   9.700   1.00 22.34 ? 198  PHE A CE2   1 
ATOM   2038 C  CZ    . PHE C 3 192 ? 67.228 1.853   10.721  1.00 23.81 ? 198  PHE A CZ    1 
ATOM   2039 N  N     . THR C 3 193 ? 74.397 3.492   12.235  1.00 28.37 ? 199  THR A N     1 
ATOM   2040 C  CA    . THR C 3 193 ? 75.707 4.076   11.951  1.00 29.86 ? 199  THR A CA    1 
ATOM   2041 C  C     . THR C 3 193 ? 76.603 2.956   11.446  1.00 31.00 ? 199  THR A C     1 
ATOM   2042 O  O     . THR C 3 193 ? 77.785 3.171   11.191  1.00 31.92 ? 199  THR A O     1 
ATOM   2043 C  CB    . THR C 3 193 ? 76.398 4.675   13.206  1.00 29.32 ? 199  THR A CB    1 
ATOM   2044 O  OG1   . THR C 3 193 ? 76.707 3.620   14.127  1.00 30.97 ? 199  THR A OG1   1 
ATOM   2045 C  CG2   . THR C 3 193 ? 75.508 5.722   13.885  1.00 26.59 ? 199  THR A CG2   1 
ATOM   2046 N  N     . ASP C 3 194 ? 76.031 1.762   11.298  1.00 31.33 ? 200  ASP A N     1 
ATOM   2047 C  CA    . ASP C 3 194 ? 76.795 0.599   10.850  1.00 31.65 ? 200  ASP A CA    1 
ATOM   2048 C  C     . ASP C 3 194 ? 76.122 -0.193  9.722   1.00 30.78 ? 200  ASP A C     1 
ATOM   2049 O  O     . ASP C 3 194 ? 76.220 -1.418  9.688   1.00 30.50 ? 200  ASP A O     1 
ATOM   2050 C  CB    . ASP C 3 194 ? 77.051 -0.328  12.047  1.00 33.33 ? 200  ASP A CB    1 
ATOM   2051 C  CG    . ASP C 3 194 ? 78.159 -1.344  11.789  1.00 36.26 ? 200  ASP A CG    1 
ATOM   2052 O  OD1   . ASP C 3 194 ? 79.263 -0.944  11.344  1.00 37.75 ? 200  ASP A OD1   1 
ATOM   2053 O  OD2   . ASP C 3 194 ? 77.929 -2.543  12.046  1.00 34.45 ? 200  ASP A OD2   1 
ATOM   2054 N  N     . VAL C 3 195 ? 75.447 0.503   8.805   1.00 28.22 ? 201  VAL A N     1 
ATOM   2055 C  CA    . VAL C 3 195 ? 74.782 -0.154  7.677   1.00 25.87 ? 201  VAL A CA    1 
ATOM   2056 C  C     . VAL C 3 195 ? 74.994 0.626   6.375   1.00 25.89 ? 201  VAL A C     1 
ATOM   2057 O  O     . VAL C 3 195 ? 75.283 1.824   6.397   1.00 25.07 ? 201  VAL A O     1 
ATOM   2058 C  CB    . VAL C 3 195 ? 73.251 -0.290  7.918   1.00 26.18 ? 201  VAL A CB    1 
ATOM   2059 C  CG1   . VAL C 3 195 ? 72.975 -1.091  9.207   1.00 23.06 ? 201  VAL A CG1   1 
ATOM   2060 C  CG2   . VAL C 3 195 ? 72.611 1.093   7.989   1.00 24.21 ? 201  VAL A CG2   1 
ATOM   2061 N  N     . GLY C 3 196 ? 74.847 -0.060  5.245   1.00 26.14 ? 202  GLY A N     1 
ATOM   2062 C  CA    . GLY C 3 196 ? 75.009 0.579   3.947   1.00 25.89 ? 202  GLY A CA    1 
ATOM   2063 C  C     . GLY C 3 196 ? 73.868 1.541   3.646   1.00 26.95 ? 202  GLY A C     1 
ATOM   2064 O  O     . GLY C 3 196 ? 72.866 1.559   4.363   1.00 26.79 ? 202  GLY A O     1 
ATOM   2065 N  N     . TYR C 3 197 ? 73.999 2.325   2.578   1.00 26.78 ? 203  TYR A N     1 
ATOM   2066 C  CA    . TYR C 3 197 ? 72.973 3.306   2.242   1.00 26.65 ? 203  TYR A CA    1 
ATOM   2067 C  C     . TYR C 3 197 ? 71.604 2.698   1.948   1.00 27.35 ? 203  TYR A C     1 
ATOM   2068 O  O     . TYR C 3 197 ? 70.587 3.165   2.473   1.00 26.55 ? 203  TYR A O     1 
ATOM   2069 C  CB    . TYR C 3 197 ? 73.433 4.183   1.061   1.00 26.27 ? 203  TYR A CB    1 
ATOM   2070 C  CG    . TYR C 3 197 ? 73.246 3.589   -0.328  1.00 25.02 ? 203  TYR A CG    1 
ATOM   2071 C  CD1   . TYR C 3 197 ? 72.028 3.716   -1.010  1.00 23.30 ? 203  TYR A CD1   1 
ATOM   2072 C  CD2   . TYR C 3 197 ? 74.293 2.929   -0.970  1.00 23.78 ? 203  TYR A CD2   1 
ATOM   2073 C  CE1   . TYR C 3 197 ? 71.864 3.207   -2.300  1.00 22.53 ? 203  TYR A CE1   1 
ATOM   2074 C  CE2   . TYR C 3 197 ? 74.137 2.415   -2.253  1.00 23.03 ? 203  TYR A CE2   1 
ATOM   2075 C  CZ    . TYR C 3 197 ? 72.923 2.560   -2.911  1.00 24.27 ? 203  TYR A CZ    1 
ATOM   2076 O  OH    . TYR C 3 197 ? 72.782 2.066   -4.185  1.00 27.39 ? 203  TYR A OH    1 
ATOM   2077 N  N     . THR C 3 198 ? 71.572 1.661   1.116   1.00 27.23 ? 204  THR A N     1 
ATOM   2078 C  CA    . THR C 3 198 ? 70.305 1.032   0.777   1.00 28.19 ? 204  THR A CA    1 
ATOM   2079 C  C     . THR C 3 198 ? 69.554 0.564   2.030   1.00 27.18 ? 204  THR A C     1 
ATOM   2080 O  O     . THR C 3 198 ? 68.334 0.646   2.091   1.00 26.96 ? 204  THR A O     1 
ATOM   2081 C  CB    . THR C 3 198 ? 70.512 -0.133  -0.232  1.00 28.87 ? 204  THR A CB    1 
ATOM   2082 O  OG1   . THR C 3 198 ? 69.417 -1.053  -0.146  1.00 32.08 ? 204  THR A OG1   1 
ATOM   2083 C  CG2   . THR C 3 198 ? 71.802 -0.851  0.040   1.00 31.77 ? 204  THR A CG2   1 
ATOM   2084 N  N     . THR C 3 199 ? 70.283 0.108   3.039   1.00 26.94 ? 205  THR A N     1 
ATOM   2085 C  CA    . THR C 3 199 ? 69.663 -0.339  4.280   1.00 27.94 ? 205  THR A CA    1 
ATOM   2086 C  C     . THR C 3 199 ? 69.104 0.852   5.068   1.00 28.96 ? 205  THR A C     1 
ATOM   2087 O  O     . THR C 3 199 ? 67.996 0.791   5.602   1.00 29.59 ? 205  THR A O     1 
ATOM   2088 C  CB    . THR C 3 199 ? 70.679 -1.088  5.187   1.00 29.17 ? 205  THR A CB    1 
ATOM   2089 O  OG1   . THR C 3 199 ? 71.050 -2.329  4.576   1.00 30.30 ? 205  THR A OG1   1 
ATOM   2090 C  CG2   . THR C 3 199 ? 70.080 -1.367  6.565   1.00 28.43 ? 205  THR A CG2   1 
ATOM   2091 N  N     . PHE C 3 200 ? 69.879 1.929   5.141   1.00 27.73 ? 206  PHE A N     1 
ATOM   2092 C  CA    . PHE C 3 200 ? 69.467 3.122   5.870   1.00 26.59 ? 206  PHE A CA    1 
ATOM   2093 C  C     . PHE C 3 200 ? 68.086 3.618   5.427   1.00 26.45 ? 206  PHE A C     1 
ATOM   2094 O  O     . PHE C 3 200 ? 67.207 3.856   6.255   1.00 24.56 ? 206  PHE A O     1 
ATOM   2095 C  CB    . PHE C 3 200 ? 70.519 4.229   5.693   1.00 26.40 ? 206  PHE A CB    1 
ATOM   2096 C  CG    . PHE C 3 200 ? 70.250 5.461   6.512   1.00 26.35 ? 206  PHE A CG    1 
ATOM   2097 C  CD1   . PHE C 3 200 ? 69.341 6.423   6.076   1.00 26.14 ? 206  PHE A CD1   1 
ATOM   2098 C  CD2   . PHE C 3 200 ? 70.894 5.653   7.734   1.00 24.56 ? 206  PHE A CD2   1 
ATOM   2099 C  CE1   . PHE C 3 200 ? 69.079 7.559   6.848   1.00 24.85 ? 206  PHE A CE1   1 
ATOM   2100 C  CE2   . PHE C 3 200 ? 70.638 6.780   8.506   1.00 24.09 ? 206  PHE A CE2   1 
ATOM   2101 C  CZ    . PHE C 3 200 ? 69.729 7.734   8.064   1.00 22.86 ? 206  PHE A CZ    1 
ATOM   2102 N  N     . TRP C 3 201 ? 67.897 3.763   4.122   1.00 25.86 ? 207  TRP A N     1 
ATOM   2103 C  CA    . TRP C 3 201 ? 66.623 4.235   3.588   1.00 27.54 ? 207  TRP A CA    1 
ATOM   2104 C  C     . TRP C 3 201 ? 65.490 3.216   3.718   1.00 28.15 ? 207  TRP A C     1 
ATOM   2105 O  O     . TRP C 3 201 ? 64.383 3.564   4.120   1.00 29.49 ? 207  TRP A O     1 
ATOM   2106 C  CB    . TRP C 3 201 ? 66.780 4.623   2.113   1.00 25.85 ? 207  TRP A CB    1 
ATOM   2107 C  CG    . TRP C 3 201 ? 67.846 5.651   1.886   1.00 24.50 ? 207  TRP A CG    1 
ATOM   2108 C  CD1   . TRP C 3 201 ? 68.937 5.530   1.073   1.00 24.02 ? 207  TRP A CD1   1 
ATOM   2109 C  CD2   . TRP C 3 201 ? 67.937 6.947   2.490   1.00 22.31 ? 207  TRP A CD2   1 
ATOM   2110 N  NE1   . TRP C 3 201 ? 69.700 6.663   1.134   1.00 23.68 ? 207  TRP A NE1   1 
ATOM   2111 C  CE2   . TRP C 3 201 ? 69.112 7.554   1.996   1.00 24.51 ? 207  TRP A CE2   1 
ATOM   2112 C  CE3   . TRP C 3 201 ? 67.142 7.655   3.401   1.00 23.70 ? 207  TRP A CE3   1 
ATOM   2113 C  CZ2   . TRP C 3 201 ? 69.516 8.846   2.385   1.00 21.33 ? 207  TRP A CZ2   1 
ATOM   2114 C  CZ3   . TRP C 3 201 ? 67.546 8.943   3.789   1.00 22.87 ? 207  TRP A CZ3   1 
ATOM   2115 C  CH2   . TRP C 3 201 ? 68.723 9.519   3.276   1.00 21.17 ? 207  TRP A CH2   1 
ATOM   2116 N  N     . SER C 3 202 ? 65.772 1.958   3.398   1.00 28.25 ? 208  SER A N     1 
ATOM   2117 C  CA    . SER C 3 202 ? 64.746 0.924   3.453   1.00 29.02 ? 208  SER A CA    1 
ATOM   2118 C  C     . SER C 3 202 ? 64.301 0.471   4.843   1.00 27.91 ? 208  SER A C     1 
ATOM   2119 O  O     . SER C 3 202 ? 63.182 -0.006  4.993   1.00 28.91 ? 208  SER A O     1 
ATOM   2120 C  CB    . SER C 3 202 ? 65.179 -0.301  2.629   1.00 29.02 ? 208  SER A CB    1 
ATOM   2121 O  OG    . SER C 3 202 ? 66.316 -0.935  3.185   1.00 31.35 ? 208  SER A OG    1 
ATOM   2122 N  N     . GLU C 3 203 ? 65.149 0.617   5.857   1.00 27.28 ? 209  GLU A N     1 
ATOM   2123 C  CA    . GLU C 3 203 ? 64.765 0.183   7.200   1.00 27.63 ? 209  GLU A CA    1 
ATOM   2124 C  C     . GLU C 3 203 ? 64.242 1.301   8.096   1.00 26.73 ? 209  GLU A C     1 
ATOM   2125 O  O     . GLU C 3 203 ? 63.779 1.030   9.201   1.00 27.04 ? 209  GLU A O     1 
ATOM   2126 C  CB    . GLU C 3 203 ? 65.938 -0.509  7.909   1.00 30.08 ? 209  GLU A CB    1 
ATOM   2127 C  CG    . GLU C 3 203 ? 66.481 -1.737  7.192   1.00 33.54 ? 209  GLU A CG    1 
ATOM   2128 C  CD    . GLU C 3 203 ? 65.501 -2.899  7.169   1.00 37.20 ? 209  GLU A CD    1 
ATOM   2129 O  OE1   . GLU C 3 203 ? 65.125 -3.390  8.256   1.00 36.65 ? 209  GLU A OE1   1 
ATOM   2130 O  OE2   . GLU C 3 203 ? 65.112 -3.322  6.058   1.00 40.21 ? 209  GLU A OE2   1 
ATOM   2131 N  N     . SER C 3 204 ? 64.325 2.549   7.638   1.00 25.30 ? 210  SER A N     1 
ATOM   2132 C  CA    . SER C 3 204 ? 63.831 3.675   8.435   1.00 24.38 ? 210  SER A CA    1 
ATOM   2133 C  C     . SER C 3 204 ? 62.447 4.085   7.955   1.00 23.41 ? 210  SER A C     1 
ATOM   2134 O  O     . SER C 3 204 ? 62.033 3.719   6.857   1.00 23.48 ? 210  SER A O     1 
ATOM   2135 C  CB    . SER C 3 204 ? 64.787 4.873   8.348   1.00 23.73 ? 210  SER A CB    1 
ATOM   2136 O  OG    . SER C 3 204 ? 64.949 5.307   7.009   1.00 23.63 ? 210  SER A OG    1 
ATOM   2137 N  N     . LEU C 3 205 ? 61.735 4.842   8.784   1.00 22.70 ? 211  LEU A N     1 
ATOM   2138 C  CA    . LEU C 3 205 ? 60.385 5.298   8.446   1.00 22.20 ? 211  LEU A CA    1 
ATOM   2139 C  C     . LEU C 3 205 ? 60.409 5.959   7.066   1.00 22.31 ? 211  LEU A C     1 
ATOM   2140 O  O     . LEU C 3 205 ? 61.369 6.651   6.719   1.00 22.52 ? 211  LEU A O     1 
ATOM   2141 C  CB    . LEU C 3 205 ? 59.886 6.298   9.503   1.00 21.67 ? 211  LEU A CB    1 
ATOM   2142 C  CG    . LEU C 3 205 ? 58.388 6.616   9.577   1.00 21.66 ? 211  LEU A CG    1 
ATOM   2143 C  CD1   . LEU C 3 205 ? 57.621 5.381   10.063  1.00 20.33 ? 211  LEU A CD1   1 
ATOM   2144 C  CD2   . LEU C 3 205 ? 58.158 7.780   10.530  1.00 20.52 ? 211  LEU A CD2   1 
ATOM   2145 N  N     . GLU C 3 206 ? 59.354 5.744   6.284   1.00 21.00 ? 212  GLU A N     1 
ATOM   2146 C  CA    . GLU C 3 206 ? 59.278 6.317   4.951   1.00 21.05 ? 212  GLU A CA    1 
ATOM   2147 C  C     . GLU C 3 206 ? 59.574 7.819   4.922   1.00 20.48 ? 212  GLU A C     1 
ATOM   2148 O  O     . GLU C 3 206 ? 60.172 8.312   3.973   1.00 20.98 ? 212  GLU A O     1 
ATOM   2149 C  CB    . GLU C 3 206 ? 57.903 6.043   4.338   1.00 22.53 ? 212  GLU A CB    1 
ATOM   2150 C  CG    . GLU C 3 206 ? 57.694 6.689   2.979   1.00 24.69 ? 212  GLU A CG    1 
ATOM   2151 C  CD    . GLU C 3 206 ? 56.375 6.301   2.330   1.00 28.27 ? 212  GLU A CD    1 
ATOM   2152 O  OE1   . GLU C 3 206 ? 55.386 6.049   3.054   1.00 29.18 ? 212  GLU A OE1   1 
ATOM   2153 O  OE2   . GLU C 3 206 ? 56.318 6.260   1.084   1.00 31.34 ? 212  GLU A OE2   1 
ATOM   2154 N  N     . ALA C 3 207 ? 59.166 8.533   5.966   1.00 18.64 ? 213  ALA A N     1 
ATOM   2155 C  CA    . ALA C 3 207 ? 59.376 9.977   6.058   1.00 19.44 ? 213  ALA A CA    1 
ATOM   2156 C  C     . ALA C 3 207 ? 60.837 10.414  5.943   1.00 19.67 ? 213  ALA A C     1 
ATOM   2157 O  O     . ALA C 3 207 ? 61.127 11.479  5.396   1.00 20.45 ? 213  ALA A O     1 
ATOM   2158 C  CB    . ALA C 3 207 ? 58.782 10.506  7.366   1.00 17.55 ? 213  ALA A CB    1 
ATOM   2159 N  N     . VAL C 3 208 ? 61.757 9.604   6.459   1.00 20.35 ? 214  VAL A N     1 
ATOM   2160 C  CA    . VAL C 3 208 ? 63.168 9.953   6.402   1.00 20.82 ? 214  VAL A CA    1 
ATOM   2161 C  C     . VAL C 3 208 ? 63.649 10.054  4.951   1.00 22.60 ? 214  VAL A C     1 
ATOM   2162 O  O     . VAL C 3 208 ? 64.407 10.962  4.593   1.00 24.81 ? 214  VAL A O     1 
ATOM   2163 C  CB    . VAL C 3 208 ? 64.018 8.926   7.176   1.00 19.47 ? 214  VAL A CB    1 
ATOM   2164 C  CG1   . VAL C 3 208 ? 65.489 9.167   6.942   1.00 18.11 ? 214  VAL A CG1   1 
ATOM   2165 C  CG2   . VAL C 3 208 ? 63.719 9.038   8.662   1.00 21.14 ? 214  VAL A CG2   1 
ATOM   2166 N  N     . ASP C 3 209 ? 63.191 9.122   4.125   1.00 22.59 ? 215  ASP A N     1 
ATOM   2167 C  CA    . ASP C 3 209 ? 63.551 9.077   2.718   1.00 22.19 ? 215  ASP A CA    1 
ATOM   2168 C  C     . ASP C 3 209 ? 62.919 10.250  1.972   1.00 22.38 ? 215  ASP A C     1 
ATOM   2169 O  O     . ASP C 3 209 ? 63.602 10.953  1.221   1.00 23.03 ? 215  ASP A O     1 
ATOM   2170 C  CB    . ASP C 3 209 ? 63.096 7.737   2.116   1.00 23.26 ? 215  ASP A CB    1 
ATOM   2171 C  CG    . ASP C 3 209 ? 63.332 7.644   0.609   1.00 24.94 ? 215  ASP A CG    1 
ATOM   2172 O  OD1   . ASP C 3 209 ? 64.468 7.875   0.136   1.00 25.65 ? 215  ASP A OD1   1 
ATOM   2173 O  OD2   . ASP C 3 209 ? 62.365 7.325   -0.109  1.00 28.60 ? 215  ASP A OD2   1 
ATOM   2174 N  N     . ILE C 3 210 ? 61.626 10.479  2.202   1.00 21.45 ? 216  ILE A N     1 
ATOM   2175 C  CA    . ILE C 3 210 ? 60.911 11.571  1.541   1.00 19.77 ? 216  ILE A CA    1 
ATOM   2176 C  C     . ILE C 3 210 ? 61.517 12.964  1.784   1.00 19.85 ? 216  ILE A C     1 
ATOM   2177 O  O     . ILE C 3 210 ? 61.661 13.748  0.846   1.00 18.37 ? 216  ILE A O     1 
ATOM   2178 C  CB    . ILE C 3 210 ? 59.423 11.593  1.966   1.00 21.11 ? 216  ILE A CB    1 
ATOM   2179 C  CG1   . ILE C 3 210 ? 58.709 10.346  1.418   1.00 20.02 ? 216  ILE A CG1   1 
ATOM   2180 C  CG2   . ILE C 3 210 ? 58.741 12.876  1.460   1.00 19.94 ? 216  ILE A CG2   1 
ATOM   2181 C  CD1   . ILE C 3 210 ? 57.249 10.271  1.793   1.00 18.76 ? 216  ILE A CD1   1 
ATOM   2182 N  N     . GLU C 3 211 ? 61.855 13.274  3.034   1.00 18.33 ? 217  GLU A N     1 
ATOM   2183 C  CA    . GLU C 3 211 ? 62.442 14.568  3.358   1.00 17.73 ? 217  GLU A CA    1 
ATOM   2184 C  C     . GLU C 3 211 ? 63.805 14.769  2.703   1.00 19.10 ? 217  GLU A C     1 
ATOM   2185 O  O     . GLU C 3 211 ? 64.093 15.853  2.198   1.00 19.39 ? 217  GLU A O     1 
ATOM   2186 C  CB    . GLU C 3 211 ? 62.566 14.746  4.872   1.00 16.31 ? 217  GLU A CB    1 
ATOM   2187 C  CG    . GLU C 3 211 ? 61.234 15.000  5.580   1.00 18.06 ? 217  GLU A CG    1 
ATOM   2188 C  CD    . GLU C 3 211 ? 60.511 16.239  5.058   1.00 20.81 ? 217  GLU A CD    1 
ATOM   2189 O  OE1   . GLU C 3 211 ? 61.146 17.318  4.988   1.00 19.19 ? 217  GLU A OE1   1 
ATOM   2190 O  OE2   . GLU C 3 211 ? 59.309 16.133  4.719   1.00 20.87 ? 217  GLU A OE2   1 
ATOM   2191 N  N     . HIS C 3 212 ? 64.654 13.742  2.710   1.00 20.35 ? 218  HIS A N     1 
ATOM   2192 C  CA    . HIS C 3 212 ? 65.962 13.882  2.068   1.00 21.42 ? 218  HIS A CA    1 
ATOM   2193 C  C     . HIS C 3 212 ? 65.814 14.073  0.556   1.00 20.59 ? 218  HIS A C     1 
ATOM   2194 O  O     . HIS C 3 212 ? 66.571 14.825  -0.056  1.00 21.18 ? 218  HIS A O     1 
ATOM   2195 C  CB    . HIS C 3 212 ? 66.875 12.678  2.361   1.00 21.63 ? 218  HIS A CB    1 
ATOM   2196 C  CG    . HIS C 3 212 ? 67.567 12.760  3.688   1.00 21.96 ? 218  HIS A CG    1 
ATOM   2197 N  ND1   . HIS C 3 212 ? 66.970 12.368  4.867   1.00 22.85 ? 218  HIS A ND1   1 
ATOM   2198 C  CD2   . HIS C 3 212 ? 68.783 13.250  4.027   1.00 21.33 ? 218  HIS A CD2   1 
ATOM   2199 C  CE1   . HIS C 3 212 ? 67.789 12.615  5.875   1.00 22.38 ? 218  HIS A CE1   1 
ATOM   2200 N  NE2   . HIS C 3 212 ? 68.896 13.152  5.392   1.00 21.96 ? 218  HIS A NE2   1 
ATOM   2201 N  N     . ARG C 3 213 ? 64.836 13.403  -0.045  1.00 19.52 ? 219  ARG A N     1 
ATOM   2202 C  CA    . ARG C 3 213 ? 64.622 13.551  -1.479  1.00 19.18 ? 219  ARG A CA    1 
ATOM   2203 C  C     . ARG C 3 213 ? 64.090 14.959  -1.769  1.00 17.94 ? 219  ARG A C     1 
ATOM   2204 O  O     . ARG C 3 213 ? 64.515 15.605  -2.729  1.00 16.91 ? 219  ARG A O     1 
ATOM   2205 C  CB    . ARG C 3 213 ? 63.642 12.489  -2.001  1.00 18.64 ? 219  ARG A CB    1 
ATOM   2206 C  CG    . ARG C 3 213 ? 64.243 11.088  -2.170  1.00 21.33 ? 219  ARG A CG    1 
ATOM   2207 C  CD    . ARG C 3 213 ? 63.209 10.119  -2.741  1.00 25.17 ? 219  ARG A CD    1 
ATOM   2208 N  NE    . ARG C 3 213 ? 63.690 8.747   -2.842  1.00 25.87 ? 219  ARG A NE    1 
ATOM   2209 C  CZ    . ARG C 3 213 ? 64.185 8.188   -3.946  1.00 30.22 ? 219  ARG A CZ    1 
ATOM   2210 N  NH1   . ARG C 3 213 ? 64.276 8.880   -5.083  1.00 29.07 ? 219  ARG A NH1   1 
ATOM   2211 N  NH2   . ARG C 3 213 ? 64.591 6.922   -3.911  1.00 28.89 ? 219  ARG A NH2   1 
ATOM   2212 N  N     . ALA C 3 214 ? 63.170 15.434  -0.934  1.00 17.20 ? 220  ALA A N     1 
ATOM   2213 C  CA    . ALA C 3 214 ? 62.605 16.770  -1.117  1.00 19.29 ? 220  ALA A CA    1 
ATOM   2214 C  C     . ALA C 3 214 ? 63.669 17.866  -0.954  1.00 20.35 ? 220  ALA A C     1 
ATOM   2215 O  O     . ALA C 3 214 ? 63.644 18.884  -1.651  1.00 22.69 ? 220  ALA A O     1 
ATOM   2216 C  CB    . ALA C 3 214 ? 61.465 17.000  -0.130  1.00 16.60 ? 220  ALA A CB    1 
ATOM   2217 N  N     . ALA C 3 215 ? 64.603 17.651  -0.036  1.00 20.35 ? 221  ALA A N     1 
ATOM   2218 C  CA    . ALA C 3 215 ? 65.657 18.621  0.205   1.00 21.59 ? 221  ALA A CA    1 
ATOM   2219 C  C     . ALA C 3 215 ? 66.640 18.684  -0.969  1.00 22.28 ? 221  ALA A C     1 
ATOM   2220 O  O     . ALA C 3 215 ? 67.068 19.768  -1.365  1.00 23.20 ? 221  ALA A O     1 
ATOM   2221 C  CB    . ALA C 3 215 ? 66.392 18.282  1.498   1.00 20.19 ? 221  ALA A CB    1 
ATOM   2222 N  N     . TRP C 3 216 ? 66.983 17.523  -1.523  1.00 22.71 ? 222  TRP A N     1 
ATOM   2223 C  CA    . TRP C 3 216 ? 67.918 17.446  -2.648  1.00 22.96 ? 222  TRP A CA    1 
ATOM   2224 C  C     . TRP C 3 216 ? 67.313 18.164  -3.843  1.00 21.20 ? 222  TRP A C     1 
ATOM   2225 O  O     . TRP C 3 216 ? 67.951 19.005  -4.460  1.00 22.03 ? 222  TRP A O     1 
ATOM   2226 C  CB    . TRP C 3 216 ? 68.205 15.978  -2.990  1.00 22.52 ? 222  TRP A CB    1 
ATOM   2227 C  CG    . TRP C 3 216 ? 69.380 15.759  -3.919  1.00 22.96 ? 222  TRP A CG    1 
ATOM   2228 C  CD1   . TRP C 3 216 ? 69.351 15.703  -5.292  1.00 21.19 ? 222  TRP A CD1   1 
ATOM   2229 C  CD2   . TRP C 3 216 ? 70.741 15.507  -3.540  1.00 21.85 ? 222  TRP A CD2   1 
ATOM   2230 N  NE1   . TRP C 3 216 ? 70.607 15.423  -5.781  1.00 21.51 ? 222  TRP A NE1   1 
ATOM   2231 C  CE2   . TRP C 3 216 ? 71.478 15.298  -4.733  1.00 21.85 ? 222  TRP A CE2   1 
ATOM   2232 C  CE3   . TRP C 3 216 ? 71.409 15.430  -2.311  1.00 21.41 ? 222  TRP A CE3   1 
ATOM   2233 C  CZ2   . TRP C 3 216 ? 72.849 15.016  -4.731  1.00 20.01 ? 222  TRP A CZ2   1 
ATOM   2234 C  CZ3   . TRP C 3 216 ? 72.779 15.145  -2.308  1.00 21.52 ? 222  TRP A CZ3   1 
ATOM   2235 C  CH2   . TRP C 3 216 ? 73.480 14.941  -3.514  1.00 20.68 ? 222  TRP A CH2   1 
ATOM   2236 N  N     . LEU C 3 217 ? 66.062 17.842  -4.145  1.00 22.19 ? 223  LEU A N     1 
ATOM   2237 C  CA    . LEU C 3 217 ? 65.356 18.468  -5.248  1.00 21.50 ? 223  LEU A CA    1 
ATOM   2238 C  C     . LEU C 3 217 ? 65.166 19.986  -5.057  1.00 21.38 ? 223  LEU A C     1 
ATOM   2239 O  O     . LEU C 3 217 ? 65.408 20.775  -5.974  1.00 18.58 ? 223  LEU A O     1 
ATOM   2240 C  CB    . LEU C 3 217 ? 63.996 17.804  -5.427  1.00 21.49 ? 223  LEU A CB    1 
ATOM   2241 C  CG    . LEU C 3 217 ? 63.033 18.469  -6.417  1.00 23.78 ? 223  LEU A CG    1 
ATOM   2242 C  CD1   . LEU C 3 217 ? 63.647 18.444  -7.820  1.00 21.43 ? 223  LEU A CD1   1 
ATOM   2243 C  CD2   . LEU C 3 217 ? 61.679 17.731  -6.397  1.00 21.51 ? 223  LEU A CD2   1 
ATOM   2244 N  N     . LEU C 3 218 ? 64.739 20.390  -3.868  1.00 20.83 ? 224  LEU A N     1 
ATOM   2245 C  CA    . LEU C 3 218 ? 64.505 21.807  -3.598  1.00 19.74 ? 224  LEU A CA    1 
ATOM   2246 C  C     . LEU C 3 218 ? 65.784 22.637  -3.602  1.00 19.11 ? 224  LEU A C     1 
ATOM   2247 O  O     . LEU C 3 218 ? 65.767 23.813  -3.960  1.00 19.05 ? 224  LEU A O     1 
ATOM   2248 C  CB    . LEU C 3 218 ? 63.729 21.953  -2.288  1.00 20.89 ? 224  LEU A CB    1 
ATOM   2249 C  CG    . LEU C 3 218 ? 62.332 21.347  -2.514  1.00 20.96 ? 224  LEU A CG    1 
ATOM   2250 C  CD1   . LEU C 3 218 ? 61.565 21.178  -1.223  1.00 20.14 ? 224  LEU A CD1   1 
ATOM   2251 C  CD2   . LEU C 3 218 ? 61.579 22.246  -3.488  1.00 22.90 ? 224  LEU A CD2   1 
ATOM   2252 N  N     . ALA C 3 219 ? 66.895 22.015  -3.223  1.00 18.96 ? 225  ALA A N     1 
ATOM   2253 C  CA    . ALA C 3 219 ? 68.179 22.698  -3.247  1.00 19.40 ? 225  ALA A CA    1 
ATOM   2254 C  C     . ALA C 3 219 ? 68.471 23.017  -4.722  1.00 21.28 ? 225  ALA A C     1 
ATOM   2255 O  O     . ALA C 3 219 ? 68.937 24.105  -5.057  1.00 21.38 ? 225  ALA A O     1 
ATOM   2256 C  CB    . ALA C 3 219 ? 69.263 21.796  -2.671  1.00 17.50 ? 225  ALA A CB    1 
ATOM   2257 N  N     . LYS C 3 220 ? 68.183 22.057  -5.598  1.00 20.17 ? 226  LYS A N     1 
ATOM   2258 C  CA    . LYS C 3 220 ? 68.388 22.237  -7.030  1.00 21.71 ? 226  LYS A CA    1 
ATOM   2259 C  C     . LYS C 3 220 ? 67.514 23.392  -7.551  1.00 21.30 ? 226  LYS A C     1 
ATOM   2260 O  O     . LYS C 3 220 ? 67.977 24.233  -8.324  1.00 20.40 ? 226  LYS A O     1 
ATOM   2261 C  CB    . LYS C 3 220 ? 68.056 20.931  -7.763  1.00 22.40 ? 226  LYS A CB    1 
ATOM   2262 C  CG    . LYS C 3 220 ? 68.026 21.019  -9.277  1.00 24.08 ? 226  LYS A CG    1 
ATOM   2263 C  CD    . LYS C 3 220 ? 69.392 21.312  -9.888  1.00 27.00 ? 226  LYS A CD    1 
ATOM   2264 C  CE    . LYS C 3 220 ? 69.308 21.215  -11.409 1.00 27.09 ? 226  LYS A CE    1 
ATOM   2265 N  NZ    . LYS C 3 220 ? 70.631 21.130  -12.068 1.00 28.79 ? 226  LYS A NZ    1 
ATOM   2266 N  N     . GLN C 3 221 ? 66.254 23.429  -7.120  1.00 20.62 ? 227  GLN A N     1 
ATOM   2267 C  CA    . GLN C 3 221 ? 65.340 24.491  -7.520  1.00 20.36 ? 227  GLN A CA    1 
ATOM   2268 C  C     . GLN C 3 221 ? 65.917 25.868  -7.158  1.00 20.93 ? 227  GLN A C     1 
ATOM   2269 O  O     . GLN C 3 221 ? 65.925 26.779  -7.991  1.00 21.46 ? 227  GLN A O     1 
ATOM   2270 C  CB    . GLN C 3 221 ? 63.975 24.317  -6.844  1.00 20.74 ? 227  GLN A CB    1 
ATOM   2271 C  CG    . GLN C 3 221 ? 63.014 25.478  -7.114  1.00 20.95 ? 227  GLN A CG    1 
ATOM   2272 C  CD    . GLN C 3 221 ? 61.671 25.322  -6.421  1.00 21.15 ? 227  GLN A CD    1 
ATOM   2273 O  OE1   . GLN C 3 221 ? 60.850 24.480  -6.800  1.00 19.08 ? 227  GLN A OE1   1 
ATOM   2274 N  NE2   . GLN C 3 221 ? 61.439 26.139  -5.398  1.00 20.21 ? 227  GLN A NE2   1 
ATOM   2275 N  N     . GLU C 3 222 ? 66.382 26.012  -5.918  1.00 21.37 ? 228  GLU A N     1 
ATOM   2276 C  CA    . GLU C 3 222 ? 66.975 27.263  -5.443  1.00 22.46 ? 228  GLU A CA    1 
ATOM   2277 C  C     . GLU C 3 222 ? 68.093 27.690  -6.391  1.00 23.64 ? 228  GLU A C     1 
ATOM   2278 O  O     . GLU C 3 222 ? 68.188 28.854  -6.775  1.00 22.56 ? 228  GLU A O     1 
ATOM   2279 C  CB    . GLU C 3 222 ? 67.544 27.092  -4.021  1.00 23.12 ? 228  GLU A CB    1 
ATOM   2280 C  CG    . GLU C 3 222 ? 66.567 27.431  -2.903  1.00 25.54 ? 228  GLU A CG    1 
ATOM   2281 C  CD    . GLU C 3 222 ? 67.175 27.361  -1.489  1.00 28.10 ? 228  GLU A CD    1 
ATOM   2282 O  OE1   . GLU C 3 222 ? 68.276 27.913  -1.246  1.00 27.68 ? 228  GLU A OE1   1 
ATOM   2283 O  OE2   . GLU C 3 222 ? 66.525 26.772  -0.603  1.00 26.79 ? 228  GLU A OE2   1 
ATOM   2284 N  N     . ARG C 3 223 ? 68.938 26.729  -6.753  1.00 24.45 ? 229  ARG A N     1 
ATOM   2285 C  CA    . ARG C 3 223 ? 70.049 26.967  -7.665  1.00 23.99 ? 229  ARG A CA    1 
ATOM   2286 C  C     . ARG C 3 223 ? 69.552 27.388  -9.037  1.00 23.55 ? 229  ARG A C     1 
ATOM   2287 O  O     . ARG C 3 223 ? 70.177 28.220  -9.685  1.00 22.16 ? 229  ARG A O     1 
ATOM   2288 C  CB    . ARG C 3 223 ? 70.892 25.706  -7.813  1.00 26.53 ? 229  ARG A CB    1 
ATOM   2289 C  CG    . ARG C 3 223 ? 72.164 25.681  -6.994  1.00 28.99 ? 229  ARG A CG    1 
ATOM   2290 C  CD    . ARG C 3 223 ? 72.795 24.295  -7.060  1.00 28.12 ? 229  ARG A CD    1 
ATOM   2291 N  NE    . ARG C 3 223 ? 72.354 23.518  -5.917  1.00 31.41 ? 229  ARG A NE    1 
ATOM   2292 C  CZ    . ARG C 3 223 ? 71.978 22.247  -5.937  1.00 28.37 ? 229  ARG A CZ    1 
ATOM   2293 N  NH1   . ARG C 3 223 ? 71.971 21.545  -7.064  1.00 25.79 ? 229  ARG A NH1   1 
ATOM   2294 N  NH2   . ARG C 3 223 ? 71.613 21.683  -4.799  1.00 30.45 ? 229  ARG A NH2   1 
ATOM   2295 N  N     . ASN C 3 224 ? 68.450 26.794  -9.495  1.00 23.25 ? 230  ASN A N     1 
ATOM   2296 C  CA    . ASN C 3 224 ? 67.892 27.162  -10.798 1.00 22.71 ? 230  ASN A CA    1 
ATOM   2297 C  C     . ASN C 3 224 ? 67.468 28.630  -10.749 1.00 23.20 ? 230  ASN A C     1 
ATOM   2298 O  O     . ASN C 3 224 ? 67.807 29.418  -11.637 1.00 23.60 ? 230  ASN A O     1 
ATOM   2299 C  CB    . ASN C 3 224 ? 66.655 26.325  -11.153 1.00 22.23 ? 230  ASN A CB    1 
ATOM   2300 C  CG    . ASN C 3 224 ? 66.958 24.842  -11.344 1.00 21.33 ? 230  ASN A CG    1 
ATOM   2301 O  OD1   . ASN C 3 224 ? 68.104 24.429  -11.519 1.00 22.33 ? 230  ASN A OD1   1 
ATOM   2302 N  ND2   . ASN C 3 224 ? 65.908 24.034  -11.324 1.00 21.50 ? 230  ASN A ND2   1 
ATOM   2303 N  N     . GLY C 3 225 ? 66.730 28.986  -9.699  1.00 21.82 ? 231  GLY A N     1 
ATOM   2304 C  CA    . GLY C 3 225 ? 66.244 30.347  -9.551  1.00 21.11 ? 231  GLY A CA    1 
ATOM   2305 C  C     . GLY C 3 225 ? 65.006 30.558  -10.408 1.00 20.24 ? 231  GLY A C     1 
ATOM   2306 O  O     . GLY C 3 225 ? 64.653 29.686  -11.199 1.00 20.11 ? 231  GLY A O     1 
ATOM   2307 N  N     . PHE C 3 226 ? 64.351 31.707  -10.262 1.00 19.45 ? 232  PHE A N     1 
ATOM   2308 C  CA    . PHE C 3 226 ? 63.148 32.015  -11.038 1.00 18.82 ? 232  PHE A CA    1 
ATOM   2309 C  C     . PHE C 3 226 ? 63.430 33.228  -11.940 1.00 19.82 ? 232  PHE A C     1 
ATOM   2310 O  O     . PHE C 3 226 ? 63.615 34.345  -11.443 1.00 18.69 ? 232  PHE A O     1 
ATOM   2311 C  CB    . PHE C 3 226 ? 61.986 32.351  -10.088 1.00 18.49 ? 232  PHE A CB    1 
ATOM   2312 C  CG    . PHE C 3 226 ? 60.617 32.042  -10.647 1.00 17.47 ? 232  PHE A CG    1 
ATOM   2313 C  CD1   . PHE C 3 226 ? 60.303 32.320  -11.980 1.00 15.73 ? 232  PHE A CD1   1 
ATOM   2314 C  CD2   . PHE C 3 226 ? 59.633 31.473  -9.829  1.00 15.94 ? 232  PHE A CD2   1 
ATOM   2315 C  CE1   . PHE C 3 226 ? 59.032 32.031  -12.490 1.00 16.46 ? 232  PHE A CE1   1 
ATOM   2316 C  CE2   . PHE C 3 226 ? 58.361 31.182  -10.325 1.00 15.92 ? 232  PHE A CE2   1 
ATOM   2317 C  CZ    . PHE C 3 226 ? 58.059 31.459  -11.658 1.00 16.52 ? 232  PHE A CZ    1 
ATOM   2318 N  N     . PRO C 3 227 ? 63.480 33.024  -13.272 1.00 20.78 ? 233  PRO A N     1 
ATOM   2319 C  CA    . PRO C 3 227 ? 63.739 34.111  -14.236 1.00 20.79 ? 233  PRO A CA    1 
ATOM   2320 C  C     . PRO C 3 227 ? 62.849 35.322  -13.936 1.00 20.80 ? 233  PRO A C     1 
ATOM   2321 O  O     . PRO C 3 227 ? 61.625 35.209  -13.887 1.00 20.46 ? 233  PRO A O     1 
ATOM   2322 C  CB    . PRO C 3 227 ? 63.422 33.460  -15.580 1.00 21.64 ? 233  PRO A CB    1 
ATOM   2323 C  CG    . PRO C 3 227 ? 63.851 32.031  -15.355 1.00 21.27 ? 233  PRO A CG    1 
ATOM   2324 C  CD    . PRO C 3 227 ? 63.305 31.733  -13.966 1.00 20.23 ? 233  PRO A CD    1 
ATOM   2325 N  N     . PHE C 3 228 ? 63.476 36.482  -13.768 1.00 22.22 ? 234  PHE A N     1 
ATOM   2326 C  CA    . PHE C 3 228 ? 62.778 37.710  -13.391 1.00 23.44 ? 234  PHE A CA    1 
ATOM   2327 C  C     . PHE C 3 228 ? 62.967 38.885  -14.359 1.00 23.28 ? 234  PHE A C     1 
ATOM   2328 O  O     . PHE C 3 228 ? 64.084 39.184  -14.767 1.00 25.61 ? 234  PHE A O     1 
ATOM   2329 C  CB    . PHE C 3 228 ? 63.284 38.092  -11.994 1.00 24.66 ? 234  PHE A CB    1 
ATOM   2330 C  CG    . PHE C 3 228 ? 62.593 39.265  -11.379 1.00 24.04 ? 234  PHE A CG    1 
ATOM   2331 C  CD1   . PHE C 3 228 ? 61.301 39.145  -10.888 1.00 23.08 ? 234  PHE A CD1   1 
ATOM   2332 C  CD2   . PHE C 3 228 ? 63.272 40.469  -11.212 1.00 24.15 ? 234  PHE A CD2   1 
ATOM   2333 C  CE1   . PHE C 3 228 ? 60.691 40.206  -10.221 1.00 25.53 ? 234  PHE A CE1   1 
ATOM   2334 C  CE2   . PHE C 3 228 ? 62.677 41.537  -10.550 1.00 25.17 ? 234  PHE A CE2   1 
ATOM   2335 C  CZ    . PHE C 3 228 ? 61.379 41.405  -10.048 1.00 24.65 ? 234  PHE A CZ    1 
ATOM   2336 N  N     . ASP C 3 229 ? 61.870 39.564  -14.699 1.00 24.79 ? 235  ASP A N     1 
ATOM   2337 C  CA    . ASP C 3 229 ? 61.896 40.717  -15.610 1.00 24.04 ? 235  ASP A CA    1 
ATOM   2338 C  C     . ASP C 3 229 ? 62.186 42.007  -14.834 1.00 25.88 ? 235  ASP A C     1 
ATOM   2339 O  O     . ASP C 3 229 ? 61.277 42.784  -14.535 1.00 27.07 ? 235  ASP A O     1 
ATOM   2340 C  CB    . ASP C 3 229 ? 60.543 40.844  -16.317 1.00 25.81 ? 235  ASP A CB    1 
ATOM   2341 C  CG    . ASP C 3 229 ? 60.559 41.847  -17.480 1.00 25.79 ? 235  ASP A CG    1 
ATOM   2342 O  OD1   . ASP C 3 229 ? 61.575 42.554  -17.678 1.00 27.69 ? 235  ASP A OD1   1 
ATOM   2343 O  OD2   . ASP C 3 229 ? 59.543 41.926  -18.201 1.00 23.94 ? 235  ASP A OD2   1 
ATOM   2344 N  N     . THR C 3 230 ? 63.455 42.236  -14.518 1.00 26.96 ? 236  THR A N     1 
ATOM   2345 C  CA    . THR C 3 230 ? 63.878 43.416  -13.766 1.00 28.00 ? 236  THR A CA    1 
ATOM   2346 C  C     . THR C 3 230 ? 63.395 44.751  -14.363 1.00 29.77 ? 236  THR A C     1 
ATOM   2347 O  O     . THR C 3 230 ? 62.936 45.643  -13.636 1.00 29.55 ? 236  THR A O     1 
ATOM   2348 C  CB    . THR C 3 230 ? 65.409 43.453  -13.648 1.00 28.46 ? 236  THR A CB    1 
ATOM   2349 O  OG1   . THR C 3 230 ? 65.863 42.248  -13.021 1.00 28.32 ? 236  THR A OG1   1 
ATOM   2350 C  CG2   . THR C 3 230 ? 65.862 44.664  -12.829 1.00 27.14 ? 236  THR A CG2   1 
ATOM   2351 N  N     . LYS C 3 231 ? 63.497 44.885  -15.682 1.00 29.37 ? 237  LYS A N     1 
ATOM   2352 C  CA    . LYS C 3 231 ? 63.066 46.110  -16.354 1.00 30.27 ? 237  LYS A CA    1 
ATOM   2353 C  C     . LYS C 3 231 ? 61.581 46.400  -16.118 1.00 28.51 ? 237  LYS A C     1 
ATOM   2354 O  O     . LYS C 3 231 ? 61.207 47.522  -15.785 1.00 29.08 ? 237  LYS A O     1 
ATOM   2355 C  CB    . LYS C 3 231 ? 63.328 46.011  -17.865 1.00 31.20 ? 237  LYS A CB    1 
ATOM   2356 C  CG    . LYS C 3 231 ? 63.757 47.316  -18.506 1.00 35.05 ? 237  LYS A CG    1 
ATOM   2357 C  CD    . LYS C 3 231 ? 62.646 48.355  -18.480 1.00 39.83 ? 237  LYS A CD    1 
ATOM   2358 C  CE    . LYS C 3 231 ? 63.207 49.778  -18.443 1.00 42.04 ? 237  LYS A CE    1 
ATOM   2359 N  NZ    . LYS C 3 231 ? 63.934 50.062  -17.155 1.00 41.57 ? 237  LYS A NZ    1 
ATOM   2360 N  N     . ALA C 3 232 ? 60.737 45.389  -16.289 1.00 25.84 ? 238  ALA A N     1 
ATOM   2361 C  CA    . ALA C 3 232 ? 59.310 45.581  -16.106 1.00 26.13 ? 238  ALA A CA    1 
ATOM   2362 C  C     . ALA C 3 232 ? 58.966 46.038  -14.692 1.00 26.54 ? 238  ALA A C     1 
ATOM   2363 O  O     . ALA C 3 232 ? 58.047 46.838  -14.495 1.00 26.71 ? 238  ALA A O     1 
ATOM   2364 C  CB    . ALA C 3 232 ? 58.565 44.308  -16.437 1.00 24.26 ? 238  ALA A CB    1 
ATOM   2365 N  N     . ILE C 3 233 ? 59.702 45.538  -13.708 1.00 26.77 ? 239  ILE A N     1 
ATOM   2366 C  CA    . ILE C 3 233 ? 59.442 45.915  -12.321 1.00 27.09 ? 239  ILE A CA    1 
ATOM   2367 C  C     . ILE C 3 233 ? 59.957 47.322  -11.986 1.00 27.16 ? 239  ILE A C     1 
ATOM   2368 O  O     . ILE C 3 233 ? 59.350 48.034  -11.189 1.00 27.89 ? 239  ILE A O     1 
ATOM   2369 C  CB    . ILE C 3 233 ? 60.029 44.855  -11.351 1.00 25.80 ? 239  ILE A CB    1 
ATOM   2370 C  CG1   . ILE C 3 233 ? 59.373 43.499  -11.647 1.00 24.68 ? 239  ILE A CG1   1 
ATOM   2371 C  CG2   . ILE C 3 233 ? 59.778 45.252  -9.896  1.00 23.82 ? 239  ILE A CG2   1 
ATOM   2372 C  CD1   . ILE C 3 233 ? 57.845 43.534  -11.631 1.00 22.52 ? 239  ILE A CD1   1 
ATOM   2373 N  N     . GLU C 3 234 ? 61.062 47.729  -12.598 1.00 27.48 ? 240  GLU A N     1 
ATOM   2374 C  CA    . GLU C 3 234 ? 61.584 49.068  -12.364 1.00 29.91 ? 240  GLU A CA    1 
ATOM   2375 C  C     . GLU C 3 234 ? 60.600 50.093  -12.934 1.00 30.73 ? 240  GLU A C     1 
ATOM   2376 O  O     . GLU C 3 234 ? 60.450 51.190  -12.387 1.00 30.88 ? 240  GLU A O     1 
ATOM   2377 C  CB    . GLU C 3 234 ? 62.949 49.239  -13.032 1.00 29.81 ? 240  GLU A CB    1 
ATOM   2378 C  CG    . GLU C 3 234 ? 63.994 48.298  -12.478 1.00 32.55 ? 240  GLU A CG    1 
ATOM   2379 C  CD    . GLU C 3 234 ? 65.328 48.442  -13.164 1.00 33.56 ? 240  GLU A CD    1 
ATOM   2380 O  OE1   . GLU C 3 234 ? 65.348 48.504  -14.411 1.00 35.14 ? 240  GLU A OE1   1 
ATOM   2381 O  OE2   . GLU C 3 234 ? 66.357 48.481  -12.456 1.00 37.11 ? 240  GLU A OE2   1 
ATOM   2382 N  N     . GLU C 3 235 ? 59.931 49.731  -14.028 1.00 29.50 ? 241  GLU A N     1 
ATOM   2383 C  CA    . GLU C 3 235 ? 58.956 50.618  -14.653 1.00 30.99 ? 241  GLU A CA    1 
ATOM   2384 C  C     . GLU C 3 235 ? 57.665 50.612  -13.835 1.00 30.92 ? 241  GLU A C     1 
ATOM   2385 O  O     . GLU C 3 235 ? 56.978 51.624  -13.739 1.00 31.45 ? 241  GLU A O     1 
ATOM   2386 C  CB    . GLU C 3 235 ? 58.671 50.174  -16.094 1.00 33.69 ? 241  GLU A CB    1 
ATOM   2387 C  CG    . GLU C 3 235 ? 59.927 50.091  -16.956 1.00 39.11 ? 241  GLU A CG    1 
ATOM   2388 C  CD    . GLU C 3 235 ? 59.673 49.550  -18.358 1.00 42.61 ? 241  GLU A CD    1 
ATOM   2389 O  OE1   . GLU C 3 235 ? 58.916 48.563  -18.505 1.00 42.63 ? 241  GLU A OE1   1 
ATOM   2390 O  OE2   . GLU C 3 235 ? 60.254 50.104  -19.317 1.00 45.74 ? 241  GLU A OE2   1 
ATOM   2391 N  N     . LEU C 3 236 ? 57.334 49.466  -13.246 1.00 30.77 ? 242  LEU A N     1 
ATOM   2392 C  CA    . LEU C 3 236 ? 56.135 49.370  -12.424 1.00 29.97 ? 242  LEU A CA    1 
ATOM   2393 C  C     . LEU C 3 236 ? 56.355 50.252  -11.204 1.00 30.56 ? 242  LEU A C     1 
ATOM   2394 O  O     . LEU C 3 236 ? 55.432 50.895  -10.699 1.00 29.67 ? 242  LEU A O     1 
ATOM   2395 C  CB    . LEU C 3 236 ? 55.901 47.930  -11.964 1.00 29.68 ? 242  LEU A CB    1 
ATOM   2396 C  CG    . LEU C 3 236 ? 54.802 47.790  -10.902 1.00 28.54 ? 242  LEU A CG    1 
ATOM   2397 C  CD1   . LEU C 3 236 ? 53.457 48.151  -11.509 1.00 28.52 ? 242  LEU A CD1   1 
ATOM   2398 C  CD2   . LEU C 3 236 ? 54.775 46.377  -10.358 1.00 27.55 ? 242  LEU A CD2   1 
ATOM   2399 N  N     . TYR C 3 237 ? 57.600 50.277  -10.745 1.00 30.19 ? 243  TYR A N     1 
ATOM   2400 C  CA    . TYR C 3 237 ? 57.974 51.062  -9.586  1.00 30.89 ? 243  TYR A CA    1 
ATOM   2401 C  C     . TYR C 3 237 ? 57.819 52.560  -9.866  1.00 31.47 ? 243  TYR A C     1 
ATOM   2402 O  O     . TYR C 3 237 ? 57.279 53.295  -9.040  1.00 31.10 ? 243  TYR A O     1 
ATOM   2403 C  CB    . TYR C 3 237 ? 59.409 50.700  -9.173  1.00 30.25 ? 243  TYR A CB    1 
ATOM   2404 C  CG    . TYR C 3 237 ? 59.942 51.461  -7.980  1.00 29.73 ? 243  TYR A CG    1 
ATOM   2405 C  CD1   . TYR C 3 237 ? 59.090 51.905  -6.968  1.00 30.09 ? 243  TYR A CD1   1 
ATOM   2406 C  CD2   . TYR C 3 237 ? 61.306 51.739  -7.865  1.00 30.58 ? 243  TYR A CD2   1 
ATOM   2407 C  CE1   . TYR C 3 237 ? 59.581 52.616  -5.870  1.00 29.43 ? 243  TYR A CE1   1 
ATOM   2408 C  CE2   . TYR C 3 237 ? 61.810 52.447  -6.773  1.00 29.97 ? 243  TYR A CE2   1 
ATOM   2409 C  CZ    . TYR C 3 237 ? 60.941 52.883  -5.780  1.00 30.85 ? 243  TYR A CZ    1 
ATOM   2410 O  OH    . TYR C 3 237 ? 61.431 53.590  -4.703  1.00 30.59 ? 243  TYR A OH    1 
ATOM   2411 N  N     . VAL C 3 238 ? 58.268 53.011  -11.034 1.00 31.98 ? 244  VAL A N     1 
ATOM   2412 C  CA    . VAL C 3 238 ? 58.140 54.425  -11.385 1.00 32.63 ? 244  VAL A CA    1 
ATOM   2413 C  C     . VAL C 3 238 ? 56.672 54.830  -11.410 1.00 32.86 ? 244  VAL A C     1 
ATOM   2414 O  O     . VAL C 3 238 ? 56.290 55.878  -10.890 1.00 33.36 ? 244  VAL A O     1 
ATOM   2415 C  CB    . VAL C 3 238 ? 58.740 54.731  -12.769 1.00 33.36 ? 244  VAL A CB    1 
ATOM   2416 C  CG1   . VAL C 3 238 ? 58.469 56.197  -13.133 1.00 33.56 ? 244  VAL A CG1   1 
ATOM   2417 C  CG2   . VAL C 3 238 ? 60.244 54.457  -12.762 1.00 32.20 ? 244  VAL A CG2   1 
ATOM   2418 N  N     . GLU C 3 239 ? 55.858 53.982  -12.026 1.00 32.78 ? 245  GLU A N     1 
ATOM   2419 C  CA    . GLU C 3 239 ? 54.426 54.209  -12.139 1.00 33.46 ? 245  GLU A CA    1 
ATOM   2420 C  C     . GLU C 3 239 ? 53.762 54.301  -10.767 1.00 32.96 ? 245  GLU A C     1 
ATOM   2421 O  O     . GLU C 3 239 ? 52.931 55.173  -10.538 1.00 33.99 ? 245  GLU A O     1 
ATOM   2422 C  CB    . GLU C 3 239 ? 53.800 53.068  -12.941 1.00 35.14 ? 245  GLU A CB    1 
ATOM   2423 C  CG    . GLU C 3 239 ? 52.295 53.157  -13.150 1.00 38.65 ? 245  GLU A CG    1 
ATOM   2424 C  CD    . GLU C 3 239 ? 51.730 51.871  -13.734 1.00 40.54 ? 245  GLU A CD    1 
ATOM   2425 O  OE1   . GLU C 3 239 ? 52.388 51.285  -14.625 1.00 40.77 ? 245  GLU A OE1   1 
ATOM   2426 O  OE2   . GLU C 3 239 ? 50.630 51.448  -13.309 1.00 42.18 ? 245  GLU A OE2   1 
ATOM   2427 N  N     . LEU C 3 240 ? 54.136 53.399  -9.861  1.00 32.98 ? 246  LEU A N     1 
ATOM   2428 C  CA    . LEU C 3 240 ? 53.573 53.358  -8.508  1.00 32.51 ? 246  LEU A CA    1 
ATOM   2429 C  C     . LEU C 3 240 ? 54.034 54.534  -7.649  1.00 32.24 ? 246  LEU A C     1 
ATOM   2430 O  O     . LEU C 3 240 ? 53.273 55.066  -6.841  1.00 32.20 ? 246  LEU A O     1 
ATOM   2431 C  CB    . LEU C 3 240 ? 53.956 52.039  -7.814  1.00 30.65 ? 246  LEU A CB    1 
ATOM   2432 C  CG    . LEU C 3 240 ? 53.464 50.724  -8.433  1.00 30.75 ? 246  LEU A CG    1 
ATOM   2433 C  CD1   . LEU C 3 240 ? 54.151 49.545  -7.759  1.00 30.45 ? 246  LEU A CD1   1 
ATOM   2434 C  CD2   . LEU C 3 240 ? 51.957 50.615  -8.295  1.00 30.77 ? 246  LEU A CD2   1 
ATOM   2435 N  N     . ALA C 3 241 ? 55.287 54.932  -7.825  1.00 32.84 ? 247  ALA A N     1 
ATOM   2436 C  CA    . ALA C 3 241 ? 55.843 56.040  -7.064  1.00 33.96 ? 247  ALA A CA    1 
ATOM   2437 C  C     . ALA C 3 241 ? 55.155 57.363  -7.409  1.00 34.02 ? 247  ALA A C     1 
ATOM   2438 O  O     . ALA C 3 241 ? 54.938 58.205  -6.533  1.00 33.89 ? 247  ALA A O     1 
ATOM   2439 C  CB    . ALA C 3 241 ? 57.343 56.142  -7.317  1.00 32.35 ? 247  ALA A CB    1 
ATOM   2440 N  N     . ALA C 3 242 ? 54.811 57.546  -8.681  1.00 34.18 ? 248  ALA A N     1 
ATOM   2441 C  CA    . ALA C 3 242 ? 54.150 58.778  -9.112  1.00 35.10 ? 248  ALA A CA    1 
ATOM   2442 C  C     . ALA C 3 242 ? 52.732 58.821  -8.557  1.00 35.95 ? 248  ALA A C     1 
ATOM   2443 O  O     . ALA C 3 242 ? 52.254 59.868  -8.111  1.00 37.13 ? 248  ALA A O     1 
ATOM   2444 C  CB    . ALA C 3 242 ? 54.122 58.864  -10.639 1.00 35.02 ? 248  ALA A CB    1 
ATOM   2445 N  N     . ARG C 3 243 ? 52.060 57.676  -8.582  1.00 36.05 ? 249  ARG A N     1 
ATOM   2446 C  CA    . ARG C 3 243 ? 50.702 57.603  -8.066  1.00 36.32 ? 249  ARG A CA    1 
ATOM   2447 C  C     . ARG C 3 243 ? 50.713 57.803  -6.551  1.00 35.97 ? 249  ARG A C     1 
ATOM   2448 O  O     . ARG C 3 243 ? 49.769 58.349  -5.976  1.00 35.84 ? 249  ARG A O     1 
ATOM   2449 C  CB    . ARG C 3 243 ? 50.074 56.252  -8.416  1.00 34.86 ? 249  ARG A CB    1 
ATOM   2450 C  CG    . ARG C 3 243 ? 48.637 56.107  -7.957  1.00 36.55 ? 249  ARG A CG    1 
ATOM   2451 C  CD    . ARG C 3 243 ? 47.792 57.291  -8.409  1.00 35.40 ? 249  ARG A CD    1 
ATOM   2452 N  NE    . ARG C 3 243 ? 46.390 57.110  -8.052  1.00 37.29 ? 249  ARG A NE    1 
ATOM   2453 C  CZ    . ARG C 3 243 ? 45.474 58.075  -8.091  1.00 38.85 ? 249  ARG A CZ    1 
ATOM   2454 N  NH1   . ARG C 3 243 ? 45.810 59.304  -8.473  1.00 38.89 ? 249  ARG A NH1   1 
ATOM   2455 N  NH2   . ARG C 3 243 ? 44.221 57.812  -7.743  1.00 37.89 ? 249  ARG A NH2   1 
ATOM   2456 N  N     . ARG C 3 244 ? 51.788 57.362  -5.905  1.00 35.72 ? 250  ARG A N     1 
ATOM   2457 C  CA    . ARG C 3 244 ? 51.890 57.523  -4.467  1.00 35.64 ? 250  ARG A CA    1 
ATOM   2458 C  C     . ARG C 3 244 ? 52.033 59.005  -4.155  1.00 35.90 ? 250  ARG A C     1 
ATOM   2459 O  O     . ARG C 3 244 ? 51.374 59.516  -3.247  1.00 36.79 ? 250  ARG A O     1 
ATOM   2460 C  CB    . ARG C 3 244 ? 53.091 56.754  -3.909  1.00 34.77 ? 250  ARG A CB    1 
ATOM   2461 C  CG    . ARG C 3 244 ? 53.325 57.010  -2.425  1.00 34.01 ? 250  ARG A CG    1 
ATOM   2462 C  CD    . ARG C 3 244 ? 54.417 56.126  -1.858  1.00 31.61 ? 250  ARG A CD    1 
ATOM   2463 N  NE    . ARG C 3 244 ? 55.696 56.306  -2.532  1.00 28.56 ? 250  ARG A NE    1 
ATOM   2464 C  CZ    . ARG C 3 244 ? 56.775 55.574  -2.275  1.00 30.46 ? 250  ARG A CZ    1 
ATOM   2465 N  NH1   . ARG C 3 244 ? 56.722 54.612  -1.359  1.00 29.67 ? 250  ARG A NH1   1 
ATOM   2466 N  NH2   . ARG C 3 244 ? 57.908 55.799  -2.930  1.00 29.93 ? 250  ARG A NH2   1 
ATOM   2467 N  N     . SER C 3 245 ? 52.892 59.686  -4.912  1.00 35.70 ? 251  SER A N     1 
ATOM   2468 C  CA    . SER C 3 245 ? 53.130 61.119  -4.732  1.00 35.94 ? 251  SER A CA    1 
ATOM   2469 C  C     . SER C 3 245 ? 51.849 61.929  -4.902  1.00 35.46 ? 251  SER A C     1 
ATOM   2470 O  O     . SER C 3 245 ? 51.525 62.767  -4.064  1.00 34.82 ? 251  SER A O     1 
ATOM   2471 C  CB    . SER C 3 245 ? 54.173 61.627  -5.733  1.00 37.38 ? 251  SER A CB    1 
ATOM   2472 O  OG    . SER C 3 245 ? 55.467 61.148  -5.418  1.00 39.33 ? 251  SER A OG    1 
ATOM   2473 N  N     . GLU C 3 246 ? 51.131 61.678  -5.993  1.00 34.92 ? 252  GLU A N     1 
ATOM   2474 C  CA    . GLU C 3 246 ? 49.884 62.384  -6.268  1.00 34.54 ? 252  GLU A CA    1 
ATOM   2475 C  C     . GLU C 3 246 ? 48.851 62.130  -5.172  1.00 34.04 ? 252  GLU A C     1 
ATOM   2476 O  O     . GLU C 3 246 ? 48.075 63.025  -4.828  1.00 34.00 ? 252  GLU A O     1 
ATOM   2477 C  CB    . GLU C 3 246 ? 49.323 61.961  -7.629  1.00 34.93 ? 252  GLU A CB    1 
ATOM   2478 C  CG    . GLU C 3 246 ? 47.993 62.617  -8.015  1.00 36.69 ? 252  GLU A CG    1 
ATOM   2479 C  CD    . GLU C 3 246 ? 48.059 64.144  -8.101  1.00 36.98 ? 252  GLU A CD    1 
ATOM   2480 O  OE1   . GLU C 3 246 ? 49.175 64.716  -8.077  1.00 36.74 ? 252  GLU A OE1   1 
ATOM   2481 O  OE2   . GLU C 3 246 ? 46.981 64.770  -8.208  1.00 38.04 ? 252  GLU A OE2   1 
ATOM   2482 N  N     . LEU C 3 247 ? 48.833 60.916  -4.626  1.00 32.60 ? 253  LEU A N     1 
ATOM   2483 C  CA    . LEU C 3 247 ? 47.891 60.599  -3.559  1.00 32.56 ? 253  LEU A CA    1 
ATOM   2484 C  C     . LEU C 3 247 ? 48.310 61.323  -2.286  1.00 32.46 ? 253  LEU A C     1 
ATOM   2485 O  O     . LEU C 3 247 ? 47.471 61.733  -1.490  1.00 31.13 ? 253  LEU A O     1 
ATOM   2486 C  CB    . LEU C 3 247 ? 47.834 59.090  -3.308  1.00 30.96 ? 253  LEU A CB    1 
ATOM   2487 C  CG    . LEU C 3 247 ? 47.140 58.291  -4.413  1.00 29.90 ? 253  LEU A CG    1 
ATOM   2488 C  CD1   . LEU C 3 247 ? 47.232 56.807  -4.120  1.00 30.56 ? 253  LEU A CD1   1 
ATOM   2489 C  CD2   . LEU C 3 247 ? 45.693 58.718  -4.509  1.00 30.76 ? 253  LEU A CD2   1 
ATOM   2490 N  N     . LEU C 3 248 ? 49.614 61.481  -2.105  1.00 34.02 ? 254  LEU A N     1 
ATOM   2491 C  CA    . LEU C 3 248 ? 50.135 62.167  -0.936  1.00 34.52 ? 254  LEU A CA    1 
ATOM   2492 C  C     . LEU C 3 248 ? 49.795 63.654  -1.030  1.00 35.49 ? 254  LEU A C     1 
ATOM   2493 O  O     . LEU C 3 248 ? 49.389 64.272  -0.043  1.00 35.22 ? 254  LEU A O     1 
ATOM   2494 C  CB    . LEU C 3 248 ? 51.651 61.982  -0.843  1.00 33.78 ? 254  LEU A CB    1 
ATOM   2495 C  CG    . LEU C 3 248 ? 52.280 62.614  0.402   1.00 34.78 ? 254  LEU A CG    1 
ATOM   2496 C  CD1   . LEU C 3 248 ? 51.624 62.040  1.664   1.00 34.43 ? 254  LEU A CD1   1 
ATOM   2497 C  CD2   . LEU C 3 248 ? 53.779 62.355  0.404   1.00 32.42 ? 254  LEU A CD2   1 
ATOM   2498 N  N     . ARG C 3 249 ? 49.959 64.216  -2.226  1.00 35.88 ? 255  ARG A N     1 
ATOM   2499 C  CA    . ARG C 3 249 ? 49.658 65.625  -2.464  1.00 36.72 ? 255  ARG A CA    1 
ATOM   2500 C  C     . ARG C 3 249 ? 48.187 65.890  -2.179  1.00 36.54 ? 255  ARG A C     1 
ATOM   2501 O  O     . ARG C 3 249 ? 47.837 66.849  -1.495  1.00 36.34 ? 255  ARG A O     1 
ATOM   2502 C  CB    . ARG C 3 249 ? 49.960 66.013  -3.918  1.00 36.39 ? 255  ARG A CB    1 
ATOM   2503 C  CG    . ARG C 3 249 ? 49.714 67.496  -4.226  1.00 37.21 ? 255  ARG A CG    1 
ATOM   2504 C  CD    . ARG C 3 249 ? 49.840 67.813  -5.720  1.00 38.02 ? 255  ARG A CD    1 
ATOM   2505 N  NE    . ARG C 3 249 ? 48.731 67.273  -6.508  1.00 38.73 ? 255  ARG A NE    1 
ATOM   2506 C  CZ    . ARG C 3 249 ? 47.485 67.748  -6.491  1.00 39.38 ? 255  ARG A CZ    1 
ATOM   2507 N  NH1   . ARG C 3 249 ? 47.174 68.786  -5.723  1.00 38.82 ? 255  ARG A NH1   1 
ATOM   2508 N  NH2   . ARG C 3 249 ? 46.545 67.185  -7.245  1.00 36.63 ? 255  ARG A NH2   1 
ATOM   2509 N  N     . LYS C 3 250 ? 47.321 65.040  -2.712  1.00 36.45 ? 256  LYS A N     1 
ATOM   2510 C  CA    . LYS C 3 250 ? 45.898 65.217  -2.493  1.00 37.94 ? 256  LYS A CA    1 
ATOM   2511 C  C     . LYS C 3 250 ? 45.539 65.072  -1.024  1.00 37.84 ? 256  LYS A C     1 
ATOM   2512 O  O     . LYS C 3 250 ? 44.756 65.858  -0.494  1.00 38.29 ? 256  LYS A O     1 
ATOM   2513 C  CB    . LYS C 3 250 ? 45.091 64.221  -3.331  1.00 37.81 ? 256  LYS A CB    1 
ATOM   2514 C  CG    . LYS C 3 250 ? 44.957 64.644  -4.780  1.00 39.63 ? 256  LYS A CG    1 
ATOM   2515 C  CD    . LYS C 3 250 ? 43.988 63.762  -5.542  1.00 41.80 ? 256  LYS A CD    1 
ATOM   2516 C  CE    . LYS C 3 250 ? 43.355 64.527  -6.702  1.00 43.12 ? 256  LYS A CE    1 
ATOM   2517 N  NZ    . LYS C 3 250 ? 42.516 65.675  -6.223  1.00 42.42 ? 256  LYS A NZ    1 
ATOM   2518 N  N     . LEU C 3 251 ? 46.118 64.074  -0.364  1.00 37.44 ? 257  LEU A N     1 
ATOM   2519 C  CA    . LEU C 3 251 ? 45.828 63.845  1.044   1.00 36.93 ? 257  LEU A CA    1 
ATOM   2520 C  C     . LEU C 3 251 ? 46.385 64.921  1.974   1.00 37.26 ? 257  LEU A C     1 
ATOM   2521 O  O     . LEU C 3 251 ? 45.692 65.348  2.895   1.00 36.00 ? 257  LEU A O     1 
ATOM   2522 C  CB    . LEU C 3 251 ? 46.320 62.455  1.469   1.00 34.52 ? 257  LEU A CB    1 
ATOM   2523 C  CG    . LEU C 3 251 ? 45.462 61.309  0.913   1.00 33.25 ? 257  LEU A CG    1 
ATOM   2524 C  CD1   . LEU C 3 251 ? 46.139 59.965  1.150   1.00 31.37 ? 257  LEU A CD1   1 
ATOM   2525 C  CD2   . LEU C 3 251 ? 44.093 61.342  1.568   1.00 29.46 ? 257  LEU A CD2   1 
ATOM   2526 N  N     . THR C 3 252 ? 47.621 65.363  1.745   1.00 37.98 ? 258  THR A N     1 
ATOM   2527 C  CA    . THR C 3 252 ? 48.197 66.394  2.605   1.00 39.96 ? 258  THR A CA    1 
ATOM   2528 C  C     . THR C 3 252 ? 47.513 67.735  2.358   1.00 42.41 ? 258  THR A C     1 
ATOM   2529 O  O     . THR C 3 252 ? 47.732 68.701  3.084   1.00 43.08 ? 258  THR A O     1 
ATOM   2530 C  CB    . THR C 3 252 ? 49.705 66.568  2.381   1.00 38.31 ? 258  THR A CB    1 
ATOM   2531 O  OG1   . THR C 3 252 ? 49.963 66.714  0.985   1.00 41.15 ? 258  THR A OG1   1 
ATOM   2532 C  CG2   . THR C 3 252 ? 50.470 65.383  2.931   1.00 37.42 ? 258  THR A CG2   1 
ATOM   2533 N  N     . GLU C 3 253 ? 46.688 67.790  1.322   1.00 43.57 ? 259  GLU A N     1 
ATOM   2534 C  CA    . GLU C 3 253 ? 45.959 69.006  1.012   1.00 45.13 ? 259  GLU A CA    1 
ATOM   2535 C  C     . GLU C 3 253 ? 44.653 68.970  1.804   1.00 44.11 ? 259  GLU A C     1 
ATOM   2536 O  O     . GLU C 3 253 ? 44.222 69.980  2.358   1.00 44.84 ? 259  GLU A O     1 
ATOM   2537 C  CB    . GLU C 3 253 ? 45.658 69.077  -0.487  1.00 47.62 ? 259  GLU A CB    1 
ATOM   2538 C  CG    . GLU C 3 253 ? 44.706 70.192  -0.882  1.00 52.33 ? 259  GLU A CG    1 
ATOM   2539 C  CD    . GLU C 3 253 ? 43.863 69.830  -2.097  1.00 56.00 ? 259  GLU A CD    1 
ATOM   2540 O  OE1   . GLU C 3 253 ? 44.438 69.652  -3.201  1.00 57.09 ? 259  GLU A OE1   1 
ATOM   2541 O  OE2   . GLU C 3 253 ? 42.622 69.716  -1.941  1.00 56.76 ? 259  GLU A OE2   1 
ATOM   2542 N  N     . THR C 3 254 ? 44.033 67.794  1.861   1.00 42.14 ? 260  THR A N     1 
ATOM   2543 C  CA    . THR C 3 254 ? 42.775 67.622  2.579   1.00 40.80 ? 260  THR A CA    1 
ATOM   2544 C  C     . THR C 3 254 ? 42.962 67.547  4.099   1.00 41.37 ? 260  THR A C     1 
ATOM   2545 O  O     . THR C 3 254 ? 42.193 68.137  4.863   1.00 40.76 ? 260  THR A O     1 
ATOM   2546 C  CB    . THR C 3 254 ? 42.053 66.351  2.108   1.00 39.85 ? 260  THR A CB    1 
ATOM   2547 O  OG1   . THR C 3 254 ? 41.798 66.446  0.701   1.00 38.83 ? 260  THR A OG1   1 
ATOM   2548 C  CG2   . THR C 3 254 ? 40.733 66.175  2.853   1.00 39.81 ? 260  THR A CG2   1 
ATOM   2549 N  N     . PHE C 3 255 ? 43.985 66.815  4.526   1.00 40.71 ? 261  PHE A N     1 
ATOM   2550 C  CA    . PHE C 3 255 ? 44.281 66.644  5.942   1.00 40.59 ? 261  PHE A CA    1 
ATOM   2551 C  C     . PHE C 3 255 ? 45.574 67.365  6.284   1.00 41.25 ? 261  PHE A C     1 
ATOM   2552 O  O     . PHE C 3 255 ? 46.660 66.799  6.171   1.00 42.22 ? 261  PHE A O     1 
ATOM   2553 C  CB    . PHE C 3 255 ? 44.418 65.156  6.263   1.00 40.26 ? 261  PHE A CB    1 
ATOM   2554 C  CG    . PHE C 3 255 ? 43.156 64.371  6.039   1.00 37.79 ? 261  PHE A CG    1 
ATOM   2555 C  CD1   . PHE C 3 255 ? 42.041 64.583  6.841   1.00 35.81 ? 261  PHE A CD1   1 
ATOM   2556 C  CD2   . PHE C 3 255 ? 43.087 63.415  5.032   1.00 36.69 ? 261  PHE A CD2   1 
ATOM   2557 C  CE1   . PHE C 3 255 ? 40.877 63.855  6.648   1.00 35.47 ? 261  PHE A CE1   1 
ATOM   2558 C  CE2   . PHE C 3 255 ? 41.923 62.679  4.830   1.00 35.09 ? 261  PHE A CE2   1 
ATOM   2559 C  CZ    . PHE C 3 255 ? 40.817 62.899  5.639   1.00 34.87 ? 261  PHE A CZ    1 
ATOM   2560 N  N     . GLY C 3 256 ? 45.450 68.615  6.713   1.00 41.76 ? 262  GLY A N     1 
ATOM   2561 C  CA    . GLY C 3 256 ? 46.620 69.408  7.043   1.00 42.71 ? 262  GLY A CA    1 
ATOM   2562 C  C     . GLY C 3 256 ? 47.461 68.940  8.216   1.00 42.44 ? 262  GLY A C     1 
ATOM   2563 O  O     . GLY C 3 256 ? 47.011 68.158  9.060   1.00 41.84 ? 262  GLY A O     1 
ATOM   2564 N  N     . SER C 3 257 ? 48.692 69.440  8.262   1.00 41.74 ? 263  SER A N     1 
ATOM   2565 C  CA    . SER C 3 257 ? 49.637 69.101  9.314   1.00 41.91 ? 263  SER A CA    1 
ATOM   2566 C  C     . SER C 3 257 ? 49.230 69.689  10.667  1.00 42.21 ? 263  SER A C     1 
ATOM   2567 O  O     . SER C 3 257 ? 48.265 70.448  10.761  1.00 42.23 ? 263  SER A O     1 
ATOM   2568 C  CB    . SER C 3 257 ? 51.027 69.602  8.929   1.00 43.12 ? 263  SER A CB    1 
ATOM   2569 O  OG    . SER C 3 257 ? 51.025 71.009  8.764   1.00 45.14 ? 263  SER A OG    1 
ATOM   2570 N  N     . TRP C 3 258 ? 49.975 69.337  11.712  1.00 42.07 ? 264  TRP A N     1 
ATOM   2571 C  CA    . TRP C 3 258 ? 49.685 69.821  13.057  1.00 41.10 ? 264  TRP A CA    1 
ATOM   2572 C  C     . TRP C 3 258 ? 50.900 69.631  13.956  1.00 39.95 ? 264  TRP A C     1 
ATOM   2573 O  O     . TRP C 3 258 ? 51.892 69.026  13.552  1.00 40.14 ? 264  TRP A O     1 
ATOM   2574 C  CB    . TRP C 3 258 ? 48.492 69.053  13.634  1.00 42.45 ? 264  TRP A CB    1 
ATOM   2575 C  CG    . TRP C 3 258 ? 48.771 67.578  13.851  1.00 45.58 ? 264  TRP A CG    1 
ATOM   2576 C  CD1   . TRP C 3 258 ? 49.251 66.990  14.989  1.00 45.16 ? 264  TRP A CD1   1 
ATOM   2577 C  CD2   . TRP C 3 258 ? 48.624 66.523  12.888  1.00 45.39 ? 264  TRP A CD2   1 
ATOM   2578 N  NE1   . TRP C 3 258 ? 49.410 65.638  14.795  1.00 45.61 ? 264  TRP A NE1   1 
ATOM   2579 C  CE2   . TRP C 3 258 ? 49.034 65.325  13.515  1.00 45.93 ? 264  TRP A CE2   1 
ATOM   2580 C  CE3   . TRP C 3 258 ? 48.190 66.475  11.557  1.00 46.25 ? 264  TRP A CE3   1 
ATOM   2581 C  CZ2   . TRP C 3 258 ? 49.024 64.089  12.854  1.00 46.51 ? 264  TRP A CZ2   1 
ATOM   2582 C  CZ3   . TRP C 3 258 ? 48.180 65.244  10.897  1.00 46.27 ? 264  TRP A CZ3   1 
ATOM   2583 C  CH2   . TRP C 3 258 ? 48.595 64.069  11.550  1.00 46.08 ? 264  TRP A CH2   1 
ATOM   2584 N  N     . TYR C 3 259 ? 50.819 70.152  15.175  1.00 38.82 ? 265  TYR A N     1 
ATOM   2585 C  CA    . TYR C 3 259 ? 51.912 70.023  16.131  1.00 38.22 ? 265  TYR A CA    1 
ATOM   2586 C  C     . TYR C 3 259 ? 51.514 69.111  17.275  1.00 37.16 ? 265  TYR A C     1 
ATOM   2587 O  O     . TYR C 3 259 ? 50.340 69.013  17.627  1.00 35.43 ? 265  TYR A O     1 
ATOM   2588 C  CB    . TYR C 3 259 ? 52.294 71.376  16.737  1.00 37.11 ? 265  TYR A CB    1 
ATOM   2589 C  CG    . TYR C 3 259 ? 52.942 72.355  15.792  1.00 37.52 ? 265  TYR A CG    1 
ATOM   2590 C  CD1   . TYR C 3 259 ? 52.175 73.133  14.927  1.00 37.86 ? 265  TYR A CD1   1 
ATOM   2591 C  CD2   . TYR C 3 259 ? 54.325 72.527  15.785  1.00 36.82 ? 265  TYR A CD2   1 
ATOM   2592 C  CE1   . TYR C 3 259 ? 52.769 74.061  14.084  1.00 37.42 ? 265  TYR A CE1   1 
ATOM   2593 C  CE2   . TYR C 3 259 ? 54.927 73.448  14.946  1.00 37.92 ? 265  TYR A CE2   1 
ATOM   2594 C  CZ    . TYR C 3 259 ? 54.141 74.213  14.099  1.00 37.59 ? 265  TYR A CZ    1 
ATOM   2595 O  OH    . TYR C 3 259 ? 54.733 75.133  13.269  1.00 39.90 ? 265  TYR A OH    1 
ATOM   2596 N  N     . GLN C 3 260 ? 52.507 68.447  17.850  1.00 37.88 ? 266  GLN A N     1 
ATOM   2597 C  CA    . GLN C 3 260 ? 52.282 67.574  18.994  1.00 41.10 ? 266  GLN A CA    1 
ATOM   2598 C  C     . GLN C 3 260 ? 53.522 67.657  19.870  1.00 41.01 ? 266  GLN A C     1 
ATOM   2599 O  O     . GLN C 3 260 ? 54.603 67.990  19.389  1.00 38.79 ? 266  GLN A O     1 
ATOM   2600 C  CB    . GLN C 3 260 ? 52.024 66.123  18.555  1.00 42.33 ? 266  GLN A CB    1 
ATOM   2601 C  CG    . GLN C 3 260 ? 53.117 65.493  17.709  1.00 45.73 ? 266  GLN A CG    1 
ATOM   2602 C  CD    . GLN C 3 260 ? 52.826 64.031  17.381  1.00 47.33 ? 266  GLN A CD    1 
ATOM   2603 O  OE1   . GLN C 3 260 ? 51.748 63.695  16.882  1.00 48.98 ? 266  GLN A OE1   1 
ATOM   2604 N  NE2   . GLN C 3 260 ? 53.791 63.159  17.657  1.00 45.72 ? 266  GLN A NE2   1 
ATOM   2605 N  N     . PRO C 3 261 ? 53.378 67.371  21.174  1.00 42.25 ? 267  PRO A N     1 
ATOM   2606 C  CA    . PRO C 3 261 ? 54.499 67.418  22.119  1.00 42.99 ? 267  PRO A CA    1 
ATOM   2607 C  C     . PRO C 3 261 ? 55.598 66.403  21.809  1.00 44.04 ? 267  PRO A C     1 
ATOM   2608 O  O     . PRO C 3 261 ? 55.317 65.239  21.524  1.00 42.86 ? 267  PRO A O     1 
ATOM   2609 C  CB    . PRO C 3 261 ? 53.823 67.156  23.461  1.00 43.52 ? 267  PRO A CB    1 
ATOM   2610 C  CG    . PRO C 3 261 ? 52.678 66.272  23.087  1.00 42.49 ? 267  PRO A CG    1 
ATOM   2611 C  CD    . PRO C 3 261 ? 52.142 66.947  21.854  1.00 41.88 ? 267  PRO A CD    1 
ATOM   2612 N  N     . LYS C 3 262 ? 56.845 66.860  21.869  1.00 45.46 ? 268  LYS A N     1 
ATOM   2613 C  CA    . LYS C 3 262 ? 58.000 66.015  21.595  1.00 47.98 ? 268  LYS A CA    1 
ATOM   2614 C  C     . LYS C 3 262 ? 59.279 66.611  22.183  1.00 49.37 ? 268  LYS A C     1 
ATOM   2615 O  O     . LYS C 3 262 ? 59.716 67.697  21.788  1.00 49.34 ? 268  LYS A O     1 
ATOM   2616 C  CB    . LYS C 3 262 ? 58.164 65.823  20.082  1.00 49.11 ? 268  LYS A CB    1 
ATOM   2617 C  CG    . LYS C 3 262 ? 59.476 65.158  19.673  1.00 51.14 ? 268  LYS A CG    1 
ATOM   2618 C  CD    . LYS C 3 262 ? 59.614 63.758  20.260  1.00 53.50 ? 268  LYS A CD    1 
ATOM   2619 C  CE    . LYS C 3 262 ? 59.013 62.682  19.355  1.00 54.78 ? 268  LYS A CE    1 
ATOM   2620 N  NZ    . LYS C 3 262 ? 59.859 62.407  18.151  1.00 54.11 ? 268  LYS A NZ    1 
ATOM   2621 N  N     . GLY C 3 263 ? 59.878 65.891  23.128  1.00 50.70 ? 269  GLY A N     1 
ATOM   2622 C  CA    . GLY C 3 263 ? 61.102 66.361  23.747  1.00 52.38 ? 269  GLY A CA    1 
ATOM   2623 C  C     . GLY C 3 263 ? 60.921 66.752  25.201  1.00 53.84 ? 269  GLY A C     1 
ATOM   2624 O  O     . GLY C 3 263 ? 61.866 67.205  25.851  1.00 54.35 ? 269  GLY A O     1 
ATOM   2625 N  N     . GLY C 3 264 ? 59.707 66.590  25.714  1.00 54.14 ? 270  GLY A N     1 
ATOM   2626 C  CA    . GLY C 3 264 ? 59.457 66.932  27.099  1.00 55.52 ? 270  GLY A CA    1 
ATOM   2627 C  C     . GLY C 3 264 ? 60.251 66.007  27.995  1.00 56.01 ? 270  GLY A C     1 
ATOM   2628 O  O     . GLY C 3 264 ? 60.127 64.788  27.895  1.00 56.70 ? 270  GLY A O     1 
ATOM   2629 N  N     . THR C 3 265 ? 61.076 66.583  28.863  1.00 56.78 ? 271  THR A N     1 
ATOM   2630 C  CA    . THR C 3 265 ? 61.900 65.802  29.782  1.00 58.22 ? 271  THR A CA    1 
ATOM   2631 C  C     . THR C 3 265 ? 61.451 66.021  31.222  1.00 58.78 ? 271  THR A C     1 
ATOM   2632 O  O     . THR C 3 265 ? 61.693 65.188  32.100  1.00 59.10 ? 271  THR A O     1 
ATOM   2633 C  CB    . THR C 3 265 ? 63.388 66.212  29.695  1.00 59.49 ? 271  THR A CB    1 
ATOM   2634 O  OG1   . THR C 3 265 ? 63.512 67.609  29.998  1.00 59.90 ? 271  THR A OG1   1 
ATOM   2635 C  CG2   . THR C 3 265 ? 63.952 65.939  28.299  1.00 59.48 ? 271  THR A CG2   1 
ATOM   2636 N  N     . GLU C 3 266 ? 60.789 67.148  31.453  1.00 58.43 ? 272  GLU A N     1 
ATOM   2637 C  CA    . GLU C 3 266 ? 60.324 67.512  32.780  1.00 57.76 ? 272  GLU A CA    1 
ATOM   2638 C  C     . GLU C 3 266 ? 58.823 67.295  32.931  1.00 56.83 ? 272  GLU A C     1 
ATOM   2639 O  O     . GLU C 3 266 ? 58.080 67.298  31.950  1.00 57.42 ? 272  GLU A O     1 
ATOM   2640 C  CB    . GLU C 3 266 ? 60.669 68.976  33.034  1.00 58.91 ? 272  GLU A CB    1 
ATOM   2641 C  CG    . GLU C 3 266 ? 60.668 69.394  34.475  1.00 59.93 ? 272  GLU A CG    1 
ATOM   2642 C  CD    . GLU C 3 266 ? 61.071 70.841  34.625  1.00 61.27 ? 272  GLU A CD    1 
ATOM   2643 O  OE1   . GLU C 3 266 ? 62.097 71.227  34.016  1.00 59.90 ? 272  GLU A OE1   1 
ATOM   2644 O  OE2   . GLU C 3 266 ? 60.368 71.587  35.346  1.00 62.29 ? 272  GLU A OE2   1 
ATOM   2645 N  N     . MET C 3 267 ? 58.383 67.108  34.169  1.00 55.73 ? 273  MET A N     1 
ATOM   2646 C  CA    . MET C 3 267 ? 56.972 66.890  34.466  1.00 54.87 ? 273  MET A CA    1 
ATOM   2647 C  C     . MET C 3 267 ? 56.284 68.228  34.734  1.00 54.40 ? 273  MET A C     1 
ATOM   2648 O  O     . MET C 3 267 ? 56.862 69.117  35.365  1.00 53.18 ? 273  MET A O     1 
ATOM   2649 C  CB    . MET C 3 267 ? 56.836 65.987  35.695  1.00 55.73 ? 273  MET A CB    1 
ATOM   2650 C  CG    . MET C 3 267 ? 55.410 65.805  36.181  1.00 56.59 ? 273  MET A CG    1 
ATOM   2651 S  SD    . MET C 3 267 ? 54.404 64.899  35.007  1.00 58.22 ? 273  MET A SD    1 
ATOM   2652 C  CE    . MET C 3 267 ? 54.502 63.238  35.706  1.00 55.91 ? 273  MET A CE    1 
ATOM   2653 N  N     . PHE C 3 268 ? 55.054 68.377  34.254  1.00 53.51 ? 274  PHE A N     1 
ATOM   2654 C  CA    . PHE C 3 268 ? 54.331 69.618  34.476  1.00 53.44 ? 274  PHE A CA    1 
ATOM   2655 C  C     . PHE C 3 268 ? 53.514 69.533  35.757  1.00 53.69 ? 274  PHE A C     1 
ATOM   2656 O  O     . PHE C 3 268 ? 52.678 68.643  35.918  1.00 53.99 ? 274  PHE A O     1 
ATOM   2657 C  CB    . PHE C 3 268 ? 53.408 69.938  33.294  1.00 53.26 ? 274  PHE A CB    1 
ATOM   2658 C  CG    . PHE C 3 268 ? 52.686 71.252  33.436  1.00 52.43 ? 274  PHE A CG    1 
ATOM   2659 C  CD1   . PHE C 3 268 ? 53.397 72.446  33.527  1.00 52.02 ? 274  PHE A CD1   1 
ATOM   2660 C  CD2   . PHE C 3 268 ? 51.297 71.295  33.508  1.00 51.92 ? 274  PHE A CD2   1 
ATOM   2661 C  CE1   . PHE C 3 268 ? 52.734 73.668  33.689  1.00 51.03 ? 274  PHE A CE1   1 
ATOM   2662 C  CE2   . PHE C 3 268 ? 50.623 72.512  33.670  1.00 51.07 ? 274  PHE A CE2   1 
ATOM   2663 C  CZ    . PHE C 3 268 ? 51.346 73.700  33.761  1.00 50.32 ? 274  PHE A CZ    1 
ATOM   2664 N  N     . CYS C 3 269 ? 53.762 70.469  36.666  1.00 54.13 ? 275  CYS A N     1 
ATOM   2665 C  CA    . CYS C 3 269 ? 53.055 70.511  37.940  1.00 54.76 ? 275  CYS A CA    1 
ATOM   2666 C  C     . CYS C 3 269 ? 52.239 71.789  38.088  1.00 54.61 ? 275  CYS A C     1 
ATOM   2667 O  O     . CYS C 3 269 ? 52.692 72.877  37.718  1.00 54.10 ? 275  CYS A O     1 
ATOM   2668 C  CB    . CYS C 3 269 ? 54.053 70.391  39.093  1.00 54.19 ? 275  CYS A CB    1 
ATOM   2669 S  SG    . CYS C 3 269 ? 54.936 68.819  39.095  1.00 56.51 ? 275  CYS A SG    1 
ATOM   2670 N  N     . HIS C 3 270 ? 51.033 71.646  38.630  1.00 54.69 ? 276  HIS A N     1 
ATOM   2671 C  CA    . HIS C 3 270 ? 50.139 72.780  38.833  1.00 55.69 ? 276  HIS A CA    1 
ATOM   2672 C  C     . HIS C 3 270 ? 50.828 73.849  39.683  1.00 55.68 ? 276  HIS A C     1 
ATOM   2673 O  O     . HIS C 3 270 ? 51.302 73.572  40.784  1.00 54.59 ? 276  HIS A O     1 
ATOM   2674 C  CB    . HIS C 3 270 ? 48.844 72.300  39.505  1.00 56.58 ? 276  HIS A CB    1 
ATOM   2675 C  CG    . HIS C 3 270 ? 47.793 73.362  39.643  1.00 57.38 ? 276  HIS A CG    1 
ATOM   2676 N  ND1   . HIS C 3 270 ? 46.473 73.066  39.908  1.00 57.88 ? 276  HIS A ND1   1 
ATOM   2677 C  CD2   . HIS C 3 270 ? 47.866 74.712  39.566  1.00 57.44 ? 276  HIS A CD2   1 
ATOM   2678 C  CE1   . HIS C 3 270 ? 45.779 74.188  39.987  1.00 58.05 ? 276  HIS A CE1   1 
ATOM   2679 N  NE2   . HIS C 3 270 ? 46.601 75.201  39.784  1.00 58.00 ? 276  HIS A NE2   1 
ATOM   2680 N  N     . PRO C 3 271 ? 50.901 75.088  39.169  1.00 56.58 ? 277  PRO A N     1 
ATOM   2681 C  CA    . PRO C 3 271 ? 51.533 76.211  39.871  1.00 57.51 ? 277  PRO A CA    1 
ATOM   2682 C  C     . PRO C 3 271 ? 51.048 76.408  41.311  1.00 58.25 ? 277  PRO A C     1 
ATOM   2683 O  O     . PRO C 3 271 ? 51.853 76.469  42.244  1.00 58.83 ? 277  PRO A O     1 
ATOM   2684 C  CB    . PRO C 3 271 ? 51.189 77.404  38.982  1.00 57.33 ? 277  PRO A CB    1 
ATOM   2685 C  CG    . PRO C 3 271 ? 51.187 76.798  37.612  1.00 57.39 ? 277  PRO A CG    1 
ATOM   2686 C  CD    . PRO C 3 271 ? 50.429 75.506  37.835  1.00 57.25 ? 277  PRO A CD    1 
ATOM   2687 N  N     . ARG C 3 272 ? 49.733 76.505  41.482  1.00 58.57 ? 278  ARG A N     1 
ATOM   2688 C  CA    . ARG C 3 272 ? 49.126 76.716  42.796  1.00 59.02 ? 278  ARG A CA    1 
ATOM   2689 C  C     . ARG C 3 272 ? 49.307 75.519  43.732  1.00 59.50 ? 278  ARG A C     1 
ATOM   2690 O  O     . ARG C 3 272 ? 49.915 75.634  44.801  1.00 58.92 ? 278  ARG A O     1 
ATOM   2691 C  CB    . ARG C 3 272 ? 47.632 77.004  42.625  1.00 59.28 ? 278  ARG A CB    1 
ATOM   2692 C  CG    . ARG C 3 272 ? 46.878 77.381  43.897  1.00 58.88 ? 278  ARG A CG    1 
ATOM   2693 C  CD    . ARG C 3 272 ? 45.405 77.050  43.718  1.00 58.52 ? 278  ARG A CD    1 
ATOM   2694 N  NE    . ARG C 3 272 ? 44.978 77.308  42.344  1.00 59.17 ? 278  ARG A NE    1 
ATOM   2695 C  CZ    . ARG C 3 272 ? 44.060 76.592  41.703  1.00 60.12 ? 278  ARG A CZ    1 
ATOM   2696 N  NH1   . ARG C 3 272 ? 43.470 75.575  42.319  1.00 60.52 ? 278  ARG A NH1   1 
ATOM   2697 N  NH2   . ARG C 3 272 ? 43.747 76.873  40.441  1.00 57.70 ? 278  ARG A NH2   1 
ATOM   2698 N  N     . THR C 3 273 ? 48.769 74.376  43.319  1.00 59.34 ? 279  THR A N     1 
ATOM   2699 C  CA    . THR C 3 273 ? 48.837 73.146  44.101  1.00 59.52 ? 279  THR A CA    1 
ATOM   2700 C  C     . THR C 3 273 ? 50.229 72.529  44.151  1.00 59.42 ? 279  THR A C     1 
ATOM   2701 O  O     . THR C 3 273 ? 50.759 72.263  45.231  1.00 59.12 ? 279  THR A O     1 
ATOM   2702 C  CB    . THR C 3 273 ? 47.863 72.095  43.541  1.00 60.01 ? 279  THR A CB    1 
ATOM   2703 O  OG1   . THR C 3 273 ? 46.516 72.519  43.790  1.00 62.28 ? 279  THR A OG1   1 
ATOM   2704 C  CG2   . THR C 3 273 ? 48.102 70.740  44.187  1.00 59.75 ? 279  THR A CG2   1 
ATOM   2705 N  N     . GLY C 3 274 ? 50.808 72.291  42.977  1.00 58.35 ? 280  GLY A N     1 
ATOM   2706 C  CA    . GLY C 3 274 ? 52.127 71.693  42.905  1.00 56.73 ? 280  GLY A CA    1 
ATOM   2707 C  C     . GLY C 3 274 ? 52.032 70.209  42.612  1.00 56.26 ? 280  GLY A C     1 
ATOM   2708 O  O     . GLY C 3 274 ? 53.050 69.519  42.544  1.00 56.02 ? 280  GLY A O     1 
ATOM   2709 N  N     . LYS C 3 275 ? 50.810 69.716  42.427  1.00 55.82 ? 281  LYS A N     1 
ATOM   2710 C  CA    . LYS C 3 275 ? 50.601 68.299  42.148  1.00 56.22 ? 281  LYS A CA    1 
ATOM   2711 C  C     . LYS C 3 275 ? 50.960 67.947  40.711  1.00 56.52 ? 281  LYS A C     1 
ATOM   2712 O  O     . LYS C 3 275 ? 50.679 68.707  39.783  1.00 56.44 ? 281  LYS A O     1 
ATOM   2713 C  CB    . LYS C 3 275 ? 49.144 67.900  42.407  1.00 56.73 ? 281  LYS A CB    1 
ATOM   2714 C  CG    . LYS C 3 275 ? 48.152 68.415  41.376  1.00 57.28 ? 281  LYS A CG    1 
ATOM   2715 C  CD    . LYS C 3 275 ? 46.792 67.748  41.538  1.00 58.21 ? 281  LYS A CD    1 
ATOM   2716 C  CE    . LYS C 3 275 ? 45.806 68.204  40.464  1.00 59.33 ? 281  LYS A CE    1 
ATOM   2717 N  NZ    . LYS C 3 275 ? 44.485 67.510  40.574  1.00 58.38 ? 281  LYS A NZ    1 
ATOM   2718 N  N     . PRO C 3 276 ? 51.598 66.784  40.510  1.00 56.87 ? 282  PRO A N     1 
ATOM   2719 C  CA    . PRO C 3 276 ? 51.982 66.353  39.164  1.00 56.47 ? 282  PRO A CA    1 
ATOM   2720 C  C     . PRO C 3 276 ? 50.754 66.126  38.287  1.00 56.10 ? 282  PRO A C     1 
ATOM   2721 O  O     . PRO C 3 276 ? 49.742 65.590  38.741  1.00 55.24 ? 282  PRO A O     1 
ATOM   2722 C  CB    . PRO C 3 276 ? 52.749 65.058  39.423  1.00 56.55 ? 282  PRO A CB    1 
ATOM   2723 C  CG    . PRO C 3 276 ? 53.362 65.299  40.769  1.00 57.30 ? 282  PRO A CG    1 
ATOM   2724 C  CD    . PRO C 3 276 ? 52.209 65.913  41.530  1.00 57.28 ? 282  PRO A CD    1 
ATOM   2725 N  N     . LEU C 3 277 ? 50.853 66.547  37.032  1.00 56.04 ? 283  LEU A N     1 
ATOM   2726 C  CA    . LEU C 3 277 ? 49.769 66.386  36.071  1.00 55.34 ? 283  LEU A CA    1 
ATOM   2727 C  C     . LEU C 3 277 ? 50.326 65.551  34.920  1.00 55.48 ? 283  LEU A C     1 
ATOM   2728 O  O     . LEU C 3 277 ? 50.370 66.004  33.774  1.00 55.91 ? 283  LEU A O     1 
ATOM   2729 C  CB    . LEU C 3 277 ? 49.323 67.758  35.563  1.00 55.03 ? 283  LEU A CB    1 
ATOM   2730 C  CG    . LEU C 3 277 ? 48.941 68.775  36.644  1.00 55.15 ? 283  LEU A CG    1 
ATOM   2731 C  CD1   . LEU C 3 277 ? 48.663 70.126  36.007  1.00 54.15 ? 283  LEU A CD1   1 
ATOM   2732 C  CD2   . LEU C 3 277 ? 47.719 68.278  37.404  1.00 54.71 ? 283  LEU A CD2   1 
ATOM   2733 N  N     . PRO C 3 278 ? 50.759 64.310  35.215  1.00 55.04 ? 284  PRO A N     1 
ATOM   2734 C  CA    . PRO C 3 278 ? 51.326 63.400  34.212  1.00 54.31 ? 284  PRO A CA    1 
ATOM   2735 C  C     . PRO C 3 278 ? 50.582 63.314  32.881  1.00 53.01 ? 284  PRO A C     1 
ATOM   2736 O  O     . PRO C 3 278 ? 51.146 62.847  31.890  1.00 52.54 ? 284  PRO A O     1 
ATOM   2737 C  CB    . PRO C 3 278 ? 51.388 62.055  34.951  1.00 54.22 ? 284  PRO A CB    1 
ATOM   2738 C  CG    . PRO C 3 278 ? 50.327 62.176  35.997  1.00 54.69 ? 284  PRO A CG    1 
ATOM   2739 C  CD    . PRO C 3 278 ? 50.516 63.592  36.479  1.00 54.91 ? 284  PRO A CD    1 
ATOM   2740 N  N     . LYS C 3 279 ? 49.330 63.763  32.854  1.00 51.07 ? 285  LYS A N     1 
ATOM   2741 C  CA    . LYS C 3 279 ? 48.554 63.735  31.621  1.00 50.42 ? 285  LYS A CA    1 
ATOM   2742 C  C     . LYS C 3 279 ? 49.034 64.840  30.678  1.00 50.70 ? 285  LYS A C     1 
ATOM   2743 O  O     . LYS C 3 279 ? 49.180 64.623  29.474  1.00 50.84 ? 285  LYS A O     1 
ATOM   2744 C  CB    . LYS C 3 279 ? 47.067 63.911  31.921  1.00 49.81 ? 285  LYS A CB    1 
ATOM   2745 N  N     . TYR C 3 280 ? 49.273 66.027  31.227  1.00 50.38 ? 286  TYR A N     1 
ATOM   2746 C  CA    . TYR C 3 280 ? 49.759 67.146  30.423  1.00 49.61 ? 286  TYR A CA    1 
ATOM   2747 C  C     . TYR C 3 280 ? 51.089 66.757  29.793  1.00 48.65 ? 286  TYR A C     1 
ATOM   2748 O  O     . TYR C 3 280 ? 51.871 66.019  30.390  1.00 48.37 ? 286  TYR A O     1 
ATOM   2749 C  CB    . TYR C 3 280 ? 49.968 68.395  31.292  1.00 49.51 ? 286  TYR A CB    1 
ATOM   2750 C  CG    . TYR C 3 280 ? 48.766 69.309  31.388  1.00 50.41 ? 286  TYR A CG    1 
ATOM   2751 C  CD1   . TYR C 3 280 ? 48.343 70.058  30.290  1.00 50.76 ? 286  TYR A CD1   1 
ATOM   2752 C  CD2   . TYR C 3 280 ? 48.051 69.424  32.576  1.00 51.57 ? 286  TYR A CD2   1 
ATOM   2753 C  CE1   . TYR C 3 280 ? 47.235 70.900  30.374  1.00 50.90 ? 286  TYR A CE1   1 
ATOM   2754 C  CE2   . TYR C 3 280 ? 46.942 70.262  32.671  1.00 52.20 ? 286  TYR A CE2   1 
ATOM   2755 C  CZ    . TYR C 3 280 ? 46.540 70.996  31.568  1.00 51.38 ? 286  TYR A CZ    1 
ATOM   2756 O  OH    . TYR C 3 280 ? 45.439 71.817  31.667  1.00 51.70 ? 286  TYR A OH    1 
ATOM   2757 N  N     . PRO C 3 281 ? 51.361 67.247  28.575  1.00 47.76 ? 287  PRO A N     1 
ATOM   2758 C  CA    . PRO C 3 281 ? 52.622 66.926  27.900  1.00 47.61 ? 287  PRO A CA    1 
ATOM   2759 C  C     . PRO C 3 281 ? 53.802 67.325  28.788  1.00 48.20 ? 287  PRO A C     1 
ATOM   2760 O  O     . PRO C 3 281 ? 53.709 68.288  29.555  1.00 46.78 ? 287  PRO A O     1 
ATOM   2761 C  CB    . PRO C 3 281 ? 52.555 67.771  26.628  1.00 47.18 ? 287  PRO A CB    1 
ATOM   2762 C  CG    . PRO C 3 281 ? 51.079 67.876  26.364  1.00 46.52 ? 287  PRO A CG    1 
ATOM   2763 C  CD    . PRO C 3 281 ? 50.525 68.129  27.740  1.00 46.43 ? 287  PRO A CD    1 
ATOM   2764 N  N     . ARG C 3 282 ? 54.906 66.587  28.698  1.00 48.87 ? 288  ARG A N     1 
ATOM   2765 C  CA    . ARG C 3 282 ? 56.079 66.915  29.501  1.00 49.43 ? 288  ARG A CA    1 
ATOM   2766 C  C     . ARG C 3 282 ? 56.649 68.234  28.989  1.00 49.07 ? 288  ARG A C     1 
ATOM   2767 O  O     . ARG C 3 282 ? 56.568 68.532  27.797  1.00 49.53 ? 288  ARG A O     1 
ATOM   2768 C  CB    . ARG C 3 282 ? 57.126 65.800  29.406  1.00 50.15 ? 288  ARG A CB    1 
ATOM   2769 C  CG    . ARG C 3 282 ? 56.645 64.472  29.971  1.00 52.92 ? 288  ARG A CG    1 
ATOM   2770 C  CD    . ARG C 3 282 ? 56.325 64.582  31.462  1.00 55.61 ? 288  ARG A CD    1 
ATOM   2771 N  NE    . ARG C 3 282 ? 55.302 63.626  31.887  1.00 57.23 ? 288  ARG A NE    1 
ATOM   2772 C  CZ    . ARG C 3 282 ? 55.425 62.303  31.815  1.00 59.09 ? 288  ARG A CZ    1 
ATOM   2773 N  NH1   . ARG C 3 282 ? 56.538 61.760  31.333  1.00 59.41 ? 288  ARG A NH1   1 
ATOM   2774 N  NH2   . ARG C 3 282 ? 54.426 61.519  32.214  1.00 60.02 ? 288  ARG A NH2   1 
ATOM   2775 N  N     . ILE C 3 283 ? 57.218 69.026  29.890  1.00 47.87 ? 289  ILE A N     1 
ATOM   2776 C  CA    . ILE C 3 283 ? 57.768 70.319  29.507  1.00 47.67 ? 289  ILE A CA    1 
ATOM   2777 C  C     . ILE C 3 283 ? 59.265 70.427  29.746  1.00 47.56 ? 289  ILE A C     1 
ATOM   2778 O  O     . ILE C 3 283 ? 59.946 69.445  30.045  1.00 46.50 ? 289  ILE A O     1 
ATOM   2779 C  CB    . ILE C 3 283 ? 57.106 71.459  30.296  1.00 47.86 ? 289  ILE A CB    1 
ATOM   2780 C  CG1   . ILE C 3 283 ? 57.503 71.355  31.773  1.00 47.58 ? 289  ILE A CG1   1 
ATOM   2781 C  CG2   . ILE C 3 283 ? 55.599 71.388  30.145  1.00 46.61 ? 289  ILE A CG2   1 
ATOM   2782 C  CD1   . ILE C 3 283 ? 57.118 72.558  32.605  1.00 48.29 ? 289  ILE A CD1   1 
ATOM   2783 N  N     . LYS C 3 284 ? 59.762 71.648  29.605  1.00 47.71 ? 290  LYS A N     1 
ATOM   2784 C  CA    . LYS C 3 284 ? 61.163 71.945  29.823  1.00 49.67 ? 290  LYS A CA    1 
ATOM   2785 C  C     . LYS C 3 284 ? 61.260 73.331  30.451  1.00 50.32 ? 290  LYS A C     1 
ATOM   2786 O  O     . LYS C 3 284 ? 60.613 74.278  29.999  1.00 51.71 ? 290  LYS A O     1 
ATOM   2787 C  CB    . LYS C 3 284 ? 61.937 71.904  28.505  1.00 49.70 ? 290  LYS A CB    1 
ATOM   2788 C  CG    . LYS C 3 284 ? 63.366 72.384  28.650  1.00 51.26 ? 290  LYS A CG    1 
ATOM   2789 C  CD    . LYS C 3 284 ? 64.179 72.197  27.385  1.00 51.46 ? 290  LYS A CD    1 
ATOM   2790 C  CE    . LYS C 3 284 ? 65.554 72.843  27.545  1.00 52.97 ? 290  LYS A CE    1 
ATOM   2791 N  NZ    . LYS C 3 284 ? 66.257 72.404  28.797  1.00 50.90 ? 290  LYS A NZ    1 
ATOM   2792 N  N     . THR C 3 285 ? 62.054 73.440  31.507  1.00 50.91 ? 291  THR A N     1 
ATOM   2793 C  CA    . THR C 3 285 ? 62.226 74.709  32.195  1.00 51.62 ? 291  THR A CA    1 
ATOM   2794 C  C     . THR C 3 285 ? 63.667 75.172  32.009  1.00 52.74 ? 291  THR A C     1 
ATOM   2795 O  O     . THR C 3 285 ? 64.560 74.769  32.751  1.00 52.29 ? 291  THR A O     1 
ATOM   2796 C  CB    . THR C 3 285 ? 61.917 74.560  33.697  1.00 51.12 ? 291  THR A CB    1 
ATOM   2797 O  OG1   . THR C 3 285 ? 60.623 73.960  33.858  1.00 49.60 ? 291  THR A OG1   1 
ATOM   2798 C  CG2   . THR C 3 285 ? 61.926 75.914  34.382  1.00 50.48 ? 291  THR A CG2   1 
ATOM   2799 N  N     . PRO C 3 286 ? 63.909 76.032  31.008  1.00 54.05 ? 292  PRO A N     1 
ATOM   2800 C  CA    . PRO C 3 286 ? 65.258 76.537  30.738  1.00 55.08 ? 292  PRO A CA    1 
ATOM   2801 C  C     . PRO C 3 286 ? 65.972 77.030  31.990  1.00 56.16 ? 292  PRO A C     1 
ATOM   2802 O  O     . PRO C 3 286 ? 65.417 77.804  32.775  1.00 55.56 ? 292  PRO A O     1 
ATOM   2803 C  CB    . PRO C 3 286 ? 65.011 77.655  29.724  1.00 54.88 ? 292  PRO A CB    1 
ATOM   2804 C  CG    . PRO C 3 286 ? 63.634 78.128  30.071  1.00 54.22 ? 292  PRO A CG    1 
ATOM   2805 C  CD    . PRO C 3 286 ? 62.906 76.825  30.278  1.00 54.04 ? 292  PRO A CD    1 
ATOM   2806 N  N     . LYS C 3 287 ? 67.205 76.564  32.171  1.00 57.25 ? 293  LYS A N     1 
ATOM   2807 C  CA    . LYS C 3 287 ? 68.010 76.948  33.323  1.00 57.98 ? 293  LYS A CA    1 
ATOM   2808 C  C     . LYS C 3 287 ? 68.520 78.370  33.139  1.00 58.25 ? 293  LYS A C     1 
ATOM   2809 O  O     . LYS C 3 287 ? 68.314 79.224  34.002  1.00 59.10 ? 293  LYS A O     1 
ATOM   2810 C  CB    . LYS C 3 287 ? 69.192 75.988  33.491  1.00 57.77 ? 293  LYS A CB    1 
ATOM   2811 N  N     . VAL C 3 288 ? 69.177 78.621  32.009  1.00 58.13 ? 294  VAL A N     1 
ATOM   2812 C  CA    . VAL C 3 288 ? 69.718 79.945  31.709  1.00 58.30 ? 294  VAL A CA    1 
ATOM   2813 C  C     . VAL C 3 288 ? 68.787 80.731  30.784  1.00 57.86 ? 294  VAL A C     1 
ATOM   2814 O  O     . VAL C 3 288 ? 68.104 80.150  29.942  1.00 58.42 ? 294  VAL A O     1 
ATOM   2815 C  CB    . VAL C 3 288 ? 71.112 79.841  31.036  1.00 59.27 ? 294  VAL A CB    1 
ATOM   2816 C  CG1   . VAL C 3 288 ? 72.090 79.130  31.963  1.00 59.70 ? 294  VAL A CG1   1 
ATOM   2817 C  CG2   . VAL C 3 288 ? 71.001 79.093  29.713  1.00 59.06 ? 294  VAL A CG2   1 
ATOM   2818 N  N     . GLY C 3 289 ? 68.761 82.052  30.944  1.00 57.31 ? 295  GLY A N     1 
ATOM   2819 C  CA    . GLY C 3 289 ? 67.916 82.883  30.103  1.00 56.48 ? 295  GLY A CA    1 
ATOM   2820 C  C     . GLY C 3 289 ? 67.310 84.075  30.823  1.00 55.79 ? 295  GLY A C     1 
ATOM   2821 O  O     . GLY C 3 289 ? 66.836 83.949  31.954  1.00 55.25 ? 295  GLY A O     1 
ATOM   2822 N  N     . GLY C 3 290 ? 67.318 85.235  30.170  1.00 55.32 ? 296  GLY A N     1 
ATOM   2823 C  CA    . GLY C 3 290 ? 66.753 86.422  30.788  1.00 55.39 ? 296  GLY A CA    1 
ATOM   2824 C  C     . GLY C 3 290 ? 66.372 87.546  29.840  1.00 55.66 ? 296  GLY A C     1 
ATOM   2825 O  O     . GLY C 3 290 ? 66.608 87.477  28.631  1.00 55.74 ? 296  GLY A O     1 
ATOM   2826 N  N     . ILE C 3 291 ? 65.771 88.590  30.403  1.00 55.69 ? 297  ILE A N     1 
ATOM   2827 C  CA    . ILE C 3 291 ? 65.354 89.759  29.638  1.00 55.15 ? 297  ILE A CA    1 
ATOM   2828 C  C     . ILE C 3 291 ? 66.440 90.828  29.688  1.00 55.58 ? 297  ILE A C     1 
ATOM   2829 O  O     . ILE C 3 291 ? 67.413 90.686  28.918  1.00 56.21 ? 297  ILE A O     1 
ATOM   2830 C  CB    . ILE C 3 291 ? 64.048 90.360  30.203  1.00 55.37 ? 297  ILE A CB    1 
ATOM   2831 C  CG1   . ILE C 3 291 ? 62.889 89.382  29.990  1.00 54.50 ? 297  ILE A CG1   1 
ATOM   2832 C  CG2   . ILE C 3 291 ? 63.759 91.702  29.539  1.00 54.56 ? 297  ILE A CG2   1 
ATOM   2833 N  N     . ASP C 3 310 ? 69.614 90.869  25.998  1.00 54.19 ? 316  ASP A N     1 
ATOM   2834 C  CA    . ASP C 3 310 ? 69.622 89.380  25.873  1.00 55.47 ? 316  ASP A CA    1 
ATOM   2835 C  C     . ASP C 3 310 ? 68.585 88.941  24.843  1.00 55.95 ? 316  ASP A C     1 
ATOM   2836 O  O     . ASP C 3 310 ? 67.414 88.728  25.174  1.00 55.90 ? 316  ASP A O     1 
ATOM   2837 C  CB    . ASP C 3 310 ? 69.309 88.727  27.227  1.00 54.42 ? 316  ASP A CB    1 
ATOM   2838 C  CG    . ASP C 3 310 ? 69.409 87.207  27.182  1.00 53.97 ? 316  ASP A CG    1 
ATOM   2839 O  OD1   . ASP C 3 310 ? 69.083 86.552  28.198  1.00 52.45 ? 316  ASP A OD1   1 
ATOM   2840 O  OD2   . ASP C 3 310 ? 69.817 86.668  26.129  1.00 53.56 ? 316  ASP A OD2   1 
ATOM   2841 N  N     . THR C 3 311 ? 69.020 88.806  23.594  1.00 56.19 ? 317  THR A N     1 
ATOM   2842 C  CA    . THR C 3 311 ? 68.116 88.405  22.524  1.00 55.93 ? 317  THR A CA    1 
ATOM   2843 C  C     . THR C 3 311 ? 67.882 86.900  22.487  1.00 56.05 ? 317  THR A C     1 
ATOM   2844 O  O     . THR C 3 311 ? 67.403 86.365  21.488  1.00 56.89 ? 317  THR A O     1 
ATOM   2845 C  CB    . THR C 3 311 ? 68.631 88.867  21.140  1.00 56.51 ? 317  THR A CB    1 
ATOM   2846 O  OG1   . THR C 3 311 ? 69.983 88.423  20.953  1.00 57.42 ? 317  THR A OG1   1 
ATOM   2847 C  CG2   . THR C 3 311 ? 68.567 90.387  21.027  1.00 56.51 ? 317  THR A CG2   1 
ATOM   2848 N  N     . ARG C 3 312 ? 68.230 86.212  23.568  1.00 55.50 ? 318  ARG A N     1 
ATOM   2849 C  CA    . ARG C 3 312 ? 67.999 84.776  23.629  1.00 55.02 ? 318  ARG A CA    1 
ATOM   2850 C  C     . ARG C 3 312 ? 66.480 84.637  23.698  1.00 55.02 ? 318  ARG A C     1 
ATOM   2851 O  O     . ARG C 3 312 ? 65.797 85.540  24.182  1.00 54.31 ? 318  ARG A O     1 
ATOM   2852 C  CB    . ARG C 3 312 ? 68.650 84.177  24.879  1.00 54.42 ? 318  ARG A CB    1 
ATOM   2853 N  N     . GLU C 3 313 ? 65.944 83.521  23.217  1.00 55.19 ? 319  GLU A N     1 
ATOM   2854 C  CA    . GLU C 3 313 ? 64.499 83.334  23.230  1.00 55.42 ? 319  GLU A CA    1 
ATOM   2855 C  C     . GLU C 3 313 ? 63.950 82.768  24.536  1.00 54.80 ? 319  GLU A C     1 
ATOM   2856 O  O     . GLU C 3 313 ? 62.760 82.917  24.826  1.00 53.57 ? 319  GLU A O     1 
ATOM   2857 C  CB    . GLU C 3 313 ? 64.067 82.430  22.073  1.00 57.05 ? 319  GLU A CB    1 
ATOM   2858 C  CG    . GLU C 3 313 ? 64.466 80.970  22.232  1.00 60.42 ? 319  GLU A CG    1 
ATOM   2859 C  CD    . GLU C 3 313 ? 65.954 80.736  22.034  1.00 62.45 ? 319  GLU A CD    1 
ATOM   2860 O  OE1   . GLU C 3 313 ? 66.768 81.329  22.778  1.00 62.86 ? 319  GLU A OE1   1 
ATOM   2861 O  OE2   . GLU C 3 313 ? 66.310 79.951  21.129  1.00 63.26 ? 319  GLU A OE2   1 
ATOM   2862 N  N     . TYR C 3 314 ? 64.809 82.131  25.327  1.00 53.99 ? 320  TYR A N     1 
ATOM   2863 C  CA    . TYR C 3 314 ? 64.363 81.536  26.581  1.00 53.92 ? 320  TYR A CA    1 
ATOM   2864 C  C     . TYR C 3 314 ? 64.610 82.383  27.824  1.00 53.84 ? 320  TYR A C     1 
ATOM   2865 O  O     . TYR C 3 314 ? 65.501 83.236  27.857  1.00 53.85 ? 320  TYR A O     1 
ATOM   2866 C  CB    . TYR C 3 314 ? 65.000 80.155  26.761  1.00 54.60 ? 320  TYR A CB    1 
ATOM   2867 C  CG    . TYR C 3 314 ? 64.606 79.172  25.683  1.00 55.51 ? 320  TYR A CG    1 
ATOM   2868 C  CD1   . TYR C 3 314 ? 63.264 78.904  25.420  1.00 56.79 ? 320  TYR A CD1   1 
ATOM   2869 C  CD2   . TYR C 3 314 ? 65.571 78.517  24.917  1.00 57.17 ? 320  TYR A CD2   1 
ATOM   2870 C  CE1   . TYR C 3 314 ? 62.887 78.005  24.415  1.00 58.53 ? 320  TYR A CE1   1 
ATOM   2871 C  CE2   . TYR C 3 314 ? 65.208 77.613  23.909  1.00 58.11 ? 320  TYR A CE2   1 
ATOM   2872 C  CZ    . TYR C 3 314 ? 63.862 77.362  23.663  1.00 58.68 ? 320  TYR A CZ    1 
ATOM   2873 O  OH    . TYR C 3 314 ? 63.488 76.479  22.670  1.00 57.95 ? 320  TYR A OH    1 
ATOM   2874 N  N     . VAL C 3 315 ? 63.798 82.134  28.847  1.00 52.86 ? 321  VAL A N     1 
ATOM   2875 C  CA    . VAL C 3 315 ? 63.892 82.848  30.112  1.00 51.80 ? 321  VAL A CA    1 
ATOM   2876 C  C     . VAL C 3 315 ? 63.959 81.846  31.254  1.00 51.58 ? 321  VAL A C     1 
ATOM   2877 O  O     . VAL C 3 315 ? 63.021 81.076  31.471  1.00 50.61 ? 321  VAL A O     1 
ATOM   2878 C  CB    . VAL C 3 315 ? 62.671 83.765  30.329  1.00 52.07 ? 321  VAL A CB    1 
ATOM   2879 C  CG1   . VAL C 3 315 ? 62.752 84.430  31.694  1.00 51.50 ? 321  VAL A CG1   1 
ATOM   2880 C  CG2   . VAL C 3 315 ? 62.613 84.816  29.231  1.00 52.05 ? 321  VAL A CG2   1 
ATOM   2881 N  N     . ALA C 3 316 ? 65.076 81.859  31.977  1.00 50.93 ? 322  ALA A N     1 
ATOM   2882 C  CA    . ALA C 3 316 ? 65.282 80.956  33.103  1.00 49.13 ? 322  ALA A CA    1 
ATOM   2883 C  C     . ALA C 3 316 ? 64.030 80.875  33.973  1.00 48.52 ? 322  ALA A C     1 
ATOM   2884 O  O     . ALA C 3 316 ? 63.494 81.903  34.403  1.00 47.63 ? 322  ALA A O     1 
ATOM   2885 C  CB    . ALA C 3 316 ? 66.464 81.431  33.932  1.00 48.89 ? 322  ALA A CB    1 
ATOM   2886 N  N     . GLY C 3 317 ? 63.563 79.652  34.218  1.00 46.76 ? 323  GLY A N     1 
ATOM   2887 C  CA    . GLY C 3 317 ? 62.382 79.465  35.042  1.00 45.43 ? 323  GLY A CA    1 
ATOM   2888 C  C     . GLY C 3 317 ? 61.058 79.582  34.306  1.00 45.99 ? 323  GLY A C     1 
ATOM   2889 O  O     . GLY C 3 317 ? 60.016 79.199  34.843  1.00 45.76 ? 323  GLY A O     1 
ATOM   2890 N  N     . ALA C 3 318 ? 61.083 80.124  33.090  1.00 45.63 ? 324  ALA A N     1 
ATOM   2891 C  CA    . ALA C 3 318 ? 59.865 80.266  32.290  1.00 44.42 ? 324  ALA A CA    1 
ATOM   2892 C  C     . ALA C 3 318 ? 59.680 78.981  31.474  1.00 43.13 ? 324  ALA A C     1 
ATOM   2893 O  O     . ALA C 3 318 ? 60.323 78.791  30.442  1.00 41.98 ? 324  ALA A O     1 
ATOM   2894 C  CB    . ALA C 3 318 ? 59.983 81.474  31.369  1.00 45.71 ? 324  ALA A CB    1 
ATOM   2895 N  N     . PRO C 3 319 ? 58.788 78.088  31.935  1.00 41.95 ? 325  PRO A N     1 
ATOM   2896 C  CA    . PRO C 3 319 ? 58.470 76.799  31.316  1.00 41.69 ? 325  PRO A CA    1 
ATOM   2897 C  C     . PRO C 3 319 ? 57.669 76.849  30.015  1.00 42.15 ? 325  PRO A C     1 
ATOM   2898 O  O     . PRO C 3 319 ? 56.804 77.711  29.831  1.00 40.92 ? 325  PRO A O     1 
ATOM   2899 C  CB    . PRO C 3 319 ? 57.702 76.089  32.418  1.00 42.04 ? 325  PRO A CB    1 
ATOM   2900 C  CG    . PRO C 3 319 ? 56.887 77.211  32.979  1.00 41.22 ? 325  PRO A CG    1 
ATOM   2901 C  CD    . PRO C 3 319 ? 57.921 78.319  33.107  1.00 41.74 ? 325  PRO A CD    1 
ATOM   2902 N  N     . TYR C 3 320 ? 57.966 75.907  29.121  1.00 41.96 ? 326  TYR A N     1 
ATOM   2903 C  CA    . TYR C 3 320 ? 57.277 75.803  27.841  1.00 41.72 ? 326  TYR A CA    1 
ATOM   2904 C  C     . TYR C 3 320 ? 57.198 74.345  27.430  1.00 40.69 ? 326  TYR A C     1 
ATOM   2905 O  O     . TYR C 3 320 ? 57.916 73.502  27.970  1.00 41.28 ? 326  TYR A O     1 
ATOM   2906 C  CB    . TYR C 3 320 ? 58.005 76.591  26.751  1.00 43.11 ? 326  TYR A CB    1 
ATOM   2907 C  CG    . TYR C 3 320 ? 59.372 76.054  26.407  1.00 44.87 ? 326  TYR A CG    1 
ATOM   2908 C  CD1   . TYR C 3 320 ? 60.482 76.366  27.192  1.00 45.57 ? 326  TYR A CD1   1 
ATOM   2909 C  CD2   . TYR C 3 320 ? 59.559 75.235  25.297  1.00 44.41 ? 326  TYR A CD2   1 
ATOM   2910 C  CE1   . TYR C 3 320 ? 61.744 75.876  26.880  1.00 45.89 ? 326  TYR A CE1   1 
ATOM   2911 C  CE2   . TYR C 3 320 ? 60.818 74.740  24.977  1.00 46.83 ? 326  TYR A CE2   1 
ATOM   2912 C  CZ    . TYR C 3 320 ? 61.906 75.067  25.774  1.00 47.00 ? 326  TYR A CZ    1 
ATOM   2913 O  OH    . TYR C 3 320 ? 63.159 74.587  25.466  1.00 48.86 ? 326  TYR A OH    1 
ATOM   2914 N  N     . THR C 3 321 ? 56.326 74.053  26.471  1.00 39.95 ? 327  THR A N     1 
ATOM   2915 C  CA    . THR C 3 321 ? 56.149 72.690  25.993  1.00 38.97 ? 327  THR A CA    1 
ATOM   2916 C  C     . THR C 3 321 ? 56.829 72.470  24.652  1.00 39.61 ? 327  THR A C     1 
ATOM   2917 O  O     . THR C 3 321 ? 56.430 73.054  23.644  1.00 39.86 ? 327  THR A O     1 
ATOM   2918 C  CB    . THR C 3 321 ? 54.656 72.333  25.828  1.00 38.28 ? 327  THR A CB    1 
ATOM   2919 O  OG1   . THR C 3 321 ? 53.972 72.510  27.074  1.00 37.39 ? 327  THR A OG1   1 
ATOM   2920 C  CG2   . THR C 3 321 ? 54.507 70.883  25.378  1.00 37.36 ? 327  THR A CG2   1 
ATOM   2921 N  N     . PRO C 3 322 ? 57.882 71.635  24.627  1.00 39.79 ? 328  PRO A N     1 
ATOM   2922 C  CA    . PRO C 3 322 ? 58.606 71.342  23.386  1.00 39.55 ? 328  PRO A CA    1 
ATOM   2923 C  C     . PRO C 3 322 ? 57.651 70.632  22.424  1.00 38.34 ? 328  PRO A C     1 
ATOM   2924 O  O     . PRO C 3 322 ? 56.954 69.704  22.817  1.00 38.89 ? 328  PRO A O     1 
ATOM   2925 C  CB    . PRO C 3 322 ? 59.734 70.425  23.857  1.00 39.91 ? 328  PRO A CB    1 
ATOM   2926 C  CG    . PRO C 3 322 ? 59.978 70.883  25.256  1.00 39.70 ? 328  PRO A CG    1 
ATOM   2927 C  CD    . PRO C 3 322 ? 58.579 71.051  25.786  1.00 39.75 ? 328  PRO A CD    1 
ATOM   2928 N  N     . VAL C 3 323 ? 57.608 71.067  21.174  1.00 38.07 ? 329  VAL A N     1 
ATOM   2929 C  CA    . VAL C 3 323 ? 56.711 70.448  20.201  1.00 38.03 ? 329  VAL A CA    1 
ATOM   2930 C  C     . VAL C 3 323 ? 57.419 70.170  18.881  1.00 38.15 ? 329  VAL A C     1 
ATOM   2931 O  O     . VAL C 3 323 ? 58.550 70.604  18.664  1.00 37.38 ? 329  VAL A O     1 
ATOM   2932 C  CB    . VAL C 3 323 ? 55.492 71.360  19.907  1.00 38.66 ? 329  VAL A CB    1 
ATOM   2933 C  CG1   . VAL C 3 323 ? 54.641 71.533  21.158  1.00 37.20 ? 329  VAL A CG1   1 
ATOM   2934 C  CG2   . VAL C 3 323 ? 55.977 72.723  19.410  1.00 38.07 ? 329  VAL A CG2   1 
ATOM   2935 N  N     . GLU C 3 324 ? 56.742 69.437  18.002  1.00 38.92 ? 330  GLU A N     1 
ATOM   2936 C  CA    . GLU C 3 324 ? 57.281 69.122  16.688  1.00 38.67 ? 330  GLU A CA    1 
ATOM   2937 C  C     . GLU C 3 324 ? 56.138 69.240  15.687  1.00 38.02 ? 330  GLU A C     1 
ATOM   2938 O  O     . GLU C 3 324 ? 54.972 69.041  16.035  1.00 36.65 ? 330  GLU A O     1 
ATOM   2939 C  CB    . GLU C 3 324 ? 57.865 67.699  16.654  1.00 40.35 ? 330  GLU A CB    1 
ATOM   2940 C  CG    . GLU C 3 324 ? 56.863 66.597  16.293  1.00 42.70 ? 330  GLU A CG    1 
ATOM   2941 C  CD    . GLU C 3 324 ? 57.507 65.217  16.195  1.00 44.90 ? 330  GLU A CD    1 
ATOM   2942 O  OE1   . GLU C 3 324 ? 58.590 65.103  15.577  1.00 45.40 ? 330  GLU A OE1   1 
ATOM   2943 O  OE2   . GLU C 3 324 ? 56.923 64.243  16.727  1.00 45.89 ? 330  GLU A OE2   1 
ATOM   2944 N  N     . HIS C 3 325 ? 56.474 69.576  14.448  1.00 38.19 ? 331  HIS A N     1 
ATOM   2945 C  CA    . HIS C 3 325 ? 55.472 69.713  13.399  1.00 38.28 ? 331  HIS A CA    1 
ATOM   2946 C  C     . HIS C 3 325 ? 55.364 68.372  12.670  1.00 37.45 ? 331  HIS A C     1 
ATOM   2947 O  O     . HIS C 3 325 ? 56.374 67.817  12.248  1.00 36.80 ? 331  HIS A O     1 
ATOM   2948 C  CB    . HIS C 3 325 ? 55.899 70.804  12.416  1.00 39.44 ? 331  HIS A CB    1 
ATOM   2949 C  CG    . HIS C 3 325 ? 54.827 71.201  11.453  1.00 39.99 ? 331  HIS A CG    1 
ATOM   2950 N  ND1   . HIS C 3 325 ? 55.101 71.653  10.181  1.00 41.11 ? 331  HIS A ND1   1 
ATOM   2951 C  CD2   . HIS C 3 325 ? 53.479 71.228  11.580  1.00 40.53 ? 331  HIS A CD2   1 
ATOM   2952 C  CE1   . HIS C 3 325 ? 53.968 71.939  9.564   1.00 41.23 ? 331  HIS A CE1   1 
ATOM   2953 N  NE2   . HIS C 3 325 ? 52.969 71.690  10.391  1.00 42.46 ? 331  HIS A NE2   1 
ATOM   2954 N  N     . VAL C 3 326 ? 54.152 67.845  12.521  1.00 37.36 ? 332  VAL A N     1 
ATOM   2955 C  CA    . VAL C 3 326 ? 53.994 66.564  11.840  1.00 36.67 ? 332  VAL A CA    1 
ATOM   2956 C  C     . VAL C 3 326 ? 53.048 66.622  10.641  1.00 35.92 ? 332  VAL A C     1 
ATOM   2957 O  O     . VAL C 3 326 ? 51.935 67.135  10.735  1.00 35.09 ? 332  VAL A O     1 
ATOM   2958 C  CB    . VAL C 3 326 ? 53.504 65.467  12.819  1.00 38.93 ? 332  VAL A CB    1 
ATOM   2959 C  CG1   . VAL C 3 326 ? 54.418 65.414  14.042  1.00 39.33 ? 332  VAL A CG1   1 
ATOM   2960 C  CG2   . VAL C 3 326 ? 52.081 65.738  13.242  1.00 39.46 ? 332  VAL A CG2   1 
ATOM   2961 N  N     . VAL C 3 327 ? 53.511 66.096  9.511   1.00 34.97 ? 333  VAL A N     1 
ATOM   2962 C  CA    . VAL C 3 327 ? 52.728 66.068  8.281   1.00 33.78 ? 333  VAL A CA    1 
ATOM   2963 C  C     . VAL C 3 327 ? 51.918 64.776  8.215   1.00 33.87 ? 333  VAL A C     1 
ATOM   2964 O  O     . VAL C 3 327 ? 52.357 63.731  8.697   1.00 35.07 ? 333  VAL A O     1 
ATOM   2965 C  CB    . VAL C 3 327 ? 53.654 66.164  7.050   1.00 34.57 ? 333  VAL A CB    1 
ATOM   2966 C  CG1   . VAL C 3 327 ? 52.848 66.062  5.760   1.00 35.90 ? 333  VAL A CG1   1 
ATOM   2967 C  CG2   . VAL C 3 327 ? 54.412 67.480  7.090   1.00 36.01 ? 333  VAL A CG2   1 
ATOM   2968 N  N     . PHE C 3 328 ? 50.733 64.846  7.623   1.00 32.79 ? 334  PHE A N     1 
ATOM   2969 C  CA    . PHE C 3 328 ? 49.871 63.679  7.513   1.00 32.49 ? 334  PHE A CA    1 
ATOM   2970 C  C     . PHE C 3 328 ? 50.542 62.549  6.734   1.00 32.80 ? 334  PHE A C     1 
ATOM   2971 O  O     . PHE C 3 328 ? 51.008 62.746  5.612   1.00 32.55 ? 334  PHE A O     1 
ATOM   2972 C  CB    . PHE C 3 328 ? 48.558 64.056  6.831   1.00 29.90 ? 334  PHE A CB    1 
ATOM   2973 C  CG    . PHE C 3 328 ? 47.585 62.915  6.705   1.00 31.15 ? 334  PHE A CG    1 
ATOM   2974 C  CD1   . PHE C 3 328 ? 46.836 62.498  7.797   1.00 29.13 ? 334  PHE A CD1   1 
ATOM   2975 C  CD2   . PHE C 3 328 ? 47.403 62.265  5.480   1.00 30.17 ? 334  PHE A CD2   1 
ATOM   2976 C  CE1   . PHE C 3 328 ? 45.913 61.451  7.673   1.00 30.04 ? 334  PHE A CE1   1 
ATOM   2977 C  CE2   . PHE C 3 328 ? 46.486 61.219  5.347   1.00 30.15 ? 334  PHE A CE2   1 
ATOM   2978 C  CZ    . PHE C 3 328 ? 45.738 60.812  6.444   1.00 28.30 ? 334  PHE A CZ    1 
ATOM   2979 N  N     . ASN C 3 329 ? 50.586 61.370  7.350   1.00 34.16 ? 335  ASN A N     1 
ATOM   2980 C  CA    . ASN C 3 329 ? 51.179 60.180  6.744   1.00 33.82 ? 335  ASN A CA    1 
ATOM   2981 C  C     . ASN C 3 329 ? 50.084 59.129  6.553   1.00 33.35 ? 335  ASN A C     1 
ATOM   2982 O  O     . ASN C 3 329 ? 49.597 58.550  7.522   1.00 31.90 ? 335  ASN A O     1 
ATOM   2983 C  CB    . ASN C 3 329 ? 52.267 59.604  7.654   1.00 35.04 ? 335  ASN A CB    1 
ATOM   2984 C  CG    . ASN C 3 329 ? 52.950 58.375  7.056   1.00 35.53 ? 335  ASN A CG    1 
ATOM   2985 O  OD1   . ASN C 3 329 ? 52.406 57.704  6.179   1.00 34.88 ? 335  ASN A OD1   1 
ATOM   2986 N  ND2   . ASN C 3 329 ? 54.144 58.071  7.548   1.00 35.53 ? 335  ASN A ND2   1 
ATOM   2987 N  N     . PRO C 3 330 ? 49.685 58.876  5.297   1.00 32.77 ? 336  PRO A N     1 
ATOM   2988 C  CA    . PRO C 3 330 ? 48.648 57.895  4.947   1.00 32.61 ? 336  PRO A CA    1 
ATOM   2989 C  C     . PRO C 3 330 ? 49.017 56.469  5.383   1.00 32.34 ? 336  PRO A C     1 
ATOM   2990 O  O     . PRO C 3 330 ? 48.145 55.603  5.503   1.00 32.73 ? 336  PRO A O     1 
ATOM   2991 C  CB    . PRO C 3 330 ? 48.544 58.027  3.428   1.00 32.73 ? 336  PRO A CB    1 
ATOM   2992 C  CG    . PRO C 3 330 ? 48.932 59.450  3.188   1.00 34.93 ? 336  PRO A CG    1 
ATOM   2993 C  CD    . PRO C 3 330 ? 50.117 59.624  4.106   1.00 32.75 ? 336  PRO A CD    1 
ATOM   2994 N  N     . SER C 3 331 ? 50.303 56.224  5.614   1.00 30.33 ? 337  SER A N     1 
ATOM   2995 C  CA    . SER C 3 331 ? 50.736 54.902  6.067   1.00 33.13 ? 337  SER A CA    1 
ATOM   2996 C  C     . SER C 3 331 ? 50.644 54.779  7.588   1.00 33.28 ? 337  SER A C     1 
ATOM   2997 O  O     . SER C 3 331 ? 51.089 53.790  8.161   1.00 33.87 ? 337  SER A O     1 
ATOM   2998 C  CB    . SER C 3 331 ? 52.177 54.614  5.629   1.00 32.33 ? 337  SER A CB    1 
ATOM   2999 O  OG    . SER C 3 331 ? 52.220 54.132  4.300   1.00 34.41 ? 337  SER A OG    1 
ATOM   3000 N  N     . SER C 3 332 ? 50.072 55.785  8.239   1.00 33.80 ? 338  SER A N     1 
ATOM   3001 C  CA    . SER C 3 332 ? 49.940 55.767  9.691   1.00 34.72 ? 338  SER A CA    1 
ATOM   3002 C  C     . SER C 3 332 ? 48.497 55.572  10.120  1.00 35.13 ? 338  SER A C     1 
ATOM   3003 O  O     . SER C 3 332 ? 47.681 56.486  10.005  1.00 35.91 ? 338  SER A O     1 
ATOM   3004 C  CB    . SER C 3 332 ? 50.483 57.072  10.287  1.00 33.87 ? 338  SER A CB    1 
ATOM   3005 O  OG    . SER C 3 332 ? 50.149 57.183  11.656  1.00 31.94 ? 338  SER A OG    1 
ATOM   3006 N  N     . ARG C 3 333 ? 48.186 54.376  10.609  1.00 36.72 ? 339  ARG A N     1 
ATOM   3007 C  CA    . ARG C 3 333 ? 46.839 54.060  11.060  1.00 39.12 ? 339  ARG A CA    1 
ATOM   3008 C  C     . ARG C 3 333 ? 46.449 55.055  12.154  1.00 39.76 ? 339  ARG A C     1 
ATOM   3009 O  O     . ARG C 3 333 ? 45.276 55.384  12.320  1.00 39.01 ? 339  ARG A O     1 
ATOM   3010 C  CB    . ARG C 3 333 ? 46.783 52.639  11.632  1.00 42.22 ? 339  ARG A CB    1 
ATOM   3011 C  CG    . ARG C 3 333 ? 47.461 51.552  10.788  1.00 45.82 ? 339  ARG A CG    1 
ATOM   3012 C  CD    . ARG C 3 333 ? 46.568 51.027  9.670   1.00 48.27 ? 339  ARG A CD    1 
ATOM   3013 N  NE    . ARG C 3 333 ? 47.228 49.975  8.893   1.00 49.46 ? 339  ARG A NE    1 
ATOM   3014 C  CZ    . ARG C 3 333 ? 46.710 49.411  7.803   1.00 50.18 ? 339  ARG A CZ    1 
ATOM   3015 N  NH1   . ARG C 3 333 ? 45.518 49.792  7.356   1.00 49.97 ? 339  ARG A NH1   1 
ATOM   3016 N  NH2   . ARG C 3 333 ? 47.389 48.476  7.150   1.00 49.78 ? 339  ARG A NH2   1 
ATOM   3017 N  N     . ASP C 3 334 ? 47.445 55.525  12.900  1.00 40.78 ? 340  ASP A N     1 
ATOM   3018 C  CA    . ASP C 3 334 ? 47.212 56.475  13.982  1.00 41.41 ? 340  ASP A CA    1 
ATOM   3019 C  C     . ASP C 3 334 ? 46.733 57.821  13.437  1.00 40.99 ? 340  ASP A C     1 
ATOM   3020 O  O     . ASP C 3 334 ? 45.713 58.343  13.889  1.00 41.02 ? 340  ASP A O     1 
ATOM   3021 C  CB    . ASP C 3 334 ? 48.488 56.671  14.805  1.00 44.44 ? 340  ASP A CB    1 
ATOM   3022 C  CG    . ASP C 3 334 ? 48.223 57.358  16.138  1.00 48.11 ? 340  ASP A CG    1 
ATOM   3023 O  OD1   . ASP C 3 334 ? 49.199 57.716  16.833  1.00 50.28 ? 340  ASP A OD1   1 
ATOM   3024 O  OD2   . ASP C 3 334 ? 47.038 57.536  16.498  1.00 49.26 ? 340  ASP A OD2   1 
ATOM   3025 N  N     . HIS C 3 335 ? 47.469 58.380  12.475  1.00 38.65 ? 341  HIS A N     1 
ATOM   3026 C  CA    . HIS C 3 335 ? 47.090 59.652  11.868  1.00 36.38 ? 341  HIS A CA    1 
ATOM   3027 C  C     . HIS C 3 335 ? 45.694 59.538  11.282  1.00 36.82 ? 341  HIS A C     1 
ATOM   3028 O  O     . HIS C 3 335 ? 44.851 60.414  11.481  1.00 37.49 ? 341  HIS A O     1 
ATOM   3029 C  CB    . HIS C 3 335 ? 48.058 60.042  10.751  1.00 33.71 ? 341  HIS A CB    1 
ATOM   3030 C  CG    . HIS C 3 335 ? 49.404 60.469  11.237  1.00 33.07 ? 341  HIS A CG    1 
ATOM   3031 N  ND1   . HIS C 3 335 ? 50.361 61.003  10.399  1.00 33.19 ? 341  HIS A ND1   1 
ATOM   3032 C  CD2   . HIS C 3 335 ? 49.961 60.431  12.470  1.00 32.70 ? 341  HIS A CD2   1 
ATOM   3033 C  CE1   . HIS C 3 335 ? 51.450 61.275  11.096  1.00 32.85 ? 341  HIS A CE1   1 
ATOM   3034 N  NE2   . HIS C 3 335 ? 51.234 60.937  12.355  1.00 34.23 ? 341  HIS A NE2   1 
ATOM   3035 N  N     . ILE C 3 336 ? 45.463 58.449  10.554  1.00 36.85 ? 342  ILE A N     1 
ATOM   3036 C  CA    . ILE C 3 336 ? 44.178 58.197  9.922   1.00 35.61 ? 342  ILE A CA    1 
ATOM   3037 C  C     . ILE C 3 336 ? 43.070 58.243  10.961  1.00 36.18 ? 342  ILE A C     1 
ATOM   3038 O  O     . ILE C 3 336 ? 42.112 58.997  10.830  1.00 36.16 ? 342  ILE A O     1 
ATOM   3039 C  CB    . ILE C 3 336 ? 44.174 56.817  9.226   1.00 35.84 ? 342  ILE A CB    1 
ATOM   3040 C  CG1   . ILE C 3 336 ? 45.193 56.814  8.085   1.00 33.40 ? 342  ILE A CG1   1 
ATOM   3041 C  CG2   . ILE C 3 336 ? 42.771 56.479  8.709   1.00 34.03 ? 342  ILE A CG2   1 
ATOM   3042 C  CD1   . ILE C 3 336 ? 45.233 55.515  7.306   1.00 33.44 ? 342  ILE A CD1   1 
ATOM   3043 N  N     . GLN C 3 337 ? 43.212 57.430  11.998  1.00 37.75 ? 343  GLN A N     1 
ATOM   3044 C  CA    . GLN C 3 337 ? 42.232 57.370  13.067  1.00 39.40 ? 343  GLN A CA    1 
ATOM   3045 C  C     . GLN C 3 337 ? 41.965 58.755  13.671  1.00 40.51 ? 343  GLN A C     1 
ATOM   3046 O  O     . GLN C 3 337 ? 40.827 59.096  13.993  1.00 40.93 ? 343  GLN A O     1 
ATOM   3047 C  CB    . GLN C 3 337 ? 42.720 56.397  14.143  1.00 39.64 ? 343  GLN A CB    1 
ATOM   3048 C  CG    . GLN C 3 337 ? 42.020 56.544  15.470  1.00 42.48 ? 343  GLN A CG    1 
ATOM   3049 C  CD    . GLN C 3 337 ? 42.699 57.550  16.376  1.00 43.88 ? 343  GLN A CD    1 
ATOM   3050 O  OE1   . GLN C 3 337 ? 42.071 58.119  17.267  1.00 46.68 ? 343  GLN A OE1   1 
ATOM   3051 N  NE2   . GLN C 3 337 ? 43.993 57.761  16.165  1.00 44.25 ? 343  GLN A NE2   1 
ATOM   3052 N  N     . LYS C 3 338 ? 43.022 59.546  13.815  1.00 40.43 ? 344  LYS A N     1 
ATOM   3053 C  CA    . LYS C 3 338 ? 42.930 60.890  14.374  1.00 40.76 ? 344  LYS A CA    1 
ATOM   3054 C  C     . LYS C 3 338 ? 42.088 61.828  13.516  1.00 40.51 ? 344  LYS A C     1 
ATOM   3055 O  O     . LYS C 3 338 ? 41.215 62.532  14.022  1.00 40.62 ? 344  LYS A O     1 
ATOM   3056 C  CB    . LYS C 3 338 ? 44.335 61.476  14.528  1.00 42.12 ? 344  LYS A CB    1 
ATOM   3057 C  CG    . LYS C 3 338 ? 44.366 62.921  14.993  1.00 43.99 ? 344  LYS A CG    1 
ATOM   3058 C  CD    . LYS C 3 338 ? 45.779 63.491  14.935  1.00 45.38 ? 344  LYS A CD    1 
ATOM   3059 C  CE    . LYS C 3 338 ? 45.812 64.929  15.429  1.00 45.96 ? 344  LYS A CE    1 
ATOM   3060 N  NZ    . LYS C 3 338 ? 45.423 65.009  16.863  1.00 47.45 ? 344  LYS A NZ    1 
ATOM   3061 N  N     . LYS C 3 339 ? 42.355 61.838  12.214  1.00 40.27 ? 345  LYS A N     1 
ATOM   3062 C  CA    . LYS C 3 339 ? 41.632 62.711  11.299  1.00 39.05 ? 345  LYS A CA    1 
ATOM   3063 C  C     . LYS C 3 339 ? 40.192 62.302  11.043  1.00 39.24 ? 345  LYS A C     1 
ATOM   3064 O  O     . LYS C 3 339 ? 39.320 63.161  10.908  1.00 41.03 ? 345  LYS A O     1 
ATOM   3065 C  CB    . LYS C 3 339 ? 42.383 62.817  9.974   1.00 38.27 ? 345  LYS A CB    1 
ATOM   3066 C  CG    . LYS C 3 339 ? 43.692 63.584  10.071  1.00 38.87 ? 345  LYS A CG    1 
ATOM   3067 C  CD    . LYS C 3 339 ? 43.453 65.061  10.357  1.00 39.87 ? 345  LYS A CD    1 
ATOM   3068 C  CE    . LYS C 3 339 ? 44.763 65.834  10.408  1.00 41.08 ? 345  LYS A CE    1 
ATOM   3069 N  NZ    . LYS C 3 339 ? 44.548 67.310  10.435  1.00 39.55 ? 345  LYS A NZ    1 
ATOM   3070 N  N     . LEU C 3 340 ? 39.931 61.003  10.974  1.00 38.42 ? 346  LEU A N     1 
ATOM   3071 C  CA    . LEU C 3 340 ? 38.570 60.538  10.732  1.00 39.80 ? 346  LEU A CA    1 
ATOM   3072 C  C     . LEU C 3 340 ? 37.640 60.816  11.916  1.00 41.13 ? 346  LEU A C     1 
ATOM   3073 O  O     . LEU C 3 340 ? 36.466 61.148  11.727  1.00 40.47 ? 346  LEU A O     1 
ATOM   3074 C  CB    . LEU C 3 340 ? 38.563 59.043  10.396  1.00 38.62 ? 346  LEU A CB    1 
ATOM   3075 C  CG    . LEU C 3 340 ? 39.263 58.687  9.080   1.00 38.85 ? 346  LEU A CG    1 
ATOM   3076 C  CD1   . LEU C 3 340 ? 39.006 57.233  8.729   1.00 36.20 ? 346  LEU A CD1   1 
ATOM   3077 C  CD2   . LEU C 3 340 ? 38.748 59.593  7.973   1.00 37.14 ? 346  LEU A CD2   1 
ATOM   3078 N  N     . GLN C 3 341 ? 38.155 60.684  13.135  1.00 41.98 ? 347  GLN A N     1 
ATOM   3079 C  CA    . GLN C 3 341 ? 37.329 60.951  14.303  1.00 43.08 ? 347  GLN A CA    1 
ATOM   3080 C  C     . GLN C 3 341 ? 37.089 62.453  14.379  1.00 43.93 ? 347  GLN A C     1 
ATOM   3081 O  O     . GLN C 3 341 ? 36.012 62.901  14.768  1.00 44.16 ? 347  GLN A O     1 
ATOM   3082 C  CB    . GLN C 3 341 ? 38.006 60.453  15.587  1.00 42.34 ? 347  GLN A CB    1 
ATOM   3083 C  CG    . GLN C 3 341 ? 38.136 58.932  15.672  1.00 43.06 ? 347  GLN A CG    1 
ATOM   3084 C  CD    . GLN C 3 341 ? 38.300 58.429  17.101  1.00 42.59 ? 347  GLN A CD    1 
ATOM   3085 O  OE1   . GLN C 3 341 ? 37.361 58.464  17.895  1.00 42.75 ? 347  GLN A OE1   1 
ATOM   3086 N  NE2   . GLN C 3 341 ? 39.497 57.963  17.433  1.00 43.15 ? 347  GLN A NE2   1 
ATOM   3087 N  N     . GLU C 3 342 ? 38.098 63.225  13.986  1.00 44.50 ? 348  GLU A N     1 
ATOM   3088 C  CA    . GLU C 3 342 ? 37.999 64.678  13.997  1.00 45.19 ? 348  GLU A CA    1 
ATOM   3089 C  C     . GLU C 3 342 ? 36.988 65.145  12.973  1.00 45.54 ? 348  GLU A C     1 
ATOM   3090 O  O     . GLU C 3 342 ? 36.701 66.336  12.882  1.00 46.77 ? 348  GLU A O     1 
ATOM   3091 C  CB    . GLU C 3 342 ? 39.354 65.314  13.687  1.00 44.69 ? 348  GLU A CB    1 
ATOM   3092 C  CG    . GLU C 3 342 ? 40.170 65.657  14.917  1.00 46.71 ? 348  GLU A CG    1 
ATOM   3093 C  CD    . GLU C 3 342 ? 41.574 66.106  14.573  1.00 48.47 ? 348  GLU A CD    1 
ATOM   3094 O  OE1   . GLU C 3 342 ? 41.735 66.834  13.568  1.00 49.87 ? 348  GLU A OE1   1 
ATOM   3095 O  OE2   . GLU C 3 342 ? 42.517 65.742  15.312  1.00 49.62 ? 348  GLU A OE2   1 
ATOM   3096 N  N     . ALA C 3 343 ? 36.451 64.206  12.200  1.00 45.29 ? 349  ALA A N     1 
ATOM   3097 C  CA    . ALA C 3 343 ? 35.469 64.537  11.177  1.00 44.46 ? 349  ALA A CA    1 
ATOM   3098 C  C     . ALA C 3 343 ? 34.133 63.882  11.482  1.00 44.96 ? 349  ALA A C     1 
ATOM   3099 O  O     . ALA C 3 343 ? 33.239 63.857  10.639  1.00 46.24 ? 349  ALA A O     1 
ATOM   3100 C  CB    . ALA C 3 343 ? 35.966 64.099  9.808   1.00 44.98 ? 349  ALA A CB    1 
ATOM   3101 N  N     . GLY C 3 344 ? 34.004 63.339  12.687  1.00 45.13 ? 350  GLY A N     1 
ATOM   3102 C  CA    . GLY C 3 344 ? 32.753 62.717  13.077  1.00 45.71 ? 350  GLY A CA    1 
ATOM   3103 C  C     . GLY C 3 344 ? 32.700 61.201  13.075  1.00 46.04 ? 350  GLY A C     1 
ATOM   3104 O  O     . GLY C 3 344 ? 31.622 60.628  13.244  1.00 46.23 ? 350  GLY A O     1 
ATOM   3105 N  N     . TRP C 3 345 ? 33.840 60.541  12.888  1.00 45.33 ? 351  TRP A N     1 
ATOM   3106 C  CA    . TRP C 3 345 ? 33.848 59.083  12.880  1.00 44.60 ? 351  TRP A CA    1 
ATOM   3107 C  C     . TRP C 3 345 ? 33.862 58.519  14.294  1.00 45.04 ? 351  TRP A C     1 
ATOM   3108 O  O     . TRP C 3 345 ? 34.661 58.935  15.136  1.00 45.40 ? 351  TRP A O     1 
ATOM   3109 C  CB    . TRP C 3 345 ? 35.058 58.545  12.103  1.00 43.84 ? 351  TRP A CB    1 
ATOM   3110 C  CG    . TRP C 3 345 ? 35.160 57.035  12.128  1.00 42.60 ? 351  TRP A CG    1 
ATOM   3111 C  CD1   . TRP C 3 345 ? 34.189 56.142  11.767  1.00 42.30 ? 351  TRP A CD1   1 
ATOM   3112 C  CD2   . TRP C 3 345 ? 36.292 56.251  12.540  1.00 41.69 ? 351  TRP A CD2   1 
ATOM   3113 N  NE1   . TRP C 3 345 ? 34.643 54.854  11.931  1.00 42.53 ? 351  TRP A NE1   1 
ATOM   3114 C  CE2   . TRP C 3 345 ? 35.930 54.891  12.402  1.00 41.64 ? 351  TRP A CE2   1 
ATOM   3115 C  CE3   . TRP C 3 345 ? 37.575 56.564  13.011  1.00 41.35 ? 351  TRP A CE3   1 
ATOM   3116 C  CZ2   . TRP C 3 345 ? 36.808 53.844  12.718  1.00 40.79 ? 351  TRP A CZ2   1 
ATOM   3117 C  CZ3   . TRP C 3 345 ? 38.448 55.520  13.326  1.00 40.31 ? 351  TRP A CZ3   1 
ATOM   3118 C  CH2   . TRP C 3 345 ? 38.057 54.179  13.177  1.00 40.21 ? 351  TRP A CH2   1 
ATOM   3119 N  N     . VAL C 3 346 ? 32.962 57.576  14.549  1.00 46.03 ? 352  VAL A N     1 
ATOM   3120 C  CA    . VAL C 3 346 ? 32.873 56.934  15.853  1.00 47.85 ? 352  VAL A CA    1 
ATOM   3121 C  C     . VAL C 3 346 ? 33.193 55.450  15.673  1.00 49.63 ? 352  VAL A C     1 
ATOM   3122 O  O     . VAL C 3 346 ? 32.369 54.679  15.171  1.00 50.12 ? 352  VAL A O     1 
ATOM   3123 C  CB    . VAL C 3 346 ? 31.455 57.082  16.466  1.00 47.90 ? 352  VAL A CB    1 
ATOM   3124 C  CG1   . VAL C 3 346 ? 31.416 56.447  17.857  1.00 46.19 ? 352  VAL A CG1   1 
ATOM   3125 C  CG2   . VAL C 3 346 ? 31.069 58.557  16.543  1.00 46.89 ? 352  VAL A CG2   1 
ATOM   3126 N  N     . PRO C 3 347 ? 34.408 55.036  16.066  1.00 50.00 ? 353  PRO A N     1 
ATOM   3127 C  CA    . PRO C 3 347 ? 34.851 53.643  15.951  1.00 51.26 ? 353  PRO A CA    1 
ATOM   3128 C  C     . PRO C 3 347 ? 33.885 52.654  16.602  1.00 52.29 ? 353  PRO A C     1 
ATOM   3129 O  O     . PRO C 3 347 ? 33.276 52.947  17.634  1.00 52.12 ? 353  PRO A O     1 
ATOM   3130 C  CB    . PRO C 3 347 ? 36.215 53.658  16.638  1.00 50.50 ? 353  PRO A CB    1 
ATOM   3131 C  CG    . PRO C 3 347 ? 36.712 55.047  16.357  1.00 49.92 ? 353  PRO A CG    1 
ATOM   3132 C  CD    . PRO C 3 347 ? 35.482 55.885  16.613  1.00 49.91 ? 353  PRO A CD    1 
ATOM   3133 N  N     . THR C 3 348 ? 33.762 51.479  15.991  1.00 53.55 ? 354  THR A N     1 
ATOM   3134 C  CA    . THR C 3 348 ? 32.874 50.430  16.484  1.00 54.70 ? 354  THR A CA    1 
ATOM   3135 C  C     . THR C 3 348 ? 33.654 49.220  16.998  1.00 54.74 ? 354  THR A C     1 
ATOM   3136 O  O     . THR C 3 348 ? 33.114 48.396  17.737  1.00 55.28 ? 354  THR A O     1 
ATOM   3137 C  CB    . THR C 3 348 ? 31.920 49.950  15.369  1.00 55.35 ? 354  THR A CB    1 
ATOM   3138 O  OG1   . THR C 3 348 ? 31.166 51.063  14.871  1.00 56.77 ? 354  THR A OG1   1 
ATOM   3139 C  CG2   . THR C 3 348 ? 30.965 48.893  15.899  1.00 54.13 ? 354  THR A CG2   1 
ATOM   3140 N  N     . LYS C 3 349 ? 34.920 49.110  16.606  1.00 54.04 ? 355  LYS A N     1 
ATOM   3141 C  CA    . LYS C 3 349 ? 35.744 47.983  17.034  1.00 53.75 ? 355  LYS A CA    1 
ATOM   3142 C  C     . LYS C 3 349 ? 37.169 48.383  17.393  1.00 52.90 ? 355  LYS A C     1 
ATOM   3143 O  O     . LYS C 3 349 ? 37.848 49.067  16.630  1.00 53.16 ? 355  LYS A O     1 
ATOM   3144 C  CB    . LYS C 3 349 ? 35.749 46.908  15.945  1.00 54.72 ? 355  LYS A CB    1 
ATOM   3145 C  CG    . LYS C 3 349 ? 35.802 47.460  14.530  1.00 56.19 ? 355  LYS A CG    1 
ATOM   3146 C  CD    . LYS C 3 349 ? 35.560 46.365  13.495  1.00 58.20 ? 355  LYS A CD    1 
ATOM   3147 C  CE    . LYS C 3 349 ? 36.606 45.258  13.581  1.00 58.79 ? 355  LYS A CE    1 
ATOM   3148 N  NZ    . LYS C 3 349 ? 36.370 44.197  12.560  1.00 59.46 ? 355  LYS A NZ    1 
ATOM   3149 N  N     . TYR C 3 350 ? 37.611 47.953  18.568  1.00 52.09 ? 356  TYR A N     1 
ATOM   3150 C  CA    . TYR C 3 350 ? 38.946 48.273  19.047  1.00 52.44 ? 356  TYR A CA    1 
ATOM   3151 C  C     . TYR C 3 350 ? 39.769 47.008  19.255  1.00 53.24 ? 356  TYR A C     1 
ATOM   3152 O  O     . TYR C 3 350 ? 39.240 45.895  19.233  1.00 53.43 ? 356  TYR A O     1 
ATOM   3153 C  CB    . TYR C 3 350 ? 38.860 49.062  20.360  1.00 50.71 ? 356  TYR A CB    1 
ATOM   3154 C  CG    . TYR C 3 350 ? 38.093 50.361  20.238  1.00 49.69 ? 356  TYR A CG    1 
ATOM   3155 C  CD1   . TYR C 3 350 ? 36.726 50.361  19.957  1.00 48.45 ? 356  TYR A CD1   1 
ATOM   3156 C  CD2   . TYR C 3 350 ? 38.738 51.592  20.375  1.00 49.03 ? 356  TYR A CD2   1 
ATOM   3157 C  CE1   . TYR C 3 350 ? 36.018 51.554  19.811  1.00 47.97 ? 356  TYR A CE1   1 
ATOM   3158 C  CE2   . TYR C 3 350 ? 38.039 52.793  20.229  1.00 48.70 ? 356  TYR A CE2   1 
ATOM   3159 C  CZ    . TYR C 3 350 ? 36.679 52.765  19.947  1.00 49.08 ? 356  TYR A CZ    1 
ATOM   3160 O  OH    . TYR C 3 350 ? 35.977 53.943  19.794  1.00 49.92 ? 356  TYR A OH    1 
ATOM   3161 N  N     . THR C 3 351 ? 41.067 47.187  19.460  1.00 53.78 ? 357  THR A N     1 
ATOM   3162 C  CA    . THR C 3 351 ? 41.970 46.067  19.664  1.00 54.79 ? 357  THR A CA    1 
ATOM   3163 C  C     . THR C 3 351 ? 42.261 45.888  21.149  1.00 56.63 ? 357  THR A C     1 
ATOM   3164 O  O     . THR C 3 351 ? 41.825 46.693  21.973  1.00 56.84 ? 357  THR A O     1 
ATOM   3165 C  CB    . THR C 3 351 ? 43.293 46.305  18.928  1.00 54.00 ? 357  THR A CB    1 
ATOM   3166 O  OG1   . THR C 3 351 ? 44.001 47.374  19.564  1.00 52.24 ? 357  THR A OG1   1 
ATOM   3167 C  CG2   . THR C 3 351 ? 43.027 46.686  17.476  1.00 53.04 ? 357  THR A CG2   1 
ATOM   3168 N  N     . ASP C 3 352 ? 43.000 44.835  21.484  1.00 58.43 ? 358  ASP A N     1 
ATOM   3169 C  CA    . ASP C 3 352 ? 43.350 44.559  22.873  1.00 60.33 ? 358  ASP A CA    1 
ATOM   3170 C  C     . ASP C 3 352 ? 44.480 45.470  23.338  1.00 61.31 ? 358  ASP A C     1 
ATOM   3171 O  O     . ASP C 3 352 ? 45.442 45.020  23.968  1.00 62.22 ? 358  ASP A O     1 
ATOM   3172 C  CB    . ASP C 3 352 ? 43.774 43.098  23.037  1.00 61.69 ? 358  ASP A CB    1 
ATOM   3173 C  CG    . ASP C 3 352 ? 42.705 42.127  22.580  1.00 63.20 ? 358  ASP A CG    1 
ATOM   3174 O  OD1   . ASP C 3 352 ? 41.525 42.318  22.956  1.00 63.05 ? 358  ASP A OD1   1 
ATOM   3175 O  OD2   . ASP C 3 352 ? 43.047 41.170  21.850  1.00 64.23 ? 358  ASP A OD2   1 
ATOM   3176 N  N     . LYS C 3 353 ? 44.358 46.752  23.014  1.00 61.13 ? 359  LYS A N     1 
ATOM   3177 C  CA    . LYS C 3 353 ? 45.356 47.744  23.397  1.00 60.44 ? 359  LYS A CA    1 
ATOM   3178 C  C     . LYS C 3 353 ? 44.693 49.120  23.389  1.00 59.34 ? 359  LYS A C     1 
ATOM   3179 O  O     . LYS C 3 353 ? 45.344 50.144  23.596  1.00 58.55 ? 359  LYS A O     1 
ATOM   3180 C  CB    . LYS C 3 353 ? 46.536 47.716  22.421  1.00 60.61 ? 359  LYS A CB    1 
ATOM   3181 C  CG    . LYS C 3 353 ? 47.713 48.583  22.847  1.00 62.19 ? 359  LYS A CG    1 
ATOM   3182 C  CD    . LYS C 3 353 ? 48.834 48.560  21.816  1.00 63.11 ? 359  LYS A CD    1 
ATOM   3183 C  CE    . LYS C 3 353 ? 50.042 49.369  22.285  1.00 63.23 ? 359  LYS A CE    1 
ATOM   3184 N  NZ    . LYS C 3 353 ? 51.150 49.361  21.284  1.00 62.58 ? 359  LYS A NZ    1 
ATOM   3185 N  N     . GLY C 3 354 ? 43.385 49.126  23.150  1.00 58.44 ? 360  GLY A N     1 
ATOM   3186 C  CA    . GLY C 3 354 ? 42.636 50.369  23.126  1.00 57.58 ? 360  GLY A CA    1 
ATOM   3187 C  C     . GLY C 3 354 ? 42.542 50.982  21.743  1.00 56.28 ? 360  GLY A C     1 
ATOM   3188 O  O     . GLY C 3 354 ? 41.552 51.641  21.410  1.00 56.89 ? 360  GLY A O     1 
ATOM   3189 N  N     . ALA C 3 355 ? 43.574 50.765  20.934  1.00 54.82 ? 361  ALA A N     1 
ATOM   3190 C  CA    . ALA C 3 355 ? 43.615 51.305  19.579  1.00 52.40 ? 361  ALA A CA    1 
ATOM   3191 C  C     . ALA C 3 355 ? 42.430 50.833  18.742  1.00 50.14 ? 361  ALA A C     1 
ATOM   3192 O  O     . ALA C 3 355 ? 42.064 49.659  18.772  1.00 50.00 ? 361  ALA A O     1 
ATOM   3193 C  CB    . ALA C 3 355 ? 44.921 50.906  18.899  1.00 52.82 ? 361  ALA A CB    1 
ATOM   3194 N  N     . PRO C 3 356 ? 41.809 51.754  17.988  1.00 48.27 ? 362  PRO A N     1 
ATOM   3195 C  CA    . PRO C 3 356 ? 40.663 51.414  17.138  1.00 47.02 ? 362  PRO A CA    1 
ATOM   3196 C  C     . PRO C 3 356 ? 41.121 50.722  15.854  1.00 46.02 ? 362  PRO A C     1 
ATOM   3197 O  O     . PRO C 3 356 ? 42.120 51.109  15.256  1.00 45.89 ? 362  PRO A O     1 
ATOM   3198 C  CB    . PRO C 3 356 ? 40.021 52.773  16.870  1.00 46.45 ? 362  PRO A CB    1 
ATOM   3199 C  CG    . PRO C 3 356 ? 41.199 53.684  16.832  1.00 46.47 ? 362  PRO A CG    1 
ATOM   3200 C  CD    . PRO C 3 356 ? 42.037 53.211  18.006  1.00 46.77 ? 362  PRO A CD    1 
ATOM   3201 N  N     . VAL C 3 357 ? 40.390 49.695  15.438  1.00 45.68 ? 363  VAL A N     1 
ATOM   3202 C  CA    . VAL C 3 357 ? 40.736 48.958  14.230  1.00 44.71 ? 363  VAL A CA    1 
ATOM   3203 C  C     . VAL C 3 357 ? 40.651 49.847  12.992  1.00 44.61 ? 363  VAL A C     1 
ATOM   3204 O  O     . VAL C 3 357 ? 39.661 50.550  12.786  1.00 44.63 ? 363  VAL A O     1 
ATOM   3205 C  CB    . VAL C 3 357 ? 39.800 47.736  14.037  1.00 43.84 ? 363  VAL A CB    1 
ATOM   3206 C  CG1   . VAL C 3 357 ? 40.099 47.041  12.712  1.00 43.18 ? 363  VAL A CG1   1 
ATOM   3207 C  CG2   . VAL C 3 357 ? 39.982 46.763  15.191  1.00 43.54 ? 363  VAL A CG2   1 
ATOM   3208 N  N     . VAL C 3 358 ? 41.698 49.810  12.173  1.00 44.37 ? 364  VAL A N     1 
ATOM   3209 C  CA    . VAL C 3 358 ? 41.742 50.595  10.948  1.00 44.19 ? 364  VAL A CA    1 
ATOM   3210 C  C     . VAL C 3 358 ? 42.248 49.755  9.777   1.00 44.53 ? 364  VAL A C     1 
ATOM   3211 O  O     . VAL C 3 358 ? 43.315 50.018  9.217   1.00 44.17 ? 364  VAL A O     1 
ATOM   3212 C  CB    . VAL C 3 358 ? 42.651 51.843  11.094  1.00 44.54 ? 364  VAL A CB    1 
ATOM   3213 C  CG1   . VAL C 3 358 ? 42.606 52.679  9.810   1.00 43.20 ? 364  VAL A CG1   1 
ATOM   3214 C  CG2   . VAL C 3 358 ? 42.203 52.679  12.285  1.00 44.04 ? 364  VAL A CG2   1 
ATOM   3215 N  N     . ASP C 3 359 ? 41.486 48.725  9.427   1.00 44.46 ? 365  ASP A N     1 
ATOM   3216 C  CA    . ASP C 3 359 ? 41.842 47.882  8.302   1.00 43.46 ? 365  ASP A CA    1 
ATOM   3217 C  C     . ASP C 3 359 ? 40.903 48.246  7.167   1.00 43.75 ? 365  ASP A C     1 
ATOM   3218 O  O     . ASP C 3 359 ? 39.969 49.022  7.358   1.00 42.83 ? 365  ASP A O     1 
ATOM   3219 C  CB    . ASP C 3 359 ? 41.725 46.392  8.651   1.00 42.28 ? 365  ASP A CB    1 
ATOM   3220 C  CG    . ASP C 3 359 ? 40.371 46.015  9.204   1.00 42.27 ? 365  ASP A CG    1 
ATOM   3221 O  OD1   . ASP C 3 359 ? 39.344 46.523  8.702   1.00 42.40 ? 365  ASP A OD1   1 
ATOM   3222 O  OD2   . ASP C 3 359 ? 40.337 45.185  10.136  1.00 41.90 ? 365  ASP A OD2   1 
ATOM   3223 N  N     . ASP C 3 360 ? 41.154 47.693  5.987   1.00 45.42 ? 366  ASP A N     1 
ATOM   3224 C  CA    . ASP C 3 360 ? 40.342 47.990  4.816   1.00 47.59 ? 366  ASP A CA    1 
ATOM   3225 C  C     . ASP C 3 360 ? 38.851 47.735  5.029   1.00 47.87 ? 366  ASP A C     1 
ATOM   3226 O  O     . ASP C 3 360 ? 38.007 48.472  4.506   1.00 48.72 ? 366  ASP A O     1 
ATOM   3227 C  CB    . ASP C 3 360 ? 40.835 47.179  3.616   1.00 49.13 ? 366  ASP A CB    1 
ATOM   3228 C  CG    . ASP C 3 360 ? 40.375 47.765  2.297   1.00 51.11 ? 366  ASP A CG    1 
ATOM   3229 O  OD1   . ASP C 3 360 ? 40.896 48.838  1.911   1.00 51.31 ? 366  ASP A OD1   1 
ATOM   3230 O  OD2   . ASP C 3 360 ? 39.487 47.160  1.656   1.00 51.39 ? 366  ASP A OD2   1 
ATOM   3231 N  N     . GLU C 3 361 ? 38.525 46.698  5.793   1.00 47.82 ? 367  GLU A N     1 
ATOM   3232 C  CA    . GLU C 3 361 ? 37.130 46.373  6.060   1.00 48.00 ? 367  GLU A CA    1 
ATOM   3233 C  C     . GLU C 3 361 ? 36.436 47.492  6.842   1.00 47.45 ? 367  GLU A C     1 
ATOM   3234 O  O     . GLU C 3 361 ? 35.278 47.819  6.577   1.00 47.47 ? 367  GLU A O     1 
ATOM   3235 C  CB    . GLU C 3 361 ? 37.025 45.062  6.840   1.00 49.11 ? 367  GLU A CB    1 
ATOM   3236 C  CG    . GLU C 3 361 ? 35.590 44.691  7.180   1.00 52.51 ? 367  GLU A CG    1 
ATOM   3237 C  CD    . GLU C 3 361 ? 35.483 43.443  8.031   1.00 53.65 ? 367  GLU A CD    1 
ATOM   3238 O  OE1   . GLU C 3 361 ? 34.343 43.076  8.392   1.00 54.67 ? 367  GLU A OE1   1 
ATOM   3239 O  OE2   . GLU C 3 361 ? 36.531 42.831  8.337   1.00 54.98 ? 367  GLU A OE2   1 
ATOM   3240 N  N     . VAL C 3 362 ? 37.144 48.069  7.810   1.00 46.93 ? 368  VAL A N     1 
ATOM   3241 C  CA    . VAL C 3 362 ? 36.601 49.156  8.616   1.00 45.88 ? 368  VAL A CA    1 
ATOM   3242 C  C     . VAL C 3 362 ? 36.552 50.441  7.801   1.00 46.19 ? 368  VAL A C     1 
ATOM   3243 O  O     . VAL C 3 362 ? 35.531 51.126  7.786   1.00 46.22 ? 368  VAL A O     1 
ATOM   3244 C  CB    . VAL C 3 362 ? 37.449 49.405  9.885   1.00 45.47 ? 368  VAL A CB    1 
ATOM   3245 C  CG1   . VAL C 3 362 ? 37.120 50.769  10.476  1.00 45.66 ? 368  VAL A CG1   1 
ATOM   3246 C  CG2   . VAL C 3 362 ? 37.173 48.321  10.909  1.00 44.51 ? 368  VAL A CG2   1 
ATOM   3247 N  N     . LEU C 3 363 ? 37.654 50.765  7.126   1.00 45.77 ? 369  LEU A N     1 
ATOM   3248 C  CA    . LEU C 3 363 ? 37.710 51.973  6.308   1.00 45.61 ? 369  LEU A CA    1 
ATOM   3249 C  C     . LEU C 3 363 ? 36.575 51.969  5.296   1.00 46.17 ? 369  LEU A C     1 
ATOM   3250 O  O     . LEU C 3 363 ? 35.917 52.984  5.088   1.00 46.56 ? 369  LEU A O     1 
ATOM   3251 C  CB    . LEU C 3 363 ? 39.055 52.074  5.579   1.00 43.34 ? 369  LEU A CB    1 
ATOM   3252 C  CG    . LEU C 3 363 ? 40.271 52.409  6.450   1.00 41.92 ? 369  LEU A CG    1 
ATOM   3253 C  CD1   . LEU C 3 363 ? 41.548 52.210  5.663   1.00 40.09 ? 369  LEU A CD1   1 
ATOM   3254 C  CD2   . LEU C 3 363 ? 40.168 53.837  6.942   1.00 40.91 ? 369  LEU A CD2   1 
ATOM   3255 N  N     . GLU C 3 364 ? 36.345 50.821  4.673   1.00 46.68 ? 370  GLU A N     1 
ATOM   3256 C  CA    . GLU C 3 364 ? 35.278 50.693  3.691   1.00 48.07 ? 370  GLU A CA    1 
ATOM   3257 C  C     . GLU C 3 364 ? 33.925 51.067  4.292   1.00 48.24 ? 370  GLU A C     1 
ATOM   3258 O  O     . GLU C 3 364 ? 33.022 51.511  3.581   1.00 48.46 ? 370  GLU A O     1 
ATOM   3259 C  CB    . GLU C 3 364 ? 35.223 49.254  3.159   1.00 49.17 ? 370  GLU A CB    1 
ATOM   3260 C  CG    . GLU C 3 364 ? 34.032 48.956  2.243   1.00 50.53 ? 370  GLU A CG    1 
ATOM   3261 C  CD    . GLU C 3 364 ? 33.879 49.968  1.114   1.00 52.14 ? 370  GLU A CD    1 
ATOM   3262 O  OE1   . GLU C 3 364 ? 34.849 50.166  0.341   1.00 52.20 ? 370  GLU A OE1   1 
ATOM   3263 O  OE2   . GLU C 3 364 ? 32.782 50.565  1.000   1.00 52.38 ? 370  GLU A OE2   1 
ATOM   3264 N  N     . GLY C 3 365 ? 33.791 50.898  5.603   1.00 48.12 ? 371  GLY A N     1 
ATOM   3265 C  CA    . GLY C 3 365 ? 32.529 51.203  6.253   1.00 48.57 ? 371  GLY A CA    1 
ATOM   3266 C  C     . GLY C 3 365 ? 32.396 52.557  6.928   1.00 49.47 ? 371  GLY A C     1 
ATOM   3267 O  O     . GLY C 3 365 ? 31.315 52.890  7.418   1.00 49.98 ? 371  GLY A O     1 
ATOM   3268 N  N     . VAL C 3 366 ? 33.474 53.336  6.963   1.00 49.50 ? 372  VAL A N     1 
ATOM   3269 C  CA    . VAL C 3 366 ? 33.448 54.657  7.591   1.00 49.82 ? 372  VAL A CA    1 
ATOM   3270 C  C     . VAL C 3 366 ? 32.557 55.653  6.841   1.00 50.72 ? 372  VAL A C     1 
ATOM   3271 O  O     . VAL C 3 366 ? 32.512 55.659  5.608   1.00 50.82 ? 372  VAL A O     1 
ATOM   3272 C  CB    . VAL C 3 366 ? 34.871 55.254  7.691   1.00 49.59 ? 372  VAL A CB    1 
ATOM   3273 C  CG1   . VAL C 3 366 ? 34.802 56.724  8.094   1.00 48.81 ? 372  VAL A CG1   1 
ATOM   3274 C  CG2   . VAL C 3 366 ? 35.682 54.479  8.708   1.00 48.46 ? 372  VAL A CG2   1 
ATOM   3275 N  N     . ARG C 3 367 ? 31.858 56.497  7.595   1.00 51.36 ? 373  ARG A N     1 
ATOM   3276 C  CA    . ARG C 3 367 ? 30.968 57.507  7.017   1.00 52.18 ? 373  ARG A CA    1 
ATOM   3277 C  C     . ARG C 3 367 ? 31.100 58.858  7.730   1.00 51.69 ? 373  ARG A C     1 
ATOM   3278 O  O     . ARG C 3 367 ? 30.979 58.938  8.953   1.00 53.01 ? 373  ARG A O     1 
ATOM   3279 C  CB    . ARG C 3 367 ? 29.512 57.030  7.093   1.00 52.23 ? 373  ARG A CB    1 
ATOM   3280 C  CG    . ARG C 3 367 ? 29.180 55.835  6.203   1.00 53.51 ? 373  ARG A CG    1 
ATOM   3281 C  CD    . ARG C 3 367 ? 29.168 56.220  4.728   1.00 54.55 ? 373  ARG A CD    1 
ATOM   3282 N  NE    . ARG C 3 367 ? 28.863 55.088  3.852   1.00 54.08 ? 373  ARG A NE    1 
ATOM   3283 C  CZ    . ARG C 3 367 ? 29.636 54.014  3.716   1.00 53.71 ? 373  ARG A CZ    1 
ATOM   3284 N  NH1   . ARG C 3 367 ? 30.768 53.916  4.402   1.00 51.45 ? 373  ARG A NH1   1 
ATOM   3285 N  NH2   . ARG C 3 367 ? 29.280 53.039  2.887   1.00 53.26 ? 373  ARG A NH2   1 
ATOM   3286 N  N     . VAL C 3 368 ? 31.354 59.916  6.962   1.00 51.12 ? 374  VAL A N     1 
ATOM   3287 C  CA    . VAL C 3 368 ? 31.491 61.261  7.521   1.00 50.27 ? 374  VAL A CA    1 
ATOM   3288 C  C     . VAL C 3 368 ? 30.730 62.268  6.659   1.00 50.62 ? 374  VAL A C     1 
ATOM   3289 O  O     . VAL C 3 368 ? 30.423 61.989  5.499   1.00 51.03 ? 374  VAL A O     1 
ATOM   3290 C  CB    . VAL C 3 368 ? 32.972 61.693  7.607   1.00 49.42 ? 374  VAL A CB    1 
ATOM   3291 C  CG1   . VAL C 3 368 ? 33.744 60.724  8.488   1.00 48.51 ? 374  VAL A CG1   1 
ATOM   3292 C  CG2   . VAL C 3 368 ? 33.584 61.753  6.216   1.00 49.08 ? 374  VAL A CG2   1 
ATOM   3293 N  N     . ASP C 3 369 ? 30.432 63.435  7.226   1.00 50.15 ? 375  ASP A N     1 
ATOM   3294 C  CA    . ASP C 3 369 ? 29.694 64.470  6.508   1.00 49.90 ? 375  ASP A CA    1 
ATOM   3295 C  C     . ASP C 3 369 ? 30.473 65.121  5.370   1.00 49.54 ? 375  ASP A C     1 
ATOM   3296 O  O     . ASP C 3 369 ? 30.041 65.085  4.219   1.00 50.26 ? 375  ASP A O     1 
ATOM   3297 C  CB    . ASP C 3 369 ? 29.223 65.564  7.472   1.00 50.18 ? 375  ASP A CB    1 
ATOM   3298 C  CG    . ASP C 3 369 ? 28.213 65.059  8.480   1.00 50.37 ? 375  ASP A CG    1 
ATOM   3299 O  OD1   . ASP C 3 369 ? 27.611 63.987  8.244   1.00 49.82 ? 375  ASP A OD1   1 
ATOM   3300 O  OD2   . ASP C 3 369 ? 28.012 65.745  9.505   1.00 51.02 ? 375  ASP A OD2   1 
ATOM   3301 N  N     . ASP C 3 370 ? 31.613 65.725  5.692   1.00 48.79 ? 376  ASP A N     1 
ATOM   3302 C  CA    . ASP C 3 370 ? 32.429 66.392  4.683   1.00 47.59 ? 376  ASP A CA    1 
ATOM   3303 C  C     . ASP C 3 370 ? 32.664 65.456  3.504   1.00 46.99 ? 376  ASP A C     1 
ATOM   3304 O  O     . ASP C 3 370 ? 33.352 64.444  3.632   1.00 46.08 ? 376  ASP A O     1 
ATOM   3305 C  CB    . ASP C 3 370 ? 33.774 66.816  5.276   1.00 49.11 ? 376  ASP A CB    1 
ATOM   3306 C  CG    . ASP C 3 370 ? 34.530 67.780  4.378   1.00 50.15 ? 376  ASP A CG    1 
ATOM   3307 O  OD1   . ASP C 3 370 ? 34.626 67.517  3.161   1.00 51.88 ? 376  ASP A OD1   1 
ATOM   3308 O  OD2   . ASP C 3 370 ? 35.036 68.802  4.891   1.00 50.51 ? 376  ASP A OD2   1 
ATOM   3309 N  N     . PRO C 3 371 ? 32.090 65.788  2.335   1.00 46.39 ? 377  PRO A N     1 
ATOM   3310 C  CA    . PRO C 3 371 ? 32.224 64.989  1.112   1.00 44.94 ? 377  PRO A CA    1 
ATOM   3311 C  C     . PRO C 3 371 ? 33.679 64.770  0.706   1.00 44.39 ? 377  PRO A C     1 
ATOM   3312 O  O     . PRO C 3 371 ? 34.067 63.658  0.345   1.00 44.88 ? 377  PRO A O     1 
ATOM   3313 C  CB    . PRO C 3 371 ? 31.460 65.810  0.074   1.00 45.08 ? 377  PRO A CB    1 
ATOM   3314 C  CG    . PRO C 3 371 ? 30.440 66.531  0.896   1.00 45.26 ? 377  PRO A CG    1 
ATOM   3315 C  CD    . PRO C 3 371 ? 31.231 66.962  2.098   1.00 45.62 ? 377  PRO A CD    1 
ATOM   3316 N  N     . GLU C 3 372 ? 34.479 65.832  0.758   1.00 42.72 ? 378  GLU A N     1 
ATOM   3317 C  CA    . GLU C 3 372 ? 35.885 65.735  0.386   1.00 43.28 ? 378  GLU A CA    1 
ATOM   3318 C  C     . GLU C 3 372 ? 36.637 64.745  1.267   1.00 42.84 ? 378  GLU A C     1 
ATOM   3319 O  O     . GLU C 3 372 ? 37.431 63.947  0.772   1.00 42.38 ? 378  GLU A O     1 
ATOM   3320 C  CB    . GLU C 3 372 ? 36.561 67.114  0.452   1.00 43.57 ? 378  GLU A CB    1 
ATOM   3321 C  CG    . GLU C 3 372 ? 38.093 67.057  0.476   1.00 45.45 ? 378  GLU A CG    1 
ATOM   3322 C  CD    . GLU C 3 372 ? 38.761 68.396  0.186   1.00 46.52 ? 378  GLU A CD    1 
ATOM   3323 O  OE1   . GLU C 3 372 ? 38.159 69.456  0.472   1.00 47.02 ? 378  GLU A OE1   1 
ATOM   3324 O  OE2   . GLU C 3 372 ? 39.906 68.388  -0.318  1.00 48.44 ? 378  GLU A OE2   1 
ATOM   3325 N  N     . LYS C 3 373 ? 36.382 64.798  2.571   1.00 42.81 ? 379  LYS A N     1 
ATOM   3326 C  CA    . LYS C 3 373 ? 37.042 63.899  3.514   1.00 41.91 ? 379  LYS A CA    1 
ATOM   3327 C  C     . LYS C 3 373 ? 36.569 62.464  3.314   1.00 41.00 ? 379  LYS A C     1 
ATOM   3328 O  O     . LYS C 3 373 ? 37.334 61.515  3.504   1.00 40.67 ? 379  LYS A O     1 
ATOM   3329 C  CB    . LYS C 3 373 ? 36.771 64.341  4.956   1.00 41.46 ? 379  LYS A CB    1 
ATOM   3330 C  CG    . LYS C 3 373 ? 37.461 65.640  5.361   1.00 41.64 ? 379  LYS A CG    1 
ATOM   3331 C  CD    . LYS C 3 373 ? 37.157 65.977  6.816   1.00 44.78 ? 379  LYS A CD    1 
ATOM   3332 C  CE    . LYS C 3 373 ? 37.722 67.331  7.229   1.00 46.57 ? 379  LYS A CE    1 
ATOM   3333 N  NZ    . LYS C 3 373 ? 39.206 67.377  7.119   1.00 48.84 ? 379  LYS A NZ    1 
ATOM   3334 N  N     . GLN C 3 374 ? 35.304 62.315  2.932   1.00 40.05 ? 380  GLN A N     1 
ATOM   3335 C  CA    . GLN C 3 374 ? 34.717 61.002  2.689   1.00 38.73 ? 380  GLN A CA    1 
ATOM   3336 C  C     . GLN C 3 374 ? 35.448 60.354  1.511   1.00 39.20 ? 380  GLN A C     1 
ATOM   3337 O  O     . GLN C 3 374 ? 35.898 59.211  1.589   1.00 39.70 ? 380  GLN A O     1 
ATOM   3338 C  CB    . GLN C 3 374 ? 33.225 61.156  2.359   1.00 37.93 ? 380  GLN A CB    1 
ATOM   3339 C  CG    . GLN C 3 374 ? 32.469 59.855  2.106   1.00 35.80 ? 380  GLN A CG    1 
ATOM   3340 C  CD    . GLN C 3 374 ? 32.344 58.995  3.353   1.00 37.17 ? 380  GLN A CD    1 
ATOM   3341 O  OE1   . GLN C 3 374 ? 31.752 59.411  4.352   1.00 35.79 ? 380  GLN A OE1   1 
ATOM   3342 N  NE2   . GLN C 3 374 ? 32.901 57.787  3.301   1.00 36.37 ? 380  GLN A NE2   1 
ATOM   3343 N  N     . ALA C 3 375 ? 35.574 61.101  0.421   1.00 38.71 ? 381  ALA A N     1 
ATOM   3344 C  CA    . ALA C 3 375 ? 36.241 60.597  -0.766  1.00 38.01 ? 381  ALA A CA    1 
ATOM   3345 C  C     . ALA C 3 375 ? 37.709 60.302  -0.465  1.00 38.47 ? 381  ALA A C     1 
ATOM   3346 O  O     . ALA C 3 375 ? 38.304 59.386  -1.041  1.00 38.10 ? 381  ALA A O     1 
ATOM   3347 C  CB    . ALA C 3 375 ? 36.125 61.616  -1.895  1.00 36.16 ? 381  ALA A CB    1 
ATOM   3348 N  N     . ALA C 3 376 ? 38.284 61.084  0.445   1.00 38.39 ? 382  ALA A N     1 
ATOM   3349 C  CA    . ALA C 3 376 ? 39.680 60.932  0.830   1.00 37.40 ? 382  ALA A CA    1 
ATOM   3350 C  C     . ALA C 3 376 ? 39.949 59.538  1.377   1.00 37.98 ? 382  ALA A C     1 
ATOM   3351 O  O     . ALA C 3 376 ? 41.077 59.048  1.327   1.00 38.67 ? 382  ALA A O     1 
ATOM   3352 C  CB    . ALA C 3 376 ? 40.048 61.979  1.866   1.00 37.35 ? 382  ALA A CB    1 
ATOM   3353 N  N     . ILE C 3 377 ? 38.909 58.903  1.904   1.00 36.86 ? 383  ILE A N     1 
ATOM   3354 C  CA    . ILE C 3 377 ? 39.045 57.565  2.450   1.00 36.99 ? 383  ILE A CA    1 
ATOM   3355 C  C     . ILE C 3 377 ? 39.439 56.568  1.359   1.00 36.99 ? 383  ILE A C     1 
ATOM   3356 O  O     . ILE C 3 377 ? 40.238 55.658  1.595   1.00 37.21 ? 383  ILE A O     1 
ATOM   3357 C  CB    . ILE C 3 377 ? 37.735 57.129  3.128   1.00 37.17 ? 383  ILE A CB    1 
ATOM   3358 C  CG1   . ILE C 3 377 ? 37.454 58.064  4.308   1.00 36.79 ? 383  ILE A CG1   1 
ATOM   3359 C  CG2   . ILE C 3 377 ? 37.835 55.681  3.595   1.00 37.54 ? 383  ILE A CG2   1 
ATOM   3360 C  CD1   . ILE C 3 377 ? 36.214 57.729  5.086   1.00 37.16 ? 383  ILE A CD1   1 
ATOM   3361 N  N     . ASP C 3 378 ? 38.889 56.742  0.162   1.00 36.92 ? 384  ASP A N     1 
ATOM   3362 C  CA    . ASP C 3 378 ? 39.221 55.854  -0.944  1.00 36.73 ? 384  ASP A CA    1 
ATOM   3363 C  C     . ASP C 3 378 ? 40.670 56.079  -1.348  1.00 36.30 ? 384  ASP A C     1 
ATOM   3364 O  O     . ASP C 3 378 ? 41.389 55.132  -1.682  1.00 35.95 ? 384  ASP A O     1 
ATOM   3365 C  CB    . ASP C 3 378 ? 38.298 56.102  -2.144  1.00 38.03 ? 384  ASP A CB    1 
ATOM   3366 C  CG    . ASP C 3 378 ? 36.897 55.547  -1.929  1.00 39.41 ? 384  ASP A CG    1 
ATOM   3367 O  OD1   . ASP C 3 378 ? 36.775 54.407  -1.427  1.00 39.13 ? 384  ASP A OD1   1 
ATOM   3368 O  OD2   . ASP C 3 378 ? 35.919 56.240  -2.274  1.00 38.90 ? 384  ASP A OD2   1 
ATOM   3369 N  N     . LEU C 3 379 ? 41.101 57.336  -1.306  1.00 35.21 ? 385  LEU A N     1 
ATOM   3370 C  CA    . LEU C 3 379 ? 42.474 57.669  -1.661  1.00 35.63 ? 385  LEU A CA    1 
ATOM   3371 C  C     . LEU C 3 379 ? 43.416 56.984  -0.680  1.00 35.07 ? 385  LEU A C     1 
ATOM   3372 O  O     . LEU C 3 379 ? 44.475 56.484  -1.059  1.00 35.09 ? 385  LEU A O     1 
ATOM   3373 C  CB    . LEU C 3 379 ? 42.689 59.182  -1.618  1.00 34.55 ? 385  LEU A CB    1 
ATOM   3374 C  CG    . LEU C 3 379 ? 41.801 60.018  -2.546  1.00 35.23 ? 385  LEU A CG    1 
ATOM   3375 C  CD1   . LEU C 3 379 ? 42.239 61.472  -2.462  1.00 33.47 ? 385  LEU A CD1   1 
ATOM   3376 C  CD2   . LEU C 3 379 ? 41.902 59.515  -3.983  1.00 33.35 ? 385  LEU A CD2   1 
ATOM   3377 N  N     . ILE C 3 380 ? 43.014 56.959  0.584   1.00 35.39 ? 386  ILE A N     1 
ATOM   3378 C  CA    . ILE C 3 380 ? 43.809 56.328  1.624   1.00 36.21 ? 386  ILE A CA    1 
ATOM   3379 C  C     . ILE C 3 380 ? 43.916 54.819  1.398   1.00 36.43 ? 386  ILE A C     1 
ATOM   3380 O  O     . ILE C 3 380 ? 44.989 54.241  1.530   1.00 35.70 ? 386  ILE A O     1 
ATOM   3381 C  CB    . ILE C 3 380 ? 43.209 56.620  3.019   1.00 36.81 ? 386  ILE A CB    1 
ATOM   3382 C  CG1   . ILE C 3 380 ? 43.434 58.099  3.363   1.00 35.25 ? 386  ILE A CG1   1 
ATOM   3383 C  CG2   . ILE C 3 380 ? 43.824 55.696  4.070   1.00 36.20 ? 386  ILE A CG2   1 
ATOM   3384 C  CD1   . ILE C 3 380 ? 43.014 58.481  4.758   1.00 35.69 ? 386  ILE A CD1   1 
ATOM   3385 N  N     . LYS C 3 381 ? 42.804 54.183  1.050   1.00 37.57 ? 387  LYS A N     1 
ATOM   3386 C  CA    . LYS C 3 381 ? 42.819 52.750  0.798   1.00 37.60 ? 387  LYS A CA    1 
ATOM   3387 C  C     . LYS C 3 381 ? 43.718 52.467  -0.404  1.00 37.06 ? 387  LYS A C     1 
ATOM   3388 O  O     . LYS C 3 381 ? 44.496 51.515  -0.396  1.00 35.29 ? 387  LYS A O     1 
ATOM   3389 C  CB    . LYS C 3 381 ? 41.401 52.232  0.535   1.00 39.35 ? 387  LYS A CB    1 
ATOM   3390 C  CG    . LYS C 3 381 ? 40.442 52.427  1.702   1.00 41.69 ? 387  LYS A CG    1 
ATOM   3391 C  CD    . LYS C 3 381 ? 39.202 51.541  1.570   1.00 45.17 ? 387  LYS A CD    1 
ATOM   3392 C  CE    . LYS C 3 381 ? 38.306 51.960  0.412   1.00 46.37 ? 387  LYS A CE    1 
ATOM   3393 N  NZ    . LYS C 3 381 ? 37.688 53.294  0.660   1.00 47.57 ? 387  LYS A NZ    1 
ATOM   3394 N  N     . GLU C 3 382 ? 43.619 53.304  -1.434  1.00 36.94 ? 388  GLU A N     1 
ATOM   3395 C  CA    . GLU C 3 382 ? 44.447 53.118  -2.617  1.00 36.90 ? 388  GLU A CA    1 
ATOM   3396 C  C     . GLU C 3 382 ? 45.921 53.302  -2.275  1.00 37.59 ? 388  GLU A C     1 
ATOM   3397 O  O     . GLU C 3 382 ? 46.773 52.555  -2.758  1.00 38.54 ? 388  GLU A O     1 
ATOM   3398 C  CB    . GLU C 3 382 ? 44.071 54.102  -3.724  1.00 36.67 ? 388  GLU A CB    1 
ATOM   3399 C  CG    . GLU C 3 382 ? 44.794 53.794  -5.033  1.00 37.51 ? 388  GLU A CG    1 
ATOM   3400 C  CD    . GLU C 3 382 ? 44.546 54.817  -6.124  1.00 37.35 ? 388  GLU A CD    1 
ATOM   3401 O  OE1   . GLU C 3 382 ? 43.621 55.638  -5.979  1.00 38.05 ? 388  GLU A OE1   1 
ATOM   3402 O  OE2   . GLU C 3 382 ? 45.275 54.789  -7.138  1.00 38.94 ? 388  GLU A OE2   1 
ATOM   3403 N  N     . TYR C 3 383 ? 46.215 54.297  -1.441  1.00 35.93 ? 389  TYR A N     1 
ATOM   3404 C  CA    . TYR C 3 383 ? 47.585 54.581  -1.039  1.00 34.93 ? 389  TYR A CA    1 
ATOM   3405 C  C     . TYR C 3 383 ? 48.212 53.398  -0.319  1.00 33.94 ? 389  TYR A C     1 
ATOM   3406 O  O     . TYR C 3 383 ? 49.330 52.991  -0.641  1.00 35.85 ? 389  TYR A O     1 
ATOM   3407 C  CB    . TYR C 3 383 ? 47.626 55.819  -0.135  1.00 33.53 ? 389  TYR A CB    1 
ATOM   3408 C  CG    . TYR C 3 383 ? 49.019 56.241  0.283   1.00 32.08 ? 389  TYR A CG    1 
ATOM   3409 C  CD1   . TYR C 3 383 ? 49.709 55.560  1.288   1.00 32.19 ? 389  TYR A CD1   1 
ATOM   3410 C  CD2   . TYR C 3 383 ? 49.649 57.323  -0.329  1.00 31.20 ? 389  TYR A CD2   1 
ATOM   3411 C  CE1   . TYR C 3 383 ? 50.995 55.947  1.672   1.00 31.46 ? 389  TYR A CE1   1 
ATOM   3412 C  CE2   . TYR C 3 383 ? 50.930 57.719  0.044   1.00 31.72 ? 389  TYR A CE2   1 
ATOM   3413 C  CZ    . TYR C 3 383 ? 51.599 57.031  1.045   1.00 32.79 ? 389  TYR A CZ    1 
ATOM   3414 O  OH    . TYR C 3 383 ? 52.862 57.439  1.428   1.00 33.38 ? 389  TYR A OH    1 
ATOM   3415 N  N     . LEU C 3 384 ? 47.498 52.861  0.664   1.00 33.28 ? 390  LEU A N     1 
ATOM   3416 C  CA    . LEU C 3 384 ? 47.988 51.719  1.431   1.00 33.52 ? 390  LEU A CA    1 
ATOM   3417 C  C     . LEU C 3 384 ? 48.292 50.543  0.501   1.00 32.77 ? 390  LEU A C     1 
ATOM   3418 O  O     . LEU C 3 384 ? 49.305 49.870  0.656   1.00 33.30 ? 390  LEU A O     1 
ATOM   3419 C  CB    . LEU C 3 384 ? 46.960 51.307  2.493   1.00 32.14 ? 390  LEU A CB    1 
ATOM   3420 C  CG    . LEU C 3 384 ? 46.773 52.312  3.641   1.00 34.19 ? 390  LEU A CG    1 
ATOM   3421 C  CD1   . LEU C 3 384 ? 45.577 51.916  4.501   1.00 32.89 ? 390  LEU A CD1   1 
ATOM   3422 C  CD2   . LEU C 3 384 ? 48.041 52.372  4.479   1.00 32.59 ? 390  LEU A CD2   1 
ATOM   3423 N  N     . MET C 3 385 ? 47.419 50.311  -0.471  1.00 31.78 ? 391  MET A N     1 
ATOM   3424 C  CA    . MET C 3 385 ? 47.615 49.227  -1.423  1.00 32.31 ? 391  MET A CA    1 
ATOM   3425 C  C     . MET C 3 385 ? 48.849 49.490  -2.297  1.00 31.25 ? 391  MET A C     1 
ATOM   3426 O  O     . MET C 3 385 ? 49.681 48.601  -2.491  1.00 30.15 ? 391  MET A O     1 
ATOM   3427 C  CB    . MET C 3 385 ? 46.358 49.057  -2.289  1.00 32.49 ? 391  MET A CB    1 
ATOM   3428 C  CG    . MET C 3 385 ? 46.481 48.026  -3.409  1.00 34.22 ? 391  MET A CG    1 
ATOM   3429 S  SD    . MET C 3 385 ? 46.739 48.775  -5.039  1.00 34.36 ? 391  MET A SD    1 
ATOM   3430 C  CE    . MET C 3 385 ? 48.455 48.665  -5.179  1.00 36.51 ? 391  MET A CE    1 
ATOM   3431 N  N     . ILE C 3 386 ? 48.973 50.712  -2.811  1.00 29.66 ? 392  ILE A N     1 
ATOM   3432 C  CA    . ILE C 3 386 ? 50.115 51.076  -3.642  1.00 28.80 ? 392  ILE A CA    1 
ATOM   3433 C  C     . ILE C 3 386 ? 51.411 50.839  -2.865  1.00 29.68 ? 392  ILE A C     1 
ATOM   3434 O  O     . ILE C 3 386 ? 52.398 50.325  -3.406  1.00 29.13 ? 392  ILE A O     1 
ATOM   3435 C  CB    . ILE C 3 386 ? 50.066 52.569  -4.043  1.00 31.18 ? 392  ILE A CB    1 
ATOM   3436 C  CG1   . ILE C 3 386 ? 48.780 52.872  -4.829  1.00 31.12 ? 392  ILE A CG1   1 
ATOM   3437 C  CG2   . ILE C 3 386 ? 51.333 52.941  -4.828  1.00 29.22 ? 392  ILE A CG2   1 
ATOM   3438 C  CD1   . ILE C 3 386 ? 48.682 52.207  -6.185  1.00 30.91 ? 392  ILE A CD1   1 
ATOM   3439 N  N     . GLN C 3 387 ? 51.411 51.225  -1.593  1.00 29.43 ? 393  GLN A N     1 
ATOM   3440 C  CA    . GLN C 3 387 ? 52.594 51.053  -0.761  1.00 29.73 ? 393  GLN A CA    1 
ATOM   3441 C  C     . GLN C 3 387 ? 52.883 49.570  -0.548  1.00 29.00 ? 393  GLN A C     1 
ATOM   3442 O  O     . GLN C 3 387 ? 54.040 49.163  -0.439  1.00 29.13 ? 393  GLN A O     1 
ATOM   3443 C  CB    . GLN C 3 387 ? 52.407 51.750  0.588   1.00 29.96 ? 393  GLN A CB    1 
ATOM   3444 C  CG    . GLN C 3 387 ? 53.682 51.847  1.406   1.00 30.02 ? 393  GLN A CG    1 
ATOM   3445 C  CD    . GLN C 3 387 ? 54.823 52.481  0.630   1.00 31.91 ? 393  GLN A CD    1 
ATOM   3446 O  OE1   . GLN C 3 387 ? 54.663 53.542  0.033   1.00 31.72 ? 393  GLN A OE1   1 
ATOM   3447 N  NE2   . GLN C 3 387 ? 55.988 51.835  0.644   1.00 30.94 ? 393  GLN A NE2   1 
ATOM   3448 N  N     . LYS C 3 388 ? 51.823 48.770  -0.500  1.00 28.36 ? 394  LYS A N     1 
ATOM   3449 C  CA    . LYS C 3 388 ? 51.957 47.330  -0.316  1.00 29.33 ? 394  LYS A CA    1 
ATOM   3450 C  C     . LYS C 3 388 ? 52.749 46.740  -1.481  1.00 26.72 ? 394  LYS A C     1 
ATOM   3451 O  O     . LYS C 3 388 ? 53.598 45.868  -1.290  1.00 26.14 ? 394  LYS A O     1 
ATOM   3452 C  CB    . LYS C 3 388 ? 50.573 46.681  -0.250  1.00 30.88 ? 394  LYS A CB    1 
ATOM   3453 C  CG    . LYS C 3 388 ? 50.560 45.279  0.341   1.00 33.06 ? 394  LYS A CG    1 
ATOM   3454 C  CD    . LYS C 3 388 ? 51.132 45.278  1.755   1.00 36.00 ? 394  LYS A CD    1 
ATOM   3455 C  CE    . LYS C 3 388 ? 50.774 44.000  2.499   1.00 37.46 ? 394  LYS A CE    1 
ATOM   3456 N  NZ    . LYS C 3 388 ? 51.094 42.800  1.691   1.00 39.80 ? 394  LYS A NZ    1 
ATOM   3457 N  N     . ARG C 3 389 ? 52.474 47.240  -2.684  1.00 25.39 ? 395  ARG A N     1 
ATOM   3458 C  CA    . ARG C 3 389 ? 53.146 46.776  -3.896  1.00 24.97 ? 395  ARG A CA    1 
ATOM   3459 C  C     . ARG C 3 389 ? 54.554 47.320  -4.026  1.00 25.00 ? 395  ARG A C     1 
ATOM   3460 O  O     . ARG C 3 389 ? 55.447 46.621  -4.489  1.00 27.76 ? 395  ARG A O     1 
ATOM   3461 C  CB    . ARG C 3 389 ? 52.341 47.170  -5.130  1.00 23.31 ? 395  ARG A CB    1 
ATOM   3462 C  CG    . ARG C 3 389 ? 50.925 46.629  -5.127  1.00 23.28 ? 395  ARG A CG    1 
ATOM   3463 C  CD    . ARG C 3 389 ? 50.892 45.109  -5.201  1.00 24.85 ? 395  ARG A CD    1 
ATOM   3464 N  NE    . ARG C 3 389 ? 49.519 44.635  -5.357  1.00 27.02 ? 395  ARG A NE    1 
ATOM   3465 C  CZ    . ARG C 3 389 ? 48.691 44.382  -4.352  1.00 26.70 ? 395  ARG A CZ    1 
ATOM   3466 N  NH1   . ARG C 3 389 ? 49.090 44.538  -3.099  1.00 28.97 ? 395  ARG A NH1   1 
ATOM   3467 N  NH2   . ARG C 3 389 ? 47.447 44.010  -4.604  1.00 28.16 ? 395  ARG A NH2   1 
ATOM   3468 N  N     . ILE C 3 390 ? 54.755 48.570  -3.629  1.00 25.32 ? 396  ILE A N     1 
ATOM   3469 C  CA    . ILE C 3 390 ? 56.075 49.180  -3.703  1.00 23.84 ? 396  ILE A CA    1 
ATOM   3470 C  C     . ILE C 3 390 ? 56.994 48.498  -2.700  1.00 23.37 ? 396  ILE A C     1 
ATOM   3471 O  O     . ILE C 3 390 ? 58.170 48.267  -2.974  1.00 21.68 ? 396  ILE A O     1 
ATOM   3472 C  CB    . ILE C 3 390 ? 56.020 50.700  -3.383  1.00 25.25 ? 396  ILE A CB    1 
ATOM   3473 C  CG1   . ILE C 3 390 ? 55.330 51.451  -4.532  1.00 25.07 ? 396  ILE A CG1   1 
ATOM   3474 C  CG2   . ILE C 3 390 ? 57.424 51.239  -3.138  1.00 21.86 ? 396  ILE A CG2   1 
ATOM   3475 C  CD1   . ILE C 3 390 ? 55.145 52.948  -4.279  1.00 22.87 ? 396  ILE A CD1   1 
ATOM   3476 N  N     . GLY C 3 391 ? 56.448 48.177  -1.533  1.00 24.16 ? 397  GLY A N     1 
ATOM   3477 C  CA    . GLY C 3 391 ? 57.243 47.524  -0.513  1.00 24.12 ? 397  GLY A CA    1 
ATOM   3478 C  C     . GLY C 3 391 ? 57.723 46.146  -0.939  1.00 23.84 ? 397  GLY A C     1 
ATOM   3479 O  O     . GLY C 3 391 ? 58.901 45.818  -0.816  1.00 23.42 ? 397  GLY A O     1 
ATOM   3480 N  N     . GLN C 3 392 ? 56.812 45.340  -1.462  1.00 24.11 ? 398  GLN A N     1 
ATOM   3481 C  CA    . GLN C 3 392 ? 57.165 43.992  -1.875  1.00 25.08 ? 398  GLN A CA    1 
ATOM   3482 C  C     . GLN C 3 392 ? 58.029 43.945  -3.129  1.00 25.05 ? 398  GLN A C     1 
ATOM   3483 O  O     . GLN C 3 392 ? 58.963 43.143  -3.225  1.00 26.01 ? 398  GLN A O     1 
ATOM   3484 C  CB    . GLN C 3 392 ? 55.896 43.159  -2.092  1.00 25.14 ? 398  GLN A CB    1 
ATOM   3485 C  CG    . GLN C 3 392 ? 56.173 41.728  -2.535  1.00 27.09 ? 398  GLN A CG    1 
ATOM   3486 C  CD    . GLN C 3 392 ? 54.930 40.864  -2.536  1.00 27.51 ? 398  GLN A CD    1 
ATOM   3487 O  OE1   . GLN C 3 392 ? 53.810 41.375  -2.513  1.00 26.61 ? 398  GLN A OE1   1 
ATOM   3488 N  NE2   . GLN C 3 392 ? 55.121 39.544  -2.574  1.00 25.99 ? 398  GLN A NE2   1 
ATOM   3489 N  N     . SER C 3 393 ? 57.740 44.825  -4.076  1.00 24.05 ? 399  SER A N     1 
ATOM   3490 C  CA    . SER C 3 393 ? 58.475 44.834  -5.328  1.00 25.21 ? 399  SER A CA    1 
ATOM   3491 C  C     . SER C 3 393 ? 59.780 45.607  -5.351  1.00 26.08 ? 399  SER A C     1 
ATOM   3492 O  O     . SER C 3 393 ? 60.715 45.207  -6.048  1.00 25.73 ? 399  SER A O     1 
ATOM   3493 C  CB    . SER C 3 393 ? 57.587 45.374  -6.455  1.00 25.56 ? 399  SER A CB    1 
ATOM   3494 O  OG    . SER C 3 393 ? 57.353 46.768  -6.298  1.00 24.07 ? 399  SER A OG    1 
ATOM   3495 N  N     . ALA C 3 394 ? 59.875 46.689  -4.583  1.00 27.34 ? 400  ALA A N     1 
ATOM   3496 C  CA    . ALA C 3 394 ? 61.083 47.495  -4.674  1.00 28.60 ? 400  ALA A CA    1 
ATOM   3497 C  C     . ALA C 3 394 ? 61.738 48.123  -3.448  1.00 29.06 ? 400  ALA A C     1 
ATOM   3498 O  O     . ALA C 3 394 ? 62.966 48.152  -3.362  1.00 30.40 ? 400  ALA A O     1 
ATOM   3499 C  CB    . ALA C 3 394 ? 60.844 48.584  -5.716  1.00 27.96 ? 400  ALA A CB    1 
ATOM   3500 N  N     . GLU C 3 395 ? 60.953 48.634  -2.507  1.00 29.38 ? 401  GLU A N     1 
ATOM   3501 C  CA    . GLU C 3 395 ? 61.556 49.308  -1.361  1.00 30.10 ? 401  GLU A CA    1 
ATOM   3502 C  C     . GLU C 3 395 ? 61.813 48.505  -0.100  1.00 29.03 ? 401  GLU A C     1 
ATOM   3503 O  O     . GLU C 3 395 ? 62.725 48.836  0.648   1.00 29.91 ? 401  GLU A O     1 
ATOM   3504 C  CB    . GLU C 3 395 ? 60.745 50.563  -1.000  1.00 30.25 ? 401  GLU A CB    1 
ATOM   3505 C  CG    . GLU C 3 395 ? 60.612 51.553  -2.151  1.00 31.56 ? 401  GLU A CG    1 
ATOM   3506 C  CD    . GLU C 3 395 ? 59.967 52.872  -1.743  1.00 33.68 ? 401  GLU A CD    1 
ATOM   3507 O  OE1   . GLU C 3 395 ? 59.244 52.903  -0.720  1.00 35.01 ? 401  GLU A OE1   1 
ATOM   3508 O  OE2   . GLU C 3 395 ? 60.174 53.879  -2.458  1.00 30.75 ? 401  GLU A OE2   1 
ATOM   3509 N  N     . GLY C 3 396 ? 61.023 47.466  0.151   1.00 28.06 ? 402  GLY A N     1 
ATOM   3510 C  CA    . GLY C 3 396 ? 61.230 46.680  1.355   1.00 27.21 ? 402  GLY A CA    1 
ATOM   3511 C  C     . GLY C 3 396 ? 62.597 46.025  1.403   1.00 28.37 ? 402  GLY A C     1 
ATOM   3512 O  O     . GLY C 3 396 ? 63.257 45.887  0.368   1.00 28.73 ? 402  GLY A O     1 
ATOM   3513 N  N     . ASP C 3 397 ? 63.031 45.626  2.599   1.00 29.19 ? 403  ASP A N     1 
ATOM   3514 C  CA    . ASP C 3 397 ? 64.326 44.958  2.762   1.00 29.84 ? 403  ASP A CA    1 
ATOM   3515 C  C     . ASP C 3 397 ? 64.377 43.659  1.954   1.00 29.08 ? 403  ASP A C     1 
ATOM   3516 O  O     . ASP C 3 397 ? 65.440 43.265  1.482   1.00 29.49 ? 403  ASP A O     1 
ATOM   3517 C  CB    . ASP C 3 397 ? 64.594 44.620  4.238   1.00 33.05 ? 403  ASP A CB    1 
ATOM   3518 C  CG    . ASP C 3 397 ? 64.650 45.848  5.123   1.00 36.14 ? 403  ASP A CG    1 
ATOM   3519 O  OD1   . ASP C 3 397 ? 65.292 46.849  4.724   1.00 38.93 ? 403  ASP A OD1   1 
ATOM   3520 O  OD2   . ASP C 3 397 ? 64.062 45.810  6.226   1.00 37.71 ? 403  ASP A OD2   1 
ATOM   3521 N  N     . LYS C 3 398 ? 63.222 43.008  1.802   1.00 27.86 ? 404  LYS A N     1 
ATOM   3522 C  CA    . LYS C 3 398 ? 63.106 41.743  1.067   1.00 27.50 ? 404  LYS A CA    1 
ATOM   3523 C  C     . LYS C 3 398 ? 62.544 41.918  -0.350  1.00 26.66 ? 404  LYS A C     1 
ATOM   3524 O  O     . LYS C 3 398 ? 62.096 40.953  -0.959  1.00 27.67 ? 404  LYS A O     1 
ATOM   3525 C  CB    . LYS C 3 398 ? 62.188 40.778  1.830   1.00 27.42 ? 404  LYS A CB    1 
ATOM   3526 C  CG    . LYS C 3 398 ? 62.552 40.540  3.292   1.00 29.32 ? 404  LYS A CG    1 
ATOM   3527 C  CD    . LYS C 3 398 ? 63.758 39.630  3.437   1.00 30.79 ? 404  LYS A CD    1 
ATOM   3528 C  CE    . LYS C 3 398 ? 64.128 39.431  4.899   1.00 34.61 ? 404  LYS A CE    1 
ATOM   3529 N  NZ    . LYS C 3 398 ? 62.974 38.938  5.720   1.00 37.00 ? 404  LYS A NZ    1 
ATOM   3530 N  N     . ALA C 3 399 ? 62.573 43.136  -0.877  1.00 25.69 ? 405  ALA A N     1 
ATOM   3531 C  CA    . ALA C 3 399 ? 62.031 43.404  -2.215  1.00 24.64 ? 405  ALA A CA    1 
ATOM   3532 C  C     . ALA C 3 399 ? 62.666 42.612  -3.364  1.00 22.57 ? 405  ALA A C     1 
ATOM   3533 O  O     . ALA C 3 399 ? 63.852 42.285  -3.342  1.00 20.75 ? 405  ALA A O     1 
ATOM   3534 C  CB    . ALA C 3 399 ? 62.112 44.907  -2.513  1.00 24.01 ? 405  ALA A CB    1 
ATOM   3535 N  N     . TRP C 3 400 ? 61.859 42.319  -4.377  1.00 23.33 ? 406  TRP A N     1 
ATOM   3536 C  CA    . TRP C 3 400 ? 62.333 41.581  -5.548  1.00 24.99 ? 406  TRP A CA    1 
ATOM   3537 C  C     . TRP C 3 400 ? 63.545 42.248  -6.215  1.00 25.54 ? 406  TRP A C     1 
ATOM   3538 O  O     . TRP C 3 400 ? 64.531 41.581  -6.537  1.00 27.67 ? 406  TRP A O     1 
ATOM   3539 C  CB    . TRP C 3 400 ? 61.204 41.435  -6.580  1.00 23.32 ? 406  TRP A CB    1 
ATOM   3540 C  CG    . TRP C 3 400 ? 59.946 40.822  -6.023  1.00 21.32 ? 406  TRP A CG    1 
ATOM   3541 C  CD1   . TRP C 3 400 ? 59.861 39.882  -5.035  1.00 19.15 ? 406  TRP A CD1   1 
ATOM   3542 C  CD2   . TRP C 3 400 ? 58.599 41.104  -6.424  1.00 20.51 ? 406  TRP A CD2   1 
ATOM   3543 N  NE1   . TRP C 3 400 ? 58.550 39.565  -4.792  1.00 19.71 ? 406  TRP A NE1   1 
ATOM   3544 C  CE2   . TRP C 3 400 ? 57.751 40.298  -5.629  1.00 20.68 ? 406  TRP A CE2   1 
ATOM   3545 C  CE3   . TRP C 3 400 ? 58.026 41.958  -7.373  1.00 21.25 ? 406  TRP A CE3   1 
ATOM   3546 C  CZ2   . TRP C 3 400 ? 56.358 40.323  -5.753  1.00 20.85 ? 406  TRP A CZ2   1 
ATOM   3547 C  CZ3   . TRP C 3 400 ? 56.636 41.985  -7.499  1.00 21.54 ? 406  TRP A CZ3   1 
ATOM   3548 C  CH2   . TRP C 3 400 ? 55.820 41.170  -6.690  1.00 22.64 ? 406  TRP A CH2   1 
ATOM   3549 N  N     . LEU C 3 401 ? 63.470 43.560  -6.418  1.00 26.39 ? 407  LEU A N     1 
ATOM   3550 C  CA    . LEU C 3 401 ? 64.556 44.309  -7.053  1.00 26.61 ? 407  LEU A CA    1 
ATOM   3551 C  C     . LEU C 3 401 ? 65.854 44.264  -6.260  1.00 26.99 ? 407  LEU A C     1 
ATOM   3552 O  O     . LEU C 3 401 ? 66.924 44.513  -6.812  1.00 28.29 ? 407  LEU A O     1 
ATOM   3553 C  CB    . LEU C 3 401 ? 64.143 45.770  -7.268  1.00 26.62 ? 407  LEU A CB    1 
ATOM   3554 C  CG    . LEU C 3 401 ? 63.079 46.055  -8.336  1.00 27.40 ? 407  LEU A CG    1 
ATOM   3555 C  CD1   . LEU C 3 401 ? 62.754 47.537  -8.333  1.00 27.59 ? 407  LEU A CD1   1 
ATOM   3556 C  CD2   . LEU C 3 401 ? 63.587 45.625  -9.716  1.00 27.49 ? 407  LEU A CD2   1 
ATOM   3557 N  N     . ARG C 3 402 ? 65.760 43.961  -4.969  1.00 26.43 ? 408  ARG A N     1 
ATOM   3558 C  CA    . ARG C 3 402 ? 66.943 43.873  -4.121  1.00 26.45 ? 408  ARG A CA    1 
ATOM   3559 C  C     . ARG C 3 402 ? 67.506 42.460  -4.168  1.00 26.52 ? 408  ARG A C     1 
ATOM   3560 O  O     . ARG C 3 402 ? 68.666 42.246  -3.831  1.00 26.95 ? 408  ARG A O     1 
ATOM   3561 C  CB    . ARG C 3 402 ? 66.618 44.220  -2.659  1.00 26.86 ? 408  ARG A CB    1 
ATOM   3562 C  CG    . ARG C 3 402 ? 66.196 45.672  -2.407  1.00 28.62 ? 408  ARG A CG    1 
ATOM   3563 C  CD    . ARG C 3 402 ? 65.921 45.917  -0.923  1.00 28.63 ? 408  ARG A CD    1 
ATOM   3564 N  NE    . ARG C 3 402 ? 65.221 47.180  -0.670  1.00 31.91 ? 408  ARG A NE    1 
ATOM   3565 C  CZ    . ARG C 3 402 ? 65.750 48.397  -0.835  1.00 32.78 ? 408  ARG A CZ    1 
ATOM   3566 N  NH1   . ARG C 3 402 ? 67.002 48.543  -1.257  1.00 32.66 ? 408  ARG A NH1   1 
ATOM   3567 N  NH2   . ARG C 3 402 ? 65.025 49.475  -0.573  1.00 31.93 ? 408  ARG A NH2   1 
ATOM   3568 N  N     . TYR C 3 403 ? 66.693 41.499  -4.599  1.00 26.81 ? 409  TYR A N     1 
ATOM   3569 C  CA    . TYR C 3 403 ? 67.142 40.111  -4.652  1.00 26.82 ? 409  TYR A CA    1 
ATOM   3570 C  C     . TYR C 3 403 ? 67.542 39.538  -6.009  1.00 27.21 ? 409  TYR A C     1 
ATOM   3571 O  O     . TYR C 3 403 ? 68.149 38.471  -6.060  1.00 26.55 ? 409  TYR A O     1 
ATOM   3572 C  CB    . TYR C 3 403 ? 66.087 39.208  -4.004  1.00 28.34 ? 409  TYR A CB    1 
ATOM   3573 C  CG    . TYR C 3 403 ? 66.284 39.030  -2.513  1.00 30.11 ? 409  TYR A CG    1 
ATOM   3574 C  CD1   . TYR C 3 403 ? 67.254 38.155  -2.021  1.00 29.53 ? 409  TYR A CD1   1 
ATOM   3575 C  CD2   . TYR C 3 403 ? 65.532 39.763  -1.596  1.00 31.81 ? 409  TYR A CD2   1 
ATOM   3576 C  CE1   . TYR C 3 403 ? 67.475 38.015  -0.660  1.00 31.82 ? 409  TYR A CE1   1 
ATOM   3577 C  CE2   . TYR C 3 403 ? 65.744 39.633  -0.221  1.00 33.87 ? 409  TYR A CE2   1 
ATOM   3578 C  CZ    . TYR C 3 403 ? 66.718 38.758  0.239   1.00 34.40 ? 409  TYR A CZ    1 
ATOM   3579 O  OH    . TYR C 3 403 ? 66.948 38.638  1.591   1.00 35.81 ? 409  TYR A OH    1 
ATOM   3580 N  N     . VAL C 3 404 ? 67.223 40.220  -7.106  1.00 27.36 ? 410  VAL A N     1 
ATOM   3581 C  CA    . VAL C 3 404 ? 67.594 39.697  -8.422  1.00 28.85 ? 410  VAL A CA    1 
ATOM   3582 C  C     . VAL C 3 404 ? 69.105 39.511  -8.490  1.00 29.12 ? 410  VAL A C     1 
ATOM   3583 O  O     . VAL C 3 404 ? 69.859 40.398  -8.095  1.00 28.70 ? 410  VAL A O     1 
ATOM   3584 C  CB    . VAL C 3 404 ? 67.208 40.650  -9.571  1.00 31.65 ? 410  VAL A CB    1 
ATOM   3585 C  CG1   . VAL C 3 404 ? 67.109 39.854  -10.881 1.00 29.72 ? 410  VAL A CG1   1 
ATOM   3586 C  CG2   . VAL C 3 404 ? 65.907 41.375  -9.254  1.00 31.98 ? 410  VAL A CG2   1 
ATOM   3587 N  N     . ALA C 3 405 ? 69.547 38.366  -9.007  1.00 30.09 ? 411  ALA A N     1 
ATOM   3588 C  CA    . ALA C 3 405 ? 70.976 38.072  -9.111  1.00 30.43 ? 411  ALA A CA    1 
ATOM   3589 C  C     . ALA C 3 405 ? 71.570 38.491  -10.460 1.00 32.01 ? 411  ALA A C     1 
ATOM   3590 O  O     . ALA C 3 405 ? 70.850 38.953  -11.343 1.00 31.34 ? 411  ALA A O     1 
ATOM   3591 C  CB    . ALA C 3 405 ? 71.208 36.582  -8.866  1.00 26.85 ? 411  ALA A CB    1 
ATOM   3592 N  N     . GLU C 3 406 ? 72.885 38.333  -10.613 1.00 35.17 ? 412  GLU A N     1 
ATOM   3593 C  CA    . GLU C 3 406 ? 73.563 38.697  -11.863 1.00 37.11 ? 412  GLU A CA    1 
ATOM   3594 C  C     . GLU C 3 406 ? 72.991 37.895  -13.025 1.00 35.41 ? 412  GLU A C     1 
ATOM   3595 O  O     . GLU C 3 406 ? 72.930 38.380  -14.154 1.00 35.76 ? 412  GLU A O     1 
ATOM   3596 C  CB    . GLU C 3 406 ? 75.071 38.407  -11.793 1.00 41.70 ? 412  GLU A CB    1 
ATOM   3597 C  CG    . GLU C 3 406 ? 75.854 39.108  -10.681 1.00 48.41 ? 412  GLU A CG    1 
ATOM   3598 C  CD    . GLU C 3 406 ? 75.908 40.620  -10.838 1.00 52.14 ? 412  GLU A CD    1 
ATOM   3599 O  OE1   . GLU C 3 406 ? 76.297 41.106  -11.927 1.00 53.15 ? 412  GLU A OE1   1 
ATOM   3600 O  OE2   . GLU C 3 406 ? 75.569 41.323  -9.856  1.00 54.67 ? 412  GLU A OE2   1 
ATOM   3601 N  N     . ASP C 3 407 ? 72.582 36.660  -12.746 1.00 32.41 ? 413  ASP A N     1 
ATOM   3602 C  CA    . ASP C 3 407 ? 72.041 35.798  -13.785 1.00 30.33 ? 413  ASP A CA    1 
ATOM   3603 C  C     . ASP C 3 407 ? 70.598 36.123  -14.165 1.00 28.50 ? 413  ASP A C     1 
ATOM   3604 O  O     . ASP C 3 407 ? 69.956 35.350  -14.873 1.00 29.31 ? 413  ASP A O     1 
ATOM   3605 C  CB    . ASP C 3 407 ? 72.153 34.324  -13.365 1.00 29.69 ? 413  ASP A CB    1 
ATOM   3606 C  CG    . ASP C 3 407 ? 71.420 34.018  -12.061 1.00 30.37 ? 413  ASP A CG    1 
ATOM   3607 O  OD1   . ASP C 3 407 ? 70.609 34.847  -11.609 1.00 29.58 ? 413  ASP A OD1   1 
ATOM   3608 O  OD2   . ASP C 3 407 ? 71.650 32.929  -11.494 1.00 32.57 ? 413  ASP A OD2   1 
ATOM   3609 N  N     . GLY C 3 408 ? 70.092 37.258  -13.694 1.00 27.21 ? 414  GLY A N     1 
ATOM   3610 C  CA    . GLY C 3 408 ? 68.726 37.658  -14.008 1.00 26.85 ? 414  GLY A CA    1 
ATOM   3611 C  C     . GLY C 3 408 ? 67.623 36.825  -13.364 1.00 27.11 ? 414  GLY A C     1 
ATOM   3612 O  O     . GLY C 3 408 ? 66.497 36.768  -13.856 1.00 25.81 ? 414  GLY A O     1 
ATOM   3613 N  N     . LYS C 3 409 ? 67.929 36.182  -12.247 1.00 26.19 ? 415  LYS A N     1 
ATOM   3614 C  CA    . LYS C 3 409 ? 66.929 35.355  -11.594 1.00 25.98 ? 415  LYS A CA    1 
ATOM   3615 C  C     . LYS C 3 409 ? 66.878 35.602  -10.095 1.00 24.32 ? 415  LYS A C     1 
ATOM   3616 O  O     . LYS C 3 409 ? 67.868 36.020  -9.484  1.00 23.37 ? 415  LYS A O     1 
ATOM   3617 C  CB    . LYS C 3 409 ? 67.243 33.873  -11.844 1.00 26.64 ? 415  LYS A CB    1 
ATOM   3618 C  CG    . LYS C 3 409 ? 67.313 33.474  -13.314 1.00 27.22 ? 415  LYS A CG    1 
ATOM   3619 C  CD    . LYS C 3 409 ? 68.034 32.142  -13.490 1.00 28.98 ? 415  LYS A CD    1 
ATOM   3620 C  CE    . LYS C 3 409 ? 67.994 31.650  -14.941 1.00 31.04 ? 415  LYS A CE    1 
ATOM   3621 N  NZ    . LYS C 3 409 ? 68.623 32.596  -15.912 1.00 34.46 ? 415  LYS A NZ    1 
ATOM   3622 N  N     . ILE C 3 410 ? 65.714 35.353  -9.512  1.00 21.52 ? 416  ILE A N     1 
ATOM   3623 C  CA    . ILE C 3 410 ? 65.548 35.476  -8.069  1.00 21.37 ? 416  ILE A CA    1 
ATOM   3624 C  C     . ILE C 3 410 ? 65.641 34.052  -7.507  1.00 21.18 ? 416  ILE A C     1 
ATOM   3625 O  O     . ILE C 3 410 ? 64.877 33.161  -7.898  1.00 20.13 ? 416  ILE A O     1 
ATOM   3626 C  CB    . ILE C 3 410 ? 64.188 36.092  -7.693  1.00 20.57 ? 416  ILE A CB    1 
ATOM   3627 C  CG1   . ILE C 3 410 ? 64.191 37.587  -8.022  1.00 17.44 ? 416  ILE A CG1   1 
ATOM   3628 C  CG2   . ILE C 3 410 ? 63.899 35.853  -6.205  1.00 19.51 ? 416  ILE A CG2   1 
ATOM   3629 C  CD1   . ILE C 3 410 ? 62.858 38.253  -7.838  1.00 16.88 ? 416  ILE A CD1   1 
ATOM   3630 N  N     . HIS C 3 411 ? 66.596 33.846  -6.609  1.00 20.53 ? 417  HIS A N     1 
ATOM   3631 C  CA    . HIS C 3 411 ? 66.822 32.543  -6.000  1.00 19.96 ? 417  HIS A CA    1 
ATOM   3632 C  C     . HIS C 3 411 ? 66.207 32.420  -4.605  1.00 20.23 ? 417  HIS A C     1 
ATOM   3633 O  O     . HIS C 3 411 ? 66.918 32.326  -3.611  1.00 20.02 ? 417  HIS A O     1 
ATOM   3634 C  CB    . HIS C 3 411 ? 68.322 32.277  -5.939  1.00 19.23 ? 417  HIS A CB    1 
ATOM   3635 C  CG    . HIS C 3 411 ? 68.968 32.189  -7.287  1.00 23.31 ? 417  HIS A CG    1 
ATOM   3636 N  ND1   . HIS C 3 411 ? 69.213 30.987  -7.920  1.00 22.47 ? 417  HIS A ND1   1 
ATOM   3637 C  CD2   . HIS C 3 411 ? 69.384 33.156  -8.141  1.00 21.55 ? 417  HIS A CD2   1 
ATOM   3638 C  CE1   . HIS C 3 411 ? 69.751 31.219  -9.104  1.00 22.69 ? 417  HIS A CE1   1 
ATOM   3639 N  NE2   . HIS C 3 411 ? 69.865 32.525  -9.263  1.00 23.93 ? 417  HIS A NE2   1 
ATOM   3640 N  N     . GLY C 3 412 ? 64.879 32.414  -4.547  1.00 20.79 ? 418  GLY A N     1 
ATOM   3641 C  CA    . GLY C 3 412 ? 64.182 32.299  -3.279  1.00 21.13 ? 418  GLY A CA    1 
ATOM   3642 C  C     . GLY C 3 412 ? 64.607 31.090  -2.470  1.00 21.36 ? 418  GLY A C     1 
ATOM   3643 O  O     . GLY C 3 412 ? 64.897 30.025  -3.015  1.00 19.88 ? 418  GLY A O     1 
ATOM   3644 N  N     . SER C 3 413 ? 64.650 31.261  -1.155  1.00 21.22 ? 419  SER A N     1 
ATOM   3645 C  CA    . SER C 3 413 ? 65.046 30.185  -0.261  1.00 21.84 ? 419  SER A CA    1 
ATOM   3646 C  C     . SER C 3 413 ? 63.825 29.350  0.111   1.00 23.13 ? 419  SER A C     1 
ATOM   3647 O  O     . SER C 3 413 ? 62.698 29.846  0.092   1.00 25.28 ? 419  SER A O     1 
ATOM   3648 C  CB    . SER C 3 413 ? 65.689 30.774  0.992   1.00 21.57 ? 419  SER A CB    1 
ATOM   3649 O  OG    . SER C 3 413 ? 66.136 29.757  1.862   1.00 22.00 ? 419  SER A OG    1 
ATOM   3650 N  N     . VAL C 3 414 ? 64.040 28.079  0.436   1.00 22.09 ? 420  VAL A N     1 
ATOM   3651 C  CA    . VAL C 3 414 ? 62.928 27.213  0.809   1.00 21.60 ? 420  VAL A CA    1 
ATOM   3652 C  C     . VAL C 3 414 ? 63.265 26.247  1.936   1.00 22.23 ? 420  VAL A C     1 
ATOM   3653 O  O     . VAL C 3 414 ? 64.214 25.469  1.834   1.00 24.73 ? 420  VAL A O     1 
ATOM   3654 C  CB    . VAL C 3 414 ? 62.427 26.353  -0.389  1.00 21.91 ? 420  VAL A CB    1 
ATOM   3655 C  CG1   . VAL C 3 414 ? 61.347 25.379  0.085   1.00 20.41 ? 420  VAL A CG1   1 
ATOM   3656 C  CG2   . VAL C 3 414 ? 61.869 27.237  -1.496  1.00 19.59 ? 420  VAL A CG2   1 
ATOM   3657 N  N     . ASN C 3 415 ? 62.497 26.302  3.018   1.00 19.92 ? 421  ASN A N     1 
ATOM   3658 C  CA    . ASN C 3 415 ? 62.693 25.360  4.118   1.00 20.45 ? 421  ASN A CA    1 
ATOM   3659 C  C     . ASN C 3 415 ? 61.675 24.268  3.766   1.00 18.77 ? 421  ASN A C     1 
ATOM   3660 O  O     . ASN C 3 415 ? 60.478 24.438  3.984   1.00 19.48 ? 421  ASN A O     1 
ATOM   3661 C  CB    . ASN C 3 415 ? 62.339 26.001  5.457   1.00 20.25 ? 421  ASN A CB    1 
ATOM   3662 C  CG    . ASN C 3 415 ? 62.556 25.064  6.618   1.00 22.08 ? 421  ASN A CG    1 
ATOM   3663 O  OD1   . ASN C 3 415 ? 62.429 23.851  6.472   1.00 21.31 ? 421  ASN A OD1   1 
ATOM   3664 N  ND2   . ASN C 3 415 ? 62.862 25.621  7.790   1.00 24.54 ? 421  ASN A ND2   1 
ATOM   3665 N  N     . PRO C 3 416 ? 62.144 23.136  3.217   1.00 17.88 ? 422  PRO A N     1 
ATOM   3666 C  CA    . PRO C 3 416 ? 61.292 22.012  2.811   1.00 19.11 ? 422  PRO A CA    1 
ATOM   3667 C  C     . PRO C 3 416 ? 60.281 21.507  3.823   1.00 19.02 ? 422  PRO A C     1 
ATOM   3668 O  O     . PRO C 3 416 ? 59.226 21.006  3.446   1.00 20.09 ? 422  PRO A O     1 
ATOM   3669 C  CB    . PRO C 3 416 ? 62.299 20.929  2.421   1.00 18.22 ? 422  PRO A CB    1 
ATOM   3670 C  CG    . PRO C 3 416 ? 63.500 21.702  2.027   1.00 18.19 ? 422  PRO A CG    1 
ATOM   3671 C  CD    . PRO C 3 416 ? 63.563 22.761  3.097   1.00 17.98 ? 422  PRO A CD    1 
ATOM   3672 N  N     . ASN C 3 417 ? 60.593 21.648  5.105   1.00 20.34 ? 423  ASN A N     1 
ATOM   3673 C  CA    . ASN C 3 417 ? 59.704 21.172  6.159   1.00 21.51 ? 423  ASN A CA    1 
ATOM   3674 C  C     . ASN C 3 417 ? 59.523 22.215  7.264   1.00 21.84 ? 423  ASN A C     1 
ATOM   3675 O  O     . ASN C 3 417 ? 59.373 21.865  8.427   1.00 24.74 ? 423  ASN A O     1 
ATOM   3676 C  CB    . ASN C 3 417 ? 60.284 19.881  6.738   1.00 21.02 ? 423  ASN A CB    1 
ATOM   3677 C  CG    . ASN C 3 417 ? 59.234 19.000  7.384   1.00 20.87 ? 423  ASN A CG    1 
ATOM   3678 O  OD1   . ASN C 3 417 ? 58.129 18.839  6.865   1.00 20.58 ? 423  ASN A OD1   1 
ATOM   3679 N  ND2   . ASN C 3 417 ? 59.587 18.403  8.513   1.00 21.25 ? 423  ASN A ND2   1 
ATOM   3680 N  N     . GLY C 3 418 ? 59.530 23.490  6.886   1.00 21.07 ? 424  GLY A N     1 
ATOM   3681 C  CA    . GLY C 3 418 ? 59.389 24.578  7.844   1.00 20.17 ? 424  GLY A CA    1 
ATOM   3682 C  C     . GLY C 3 418 ? 58.082 24.762  8.610   1.00 20.39 ? 424  GLY A C     1 
ATOM   3683 O  O     . GLY C 3 418 ? 58.062 25.465  9.620   1.00 19.79 ? 424  GLY A O     1 
ATOM   3684 N  N     . ALA C 3 419 ? 56.989 24.162  8.145   1.00 21.00 ? 425  ALA A N     1 
ATOM   3685 C  CA    . ALA C 3 419 ? 55.705 24.296  8.840   1.00 19.82 ? 425  ALA A CA    1 
ATOM   3686 C  C     . ALA C 3 419 ? 55.431 23.034  9.658   1.00 19.27 ? 425  ALA A C     1 
ATOM   3687 O  O     . ALA C 3 419 ? 55.844 21.949  9.261   1.00 19.69 ? 425  ALA A O     1 
ATOM   3688 C  CB    . ALA C 3 419 ? 54.580 24.524  7.829   1.00 18.21 ? 425  ALA A CB    1 
ATOM   3689 N  N     . VAL C 3 420 ? 54.741 23.171  10.789  1.00 19.94 ? 426  VAL A N     1 
ATOM   3690 C  CA    . VAL C 3 420 ? 54.434 22.019  11.641  1.00 22.16 ? 426  VAL A CA    1 
ATOM   3691 C  C     . VAL C 3 420 ? 53.682 20.900  10.924  1.00 22.83 ? 426  VAL A C     1 
ATOM   3692 O  O     . VAL C 3 420 ? 53.897 19.725  11.211  1.00 25.34 ? 426  VAL A O     1 
ATOM   3693 C  CB    . VAL C 3 420 ? 53.598 22.415  12.894  1.00 24.31 ? 426  VAL A CB    1 
ATOM   3694 C  CG1   . VAL C 3 420 ? 54.483 23.100  13.916  1.00 27.50 ? 426  VAL A CG1   1 
ATOM   3695 C  CG2   . VAL C 3 420 ? 52.446 23.332  12.499  1.00 20.37 ? 426  VAL A CG2   1 
ATOM   3696 N  N     . THR C 3 421 ? 52.812 21.269  9.990   1.00 22.72 ? 427  THR A N     1 
ATOM   3697 C  CA    . THR C 3 421 ? 52.011 20.303  9.240   1.00 22.64 ? 427  THR A CA    1 
ATOM   3698 C  C     . THR C 3 421 ? 52.791 19.507  8.199   1.00 23.27 ? 427  THR A C     1 
ATOM   3699 O  O     . THR C 3 421 ? 52.273 18.540  7.629   1.00 23.95 ? 427  THR A O     1 
ATOM   3700 C  CB    . THR C 3 421 ? 50.868 21.003  8.511   1.00 23.16 ? 427  THR A CB    1 
ATOM   3701 O  OG1   . THR C 3 421 ? 51.407 22.072  7.722   1.00 24.03 ? 427  THR A OG1   1 
ATOM   3702 C  CG2   . THR C 3 421 ? 49.858 21.562  9.508   1.00 23.41 ? 427  THR A CG2   1 
ATOM   3703 N  N     . GLY C 3 422 ? 54.031 19.912  7.945   1.00 22.01 ? 428  GLY A N     1 
ATOM   3704 C  CA    . GLY C 3 422 ? 54.821 19.213  6.953   1.00 21.11 ? 428  GLY A CA    1 
ATOM   3705 C  C     . GLY C 3 422 ? 54.908 20.014  5.673   1.00 20.72 ? 428  GLY A C     1 
ATOM   3706 O  O     . GLY C 3 422 ? 55.536 19.586  4.707   1.00 21.35 ? 428  GLY A O     1 
ATOM   3707 N  N     . ARG C 3 423 ? 54.247 21.167  5.651   1.00 20.40 ? 429  ARG A N     1 
ATOM   3708 C  CA    . ARG C 3 423 ? 54.305 22.046  4.489   1.00 19.57 ? 429  ARG A CA    1 
ATOM   3709 C  C     . ARG C 3 423 ? 55.687 22.687  4.563   1.00 21.11 ? 429  ARG A C     1 
ATOM   3710 O  O     . ARG C 3 423 ? 56.353 22.616  5.599   1.00 21.34 ? 429  ARG A O     1 
ATOM   3711 C  CB    . ARG C 3 423 ? 53.259 23.171  4.580   1.00 19.38 ? 429  ARG A CB    1 
ATOM   3712 C  CG    . ARG C 3 423 ? 51.874 22.900  3.977   1.00 19.09 ? 429  ARG A CG    1 
ATOM   3713 C  CD    . ARG C 3 423 ? 51.082 24.223  3.886   1.00 15.93 ? 429  ARG A CD    1 
ATOM   3714 N  NE    . ARG C 3 423 ? 49.767 24.096  3.257   1.00 16.00 ? 429  ARG A NE    1 
ATOM   3715 C  CZ    . ARG C 3 423 ? 49.037 25.134  2.844   1.00 18.80 ? 429  ARG A CZ    1 
ATOM   3716 N  NH1   . ARG C 3 423 ? 49.501 26.365  2.995   1.00 17.47 ? 429  ARG A NH1   1 
ATOM   3717 N  NH2   . ARG C 3 423 ? 47.844 24.953  2.276   1.00 17.37 ? 429  ARG A NH2   1 
ATOM   3718 N  N     . ALA C 3 424 ? 56.110 23.318  3.475   1.00 20.81 ? 430  ALA A N     1 
ATOM   3719 C  CA    . ALA C 3 424 ? 57.390 24.014  3.437   1.00 21.11 ? 430  ALA A CA    1 
ATOM   3720 C  C     . ALA C 3 424 ? 57.133 25.501  3.710   1.00 21.73 ? 430  ALA A C     1 
ATOM   3721 O  O     . ALA C 3 424 ? 55.978 25.952  3.698   1.00 22.02 ? 430  ALA A O     1 
ATOM   3722 C  CB    . ALA C 3 424 ? 58.027 23.855  2.058   1.00 21.46 ? 430  ALA A CB    1 
ATOM   3723 N  N     . THR C 3 425 ? 58.201 26.252  3.977   1.00 19.77 ? 431  THR A N     1 
ATOM   3724 C  CA    . THR C 3 425 ? 58.090 27.692  4.172   1.00 19.44 ? 431  THR A CA    1 
ATOM   3725 C  C     . THR C 3 425 ? 58.985 28.324  3.101   1.00 19.16 ? 431  THR A C     1 
ATOM   3726 O  O     . THR C 3 425 ? 59.895 27.673  2.587   1.00 19.87 ? 431  THR A O     1 
ATOM   3727 C  CB    . THR C 3 425 ? 58.530 28.147  5.587   1.00 20.87 ? 431  THR A CB    1 
ATOM   3728 O  OG1   . THR C 3 425 ? 59.896 27.780  5.826   1.00 21.10 ? 431  THR A OG1   1 
ATOM   3729 C  CG2   . THR C 3 425 ? 57.621 27.525  6.642   1.00 19.05 ? 431  THR A CG2   1 
ATOM   3730 N  N     . HIS C 3 426 ? 58.718 29.574  2.746   1.00 20.13 ? 432  HIS A N     1 
ATOM   3731 C  CA    . HIS C 3 426 ? 59.482 30.239  1.695   1.00 20.00 ? 432  HIS A CA    1 
ATOM   3732 C  C     . HIS C 3 426 ? 59.895 31.648  2.100   1.00 19.94 ? 432  HIS A C     1 
ATOM   3733 O  O     . HIS C 3 426 ? 59.104 32.387  2.687   1.00 20.30 ? 432  HIS A O     1 
ATOM   3734 C  CB    . HIS C 3 426 ? 58.646 30.290  0.412   1.00 18.06 ? 432  HIS A CB    1 
ATOM   3735 C  CG    . HIS C 3 426 ? 57.905 29.019  0.120   1.00 18.94 ? 432  HIS A CG    1 
ATOM   3736 N  ND1   . HIS C 3 426 ? 56.844 28.583  0.885   1.00 17.71 ? 432  HIS A ND1   1 
ATOM   3737 C  CD2   . HIS C 3 426 ? 58.066 28.095  -0.859  1.00 18.86 ? 432  HIS A CD2   1 
ATOM   3738 C  CE1   . HIS C 3 426 ? 56.380 27.450  0.387   1.00 19.15 ? 432  HIS A CE1   1 
ATOM   3739 N  NE2   . HIS C 3 426 ? 57.104 27.132  -0.671  1.00 18.25 ? 432  HIS A NE2   1 
ATOM   3740 N  N     . ALA C 3 427 ? 61.124 32.026  1.763   1.00 18.81 ? 433  ALA A N     1 
ATOM   3741 C  CA    . ALA C 3 427 ? 61.619 33.347  2.134   1.00 21.15 ? 433  ALA A CA    1 
ATOM   3742 C  C     . ALA C 3 427 ? 62.850 33.812  1.370   1.00 20.90 ? 433  ALA A C     1 
ATOM   3743 O  O     . ALA C 3 427 ? 63.555 33.013  0.754   1.00 22.73 ? 433  ALA A O     1 
ATOM   3744 C  CB    . ALA C 3 427 ? 61.921 33.376  3.639   1.00 20.33 ? 433  ALA A CB    1 
ATOM   3745 N  N     . PHE C 3 428 ? 63.092 35.121  1.444   1.00 22.14 ? 434  PHE A N     1 
ATOM   3746 C  CA    . PHE C 3 428 ? 64.238 35.788  0.831   1.00 22.17 ? 434  PHE A CA    1 
ATOM   3747 C  C     . PHE C 3 428 ? 64.311 35.812  -0.689  1.00 20.89 ? 434  PHE A C     1 
ATOM   3748 O  O     . PHE C 3 428 ? 65.285 35.335  -1.268  1.00 24.28 ? 434  PHE A O     1 
ATOM   3749 C  CB    . PHE C 3 428 ? 65.551 35.199  1.372   1.00 23.48 ? 434  PHE A CB    1 
ATOM   3750 C  CG    . PHE C 3 428 ? 65.545 34.965  2.858   1.00 25.02 ? 434  PHE A CG    1 
ATOM   3751 C  CD1   . PHE C 3 428 ? 65.022 35.919  3.725   1.00 27.45 ? 434  PHE A CD1   1 
ATOM   3752 C  CD2   . PHE C 3 428 ? 66.069 33.796  3.392   1.00 26.35 ? 434  PHE A CD2   1 
ATOM   3753 C  CE1   . PHE C 3 428 ? 65.021 35.714  5.106   1.00 28.64 ? 434  PHE A CE1   1 
ATOM   3754 C  CE2   . PHE C 3 428 ? 66.076 33.577  4.771   1.00 28.13 ? 434  PHE A CE2   1 
ATOM   3755 C  CZ    . PHE C 3 428 ? 65.550 34.539  5.630   1.00 28.83 ? 434  PHE A CZ    1 
ATOM   3756 N  N     . PRO C 3 429 ? 63.261 36.300  -1.361  1.00 18.76 ? 435  PRO A N     1 
ATOM   3757 C  CA    . PRO C 3 429 ? 62.010 36.817  -0.804  1.00 18.09 ? 435  PRO A CA    1 
ATOM   3758 C  C     . PRO C 3 429 ? 61.050 35.622  -0.767  1.00 18.31 ? 435  PRO A C     1 
ATOM   3759 O  O     . PRO C 3 429 ? 61.413 34.534  -1.216  1.00 17.66 ? 435  PRO A O     1 
ATOM   3760 C  CB    . PRO C 3 429 ? 61.600 37.877  -1.824  1.00 17.86 ? 435  PRO A CB    1 
ATOM   3761 C  CG    . PRO C 3 429 ? 62.037 37.276  -3.111  1.00 16.26 ? 435  PRO A CG    1 
ATOM   3762 C  CD    . PRO C 3 429 ? 63.383 36.653  -2.791  1.00 16.80 ? 435  PRO A CD    1 
ATOM   3763 N  N     . ASN C 3 430 ? 59.846 35.802  -0.237  1.00 18.59 ? 436  ASN A N     1 
ATOM   3764 C  CA    . ASN C 3 430 ? 58.885 34.695  -0.174  1.00 20.26 ? 436  ASN A CA    1 
ATOM   3765 C  C     . ASN C 3 430 ? 58.112 34.563  -1.496  1.00 20.33 ? 436  ASN A C     1 
ATOM   3766 O  O     . ASN C 3 430 ? 57.110 35.263  -1.721  1.00 20.87 ? 436  ASN A O     1 
ATOM   3767 C  CB    . ASN C 3 430 ? 57.907 34.917  0.988   1.00 19.94 ? 436  ASN A CB    1 
ATOM   3768 C  CG    . ASN C 3 430 ? 56.808 33.866  1.038   1.00 22.85 ? 436  ASN A CG    1 
ATOM   3769 O  OD1   . ASN C 3 430 ? 56.714 32.997  0.158   1.00 17.99 ? 436  ASN A OD1   1 
ATOM   3770 N  ND2   . ASN C 3 430 ? 55.962 33.942  2.072   1.00 21.56 ? 436  ASN A ND2   1 
ATOM   3771 N  N     . LEU C 3 431 ? 58.572 33.656  -2.355  1.00 18.74 ? 437  LEU A N     1 
ATOM   3772 C  CA    . LEU C 3 431 ? 57.950 33.438  -3.654  1.00 18.89 ? 437  LEU A CA    1 
ATOM   3773 C  C     . LEU C 3 431 ? 56.565 32.799  -3.585  1.00 19.03 ? 437  LEU A C     1 
ATOM   3774 O  O     . LEU C 3 431 ? 55.903 32.654  -4.609  1.00 19.10 ? 437  LEU A O     1 
ATOM   3775 C  CB    . LEU C 3 431 ? 58.872 32.599  -4.551  1.00 20.49 ? 437  LEU A CB    1 
ATOM   3776 C  CG    . LEU C 3 431 ? 60.254 33.201  -4.822  1.00 22.39 ? 437  LEU A CG    1 
ATOM   3777 C  CD1   . LEU C 3 431 ? 61.009 32.335  -5.821  1.00 24.17 ? 437  LEU A CD1   1 
ATOM   3778 C  CD2   . LEU C 3 431 ? 60.104 34.618  -5.363  1.00 23.60 ? 437  LEU A CD2   1 
ATOM   3779 N  N     . ALA C 3 432 ? 56.134 32.408  -2.386  1.00 20.19 ? 438  ALA A N     1 
ATOM   3780 C  CA    . ALA C 3 432 ? 54.801 31.830  -2.203  1.00 18.00 ? 438  ALA A CA    1 
ATOM   3781 C  C     . ALA C 3 432 ? 53.794 32.906  -1.754  1.00 18.83 ? 438  ALA A C     1 
ATOM   3782 O  O     . ALA C 3 432 ? 52.726 32.576  -1.225  1.00 18.66 ? 438  ALA A O     1 
ATOM   3783 C  CB    . ALA C 3 432 ? 54.840 30.701  -1.187  1.00 17.63 ? 438  ALA A CB    1 
ATOM   3784 N  N     . GLN C 3 433 ? 54.136 34.183  -1.948  1.00 17.58 ? 439  GLN A N     1 
ATOM   3785 C  CA    . GLN C 3 433 ? 53.220 35.277  -1.598  1.00 20.52 ? 439  GLN A CA    1 
ATOM   3786 C  C     . GLN C 3 433 ? 53.164 36.381  -2.676  1.00 21.08 ? 439  GLN A C     1 
ATOM   3787 O  O     . GLN C 3 433 ? 52.891 37.548  -2.379  1.00 22.19 ? 439  GLN A O     1 
ATOM   3788 C  CB    . GLN C 3 433 ? 53.557 35.887  -0.213  1.00 19.04 ? 439  GLN A CB    1 
ATOM   3789 C  CG    . GLN C 3 433 ? 54.842 36.723  -0.120  1.00 16.99 ? 439  GLN A CG    1 
ATOM   3790 C  CD    . GLN C 3 433 ? 55.118 37.243  1.303   1.00 19.32 ? 439  GLN A CD    1 
ATOM   3791 O  OE1   . GLN C 3 433 ? 56.205 37.764  1.591   1.00 19.44 ? 439  GLN A OE1   1 
ATOM   3792 N  NE2   . GLN C 3 433 ? 54.136 37.101  2.192   1.00 17.36 ? 439  GLN A NE2   1 
ATOM   3793 N  N     . ILE C 3 434 ? 53.435 36.010  -3.924  1.00 21.93 ? 440  ILE A N     1 
ATOM   3794 C  CA    . ILE C 3 434 ? 53.371 36.964  -5.038  1.00 20.93 ? 440  ILE A CA    1 
ATOM   3795 C  C     . ILE C 3 434 ? 51.891 37.283  -5.235  1.00 21.10 ? 440  ILE A C     1 
ATOM   3796 O  O     . ILE C 3 434 ? 51.051 36.380  -5.205  1.00 20.60 ? 440  ILE A O     1 
ATOM   3797 C  CB    . ILE C 3 434 ? 53.885 36.356  -6.367  1.00 21.23 ? 440  ILE A CB    1 
ATOM   3798 C  CG1   . ILE C 3 434 ? 55.292 35.775  -6.185  1.00 19.52 ? 440  ILE A CG1   1 
ATOM   3799 C  CG2   . ILE C 3 434 ? 53.843 37.416  -7.469  1.00 17.84 ? 440  ILE A CG2   1 
ATOM   3800 C  CD1   . ILE C 3 434 ? 56.364 36.801  -5.883  1.00 20.15 ? 440  ILE A CD1   1 
ATOM   3801 N  N     . PRO C 3 435 ? 51.551 38.569  -5.429  1.00 20.53 ? 441  PRO A N     1 
ATOM   3802 C  CA    . PRO C 3 435 ? 50.154 38.986  -5.629  1.00 21.48 ? 441  PRO A CA    1 
ATOM   3803 C  C     . PRO C 3 435 ? 49.447 38.165  -6.716  1.00 22.32 ? 441  PRO A C     1 
ATOM   3804 O  O     . PRO C 3 435 ? 50.049 37.814  -7.732  1.00 20.48 ? 441  PRO A O     1 
ATOM   3805 C  CB    . PRO C 3 435 ? 50.284 40.458  -6.016  1.00 21.23 ? 441  PRO A CB    1 
ATOM   3806 C  CG    . PRO C 3 435 ? 51.526 40.897  -5.262  1.00 23.48 ? 441  PRO A CG    1 
ATOM   3807 C  CD    . PRO C 3 435 ? 52.468 39.724  -5.448  1.00 21.08 ? 441  PRO A CD    1 
ATOM   3808 N  N     . GLY C 3 436 ? 48.172 37.860  -6.498  1.00 22.80 ? 442  GLY A N     1 
ATOM   3809 C  CA    . GLY C 3 436 ? 47.421 37.089  -7.481  1.00 25.68 ? 442  GLY A CA    1 
ATOM   3810 C  C     . GLY C 3 436 ? 47.114 37.905  -8.727  1.00 26.07 ? 442  GLY A C     1 
ATOM   3811 O  O     . GLY C 3 436 ? 46.903 39.114  -8.629  1.00 25.74 ? 442  GLY A O     1 
ATOM   3812 N  N     . VAL C 3 437 ? 47.083 37.262  -9.892  1.00 26.15 ? 443  VAL A N     1 
ATOM   3813 C  CA    . VAL C 3 437 ? 46.805 37.982  -11.136 1.00 30.33 ? 443  VAL A CA    1 
ATOM   3814 C  C     . VAL C 3 437 ? 45.514 38.795  -11.109 1.00 31.27 ? 443  VAL A C     1 
ATOM   3815 O  O     . VAL C 3 437 ? 45.377 39.752  -11.870 1.00 32.62 ? 443  VAL A O     1 
ATOM   3816 C  CB    . VAL C 3 437 ? 46.725 37.039  -12.365 1.00 29.96 ? 443  VAL A CB    1 
ATOM   3817 C  CG1   . VAL C 3 437 ? 48.080 36.483  -12.681 1.00 35.28 ? 443  VAL A CG1   1 
ATOM   3818 C  CG2   . VAL C 3 437 ? 45.743 35.922  -12.108 1.00 31.11 ? 443  VAL A CG2   1 
ATOM   3819 N  N     . ARG C 3 438 ? 44.577 38.420  -10.242 1.00 32.03 ? 444  ARG A N     1 
ATOM   3820 C  CA    . ARG C 3 438 ? 43.301 39.124  -10.152 1.00 33.90 ? 444  ARG A CA    1 
ATOM   3821 C  C     . ARG C 3 438 ? 43.306 40.281  -9.160  1.00 34.66 ? 444  ARG A C     1 
ATOM   3822 O  O     . ARG C 3 438 ? 42.288 40.951  -8.982  1.00 37.04 ? 444  ARG A O     1 
ATOM   3823 C  CB    . ARG C 3 438 ? 42.172 38.151  -9.790  1.00 35.87 ? 444  ARG A CB    1 
ATOM   3824 C  CG    . ARG C 3 438 ? 41.860 37.125  -10.871 1.00 39.22 ? 444  ARG A CG    1 
ATOM   3825 C  CD    . ARG C 3 438 ? 40.840 36.104  -10.388 1.00 42.97 ? 444  ARG A CD    1 
ATOM   3826 N  NE    . ARG C 3 438 ? 41.142 34.773  -10.910 1.00 47.00 ? 444  ARG A NE    1 
ATOM   3827 C  CZ    . ARG C 3 438 ? 42.240 34.086  -10.608 1.00 47.23 ? 444  ARG A CZ    1 
ATOM   3828 N  NH1   . ARG C 3 438 ? 43.139 34.599  -9.780  1.00 50.09 ? 444  ARG A NH1   1 
ATOM   3829 N  NH2   . ARG C 3 438 ? 42.452 32.896  -11.147 1.00 49.70 ? 444  ARG A NH2   1 
ATOM   3830 N  N     . SER C 3 439 ? 44.438 40.517  -8.508  1.00 32.83 ? 445  SER A N     1 
ATOM   3831 C  CA    . SER C 3 439 ? 44.521 41.616  -7.565  1.00 31.43 ? 445  SER A CA    1 
ATOM   3832 C  C     . SER C 3 439 ? 45.173 42.791  -8.295  1.00 31.90 ? 445  SER A C     1 
ATOM   3833 O  O     . SER C 3 439 ? 45.875 42.598  -9.290  1.00 32.30 ? 445  SER A O     1 
ATOM   3834 C  CB    . SER C 3 439 ? 45.360 41.222  -6.342  1.00 32.39 ? 445  SER A CB    1 
ATOM   3835 O  OG    . SER C 3 439 ? 46.746 41.250  -6.633  1.00 29.70 ? 445  SER A OG    1 
ATOM   3836 N  N     . PRO C 3 440 ? 44.940 44.025  -7.817  1.00 31.22 ? 446  PRO A N     1 
ATOM   3837 C  CA    . PRO C 3 440 ? 45.515 45.224  -8.437  1.00 30.48 ? 446  PRO A CA    1 
ATOM   3838 C  C     . PRO C 3 440 ? 47.014 45.085  -8.666  1.00 30.00 ? 446  PRO A C     1 
ATOM   3839 O  O     . PRO C 3 440 ? 47.768 44.780  -7.737  1.00 30.41 ? 446  PRO A O     1 
ATOM   3840 C  CB    . PRO C 3 440 ? 45.177 46.323  -7.433  1.00 30.71 ? 446  PRO A CB    1 
ATOM   3841 C  CG    . PRO C 3 440 ? 43.841 45.877  -6.902  1.00 30.67 ? 446  PRO A CG    1 
ATOM   3842 C  CD    . PRO C 3 440 ? 44.075 44.385  -6.677  1.00 32.14 ? 446  PRO A CD    1 
ATOM   3843 N  N     . TYR C 3 441 ? 47.425 45.309  -9.914  1.00 29.90 ? 447  TYR A N     1 
ATOM   3844 C  CA    . TYR C 3 441 ? 48.820 45.214  -10.344 1.00 28.94 ? 447  TYR A CA    1 
ATOM   3845 C  C     . TYR C 3 441 ? 49.349 43.782  -10.316 1.00 29.04 ? 447  TYR A C     1 
ATOM   3846 O  O     . TYR C 3 441 ? 50.543 43.551  -10.510 1.00 27.39 ? 447  TYR A O     1 
ATOM   3847 C  CB    . TYR C 3 441 ? 49.710 46.109  -9.479  1.00 30.53 ? 447  TYR A CB    1 
ATOM   3848 C  CG    . TYR C 3 441 ? 49.346 47.578  -9.534  1.00 32.28 ? 447  TYR A CG    1 
ATOM   3849 C  CD1   . TYR C 3 441 ? 49.521 48.324  -10.703 1.00 31.92 ? 447  TYR A CD1   1 
ATOM   3850 C  CD2   . TYR C 3 441 ? 48.810 48.219  -8.420  1.00 33.02 ? 447  TYR A CD2   1 
ATOM   3851 C  CE1   . TYR C 3 441 ? 49.170 49.668  -10.756 1.00 32.08 ? 447  TYR A CE1   1 
ATOM   3852 C  CE2   . TYR C 3 441 ? 48.456 49.562  -8.463  1.00 34.28 ? 447  TYR A CE2   1 
ATOM   3853 C  CZ    . TYR C 3 441 ? 48.637 50.280  -9.633  1.00 34.18 ? 447  TYR A CZ    1 
ATOM   3854 O  OH    . TYR C 3 441 ? 48.279 51.607  -9.662  1.00 36.72 ? 447  TYR A OH    1 
ATOM   3855 N  N     . GLY C 3 442 ? 48.455 42.822  -10.089 1.00 29.31 ? 448  GLY A N     1 
ATOM   3856 C  CA    . GLY C 3 442 ? 48.866 41.431  -10.036 1.00 30.45 ? 448  GLY A CA    1 
ATOM   3857 C  C     . GLY C 3 442 ? 49.346 40.890  -11.374 1.00 32.36 ? 448  GLY A C     1 
ATOM   3858 O  O     . GLY C 3 442 ? 50.212 40.015  -11.432 1.00 31.74 ? 448  GLY A O     1 
ATOM   3859 N  N     . GLU C 3 443 ? 48.786 41.415  -12.457 1.00 33.96 ? 449  GLU A N     1 
ATOM   3860 C  CA    . GLU C 3 443 ? 49.164 40.964  -13.785 1.00 34.91 ? 449  GLU A CA    1 
ATOM   3861 C  C     . GLU C 3 443 ? 50.637 41.267  -14.005 1.00 33.68 ? 449  GLU A C     1 
ATOM   3862 O  O     . GLU C 3 443 ? 51.413 40.397  -14.397 1.00 31.78 ? 449  GLU A O     1 
ATOM   3863 C  CB    . GLU C 3 443 ? 48.328 41.679  -14.846 1.00 38.93 ? 449  GLU A CB    1 
ATOM   3864 C  CG    . GLU C 3 443 ? 48.041 40.841  -16.076 1.00 44.66 ? 449  GLU A CG    1 
ATOM   3865 C  CD    . GLU C 3 443 ? 47.059 39.719  -15.788 1.00 48.91 ? 449  GLU A CD    1 
ATOM   3866 O  OE1   . GLU C 3 443 ? 47.369 38.850  -14.945 1.00 53.11 ? 449  GLU A OE1   1 
ATOM   3867 O  OE2   . GLU C 3 443 ? 45.970 39.704  -16.400 1.00 50.76 ? 449  GLU A OE2   1 
ATOM   3868 N  N     . GLN C 3 444 ? 51.022 42.507  -13.735 1.00 33.38 ? 450  GLN A N     1 
ATOM   3869 C  CA    . GLN C 3 444 ? 52.410 42.914  -13.916 1.00 33.45 ? 450  GLN A CA    1 
ATOM   3870 C  C     . GLN C 3 444 ? 53.378 42.178  -12.990 1.00 30.68 ? 450  GLN A C     1 
ATOM   3871 O  O     . GLN C 3 444 ? 54.436 41.735  -13.423 1.00 30.11 ? 450  GLN A O     1 
ATOM   3872 C  CB    . GLN C 3 444 ? 52.536 44.424  -13.725 1.00 35.02 ? 450  GLN A CB    1 
ATOM   3873 C  CG    . GLN C 3 444 ? 51.722 45.230  -14.733 1.00 39.26 ? 450  GLN A CG    1 
ATOM   3874 C  CD    . GLN C 3 444 ? 50.437 45.799  -14.144 1.00 41.56 ? 450  GLN A CD    1 
ATOM   3875 O  OE1   . GLN C 3 444 ? 49.535 45.059  -13.715 1.00 39.72 ? 450  GLN A OE1   1 
ATOM   3876 N  NE2   . GLN C 3 444 ? 50.351 47.128  -14.116 1.00 40.86 ? 450  GLN A NE2   1 
ATOM   3877 N  N     . CYS C 3 445 ? 53.015 42.049  -11.719 1.00 29.75 ? 451  CYS A N     1 
ATOM   3878 C  CA    . CYS C 3 445 ? 53.859 41.355  -10.752 1.00 29.61 ? 451  CYS A CA    1 
ATOM   3879 C  C     . CYS C 3 445 ? 54.078 39.915  -11.205 1.00 28.75 ? 451  CYS A C     1 
ATOM   3880 O  O     . CYS C 3 445 ? 55.207 39.443  -11.353 1.00 27.95 ? 451  CYS A O     1 
ATOM   3881 C  CB    . CYS C 3 445 ? 53.191 41.342  -9.370  1.00 29.27 ? 451  CYS A CB    1 
ATOM   3882 S  SG    . CYS C 3 445 ? 53.001 42.957  -8.555  1.00 28.80 ? 451  CYS A SG    1 
ATOM   3883 N  N     . ARG C 3 446 ? 52.967 39.229  -11.429 1.00 28.16 ? 452  ARG A N     1 
ATOM   3884 C  CA    . ARG C 3 446 ? 52.975 37.838  -11.834 1.00 27.72 ? 452  ARG A CA    1 
ATOM   3885 C  C     . ARG C 3 446 ? 53.772 37.611  -13.125 1.00 28.34 ? 452  ARG A C     1 
ATOM   3886 O  O     . ARG C 3 446 ? 54.589 36.683  -13.213 1.00 27.85 ? 452  ARG A O     1 
ATOM   3887 C  CB    . ARG C 3 446 ? 51.529 37.383  -12.000 1.00 27.94 ? 452  ARG A CB    1 
ATOM   3888 C  CG    . ARG C 3 446 ? 51.219 36.065  -11.356 1.00 31.31 ? 452  ARG A CG    1 
ATOM   3889 C  CD    . ARG C 3 446 ? 51.222 36.087  -9.828  1.00 28.89 ? 452  ARG A CD    1 
ATOM   3890 N  NE    . ARG C 3 446 ? 51.155 34.701  -9.389  1.00 33.50 ? 452  ARG A NE    1 
ATOM   3891 C  CZ    . ARG C 3 446 ? 50.776 34.271  -8.194  1.00 31.39 ? 452  ARG A CZ    1 
ATOM   3892 N  NH1   . ARG C 3 446 ? 50.410 35.111  -7.242  1.00 33.13 ? 452  ARG A NH1   1 
ATOM   3893 N  NH2   . ARG C 3 446 ? 50.742 32.969  -7.972  1.00 32.37 ? 452  ARG A NH2   1 
ATOM   3894 N  N     . ALA C 3 447 ? 53.542 38.477  -14.108 1.00 27.70 ? 453  ALA A N     1 
ATOM   3895 C  CA    . ALA C 3 447 ? 54.211 38.406  -15.402 1.00 27.64 ? 453  ALA A CA    1 
ATOM   3896 C  C     . ALA C 3 447 ? 55.730 38.596  -15.347 1.00 27.43 ? 453  ALA A C     1 
ATOM   3897 O  O     . ALA C 3 447 ? 56.442 38.142  -16.245 1.00 28.25 ? 453  ALA A O     1 
ATOM   3898 C  CB    . ALA C 3 447 ? 53.596 39.432  -16.355 1.00 28.46 ? 453  ALA A CB    1 
ATOM   3899 N  N     . ALA C 3 448 ? 56.229 39.270  -14.316 1.00 25.17 ? 454  ALA A N     1 
ATOM   3900 C  CA    . ALA C 3 448 ? 57.671 39.481  -14.191 1.00 24.49 ? 454  ALA A CA    1 
ATOM   3901 C  C     . ALA C 3 448 ? 58.395 38.175  -13.823 1.00 24.13 ? 454  ALA A C     1 
ATOM   3902 O  O     . ALA C 3 448 ? 59.620 38.073  -13.961 1.00 24.64 ? 454  ALA A O     1 
ATOM   3903 C  CB    . ALA C 3 448 ? 57.961 40.561  -13.154 1.00 23.28 ? 454  ALA A CB    1 
ATOM   3904 N  N     . PHE C 3 449 ? 57.639 37.186  -13.352 1.00 23.03 ? 455  PHE A N     1 
ATOM   3905 C  CA    . PHE C 3 449 ? 58.205 35.886  -13.007 1.00 22.69 ? 455  PHE A CA    1 
ATOM   3906 C  C     . PHE C 3 449 ? 57.837 34.911  -14.139 1.00 23.92 ? 455  PHE A C     1 
ATOM   3907 O  O     . PHE C 3 449 ? 56.691 34.456  -14.231 1.00 23.69 ? 455  PHE A O     1 
ATOM   3908 C  CB    . PHE C 3 449 ? 57.642 35.378  -11.661 1.00 22.46 ? 455  PHE A CB    1 
ATOM   3909 C  CG    . PHE C 3 449 ? 58.130 36.160  -10.453 1.00 19.43 ? 455  PHE A CG    1 
ATOM   3910 C  CD1   . PHE C 3 449 ? 57.512 37.347  -10.069 1.00 19.09 ? 455  PHE A CD1   1 
ATOM   3911 C  CD2   . PHE C 3 449 ? 59.244 35.729  -9.734  1.00 19.51 ? 455  PHE A CD2   1 
ATOM   3912 C  CE1   . PHE C 3 449 ? 58.000 38.099  -8.983  1.00 17.87 ? 455  PHE A CE1   1 
ATOM   3913 C  CE2   . PHE C 3 449 ? 59.738 36.472  -8.649  1.00 17.49 ? 455  PHE A CE2   1 
ATOM   3914 C  CZ    . PHE C 3 449 ? 59.114 37.659  -8.275  1.00 15.84 ? 455  PHE A CZ    1 
ATOM   3915 N  N     . GLY C 3 450 ? 58.791 34.607  -15.015 1.00 22.79 ? 456  GLY A N     1 
ATOM   3916 C  CA    . GLY C 3 450 ? 58.483 33.703  -16.109 1.00 23.36 ? 456  GLY A CA    1 
ATOM   3917 C  C     . GLY C 3 450 ? 59.661 33.108  -16.859 1.00 24.12 ? 456  GLY A C     1 
ATOM   3918 O  O     . GLY C 3 450 ? 60.714 33.740  -16.995 1.00 23.08 ? 456  GLY A O     1 
ATOM   3919 N  N     . ALA C 3 451 ? 59.478 31.881  -17.345 1.00 23.38 ? 457  ALA A N     1 
ATOM   3920 C  CA    . ALA C 3 451 ? 60.513 31.183  -18.109 1.00 24.48 ? 457  ALA A CA    1 
ATOM   3921 C  C     . ALA C 3 451 ? 60.896 32.011  -19.340 1.00 25.86 ? 457  ALA A C     1 
ATOM   3922 O  O     . ALA C 3 451 ? 62.047 31.985  -19.780 1.00 25.38 ? 457  ALA A O     1 
ATOM   3923 C  CB    . ALA C 3 451 ? 60.005 29.805  -18.548 1.00 22.34 ? 457  ALA A CB    1 
ATOM   3924 N  N     . GLU C 3 452 ? 59.919 32.744  -19.878 1.00 24.83 ? 458  GLU A N     1 
ATOM   3925 C  CA    . GLU C 3 452 ? 60.122 33.578  -21.061 1.00 26.98 ? 458  GLU A CA    1 
ATOM   3926 C  C     . GLU C 3 452 ? 61.264 34.583  -20.878 1.00 28.25 ? 458  GLU A C     1 
ATOM   3927 O  O     . GLU C 3 452 ? 61.862 35.032  -21.859 1.00 27.85 ? 458  GLU A O     1 
ATOM   3928 C  CB    . GLU C 3 452 ? 58.844 34.356  -21.391 1.00 27.23 ? 458  GLU A CB    1 
ATOM   3929 C  CG    . GLU C 3 452 ? 58.619 35.554  -20.467 1.00 28.03 ? 458  GLU A CG    1 
ATOM   3930 C  CD    . GLU C 3 452 ? 57.517 36.474  -20.953 1.00 29.62 ? 458  GLU A CD    1 
ATOM   3931 O  OE1   . GLU C 3 452 ? 57.467 36.730  -22.172 1.00 31.98 ? 458  GLU A OE1   1 
ATOM   3932 O  OE2   . GLU C 3 452 ? 56.714 36.952  -20.122 1.00 30.39 ? 458  GLU A OE2   1 
ATOM   3933 N  N     . HIS C 3 453 ? 61.547 34.942  -19.625 1.00 28.46 ? 459  HIS A N     1 
ATOM   3934 C  CA    . HIS C 3 453 ? 62.600 35.905  -19.320 1.00 27.88 ? 459  HIS A CA    1 
ATOM   3935 C  C     . HIS C 3 453 ? 63.976 35.261  -19.285 1.00 28.41 ? 459  HIS A C     1 
ATOM   3936 O  O     . HIS C 3 453 ? 64.982 35.928  -19.026 1.00 28.62 ? 459  HIS A O     1 
ATOM   3937 C  CB    . HIS C 3 453 ? 62.305 36.608  -17.992 1.00 27.81 ? 459  HIS A CB    1 
ATOM   3938 C  CG    . HIS C 3 453 ? 60.945 37.223  -17.940 1.00 29.63 ? 459  HIS A CG    1 
ATOM   3939 N  ND1   . HIS C 3 453 ? 60.496 38.110  -18.894 1.00 31.14 ? 459  HIS A ND1   1 
ATOM   3940 C  CD2   . HIS C 3 453 ? 59.919 37.052  -17.072 1.00 30.65 ? 459  HIS A CD2   1 
ATOM   3941 C  CE1   . HIS C 3 453 ? 59.252 38.459  -18.619 1.00 30.75 ? 459  HIS A CE1   1 
ATOM   3942 N  NE2   . HIS C 3 453 ? 58.878 37.831  -17.519 1.00 32.18 ? 459  HIS A NE2   1 
ATOM   3943 N  N     . HIS C 3 454 ? 64.020 33.956  -19.533 1.00 28.31 ? 460  HIS A N     1 
ATOM   3944 C  CA    . HIS C 3 454 ? 65.289 33.247  -19.586 1.00 27.09 ? 460  HIS A CA    1 
ATOM   3945 C  C     . HIS C 3 454 ? 65.535 32.841  -21.040 1.00 27.57 ? 460  HIS A C     1 
ATOM   3946 O  O     . HIS C 3 454 ? 64.684 32.213  -21.669 1.00 27.24 ? 460  HIS A O     1 
ATOM   3947 C  CB    . HIS C 3 454 ? 65.269 31.997  -18.708 1.00 27.36 ? 460  HIS A CB    1 
ATOM   3948 C  CG    . HIS C 3 454 ? 66.474 31.126  -18.887 1.00 28.42 ? 460  HIS A CG    1 
ATOM   3949 N  ND1   . HIS C 3 454 ? 67.735 31.504  -18.476 1.00 27.97 ? 460  HIS A ND1   1 
ATOM   3950 C  CD2   . HIS C 3 454 ? 66.624 29.928  -19.502 1.00 28.60 ? 460  HIS A CD2   1 
ATOM   3951 C  CE1   . HIS C 3 454 ? 68.608 30.578  -18.831 1.00 27.71 ? 460  HIS A CE1   1 
ATOM   3952 N  NE2   . HIS C 3 454 ? 67.960 29.612  -19.456 1.00 27.53 ? 460  HIS A NE2   1 
ATOM   3953 N  N     . LEU C 3 455 ? 66.698 33.207  -21.569 1.00 27.86 ? 461  LEU A N     1 
ATOM   3954 C  CA    . LEU C 3 455 ? 67.056 32.877  -22.944 1.00 28.01 ? 461  LEU A CA    1 
ATOM   3955 C  C     . LEU C 3 455 ? 67.990 31.667  -22.905 1.00 27.95 ? 461  LEU A C     1 
ATOM   3956 O  O     . LEU C 3 455 ? 68.949 31.630  -22.114 1.00 26.88 ? 461  LEU A O     1 
ATOM   3957 C  CB    . LEU C 3 455 ? 67.753 34.071  -23.615 1.00 26.50 ? 461  LEU A CB    1 
ATOM   3958 C  CG    . LEU C 3 455 ? 67.026 35.427  -23.563 1.00 27.51 ? 461  LEU A CG    1 
ATOM   3959 C  CD1   . LEU C 3 455 ? 67.904 36.511  -24.192 1.00 28.06 ? 461  LEU A CD1   1 
ATOM   3960 C  CD2   . LEU C 3 455 ? 65.690 35.345  -24.268 1.00 24.59 ? 461  LEU A CD2   1 
ATOM   3961 N  N     . ASP C 3 456 ? 67.707 30.678  -23.752 1.00 27.12 ? 462  ASP A N     1 
ATOM   3962 C  CA    . ASP C 3 456 ? 68.507 29.462  -23.793 1.00 27.89 ? 462  ASP A CA    1 
ATOM   3963 C  C     . ASP C 3 456 ? 69.987 29.754  -23.995 1.00 27.67 ? 462  ASP A C     1 
ATOM   3964 O  O     . ASP C 3 456 ? 70.356 30.588  -24.818 1.00 27.05 ? 462  ASP A O     1 
ATOM   3965 C  CB    . ASP C 3 456 ? 68.033 28.535  -24.904 1.00 27.97 ? 462  ASP A CB    1 
ATOM   3966 C  CG    . ASP C 3 456 ? 68.708 27.195  -24.844 1.00 30.08 ? 462  ASP A CG    1 
ATOM   3967 O  OD1   . ASP C 3 456 ? 68.266 26.345  -24.042 1.00 31.28 ? 462  ASP A OD1   1 
ATOM   3968 O  OD2   . ASP C 3 456 ? 69.694 26.996  -25.580 1.00 31.56 ? 462  ASP A OD2   1 
ATOM   3969 N  N     . GLY C 3 457 ? 70.828 29.051  -23.244 1.00 28.32 ? 463  GLY A N     1 
ATOM   3970 C  CA    . GLY C 3 457 ? 72.259 29.253  -23.339 1.00 28.87 ? 463  GLY A CA    1 
ATOM   3971 C  C     . GLY C 3 457 ? 72.855 28.944  -24.700 1.00 29.80 ? 463  GLY A C     1 
ATOM   3972 O  O     . GLY C 3 457 ? 73.944 29.418  -25.015 1.00 30.62 ? 463  GLY A O     1 
ATOM   3973 N  N     . ILE C 3 458 ? 72.158 28.152  -25.509 1.00 29.52 ? 464  ILE A N     1 
ATOM   3974 C  CA    . ILE C 3 458 ? 72.660 27.811  -26.834 1.00 30.77 ? 464  ILE A CA    1 
ATOM   3975 C  C     . ILE C 3 458 ? 71.972 28.607  -27.946 1.00 31.09 ? 464  ILE A C     1 
ATOM   3976 O  O     . ILE C 3 458 ? 72.627 29.347  -28.686 1.00 31.63 ? 464  ILE A O     1 
ATOM   3977 C  CB    . ILE C 3 458 ? 72.483 26.301  -27.136 1.00 32.06 ? 464  ILE A CB    1 
ATOM   3978 C  CG1   . ILE C 3 458 ? 73.216 25.458  -26.087 1.00 31.27 ? 464  ILE A CG1   1 
ATOM   3979 C  CG2   . ILE C 3 458 ? 72.997 25.982  -28.540 1.00 31.68 ? 464  ILE A CG2   1 
ATOM   3980 C  CD1   . ILE C 3 458 ? 74.687 25.765  -25.967 1.00 33.51 ? 464  ILE A CD1   1 
ATOM   3981 N  N     . THR C 3 459 ? 70.653 28.465  -28.047 1.00 30.03 ? 465  THR A N     1 
ATOM   3982 C  CA    . THR C 3 459 ? 69.873 29.135  -29.085 1.00 30.36 ? 465  THR A CA    1 
ATOM   3983 C  C     . THR C 3 459 ? 69.483 30.580  -28.801 1.00 30.54 ? 465  THR A C     1 
ATOM   3984 O  O     . THR C 3 459 ? 69.097 31.308  -29.714 1.00 29.58 ? 465  THR A O     1 
ATOM   3985 C  CB    . THR C 3 459 ? 68.565 28.388  -29.358 1.00 31.50 ? 465  THR A CB    1 
ATOM   3986 O  OG1   . THR C 3 459 ? 67.698 28.544  -28.229 1.00 31.09 ? 465  THR A OG1   1 
ATOM   3987 C  CG2   . THR C 3 459 ? 68.825 26.903  -29.599 1.00 31.25 ? 465  THR A CG2   1 
ATOM   3988 N  N     . GLY C 3 460 ? 69.552 30.987  -27.539 1.00 31.19 ? 466  GLY A N     1 
ATOM   3989 C  CA    . GLY C 3 460 ? 69.178 32.343  -27.182 1.00 30.10 ? 466  GLY A CA    1 
ATOM   3990 C  C     . GLY C 3 460 ? 67.673 32.547  -27.196 1.00 32.26 ? 466  GLY A C     1 
ATOM   3991 O  O     . GLY C 3 460 ? 67.196 33.657  -26.955 1.00 34.01 ? 466  GLY A O     1 
ATOM   3992 N  N     . LYS C 3 461 ? 66.920 31.482  -27.475 1.00 31.61 ? 467  LYS A N     1 
ATOM   3993 C  CA    . LYS C 3 461 ? 65.459 31.563  -27.515 1.00 31.18 ? 467  LYS A CA    1 
ATOM   3994 C  C     . LYS C 3 461 ? 64.860 31.462  -26.114 1.00 31.20 ? 467  LYS A C     1 
ATOM   3995 O  O     . LYS C 3 461 ? 65.396 30.769  -25.245 1.00 30.34 ? 467  LYS A O     1 
ATOM   3996 C  CB    . LYS C 3 461 ? 64.871 30.443  -28.386 1.00 32.62 ? 467  LYS A CB    1 
ATOM   3997 C  CG    . LYS C 3 461 ? 65.404 30.390  -29.815 1.00 35.10 ? 467  LYS A CG    1 
ATOM   3998 C  CD    . LYS C 3 461 ? 65.379 31.760  -30.489 1.00 37.19 ? 467  LYS A CD    1 
ATOM   3999 C  CE    . LYS C 3 461 ? 63.991 32.364  -30.479 1.00 38.58 ? 467  LYS A CE    1 
ATOM   4000 N  NZ    . LYS C 3 461 ? 63.006 31.420  -31.064 1.00 40.33 ? 467  LYS A NZ    1 
ATOM   4001 N  N     . PRO C 3 462 ? 63.726 32.146  -25.883 1.00 30.52 ? 468  PRO A N     1 
ATOM   4002 C  CA    . PRO C 3 462 ? 63.045 32.138  -24.584 1.00 28.68 ? 468  PRO A CA    1 
ATOM   4003 C  C     . PRO C 3 462 ? 62.579 30.733  -24.226 1.00 28.92 ? 468  PRO A C     1 
ATOM   4004 O  O     . PRO C 3 462 ? 62.265 29.934  -25.112 1.00 29.90 ? 468  PRO A O     1 
ATOM   4005 C  CB    . PRO C 3 462 ? 61.857 33.075  -24.804 1.00 30.43 ? 468  PRO A CB    1 
ATOM   4006 C  CG    . PRO C 3 462 ? 62.299 33.959  -25.965 1.00 29.66 ? 468  PRO A CG    1 
ATOM   4007 C  CD    . PRO C 3 462 ? 62.988 32.973  -26.857 1.00 29.58 ? 468  PRO A CD    1 
ATOM   4008 N  N     . TRP C 3 463 ? 62.548 30.426  -22.934 1.00 26.53 ? 469  TRP A N     1 
ATOM   4009 C  CA    . TRP C 3 463 ? 62.087 29.123  -22.492 1.00 26.46 ? 469  TRP A CA    1 
ATOM   4010 C  C     . TRP C 3 463 ? 60.580 29.220  -22.282 1.00 27.24 ? 469  TRP A C     1 
ATOM   4011 O  O     . TRP C 3 463 ? 60.023 30.317  -22.299 1.00 27.35 ? 469  TRP A O     1 
ATOM   4012 C  CB    . TRP C 3 463 ? 62.807 28.700  -21.199 1.00 23.60 ? 469  TRP A CB    1 
ATOM   4013 C  CG    . TRP C 3 463 ? 64.056 27.893  -21.461 1.00 22.51 ? 469  TRP A CG    1 
ATOM   4014 C  CD1   . TRP C 3 463 ? 64.967 28.094  -22.464 1.00 22.01 ? 469  TRP A CD1   1 
ATOM   4015 C  CD2   . TRP C 3 463 ? 64.522 26.754  -20.724 1.00 21.40 ? 469  TRP A CD2   1 
ATOM   4016 N  NE1   . TRP C 3 463 ? 65.963 27.151  -22.399 1.00 20.58 ? 469  TRP A NE1   1 
ATOM   4017 C  CE2   . TRP C 3 463 ? 65.718 26.317  -21.341 1.00 22.32 ? 469  TRP A CE2   1 
ATOM   4018 C  CE3   . TRP C 3 463 ? 64.048 26.060  -19.602 1.00 21.73 ? 469  TRP A CE3   1 
ATOM   4019 C  CZ2   . TRP C 3 463 ? 66.446 25.213  -20.873 1.00 23.91 ? 469  TRP A CZ2   1 
ATOM   4020 C  CZ3   . TRP C 3 463 ? 64.771 24.963  -19.134 1.00 21.24 ? 469  TRP A CZ3   1 
ATOM   4021 C  CH2   . TRP C 3 463 ? 65.957 24.550  -19.770 1.00 22.71 ? 469  TRP A CH2   1 
ATOM   4022 N  N     . VAL C 3 464 ? 59.927 28.074  -22.118 1.00 27.58 ? 470  VAL A N     1 
ATOM   4023 C  CA    . VAL C 3 464 ? 58.488 28.014  -21.913 1.00 28.37 ? 470  VAL A CA    1 
ATOM   4024 C  C     . VAL C 3 464 ? 58.187 27.548  -20.490 1.00 28.60 ? 470  VAL A C     1 
ATOM   4025 O  O     . VAL C 3 464 ? 58.988 26.849  -19.864 1.00 29.23 ? 470  VAL A O     1 
ATOM   4026 C  CB    . VAL C 3 464 ? 57.822 27.051  -22.918 1.00 29.99 ? 470  VAL A CB    1 
ATOM   4027 C  CG1   . VAL C 3 464 ? 56.317 27.026  -22.690 1.00 30.93 ? 470  VAL A CG1   1 
ATOM   4028 C  CG2   . VAL C 3 464 ? 58.126 27.507  -24.347 1.00 30.43 ? 470  VAL A CG2   1 
ATOM   4029 N  N     . GLN C 3 465 ? 57.019 27.931  -19.991 1.00 26.33 ? 471  GLN A N     1 
ATOM   4030 C  CA    . GLN C 3 465 ? 56.632 27.605  -18.635 1.00 24.35 ? 471  GLN A CA    1 
ATOM   4031 C  C     . GLN C 3 465 ? 55.474 26.623  -18.553 1.00 24.15 ? 471  GLN A C     1 
ATOM   4032 O  O     . GLN C 3 465 ? 54.501 26.717  -19.306 1.00 23.57 ? 471  GLN A O     1 
ATOM   4033 C  CB    . GLN C 3 465 ? 56.272 28.903  -17.905 1.00 23.75 ? 471  GLN A CB    1 
ATOM   4034 C  CG    . GLN C 3 465 ? 56.280 28.817  -16.385 1.00 23.57 ? 471  GLN A CG    1 
ATOM   4035 C  CD    . GLN C 3 465 ? 56.293 30.189  -15.743 1.00 23.80 ? 471  GLN A CD    1 
ATOM   4036 O  OE1   . GLN C 3 465 ? 57.031 31.075  -16.176 1.00 23.50 ? 471  GLN A OE1   1 
ATOM   4037 N  NE2   . GLN C 3 465 ? 55.490 30.372  -14.701 1.00 26.57 ? 471  GLN A NE2   1 
ATOM   4038 N  N     . ALA C 3 466 ? 55.595 25.678  -17.628 1.00 22.58 ? 472  ALA A N     1 
ATOM   4039 C  CA    . ALA C 3 466 ? 54.564 24.681  -17.391 1.00 23.46 ? 472  ALA A CA    1 
ATOM   4040 C  C     . ALA C 3 466 ? 54.143 24.838  -15.936 1.00 23.42 ? 472  ALA A C     1 
ATOM   4041 O  O     . ALA C 3 466 ? 54.974 24.751  -15.038 1.00 24.03 ? 472  ALA A O     1 
ATOM   4042 C  CB    . ALA C 3 466 ? 55.114 23.277  -17.626 1.00 23.63 ? 472  ALA A CB    1 
ATOM   4043 N  N     . GLY C 3 467 ? 52.858 25.090  -15.709 1.00 23.71 ? 473  GLY A N     1 
ATOM   4044 C  CA    . GLY C 3 467 ? 52.366 25.246  -14.354 1.00 23.57 ? 473  GLY A CA    1 
ATOM   4045 C  C     . GLY C 3 467 ? 51.353 24.162  -14.032 1.00 23.98 ? 473  GLY A C     1 
ATOM   4046 O  O     . GLY C 3 467 ? 50.402 23.953  -14.788 1.00 23.45 ? 473  GLY A O     1 
ATOM   4047 N  N     . ILE C 3 468 ? 51.557 23.450  -12.929 1.00 22.61 ? 474  ILE A N     1 
ATOM   4048 C  CA    . ILE C 3 468 ? 50.625 22.403  -12.550 1.00 22.11 ? 474  ILE A CA    1 
ATOM   4049 C  C     . ILE C 3 468 ? 50.190 22.600  -11.105 1.00 23.00 ? 474  ILE A C     1 
ATOM   4050 O  O     . ILE C 3 468 ? 51.007 22.871  -10.225 1.00 22.53 ? 474  ILE A O     1 
ATOM   4051 C  CB    . ILE C 3 468 ? 51.231 20.996  -12.724 1.00 21.55 ? 474  ILE A CB    1 
ATOM   4052 C  CG1   . ILE C 3 468 ? 51.738 20.816  -14.158 1.00 20.02 ? 474  ILE A CG1   1 
ATOM   4053 C  CG2   . ILE C 3 468 ? 50.184 19.936  -12.397 1.00 19.68 ? 474  ILE A CG2   1 
ATOM   4054 C  CD1   . ILE C 3 468 ? 53.119 21.413  -14.398 1.00 18.24 ? 474  ILE A CD1   1 
ATOM   4055 N  N     . ASP C 3 469 ? 48.892 22.450  -10.876 1.00 24.55 ? 475  ASP A N     1 
ATOM   4056 C  CA    . ASP C 3 469 ? 48.309 22.652  -9.561  1.00 25.20 ? 475  ASP A CA    1 
ATOM   4057 C  C     . ASP C 3 469 ? 47.334 21.526  -9.180  1.00 25.35 ? 475  ASP A C     1 
ATOM   4058 O  O     . ASP C 3 469 ? 46.443 21.169  -9.956  1.00 24.61 ? 475  ASP A O     1 
ATOM   4059 C  CB    . ASP C 3 469 ? 47.575 23.992  -9.574  1.00 27.68 ? 475  ASP A CB    1 
ATOM   4060 C  CG    . ASP C 3 469 ? 47.277 24.502  -8.193  1.00 31.05 ? 475  ASP A CG    1 
ATOM   4061 O  OD1   . ASP C 3 469 ? 47.142 23.678  -7.274  1.00 34.10 ? 475  ASP A OD1   1 
ATOM   4062 O  OD2   . ASP C 3 469 ? 47.167 25.731  -8.026  1.00 34.67 ? 475  ASP A OD2   1 
ATOM   4063 N  N     . ALA C 3 470 ? 47.498 20.973  -7.984  1.00 24.98 ? 476  ALA A N     1 
ATOM   4064 C  CA    . ALA C 3 470 ? 46.608 19.905  -7.521  1.00 25.64 ? 476  ALA A CA    1 
ATOM   4065 C  C     . ALA C 3 470 ? 45.178 20.445  -7.390  1.00 24.95 ? 476  ALA A C     1 
ATOM   4066 O  O     . ALA C 3 470 ? 44.954 21.484  -6.794  1.00 24.26 ? 476  ALA A O     1 
ATOM   4067 C  CB    . ALA C 3 470 ? 47.091 19.363  -6.175  1.00 21.23 ? 476  ALA A CB    1 
ATOM   4068 N  N     . SER C 3 471 ? 44.211 19.722  -7.932  1.00 26.60 ? 477  SER A N     1 
ATOM   4069 C  CA    . SER C 3 471 ? 42.814 20.152  -7.891  1.00 25.60 ? 477  SER A CA    1 
ATOM   4070 C  C     . SER C 3 471 ? 42.100 19.857  -6.562  1.00 24.45 ? 477  SER A C     1 
ATOM   4071 O  O     . SER C 3 471 ? 42.151 18.733  -6.057  1.00 23.37 ? 477  SER A O     1 
ATOM   4072 C  CB    . SER C 3 471 ? 42.062 19.490  -9.046  1.00 25.97 ? 477  SER A CB    1 
ATOM   4073 O  OG    . SER C 3 471 ? 42.824 19.575  -10.245 1.00 26.99 ? 477  SER A OG    1 
ATOM   4074 N  N     . GLY C 3 472 ? 41.432 20.878  -6.021  1.00 23.30 ? 478  GLY A N     1 
ATOM   4075 C  CA    . GLY C 3 472 ? 40.697 20.748  -4.772  1.00 24.58 ? 478  GLY A CA    1 
ATOM   4076 C  C     . GLY C 3 472 ? 41.403 19.863  -3.766  1.00 26.02 ? 478  GLY A C     1 
ATOM   4077 O  O     . GLY C 3 472 ? 40.774 19.060  -3.070  1.00 25.89 ? 478  GLY A O     1 
ATOM   4078 N  N     . LEU C 3 473 ? 42.719 20.037  -3.681  1.00 25.78 ? 479  LEU A N     1 
ATOM   4079 C  CA    . LEU C 3 473 ? 43.568 19.234  -2.811  1.00 25.12 ? 479  LEU A CA    1 
ATOM   4080 C  C     . LEU C 3 473 ? 43.034 18.867  -1.437  1.00 24.55 ? 479  LEU A C     1 
ATOM   4081 O  O     . LEU C 3 473 ? 42.719 17.708  -1.182  1.00 24.01 ? 479  LEU A O     1 
ATOM   4082 C  CB    . LEU C 3 473 ? 44.934 19.901  -2.643  1.00 24.62 ? 479  LEU A CB    1 
ATOM   4083 C  CG    . LEU C 3 473 ? 45.883 19.156  -1.694  1.00 24.70 ? 479  LEU A CG    1 
ATOM   4084 C  CD1   . LEU C 3 473 ? 46.180 17.754  -2.240  1.00 23.40 ? 479  LEU A CD1   1 
ATOM   4085 C  CD2   . LEU C 3 473 ? 47.167 19.954  -1.534  1.00 23.42 ? 479  LEU A CD2   1 
ATOM   4086 N  N     . GLU C 3 474 ? 42.937 19.847  -0.546  1.00 25.15 ? 480  GLU A N     1 
ATOM   4087 C  CA    . GLU C 3 474 ? 42.498 19.558  0.806   1.00 24.95 ? 480  GLU A CA    1 
ATOM   4088 C  C     . GLU C 3 474 ? 41.053 19.103  0.973   1.00 25.40 ? 480  GLU A C     1 
ATOM   4089 O  O     . GLU C 3 474 ? 40.713 18.520  1.999   1.00 25.61 ? 480  GLU A O     1 
ATOM   4090 C  CB    . GLU C 3 474 ? 42.847 20.737  1.733   1.00 26.20 ? 480  GLU A CB    1 
ATOM   4091 C  CG    . GLU C 3 474 ? 44.291 20.639  2.260   1.00 25.41 ? 480  GLU A CG    1 
ATOM   4092 C  CD    . GLU C 3 474 ? 44.789 21.882  3.003   1.00 27.90 ? 480  GLU A CD    1 
ATOM   4093 O  OE1   . GLU C 3 474 ? 44.057 22.422  3.861   1.00 28.82 ? 480  GLU A OE1   1 
ATOM   4094 O  OE2   . GLU C 3 474 ? 45.933 22.309  2.739   1.00 25.76 ? 480  GLU A OE2   1 
ATOM   4095 N  N     . LEU C 3 475 ? 40.203 19.341  -0.021  1.00 25.10 ? 481  LEU A N     1 
ATOM   4096 C  CA    . LEU C 3 475 ? 38.821 18.875  0.086   1.00 23.90 ? 481  LEU A CA    1 
ATOM   4097 C  C     . LEU C 3 475 ? 38.818 17.392  -0.277  1.00 24.56 ? 481  LEU A C     1 
ATOM   4098 O  O     . LEU C 3 475 ? 37.991 16.618  0.216   1.00 24.70 ? 481  LEU A O     1 
ATOM   4099 C  CB    . LEU C 3 475 ? 37.885 19.648  -0.847  1.00 23.42 ? 481  LEU A CB    1 
ATOM   4100 C  CG    . LEU C 3 475 ? 37.474 21.067  -0.434  1.00 23.56 ? 481  LEU A CG    1 
ATOM   4101 C  CD1   . LEU C 3 475 ? 36.443 21.584  -1.427  1.00 22.17 ? 481  LEU A CD1   1 
ATOM   4102 C  CD2   . LEU C 3 475 ? 36.897 21.083  0.984   1.00 21.34 ? 481  LEU A CD2   1 
ATOM   4103 N  N     . ARG C 3 476 ? 39.750 17.001  -1.144  1.00 24.14 ? 482  ARG A N     1 
ATOM   4104 C  CA    . ARG C 3 476 ? 39.874 15.600  -1.537  1.00 23.74 ? 482  ARG A CA    1 
ATOM   4105 C  C     . ARG C 3 476 ? 40.470 14.818  -0.371  1.00 24.31 ? 482  ARG A C     1 
ATOM   4106 O  O     . ARG C 3 476 ? 40.191 13.629  -0.206  1.00 23.83 ? 482  ARG A O     1 
ATOM   4107 C  CB    . ARG C 3 476 ? 40.749 15.459  -2.786  1.00 22.89 ? 482  ARG A CB    1 
ATOM   4108 C  CG    . ARG C 3 476 ? 40.127 16.122  -4.016  1.00 23.68 ? 482  ARG A CG    1 
ATOM   4109 C  CD    . ARG C 3 476 ? 40.670 15.564  -5.331  1.00 23.57 ? 482  ARG A CD    1 
ATOM   4110 N  NE    . ARG C 3 476 ? 40.200 16.343  -6.474  1.00 23.17 ? 482  ARG A NE    1 
ATOM   4111 C  CZ    . ARG C 3 476 ? 40.186 15.905  -7.728  1.00 23.40 ? 482  ARG A CZ    1 
ATOM   4112 N  NH1   . ARG C 3 476 ? 40.616 14.682  -8.017  1.00 22.10 ? 482  ARG A NH1   1 
ATOM   4113 N  NH2   . ARG C 3 476 ? 39.741 16.695  -8.695  1.00 22.90 ? 482  ARG A NH2   1 
ATOM   4114 N  N     . CYS C 3 477 ? 41.288 15.493  0.441   1.00 24.16 ? 483  CYS A N     1 
ATOM   4115 C  CA    . CYS C 3 477 ? 41.876 14.854  1.609   1.00 24.99 ? 483  CYS A CA    1 
ATOM   4116 C  C     . CYS C 3 477 ? 40.738 14.627  2.603   1.00 25.20 ? 483  CYS A C     1 
ATOM   4117 O  O     . CYS C 3 477 ? 40.712 13.632  3.328   1.00 25.73 ? 483  CYS A O     1 
ATOM   4118 C  CB    . CYS C 3 477 ? 42.958 15.743  2.231   1.00 25.76 ? 483  CYS A CB    1 
ATOM   4119 S  SG    . CYS C 3 477 ? 44.480 15.869  1.258   1.00 26.41 ? 483  CYS A SG    1 
ATOM   4120 N  N     . LEU C 3 478 ? 39.795 15.561  2.633   1.00 25.64 ? 484  LEU A N     1 
ATOM   4121 C  CA    . LEU C 3 478 ? 38.647 15.426  3.511   1.00 26.07 ? 484  LEU A CA    1 
ATOM   4122 C  C     . LEU C 3 478 ? 37.858 14.209  3.038   1.00 25.70 ? 484  LEU A C     1 
ATOM   4123 O  O     . LEU C 3 478 ? 37.460 13.378  3.838   1.00 26.86 ? 484  LEU A O     1 
ATOM   4124 C  CB    . LEU C 3 478 ? 37.763 16.675  3.445   1.00 26.19 ? 484  LEU A CB    1 
ATOM   4125 C  CG    . LEU C 3 478 ? 36.435 16.573  4.205   1.00 25.63 ? 484  LEU A CG    1 
ATOM   4126 C  CD1   . LEU C 3 478 ? 36.705 16.503  5.707   1.00 23.87 ? 484  LEU A CD1   1 
ATOM   4127 C  CD2   . LEU C 3 478 ? 35.554 17.769  3.867   1.00 22.53 ? 484  LEU A CD2   1 
ATOM   4128 N  N     . ALA C 3 479 ? 37.642 14.112  1.728   1.00 26.19 ? 485  ALA A N     1 
ATOM   4129 C  CA    . ALA C 3 479 ? 36.910 12.983  1.157   1.00 27.14 ? 485  ALA A CA    1 
ATOM   4130 C  C     . ALA C 3 479 ? 37.541 11.675  1.627   1.00 28.58 ? 485  ALA A C     1 
ATOM   4131 O  O     . ALA C 3 479 ? 36.851 10.776  2.115   1.00 29.46 ? 485  ALA A O     1 
ATOM   4132 C  CB    . ALA C 3 479 ? 36.927 13.054  -0.370  1.00 25.33 ? 485  ALA A CB    1 
ATOM   4133 N  N     . HIS C 3 480 ? 38.859 11.583  1.471   1.00 28.63 ? 486  HIS A N     1 
ATOM   4134 C  CA    . HIS C 3 480 ? 39.619 10.403  1.878   1.00 27.16 ? 486  HIS A CA    1 
ATOM   4135 C  C     . HIS C 3 480 ? 39.321 9.981   3.315   1.00 28.57 ? 486  HIS A C     1 
ATOM   4136 O  O     . HIS C 3 480 ? 38.923 8.843   3.562   1.00 29.71 ? 486  HIS A O     1 
ATOM   4137 C  CB    . HIS C 3 480 ? 41.121 10.680  1.743   1.00 24.63 ? 486  HIS A CB    1 
ATOM   4138 C  CG    . HIS C 3 480 ? 41.988 9.651   2.397   1.00 22.09 ? 486  HIS A CG    1 
ATOM   4139 N  ND1   . HIS C 3 480 ? 42.189 8.395   1.864   1.00 23.01 ? 486  HIS A ND1   1 
ATOM   4140 C  CD2   . HIS C 3 480 ? 42.688 9.684   3.556   1.00 19.87 ? 486  HIS A CD2   1 
ATOM   4141 C  CE1   . HIS C 3 480 ? 42.974 7.699   2.668   1.00 21.80 ? 486  HIS A CE1   1 
ATOM   4142 N  NE2   . HIS C 3 480 ? 43.290 8.458   3.702   1.00 20.39 ? 486  HIS A NE2   1 
ATOM   4143 N  N     . PHE C 3 481 ? 39.520 10.899  4.258   1.00 28.50 ? 487  PHE A N     1 
ATOM   4144 C  CA    . PHE C 3 481 ? 39.296 10.598  5.670   1.00 28.52 ? 487  PHE A CA    1 
ATOM   4145 C  C     . PHE C 3 481 ? 37.831 10.453  6.082   1.00 28.05 ? 487  PHE A C     1 
ATOM   4146 O  O     . PHE C 3 481 ? 37.537 9.945   7.161   1.00 27.62 ? 487  PHE A O     1 
ATOM   4147 C  CB    . PHE C 3 481 ? 39.979 11.658  6.540   1.00 28.79 ? 487  PHE A CB    1 
ATOM   4148 C  CG    . PHE C 3 481 ? 41.482 11.600  6.495   1.00 28.42 ? 487  PHE A CG    1 
ATOM   4149 C  CD1   . PHE C 3 481 ? 42.164 10.491  6.995   1.00 27.55 ? 487  PHE A CD1   1 
ATOM   4150 C  CD2   . PHE C 3 481 ? 42.218 12.644  5.944   1.00 28.41 ? 487  PHE A CD2   1 
ATOM   4151 C  CE1   . PHE C 3 481 ? 43.558 10.427  6.942   1.00 27.20 ? 487  PHE A CE1   1 
ATOM   4152 C  CE2   . PHE C 3 481 ? 43.615 12.587  5.889   1.00 27.50 ? 487  PHE A CE2   1 
ATOM   4153 C  CZ    . PHE C 3 481 ? 44.281 11.477  6.389   1.00 26.47 ? 487  PHE A CZ    1 
ATOM   4154 N  N     . MET C 3 482 ? 36.915 10.900  5.233   1.00 28.50 ? 488  MET A N     1 
ATOM   4155 C  CA    . MET C 3 482 ? 35.492 10.793  5.543   1.00 30.56 ? 488  MET A CA    1 
ATOM   4156 C  C     . MET C 3 482 ? 34.905 9.515   4.966   1.00 30.17 ? 488  MET A C     1 
ATOM   4157 O  O     . MET C 3 482 ? 33.758 9.173   5.249   1.00 31.41 ? 488  MET A O     1 
ATOM   4158 C  CB    . MET C 3 482 ? 34.706 11.974  4.971   1.00 29.19 ? 488  MET A CB    1 
ATOM   4159 C  CG    . MET C 3 482 ? 34.913 13.297  5.679   1.00 30.60 ? 488  MET A CG    1 
ATOM   4160 S  SD    . MET C 3 482 ? 33.571 14.469  5.302   1.00 35.38 ? 488  MET A SD    1 
ATOM   4161 C  CE    . MET C 3 482 ? 33.525 14.397  3.516   1.00 32.43 ? 488  MET A CE    1 
ATOM   4162 N  N     . ALA C 3 483 ? 35.695 8.821   4.156   1.00 28.18 ? 489  ALA A N     1 
ATOM   4163 C  CA    . ALA C 3 483 ? 35.244 7.596   3.509   1.00 28.53 ? 489  ALA A CA    1 
ATOM   4164 C  C     . ALA C 3 483 ? 34.757 6.519   4.480   1.00 28.86 ? 489  ALA A C     1 
ATOM   4165 O  O     . ALA C 3 483 ? 33.765 5.859   4.215   1.00 30.66 ? 489  ALA A O     1 
ATOM   4166 C  CB    . ALA C 3 483 ? 36.350 7.052   2.607   1.00 26.65 ? 489  ALA A CB    1 
ATOM   4167 N  N     . ARG C 3 484 ? 35.437 6.338   5.604   1.00 29.62 ? 490  ARG A N     1 
ATOM   4168 C  CA    . ARG C 3 484 ? 35.003 5.334   6.568   1.00 29.81 ? 490  ARG A CA    1 
ATOM   4169 C  C     . ARG C 3 484 ? 33.642 5.697   7.171   1.00 30.08 ? 490  ARG A C     1 
ATOM   4170 O  O     . ARG C 3 484 ? 32.937 4.833   7.698   1.00 29.10 ? 490  ARG A O     1 
ATOM   4171 C  CB    . ARG C 3 484 ? 36.030 5.184   7.690   1.00 31.21 ? 490  ARG A CB    1 
ATOM   4172 C  CG    . ARG C 3 484 ? 36.494 6.497   8.252   1.00 33.68 ? 490  ARG A CG    1 
ATOM   4173 C  CD    . ARG C 3 484 ? 37.275 6.317   9.535   1.00 37.23 ? 490  ARG A CD    1 
ATOM   4174 N  NE    . ARG C 3 484 ? 36.417 5.900   10.639  1.00 40.83 ? 490  ARG A NE    1 
ATOM   4175 C  CZ    . ARG C 3 484 ? 36.724 6.071   11.921  1.00 42.67 ? 490  ARG A CZ    1 
ATOM   4176 N  NH1   . ARG C 3 484 ? 37.870 6.657   12.257  1.00 41.85 ? 490  ARG A NH1   1 
ATOM   4177 N  NH2   . ARG C 3 484 ? 35.893 5.652   12.866  1.00 42.82 ? 490  ARG A NH2   1 
ATOM   4178 N  N     . PHE C 3 485 ? 33.273 6.971   7.092   1.00 29.75 ? 491  PHE A N     1 
ATOM   4179 C  CA    . PHE C 3 485 ? 31.995 7.415   7.637   1.00 29.95 ? 491  PHE A CA    1 
ATOM   4180 C  C     . PHE C 3 485 ? 30.884 7.451   6.585   1.00 30.56 ? 491  PHE A C     1 
ATOM   4181 O  O     . PHE C 3 485 ? 29.745 7.078   6.871   1.00 31.73 ? 491  PHE A O     1 
ATOM   4182 C  CB    . PHE C 3 485 ? 32.136 8.804   8.271   1.00 28.96 ? 491  PHE A CB    1 
ATOM   4183 C  CG    . PHE C 3 485 ? 33.057 8.843   9.466   1.00 30.06 ? 491  PHE A CG    1 
ATOM   4184 C  CD1   . PHE C 3 485 ? 32.684 8.254   10.669  1.00 29.82 ? 491  PHE A CD1   1 
ATOM   4185 C  CD2   . PHE C 3 485 ? 34.297 9.467   9.384   1.00 28.28 ? 491  PHE A CD2   1 
ATOM   4186 C  CE1   . PHE C 3 485 ? 33.534 8.284   11.784  1.00 31.29 ? 491  PHE A CE1   1 
ATOM   4187 C  CE2   . PHE C 3 485 ? 35.154 9.507   10.479  1.00 30.20 ? 491  PHE A CE2   1 
ATOM   4188 C  CZ    . PHE C 3 485 ? 34.772 8.912   11.689  1.00 32.78 ? 491  PHE A CZ    1 
ATOM   4189 N  N     . ASP C 3 486 ? 31.210 7.871   5.366   1.00 30.20 ? 492  ASP A N     1 
ATOM   4190 C  CA    . ASP C 3 486 ? 30.191 7.976   4.321   1.00 30.40 ? 492  ASP A CA    1 
ATOM   4191 C  C     . ASP C 3 486 ? 30.337 7.022   3.140   1.00 30.39 ? 492  ASP A C     1 
ATOM   4192 O  O     . ASP C 3 486 ? 29.670 7.186   2.125   1.00 31.27 ? 492  ASP A O     1 
ATOM   4193 C  CB    . ASP C 3 486 ? 30.130 9.422   3.810   1.00 30.57 ? 492  ASP A CB    1 
ATOM   4194 C  CG    . ASP C 3 486 ? 31.268 9.762   2.864   1.00 30.60 ? 492  ASP A CG    1 
ATOM   4195 O  OD1   . ASP C 3 486 ? 32.308 9.060   2.878   1.00 30.13 ? 492  ASP A OD1   1 
ATOM   4196 O  OD2   . ASP C 3 486 ? 31.118 10.744  2.108   1.00 29.08 ? 492  ASP A OD2   1 
ATOM   4197 N  N     . ASN C 3 487 ? 31.203 6.026   3.275   1.00 31.39 ? 493  ASN A N     1 
ATOM   4198 C  CA    . ASN C 3 487 ? 31.429 5.036   2.225   1.00 32.65 ? 493  ASN A CA    1 
ATOM   4199 C  C     . ASN C 3 487 ? 31.866 5.595   0.871   1.00 33.79 ? 493  ASN A C     1 
ATOM   4200 O  O     . ASN C 3 487 ? 31.595 4.990   -0.170  1.00 34.95 ? 493  ASN A O     1 
ATOM   4201 C  CB    . ASN C 3 487 ? 30.178 4.179   2.031   1.00 33.22 ? 493  ASN A CB    1 
ATOM   4202 C  CG    . ASN C 3 487 ? 29.763 3.466   3.297   1.00 35.54 ? 493  ASN A CG    1 
ATOM   4203 O  OD1   . ASN C 3 487 ? 30.570 2.790   3.943   1.00 38.78 ? 493  ASN A OD1   1 
ATOM   4204 N  ND2   . ASN C 3 487 ? 28.501 3.609   3.663   1.00 35.66 ? 493  ASN A ND2   1 
ATOM   4205 N  N     . GLY C 3 488 ? 32.532 6.746   0.881   1.00 33.55 ? 494  GLY A N     1 
ATOM   4206 C  CA    . GLY C 3 488 ? 33.003 7.332   -0.362  1.00 34.07 ? 494  GLY A CA    1 
ATOM   4207 C  C     . GLY C 3 488 ? 32.028 8.207   -1.128  1.00 35.33 ? 494  GLY A C     1 
ATOM   4208 O  O     . GLY C 3 488 ? 32.297 8.568   -2.274  1.00 35.67 ? 494  GLY A O     1 
ATOM   4209 N  N     . GLU C 3 489 ? 30.906 8.565   -0.510  1.00 36.20 ? 495  GLU A N     1 
ATOM   4210 C  CA    . GLU C 3 489 ? 29.918 9.400   -1.188  1.00 37.57 ? 495  GLU A CA    1 
ATOM   4211 C  C     . GLU C 3 489 ? 30.510 10.740  -1.594  1.00 36.32 ? 495  GLU A C     1 
ATOM   4212 O  O     . GLU C 3 489 ? 30.397 11.150  -2.752  1.00 36.44 ? 495  GLU A O     1 
ATOM   4213 C  CB    . GLU C 3 489 ? 28.696 9.620   -0.293  1.00 39.60 ? 495  GLU A CB    1 
ATOM   4214 C  CG    . GLU C 3 489 ? 27.927 8.339   -0.013  1.00 44.29 ? 495  GLU A CG    1 
ATOM   4215 C  CD    . GLU C 3 489 ? 26.964 8.465   1.151   1.00 47.14 ? 495  GLU A CD    1 
ATOM   4216 O  OE1   . GLU C 3 489 ? 26.442 7.420   1.598   1.00 48.94 ? 495  GLU A OE1   1 
ATOM   4217 O  OE2   . GLU C 3 489 ? 26.727 9.603   1.619   1.00 50.36 ? 495  GLU A OE2   1 
ATOM   4218 N  N     . TYR C 3 490 ? 31.150 11.419  -0.648  1.00 35.28 ? 496  TYR A N     1 
ATOM   4219 C  CA    . TYR C 3 490 ? 31.747 12.710  -0.947  1.00 34.14 ? 496  TYR A CA    1 
ATOM   4220 C  C     . TYR C 3 490 ? 32.889 12.555  -1.945  1.00 34.28 ? 496  TYR A C     1 
ATOM   4221 O  O     . TYR C 3 490 ? 33.007 13.342  -2.878  1.00 33.06 ? 496  TYR A O     1 
ATOM   4222 C  CB    . TYR C 3 490 ? 32.249 13.384  0.335   1.00 34.81 ? 496  TYR A CB    1 
ATOM   4223 C  CG    . TYR C 3 490 ? 32.733 14.796  0.107   1.00 36.13 ? 496  TYR A CG    1 
ATOM   4224 C  CD1   . TYR C 3 490 ? 31.886 15.763  -0.435  1.00 36.95 ? 496  TYR A CD1   1 
ATOM   4225 C  CD2   . TYR C 3 490 ? 34.048 15.161  0.393   1.00 36.39 ? 496  TYR A CD2   1 
ATOM   4226 C  CE1   . TYR C 3 490 ? 32.338 17.058  -0.694  1.00 36.65 ? 496  TYR A CE1   1 
ATOM   4227 C  CE2   . TYR C 3 490 ? 34.509 16.453  0.141   1.00 36.30 ? 496  TYR A CE2   1 
ATOM   4228 C  CZ    . TYR C 3 490 ? 33.650 17.392  -0.404  1.00 36.31 ? 496  TYR A CZ    1 
ATOM   4229 O  OH    . TYR C 3 490 ? 34.107 18.659  -0.671  1.00 36.96 ? 496  TYR A OH    1 
ATOM   4230 N  N     . ALA C 3 491 ? 33.721 11.531  -1.753  1.00 34.47 ? 497  ALA A N     1 
ATOM   4231 C  CA    . ALA C 3 491 ? 34.842 11.281  -2.652  1.00 35.26 ? 497  ALA A CA    1 
ATOM   4232 C  C     . ALA C 3 491 ? 34.322 11.157  -4.078  1.00 37.20 ? 497  ALA A C     1 
ATOM   4233 O  O     . ALA C 3 491 ? 34.984 11.570  -5.033  1.00 36.68 ? 497  ALA A O     1 
ATOM   4234 C  CB    . ALA C 3 491 ? 35.574 10.006  -2.247  1.00 33.85 ? 497  ALA A CB    1 
ATOM   4235 N  N     . HIS C 3 492 ? 33.125 10.591  -4.209  1.00 38.50 ? 498  HIS A N     1 
ATOM   4236 C  CA    . HIS C 3 492 ? 32.501 10.412  -5.511  1.00 40.61 ? 498  HIS A CA    1 
ATOM   4237 C  C     . HIS C 3 492 ? 31.816 11.677  -6.032  1.00 41.63 ? 498  HIS A C     1 
ATOM   4238 O  O     . HIS C 3 492 ? 31.961 12.028  -7.205  1.00 41.43 ? 498  HIS A O     1 
ATOM   4239 C  CB    . HIS C 3 492 ? 31.467 9.283   -5.456  1.00 41.58 ? 498  HIS A CB    1 
ATOM   4240 C  CG    . HIS C 3 492 ? 30.641 9.169   -6.700  1.00 43.05 ? 498  HIS A CG    1 
ATOM   4241 N  ND1   . HIS C 3 492 ? 31.084 8.515   -7.831  1.00 44.46 ? 498  HIS A ND1   1 
ATOM   4242 C  CD2   . HIS C 3 492 ? 29.426 9.680   -7.012  1.00 43.23 ? 498  HIS A CD2   1 
ATOM   4243 C  CE1   . HIS C 3 492 ? 30.177 8.630   -8.786  1.00 44.79 ? 498  HIS A CE1   1 
ATOM   4244 N  NE2   . HIS C 3 492 ? 29.162 9.332   -8.315  1.00 44.22 ? 498  HIS A NE2   1 
ATOM   4245 N  N     . GLU C 3 493 ? 31.059 12.356  -5.174  1.00 42.06 ? 499  GLU A N     1 
ATOM   4246 C  CA    . GLU C 3 493 ? 30.349 13.555  -5.608  1.00 43.66 ? 499  GLU A CA    1 
ATOM   4247 C  C     . GLU C 3 493 ? 31.286 14.727  -5.895  1.00 43.26 ? 499  GLU A C     1 
ATOM   4248 O  O     . GLU C 3 493 ? 30.968 15.604  -6.698  1.00 44.02 ? 499  GLU A O     1 
ATOM   4249 C  CB    . GLU C 3 493 ? 29.296 13.960  -4.566  1.00 45.20 ? 499  GLU A CB    1 
ATOM   4250 C  CG    . GLU C 3 493 ? 29.851 14.542  -3.269  1.00 48.91 ? 499  GLU A CG    1 
ATOM   4251 C  CD    . GLU C 3 493 ? 28.757 14.877  -2.254  1.00 51.08 ? 499  GLU A CD    1 
ATOM   4252 O  OE1   . GLU C 3 493 ? 28.102 13.939  -1.744  1.00 51.73 ? 499  GLU A OE1   1 
ATOM   4253 O  OE2   . GLU C 3 493 ? 28.548 16.079  -1.968  1.00 51.91 ? 499  GLU A OE2   1 
ATOM   4254 N  N     . ILE C 3 494 ? 32.451 14.731  -5.255  1.00 43.05 ? 500  ILE A N     1 
ATOM   4255 C  CA    . ILE C 3 494 ? 33.417 15.806  -5.449  1.00 42.60 ? 500  ILE A CA    1 
ATOM   4256 C  C     . ILE C 3 494 ? 34.010 15.780  -6.856  1.00 42.40 ? 500  ILE A C     1 
ATOM   4257 O  O     . ILE C 3 494 ? 34.561 16.773  -7.329  1.00 42.97 ? 500  ILE A O     1 
ATOM   4258 C  CB    . ILE C 3 494 ? 34.562 15.715  -4.409  1.00 42.39 ? 500  ILE A CB    1 
ATOM   4259 C  CG1   . ILE C 3 494 ? 35.375 17.008  -4.409  1.00 42.02 ? 500  ILE A CG1   1 
ATOM   4260 C  CG2   . ILE C 3 494 ? 35.468 14.532  -4.726  1.00 42.53 ? 500  ILE A CG2   1 
ATOM   4261 C  CD1   . ILE C 3 494 ? 36.351 17.108  -3.258  1.00 40.71 ? 500  ILE A CD1   1 
ATOM   4262 N  N     . LEU C 3 495 ? 33.889 14.642  -7.527  1.00 42.12 ? 501  LEU A N     1 
ATOM   4263 C  CA    . LEU C 3 495 ? 34.419 14.503  -8.876  1.00 42.87 ? 501  LEU A CA    1 
ATOM   4264 C  C     . LEU C 3 495 ? 33.411 14.899  -9.951  1.00 43.60 ? 501  LEU A C     1 
ATOM   4265 O  O     . LEU C 3 495 ? 33.706 14.805  -11.145 1.00 42.91 ? 501  LEU A O     1 
ATOM   4266 C  CB    . LEU C 3 495 ? 34.882 13.064  -9.115  1.00 42.31 ? 501  LEU A CB    1 
ATOM   4267 C  CG    . LEU C 3 495 ? 36.076 12.601  -8.272  1.00 43.49 ? 501  LEU A CG    1 
ATOM   4268 C  CD1   . LEU C 3 495 ? 36.460 11.177  -8.661  1.00 43.45 ? 501  LEU A CD1   1 
ATOM   4269 C  CD2   . LEU C 3 495 ? 37.252 13.541  -8.487  1.00 41.98 ? 501  LEU A CD2   1 
ATOM   4270 N  N     . ASN C 3 496 ? 32.229 15.342  -9.522  1.00 44.33 ? 502  ASN A N     1 
ATOM   4271 C  CA    . ASN C 3 496 ? 31.166 15.759  -10.439 1.00 44.90 ? 502  ASN A CA    1 
ATOM   4272 C  C     . ASN C 3 496 ? 31.292 17.247  -10.749 1.00 43.74 ? 502  ASN A C     1 
ATOM   4273 O  O     . ASN C 3 496 ? 30.617 18.081  -10.135 1.00 42.57 ? 502  ASN A O     1 
ATOM   4274 C  CB    . ASN C 3 496 ? 29.793 15.463  -9.823  1.00 46.34 ? 502  ASN A CB    1 
ATOM   4275 C  CG    . ASN C 3 496 ? 28.645 16.062  -10.626 1.00 48.27 ? 502  ASN A CG    1 
ATOM   4276 O  OD1   . ASN C 3 496 ? 28.539 15.858  -11.841 1.00 47.84 ? 502  ASN A OD1   1 
ATOM   4277 N  ND2   . ASN C 3 496 ? 27.774 16.804  -9.945  1.00 48.47 ? 502  ASN A ND2   1 
ATOM   4278 N  N     . GLY C 3 497 ? 32.152 17.566  -11.715 1.00 43.25 ? 503  GLY A N     1 
ATOM   4279 C  CA    . GLY C 3 497 ? 32.389 18.951  -12.084 1.00 42.71 ? 503  GLY A CA    1 
ATOM   4280 C  C     . GLY C 3 497 ? 33.373 19.549  -11.089 1.00 42.82 ? 503  GLY A C     1 
ATOM   4281 O  O     . GLY C 3 497 ? 33.840 18.850  -10.190 1.00 43.33 ? 503  GLY A O     1 
ATOM   4282 N  N     . ASP C 3 498 ? 33.700 20.829  -11.239 1.00 42.78 ? 504  ASP A N     1 
ATOM   4283 C  CA    . ASP C 3 498 ? 34.626 21.479  -10.316 1.00 41.84 ? 504  ASP A CA    1 
ATOM   4284 C  C     . ASP C 3 498 ? 33.935 21.729  -8.979  1.00 41.20 ? 504  ASP A C     1 
ATOM   4285 O  O     . ASP C 3 498 ? 32.911 22.413  -8.921  1.00 42.14 ? 504  ASP A O     1 
ATOM   4286 C  CB    . ASP C 3 498 ? 35.115 22.815  -10.879 1.00 41.68 ? 504  ASP A CB    1 
ATOM   4287 C  CG    . ASP C 3 498 ? 36.164 23.461  -9.995  1.00 41.34 ? 504  ASP A CG    1 
ATOM   4288 O  OD1   . ASP C 3 498 ? 37.273 22.895  -9.901  1.00 39.47 ? 504  ASP A OD1   1 
ATOM   4289 O  OD2   . ASP C 3 498 ? 35.877 24.516  -9.383  1.00 40.50 ? 504  ASP A OD2   1 
ATOM   4290 N  N     . ILE C 3 499 ? 34.511 21.195  -7.907  1.00 38.96 ? 505  ILE A N     1 
ATOM   4291 C  CA    . ILE C 3 499 ? 33.938 21.338  -6.572  1.00 38.64 ? 505  ILE A CA    1 
ATOM   4292 C  C     . ILE C 3 499 ? 33.807 22.789  -6.069  1.00 38.34 ? 505  ILE A C     1 
ATOM   4293 O  O     . ILE C 3 499 ? 32.811 23.132  -5.421  1.00 37.18 ? 505  ILE A O     1 
ATOM   4294 C  CB    . ILE C 3 499 ? 34.749 20.489  -5.534  1.00 37.48 ? 505  ILE A CB    1 
ATOM   4295 C  CG1   . ILE C 3 499 ? 34.067 20.520  -4.164  1.00 36.79 ? 505  ILE A CG1   1 
ATOM   4296 C  CG2   . ILE C 3 499 ? 36.173 21.014  -5.427  1.00 38.40 ? 505  ILE A CG2   1 
ATOM   4297 C  CD1   . ILE C 3 499 ? 32.643 19.986  -4.159  1.00 35.83 ? 505  ILE A CD1   1 
ATOM   4298 N  N     . HIS C 3 500 ? 34.792 23.637  -6.365  1.00 37.51 ? 506  HIS A N     1 
ATOM   4299 C  CA    . HIS C 3 500 ? 34.745 25.034  -5.915  1.00 37.12 ? 506  HIS A CA    1 
ATOM   4300 C  C     . HIS C 3 500 ? 33.727 25.854  -6.688  1.00 37.82 ? 506  HIS A C     1 
ATOM   4301 O  O     . HIS C 3 500 ? 33.036 26.702  -6.117  1.00 37.82 ? 506  HIS A O     1 
ATOM   4302 C  CB    . HIS C 3 500 ? 36.125 25.689  -6.033  1.00 34.49 ? 506  HIS A CB    1 
ATOM   4303 C  CG    . HIS C 3 500 ? 37.136 25.115  -5.096  1.00 33.57 ? 506  HIS A CG    1 
ATOM   4304 N  ND1   . HIS C 3 500 ? 36.976 25.136  -3.726  1.00 31.34 ? 506  HIS A ND1   1 
ATOM   4305 C  CD2   . HIS C 3 500 ? 38.302 24.472  -5.328  1.00 30.75 ? 506  HIS A CD2   1 
ATOM   4306 C  CE1   . HIS C 3 500 ? 37.998 24.529  -3.156  1.00 31.41 ? 506  HIS A CE1   1 
ATOM   4307 N  NE2   . HIS C 3 500 ? 38.817 24.116  -4.106  1.00 31.07 ? 506  HIS A NE2   1 
ATOM   4308 N  N     . THR C 3 501 ? 33.649 25.615  -7.992  1.00 38.59 ? 507  THR A N     1 
ATOM   4309 C  CA    . THR C 3 501 ? 32.687 26.317  -8.823  1.00 39.23 ? 507  THR A CA    1 
ATOM   4310 C  C     . THR C 3 501 ? 31.299 25.842  -8.417  1.00 39.55 ? 507  THR A C     1 
ATOM   4311 O  O     . THR C 3 501 ? 30.346 26.622  -8.389  1.00 40.09 ? 507  THR A O     1 
ATOM   4312 C  CB    . THR C 3 501 ? 32.930 26.027  -10.316 1.00 39.77 ? 507  THR A CB    1 
ATOM   4313 O  OG1   . THR C 3 501 ? 33.980 26.877  -10.794 1.00 40.92 ? 507  THR A OG1   1 
ATOM   4314 C  CG2   . THR C 3 501 ? 31.666 26.262  -11.128 1.00 39.23 ? 507  THR A CG2   1 
ATOM   4315 N  N     . LYS C 3 502 ? 31.191 24.558  -8.086  1.00 39.79 ? 508  LYS A N     1 
ATOM   4316 C  CA    . LYS C 3 502 ? 29.913 24.005  -7.670  1.00 40.60 ? 508  LYS A CA    1 
ATOM   4317 C  C     . LYS C 3 502 ? 29.492 24.625  -6.342  1.00 40.69 ? 508  LYS A C     1 
ATOM   4318 O  O     . LYS C 3 502 ? 28.308 24.886  -6.123  1.00 42.61 ? 508  LYS A O     1 
ATOM   4319 C  CB    . LYS C 3 502 ? 29.994 22.482  -7.532  1.00 42.27 ? 508  LYS A CB    1 
ATOM   4320 C  CG    . LYS C 3 502 ? 28.637 21.820  -7.310  1.00 42.06 ? 508  LYS A CG    1 
ATOM   4321 C  CD    . LYS C 3 502 ? 28.753 20.305  -7.175  1.00 41.99 ? 508  LYS A CD    1 
ATOM   4322 C  CE    . LYS C 3 502 ? 29.439 19.916  -5.875  1.00 42.76 ? 508  LYS A CE    1 
ATOM   4323 N  NZ    . LYS C 3 502 ? 29.645 18.443  -5.752  1.00 43.09 ? 508  LYS A NZ    1 
ATOM   4324 N  N     . ASN C 3 503 ? 30.456 24.857  -5.454  1.00 39.40 ? 509  ASN A N     1 
ATOM   4325 C  CA    . ASN C 3 503 ? 30.153 25.464  -4.162  1.00 38.53 ? 509  ASN A CA    1 
ATOM   4326 C  C     . ASN C 3 503 ? 29.835 26.948  -4.332  1.00 39.03 ? 509  ASN A C     1 
ATOM   4327 O  O     . ASN C 3 503 ? 28.975 27.492  -3.640  1.00 38.89 ? 509  ASN A O     1 
ATOM   4328 C  CB    . ASN C 3 503 ? 31.326 25.311  -3.186  1.00 38.46 ? 509  ASN A CB    1 
ATOM   4329 C  CG    . ASN C 3 503 ? 31.509 23.886  -2.709  1.00 37.40 ? 509  ASN A CG    1 
ATOM   4330 O  OD1   . ASN C 3 503 ? 30.564 23.098  -2.697  1.00 37.60 ? 509  ASN A OD1   1 
ATOM   4331 N  ND2   . ASN C 3 503 ? 32.725 23.551  -2.294  1.00 36.54 ? 509  ASN A ND2   1 
ATOM   4332 N  N     . GLN C 3 504 ? 30.537 27.600  -5.253  1.00 39.27 ? 510  GLN A N     1 
ATOM   4333 C  CA    . GLN C 3 504 ? 30.321 29.016  -5.506  1.00 39.82 ? 510  GLN A CA    1 
ATOM   4334 C  C     . GLN C 3 504 ? 28.849 29.250  -5.835  1.00 40.27 ? 510  GLN A C     1 
ATOM   4335 O  O     . GLN C 3 504 ? 28.207 30.154  -5.291  1.00 39.44 ? 510  GLN A O     1 
ATOM   4336 C  CB    . GLN C 3 504 ? 31.178 29.482  -6.683  1.00 39.05 ? 510  GLN A CB    1 
ATOM   4337 C  CG    . GLN C 3 504 ? 31.178 30.988  -6.881  1.00 39.92 ? 510  GLN A CG    1 
ATOM   4338 C  CD    . GLN C 3 504 ? 31.469 31.387  -8.314  1.00 41.07 ? 510  GLN A CD    1 
ATOM   4339 O  OE1   . GLN C 3 504 ? 32.324 30.798  -8.980  1.00 42.02 ? 510  GLN A OE1   1 
ATOM   4340 N  NE2   . GLN C 3 504 ? 30.764 32.400  -8.795  1.00 41.81 ? 510  GLN A NE2   1 
ATOM   4341 N  N     . ILE C 3 505 ? 28.324 28.422  -6.732  1.00 40.48 ? 511  ILE A N     1 
ATOM   4342 C  CA    . ILE C 3 505 ? 26.935 28.529  -7.152  1.00 42.13 ? 511  ILE A CA    1 
ATOM   4343 C  C     . ILE C 3 505 ? 25.976 28.328  -5.981  1.00 42.38 ? 511  ILE A C     1 
ATOM   4344 O  O     . ILE C 3 505 ? 25.087 29.152  -5.749  1.00 42.20 ? 511  ILE A O     1 
ATOM   4345 C  CB    . ILE C 3 505 ? 26.630 27.509  -8.276  1.00 42.61 ? 511  ILE A CB    1 
ATOM   4346 C  CG1   . ILE C 3 505 ? 27.420 27.898  -9.536  1.00 43.39 ? 511  ILE A CG1   1 
ATOM   4347 C  CG2   . ILE C 3 505 ? 25.132 27.469  -8.564  1.00 42.05 ? 511  ILE A CG2   1 
ATOM   4348 C  CD1   . ILE C 3 505 ? 27.375 26.878  -10.655 1.00 41.87 ? 511  ILE A CD1   1 
ATOM   4349 N  N     . ALA C 3 506 ? 26.172 27.248  -5.232  1.00 43.33 ? 512  ALA A N     1 
ATOM   4350 C  CA    . ALA C 3 506 ? 25.316 26.944  -4.091  1.00 44.67 ? 512  ALA A CA    1 
ATOM   4351 C  C     . ALA C 3 506 ? 25.364 28.027  -3.016  1.00 45.56 ? 512  ALA A C     1 
ATOM   4352 O  O     . ALA C 3 506 ? 24.357 28.312  -2.370  1.00 46.59 ? 512  ALA A O     1 
ATOM   4353 C  CB    . ALA C 3 506 ? 25.705 25.594  -3.490  1.00 44.28 ? 512  ALA A CB    1 
ATOM   4354 N  N     . ALA C 3 507 ? 26.533 28.626  -2.820  1.00 45.62 ? 513  ALA A N     1 
ATOM   4355 C  CA    . ALA C 3 507 ? 26.682 29.666  -1.811  1.00 45.64 ? 513  ALA A CA    1 
ATOM   4356 C  C     . ALA C 3 507 ? 26.371 31.048  -2.377  1.00 46.09 ? 513  ALA A C     1 
ATOM   4357 O  O     . ALA C 3 507 ? 26.373 32.040  -1.650  1.00 45.18 ? 513  ALA A O     1 
ATOM   4358 C  CB    . ALA C 3 507 ? 28.093 29.636  -1.240  1.00 44.91 ? 513  ALA A CB    1 
ATOM   4359 N  N     . GLU C 3 508 ? 26.111 31.110  -3.679  1.00 47.32 ? 514  GLU A N     1 
ATOM   4360 C  CA    . GLU C 3 508 ? 25.788 32.375  -4.332  1.00 48.46 ? 514  GLU A CA    1 
ATOM   4361 C  C     . GLU C 3 508 ? 26.921 33.394  -4.177  1.00 47.90 ? 514  GLU A C     1 
ATOM   4362 O  O     . GLU C 3 508 ? 26.682 34.584  -3.954  1.00 48.09 ? 514  GLU A O     1 
ATOM   4363 C  CB    . GLU C 3 508 ? 24.489 32.935  -3.745  1.00 49.68 ? 514  GLU A CB    1 
ATOM   4364 C  CG    . GLU C 3 508 ? 23.357 31.917  -3.729  1.00 53.07 ? 514  GLU A CG    1 
ATOM   4365 C  CD    . GLU C 3 508 ? 22.046 32.491  -3.229  1.00 54.56 ? 514  GLU A CD    1 
ATOM   4366 O  OE1   . GLU C 3 508 ? 21.489 33.383  -3.906  1.00 55.41 ? 514  GLU A OE1   1 
ATOM   4367 O  OE2   . GLU C 3 508 ? 21.572 32.049  -2.159  1.00 55.40 ? 514  GLU A OE2   1 
ATOM   4368 N  N     . LEU C 3 509 ? 28.154 32.919  -4.310  1.00 46.54 ? 515  LEU A N     1 
ATOM   4369 C  CA    . LEU C 3 509 ? 29.324 33.775  -4.178  1.00 45.55 ? 515  LEU A CA    1 
ATOM   4370 C  C     . LEU C 3 509 ? 29.731 34.384  -5.527  1.00 44.30 ? 515  LEU A C     1 
ATOM   4371 O  O     . LEU C 3 509 ? 29.478 33.806  -6.581  1.00 43.85 ? 515  LEU A O     1 
ATOM   4372 C  CB    . LEU C 3 509 ? 30.470 32.968  -3.556  1.00 45.26 ? 515  LEU A CB    1 
ATOM   4373 C  CG    . LEU C 3 509 ? 30.056 32.274  -2.245  1.00 45.19 ? 515  LEU A CG    1 
ATOM   4374 C  CD1   . LEU C 3 509 ? 31.216 31.463  -1.689  1.00 43.21 ? 515  LEU A CD1   1 
ATOM   4375 C  CD2   . LEU C 3 509 ? 29.595 33.318  -1.228  1.00 43.32 ? 515  LEU A CD2   1 
ATOM   4376 N  N     . PRO C 3 510 ? 30.367 35.568  -5.504  1.00 43.19 ? 516  PRO A N     1 
ATOM   4377 C  CA    . PRO C 3 510 ? 30.814 36.292  -6.701  1.00 42.38 ? 516  PRO A CA    1 
ATOM   4378 C  C     . PRO C 3 510 ? 31.927 35.683  -7.558  1.00 42.16 ? 516  PRO A C     1 
ATOM   4379 O  O     . PRO C 3 510 ? 31.920 35.833  -8.781  1.00 40.28 ? 516  PRO A O     1 
ATOM   4380 C  CB    . PRO C 3 510 ? 31.203 37.662  -6.145  1.00 41.91 ? 516  PRO A CB    1 
ATOM   4381 C  CG    . PRO C 3 510 ? 31.689 37.337  -4.774  1.00 42.10 ? 516  PRO A CG    1 
ATOM   4382 C  CD    . PRO C 3 510 ? 30.657 36.348  -4.286  1.00 42.35 ? 516  PRO A CD    1 
ATOM   4383 N  N     . THR C 3 511 ? 32.887 35.013  -6.928  1.00 41.62 ? 517  THR A N     1 
ATOM   4384 C  CA    . THR C 3 511 ? 33.991 34.414  -7.673  1.00 39.84 ? 517  THR A CA    1 
ATOM   4385 C  C     . THR C 3 511 ? 34.328 33.039  -7.131  1.00 38.56 ? 517  THR A C     1 
ATOM   4386 O  O     . THR C 3 511 ? 33.877 32.658  -6.055  1.00 37.50 ? 517  THR A O     1 
ATOM   4387 C  CB    . THR C 3 511 ? 35.270 35.277  -7.581  1.00 39.81 ? 517  THR A CB    1 
ATOM   4388 O  OG1   . THR C 3 511 ? 35.723 35.309  -6.219  1.00 37.87 ? 517  THR A OG1   1 
ATOM   4389 C  CG2   . THR C 3 511 ? 34.998 36.705  -8.063  1.00 38.52 ? 517  THR A CG2   1 
ATOM   4390 N  N     . ARG C 3 512 ? 35.133 32.304  -7.890  1.00 38.54 ? 518  ARG A N     1 
ATOM   4391 C  CA    . ARG C 3 512 ? 35.563 30.976  -7.494  1.00 37.53 ? 518  ARG A CA    1 
ATOM   4392 C  C     . ARG C 3 512 ? 36.550 31.099  -6.330  1.00 37.66 ? 518  ARG A C     1 
ATOM   4393 O  O     . ARG C 3 512 ? 36.571 30.253  -5.433  1.00 38.16 ? 518  ARG A O     1 
ATOM   4394 C  CB    . ARG C 3 512 ? 36.217 30.263  -8.682  1.00 37.89 ? 518  ARG A CB    1 
ATOM   4395 C  CG    . ARG C 3 512 ? 36.625 28.820  -8.410  1.00 35.92 ? 518  ARG A CG    1 
ATOM   4396 C  CD    . ARG C 3 512 ? 37.018 28.112  -9.703  1.00 35.04 ? 518  ARG A CD    1 
ATOM   4397 N  NE    . ARG C 3 512 ? 37.500 26.755  -9.464  1.00 34.42 ? 518  ARG A NE    1 
ATOM   4398 C  CZ    . ARG C 3 512 ? 38.684 26.461  -8.933  1.00 32.66 ? 518  ARG A CZ    1 
ATOM   4399 N  NH1   . ARG C 3 512 ? 39.517 27.433  -8.589  1.00 30.73 ? 518  ARG A NH1   1 
ATOM   4400 N  NH2   . ARG C 3 512 ? 39.028 25.195  -8.729  1.00 30.94 ? 518  ARG A NH2   1 
ATOM   4401 N  N     . ASP C 3 513 ? 37.361 32.156  -6.336  1.00 36.78 ? 519  ASP A N     1 
ATOM   4402 C  CA    . ASP C 3 513 ? 38.318 32.363  -5.252  1.00 36.35 ? 519  ASP A CA    1 
ATOM   4403 C  C     . ASP C 3 513 ? 37.588 32.578  -3.922  1.00 34.60 ? 519  ASP A C     1 
ATOM   4404 O  O     . ASP C 3 513 ? 37.979 32.033  -2.891  1.00 33.36 ? 519  ASP A O     1 
ATOM   4405 C  CB    . ASP C 3 513 ? 39.228 33.558  -5.552  1.00 37.13 ? 519  ASP A CB    1 
ATOM   4406 C  CG    . ASP C 3 513 ? 40.220 33.273  -6.673  1.00 40.43 ? 519  ASP A CG    1 
ATOM   4407 O  OD1   . ASP C 3 513 ? 40.694 32.116  -6.778  1.00 39.80 ? 519  ASP A OD1   1 
ATOM   4408 O  OD2   . ASP C 3 513 ? 40.543 34.209  -7.439  1.00 41.93 ? 519  ASP A OD2   1 
ATOM   4409 N  N     . ASN C 3 514 ? 36.521 33.369  -3.958  1.00 34.07 ? 520  ASN A N     1 
ATOM   4410 C  CA    . ASN C 3 514 ? 35.727 33.644  -2.767  1.00 33.28 ? 520  ASN A CA    1 
ATOM   4411 C  C     . ASN C 3 514 ? 35.180 32.320  -2.222  1.00 32.80 ? 520  ASN A C     1 
ATOM   4412 O  O     . ASN C 3 514 ? 35.139 32.106  -1.010  1.00 31.58 ? 520  ASN A O     1 
ATOM   4413 C  CB    . ASN C 3 514 ? 34.565 34.580  -3.121  1.00 34.01 ? 520  ASN A CB    1 
ATOM   4414 C  CG    . ASN C 3 514 ? 33.863 35.136  -1.895  1.00 34.51 ? 520  ASN A CG    1 
ATOM   4415 O  OD1   . ASN C 3 514 ? 32.651 35.335  -1.901  1.00 35.71 ? 520  ASN A OD1   1 
ATOM   4416 N  ND2   . ASN C 3 514 ? 34.627 35.408  -0.844  1.00 33.75 ? 520  ASN A ND2   1 
ATOM   4417 N  N     . ALA C 3 515 ? 34.776 31.433  -3.132  1.00 31.78 ? 521  ALA A N     1 
ATOM   4418 C  CA    . ALA C 3 515 ? 34.231 30.129  -2.760  1.00 32.43 ? 521  ALA A CA    1 
ATOM   4419 C  C     . ALA C 3 515 ? 35.274 29.261  -2.058  1.00 32.48 ? 521  ALA A C     1 
ATOM   4420 O  O     . ALA C 3 515 ? 34.954 28.527  -1.124  1.00 32.18 ? 521  ALA A O     1 
ATOM   4421 C  CB    . ALA C 3 515 ? 33.709 29.409  -3.997  1.00 30.85 ? 521  ALA A CB    1 
ATOM   4422 N  N     . LYS C 3 516 ? 36.519 29.346  -2.521  1.00 32.12 ? 522  LYS A N     1 
ATOM   4423 C  CA    . LYS C 3 516 ? 37.609 28.569  -1.939  1.00 31.93 ? 522  LYS A CA    1 
ATOM   4424 C  C     . LYS C 3 516 ? 37.907 29.041  -0.523  1.00 31.69 ? 522  LYS A C     1 
ATOM   4425 O  O     . LYS C 3 516 ? 37.980 28.224  0.399   1.00 30.32 ? 522  LYS A O     1 
ATOM   4426 C  CB    . LYS C 3 516 ? 38.864 28.668  -2.816  1.00 30.90 ? 522  LYS A CB    1 
ATOM   4427 C  CG    . LYS C 3 516 ? 38.736 27.917  -4.126  1.00 31.72 ? 522  LYS A CG    1 
ATOM   4428 C  CD    . LYS C 3 516 ? 39.786 28.329  -5.154  1.00 31.69 ? 522  LYS A CD    1 
ATOM   4429 C  CE    . LYS C 3 516 ? 41.200 28.098  -4.664  1.00 31.30 ? 522  LYS A CE    1 
ATOM   4430 N  NZ    . LYS C 3 516 ? 42.176 28.246  -5.772  1.00 31.15 ? 522  LYS A NZ    1 
ATOM   4431 N  N     . THR C 3 517 ? 38.078 30.352  -0.344  1.00 31.84 ? 523  THR A N     1 
ATOM   4432 C  CA    . THR C 3 517 ? 38.344 30.876  0.993   1.00 32.61 ? 523  THR A CA    1 
ATOM   4433 C  C     . THR C 3 517 ? 37.125 30.663  1.905   1.00 32.31 ? 523  THR A C     1 
ATOM   4434 O  O     . THR C 3 517 ? 37.256 30.578  3.128   1.00 33.39 ? 523  THR A O     1 
ATOM   4435 C  CB    . THR C 3 517 ? 38.772 32.383  0.964   1.00 32.32 ? 523  THR A CB    1 
ATOM   4436 O  OG1   . THR C 3 517 ? 38.204 33.065  2.087   1.00 34.08 ? 523  THR A OG1   1 
ATOM   4437 C  CG2   . THR C 3 517 ? 38.350 33.055  -0.309  1.00 32.02 ? 523  THR A CG2   1 
ATOM   4438 N  N     . PHE C 3 518 ? 35.941 30.548  1.312   1.00 31.58 ? 524  PHE A N     1 
ATOM   4439 C  CA    . PHE C 3 518 ? 34.735 30.297  2.101   1.00 31.60 ? 524  PHE A CA    1 
ATOM   4440 C  C     . PHE C 3 518 ? 34.722 28.855  2.620   1.00 30.32 ? 524  PHE A C     1 
ATOM   4441 O  O     . PHE C 3 518 ? 34.645 28.615  3.821   1.00 29.86 ? 524  PHE A O     1 
ATOM   4442 C  CB    . PHE C 3 518 ? 33.458 30.515  1.270   1.00 29.60 ? 524  PHE A CB    1 
ATOM   4443 C  CG    . PHE C 3 518 ? 32.275 29.733  1.781   1.00 30.46 ? 524  PHE A CG    1 
ATOM   4444 C  CD1   . PHE C 3 518 ? 31.664 30.072  2.984   1.00 30.80 ? 524  PHE A CD1   1 
ATOM   4445 C  CD2   . PHE C 3 518 ? 31.836 28.591  1.109   1.00 31.74 ? 524  PHE A CD2   1 
ATOM   4446 C  CE1   . PHE C 3 518 ? 30.641 29.286  3.514   1.00 30.52 ? 524  PHE A CE1   1 
ATOM   4447 C  CE2   . PHE C 3 518 ? 30.815 27.795  1.632   1.00 29.45 ? 524  PHE A CE2   1 
ATOM   4448 C  CZ    . PHE C 3 518 ? 30.218 28.144  2.837   1.00 31.55 ? 524  PHE A CZ    1 
ATOM   4449 N  N     . ILE C 3 519 ? 34.784 27.900  1.699   1.00 30.64 ? 525  ILE A N     1 
ATOM   4450 C  CA    . ILE C 3 519 ? 34.735 26.492  2.070   1.00 31.19 ? 525  ILE A CA    1 
ATOM   4451 C  C     . ILE C 3 519 ? 35.811 26.093  3.065   1.00 31.19 ? 525  ILE A C     1 
ATOM   4452 O  O     . ILE C 3 519 ? 35.533 25.365  4.019   1.00 32.78 ? 525  ILE A O     1 
ATOM   4453 C  CB    . ILE C 3 519 ? 34.825 25.567  0.828   1.00 31.36 ? 525  ILE A CB    1 
ATOM   4454 C  CG1   . ILE C 3 519 ? 34.300 24.173  1.185   1.00 31.94 ? 525  ILE A CG1   1 
ATOM   4455 C  CG2   . ILE C 3 519 ? 36.252 25.467  0.333   1.00 31.41 ? 525  ILE A CG2   1 
ATOM   4456 C  CD1   . ILE C 3 519 ? 32.821 24.144  1.502   1.00 29.99 ? 525  ILE A CD1   1 
ATOM   4457 N  N     . TYR C 3 520 ? 37.036 26.565  2.867   1.00 29.80 ? 526  TYR A N     1 
ATOM   4458 C  CA    . TYR C 3 520 ? 38.094 26.198  3.795   1.00 29.23 ? 526  TYR A CA    1 
ATOM   4459 C  C     . TYR C 3 520 ? 37.919 26.865  5.154   1.00 28.88 ? 526  TYR A C     1 
ATOM   4460 O  O     . TYR C 3 520 ? 38.151 26.238  6.183   1.00 28.35 ? 526  TYR A O     1 
ATOM   4461 C  CB    . TYR C 3 520 ? 39.468 26.506  3.198   1.00 28.24 ? 526  TYR A CB    1 
ATOM   4462 C  CG    . TYR C 3 520 ? 39.863 25.512  2.134   1.00 26.92 ? 526  TYR A CG    1 
ATOM   4463 C  CD1   . TYR C 3 520 ? 39.845 24.139  2.400   1.00 26.72 ? 526  TYR A CD1   1 
ATOM   4464 C  CD2   . TYR C 3 520 ? 40.223 25.930  0.851   1.00 26.53 ? 526  TYR A CD2   1 
ATOM   4465 C  CE1   . TYR C 3 520 ? 40.170 23.205  1.412   1.00 25.08 ? 526  TYR A CE1   1 
ATOM   4466 C  CE2   . TYR C 3 520 ? 40.551 25.002  -0.145  1.00 25.33 ? 526  TYR A CE2   1 
ATOM   4467 C  CZ    . TYR C 3 520 ? 40.523 23.644  0.145   1.00 25.15 ? 526  TYR A CZ    1 
ATOM   4468 O  OH    . TYR C 3 520 ? 40.863 22.724  -0.823  1.00 24.57 ? 526  TYR A OH    1 
ATOM   4469 N  N     . GLY C 3 521 ? 37.506 28.129  5.164   1.00 29.20 ? 527  GLY A N     1 
ATOM   4470 C  CA    . GLY C 3 521 ? 37.290 28.800  6.433   1.00 29.63 ? 527  GLY A CA    1 
ATOM   4471 C  C     . GLY C 3 521 ? 36.253 28.004  7.206   1.00 30.42 ? 527  GLY A C     1 
ATOM   4472 O  O     . GLY C 3 521 ? 36.405 27.726  8.400   1.00 30.02 ? 527  GLY A O     1 
ATOM   4473 N  N     . PHE C 3 522 ? 35.190 27.629  6.500   1.00 30.43 ? 528  PHE A N     1 
ATOM   4474 C  CA    . PHE C 3 522 ? 34.108 26.843  7.068   1.00 30.34 ? 528  PHE A CA    1 
ATOM   4475 C  C     . PHE C 3 522 ? 34.629 25.511  7.602   1.00 30.32 ? 528  PHE A C     1 
ATOM   4476 O  O     . PHE C 3 522 ? 34.427 25.170  8.767   1.00 30.32 ? 528  PHE A O     1 
ATOM   4477 C  CB    . PHE C 3 522 ? 33.056 26.577  5.991   1.00 30.41 ? 528  PHE A CB    1 
ATOM   4478 C  CG    . PHE C 3 522 ? 32.217 25.354  6.243   1.00 29.67 ? 528  PHE A CG    1 
ATOM   4479 C  CD1   . PHE C 3 522 ? 31.390 25.273  7.359   1.00 30.80 ? 528  PHE A CD1   1 
ATOM   4480 C  CD2   . PHE C 3 522 ? 32.242 24.287  5.351   1.00 30.36 ? 528  PHE A CD2   1 
ATOM   4481 C  CE1   . PHE C 3 522 ? 30.594 24.144  7.584   1.00 31.35 ? 528  PHE A CE1   1 
ATOM   4482 C  CE2   . PHE C 3 522 ? 31.449 23.153  5.565   1.00 31.30 ? 528  PHE A CE2   1 
ATOM   4483 C  CZ    . PHE C 3 522 ? 30.623 23.084  6.685   1.00 30.96 ? 528  PHE A CZ    1 
ATOM   4484 N  N     . LEU C 3 523 ? 35.295 24.763  6.731   1.00 30.44 ? 529  LEU A N     1 
ATOM   4485 C  CA    . LEU C 3 523 ? 35.827 23.458  7.089   1.00 30.97 ? 529  LEU A CA    1 
ATOM   4486 C  C     . LEU C 3 523 ? 36.746 23.506  8.301   1.00 30.72 ? 529  LEU A C     1 
ATOM   4487 O  O     . LEU C 3 523 ? 36.803 22.552  9.078   1.00 29.72 ? 529  LEU A O     1 
ATOM   4488 C  CB    . LEU C 3 523 ? 36.581 22.857  5.900   1.00 31.64 ? 529  LEU A CB    1 
ATOM   4489 C  CG    . LEU C 3 523 ? 37.178 21.466  6.128   1.00 33.07 ? 529  LEU A CG    1 
ATOM   4490 C  CD1   . LEU C 3 523 ? 36.067 20.458  6.416   1.00 32.96 ? 529  LEU A CD1   1 
ATOM   4491 C  CD2   . LEU C 3 523 ? 37.977 21.054  4.901   1.00 34.17 ? 529  LEU A CD2   1 
ATOM   4492 N  N     . TYR C 3 524 ? 37.450 24.621  8.474   1.00 31.02 ? 530  TYR A N     1 
ATOM   4493 C  CA    . TYR C 3 524 ? 38.377 24.752  9.590   1.00 31.39 ? 530  TYR A CA    1 
ATOM   4494 C  C     . TYR C 3 524 ? 37.918 25.582  10.794  1.00 31.59 ? 530  TYR A C     1 
ATOM   4495 O  O     . TYR C 3 524 ? 38.730 26.217  11.469  1.00 30.15 ? 530  TYR A O     1 
ATOM   4496 C  CB    . TYR C 3 524 ? 39.737 25.244  9.076   1.00 30.18 ? 530  TYR A CB    1 
ATOM   4497 C  CG    . TYR C 3 524 ? 40.343 24.300  8.057   1.00 30.69 ? 530  TYR A CG    1 
ATOM   4498 C  CD1   . TYR C 3 524 ? 40.259 22.916  8.229   1.00 30.26 ? 530  TYR A CD1   1 
ATOM   4499 C  CD2   . TYR C 3 524 ? 40.998 24.784  6.924   1.00 30.10 ? 530  TYR A CD2   1 
ATOM   4500 C  CE1   . TYR C 3 524 ? 40.812 22.036  7.297   1.00 30.23 ? 530  TYR A CE1   1 
ATOM   4501 C  CE2   . TYR C 3 524 ? 41.558 23.914  5.986   1.00 29.25 ? 530  TYR A CE2   1 
ATOM   4502 C  CZ    . TYR C 3 524 ? 41.461 22.542  6.179   1.00 29.93 ? 530  TYR A CZ    1 
ATOM   4503 O  OH    . TYR C 3 524 ? 42.012 21.678  5.262   1.00 27.44 ? 530  TYR A OH    1 
ATOM   4504 N  N     . GLY C 3 525 ? 36.613 25.568  11.050  1.00 32.76 ? 531  GLY A N     1 
ATOM   4505 C  CA    . GLY C 3 525 ? 36.064 26.248  12.210  1.00 33.73 ? 531  GLY A CA    1 
ATOM   4506 C  C     . GLY C 3 525 ? 35.758 27.732  12.248  1.00 34.59 ? 531  GLY A C     1 
ATOM   4507 O  O     . GLY C 3 525 ? 35.657 28.290  13.339  1.00 36.14 ? 531  GLY A O     1 
ATOM   4508 N  N     . ALA C 3 526 ? 35.599 28.385  11.106  1.00 34.91 ? 532  ALA A N     1 
ATOM   4509 C  CA    . ALA C 3 526 ? 35.288 29.812  11.125  1.00 37.18 ? 532  ALA A CA    1 
ATOM   4510 C  C     . ALA C 3 526 ? 33.910 30.026  11.754  1.00 38.31 ? 532  ALA A C     1 
ATOM   4511 O  O     . ALA C 3 526 ? 32.960 29.294  11.457  1.00 38.52 ? 532  ALA A O     1 
ATOM   4512 C  CB    . ALA C 3 526 ? 35.311 30.381  9.706   1.00 36.68 ? 532  ALA A CB    1 
ATOM   4513 N  N     . GLY C 3 527 ? 33.813 31.026  12.629  1.00 40.51 ? 533  GLY A N     1 
ATOM   4514 C  CA    . GLY C 3 527 ? 32.553 31.340  13.289  1.00 41.64 ? 533  GLY A CA    1 
ATOM   4515 C  C     . GLY C 3 527 ? 31.549 31.942  12.320  1.00 42.37 ? 533  GLY A C     1 
ATOM   4516 O  O     . GLY C 3 527 ? 31.891 32.215  11.164  1.00 42.26 ? 533  GLY A O     1 
ATOM   4517 N  N     . ASP C 3 528 ? 30.312 32.143  12.775  1.00 43.34 ? 534  ASP A N     1 
ATOM   4518 C  CA    . ASP C 3 528 ? 29.270 32.712  11.919  1.00 43.40 ? 534  ASP A CA    1 
ATOM   4519 C  C     . ASP C 3 528 ? 29.657 34.099  11.420  1.00 43.20 ? 534  ASP A C     1 
ATOM   4520 O  O     . ASP C 3 528 ? 29.479 34.418  10.242  1.00 42.01 ? 534  ASP A O     1 
ATOM   4521 C  CB    . ASP C 3 528 ? 27.931 32.802  12.665  1.00 44.28 ? 534  ASP A CB    1 
ATOM   4522 C  CG    . ASP C 3 528 ? 27.327 31.433  12.974  1.00 46.50 ? 534  ASP A CG    1 
ATOM   4523 O  OD1   . ASP C 3 528 ? 27.443 30.515  12.135  1.00 48.71 ? 534  ASP A OD1   1 
ATOM   4524 O  OD2   . ASP C 3 528 ? 26.712 31.280  14.051  1.00 46.18 ? 534  ASP A OD2   1 
ATOM   4525 N  N     . GLU C 3 529 ? 30.186 34.921  12.321  1.00 43.85 ? 535  GLU A N     1 
ATOM   4526 C  CA    . GLU C 3 529 ? 30.590 36.273  11.963  1.00 45.67 ? 535  GLU A CA    1 
ATOM   4527 C  C     . GLU C 3 529 ? 31.702 36.231  10.931  1.00 45.17 ? 535  GLU A C     1 
ATOM   4528 O  O     . GLU C 3 529 ? 31.647 36.925  9.911   1.00 45.04 ? 535  GLU A O     1 
ATOM   4529 C  CB    . GLU C 3 529 ? 31.071 37.036  13.199  1.00 47.55 ? 535  GLU A CB    1 
ATOM   4530 C  CG    . GLU C 3 529 ? 31.459 38.480  12.921  1.00 49.84 ? 535  GLU A CG    1 
ATOM   4531 C  CD    . GLU C 3 529 ? 31.730 39.261  14.194  1.00 52.91 ? 535  GLU A CD    1 
ATOM   4532 O  OE1   . GLU C 3 529 ? 30.884 39.198  15.111  1.00 55.32 ? 535  GLU A OE1   1 
ATOM   4533 O  OE2   . GLU C 3 529 ? 32.778 39.944  14.282  1.00 53.00 ? 535  GLU A OE2   1 
ATOM   4534 N  N     . LYS C 3 530 ? 32.713 35.412  11.204  1.00 44.00 ? 536  LYS A N     1 
ATOM   4535 C  CA    . LYS C 3 530 ? 33.844 35.276  10.300  1.00 43.67 ? 536  LYS A CA    1 
ATOM   4536 C  C     . LYS C 3 530 ? 33.383 34.832  8.911   1.00 42.56 ? 536  LYS A C     1 
ATOM   4537 O  O     . LYS C 3 530 ? 33.832 35.378  7.901   1.00 42.57 ? 536  LYS A O     1 
ATOM   4538 C  CB    . LYS C 3 530 ? 34.858 34.277  10.868  1.00 44.01 ? 536  LYS A CB    1 
ATOM   4539 C  CG    . LYS C 3 530 ? 36.055 34.048  9.963   1.00 44.41 ? 536  LYS A CG    1 
ATOM   4540 C  CD    . LYS C 3 530 ? 36.764 35.352  9.645   1.00 43.77 ? 536  LYS A CD    1 
ATOM   4541 C  CE    . LYS C 3 530 ? 37.334 35.982  10.908  1.00 43.43 ? 536  LYS A CE    1 
ATOM   4542 N  NZ    . LYS C 3 530 ? 38.154 37.179  10.585  1.00 42.66 ? 536  LYS A NZ    1 
ATOM   4543 N  N     . ILE C 3 531 ? 32.489 33.847  8.860   1.00 41.18 ? 537  ILE A N     1 
ATOM   4544 C  CA    . ILE C 3 531 ? 31.979 33.372  7.579   1.00 41.17 ? 537  ILE A CA    1 
ATOM   4545 C  C     . ILE C 3 531 ? 31.330 34.553  6.855   1.00 40.78 ? 537  ILE A C     1 
ATOM   4546 O  O     . ILE C 3 531 ? 31.581 34.785  5.670   1.00 39.73 ? 537  ILE A O     1 
ATOM   4547 C  CB    . ILE C 3 531 ? 30.925 32.251  7.761   1.00 41.05 ? 537  ILE A CB    1 
ATOM   4548 C  CG1   . ILE C 3 531 ? 31.549 31.046  8.469   1.00 41.89 ? 537  ILE A CG1   1 
ATOM   4549 C  CG2   . ILE C 3 531 ? 30.381 31.816  6.401   1.00 40.34 ? 537  ILE A CG2   1 
ATOM   4550 C  CD1   . ILE C 3 531 ? 32.591 30.317  7.645   1.00 43.39 ? 537  ILE A CD1   1 
ATOM   4551 N  N     . GLY C 3 532 ? 30.502 35.302  7.581   1.00 40.52 ? 538  GLY A N     1 
ATOM   4552 C  CA    . GLY C 3 532 ? 29.836 36.452  6.997   1.00 40.22 ? 538  GLY A CA    1 
ATOM   4553 C  C     . GLY C 3 532 ? 30.836 37.397  6.361   1.00 39.92 ? 538  GLY A C     1 
ATOM   4554 O  O     . GLY C 3 532 ? 30.662 37.831  5.224   1.00 39.80 ? 538  GLY A O     1 
ATOM   4555 N  N     . GLN C 3 533 ? 31.895 37.711  7.099   1.00 40.80 ? 539  GLN A N     1 
ATOM   4556 C  CA    . GLN C 3 533 ? 32.934 38.597  6.601   1.00 42.09 ? 539  GLN A CA    1 
ATOM   4557 C  C     . GLN C 3 533 ? 33.489 38.067  5.276   1.00 42.92 ? 539  GLN A C     1 
ATOM   4558 O  O     . GLN C 3 533 ? 33.517 38.782  4.277   1.00 42.90 ? 539  GLN A O     1 
ATOM   4559 C  CB    . GLN C 3 533 ? 34.054 38.708  7.637   1.00 42.80 ? 539  GLN A CB    1 
ATOM   4560 C  CG    . GLN C 3 533 ? 35.124 39.729  7.302   1.00 45.56 ? 539  GLN A CG    1 
ATOM   4561 C  CD    . GLN C 3 533 ? 36.099 39.941  8.447   1.00 47.88 ? 539  GLN A CD    1 
ATOM   4562 O  OE1   . GLN C 3 533 ? 35.702 40.291  9.561   1.00 50.21 ? 539  GLN A OE1   1 
ATOM   4563 N  NE2   . GLN C 3 533 ? 37.384 39.733  8.178   1.00 47.81 ? 539  GLN A NE2   1 
ATOM   4564 N  N     . ILE C 3 534 ? 33.913 36.804  5.275   1.00 42.91 ? 540  ILE A N     1 
ATOM   4565 C  CA    . ILE C 3 534 ? 34.469 36.169  4.083   1.00 41.30 ? 540  ILE A CA    1 
ATOM   4566 C  C     . ILE C 3 534 ? 33.593 36.361  2.844   1.00 41.31 ? 540  ILE A C     1 
ATOM   4567 O  O     . ILE C 3 534 ? 34.096 36.718  1.779   1.00 40.25 ? 540  ILE A O     1 
ATOM   4568 C  CB    . ILE C 3 534 ? 34.663 34.638  4.291   1.00 41.62 ? 540  ILE A CB    1 
ATOM   4569 C  CG1   . ILE C 3 534 ? 35.461 34.367  5.571   1.00 41.31 ? 540  ILE A CG1   1 
ATOM   4570 C  CG2   . ILE C 3 534 ? 35.358 34.035  3.080   1.00 41.11 ? 540  ILE A CG2   1 
ATOM   4571 C  CD1   . ILE C 3 534 ? 36.836 34.967  5.581   1.00 42.25 ? 540  ILE A CD1   1 
ATOM   4572 N  N     . VAL C 3 535 ? 32.292 36.108  2.976   1.00 41.42 ? 541  VAL A N     1 
ATOM   4573 C  CA    . VAL C 3 535 ? 31.379 36.252  1.845   1.00 42.98 ? 541  VAL A CA    1 
ATOM   4574 C  C     . VAL C 3 535 ? 30.848 37.679  1.707   1.00 44.10 ? 541  VAL A C     1 
ATOM   4575 O  O     . VAL C 3 535 ? 30.057 37.971  0.805   1.00 44.70 ? 541  VAL A O     1 
ATOM   4576 C  CB    . VAL C 3 535 ? 30.175 35.274  1.951   1.00 42.22 ? 541  VAL A CB    1 
ATOM   4577 C  CG1   . VAL C 3 535 ? 30.681 33.841  2.084   1.00 42.05 ? 541  VAL A CG1   1 
ATOM   4578 C  CG2   . VAL C 3 535 ? 29.295 35.647  3.131   1.00 42.71 ? 541  VAL A CG2   1 
ATOM   4579 N  N     . GLY C 3 536 ? 31.290 38.559  2.601   1.00 44.46 ? 542  GLY A N     1 
ATOM   4580 C  CA    . GLY C 3 536 ? 30.864 39.947  2.560   1.00 45.61 ? 542  GLY A CA    1 
ATOM   4581 C  C     . GLY C 3 536 ? 29.425 40.167  2.986   1.00 46.87 ? 542  GLY A C     1 
ATOM   4582 O  O     . GLY C 3 536 ? 28.672 40.856  2.301   1.00 47.43 ? 542  GLY A O     1 
ATOM   4583 N  N     . ALA C 3 537 ? 29.042 39.586  4.118   1.00 48.07 ? 543  ALA A N     1 
ATOM   4584 C  CA    . ALA C 3 537 ? 27.684 39.721  4.629   1.00 48.13 ? 543  ALA A CA    1 
ATOM   4585 C  C     . ALA C 3 537 ? 27.679 39.701  6.152   1.00 48.98 ? 543  ALA A C     1 
ATOM   4586 O  O     . ALA C 3 537 ? 28.706 39.954  6.785   1.00 49.20 ? 543  ALA A O     1 
ATOM   4587 C  CB    . ALA C 3 537 ? 26.807 38.602  4.084   1.00 48.27 ? 543  ALA A CB    1 
ATOM   4588 N  N     . GLY C 3 538 ? 26.525 39.388  6.736   1.00 49.77 ? 544  GLY A N     1 
ATOM   4589 C  CA    . GLY C 3 538 ? 26.411 39.360  8.185   1.00 50.63 ? 544  GLY A CA    1 
ATOM   4590 C  C     . GLY C 3 538 ? 26.485 37.987  8.827   1.00 51.60 ? 544  GLY A C     1 
ATOM   4591 O  O     . GLY C 3 538 ? 26.432 36.961  8.144   1.00 51.51 ? 544  GLY A O     1 
ATOM   4592 N  N     . LYS C 3 539 ? 26.597 37.975  10.153  1.00 52.38 ? 545  LYS A N     1 
ATOM   4593 C  CA    . LYS C 3 539 ? 26.694 36.737  10.915  1.00 53.69 ? 545  LYS A CA    1 
ATOM   4594 C  C     . LYS C 3 539 ? 25.514 35.805  10.677  1.00 53.93 ? 545  LYS A C     1 
ATOM   4595 O  O     . LYS C 3 539 ? 25.667 34.586  10.722  1.00 54.29 ? 545  LYS A O     1 
ATOM   4596 C  CB    . LYS C 3 539 ? 26.806 37.040  12.413  1.00 54.92 ? 545  LYS A CB    1 
ATOM   4597 C  CG    . LYS C 3 539 ? 25.558 37.657  13.019  1.00 57.02 ? 545  LYS A CG    1 
ATOM   4598 C  CD    . LYS C 3 539 ? 25.710 37.857  14.523  1.00 58.41 ? 545  LYS A CD    1 
ATOM   4599 C  CE    . LYS C 3 539 ? 24.397 38.300  15.162  1.00 58.96 ? 545  LYS A CE    1 
ATOM   4600 N  NZ    . LYS C 3 539 ? 23.304 37.293  14.978  1.00 58.95 ? 545  LYS A NZ    1 
ATOM   4601 N  N     . GLU C 3 540 ? 24.338 36.373  10.427  1.00 54.04 ? 546  GLU A N     1 
ATOM   4602 C  CA    . GLU C 3 540 ? 23.153 35.557  10.187  1.00 54.24 ? 546  GLU A CA    1 
ATOM   4603 C  C     . GLU C 3 540 ? 23.306 34.792  8.877   1.00 53.67 ? 546  GLU A C     1 
ATOM   4604 O  O     . GLU C 3 540 ? 22.882 33.641  8.768   1.00 52.78 ? 546  GLU A O     1 
ATOM   4605 C  CB    . GLU C 3 540 ? 21.893 36.431  10.159  1.00 56.06 ? 546  GLU A CB    1 
ATOM   4606 C  CG    . GLU C 3 540 ? 21.611 37.138  11.488  1.00 58.54 ? 546  GLU A CG    1 
ATOM   4607 C  CD    . GLU C 3 540 ? 21.799 38.652  11.417  1.00 61.00 ? 546  GLU A CD    1 
ATOM   4608 O  OE1   . GLU C 3 540 ? 22.849 39.109  10.903  1.00 61.26 ? 546  GLU A OE1   1 
ATOM   4609 O  OE2   . GLU C 3 540 ? 20.897 39.387  11.886  1.00 62.20 ? 546  GLU A OE2   1 
ATOM   4610 N  N     . ARG C 3 541 ? 23.914 35.437  7.885   1.00 53.23 ? 547  ARG A N     1 
ATOM   4611 C  CA    . ARG C 3 541 ? 24.148 34.804  6.590   1.00 52.83 ? 547  ARG A CA    1 
ATOM   4612 C  C     . ARG C 3 541 ? 25.207 33.728  6.814   1.00 53.06 ? 547  ARG A C     1 
ATOM   4613 O  O     . ARG C 3 541 ? 25.233 32.704  6.128   1.00 52.42 ? 547  ARG A O     1 
ATOM   4614 C  CB    . ARG C 3 541 ? 24.637 35.844  5.575   1.00 52.70 ? 547  ARG A CB    1 
ATOM   4615 C  CG    . ARG C 3 541 ? 25.115 35.289  4.235   1.00 52.79 ? 547  ARG A CG    1 
ATOM   4616 C  CD    . ARG C 3 541 ? 24.064 34.430  3.540   1.00 53.69 ? 547  ARG A CD    1 
ATOM   4617 N  NE    . ARG C 3 541 ? 24.459 34.096  2.171   1.00 54.03 ? 547  ARG A NE    1 
ATOM   4618 C  CZ    . ARG C 3 541 ? 23.881 33.152  1.429   1.00 54.84 ? 547  ARG A CZ    1 
ATOM   4619 N  NH1   . ARG C 3 541 ? 22.877 32.435  1.918   1.00 54.34 ? 547  ARG A NH1   1 
ATOM   4620 N  NH2   . ARG C 3 541 ? 24.306 32.926  0.192   1.00 53.96 ? 547  ARG A NH2   1 
ATOM   4621 N  N     . GLY C 3 542 ? 26.069 33.969  7.799   1.00 52.95 ? 548  GLY A N     1 
ATOM   4622 C  CA    . GLY C 3 542 ? 27.115 33.020  8.128   1.00 52.56 ? 548  GLY A CA    1 
ATOM   4623 C  C     . GLY C 3 542 ? 26.527 31.746  8.704   1.00 52.57 ? 548  GLY A C     1 
ATOM   4624 O  O     . GLY C 3 542 ? 27.048 30.656  8.469   1.00 52.40 ? 548  GLY A O     1 
ATOM   4625 N  N     . LYS C 3 543 ? 25.444 31.881  9.466   1.00 52.48 ? 549  LYS A N     1 
ATOM   4626 C  CA    . LYS C 3 543 ? 24.778 30.724  10.057  1.00 51.85 ? 549  LYS A CA    1 
ATOM   4627 C  C     . LYS C 3 543 ? 24.197 29.870  8.942   1.00 50.69 ? 549  LYS A C     1 
ATOM   4628 O  O     . LYS C 3 543 ? 24.459 28.669  8.869   1.00 49.96 ? 549  LYS A O     1 
ATOM   4629 C  CB    . LYS C 3 543 ? 23.647 31.163  10.988  1.00 53.03 ? 549  LYS A CB    1 
ATOM   4630 C  CG    . LYS C 3 543 ? 24.102 31.826  12.275  1.00 54.88 ? 549  LYS A CG    1 
ATOM   4631 C  CD    . LYS C 3 543 ? 22.906 32.250  13.124  1.00 56.06 ? 549  LYS A CD    1 
ATOM   4632 C  CE    . LYS C 3 543 ? 22.014 31.066  13.477  1.00 55.53 ? 549  LYS A CE    1 
ATOM   4633 N  NZ    . LYS C 3 543 ? 22.740 30.041  14.278  1.00 56.71 ? 549  LYS A NZ    1 
ATOM   4634 N  N     . GLU C 3 544 ? 23.405 30.504  8.080   1.00 49.96 ? 550  GLU A N     1 
ATOM   4635 C  CA    . GLU C 3 544 ? 22.774 29.824  6.951   1.00 49.86 ? 550  GLU A CA    1 
ATOM   4636 C  C     . GLU C 3 544 ? 23.766 28.905  6.249   1.00 48.48 ? 550  GLU A C     1 
ATOM   4637 O  O     . GLU C 3 544 ? 23.554 27.695  6.156   1.00 47.67 ? 550  GLU A O     1 
ATOM   4638 C  CB    . GLU C 3 544 ? 22.252 30.841  5.930   1.00 50.50 ? 550  GLU A CB    1 
ATOM   4639 C  CG    . GLU C 3 544 ? 21.154 31.771  6.424   1.00 52.39 ? 550  GLU A CG    1 
ATOM   4640 C  CD    . GLU C 3 544 ? 20.885 32.919  5.450   1.00 53.68 ? 550  GLU A CD    1 
ATOM   4641 O  OE1   . GLU C 3 544 ? 20.671 32.652  4.245   1.00 53.67 ? 550  GLU A OE1   1 
ATOM   4642 O  OE2   . GLU C 3 544 ? 20.885 34.092  5.890   1.00 53.00 ? 550  GLU A OE2   1 
ATOM   4643 N  N     . LEU C 3 545 ? 24.845 29.501  5.751   1.00 47.45 ? 551  LEU A N     1 
ATOM   4644 C  CA    . LEU C 3 545 ? 25.886 28.774  5.034   1.00 46.81 ? 551  LEU A CA    1 
ATOM   4645 C  C     . LEU C 3 545 ? 26.494 27.633  5.848   1.00 46.97 ? 551  LEU A C     1 
ATOM   4646 O  O     . LEU C 3 545 ? 26.654 26.515  5.348   1.00 46.21 ? 551  LEU A O     1 
ATOM   4647 C  CB    . LEU C 3 545 ? 26.980 29.755  4.594   1.00 45.89 ? 551  LEU A CB    1 
ATOM   4648 C  CG    . LEU C 3 545 ? 26.812 30.430  3.222   1.00 45.67 ? 551  LEU A CG    1 
ATOM   4649 C  CD1   . LEU C 3 545 ? 25.346 30.675  2.927   1.00 46.13 ? 551  LEU A CD1   1 
ATOM   4650 C  CD2   . LEU C 3 545 ? 27.598 31.735  3.189   1.00 44.09 ? 551  LEU A CD2   1 
ATOM   4651 N  N     . LYS C 3 546 ? 26.817 27.919  7.105   1.00 47.05 ? 552  LYS A N     1 
ATOM   4652 C  CA    . LYS C 3 546 ? 27.412 26.936  7.999   1.00 46.74 ? 552  LYS A CA    1 
ATOM   4653 C  C     . LYS C 3 546 ? 26.583 25.654  8.132   1.00 47.58 ? 552  LYS A C     1 
ATOM   4654 O  O     . LYS C 3 546 ? 27.112 24.551  7.982   1.00 47.55 ? 552  LYS A O     1 
ATOM   4655 C  CB    . LYS C 3 546 ? 27.635 27.568  9.374   1.00 45.56 ? 552  LYS A CB    1 
ATOM   4656 C  CG    . LYS C 3 546 ? 29.076 27.522  9.850   1.00 45.89 ? 552  LYS A CG    1 
ATOM   4657 C  CD    . LYS C 3 546 ? 29.365 26.262  10.651  1.00 45.33 ? 552  LYS A CD    1 
ATOM   4658 C  CE    . LYS C 3 546 ? 28.908 26.416  12.092  1.00 46.12 ? 552  LYS A CE    1 
ATOM   4659 N  NZ    . LYS C 3 546 ? 29.607 27.556  12.763  1.00 45.40 ? 552  LYS A NZ    1 
ATOM   4660 N  N     . LYS C 3 547 ? 25.288 25.791  8.407   1.00 47.92 ? 553  LYS A N     1 
ATOM   4661 C  CA    . LYS C 3 547 ? 24.434 24.614  8.554   1.00 48.39 ? 553  LYS A CA    1 
ATOM   4662 C  C     . LYS C 3 547 ? 24.100 24.011  7.194   1.00 47.47 ? 553  LYS A C     1 
ATOM   4663 O  O     . LYS C 3 547 ? 23.877 22.803  7.076   1.00 46.31 ? 553  LYS A O     1 
ATOM   4664 C  CB    . LYS C 3 547 ? 23.130 24.971  9.279   1.00 49.50 ? 553  LYS A CB    1 
ATOM   4665 C  CG    . LYS C 3 547 ? 22.101 25.674  8.404   1.00 52.27 ? 553  LYS A CG    1 
ATOM   4666 C  CD    . LYS C 3 547 ? 20.777 25.857  9.135   1.00 54.78 ? 553  LYS A CD    1 
ATOM   4667 C  CE    . LYS C 3 547 ? 20.130 24.518  9.458   1.00 56.92 ? 553  LYS A CE    1 
ATOM   4668 N  NZ    . LYS C 3 547 ? 18.823 24.688  10.160  1.00 57.44 ? 553  LYS A NZ    1 
ATOM   4669 N  N     . LYS C 3 548 ? 24.063 24.859  6.172   1.00 46.73 ? 554  LYS A N     1 
ATOM   4670 C  CA    . LYS C 3 548 ? 23.753 24.404  4.823   1.00 47.02 ? 554  LYS A CA    1 
ATOM   4671 C  C     . LYS C 3 548 ? 24.778 23.388  4.326   1.00 46.50 ? 554  LYS A C     1 
ATOM   4672 O  O     . LYS C 3 548 ? 24.407 22.317  3.848   1.00 46.34 ? 554  LYS A O     1 
ATOM   4673 C  CB    . LYS C 3 548 ? 23.696 25.592  3.860   1.00 48.74 ? 554  LYS A CB    1 
ATOM   4674 C  CG    . LYS C 3 548 ? 23.233 25.222  2.455   1.00 50.72 ? 554  LYS A CG    1 
ATOM   4675 C  CD    . LYS C 3 548 ? 23.155 26.442  1.549   1.00 52.77 ? 554  LYS A CD    1 
ATOM   4676 C  CE    . LYS C 3 548 ? 22.578 26.087  0.183   1.00 54.95 ? 554  LYS A CE    1 
ATOM   4677 N  NZ    . LYS C 3 548 ? 23.396 25.058  -0.519  1.00 55.25 ? 554  LYS A NZ    1 
ATOM   4678 N  N     . PHE C 3 549 ? 26.063 23.721  4.438   1.00 45.44 ? 555  PHE A N     1 
ATOM   4679 C  CA    . PHE C 3 549 ? 27.119 22.813  3.994   1.00 44.07 ? 555  PHE A CA    1 
ATOM   4680 C  C     . PHE C 3 549 ? 27.404 21.717  5.010   1.00 44.25 ? 555  PHE A C     1 
ATOM   4681 O  O     . PHE C 3 549 ? 27.854 20.632  4.649   1.00 44.35 ? 555  PHE A O     1 
ATOM   4682 C  CB    . PHE C 3 549 ? 28.412 23.577  3.698   1.00 41.62 ? 555  PHE A CB    1 
ATOM   4683 C  CG    . PHE C 3 549 ? 28.405 24.288  2.378   1.00 39.81 ? 555  PHE A CG    1 
ATOM   4684 C  CD1   . PHE C 3 549 ? 27.666 25.458  2.204   1.00 38.97 ? 555  PHE A CD1   1 
ATOM   4685 C  CD2   . PHE C 3 549 ? 29.109 23.770  1.296   1.00 37.14 ? 555  PHE A CD2   1 
ATOM   4686 C  CE1   . PHE C 3 549 ? 27.626 26.101  0.970   1.00 38.11 ? 555  PHE A CE1   1 
ATOM   4687 C  CE2   . PHE C 3 549 ? 29.078 24.400  0.061   1.00 38.00 ? 555  PHE A CE2   1 
ATOM   4688 C  CZ    . PHE C 3 549 ? 28.332 25.573  -0.105  1.00 38.76 ? 555  PHE A CZ    1 
ATOM   4689 N  N     . LEU C 3 550 ? 27.146 21.995  6.281   1.00 44.24 ? 556  LEU A N     1 
ATOM   4690 C  CA    . LEU C 3 550 ? 27.379 20.995  7.311   1.00 44.95 ? 556  LEU A CA    1 
ATOM   4691 C  C     . LEU C 3 550 ? 26.345 19.869  7.196   1.00 45.46 ? 556  LEU A C     1 
ATOM   4692 O  O     . LEU C 3 550 ? 26.687 18.685  7.290   1.00 45.35 ? 556  LEU A O     1 
ATOM   4693 C  CB    . LEU C 3 550 ? 27.316 21.643  8.694   1.00 44.67 ? 556  LEU A CB    1 
ATOM   4694 C  CG    . LEU C 3 550 ? 27.804 20.826  9.890   1.00 44.34 ? 556  LEU A CG    1 
ATOM   4695 C  CD1   . LEU C 3 550 ? 29.178 20.221  9.607   1.00 45.54 ? 556  LEU A CD1   1 
ATOM   4696 C  CD2   . LEU C 3 550 ? 27.865 21.739  11.106  1.00 44.54 ? 556  LEU A CD2   1 
ATOM   4697 N  N     . GLU C 3 551 ? 25.085 20.239  6.982   1.00 45.38 ? 557  GLU A N     1 
ATOM   4698 C  CA    . GLU C 3 551 ? 24.016 19.253  6.844   1.00 46.37 ? 557  GLU A CA    1 
ATOM   4699 C  C     . GLU C 3 551 ? 24.137 18.488  5.531   1.00 45.40 ? 557  GLU A C     1 
ATOM   4700 O  O     . GLU C 3 551 ? 23.729 17.333  5.437   1.00 45.26 ? 557  GLU A O     1 
ATOM   4701 C  CB    . GLU C 3 551 ? 22.642 19.929  6.917   1.00 48.10 ? 557  GLU A CB    1 
ATOM   4702 C  CG    . GLU C 3 551 ? 22.295 20.474  8.292   1.00 51.12 ? 557  GLU A CG    1 
ATOM   4703 C  CD    . GLU C 3 551 ? 20.901 21.070  8.356   1.00 53.93 ? 557  GLU A CD    1 
ATOM   4704 O  OE1   . GLU C 3 551 ? 20.495 21.515  9.454   1.00 54.78 ? 557  GLU A OE1   1 
ATOM   4705 O  OE2   . GLU C 3 551 ? 20.211 21.096  7.311   1.00 54.94 ? 557  GLU A OE2   1 
ATOM   4706 N  N     . ASN C 3 552 ? 24.700 19.131  4.517   1.00 45.47 ? 558  ASN A N     1 
ATOM   4707 C  CA    . ASN C 3 552 ? 24.870 18.482  3.225   1.00 44.86 ? 558  ASN A CA    1 
ATOM   4708 C  C     . ASN C 3 552 ? 25.962 17.413  3.285   1.00 44.13 ? 558  ASN A C     1 
ATOM   4709 O  O     . ASN C 3 552 ? 26.101 16.608  2.365   1.00 45.20 ? 558  ASN A O     1 
ATOM   4710 C  CB    . ASN C 3 552 ? 25.216 19.517  2.154   1.00 46.39 ? 558  ASN A CB    1 
ATOM   4711 C  CG    . ASN C 3 552 ? 25.387 18.895  0.778   1.00 48.74 ? 558  ASN A CG    1 
ATOM   4712 O  OD1   . ASN C 3 552 ? 24.483 18.231  0.265   1.00 49.48 ? 558  ASN A OD1   1 
ATOM   4713 N  ND2   . ASN C 3 552 ? 26.550 19.109  0.172   1.00 49.86 ? 558  ASN A ND2   1 
ATOM   4714 N  N     . THR C 3 553 ? 26.730 17.410  4.370   1.00 42.59 ? 559  THR A N     1 
ATOM   4715 C  CA    . THR C 3 553 ? 27.808 16.440  4.566   1.00 41.53 ? 559  THR A CA    1 
ATOM   4716 C  C     . THR C 3 553 ? 28.066 16.266  6.062   1.00 39.96 ? 559  THR A C     1 
ATOM   4717 O  O     . THR C 3 553 ? 29.048 16.777  6.596   1.00 40.35 ? 559  THR A O     1 
ATOM   4718 C  CB    . THR C 3 553 ? 29.122 16.903  3.872   1.00 41.54 ? 559  THR A CB    1 
ATOM   4719 O  OG1   . THR C 3 553 ? 28.928 16.932  2.452   1.00 42.80 ? 559  THR A OG1   1 
ATOM   4720 C  CG2   . THR C 3 553 ? 30.271 15.956  4.190   1.00 41.28 ? 559  THR A CG2   1 
ATOM   4721 N  N     . PRO C 3 554 ? 27.172 15.549  6.759   1.00 39.01 ? 560  PRO A N     1 
ATOM   4722 C  CA    . PRO C 3 554 ? 27.308 15.315  8.201   1.00 38.55 ? 560  PRO A CA    1 
ATOM   4723 C  C     . PRO C 3 554 ? 28.533 14.507  8.632   1.00 38.88 ? 560  PRO A C     1 
ATOM   4724 O  O     . PRO C 3 554 ? 28.936 14.558  9.795   1.00 39.92 ? 560  PRO A O     1 
ATOM   4725 C  CB    . PRO C 3 554 ? 25.987 14.632  8.568   1.00 39.21 ? 560  PRO A CB    1 
ATOM   4726 C  CG    . PRO C 3 554 ? 25.578 13.951  7.282   1.00 39.10 ? 560  PRO A CG    1 
ATOM   4727 C  CD    . PRO C 3 554 ? 25.902 14.998  6.252   1.00 38.94 ? 560  PRO A CD    1 
ATOM   4728 N  N     . ALA C 3 555 ? 29.128 13.765  7.702   1.00 37.81 ? 561  ALA A N     1 
ATOM   4729 C  CA    . ALA C 3 555 ? 30.309 12.971  8.021   1.00 36.07 ? 561  ALA A CA    1 
ATOM   4730 C  C     . ALA C 3 555 ? 31.444 13.879  8.485   1.00 35.07 ? 561  ALA A C     1 
ATOM   4731 O  O     . ALA C 3 555 ? 32.424 13.416  9.071   1.00 35.26 ? 561  ALA A O     1 
ATOM   4732 C  CB    . ALA C 3 555 ? 30.747 12.168  6.811   1.00 36.37 ? 561  ALA A CB    1 
ATOM   4733 N  N     . ILE C 3 556 ? 31.315 15.172  8.210   1.00 32.33 ? 562  ILE A N     1 
ATOM   4734 C  CA    . ILE C 3 556 ? 32.328 16.130  8.628   1.00 33.04 ? 562  ILE A CA    1 
ATOM   4735 C  C     . ILE C 3 556 ? 32.363 16.180  10.157  1.00 33.67 ? 562  ILE A C     1 
ATOM   4736 O  O     . ILE C 3 556 ? 33.438 16.214  10.766  1.00 33.71 ? 562  ILE A O     1 
ATOM   4737 C  CB    . ILE C 3 556 ? 32.036 17.538  8.050   1.00 30.91 ? 562  ILE A CB    1 
ATOM   4738 C  CG1   . ILE C 3 556 ? 32.298 17.530  6.538   1.00 30.61 ? 562  ILE A CG1   1 
ATOM   4739 C  CG2   . ILE C 3 556 ? 32.887 18.579  8.744   1.00 30.01 ? 562  ILE A CG2   1 
ATOM   4740 C  CD1   . ILE C 3 556 ? 31.988 18.829  5.832   1.00 30.63 ? 562  ILE A CD1   1 
ATOM   4741 N  N     . ALA C 3 557 ? 31.181 16.160  10.771  1.00 33.40 ? 563  ALA A N     1 
ATOM   4742 C  CA    . ALA C 3 557 ? 31.074 16.187  12.224  1.00 33.55 ? 563  ALA A CA    1 
ATOM   4743 C  C     . ALA C 3 557 ? 31.627 14.887  12.794  1.00 33.13 ? 563  ALA A C     1 
ATOM   4744 O  O     . ALA C 3 557 ? 32.334 14.888  13.798  1.00 34.45 ? 563  ALA A O     1 
ATOM   4745 C  CB    . ALA C 3 557 ? 29.611 16.364  12.645  1.00 35.23 ? 563  ALA A CB    1 
ATOM   4746 N  N     . ALA C 3 558 ? 31.306 13.778  12.141  1.00 32.26 ? 564  ALA A N     1 
ATOM   4747 C  CA    . ALA C 3 558 ? 31.774 12.471  12.585  1.00 32.28 ? 564  ALA A CA    1 
ATOM   4748 C  C     . ALA C 3 558 ? 33.299 12.446  12.631  1.00 31.21 ? 564  ALA A C     1 
ATOM   4749 O  O     . ALA C 3 558 ? 33.895 12.025  13.626  1.00 31.75 ? 564  ALA A O     1 
ATOM   4750 C  CB    . ALA C 3 558 ? 31.257 11.384  11.645  1.00 30.95 ? 564  ALA A CB    1 
ATOM   4751 N  N     . LEU C 3 559 ? 33.923 12.901  11.549  1.00 30.61 ? 565  LEU A N     1 
ATOM   4752 C  CA    . LEU C 3 559 ? 35.379 12.937  11.465  1.00 29.48 ? 565  LEU A CA    1 
ATOM   4753 C  C     . LEU C 3 559 ? 35.945 13.784  12.596  1.00 30.31 ? 565  LEU A C     1 
ATOM   4754 O  O     . LEU C 3 559 ? 36.880 13.370  13.279  1.00 30.35 ? 565  LEU A O     1 
ATOM   4755 C  CB    . LEU C 3 559 ? 35.812 13.501  10.112  1.00 28.73 ? 565  LEU A CB    1 
ATOM   4756 C  CG    . LEU C 3 559 ? 37.308 13.685  9.834   1.00 27.54 ? 565  LEU A CG    1 
ATOM   4757 C  CD1   . LEU C 3 559 ? 38.075 12.370  10.031  1.00 23.21 ? 565  LEU A CD1   1 
ATOM   4758 C  CD2   . LEU C 3 559 ? 37.460 14.190  8.406   1.00 26.37 ? 565  LEU A CD2   1 
ATOM   4759 N  N     . ARG C 3 560 ? 35.367 14.966  12.795  1.00 31.91 ? 566  ARG A N     1 
ATOM   4760 C  CA    . ARG C 3 560 ? 35.804 15.866  13.859  1.00 34.40 ? 566  ARG A CA    1 
ATOM   4761 C  C     . ARG C 3 560 ? 35.704 15.216  15.236  1.00 35.65 ? 566  ARG A C     1 
ATOM   4762 O  O     . ARG C 3 560 ? 36.625 15.324  16.045  1.00 35.53 ? 566  ARG A O     1 
ATOM   4763 C  CB    . ARG C 3 560 ? 34.972 17.152  13.853  1.00 35.00 ? 566  ARG A CB    1 
ATOM   4764 C  CG    . ARG C 3 560 ? 35.350 18.159  12.776  1.00 37.37 ? 566  ARG A CG    1 
ATOM   4765 C  CD    . ARG C 3 560 ? 34.350 19.310  12.747  1.00 39.94 ? 566  ARG A CD    1 
ATOM   4766 N  NE    . ARG C 3 560 ? 34.686 20.331  11.756  1.00 41.87 ? 566  ARG A NE    1 
ATOM   4767 C  CZ    . ARG C 3 560 ? 33.851 21.290  11.361  1.00 41.97 ? 566  ARG A CZ    1 
ATOM   4768 N  NH1   . ARG C 3 560 ? 32.626 21.355  11.873  1.00 41.95 ? 566  ARG A NH1   1 
ATOM   4769 N  NH2   . ARG C 3 560 ? 34.234 22.183  10.457  1.00 42.13 ? 566  ARG A NH2   1 
ATOM   4770 N  N     . GLU C 3 561 ? 34.583 14.548  15.503  1.00 37.97 ? 567  GLU A N     1 
ATOM   4771 C  CA    . GLU C 3 561 ? 34.373 13.886  16.791  1.00 39.65 ? 567  GLU A CA    1 
ATOM   4772 C  C     . GLU C 3 561 ? 35.426 12.800  16.994  1.00 39.54 ? 567  GLU A C     1 
ATOM   4773 O  O     . GLU C 3 561 ? 36.001 12.660  18.077  1.00 40.06 ? 567  GLU A O     1 
ATOM   4774 C  CB    . GLU C 3 561 ? 32.987 13.234  16.850  1.00 40.33 ? 567  GLU A CB    1 
ATOM   4775 C  CG    . GLU C 3 561 ? 31.839 14.105  16.378  1.00 45.19 ? 567  GLU A CG    1 
ATOM   4776 C  CD    . GLU C 3 561 ? 30.525 13.329  16.256  1.00 48.23 ? 567  GLU A CD    1 
ATOM   4777 O  OE1   . GLU C 3 561 ? 29.591 13.835  15.591  1.00 47.94 ? 567  GLU A OE1   1 
ATOM   4778 O  OE2   . GLU C 3 561 ? 30.428 12.215  16.830  1.00 49.48 ? 567  GLU A OE2   1 
ATOM   4779 N  N     . SER C 3 562 ? 35.666 12.028  15.941  1.00 38.39 ? 568  SER A N     1 
ATOM   4780 C  CA    . SER C 3 562 ? 36.632 10.942  15.998  1.00 38.24 ? 568  SER A CA    1 
ATOM   4781 C  C     . SER C 3 562 ? 38.029 11.485  16.286  1.00 37.80 ? 568  SER A C     1 
ATOM   4782 O  O     . SER C 3 562 ? 38.761 10.941  17.110  1.00 37.47 ? 568  SER A O     1 
ATOM   4783 C  CB    . SER C 3 562 ? 36.618 10.177  14.677  1.00 37.76 ? 568  SER A CB    1 
ATOM   4784 O  OG    . SER C 3 562 ? 37.134 8.868   14.846  1.00 42.59 ? 568  SER A OG    1 
ATOM   4785 N  N     . ILE C 3 563 ? 38.396 12.566  15.609  1.00 37.99 ? 569  ILE A N     1 
ATOM   4786 C  CA    . ILE C 3 563 ? 39.703 13.170  15.818  1.00 37.24 ? 569  ILE A CA    1 
ATOM   4787 C  C     . ILE C 3 563 ? 39.815 13.567  17.285  1.00 37.52 ? 569  ILE A C     1 
ATOM   4788 O  O     . ILE C 3 563 ? 40.808 13.259  17.945  1.00 37.60 ? 569  ILE A O     1 
ATOM   4789 C  CB    . ILE C 3 563 ? 39.884 14.403  14.904  1.00 36.84 ? 569  ILE A CB    1 
ATOM   4790 C  CG1   . ILE C 3 563 ? 39.940 13.944  13.442  1.00 35.73 ? 569  ILE A CG1   1 
ATOM   4791 C  CG2   . ILE C 3 563 ? 41.143 15.172  15.286  1.00 35.85 ? 569  ILE A CG2   1 
ATOM   4792 C  CD1   . ILE C 3 563 ? 39.938 15.081  12.425  1.00 34.95 ? 569  ILE A CD1   1 
ATOM   4793 N  N     . GLN C 3 564 ? 38.778 14.233  17.786  1.00 37.77 ? 570  GLN A N     1 
ATOM   4794 C  CA    . GLN C 3 564 ? 38.716 14.678  19.179  1.00 38.76 ? 570  GLN A CA    1 
ATOM   4795 C  C     . GLN C 3 564 ? 38.882 13.548  20.200  1.00 39.00 ? 570  GLN A C     1 
ATOM   4796 O  O     . GLN C 3 564 ? 39.703 13.642  21.119  1.00 37.75 ? 570  GLN A O     1 
ATOM   4797 C  CB    . GLN C 3 564 ? 37.377 15.373  19.439  1.00 38.69 ? 570  GLN A CB    1 
ATOM   4798 C  CG    . GLN C 3 564 ? 37.421 16.880  19.346  1.00 40.59 ? 570  GLN A CG    1 
ATOM   4799 C  CD    . GLN C 3 564 ? 38.141 17.511  20.525  1.00 41.36 ? 570  GLN A CD    1 
ATOM   4800 O  OE1   . GLN C 3 564 ? 37.745 17.336  21.682  1.00 40.14 ? 570  GLN A OE1   1 
ATOM   4801 N  NE2   . GLN C 3 564 ? 39.202 18.252  20.238  1.00 41.22 ? 570  GLN A NE2   1 
ATOM   4802 N  N     . GLN C 3 565 ? 38.089 12.492  20.041  1.00 39.78 ? 571  GLN A N     1 
ATOM   4803 C  CA    . GLN C 3 565 ? 38.123 11.352  20.956  1.00 41.51 ? 571  GLN A CA    1 
ATOM   4804 C  C     . GLN C 3 565 ? 39.492 10.682  20.999  1.00 41.80 ? 571  GLN A C     1 
ATOM   4805 O  O     . GLN C 3 565 ? 39.886 10.119  22.018  1.00 42.16 ? 571  GLN A O     1 
ATOM   4806 C  CB    . GLN C 3 565 ? 37.057 10.322  20.559  1.00 41.73 ? 571  GLN A CB    1 
ATOM   4807 N  N     . THR C 3 566 ? 40.215 10.754  19.889  1.00 42.29 ? 572  THR A N     1 
ATOM   4808 C  CA    . THR C 3 566 ? 41.540 10.156  19.798  1.00 42.45 ? 572  THR A CA    1 
ATOM   4809 C  C     . THR C 3 566 ? 42.610 10.992  20.496  1.00 42.66 ? 572  THR A C     1 
ATOM   4810 O  O     . THR C 3 566 ? 43.463 10.459  21.211  1.00 41.90 ? 572  THR A O     1 
ATOM   4811 C  CB    . THR C 3 566 ? 41.970 9.992   18.325  1.00 42.05 ? 572  THR A CB    1 
ATOM   4812 O  OG1   . THR C 3 566 ? 41.044 9.134   17.647  1.00 42.57 ? 572  THR A OG1   1 
ATOM   4813 C  CG2   . THR C 3 566 ? 43.365 9.404   18.239  1.00 41.67 ? 572  THR A CG2   1 
ATOM   4814 N  N     . LEU C 3 567 ? 42.553 12.304  20.288  1.00 41.89 ? 573  LEU A N     1 
ATOM   4815 C  CA    . LEU C 3 567 ? 43.546 13.218  20.848  1.00 41.67 ? 573  LEU A CA    1 
ATOM   4816 C  C     . LEU C 3 567 ? 43.293 13.756  22.244  1.00 42.00 ? 573  LEU A C     1 
ATOM   4817 O  O     . LEU C 3 567 ? 44.211 13.818  23.056  1.00 41.08 ? 573  LEU A O     1 
ATOM   4818 C  CB    . LEU C 3 567 ? 43.739 14.402  19.900  1.00 40.67 ? 573  LEU A CB    1 
ATOM   4819 C  CG    . LEU C 3 567 ? 44.179 14.057  18.478  1.00 38.46 ? 573  LEU A CG    1 
ATOM   4820 C  CD1   . LEU C 3 567 ? 44.131 15.293  17.622  1.00 38.71 ? 573  LEU A CD1   1 
ATOM   4821 C  CD2   . LEU C 3 567 ? 45.572 13.474  18.508  1.00 39.06 ? 573  LEU A CD2   1 
ATOM   4822 N  N     . VAL C 3 568 ? 42.058 14.158  22.518  1.00 43.56 ? 574  VAL A N     1 
ATOM   4823 C  CA    . VAL C 3 568 ? 41.715 14.728  23.817  1.00 45.21 ? 574  VAL A CA    1 
ATOM   4824 C  C     . VAL C 3 568 ? 41.041 13.740  24.771  1.00 46.87 ? 574  VAL A C     1 
ATOM   4825 O  O     . VAL C 3 568 ? 40.268 12.879  24.343  1.00 46.87 ? 574  VAL A O     1 
ATOM   4826 C  CB    . VAL C 3 568 ? 40.775 15.942  23.637  1.00 44.67 ? 574  VAL A CB    1 
ATOM   4827 C  CG1   . VAL C 3 568 ? 40.605 16.673  24.956  1.00 44.04 ? 574  VAL A CG1   1 
ATOM   4828 C  CG2   . VAL C 3 568 ? 41.319 16.867  22.561  1.00 43.54 ? 574  VAL A CG2   1 
ATOM   4829 N  N     . GLU C 3 569 ? 41.331 13.863  26.064  1.00 48.27 ? 575  GLU A N     1 
ATOM   4830 C  CA    . GLU C 3 569 ? 40.705 12.987  27.052  1.00 50.41 ? 575  GLU A CA    1 
ATOM   4831 C  C     . GLU C 3 569 ? 39.973 13.810  28.111  1.00 49.70 ? 575  GLU A C     1 
ATOM   4832 O  O     . GLU C 3 569 ? 40.251 15.028  28.180  1.00 50.42 ? 575  GLU A O     1 
ATOM   4833 C  CB    . GLU C 3 569 ? 41.742 12.085  27.728  1.00 52.43 ? 575  GLU A CB    1 
ATOM   4834 C  CG    . GLU C 3 569 ? 42.696 12.806  28.660  1.00 56.14 ? 575  GLU A CG    1 
ATOM   4835 C  CD    . GLU C 3 569 ? 43.622 11.852  29.396  1.00 58.29 ? 575  GLU A CD    1 
ATOM   4836 O  OE1   . GLU C 3 569 ? 44.360 11.095  28.722  1.00 58.18 ? 575  GLU A OE1   1 
ATOM   4837 O  OE2   . GLU C 3 569 ? 43.611 11.862  30.649  1.00 59.71 ? 575  GLU A OE2   1 
ATOM   4838 N  N     . LYS C 3 581 ? 43.649 18.194  28.738  1.00 43.52 ? 587  LYS A N     1 
ATOM   4839 C  CA    . LYS C 3 581 ? 44.584 17.048  28.906  1.00 43.27 ? 587  LYS A CA    1 
ATOM   4840 C  C     . LYS C 3 581 ? 44.651 16.261  27.607  1.00 43.14 ? 587  LYS A C     1 
ATOM   4841 O  O     . LYS C 3 581 ? 43.619 15.938  27.014  1.00 42.90 ? 587  LYS A O     1 
ATOM   4842 C  CB    . LYS C 3 581 ? 44.112 16.121  30.029  1.00 44.78 ? 587  LYS A CB    1 
ATOM   4843 C  CG    . LYS C 3 581 ? 44.028 16.761  31.405  1.00 44.98 ? 587  LYS A CG    1 
ATOM   4844 C  CD    . LYS C 3 581 ? 43.702 15.707  32.458  1.00 45.70 ? 587  LYS A CD    1 
ATOM   4845 C  CE    . LYS C 3 581 ? 43.598 16.317  33.849  1.00 47.21 ? 587  LYS A CE    1 
ATOM   4846 N  NZ    . LYS C 3 581 ? 43.419 15.274  34.904  1.00 47.11 ? 587  LYS A NZ    1 
ATOM   4847 N  N     . TRP C 3 582 ? 45.868 15.940  27.180  1.00 41.70 ? 588  TRP A N     1 
ATOM   4848 C  CA    . TRP C 3 582 ? 46.069 15.208  25.941  1.00 40.06 ? 588  TRP A CA    1 
ATOM   4849 C  C     . TRP C 3 582 ? 46.255 13.707  26.078  1.00 40.32 ? 588  TRP A C     1 
ATOM   4850 O  O     . TRP C 3 582 ? 47.095 13.231  26.846  1.00 40.02 ? 588  TRP A O     1 
ATOM   4851 C  CB    . TRP C 3 582 ? 47.268 15.776  25.186  1.00 37.30 ? 588  TRP A CB    1 
ATOM   4852 C  CG    . TRP C 3 582 ? 47.093 17.189  24.755  1.00 33.91 ? 588  TRP A CG    1 
ATOM   4853 C  CD1   . TRP C 3 582 ? 47.445 18.307  25.447  1.00 33.02 ? 588  TRP A CD1   1 
ATOM   4854 C  CD2   . TRP C 3 582 ? 46.553 17.638  23.509  1.00 31.92 ? 588  TRP A CD2   1 
ATOM   4855 N  NE1   . TRP C 3 582 ? 47.166 19.431  24.706  1.00 32.40 ? 588  TRP A NE1   1 
ATOM   4856 C  CE2   . TRP C 3 582 ? 46.616 19.048  23.511  1.00 32.57 ? 588  TRP A CE2   1 
ATOM   4857 C  CE3   . TRP C 3 582 ? 46.022 16.986  22.390  1.00 30.29 ? 588  TRP A CE3   1 
ATOM   4858 C  CZ2   . TRP C 3 582 ? 46.170 19.822  22.431  1.00 31.15 ? 588  TRP A CZ2   1 
ATOM   4859 C  CZ3   . TRP C 3 582 ? 45.578 17.751  21.320  1.00 30.40 ? 588  TRP A CZ3   1 
ATOM   4860 C  CH2   . TRP C 3 582 ? 45.656 19.158  21.348  1.00 31.79 ? 588  TRP A CH2   1 
ATOM   4861 N  N     . LYS C 3 583 ? 45.460 12.967  25.317  1.00 40.60 ? 589  LYS A N     1 
ATOM   4862 C  CA    . LYS C 3 583 ? 45.541 11.516  25.297  1.00 41.13 ? 589  LYS A CA    1 
ATOM   4863 C  C     . LYS C 3 583 ? 46.759 11.220  24.412  1.00 41.82 ? 589  LYS A C     1 
ATOM   4864 O  O     . LYS C 3 583 ? 47.481 10.245  24.624  1.00 43.04 ? 589  LYS A O     1 
ATOM   4865 C  CB    . LYS C 3 583 ? 44.259 10.938  24.690  1.00 41.37 ? 589  LYS A CB    1 
ATOM   4866 C  CG    . LYS C 3 583 ? 44.017 9.462   24.986  1.00 43.61 ? 589  LYS A CG    1 
ATOM   4867 C  CD    . LYS C 3 583 ? 42.634 9.011   24.503  1.00 43.65 ? 589  LYS A CD    1 
ATOM   4868 C  CE    . LYS C 3 583 ? 41.509 9.781   25.197  1.00 43.97 ? 589  LYS A CE    1 
ATOM   4869 N  NZ    . LYS C 3 583 ? 40.157 9.439   24.651  1.00 42.39 ? 589  LYS A NZ    1 
ATOM   4870 N  N     . ARG C 3 584 ? 46.977 12.098  23.431  1.00 41.63 ? 590  ARG A N     1 
ATOM   4871 C  CA    . ARG C 3 584 ? 48.099 12.026  22.493  1.00 40.60 ? 590  ARG A CA    1 
ATOM   4872 C  C     . ARG C 3 584 ? 48.145 13.367  21.763  1.00 39.99 ? 590  ARG A C     1 
ATOM   4873 O  O     . ARG C 3 584 ? 47.118 13.843  21.284  1.00 40.98 ? 590  ARG A O     1 
ATOM   4874 C  CB    . ARG C 3 584 ? 47.899 10.910  21.474  1.00 41.19 ? 590  ARG A CB    1 
ATOM   4875 C  CG    . ARG C 3 584 ? 49.155 10.621  20.676  1.00 43.02 ? 590  ARG A CG    1 
ATOM   4876 C  CD    . ARG C 3 584 ? 48.825 10.207  19.271  1.00 45.22 ? 590  ARG A CD    1 
ATOM   4877 N  NE    . ARG C 3 584 ? 47.972 9.029   19.229  1.00 49.16 ? 590  ARG A NE    1 
ATOM   4878 C  CZ    . ARG C 3 584 ? 47.432 8.545   18.115  1.00 50.38 ? 590  ARG A CZ    1 
ATOM   4879 N  NH1   . ARG C 3 584 ? 47.661 9.147   16.954  1.00 51.05 ? 590  ARG A NH1   1 
ATOM   4880 N  NH2   . ARG C 3 584 ? 46.667 7.460   18.161  1.00 51.15 ? 590  ARG A NH2   1 
ATOM   4881 N  N     . ARG C 3 585 ? 49.317 13.982  21.658  1.00 38.77 ? 591  ARG A N     1 
ATOM   4882 C  CA    . ARG C 3 585 ? 49.372 15.279  21.003  1.00 38.55 ? 591  ARG A CA    1 
ATOM   4883 C  C     . ARG C 3 585 ? 49.943 15.331  19.585  1.00 37.75 ? 591  ARG A C     1 
ATOM   4884 O  O     . ARG C 3 585 ? 50.504 16.347  19.167  1.00 37.38 ? 591  ARG A O     1 
ATOM   4885 C  CB    . ARG C 3 585 ? 50.100 16.292  21.893  1.00 39.54 ? 591  ARG A CB    1 
ATOM   4886 C  CG    . ARG C 3 585 ? 49.661 17.723  21.597  1.00 42.48 ? 591  ARG A CG    1 
ATOM   4887 C  CD    . ARG C 3 585 ? 50.267 18.741  22.538  1.00 44.82 ? 591  ARG A CD    1 
ATOM   4888 N  NE    . ARG C 3 585 ? 49.796 20.088  22.228  1.00 45.56 ? 591  ARG A NE    1 
ATOM   4889 C  CZ    . ARG C 3 585 ? 50.149 21.179  22.903  1.00 46.75 ? 591  ARG A CZ    1 
ATOM   4890 N  NH1   . ARG C 3 585 ? 50.983 21.087  23.933  1.00 46.95 ? 591  ARG A NH1   1 
ATOM   4891 N  NH2   . ARG C 3 585 ? 49.663 22.361  22.550  1.00 44.83 ? 591  ARG A NH2   1 
ATOM   4892 N  N     . TRP C 3 586 ? 49.789 14.244  18.839  1.00 35.85 ? 592  TRP A N     1 
ATOM   4893 C  CA    . TRP C 3 586 ? 50.268 14.216  17.464  1.00 34.21 ? 592  TRP A CA    1 
ATOM   4894 C  C     . TRP C 3 586 ? 49.489 13.244  16.595  1.00 33.09 ? 592  TRP A C     1 
ATOM   4895 O  O     . TRP C 3 586 ? 49.006 12.214  17.064  1.00 33.46 ? 592  TRP A O     1 
ATOM   4896 C  CB    . TRP C 3 586 ? 51.760 13.869  17.407  1.00 33.62 ? 592  TRP A CB    1 
ATOM   4897 C  CG    . TRP C 3 586 ? 52.122 12.599  18.114  1.00 33.12 ? 592  TRP A CG    1 
ATOM   4898 C  CD1   . TRP C 3 586 ? 52.556 12.474  19.399  1.00 31.54 ? 592  TRP A CD1   1 
ATOM   4899 C  CD2   . TRP C 3 586 ? 52.070 11.271  17.576  1.00 32.21 ? 592  TRP A CD2   1 
ATOM   4900 N  NE1   . TRP C 3 586 ? 52.781 11.154  19.698  1.00 31.95 ? 592  TRP A NE1   1 
ATOM   4901 C  CE2   . TRP C 3 586 ? 52.491 10.392  18.598  1.00 31.46 ? 592  TRP A CE2   1 
ATOM   4902 C  CE3   . TRP C 3 586 ? 51.709 10.740  16.331  1.00 31.04 ? 592  TRP A CE3   1 
ATOM   4903 C  CZ2   . TRP C 3 586 ? 52.564 9.008   18.414  1.00 31.27 ? 592  TRP A CZ2   1 
ATOM   4904 C  CZ3   . TRP C 3 586 ? 51.779 9.364   16.146  1.00 31.84 ? 592  TRP A CZ3   1 
ATOM   4905 C  CH2   . TRP C 3 586 ? 52.204 8.513   17.184  1.00 32.45 ? 592  TRP A CH2   1 
ATOM   4906 N  N     . ILE C 3 587 ? 49.363 13.599  15.323  1.00 31.92 ? 593  ILE A N     1 
ATOM   4907 C  CA    . ILE C 3 587 ? 48.673 12.785  14.336  1.00 31.08 ? 593  ILE A CA    1 
ATOM   4908 C  C     . ILE C 3 587 ? 49.750 12.035  13.547  1.00 30.95 ? 593  ILE A C     1 
ATOM   4909 O  O     . ILE C 3 587 ? 50.876 12.524  13.406  1.00 31.07 ? 593  ILE A O     1 
ATOM   4910 C  CB    . ILE C 3 587 ? 47.869 13.677  13.353  1.00 32.34 ? 593  ILE A CB    1 
ATOM   4911 C  CG1   . ILE C 3 587 ? 46.782 14.438  14.106  1.00 32.65 ? 593  ILE A CG1   1 
ATOM   4912 C  CG2   . ILE C 3 587 ? 47.263 12.838  12.248  1.00 32.52 ? 593  ILE A CG2   1 
ATOM   4913 C  CD1   . ILE C 3 587 ? 45.853 13.547  14.875  1.00 35.30 ? 593  ILE A CD1   1 
ATOM   4914 N  N     . LYS C 3 588 ? 49.405 10.857  13.039  1.00 29.10 ? 594  LYS A N     1 
ATOM   4915 C  CA    . LYS C 3 588 ? 50.334 10.057  12.254  1.00 29.23 ? 594  LYS A CA    1 
ATOM   4916 C  C     . LYS C 3 588 ? 50.143 10.459  10.796  1.00 27.58 ? 594  LYS A C     1 
ATOM   4917 O  O     . LYS C 3 588 ? 49.084 10.219  10.229  1.00 27.41 ? 594  LYS A O     1 
ATOM   4918 C  CB    . LYS C 3 588 ? 50.023 8.565   12.416  1.00 31.78 ? 594  LYS A CB    1 
ATOM   4919 C  CG    . LYS C 3 588 ? 51.088 7.624   11.837  1.00 34.20 ? 594  LYS A CG    1 
ATOM   4920 C  CD    . LYS C 3 588 ? 50.492 6.287   11.386  1.00 37.73 ? 594  LYS A CD    1 
ATOM   4921 C  CE    . LYS C 3 588 ? 49.710 5.592   12.492  1.00 42.84 ? 594  LYS A CE    1 
ATOM   4922 N  NZ    . LYS C 3 588 ? 49.055 4.318   12.030  1.00 45.26 ? 594  LYS A NZ    1 
ATOM   4923 N  N     . GLY C 3 589 ? 51.166 11.060  10.193  1.00 26.12 ? 595  GLY A N     1 
ATOM   4924 C  CA    . GLY C 3 589 ? 51.068 11.489  8.804   1.00 23.86 ? 595  GLY A CA    1 
ATOM   4925 C  C     . GLY C 3 589 ? 51.046 10.354  7.796   1.00 22.70 ? 595  GLY A C     1 
ATOM   4926 O  O     . GLY C 3 589 ? 51.345 9.216   8.136   1.00 24.12 ? 595  GLY A O     1 
ATOM   4927 N  N     . LEU C 3 590 ? 50.703 10.658  6.548   1.00 22.37 ? 596  LEU A N     1 
ATOM   4928 C  CA    . LEU C 3 590 ? 50.640 9.632   5.510   1.00 21.22 ? 596  LEU A CA    1 
ATOM   4929 C  C     . LEU C 3 590 ? 51.911 8.779   5.415   1.00 21.71 ? 596  LEU A C     1 
ATOM   4930 O  O     . LEU C 3 590 ? 51.837 7.583   5.141   1.00 19.90 ? 596  LEU A O     1 
ATOM   4931 C  CB    . LEU C 3 590 ? 50.330 10.266  4.150   1.00 21.51 ? 596  LEU A CB    1 
ATOM   4932 C  CG    . LEU C 3 590 ? 48.958 10.946  4.017   1.00 21.72 ? 596  LEU A CG    1 
ATOM   4933 C  CD1   . LEU C 3 590 ? 48.856 11.664  2.682   1.00 23.64 ? 596  LEU A CD1   1 
ATOM   4934 C  CD2   . LEU C 3 590 ? 47.855 9.906   4.137   1.00 22.35 ? 596  LEU A CD2   1 
ATOM   4935 N  N     . ASP C 3 591 ? 53.071 9.384   5.659   1.00 21.29 ? 597  ASP A N     1 
ATOM   4936 C  CA    . ASP C 3 591 ? 54.321 8.644   5.581   1.00 20.88 ? 597  ASP A CA    1 
ATOM   4937 C  C     . ASP C 3 591 ? 54.805 8.130   6.937   1.00 21.63 ? 597  ASP A C     1 
ATOM   4938 O  O     . ASP C 3 591 ? 55.959 7.731   7.075   1.00 21.68 ? 597  ASP A O     1 
ATOM   4939 C  CB    . ASP C 3 591 ? 55.411 9.508   4.941   1.00 21.98 ? 597  ASP A CB    1 
ATOM   4940 C  CG    . ASP C 3 591 ? 55.756 10.734  5.772   1.00 22.44 ? 597  ASP A CG    1 
ATOM   4941 O  OD1   . ASP C 3 591 ? 55.264 10.857  6.912   1.00 20.96 ? 597  ASP A OD1   1 
ATOM   4942 O  OD2   . ASP C 3 591 ? 56.531 11.574  5.281   1.00 22.96 ? 597  ASP A OD2   1 
ATOM   4943 N  N     . GLY C 3 592 ? 53.926 8.163   7.937   1.00 21.49 ? 598  GLY A N     1 
ATOM   4944 C  CA    . GLY C 3 592 ? 54.283 7.673   9.259   1.00 21.92 ? 598  GLY A CA    1 
ATOM   4945 C  C     . GLY C 3 592 ? 54.833 8.642   10.296  1.00 23.17 ? 598  GLY A C     1 
ATOM   4946 O  O     . GLY C 3 592 ? 54.877 8.299   11.480  1.00 24.30 ? 598  GLY A O     1 
ATOM   4947 N  N     . ARG C 3 593 ? 55.245 9.842   9.896   1.00 22.15 ? 599  ARG A N     1 
ATOM   4948 C  CA    . ARG C 3 593 ? 55.800 10.774  10.873  1.00 21.95 ? 599  ARG A CA    1 
ATOM   4949 C  C     . ARG C 3 593 ? 54.782 11.242  11.905  1.00 22.95 ? 599  ARG A C     1 
ATOM   4950 O  O     . ARG C 3 593 ? 53.576 11.013  11.771  1.00 19.36 ? 599  ARG A O     1 
ATOM   4951 C  CB    . ARG C 3 593 ? 56.420 12.002  10.183  1.00 21.55 ? 599  ARG A CB    1 
ATOM   4952 C  CG    . ARG C 3 593 ? 55.428 12.967  9.532   1.00 20.92 ? 599  ARG A CG    1 
ATOM   4953 C  CD    . ARG C 3 593 ? 55.835 13.220  8.081   1.00 22.12 ? 599  ARG A CD    1 
ATOM   4954 N  NE    . ARG C 3 593 ? 56.361 14.556  7.889   1.00 22.69 ? 599  ARG A NE    1 
ATOM   4955 C  CZ    . ARG C 3 593 ? 57.115 14.932  6.865   1.00 19.25 ? 599  ARG A CZ    1 
ATOM   4956 N  NH1   . ARG C 3 593 ? 57.448 14.072  5.919   1.00 19.54 ? 599  ARG A NH1   1 
ATOM   4957 N  NH2   . ARG C 3 593 ? 57.539 16.179  6.796   1.00 20.78 ? 599  ARG A NH2   1 
ATOM   4958 N  N     . LYS C 3 594 ? 55.292 11.877  12.955  1.00 24.09 ? 600  LYS A N     1 
ATOM   4959 C  CA    . LYS C 3 594 ? 54.438 12.422  13.997  1.00 25.72 ? 600  LYS A CA    1 
ATOM   4960 C  C     . LYS C 3 594 ? 54.166 13.844  13.558  1.00 25.25 ? 600  LYS A C     1 
ATOM   4961 O  O     . LYS C 3 594 ? 55.092 14.559  13.201  1.00 25.34 ? 600  LYS A O     1 
ATOM   4962 C  CB    . LYS C 3 594 ? 55.151 12.489  15.349  1.00 26.52 ? 600  LYS A CB    1 
ATOM   4963 C  CG    . LYS C 3 594 ? 55.487 11.177  16.035  1.00 27.81 ? 600  LYS A CG    1 
ATOM   4964 C  CD    . LYS C 3 594 ? 56.073 11.499  17.418  1.00 29.59 ? 600  LYS A CD    1 
ATOM   4965 C  CE    . LYS C 3 594 ? 56.492 10.269  18.202  1.00 30.48 ? 600  LYS A CE    1 
ATOM   4966 N  NZ    . LYS C 3 594 ? 57.006 10.659  19.554  1.00 32.15 ? 600  LYS A NZ    1 
ATOM   4967 N  N     . VAL C 3 595 ? 52.907 14.257  13.575  1.00 25.14 ? 601  VAL A N     1 
ATOM   4968 C  CA    . VAL C 3 595 ? 52.570 15.618  13.196  1.00 24.52 ? 601  VAL A CA    1 
ATOM   4969 C  C     . VAL C 3 595 ? 51.962 16.282  14.420  1.00 25.66 ? 601  VAL A C     1 
ATOM   4970 O  O     . VAL C 3 595 ? 50.840 15.972  14.812  1.00 26.78 ? 601  VAL A O     1 
ATOM   4971 C  CB    . VAL C 3 595 ? 51.557 15.652  12.042  1.00 24.66 ? 601  VAL A CB    1 
ATOM   4972 C  CG1   . VAL C 3 595 ? 51.346 17.099  11.581  1.00 22.20 ? 601  VAL A CG1   1 
ATOM   4973 C  CG2   . VAL C 3 595 ? 52.040 14.761  10.899  1.00 23.38 ? 601  VAL A CG2   1 
ATOM   4974 N  N     . HIS C 3 596 ? 52.718 17.188  15.027  1.00 25.63 ? 602  HIS A N     1 
ATOM   4975 C  CA    . HIS C 3 596 ? 52.281 17.894  16.224  1.00 26.43 ? 602  HIS A CA    1 
ATOM   4976 C  C     . HIS C 3 596 ? 50.977 18.683  16.066  1.00 28.03 ? 602  HIS A C     1 
ATOM   4977 O  O     . HIS C 3 596 ? 50.828 19.479  15.137  1.00 30.35 ? 602  HIS A O     1 
ATOM   4978 C  CB    . HIS C 3 596 ? 53.393 18.841  16.680  1.00 25.44 ? 602  HIS A CB    1 
ATOM   4979 C  CG    . HIS C 3 596 ? 53.082 19.578  17.945  1.00 26.50 ? 602  HIS A CG    1 
ATOM   4980 N  ND1   . HIS C 3 596 ? 52.947 18.946  19.162  1.00 26.66 ? 602  HIS A ND1   1 
ATOM   4981 C  CD2   . HIS C 3 596 ? 52.910 20.899  18.187  1.00 27.04 ? 602  HIS A CD2   1 
ATOM   4982 C  CE1   . HIS C 3 596 ? 52.709 19.845  20.099  1.00 25.51 ? 602  HIS A CE1   1 
ATOM   4983 N  NE2   . HIS C 3 596 ? 52.682 21.038  19.535  1.00 25.82 ? 602  HIS A NE2   1 
ATOM   4984 N  N     . VAL C 3 597 ? 50.036 18.453  16.979  1.00 28.35 ? 603  VAL A N     1 
ATOM   4985 C  CA    . VAL C 3 597 ? 48.761 19.168  16.976  1.00 27.41 ? 603  VAL A CA    1 
ATOM   4986 C  C     . VAL C 3 597 ? 48.882 20.290  18.004  1.00 27.58 ? 603  VAL A C     1 
ATOM   4987 O  O     . VAL C 3 597 ? 49.301 20.061  19.134  1.00 27.91 ? 603  VAL A O     1 
ATOM   4988 C  CB    . VAL C 3 597 ? 47.574 18.246  17.367  1.00 27.76 ? 603  VAL A CB    1 
ATOM   4989 C  CG1   . VAL C 3 597 ? 46.277 19.050  17.411  1.00 26.99 ? 603  VAL A CG1   1 
ATOM   4990 C  CG2   . VAL C 3 597 ? 47.436 17.120  16.362  1.00 25.03 ? 603  VAL A CG2   1 
ATOM   4991 N  N     . ARG C 3 598 ? 48.541 21.507  17.596  1.00 28.35 ? 604  ARG A N     1 
ATOM   4992 C  CA    . ARG C 3 598 ? 48.623 22.670  18.478  1.00 29.54 ? 604  ARG A CA    1 
ATOM   4993 C  C     . ARG C 3 598 ? 47.351 22.917  19.282  1.00 29.99 ? 604  ARG A C     1 
ATOM   4994 O  O     . ARG C 3 598 ? 47.420 23.305  20.440  1.00 31.76 ? 604  ARG A O     1 
ATOM   4995 C  CB    . ARG C 3 598 ? 48.959 23.932  17.667  1.00 28.10 ? 604  ARG A CB    1 
ATOM   4996 C  CG    . ARG C 3 598 ? 50.399 23.982  17.167  1.00 27.19 ? 604  ARG A CG    1 
ATOM   4997 C  CD    . ARG C 3 598 ? 50.619 25.103  16.154  1.00 26.42 ? 604  ARG A CD    1 
ATOM   4998 N  NE    . ARG C 3 598 ? 52.032 25.264  15.813  1.00 25.87 ? 604  ARG A NE    1 
ATOM   4999 C  CZ    . ARG C 3 598 ? 52.478 25.996  14.792  1.00 26.59 ? 604  ARG A CZ    1 
ATOM   5000 N  NH1   . ARG C 3 598 ? 51.625 26.634  14.001  1.00 25.04 ? 604  ARG A NH1   1 
ATOM   5001 N  NH2   . ARG C 3 598 ? 53.779 26.096  14.563  1.00 25.32 ? 604  ARG A NH2   1 
ATOM   5002 N  N     . SER C 3 599 ? 46.193 22.701  18.664  1.00 31.23 ? 605  SER A N     1 
ATOM   5003 C  CA    . SER C 3 599 ? 44.911 22.917  19.332  1.00 31.77 ? 605  SER A CA    1 
ATOM   5004 C  C     . SER C 3 599 ? 43.863 21.916  18.910  1.00 31.40 ? 605  SER A C     1 
ATOM   5005 O  O     . SER C 3 599 ? 43.821 21.500  17.753  1.00 32.99 ? 605  SER A O     1 
ATOM   5006 C  CB    . SER C 3 599 ? 44.362 24.311  19.022  1.00 31.03 ? 605  SER A CB    1 
ATOM   5007 O  OG    . SER C 3 599 ? 44.882 25.270  19.912  1.00 36.26 ? 605  SER A OG    1 
ATOM   5008 N  N     . PRO C 3 600 ? 42.990 21.518  19.843  1.00 30.75 ? 606  PRO A N     1 
ATOM   5009 C  CA    . PRO C 3 600 ? 41.952 20.559  19.469  1.00 30.25 ? 606  PRO A CA    1 
ATOM   5010 C  C     . PRO C 3 600 ? 41.099 21.138  18.344  1.00 29.79 ? 606  PRO A C     1 
ATOM   5011 O  O     . PRO C 3 600 ? 40.666 20.410  17.455  1.00 30.65 ? 606  PRO A O     1 
ATOM   5012 C  CB    . PRO C 3 600 ? 41.160 20.387  20.763  1.00 28.64 ? 606  PRO A CB    1 
ATOM   5013 C  CG    . PRO C 3 600 ? 42.199 20.553  21.811  1.00 28.92 ? 606  PRO A CG    1 
ATOM   5014 C  CD    . PRO C 3 600 ? 42.997 21.744  21.299  1.00 30.71 ? 606  PRO A CD    1 
ATOM   5015 N  N     . HIS C 3 601 ? 40.884 22.454  18.373  1.00 30.46 ? 607  HIS A N     1 
ATOM   5016 C  CA    . HIS C 3 601 ? 40.055 23.106  17.359  1.00 32.51 ? 607  HIS A CA    1 
ATOM   5017 C  C     . HIS C 3 601 ? 40.714 23.228  15.984  1.00 32.31 ? 607  HIS A C     1 
ATOM   5018 O  O     . HIS C 3 601 ? 40.031 23.418  14.976  1.00 32.13 ? 607  HIS A O     1 
ATOM   5019 C  CB    . HIS C 3 601 ? 39.592 24.495  17.842  1.00 33.15 ? 607  HIS A CB    1 
ATOM   5020 C  CG    . HIS C 3 601 ? 40.526 25.613  17.490  1.00 35.11 ? 607  HIS A CG    1 
ATOM   5021 N  ND1   . HIS C 3 601 ? 41.667 25.891  18.214  1.00 37.41 ? 607  HIS A ND1   1 
ATOM   5022 C  CD2   . HIS C 3 601 ? 40.487 26.523  16.487  1.00 35.58 ? 607  HIS A CD2   1 
ATOM   5023 C  CE1   . HIS C 3 601 ? 42.288 26.926  17.673  1.00 35.82 ? 607  HIS A CE1   1 
ATOM   5024 N  NE2   . HIS C 3 601 ? 41.593 27.328  16.624  1.00 35.35 ? 607  HIS A NE2   1 
ATOM   5025 N  N     . ALA C 3 602 ? 42.036 23.117  15.945  1.00 31.64 ? 608  ALA A N     1 
ATOM   5026 C  CA    . ALA C 3 602 ? 42.768 23.210  14.688  1.00 31.25 ? 608  ALA A CA    1 
ATOM   5027 C  C     . ALA C 3 602 ? 43.261 21.829  14.246  1.00 31.54 ? 608  ALA A C     1 
ATOM   5028 O  O     . ALA C 3 602 ? 44.025 21.710  13.286  1.00 32.50 ? 608  ALA A O     1 
ATOM   5029 C  CB    . ALA C 3 602 ? 43.947 24.166  14.847  1.00 30.64 ? 608  ALA A CB    1 
ATOM   5030 N  N     . ALA C 3 603 ? 42.810 20.792  14.948  1.00 29.62 ? 609  ALA A N     1 
ATOM   5031 C  CA    . ALA C 3 603 ? 43.203 19.413  14.663  1.00 28.50 ? 609  ALA A CA    1 
ATOM   5032 C  C     . ALA C 3 603 ? 42.834 18.921  13.260  1.00 27.58 ? 609  ALA A C     1 
ATOM   5033 O  O     . ALA C 3 603 ? 43.645 18.277  12.596  1.00 25.75 ? 609  ALA A O     1 
ATOM   5034 C  CB    . ALA C 3 603 ? 42.605 18.471  15.718  1.00 26.55 ? 609  ALA A CB    1 
ATOM   5035 N  N     . LEU C 3 604 ? 41.612 19.200  12.816  1.00 27.45 ? 610  LEU A N     1 
ATOM   5036 C  CA    . LEU C 3 604 ? 41.202 18.765  11.486  1.00 26.36 ? 610  LEU A CA    1 
ATOM   5037 C  C     . LEU C 3 604 ? 42.094 19.416  10.441  1.00 26.06 ? 610  LEU A C     1 
ATOM   5038 O  O     . LEU C 3 604 ? 42.475 18.776  9.459   1.00 26.83 ? 610  LEU A O     1 
ATOM   5039 C  CB    . LEU C 3 604 ? 39.743 19.125  11.195  1.00 25.67 ? 610  LEU A CB    1 
ATOM   5040 C  CG    . LEU C 3 604 ? 39.344 18.775  9.752   1.00 25.49 ? 610  LEU A CG    1 
ATOM   5041 C  CD1   . LEU C 3 604 ? 39.588 17.298  9.489   1.00 23.32 ? 610  LEU A CD1   1 
ATOM   5042 C  CD2   . LEU C 3 604 ? 37.901 19.115  9.506   1.00 23.60 ? 610  LEU A CD2   1 
ATOM   5043 N  N     . ASN C 3 605 ? 42.422 20.689  10.648  1.00 23.95 ? 611  ASN A N     1 
ATOM   5044 C  CA    . ASN C 3 605 ? 43.288 21.389  9.709   1.00 23.36 ? 611  ASN A CA    1 
ATOM   5045 C  C     . ASN C 3 605 ? 44.654 20.708  9.683   1.00 23.05 ? 611  ASN A C     1 
ATOM   5046 O  O     . ASN C 3 605 ? 45.244 20.505  8.619   1.00 23.27 ? 611  ASN A O     1 
ATOM   5047 C  CB    . ASN C 3 605 ? 43.444 22.857  10.104  1.00 24.02 ? 611  ASN A CB    1 
ATOM   5048 C  CG    . ASN C 3 605 ? 44.423 23.593  9.216   1.00 25.21 ? 611  ASN A CG    1 
ATOM   5049 O  OD1   . ASN C 3 605 ? 45.578 23.792  9.582   1.00 25.17 ? 611  ASN A OD1   1 
ATOM   5050 N  ND2   . ASN C 3 605 ? 43.966 23.987  8.028   1.00 26.46 ? 611  ASN A ND2   1 
ATOM   5051 N  N     . THR C 3 606 ? 45.145 20.340  10.860  1.00 22.64 ? 612  THR A N     1 
ATOM   5052 C  CA    . THR C 3 606 ? 46.429 19.669  10.952  1.00 23.77 ? 612  THR A CA    1 
ATOM   5053 C  C     . THR C 3 606 ? 46.388 18.395  10.112  1.00 24.56 ? 612  THR A C     1 
ATOM   5054 O  O     . THR C 3 606 ? 47.254 18.170  9.272   1.00 25.26 ? 612  THR A O     1 
ATOM   5055 C  CB    . THR C 3 606 ? 46.768 19.320  12.412  1.00 22.68 ? 612  THR A CB    1 
ATOM   5056 O  OG1   . THR C 3 606 ? 46.821 20.524  13.185  1.00 22.78 ? 612  THR A OG1   1 
ATOM   5057 C  CG2   . THR C 3 606 ? 48.112 18.632  12.496  1.00 22.54 ? 612  THR A CG2   1 
ATOM   5058 N  N     . LEU C 3 607 ? 45.361 17.580  10.322  1.00 24.84 ? 613  LEU A N     1 
ATOM   5059 C  CA    . LEU C 3 607 ? 45.209 16.333  9.583   1.00 25.20 ? 613  LEU A CA    1 
ATOM   5060 C  C     . LEU C 3 607 ? 45.165 16.502  8.061   1.00 24.65 ? 613  LEU A C     1 
ATOM   5061 O  O     . LEU C 3 607 ? 45.855 15.796  7.334   1.00 25.66 ? 613  LEU A O     1 
ATOM   5062 C  CB    . LEU C 3 607 ? 43.935 15.609  10.027  1.00 24.66 ? 613  LEU A CB    1 
ATOM   5063 C  CG    . LEU C 3 607 ? 43.628 14.312  9.270   1.00 25.87 ? 613  LEU A CG    1 
ATOM   5064 C  CD1   . LEU C 3 607 ? 44.632 13.231  9.692   1.00 24.60 ? 613  LEU A CD1   1 
ATOM   5065 C  CD2   . LEU C 3 607 ? 42.194 13.857  9.563   1.00 24.55 ? 613  LEU A CD2   1 
ATOM   5066 N  N     . LEU C 3 608 ? 44.345 17.434  7.586   1.00 24.31 ? 614  LEU A N     1 
ATOM   5067 C  CA    . LEU C 3 608 ? 44.180 17.656  6.151   1.00 22.24 ? 614  LEU A CA    1 
ATOM   5068 C  C     . LEU C 3 608 ? 45.308 18.442  5.475   1.00 21.43 ? 614  LEU A C     1 
ATOM   5069 O  O     . LEU C 3 608 ? 45.710 18.112  4.363   1.00 20.27 ? 614  LEU A O     1 
ATOM   5070 C  CB    . LEU C 3 608 ? 42.836 18.344  5.895   1.00 23.89 ? 614  LEU A CB    1 
ATOM   5071 C  CG    . LEU C 3 608 ? 41.630 17.623  6.504   1.00 24.63 ? 614  LEU A CG    1 
ATOM   5072 C  CD1   . LEU C 3 608 ? 40.360 18.424  6.262   1.00 26.76 ? 614  LEU A CD1   1 
ATOM   5073 C  CD2   . LEU C 3 608 ? 41.507 16.241  5.900   1.00 24.51 ? 614  LEU A CD2   1 
ATOM   5074 N  N     . GLN C 3 609 ? 45.817 19.479  6.134   1.00 21.11 ? 615  GLN A N     1 
ATOM   5075 C  CA    . GLN C 3 609 ? 46.902 20.258  5.543   1.00 20.50 ? 615  GLN A CA    1 
ATOM   5076 C  C     . GLN C 3 609 ? 48.158 19.382  5.461   1.00 20.91 ? 615  GLN A C     1 
ATOM   5077 O  O     . GLN C 3 609 ? 48.917 19.458  4.491   1.00 22.24 ? 615  GLN A O     1 
ATOM   5078 C  CB    . GLN C 3 609 ? 47.198 21.514  6.376   1.00 19.01 ? 615  GLN A CB    1 
ATOM   5079 C  CG    . GLN C 3 609 ? 48.112 22.511  5.676   1.00 19.35 ? 615  GLN A CG    1 
ATOM   5080 C  CD    . GLN C 3 609 ? 48.522 23.680  6.564   1.00 21.15 ? 615  GLN A CD    1 
ATOM   5081 O  OE1   . GLN C 3 609 ? 49.575 23.646  7.211   1.00 20.55 ? 615  GLN A OE1   1 
ATOM   5082 N  NE2   . GLN C 3 609 ? 47.683 24.715  6.610   1.00 19.38 ? 615  GLN A NE2   1 
ATOM   5083 N  N     . SER C 3 610 ? 48.374 18.551  6.480   1.00 21.32 ? 616  SER A N     1 
ATOM   5084 C  CA    . SER C 3 610 ? 49.540 17.668  6.497   1.00 22.38 ? 616  SER A CA    1 
ATOM   5085 C  C     . SER C 3 610 ? 49.448 16.623  5.394   1.00 23.14 ? 616  SER A C     1 
ATOM   5086 O  O     . SER C 3 610 ? 50.419 16.389  4.662   1.00 22.46 ? 616  SER A O     1 
ATOM   5087 C  CB    . SER C 3 610 ? 49.672 16.959  7.838   1.00 22.57 ? 616  SER A CB    1 
ATOM   5088 O  OG    . SER C 3 610 ? 50.806 16.110  7.822   1.00 24.52 ? 616  SER A OG    1 
ATOM   5089 N  N     . ALA C 3 611 ? 48.278 15.990  5.290   1.00 23.05 ? 617  ALA A N     1 
ATOM   5090 C  CA    . ALA C 3 611 ? 48.052 14.983  4.258   1.00 22.66 ? 617  ALA A CA    1 
ATOM   5091 C  C     . ALA C 3 611 ? 48.317 15.638  2.906   1.00 20.45 ? 617  ALA A C     1 
ATOM   5092 O  O     . ALA C 3 611 ? 49.088 15.122  2.093   1.00 21.04 ? 617  ALA A O     1 
ATOM   5093 C  CB    . ALA C 3 611 ? 46.606 14.460  4.324   1.00 23.78 ? 617  ALA A CB    1 
ATOM   5094 N  N     . GLY C 3 612 ? 47.687 16.786  2.682   1.00 19.27 ? 618  GLY A N     1 
ATOM   5095 C  CA    . GLY C 3 612 ? 47.872 17.509  1.431   1.00 20.69 ? 618  GLY A CA    1 
ATOM   5096 C  C     . GLY C 3 612 ? 49.325 17.901  1.180   1.00 21.12 ? 618  GLY A C     1 
ATOM   5097 O  O     . GLY C 3 612 ? 49.804 17.846  0.047   1.00 21.44 ? 618  GLY A O     1 
ATOM   5098 N  N     . ALA C 3 613 ? 50.026 18.296  2.240   1.00 20.53 ? 619  ALA A N     1 
ATOM   5099 C  CA    . ALA C 3 613 ? 51.431 18.676  2.139   1.00 21.73 ? 619  ALA A CA    1 
ATOM   5100 C  C     . ALA C 3 613 ? 52.317 17.474  1.816   1.00 23.32 ? 619  ALA A C     1 
ATOM   5101 O  O     . ALA C 3 613 ? 53.236 17.574  0.999   1.00 23.35 ? 619  ALA A O     1 
ATOM   5102 C  CB    . ALA C 3 613 ? 51.893 19.316  3.441   1.00 20.83 ? 619  ALA A CB    1 
ATOM   5103 N  N     . LEU C 3 614 ? 52.048 16.336  2.451   1.00 23.13 ? 620  LEU A N     1 
ATOM   5104 C  CA    . LEU C 3 614 ? 52.858 15.149  2.193   1.00 22.98 ? 620  LEU A CA    1 
ATOM   5105 C  C     . LEU C 3 614 ? 52.592 14.602  0.793   1.00 23.80 ? 620  LEU A C     1 
ATOM   5106 O  O     . LEU C 3 614 ? 53.502 14.132  0.111   1.00 23.85 ? 620  LEU A O     1 
ATOM   5107 C  CB    . LEU C 3 614 ? 52.604 14.077  3.262   1.00 22.23 ? 620  LEU A CB    1 
ATOM   5108 C  CG    . LEU C 3 614 ? 52.931 14.492  4.707   1.00 22.27 ? 620  LEU A CG    1 
ATOM   5109 C  CD1   . LEU C 3 614 ? 53.025 13.251  5.588   1.00 23.79 ? 620  LEU A CD1   1 
ATOM   5110 C  CD2   . LEU C 3 614 ? 54.248 15.249  4.755   1.00 21.58 ? 620  LEU A CD2   1 
ATOM   5111 N  N     . ILE C 3 615 ? 51.343 14.684  0.357   1.00 23.97 ? 621  ILE A N     1 
ATOM   5112 C  CA    . ILE C 3 615 ? 50.986 14.223  -0.972  1.00 23.25 ? 621  ILE A CA    1 
ATOM   5113 C  C     . ILE C 3 615 ? 51.767 15.044  -1.996  1.00 24.11 ? 621  ILE A C     1 
ATOM   5114 O  O     . ILE C 3 615 ? 52.413 14.498  -2.896  1.00 24.00 ? 621  ILE A O     1 
ATOM   5115 C  CB    . ILE C 3 615 ? 49.458 14.374  -1.211  1.00 22.81 ? 621  ILE A CB    1 
ATOM   5116 C  CG1   . ILE C 3 615 ? 48.714 13.235  -0.499  1.00 23.25 ? 621  ILE A CG1   1 
ATOM   5117 C  CG2   . ILE C 3 615 ? 49.149 14.406  -2.703  1.00 22.58 ? 621  ILE A CG2   1 
ATOM   5118 C  CD1   . ILE C 3 615 ? 47.198 13.289  -0.625  1.00 18.30 ? 621  ILE A CD1   1 
ATOM   5119 N  N     . CYS C 3 616 ? 51.732 16.360  -1.840  1.00 24.36 ? 622  CYS A N     1 
ATOM   5120 C  CA    . CYS C 3 616 ? 52.427 17.241  -2.776  1.00 25.57 ? 622  CYS A CA    1 
ATOM   5121 C  C     . CYS C 3 616 ? 53.935 17.090  -2.764  1.00 24.80 ? 622  CYS A C     1 
ATOM   5122 O  O     . CYS C 3 616 ? 54.588 17.266  -3.796  1.00 26.90 ? 622  CYS A O     1 
ATOM   5123 C  CB    . CYS C 3 616 ? 52.069 18.701  -2.500  1.00 25.51 ? 622  CYS A CB    1 
ATOM   5124 S  SG    . CYS C 3 616 ? 50.357 19.066  -2.861  1.00 27.17 ? 622  CYS A SG    1 
ATOM   5125 N  N     . LYS C 3 617 ? 54.487 16.767  -1.602  1.00 24.07 ? 623  LYS A N     1 
ATOM   5126 C  CA    . LYS C 3 617 ? 55.925 16.603  -1.474  1.00 24.38 ? 623  LYS A CA    1 
ATOM   5127 C  C     . LYS C 3 617 ? 56.384 15.342  -2.224  1.00 24.49 ? 623  LYS A C     1 
ATOM   5128 O  O     . LYS C 3 617 ? 57.331 15.381  -3.012  1.00 24.85 ? 623  LYS A O     1 
ATOM   5129 C  CB    . LYS C 3 617 ? 56.299 16.541  0.009   1.00 24.21 ? 623  LYS A CB    1 
ATOM   5130 C  CG    . LYS C 3 617 ? 57.748 16.851  0.316   1.00 24.40 ? 623  LYS A CG    1 
ATOM   5131 C  CD    . LYS C 3 617 ? 58.002 16.981  1.817   1.00 23.90 ? 623  LYS A CD    1 
ATOM   5132 C  CE    . LYS C 3 617 ? 57.545 18.330  2.366   1.00 26.02 ? 623  LYS A CE    1 
ATOM   5133 N  NZ    . LYS C 3 617 ? 57.919 18.522  3.808   1.00 24.37 ? 623  LYS A NZ    1 
ATOM   5134 N  N     . LEU C 3 618 ? 55.705 14.226  -1.992  1.00 24.53 ? 624  LEU A N     1 
ATOM   5135 C  CA    . LEU C 3 618 ? 56.059 12.989  -2.674  1.00 22.83 ? 624  LEU A CA    1 
ATOM   5136 C  C     . LEU C 3 618 ? 55.795 13.229  -4.161  1.00 21.65 ? 624  LEU A C     1 
ATOM   5137 O  O     . LEU C 3 618 ? 56.501 12.722  -5.031  1.00 21.49 ? 624  LEU A O     1 
ATOM   5138 C  CB    . LEU C 3 618 ? 55.189 11.838  -2.160  1.00 24.24 ? 624  LEU A CB    1 
ATOM   5139 C  CG    . LEU C 3 618 ? 55.720 10.405  -2.299  1.00 25.57 ? 624  LEU A CG    1 
ATOM   5140 C  CD1   . LEU C 3 618 ? 54.644 9.423   -1.860  1.00 26.06 ? 624  LEU A CD1   1 
ATOM   5141 C  CD2   . LEU C 3 618 ? 56.120 10.125  -3.719  1.00 28.91 ? 624  LEU A CD2   1 
ATOM   5142 N  N     . TRP C 3 619 ? 54.771 14.025  -4.438  1.00 20.77 ? 625  TRP A N     1 
ATOM   5143 C  CA    . TRP C 3 619 ? 54.389 14.362  -5.803  1.00 20.66 ? 625  TRP A CA    1 
ATOM   5144 C  C     . TRP C 3 619 ? 55.479 15.073  -6.621  1.00 20.71 ? 625  TRP A C     1 
ATOM   5145 O  O     . TRP C 3 619 ? 55.787 14.656  -7.741  1.00 21.42 ? 625  TRP A O     1 
ATOM   5146 C  CB    . TRP C 3 619 ? 53.128 15.228  -5.778  1.00 21.67 ? 625  TRP A CB    1 
ATOM   5147 C  CG    . TRP C 3 619 ? 52.737 15.764  -7.114  1.00 21.39 ? 625  TRP A CG    1 
ATOM   5148 C  CD1   . TRP C 3 619 ? 52.519 15.047  -8.255  1.00 20.23 ? 625  TRP A CD1   1 
ATOM   5149 C  CD2   . TRP C 3 619 ? 52.496 17.135  -7.449  1.00 21.25 ? 625  TRP A CD2   1 
ATOM   5150 N  NE1   . TRP C 3 619 ? 52.155 15.886  -9.279  1.00 21.10 ? 625  TRP A NE1   1 
ATOM   5151 C  CE2   . TRP C 3 619 ? 52.133 17.173  -8.814  1.00 21.22 ? 625  TRP A CE2   1 
ATOM   5152 C  CE3   . TRP C 3 619 ? 52.550 18.334  -6.728  1.00 19.86 ? 625  TRP A CE3   1 
ATOM   5153 C  CZ2   . TRP C 3 619 ? 51.825 18.367  -9.477  1.00 20.74 ? 625  TRP A CZ2   1 
ATOM   5154 C  CZ3   . TRP C 3 619 ? 52.241 19.526  -7.387  1.00 20.80 ? 625  TRP A CZ3   1 
ATOM   5155 C  CH2   . TRP C 3 619 ? 51.883 19.532  -8.748  1.00 22.73 ? 625  TRP A CH2   1 
ATOM   5156 N  N     . ILE C 3 620 ? 56.057 16.147  -6.086  1.00 21.15 ? 626  ILE A N     1 
ATOM   5157 C  CA    . ILE C 3 620 ? 57.090 16.863  -6.839  1.00 21.74 ? 626  ILE A CA    1 
ATOM   5158 C  C     . ILE C 3 620 ? 58.319 15.994  -7.025  1.00 22.81 ? 626  ILE A C     1 
ATOM   5159 O  O     . ILE C 3 620 ? 59.036 16.119  -8.015  1.00 23.61 ? 626  ILE A O     1 
ATOM   5160 C  CB    . ILE C 3 620 ? 57.502 18.188  -6.159  1.00 21.71 ? 626  ILE A CB    1 
ATOM   5161 C  CG1   . ILE C 3 620 ? 58.155 17.926  -4.804  1.00 21.06 ? 626  ILE A CG1   1 
ATOM   5162 C  CG2   . ILE C 3 620 ? 56.284 19.077  -6.006  1.00 21.19 ? 626  ILE A CG2   1 
ATOM   5163 C  CD1   . ILE C 3 620 ? 58.739 19.191  -4.165  1.00 21.90 ? 626  ILE A CD1   1 
ATOM   5164 N  N     . ILE C 3 621 ? 58.540 15.093  -6.075  1.00 22.84 ? 627  ILE A N     1 
ATOM   5165 C  CA    . ILE C 3 621 ? 59.670 14.182  -6.130  1.00 22.80 ? 627  ILE A CA    1 
ATOM   5166 C  C     . ILE C 3 621 ? 59.452 13.154  -7.238  1.00 23.08 ? 627  ILE A C     1 
ATOM   5167 O  O     . ILE C 3 621 ? 60.328 12.919  -8.073  1.00 20.58 ? 627  ILE A O     1 
ATOM   5168 C  CB    . ILE C 3 621 ? 59.830 13.431  -4.796  1.00 23.40 ? 627  ILE A CB    1 
ATOM   5169 C  CG1   . ILE C 3 621 ? 60.304 14.392  -3.704  1.00 23.63 ? 627  ILE A CG1   1 
ATOM   5170 C  CG2   . ILE C 3 621 ? 60.797 12.265  -4.974  1.00 24.54 ? 627  ILE A CG2   1 
ATOM   5171 C  CD1   . ILE C 3 621 ? 60.219 13.819  -2.292  1.00 22.96 ? 627  ILE A CD1   1 
ATOM   5172 N  N     . LYS C 3 622 ? 58.271 12.546  -7.229  1.00 23.88 ? 628  LYS A N     1 
ATOM   5173 C  CA    . LYS C 3 622 ? 57.932 11.529  -8.212  1.00 24.29 ? 628  LYS A CA    1 
ATOM   5174 C  C     . LYS C 3 622 ? 57.873 12.139  -9.598  1.00 24.11 ? 628  LYS A C     1 
ATOM   5175 O  O     . LYS C 3 622 ? 58.219 11.492  -10.584 1.00 24.20 ? 628  LYS A O     1 
ATOM   5176 C  CB    . LYS C 3 622 ? 56.590 10.881  -7.867  1.00 25.58 ? 628  LYS A CB    1 
ATOM   5177 C  CG    . LYS C 3 622 ? 56.253 9.664   -8.722  1.00 29.87 ? 628  LYS A CG    1 
ATOM   5178 C  CD    . LYS C 3 622 ? 57.240 8.513   -8.492  1.00 29.78 ? 628  LYS A CD    1 
ATOM   5179 C  CE    . LYS C 3 622 ? 56.905 7.325   -9.390  1.00 33.51 ? 628  LYS A CE    1 
ATOM   5180 N  NZ    . LYS C 3 622 ? 57.846 6.170   -9.232  1.00 35.90 ? 628  LYS A NZ    1 
ATOM   5181 N  N     . THR C 3 623 ? 57.450 13.395  -9.674  1.00 23.56 ? 629  THR A N     1 
ATOM   5182 C  CA    . THR C 3 623 ? 57.366 14.057  -10.962 1.00 23.65 ? 629  THR A CA    1 
ATOM   5183 C  C     . THR C 3 623 ? 58.733 14.166  -11.622 1.00 23.58 ? 629  THR A C     1 
ATOM   5184 O  O     . THR C 3 623 ? 58.906 13.754  -12.773 1.00 22.47 ? 629  THR A O     1 
ATOM   5185 C  CB    . THR C 3 623 ? 56.769 15.468  -10.837 1.00 24.99 ? 629  THR A CB    1 
ATOM   5186 O  OG1   . THR C 3 623 ? 55.415 15.373  -10.384 1.00 25.50 ? 629  THR A OG1   1 
ATOM   5187 C  CG2   . THR C 3 623 ? 56.810 16.184  -12.183 1.00 23.94 ? 629  THR A CG2   1 
ATOM   5188 N  N     . GLU C 3 624 ? 59.705 14.709  -10.894 1.00 23.63 ? 630  GLU A N     1 
ATOM   5189 C  CA    . GLU C 3 624 ? 61.041 14.871  -11.453 1.00 25.45 ? 630  GLU A CA    1 
ATOM   5190 C  C     . GLU C 3 624 ? 61.684 13.526  -11.768 1.00 26.41 ? 630  GLU A C     1 
ATOM   5191 O  O     . GLU C 3 624 ? 62.363 13.375  -12.786 1.00 25.63 ? 630  GLU A O     1 
ATOM   5192 C  CB    . GLU C 3 624 ? 61.960 15.644  -10.502 1.00 26.45 ? 630  GLU A CB    1 
ATOM   5193 C  CG    . GLU C 3 624 ? 63.334 15.862  -11.113 1.00 28.98 ? 630  GLU A CG    1 
ATOM   5194 C  CD    . GLU C 3 624 ? 64.469 15.698  -10.131 1.00 27.95 ? 630  GLU A CD    1 
ATOM   5195 O  OE1   . GLU C 3 624 ? 64.400 14.804  -9.273  1.00 27.70 ? 630  GLU A OE1   1 
ATOM   5196 O  OE2   . GLU C 3 624 ? 65.452 16.453  -10.233 1.00 30.11 ? 630  GLU A OE2   1 
ATOM   5197 N  N     . GLU C 3 625 ? 61.471 12.555  -10.887 1.00 26.61 ? 631  GLU A N     1 
ATOM   5198 C  CA    . GLU C 3 625 ? 62.025 11.224  -11.076 1.00 28.27 ? 631  GLU A CA    1 
ATOM   5199 C  C     . GLU C 3 625 ? 61.514 10.599  -12.381 1.00 27.97 ? 631  GLU A C     1 
ATOM   5200 O  O     . GLU C 3 625 ? 62.261 9.931   -13.101 1.00 27.10 ? 631  GLU A O     1 
ATOM   5201 C  CB    . GLU C 3 625 ? 61.678 10.354  -9.863  1.00 30.23 ? 631  GLU A CB    1 
ATOM   5202 C  CG    . GLU C 3 625 ? 62.003 8.886   -10.003 1.00 36.58 ? 631  GLU A CG    1 
ATOM   5203 C  CD    . GLU C 3 625 ? 62.161 8.189   -8.652  1.00 41.05 ? 631  GLU A CD    1 
ATOM   5204 O  OE1   . GLU C 3 625 ? 61.363 8.471   -7.722  1.00 41.10 ? 631  GLU A OE1   1 
ATOM   5205 O  OE2   . GLU C 3 625 ? 63.088 7.351   -8.531  1.00 42.70 ? 631  GLU A OE2   1 
ATOM   5206 N  N     . MET C 3 626 ? 60.247 10.835  -12.697 1.00 27.43 ? 632  MET A N     1 
ATOM   5207 C  CA    . MET C 3 626 ? 59.678 10.293  -13.923 1.00 28.85 ? 632  MET A CA    1 
ATOM   5208 C  C     . MET C 3 626 ? 60.203 11.030  -15.158 1.00 28.70 ? 632  MET A C     1 
ATOM   5209 O  O     . MET C 3 626 ? 60.418 10.420  -16.205 1.00 28.56 ? 632  MET A O     1 
ATOM   5210 C  CB    . MET C 3 626 ? 58.152 10.356  -13.872 1.00 29.61 ? 632  MET A CB    1 
ATOM   5211 C  CG    . MET C 3 626 ? 57.524 9.277   -12.989 1.00 29.49 ? 632  MET A CG    1 
ATOM   5212 S  SD    . MET C 3 626 ? 55.747 9.541   -12.715 1.00 33.51 ? 632  MET A SD    1 
ATOM   5213 C  CE    . MET C 3 626 ? 55.160 9.542   -14.378 1.00 33.13 ? 632  MET A CE    1 
ATOM   5214 N  N     . LEU C 3 627 ? 60.420 12.337  -15.033 1.00 28.25 ? 633  LEU A N     1 
ATOM   5215 C  CA    . LEU C 3 627 ? 60.941 13.116  -16.152 1.00 27.80 ? 633  LEU A CA    1 
ATOM   5216 C  C     . LEU C 3 627 ? 62.344 12.623  -16.508 1.00 28.59 ? 633  LEU A C     1 
ATOM   5217 O  O     . LEU C 3 627 ? 62.700 12.515  -17.684 1.00 27.15 ? 633  LEU A O     1 
ATOM   5218 C  CB    . LEU C 3 627 ? 60.999 14.603  -15.794 1.00 26.34 ? 633  LEU A CB    1 
ATOM   5219 C  CG    . LEU C 3 627 ? 59.661 15.323  -15.616 1.00 24.66 ? 633  LEU A CG    1 
ATOM   5220 C  CD1   . LEU C 3 627 ? 59.916 16.785  -15.270 1.00 22.52 ? 633  LEU A CD1   1 
ATOM   5221 C  CD2   . LEU C 3 627 ? 58.846 15.202  -16.889 1.00 22.17 ? 633  LEU A CD2   1 
ATOM   5222 N  N     . VAL C 3 628 ? 63.129 12.327  -15.476 1.00 29.65 ? 634  VAL A N     1 
ATOM   5223 C  CA    . VAL C 3 628 ? 64.488 11.847  -15.646 1.00 30.92 ? 634  VAL A CA    1 
ATOM   5224 C  C     . VAL C 3 628 ? 64.519 10.415  -16.177 1.00 32.57 ? 634  VAL A C     1 
ATOM   5225 O  O     . VAL C 3 628 ? 65.446 10.040  -16.898 1.00 34.29 ? 634  VAL A O     1 
ATOM   5226 C  CB    . VAL C 3 628 ? 65.265 11.931  -14.310 1.00 31.11 ? 634  VAL A CB    1 
ATOM   5227 C  CG1   . VAL C 3 628 ? 66.619 11.249  -14.437 1.00 32.71 ? 634  VAL A CG1   1 
ATOM   5228 C  CG2   . VAL C 3 628 ? 65.463 13.387  -13.927 1.00 30.82 ? 634  VAL A CG2   1 
ATOM   5229 N  N     . GLU C 3 629 ? 63.514 9.615   -15.825 1.00 33.52 ? 635  GLU A N     1 
ATOM   5230 C  CA    . GLU C 3 629 ? 63.451 8.237   -16.299 1.00 34.13 ? 635  GLU A CA    1 
ATOM   5231 C  C     . GLU C 3 629 ? 63.102 8.232   -17.782 1.00 33.87 ? 635  GLU A C     1 
ATOM   5232 O  O     . GLU C 3 629 ? 63.357 7.258   -18.486 1.00 34.42 ? 635  GLU A O     1 
ATOM   5233 C  CB    . GLU C 3 629 ? 62.419 7.430   -15.499 1.00 35.69 ? 635  GLU A CB    1 
ATOM   5234 C  CG    . GLU C 3 629 ? 62.911 7.059   -14.097 1.00 41.90 ? 635  GLU A CG    1 
ATOM   5235 C  CD    . GLU C 3 629 ? 61.867 6.337   -13.241 1.00 44.72 ? 635  GLU A CD    1 
ATOM   5236 O  OE1   . GLU C 3 629 ? 62.249 5.795   -12.176 1.00 44.16 ? 635  GLU A OE1   1 
ATOM   5237 O  OE2   . GLU C 3 629 ? 60.673 6.317   -13.622 1.00 46.22 ? 635  GLU A OE2   1 
ATOM   5238 N  N     . LYS C 3 630 ? 62.518 9.328   -18.250 1.00 32.47 ? 636  LYS A N     1 
ATOM   5239 C  CA    . LYS C 3 630 ? 62.163 9.456   -19.652 1.00 31.88 ? 636  LYS A CA    1 
ATOM   5240 C  C     . LYS C 3 630 ? 63.360 10.003  -20.422 1.00 31.37 ? 636  LYS A C     1 
ATOM   5241 O  O     . LYS C 3 630 ? 63.314 10.137  -21.641 1.00 30.95 ? 636  LYS A O     1 
ATOM   5242 C  CB    . LYS C 3 630 ? 60.958 10.385  -19.820 1.00 30.68 ? 636  LYS A CB    1 
ATOM   5243 C  CG    . LYS C 3 630 ? 59.697 9.831   -19.185 1.00 32.25 ? 636  LYS A CG    1 
ATOM   5244 C  CD    . LYS C 3 630 ? 58.491 10.708  -19.455 1.00 32.09 ? 636  LYS A CD    1 
ATOM   5245 C  CE    . LYS C 3 630 ? 57.227 10.066  -18.911 1.00 30.54 ? 636  LYS A CE    1 
ATOM   5246 N  NZ    . LYS C 3 630 ? 56.003 10.821  -19.298 1.00 31.94 ? 636  LYS A NZ    1 
ATOM   5247 N  N     . GLY C 3 631 ? 64.434 10.307  -19.698 1.00 30.70 ? 637  GLY A N     1 
ATOM   5248 C  CA    . GLY C 3 631 ? 65.631 10.826  -20.335 1.00 30.89 ? 637  GLY A CA    1 
ATOM   5249 C  C     . GLY C 3 631 ? 65.816 12.337  -20.281 1.00 31.71 ? 637  GLY A C     1 
ATOM   5250 O  O     . GLY C 3 631 ? 66.846 12.848  -20.724 1.00 31.44 ? 637  GLY A O     1 
ATOM   5251 N  N     . LEU C 3 632 ? 64.833 13.058  -19.747 1.00 30.12 ? 638  LEU A N     1 
ATOM   5252 C  CA    . LEU C 3 632 ? 64.934 14.511  -19.649 1.00 29.14 ? 638  LEU A CA    1 
ATOM   5253 C  C     . LEU C 3 632 ? 65.955 14.917  -18.584 1.00 28.80 ? 638  LEU A C     1 
ATOM   5254 O  O     . LEU C 3 632 ? 66.067 14.273  -17.539 1.00 28.60 ? 638  LEU A O     1 
ATOM   5255 C  CB    . LEU C 3 632 ? 63.564 15.107  -19.319 1.00 30.63 ? 638  LEU A CB    1 
ATOM   5256 C  CG    . LEU C 3 632 ? 62.550 15.150  -20.463 1.00 31.24 ? 638  LEU A CG    1 
ATOM   5257 C  CD1   . LEU C 3 632 ? 62.466 13.796  -21.134 1.00 34.75 ? 638  LEU A CD1   1 
ATOM   5258 C  CD2   . LEU C 3 632 ? 61.200 15.563  -19.923 1.00 31.96 ? 638  LEU A CD2   1 
ATOM   5259 N  N     . LYS C 3 633 ? 66.696 15.985  -18.855 1.00 27.61 ? 639  LYS A N     1 
ATOM   5260 C  CA    . LYS C 3 633 ? 67.719 16.471  -17.931 1.00 27.36 ? 639  LYS A CA    1 
ATOM   5261 C  C     . LYS C 3 633 ? 67.330 17.741  -17.162 1.00 25.94 ? 639  LYS A C     1 
ATOM   5262 O  O     . LYS C 3 633 ? 66.900 18.735  -17.751 1.00 23.65 ? 639  LYS A O     1 
ATOM   5263 C  CB    . LYS C 3 633 ? 69.022 16.724  -18.690 1.00 29.90 ? 639  LYS A CB    1 
ATOM   5264 C  CG    . LYS C 3 633 ? 70.105 17.390  -17.856 1.00 34.66 ? 639  LYS A CG    1 
ATOM   5265 C  CD    . LYS C 3 633 ? 71.381 17.610  -18.664 1.00 37.08 ? 639  LYS A CD    1 
ATOM   5266 C  CE    . LYS C 3 633 ? 72.383 18.439  -17.873 1.00 38.70 ? 639  LYS A CE    1 
ATOM   5267 N  NZ    . LYS C 3 633 ? 72.604 17.903  -16.490 1.00 42.25 ? 639  LYS A NZ    1 
ATOM   5268 N  N     . HIS C 3 634 ? 67.517 17.700  -15.845 1.00 24.15 ? 640  HIS A N     1 
ATOM   5269 C  CA    . HIS C 3 634 ? 67.185 18.824  -14.979 1.00 22.81 ? 640  HIS A CA    1 
ATOM   5270 C  C     . HIS C 3 634 ? 68.283 19.893  -14.923 1.00 22.53 ? 640  HIS A C     1 
ATOM   5271 O  O     . HIS C 3 634 ? 69.353 19.666  -14.357 1.00 23.52 ? 640  HIS A O     1 
ATOM   5272 C  CB    . HIS C 3 634 ? 66.887 18.313  -13.568 1.00 19.98 ? 640  HIS A CB    1 
ATOM   5273 C  CG    . HIS C 3 634 ? 66.170 19.305  -12.707 1.00 19.25 ? 640  HIS A CG    1 
ATOM   5274 N  ND1   . HIS C 3 634 ? 65.476 18.941  -11.573 1.00 18.01 ? 640  HIS A ND1   1 
ATOM   5275 C  CD2   . HIS C 3 634 ? 65.999 20.642  -12.839 1.00 18.96 ? 640  HIS A CD2   1 
ATOM   5276 C  CE1   . HIS C 3 634 ? 64.903 20.008  -11.049 1.00 18.42 ? 640  HIS A CE1   1 
ATOM   5277 N  NE2   . HIS C 3 634 ? 65.203 21.054  -11.798 1.00 20.80 ? 640  HIS A NE2   1 
ATOM   5278 N  N     . GLY C 3 635 ? 68.000 21.055  -15.509 1.00 22.51 ? 641  GLY A N     1 
ATOM   5279 C  CA    . GLY C 3 635 ? 68.953 22.154  -15.514 1.00 21.89 ? 641  GLY A CA    1 
ATOM   5280 C  C     . GLY C 3 635 ? 68.783 23.099  -16.696 1.00 21.56 ? 641  GLY A C     1 
ATOM   5281 O  O     . GLY C 3 635 ? 68.214 22.723  -17.721 1.00 21.94 ? 641  GLY A O     1 
ATOM   5282 N  N     . TRP C 3 636 ? 69.276 24.328  -16.561 1.00 22.78 ? 642  TRP A N     1 
ATOM   5283 C  CA    . TRP C 3 636 ? 69.188 25.312  -17.639 1.00 23.65 ? 642  TRP A CA    1 
ATOM   5284 C  C     . TRP C 3 636 ? 69.995 24.841  -18.850 1.00 24.65 ? 642  TRP A C     1 
ATOM   5285 O  O     . TRP C 3 636 ? 69.755 25.269  -19.982 1.00 25.68 ? 642  TRP A O     1 
ATOM   5286 C  CB    . TRP C 3 636 ? 69.713 26.673  -17.171 1.00 23.11 ? 642  TRP A CB    1 
ATOM   5287 C  CG    . TRP C 3 636 ? 68.883 27.317  -16.083 1.00 25.42 ? 642  TRP A CG    1 
ATOM   5288 C  CD1   . TRP C 3 636 ? 69.321 27.732  -14.858 1.00 24.01 ? 642  TRP A CD1   1 
ATOM   5289 C  CD2   . TRP C 3 636 ? 67.479 27.633  -16.133 1.00 24.24 ? 642  TRP A CD2   1 
ATOM   5290 N  NE1   . TRP C 3 636 ? 68.283 28.288  -14.144 1.00 25.37 ? 642  TRP A NE1   1 
ATOM   5291 C  CE2   . TRP C 3 636 ? 67.142 28.239  -14.900 1.00 23.95 ? 642  TRP A CE2   1 
ATOM   5292 C  CE3   . TRP C 3 636 ? 66.477 27.463  -17.099 1.00 22.74 ? 642  TRP A CE3   1 
ATOM   5293 C  CZ2   . TRP C 3 636 ? 65.844 28.676  -14.606 1.00 23.79 ? 642  TRP A CZ2   1 
ATOM   5294 C  CZ3   . TRP C 3 636 ? 65.184 27.899  -16.807 1.00 22.99 ? 642  TRP A CZ3   1 
ATOM   5295 C  CH2   . TRP C 3 636 ? 64.880 28.498  -15.571 1.00 22.94 ? 642  TRP A CH2   1 
ATOM   5296 N  N     . ASP C 3 637 ? 70.964 23.967  -18.607 1.00 24.79 ? 643  ASP A N     1 
ATOM   5297 C  CA    . ASP C 3 637 ? 71.788 23.431  -19.682 1.00 25.96 ? 643  ASP A CA    1 
ATOM   5298 C  C     . ASP C 3 637 ? 71.225 22.067  -20.064 1.00 25.86 ? 643  ASP A C     1 
ATOM   5299 O  O     . ASP C 3 637 ? 71.944 21.195  -20.557 1.00 26.05 ? 643  ASP A O     1 
ATOM   5300 C  CB    . ASP C 3 637 ? 73.242 23.300  -19.216 1.00 26.56 ? 643  ASP A CB    1 
ATOM   5301 C  CG    . ASP C 3 637 ? 73.389 22.418  -17.974 1.00 30.98 ? 643  ASP A CG    1 
ATOM   5302 O  OD1   . ASP C 3 637 ? 72.358 21.996  -17.400 1.00 29.29 ? 643  ASP A OD1   1 
ATOM   5303 O  OD2   . ASP C 3 637 ? 74.546 22.156  -17.570 1.00 31.90 ? 643  ASP A OD2   1 
ATOM   5304 N  N     . GLY C 3 638 ? 69.926 21.898  -19.819 1.00 26.36 ? 644  GLY A N     1 
ATOM   5305 C  CA    . GLY C 3 638 ? 69.254 20.650  -20.118 1.00 25.49 ? 644  GLY A CA    1 
ATOM   5306 C  C     . GLY C 3 638 ? 67.899 20.822  -20.779 1.00 26.32 ? 644  GLY A C     1 
ATOM   5307 O  O     . GLY C 3 638 ? 67.789 21.514  -21.790 1.00 25.72 ? 644  GLY A O     1 
ATOM   5308 N  N     . ASP C 3 639 ? 66.865 20.209  -20.203 1.00 26.68 ? 645  ASP A N     1 
ATOM   5309 C  CA    . ASP C 3 639 ? 65.519 20.272  -20.775 1.00 26.78 ? 645  ASP A CA    1 
ATOM   5310 C  C     . ASP C 3 639 ? 64.451 20.965  -19.929 1.00 26.44 ? 645  ASP A C     1 
ATOM   5311 O  O     . ASP C 3 639 ? 63.530 21.571  -20.468 1.00 27.42 ? 645  ASP A O     1 
ATOM   5312 C  CB    . ASP C 3 639 ? 65.060 18.853  -21.123 1.00 26.91 ? 645  ASP A CB    1 
ATOM   5313 C  CG    . ASP C 3 639 ? 66.071 18.130  -21.976 1.00 27.67 ? 645  ASP A CG    1 
ATOM   5314 O  OD1   . ASP C 3 639 ? 66.364 18.641  -23.076 1.00 29.64 ? 645  ASP A OD1   1 
ATOM   5315 O  OD2   . ASP C 3 639 ? 66.589 17.073  -21.549 1.00 27.79 ? 645  ASP A OD2   1 
ATOM   5316 N  N     . PHE C 3 640 ? 64.563 20.875  -18.609 1.00 25.85 ? 646  PHE A N     1 
ATOM   5317 C  CA    . PHE C 3 640 ? 63.587 21.511  -17.737 1.00 24.11 ? 646  PHE A CA    1 
ATOM   5318 C  C     . PHE C 3 640 ? 64.250 21.968  -16.450 1.00 23.26 ? 646  PHE A C     1 
ATOM   5319 O  O     . PHE C 3 640 ? 65.343 21.514  -16.112 1.00 23.46 ? 646  PHE A O     1 
ATOM   5320 C  CB    . PHE C 3 640 ? 62.450 20.539  -17.396 1.00 23.74 ? 646  PHE A CB    1 
ATOM   5321 C  CG    . PHE C 3 640 ? 62.865 19.408  -16.486 1.00 23.55 ? 646  PHE A CG    1 
ATOM   5322 C  CD1   . PHE C 3 640 ? 63.409 18.235  -17.008 1.00 22.24 ? 646  PHE A CD1   1 
ATOM   5323 C  CD2   . PHE C 3 640 ? 62.744 19.533  -15.098 1.00 22.92 ? 646  PHE A CD2   1 
ATOM   5324 C  CE1   . PHE C 3 640 ? 63.831 17.197  -16.163 1.00 21.42 ? 646  PHE A CE1   1 
ATOM   5325 C  CE2   . PHE C 3 640 ? 63.161 18.507  -14.243 1.00 22.41 ? 646  PHE A CE2   1 
ATOM   5326 C  CZ    . PHE C 3 640 ? 63.708 17.334  -14.778 1.00 21.94 ? 646  PHE A CZ    1 
ATOM   5327 N  N     . ALA C 3 641 ? 63.579 22.860  -15.732 1.00 22.41 ? 647  ALA A N     1 
ATOM   5328 C  CA    . ALA C 3 641 ? 64.099 23.358  -14.465 1.00 23.28 ? 647  ALA A CA    1 
ATOM   5329 C  C     . ALA C 3 641 ? 62.990 23.836  -13.525 1.00 22.12 ? 647  ALA A C     1 
ATOM   5330 O  O     . ALA C 3 641 ? 62.176 24.682  -13.897 1.00 20.75 ? 647  ALA A O     1 
ATOM   5331 C  CB    . ALA C 3 641 ? 65.091 24.491  -14.717 1.00 22.44 ? 647  ALA A CB    1 
ATOM   5332 N  N     . TYR C 3 642 ? 62.948 23.273  -12.317 1.00 20.80 ? 648  TYR A N     1 
ATOM   5333 C  CA    . TYR C 3 642 ? 61.963 23.689  -11.314 1.00 19.90 ? 648  TYR A CA    1 
ATOM   5334 C  C     . TYR C 3 642 ? 62.300 25.143  -10.940 1.00 20.95 ? 648  TYR A C     1 
ATOM   5335 O  O     . TYR C 3 642 ? 63.449 25.446  -10.611 1.00 18.93 ? 648  TYR A O     1 
ATOM   5336 C  CB    . TYR C 3 642 ? 62.078 22.818  -10.059 1.00 20.57 ? 648  TYR A CB    1 
ATOM   5337 C  CG    . TYR C 3 642 ? 61.292 21.519  -10.074 1.00 22.69 ? 648  TYR A CG    1 
ATOM   5338 C  CD1   . TYR C 3 642 ? 61.266 20.702  -11.202 1.00 21.95 ? 648  TYR A CD1   1 
ATOM   5339 C  CD2   . TYR C 3 642 ? 60.609 21.089  -8.934  1.00 21.09 ? 648  TYR A CD2   1 
ATOM   5340 C  CE1   . TYR C 3 642 ? 60.588 19.501  -11.195 1.00 21.50 ? 648  TYR A CE1   1 
ATOM   5341 C  CE2   . TYR C 3 642 ? 59.933 19.889  -8.917  1.00 22.32 ? 648  TYR A CE2   1 
ATOM   5342 C  CZ    . TYR C 3 642 ? 59.925 19.097  -10.049 1.00 22.79 ? 648  TYR A CZ    1 
ATOM   5343 O  OH    . TYR C 3 642 ? 59.267 17.897  -10.031 1.00 21.76 ? 648  TYR A OH    1 
ATOM   5344 N  N     . MET C 3 643 ? 61.314 26.034  -10.988 1.00 20.29 ? 649  MET A N     1 
ATOM   5345 C  CA    . MET C 3 643 ? 61.554 27.433  -10.642 1.00 22.96 ? 649  MET A CA    1 
ATOM   5346 C  C     . MET C 3 643 ? 60.893 27.767  -9.308  1.00 24.36 ? 649  MET A C     1 
ATOM   5347 O  O     . MET C 3 643 ? 61.379 28.614  -8.556  1.00 25.02 ? 649  MET A O     1 
ATOM   5348 C  CB    . MET C 3 643 ? 61.018 28.361  -11.749 1.00 22.42 ? 649  MET A CB    1 
ATOM   5349 C  CG    . MET C 3 643 ? 61.513 27.991  -13.150 1.00 22.10 ? 649  MET A CG    1 
ATOM   5350 S  SD    . MET C 3 643 ? 60.924 29.067  -14.473 1.00 23.73 ? 649  MET A SD    1 
ATOM   5351 C  CE    . MET C 3 643 ? 59.136 28.734  -14.395 1.00 17.14 ? 649  MET A CE    1 
ATOM   5352 N  N     . ALA C 3 644 ? 59.787 27.091  -9.011  1.00 25.61 ? 650  ALA A N     1 
ATOM   5353 C  CA    . ALA C 3 644 ? 59.082 27.333  -7.763  1.00 25.98 ? 650  ALA A CA    1 
ATOM   5354 C  C     . ALA C 3 644 ? 58.085 26.250  -7.394  1.00 26.38 ? 650  ALA A C     1 
ATOM   5355 O  O     . ALA C 3 644 ? 57.498 25.593  -8.254  1.00 26.93 ? 650  ALA A O     1 
ATOM   5356 C  CB    . ALA C 3 644 ? 58.368 28.680  -7.823  1.00 28.31 ? 650  ALA A CB    1 
ATOM   5357 N  N     . TRP C 3 645 ? 57.905 26.085  -6.089  1.00 25.40 ? 651  TRP A N     1 
ATOM   5358 C  CA    . TRP C 3 645 ? 56.966 25.135  -5.526  1.00 23.15 ? 651  TRP A CA    1 
ATOM   5359 C  C     . TRP C 3 645 ? 56.156 25.897  -4.483  1.00 22.72 ? 651  TRP A C     1 
ATOM   5360 O  O     . TRP C 3 645 ? 56.674 26.262  -3.429  1.00 21.63 ? 651  TRP A O     1 
ATOM   5361 C  CB    . TRP C 3 645 ? 57.707 23.972  -4.868  1.00 22.59 ? 651  TRP A CB    1 
ATOM   5362 C  CG    . TRP C 3 645 ? 56.786 23.016  -4.188  1.00 19.83 ? 651  TRP A CG    1 
ATOM   5363 C  CD1   . TRP C 3 645 ? 55.595 22.567  -4.655  1.00 20.05 ? 651  TRP A CD1   1 
ATOM   5364 C  CD2   . TRP C 3 645 ? 56.986 22.386  -2.917  1.00 18.84 ? 651  TRP A CD2   1 
ATOM   5365 N  NE1   . TRP C 3 645 ? 55.031 21.695  -3.756  1.00 20.44 ? 651  TRP A NE1   1 
ATOM   5366 C  CE2   . TRP C 3 645 ? 55.865 21.566  -2.679  1.00 18.09 ? 651  TRP A CE2   1 
ATOM   5367 C  CE3   . TRP C 3 645 ? 58.002 22.440  -1.954  1.00 16.19 ? 651  TRP A CE3   1 
ATOM   5368 C  CZ2   . TRP C 3 645 ? 55.726 20.802  -1.517  1.00 16.99 ? 651  TRP A CZ2   1 
ATOM   5369 C  CZ3   . TRP C 3 645 ? 57.865 21.681  -0.793  1.00 17.59 ? 651  TRP A CZ3   1 
ATOM   5370 C  CH2   . TRP C 3 645 ? 56.734 20.874  -0.587  1.00 16.48 ? 651  TRP A CH2   1 
ATOM   5371 N  N     . VAL C 3 646 ? 54.887 26.137  -4.789  1.00 20.98 ? 652  VAL A N     1 
ATOM   5372 C  CA    . VAL C 3 646 ? 54.006 26.883  -3.898  1.00 20.19 ? 652  VAL A CA    1 
ATOM   5373 C  C     . VAL C 3 646 ? 52.908 26.001  -3.312  1.00 20.99 ? 652  VAL A C     1 
ATOM   5374 O  O     . VAL C 3 646 ? 51.755 26.065  -3.735  1.00 22.08 ? 652  VAL A O     1 
ATOM   5375 C  CB    . VAL C 3 646 ? 53.395 28.107  -4.659  1.00 19.94 ? 652  VAL A CB    1 
ATOM   5376 C  CG1   . VAL C 3 646 ? 52.461 28.908  -3.761  1.00 15.67 ? 652  VAL A CG1   1 
ATOM   5377 C  CG2   . VAL C 3 646 ? 54.529 28.998  -5.155  1.00 17.02 ? 652  VAL A CG2   1 
ATOM   5378 N  N     . HIS C 3 647 ? 53.298 25.181  -2.333  1.00 21.26 ? 653  HIS A N     1 
ATOM   5379 C  CA    . HIS C 3 647 ? 52.416 24.245  -1.621  1.00 20.12 ? 653  HIS A CA    1 
ATOM   5380 C  C     . HIS C 3 647 ? 51.867 23.113  -2.490  1.00 20.88 ? 653  HIS A C     1 
ATOM   5381 O  O     . HIS C 3 647 ? 52.355 21.985  -2.405  1.00 21.23 ? 653  HIS A O     1 
ATOM   5382 C  CB    . HIS C 3 647 ? 51.291 25.017  -0.931  1.00 18.87 ? 653  HIS A CB    1 
ATOM   5383 C  CG    . HIS C 3 647 ? 51.797 26.104  -0.034  1.00 19.65 ? 653  HIS A CG    1 
ATOM   5384 N  ND1   . HIS C 3 647 ? 52.566 25.849  1.081   1.00 18.33 ? 653  HIS A ND1   1 
ATOM   5385 C  CD2   . HIS C 3 647 ? 51.726 27.452  -0.139  1.00 19.71 ? 653  HIS A CD2   1 
ATOM   5386 C  CE1   . HIS C 3 647 ? 52.952 26.991  1.620   1.00 19.88 ? 653  HIS A CE1   1 
ATOM   5387 N  NE2   . HIS C 3 647 ? 52.456 27.980  0.898   1.00 20.68 ? 653  HIS A NE2   1 
ATOM   5388 N  N     . ASP C 3 648 ? 50.869 23.387  -3.324  1.00 21.48 ? 654  ASP A N     1 
ATOM   5389 C  CA    . ASP C 3 648 ? 50.339 22.327  -4.179  1.00 23.16 ? 654  ASP A CA    1 
ATOM   5390 C  C     . ASP C 3 648 ? 50.479 22.724  -5.647  1.00 22.94 ? 654  ASP A C     1 
ATOM   5391 O  O     . ASP C 3 648 ? 49.745 22.257  -6.513  1.00 22.07 ? 654  ASP A O     1 
ATOM   5392 C  CB    . ASP C 3 648 ? 48.879 22.041  -3.826  1.00 23.47 ? 654  ASP A CB    1 
ATOM   5393 C  CG    . ASP C 3 648 ? 47.920 23.109  -4.335  1.00 25.14 ? 654  ASP A CG    1 
ATOM   5394 O  OD1   . ASP C 3 648 ? 48.315 24.281  -4.491  1.00 24.40 ? 654  ASP A OD1   1 
ATOM   5395 O  OD2   . ASP C 3 648 ? 46.744 22.764  -4.556  1.00 27.47 ? 654  ASP A OD2   1 
ATOM   5396 N  N     . GLU C 3 649 ? 51.461 23.578  -5.908  1.00 23.21 ? 655  GLU A N     1 
ATOM   5397 C  CA    . GLU C 3 649 ? 51.711 24.089  -7.249  1.00 23.42 ? 655  GLU A CA    1 
ATOM   5398 C  C     . GLU C 3 649 ? 53.198 24.125  -7.601  1.00 22.61 ? 655  GLU A C     1 
ATOM   5399 O  O     . GLU C 3 649 ? 54.037 24.484  -6.777  1.00 23.02 ? 655  GLU A O     1 
ATOM   5400 C  CB    . GLU C 3 649 ? 51.138 25.514  -7.359  1.00 22.75 ? 655  GLU A CB    1 
ATOM   5401 C  CG    . GLU C 3 649 ? 51.474 26.277  -8.652  1.00 24.11 ? 655  GLU A CG    1 
ATOM   5402 C  CD    . GLU C 3 649 ? 51.251 27.793  -8.530  1.00 26.34 ? 655  GLU A CD    1 
ATOM   5403 O  OE1   . GLU C 3 649 ? 51.454 28.530  -9.530  1.00 24.19 ? 655  GLU A OE1   1 
ATOM   5404 O  OE2   . GLU C 3 649 ? 50.881 28.255  -7.426  1.00 24.87 ? 655  GLU A OE2   1 
ATOM   5405 N  N     . ILE C 3 650 ? 53.520 23.741  -8.826  1.00 22.47 ? 656  ILE A N     1 
ATOM   5406 C  CA    . ILE C 3 650 ? 54.895 23.825  -9.282  1.00 23.71 ? 656  ILE A CA    1 
ATOM   5407 C  C     . ILE C 3 650 ? 54.897 24.605  -10.584 1.00 23.94 ? 656  ILE A C     1 
ATOM   5408 O  O     . ILE C 3 650 ? 53.947 24.531  -11.368 1.00 23.55 ? 656  ILE A O     1 
ATOM   5409 C  CB    . ILE C 3 650 ? 55.541 22.448  -9.533  1.00 24.38 ? 656  ILE A CB    1 
ATOM   5410 C  CG1   . ILE C 3 650 ? 54.722 21.658  -10.553 1.00 25.82 ? 656  ILE A CG1   1 
ATOM   5411 C  CG2   . ILE C 3 650 ? 55.693 21.708  -8.221  1.00 26.69 ? 656  ILE A CG2   1 
ATOM   5412 C  CD1   . ILE C 3 650 ? 55.345 20.339  -10.934 1.00 27.05 ? 656  ILE A CD1   1 
ATOM   5413 N  N     . GLN C 3 651 ? 55.953 25.381  -10.787 1.00 22.91 ? 657  GLN A N     1 
ATOM   5414 C  CA    . GLN C 3 651 ? 56.122 26.159  -12.005 1.00 23.24 ? 657  GLN A CA    1 
ATOM   5415 C  C     . GLN C 3 651 ? 57.453 25.678  -12.543 1.00 23.92 ? 657  GLN A C     1 
ATOM   5416 O  O     . GLN C 3 651 ? 58.480 25.808  -11.869 1.00 24.26 ? 657  GLN A O     1 
ATOM   5417 C  CB    . GLN C 3 651 ? 56.180 27.655  -11.703 1.00 22.34 ? 657  GLN A CB    1 
ATOM   5418 C  CG    . GLN C 3 651 ? 54.845 28.271  -11.307 1.00 22.95 ? 657  GLN A CG    1 
ATOM   5419 C  CD    . GLN C 3 651 ? 53.753 28.042  -12.348 1.00 25.06 ? 657  GLN A CD    1 
ATOM   5420 O  OE1   . GLN C 3 651 ? 54.004 28.090  -13.557 1.00 26.48 ? 657  GLN A OE1   1 
ATOM   5421 N  NE2   . GLN C 3 651 ? 52.532 27.813  -11.880 1.00 21.51 ? 657  GLN A NE2   1 
ATOM   5422 N  N     . VAL C 3 652 ? 57.437 25.125  -13.754 1.00 24.66 ? 658  VAL A N     1 
ATOM   5423 C  CA    . VAL C 3 652 ? 58.651 24.573  -14.351 1.00 24.64 ? 658  VAL A CA    1 
ATOM   5424 C  C     . VAL C 3 652 ? 59.046 25.176  -15.695 1.00 24.44 ? 658  VAL A C     1 
ATOM   5425 O  O     . VAL C 3 652 ? 58.229 25.273  -16.609 1.00 26.39 ? 658  VAL A O     1 
ATOM   5426 C  CB    . VAL C 3 652 ? 58.513 23.030  -14.514 1.00 24.75 ? 658  VAL A CB    1 
ATOM   5427 C  CG1   . VAL C 3 652 ? 59.824 22.425  -14.974 1.00 25.05 ? 658  VAL A CG1   1 
ATOM   5428 C  CG2   . VAL C 3 652 ? 58.082 22.411  -13.198 1.00 22.50 ? 658  VAL A CG2   1 
ATOM   5429 N  N     . GLY C 3 653 ? 60.311 25.578  -15.795 1.00 25.28 ? 659  GLY A N     1 
ATOM   5430 C  CA    . GLY C 3 653 ? 60.827 26.143  -17.027 1.00 23.80 ? 659  GLY A CA    1 
ATOM   5431 C  C     . GLY C 3 653 ? 61.128 25.011  -17.991 1.00 23.24 ? 659  GLY A C     1 
ATOM   5432 O  O     . GLY C 3 653 ? 61.686 23.991  -17.599 1.00 21.93 ? 659  GLY A O     1 
ATOM   5433 N  N     . CYS C 3 654 ? 60.761 25.183  -19.253 1.00 22.78 ? 660  CYS A N     1 
ATOM   5434 C  CA    . CYS C 3 654 ? 60.987 24.141  -20.239 1.00 24.09 ? 660  CYS A CA    1 
ATOM   5435 C  C     . CYS C 3 654 ? 61.645 24.680  -21.503 1.00 25.21 ? 660  CYS A C     1 
ATOM   5436 O  O     . CYS C 3 654 ? 61.226 25.705  -22.050 1.00 24.83 ? 660  CYS A O     1 
ATOM   5437 C  CB    . CYS C 3 654 ? 59.654 23.463  -20.572 1.00 23.46 ? 660  CYS A CB    1 
ATOM   5438 S  SG    . CYS C 3 654 ? 58.827 22.793  -19.103 1.00 25.30 ? 660  CYS A SG    1 
ATOM   5439 N  N     . ARG C 3 655 ? 62.680 23.981  -21.964 1.00 24.60 ? 661  ARG A N     1 
ATOM   5440 C  CA    . ARG C 3 655 ? 63.409 24.397  -23.153 1.00 25.06 ? 661  ARG A CA    1 
ATOM   5441 C  C     . ARG C 3 655 ? 62.512 24.499  -24.392 1.00 25.72 ? 661  ARG A C     1 
ATOM   5442 O  O     . ARG C 3 655 ? 62.762 25.322  -25.275 1.00 25.50 ? 661  ARG A O     1 
ATOM   5443 C  CB    . ARG C 3 655 ? 64.578 23.433  -23.410 1.00 23.17 ? 661  ARG A CB    1 
ATOM   5444 C  CG    . ARG C 3 655 ? 65.511 23.864  -24.532 1.00 21.92 ? 661  ARG A CG    1 
ATOM   5445 C  CD    . ARG C 3 655 ? 66.808 23.053  -24.533 1.00 21.17 ? 661  ARG A CD    1 
ATOM   5446 N  NE    . ARG C 3 655 ? 66.563 21.615  -24.621 1.00 22.38 ? 661  ARG A NE    1 
ATOM   5447 C  CZ    . ARG C 3 655 ? 66.038 21.003  -25.678 1.00 22.69 ? 661  ARG A CZ    1 
ATOM   5448 N  NH1   . ARG C 3 655 ? 65.706 21.697  -26.757 1.00 20.40 ? 661  ARG A NH1   1 
ATOM   5449 N  NH2   . ARG C 3 655 ? 65.814 19.696  -25.646 1.00 21.61 ? 661  ARG A NH2   1 
ATOM   5450 N  N     . THR C 3 656 ? 61.465 23.678  -24.454 1.00 26.01 ? 662  THR A N     1 
ATOM   5451 C  CA    . THR C 3 656 ? 60.548 23.697  -25.604 1.00 26.69 ? 662  THR A CA    1 
ATOM   5452 C  C     . THR C 3 656 ? 59.107 23.405  -25.189 1.00 28.22 ? 662  THR A C     1 
ATOM   5453 O  O     . THR C 3 656 ? 58.857 22.914  -24.089 1.00 28.53 ? 662  THR A O     1 
ATOM   5454 C  CB    . THR C 3 656 ? 60.931 22.640  -26.667 1.00 24.60 ? 662  THR A CB    1 
ATOM   5455 O  OG1   . THR C 3 656 ? 60.465 21.356  -26.243 1.00 24.16 ? 662  THR A OG1   1 
ATOM   5456 C  CG2   . THR C 3 656 ? 62.440 22.586  -26.859 1.00 22.34 ? 662  THR A CG2   1 
ATOM   5457 N  N     . GLU C 3 657 ? 58.167 23.699  -26.084 1.00 29.94 ? 663  GLU A N     1 
ATOM   5458 C  CA    . GLU C 3 657 ? 56.752 23.469  -25.812 1.00 32.17 ? 663  GLU A CA    1 
ATOM   5459 C  C     . GLU C 3 657 ? 56.431 21.995  -25.688 1.00 31.95 ? 663  GLU A C     1 
ATOM   5460 O  O     . GLU C 3 657 ? 55.536 21.607  -24.939 1.00 32.81 ? 663  GLU A O     1 
ATOM   5461 C  CB    . GLU C 3 657 ? 55.879 24.057  -26.915 1.00 34.62 ? 663  GLU A CB    1 
ATOM   5462 C  CG    . GLU C 3 657 ? 55.890 25.566  -27.002 1.00 37.99 ? 663  GLU A CG    1 
ATOM   5463 C  CD    . GLU C 3 657 ? 54.591 26.093  -27.574 1.00 39.99 ? 663  GLU A CD    1 
ATOM   5464 O  OE1   . GLU C 3 657 ? 53.996 25.380  -28.418 1.00 39.76 ? 663  GLU A OE1   1 
ATOM   5465 O  OE2   . GLU C 3 657 ? 54.171 27.207  -27.185 1.00 39.32 ? 663  GLU A OE2   1 
ATOM   5466 N  N     . GLU C 3 658 ? 57.152 21.182  -26.447 1.00 33.02 ? 664  GLU A N     1 
ATOM   5467 C  CA    . GLU C 3 658 ? 56.962 19.740  -26.430 1.00 33.90 ? 664  GLU A CA    1 
ATOM   5468 C  C     . GLU C 3 658 ? 57.321 19.236  -25.038 1.00 31.04 ? 664  GLU A C     1 
ATOM   5469 O  O     . GLU C 3 658 ? 56.629 18.397  -24.468 1.00 29.27 ? 664  GLU A O     1 
ATOM   5470 C  CB    . GLU C 3 658 ? 57.858 19.080  -27.491 1.00 35.74 ? 664  GLU A CB    1 
ATOM   5471 C  CG    . GLU C 3 658 ? 57.905 17.555  -27.435 1.00 42.44 ? 664  GLU A CG    1 
ATOM   5472 C  CD    . GLU C 3 658 ? 56.610 16.894  -27.882 1.00 46.87 ? 664  GLU A CD    1 
ATOM   5473 O  OE1   . GLU C 3 658 ? 56.318 16.924  -29.100 1.00 51.27 ? 664  GLU A OE1   1 
ATOM   5474 O  OE2   . GLU C 3 658 ? 55.883 16.346  -27.018 1.00 48.02 ? 664  GLU A OE2   1 
ATOM   5475 N  N     . ILE C 3 659 ? 58.416 19.759  -24.498 1.00 30.39 ? 665  ILE A N     1 
ATOM   5476 C  CA    . ILE C 3 659 ? 58.863 19.377  -23.168 1.00 29.22 ? 665  ILE A CA    1 
ATOM   5477 C  C     . ILE C 3 659 ? 57.856 19.854  -22.124 1.00 28.25 ? 665  ILE A C     1 
ATOM   5478 O  O     . ILE C 3 659 ? 57.581 19.147  -21.163 1.00 27.50 ? 665  ILE A O     1 
ATOM   5479 C  CB    . ILE C 3 659 ? 60.276 19.946  -22.886 1.00 29.90 ? 665  ILE A CB    1 
ATOM   5480 C  CG1   . ILE C 3 659 ? 61.313 19.107  -23.655 1.00 27.45 ? 665  ILE A CG1   1 
ATOM   5481 C  CG2   . ILE C 3 659 ? 60.558 19.959  -21.385 1.00 27.64 ? 665  ILE A CG2   1 
ATOM   5482 C  CD1   . ILE C 3 659 ? 62.724 19.636  -23.597 1.00 24.19 ? 665  ILE A CD1   1 
ATOM   5483 N  N     . ALA C 3 660 ? 57.291 21.040  -22.330 1.00 27.07 ? 666  ALA A N     1 
ATOM   5484 C  CA    . ALA C 3 660 ? 56.298 21.569  -21.410 1.00 28.06 ? 666  ALA A CA    1 
ATOM   5485 C  C     . ALA C 3 660 ? 55.076 20.645  -21.405 1.00 29.23 ? 666  ALA A C     1 
ATOM   5486 O  O     . ALA C 3 660 ? 54.483 20.399  -20.354 1.00 28.16 ? 666  ALA A O     1 
ATOM   5487 C  CB    . ALA C 3 660 ? 55.892 22.985  -21.818 1.00 27.96 ? 666  ALA A CB    1 
ATOM   5488 N  N     . GLN C 3 661 ? 54.710 20.133  -22.582 1.00 30.00 ? 667  GLN A N     1 
ATOM   5489 C  CA    . GLN C 3 661 ? 53.572 19.224  -22.696 1.00 31.85 ? 667  GLN A CA    1 
ATOM   5490 C  C     . GLN C 3 661 ? 53.849 17.950  -21.879 1.00 31.02 ? 667  GLN A C     1 
ATOM   5491 O  O     . GLN C 3 661 ? 52.978 17.474  -21.152 1.00 31.52 ? 667  GLN A O     1 
ATOM   5492 C  CB    . GLN C 3 661 ? 53.302 18.865  -24.175 1.00 35.69 ? 667  GLN A CB    1 
ATOM   5493 C  CG    . GLN C 3 661 ? 52.017 18.042  -24.403 1.00 41.62 ? 667  GLN A CG    1 
ATOM   5494 C  CD    . GLN C 3 661 ? 51.881 17.436  -25.819 1.00 44.21 ? 667  GLN A CD    1 
ATOM   5495 O  OE1   . GLN C 3 661 ? 51.798 18.155  -26.819 1.00 44.34 ? 667  GLN A OE1   1 
ATOM   5496 N  NE2   . GLN C 3 661 ? 51.847 16.102  -25.892 1.00 44.66 ? 667  GLN A NE2   1 
ATOM   5497 N  N     . VAL C 3 662 ? 55.062 17.409  -21.984 1.00 29.82 ? 668  VAL A N     1 
ATOM   5498 C  CA    . VAL C 3 662 ? 55.419 16.200  -21.236 1.00 28.55 ? 668  VAL A CA    1 
ATOM   5499 C  C     . VAL C 3 662 ? 55.461 16.439  -19.717 1.00 27.95 ? 668  VAL A C     1 
ATOM   5500 O  O     . VAL C 3 662 ? 55.061 15.575  -18.935 1.00 27.86 ? 668  VAL A O     1 
ATOM   5501 C  CB    . VAL C 3 662 ? 56.792 15.622  -21.703 1.00 28.77 ? 668  VAL A CB    1 
ATOM   5502 C  CG1   . VAL C 3 662 ? 57.224 14.467  -20.791 1.00 26.56 ? 668  VAL A CG1   1 
ATOM   5503 C  CG2   . VAL C 3 662 ? 56.682 15.123  -23.141 1.00 26.03 ? 668  VAL A CG2   1 
ATOM   5504 N  N     . VAL C 3 663 ? 55.946 17.607  -19.302 1.00 27.11 ? 669  VAL A N     1 
ATOM   5505 C  CA    . VAL C 3 663 ? 56.014 17.936  -17.881 1.00 24.17 ? 669  VAL A CA    1 
ATOM   5506 C  C     . VAL C 3 663 ? 54.606 17.916  -17.301 1.00 24.60 ? 669  VAL A C     1 
ATOM   5507 O  O     . VAL C 3 663 ? 54.367 17.347  -16.235 1.00 23.15 ? 669  VAL A O     1 
ATOM   5508 C  CB    . VAL C 3 663 ? 56.637 19.333  -17.650 1.00 23.83 ? 669  VAL A CB    1 
ATOM   5509 C  CG1   . VAL C 3 663 ? 56.548 19.706  -16.179 1.00 20.95 ? 669  VAL A CG1   1 
ATOM   5510 C  CG2   . VAL C 3 663 ? 58.090 19.331  -18.101 1.00 22.31 ? 669  VAL A CG2   1 
ATOM   5511 N  N     . ILE C 3 664 ? 53.673 18.539  -18.013 1.00 25.80 ? 670  ILE A N     1 
ATOM   5512 C  CA    . ILE C 3 664 ? 52.286 18.585  -17.577 1.00 26.32 ? 670  ILE A CA    1 
ATOM   5513 C  C     . ILE C 3 664 ? 51.700 17.173  -17.476 1.00 28.48 ? 670  ILE A C     1 
ATOM   5514 O  O     . ILE C 3 664 ? 51.120 16.809  -16.449 1.00 30.61 ? 670  ILE A O     1 
ATOM   5515 C  CB    . ILE C 3 664 ? 51.441 19.446  -18.547 1.00 26.11 ? 670  ILE A CB    1 
ATOM   5516 C  CG1   . ILE C 3 664 ? 51.898 20.907  -18.440 1.00 25.95 ? 670  ILE A CG1   1 
ATOM   5517 C  CG2   . ILE C 3 664 ? 49.935 19.272  -18.259 1.00 24.58 ? 670  ILE A CG2   1 
ATOM   5518 C  CD1   . ILE C 3 664 ? 51.190 21.872  -19.357 1.00 23.39 ? 670  ILE A CD1   1 
ATOM   5519 N  N     . GLU C 3 665 ? 51.872 16.373  -18.528 1.00 28.65 ? 671  GLU A N     1 
ATOM   5520 C  CA    . GLU C 3 665 ? 51.345 15.002  -18.548 1.00 28.81 ? 671  GLU A CA    1 
ATOM   5521 C  C     . GLU C 3 665 ? 51.988 14.145  -17.476 1.00 27.62 ? 671  GLU A C     1 
ATOM   5522 O  O     . GLU C 3 665 ? 51.323 13.334  -16.830 1.00 27.85 ? 671  GLU A O     1 
ATOM   5523 C  CB    . GLU C 3 665 ? 51.590 14.344  -19.913 1.00 28.96 ? 671  GLU A CB    1 
ATOM   5524 C  CG    . GLU C 3 665 ? 51.250 15.247  -21.084 1.00 33.12 ? 671  GLU A CG    1 
ATOM   5525 C  CD    . GLU C 3 665 ? 51.329 14.543  -22.429 1.00 34.26 ? 671  GLU A CD    1 
ATOM   5526 O  OE1   . GLU C 3 665 ? 52.279 13.767  -22.649 1.00 35.70 ? 671  GLU A OE1   1 
ATOM   5527 O  OE2   . GLU C 3 665 ? 50.440 14.784  -23.273 1.00 35.52 ? 671  GLU A OE2   1 
ATOM   5528 N  N     . THR C 3 666 ? 53.293 14.314  -17.306 1.00 26.67 ? 672  THR A N     1 
ATOM   5529 C  CA    . THR C 3 666 ? 54.030 13.549  -16.319 1.00 25.71 ? 672  THR A CA    1 
ATOM   5530 C  C     . THR C 3 666 ? 53.594 13.911  -14.903 1.00 24.85 ? 672  THR A C     1 
ATOM   5531 O  O     . THR C 3 666 ? 53.448 13.034  -14.052 1.00 23.43 ? 672  THR A O     1 
ATOM   5532 C  CB    . THR C 3 666 ? 55.543 13.777  -16.465 1.00 26.42 ? 672  THR A CB    1 
ATOM   5533 O  OG1   . THR C 3 666 ? 55.945 13.429  -17.795 1.00 27.14 ? 672  THR A OG1   1 
ATOM   5534 C  CG2   . THR C 3 666 ? 56.310 12.914  -15.473 1.00 24.14 ? 672  THR A CG2   1 
ATOM   5535 N  N     . ALA C 3 667 ? 53.377 15.199  -14.657 1.00 24.17 ? 673  ALA A N     1 
ATOM   5536 C  CA    . ALA C 3 667 ? 52.951 15.655  -13.339 1.00 23.69 ? 673  ALA A CA    1 
ATOM   5537 C  C     . ALA C 3 667 ? 51.611 15.018  -12.942 1.00 24.23 ? 673  ALA A C     1 
ATOM   5538 O  O     . ALA C 3 667 ? 51.372 14.751  -11.766 1.00 24.21 ? 673  ALA A O     1 
ATOM   5539 C  CB    . ALA C 3 667 ? 52.838 17.173  -13.327 1.00 23.95 ? 673  ALA A CB    1 
ATOM   5540 N  N     . GLN C 3 668 ? 50.744 14.780  -13.926 1.00 25.37 ? 674  GLN A N     1 
ATOM   5541 C  CA    . GLN C 3 668 ? 49.435 14.165  -13.676 1.00 25.56 ? 674  GLN A CA    1 
ATOM   5542 C  C     . GLN C 3 668 ? 49.595 12.684  -13.343 1.00 26.14 ? 674  GLN A C     1 
ATOM   5543 O  O     . GLN C 3 668 ? 48.895 12.163  -12.469 1.00 26.49 ? 674  GLN A O     1 
ATOM   5544 C  CB    . GLN C 3 668 ? 48.522 14.329  -14.902 1.00 25.89 ? 674  GLN A CB    1 
ATOM   5545 C  CG    . GLN C 3 668 ? 47.195 13.550  -14.856 1.00 25.02 ? 674  GLN A CG    1 
ATOM   5546 C  CD    . GLN C 3 668 ? 46.250 14.002  -13.744 1.00 26.72 ? 674  GLN A CD    1 
ATOM   5547 O  OE1   . GLN C 3 668 ? 46.397 15.093  -13.182 1.00 25.14 ? 674  GLN A OE1   1 
ATOM   5548 N  NE2   . GLN C 3 668 ? 45.263 13.165  -13.435 1.00 24.57 ? 674  GLN A NE2   1 
ATOM   5549 N  N     . GLU C 3 669 ? 50.514 12.012  -14.035 1.00 25.16 ? 675  GLU A N     1 
ATOM   5550 C  CA    . GLU C 3 669 ? 50.763 10.593  -13.788 1.00 26.34 ? 675  GLU A CA    1 
ATOM   5551 C  C     . GLU C 3 669 ? 51.352 10.395  -12.393 1.00 26.01 ? 675  GLU A C     1 
ATOM   5552 O  O     . GLU C 3 669 ? 50.984 9.465   -11.681 1.00 26.76 ? 675  GLU A O     1 
ATOM   5553 C  CB    . GLU C 3 669 ? 51.742 10.017  -14.817 1.00 27.56 ? 675  GLU A CB    1 
ATOM   5554 C  CG    . GLU C 3 669 ? 51.355 10.255  -16.259 1.00 32.32 ? 675  GLU A CG    1 
ATOM   5555 C  CD    . GLU C 3 669 ? 52.327 9.614   -17.241 1.00 34.77 ? 675  GLU A CD    1 
ATOM   5556 O  OE1   . GLU C 3 669 ? 53.550 9.878   -17.155 1.00 35.47 ? 675  GLU A OE1   1 
ATOM   5557 O  OE2   . GLU C 3 669 ? 51.860 8.848   -18.107 1.00 35.87 ? 675  GLU A OE2   1 
ATOM   5558 N  N     . ALA C 3 670 ? 52.274 11.272  -12.013 1.00 24.85 ? 676  ALA A N     1 
ATOM   5559 C  CA    . ALA C 3 670 ? 52.912 11.193  -10.708 1.00 24.35 ? 676  ALA A CA    1 
ATOM   5560 C  C     . ALA C 3 670 ? 51.878 11.338  -9.588  1.00 23.60 ? 676  ALA A C     1 
ATOM   5561 O  O     . ALA C 3 670 ? 51.955 10.647  -8.571  1.00 21.05 ? 676  ALA A O     1 
ATOM   5562 C  CB    . ALA C 3 670 ? 53.987 12.284  -10.584 1.00 23.62 ? 676  ALA A CB    1 
ATOM   5563 N  N     . MET C 3 671 ? 50.915 12.238  -9.779  1.00 23.33 ? 677  MET A N     1 
ATOM   5564 C  CA    . MET C 3 671 ? 49.874 12.450  -8.777  1.00 24.66 ? 677  MET A CA    1 
ATOM   5565 C  C     . MET C 3 671 ? 48.999 11.199  -8.592  1.00 25.10 ? 677  MET A C     1 
ATOM   5566 O  O     . MET C 3 671 ? 48.702 10.806  -7.462  1.00 25.61 ? 677  MET A O     1 
ATOM   5567 C  CB    . MET C 3 671 ? 49.009 13.660  -9.147  1.00 23.07 ? 677  MET A CB    1 
ATOM   5568 C  CG    . MET C 3 671 ? 47.952 14.021  -8.084  1.00 25.26 ? 677  MET A CG    1 
ATOM   5569 S  SD    . MET C 3 671 ? 48.607 14.504  -6.441  1.00 24.88 ? 677  MET A SD    1 
ATOM   5570 C  CE    . MET C 3 671 ? 49.112 16.220  -6.787  1.00 22.09 ? 677  MET A CE    1 
ATOM   5571 N  N     . ARG C 3 672 ? 48.600 10.570  -9.697  1.00 25.40 ? 678  ARG A N     1 
ATOM   5572 C  CA    . ARG C 3 672 ? 47.780 9.357   -9.633  1.00 25.60 ? 678  ARG A CA    1 
ATOM   5573 C  C     . ARG C 3 672 ? 48.606 8.271   -8.949  1.00 25.36 ? 678  ARG A C     1 
ATOM   5574 O  O     . ARG C 3 672 ? 48.077 7.435   -8.201  1.00 25.64 ? 678  ARG A O     1 
ATOM   5575 C  CB    . ARG C 3 672 ? 47.381 8.913   -11.044 1.00 26.64 ? 678  ARG A CB    1 
ATOM   5576 C  CG    . ARG C 3 672 ? 46.694 10.009  -11.843 1.00 29.25 ? 678  ARG A CG    1 
ATOM   5577 C  CD    . ARG C 3 672 ? 45.282 10.295  -11.348 1.00 31.35 ? 678  ARG A CD    1 
ATOM   5578 N  NE    . ARG C 3 672 ? 44.358 9.296   -11.871 1.00 36.92 ? 678  ARG A NE    1 
ATOM   5579 C  CZ    . ARG C 3 672 ? 43.212 9.570   -12.490 1.00 35.37 ? 678  ARG A CZ    1 
ATOM   5580 N  NH1   . ARG C 3 672 ? 42.816 10.824  -12.672 1.00 34.05 ? 678  ARG A NH1   1 
ATOM   5581 N  NH2   . ARG C 3 672 ? 42.477 8.576   -12.957 1.00 36.91 ? 678  ARG A NH2   1 
ATOM   5582 N  N     . TRP C 3 673 ? 49.911 8.304   -9.197  1.00 23.37 ? 679  TRP A N     1 
ATOM   5583 C  CA    . TRP C 3 673 ? 50.831 7.346   -8.594  1.00 23.91 ? 679  TRP A CA    1 
ATOM   5584 C  C     . TRP C 3 673 ? 50.883 7.553   -7.072  1.00 23.95 ? 679  TRP A C     1 
ATOM   5585 O  O     . TRP C 3 673 ? 50.826 6.592   -6.298  1.00 25.18 ? 679  TRP A O     1 
ATOM   5586 C  CB    . TRP C 3 673 ? 52.230 7.514   -9.193  1.00 24.98 ? 679  TRP A CB    1 
ATOM   5587 C  CG    . TRP C 3 673 ? 53.208 6.504   -8.696  1.00 25.64 ? 679  TRP A CG    1 
ATOM   5588 C  CD1   . TRP C 3 673 ? 53.495 5.296   -9.257  1.00 24.14 ? 679  TRP A CD1   1 
ATOM   5589 C  CD2   . TRP C 3 673 ? 54.003 6.593   -7.503  1.00 26.91 ? 679  TRP A CD2   1 
ATOM   5590 N  NE1   . TRP C 3 673 ? 54.415 4.624   -8.491  1.00 25.38 ? 679  TRP A NE1   1 
ATOM   5591 C  CE2   . TRP C 3 673 ? 54.744 5.395   -7.407  1.00 26.56 ? 679  TRP A CE2   1 
ATOM   5592 C  CE3   . TRP C 3 673 ? 54.159 7.569   -6.509  1.00 26.18 ? 679  TRP A CE3   1 
ATOM   5593 C  CZ2   . TRP C 3 673 ? 55.632 5.142   -6.352  1.00 25.96 ? 679  TRP A CZ2   1 
ATOM   5594 C  CZ3   . TRP C 3 673 ? 55.042 7.320   -5.460  1.00 25.89 ? 679  TRP A CZ3   1 
ATOM   5595 C  CH2   . TRP C 3 673 ? 55.766 6.113   -5.392  1.00 27.48 ? 679  TRP A CH2   1 
ATOM   5596 N  N     . VAL C 3 674 ? 50.998 8.805   -6.640  1.00 22.97 ? 680  VAL A N     1 
ATOM   5597 C  CA    . VAL C 3 674 ? 51.028 9.084   -5.210  1.00 23.24 ? 680  VAL A CA    1 
ATOM   5598 C  C     . VAL C 3 674 ? 49.720 8.599   -4.557  1.00 23.88 ? 680  VAL A C     1 
ATOM   5599 O  O     . VAL C 3 674 ? 49.746 7.938   -3.522  1.00 23.84 ? 680  VAL A O     1 
ATOM   5600 C  CB    . VAL C 3 674 ? 51.220 10.600  -4.928  1.00 22.16 ? 680  VAL A CB    1 
ATOM   5601 C  CG1   . VAL C 3 674 ? 51.067 10.879  -3.445  1.00 22.30 ? 680  VAL A CG1   1 
ATOM   5602 C  CG2   . VAL C 3 674 ? 52.601 11.039  -5.376  1.00 18.68 ? 680  VAL A CG2   1 
ATOM   5603 N  N     . GLY C 3 675 ? 48.586 8.922   -5.174  1.00 24.47 ? 681  GLY A N     1 
ATOM   5604 C  CA    . GLY C 3 675 ? 47.302 8.501   -4.638  1.00 25.39 ? 681  GLY A CA    1 
ATOM   5605 C  C     . GLY C 3 675 ? 47.189 6.990   -4.475  1.00 27.06 ? 681  GLY A C     1 
ATOM   5606 O  O     . GLY C 3 675 ? 46.624 6.497   -3.500  1.00 28.42 ? 681  GLY A O     1 
ATOM   5607 N  N     . ASP C 3 676 ? 47.732 6.252   -5.435  1.00 28.10 ? 682  ASP A N     1 
ATOM   5608 C  CA    . ASP C 3 676 ? 47.710 4.797   -5.391  1.00 28.28 ? 682  ASP A CA    1 
ATOM   5609 C  C     . ASP C 3 676 ? 48.689 4.289   -4.343  1.00 26.86 ? 682  ASP A C     1 
ATOM   5610 O  O     . ASP C 3 676 ? 48.404 3.341   -3.603  1.00 26.11 ? 682  ASP A O     1 
ATOM   5611 C  CB    . ASP C 3 676 ? 48.097 4.223   -6.752  1.00 30.19 ? 682  ASP A CB    1 
ATOM   5612 C  CG    . ASP C 3 676 ? 48.288 2.727   -6.710  1.00 35.85 ? 682  ASP A CG    1 
ATOM   5613 O  OD1   . ASP C 3 676 ? 47.280 1.985   -6.823  1.00 38.32 ? 682  ASP A OD1   1 
ATOM   5614 O  OD2   . ASP C 3 676 ? 49.447 2.288   -6.543  1.00 36.99 ? 682  ASP A OD2   1 
ATOM   5615 N  N     . HIS C 3 677 ? 49.854 4.926   -4.299  1.00 26.53 ? 683  HIS A N     1 
ATOM   5616 C  CA    . HIS C 3 677 ? 50.915 4.567   -3.359  1.00 24.29 ? 683  HIS A CA    1 
ATOM   5617 C  C     . HIS C 3 677 ? 50.423 4.546   -1.908  1.00 24.11 ? 683  HIS A C     1 
ATOM   5618 O  O     . HIS C 3 677 ? 50.797 3.670   -1.128  1.00 22.62 ? 683  HIS A O     1 
ATOM   5619 C  CB    . HIS C 3 677 ? 52.071 5.559   -3.513  1.00 24.78 ? 683  HIS A CB    1 
ATOM   5620 C  CG    . HIS C 3 677 ? 53.123 5.438   -2.458  1.00 24.53 ? 683  HIS A CG    1 
ATOM   5621 N  ND1   . HIS C 3 677 ? 54.040 4.409   -2.433  1.00 24.17 ? 683  HIS A ND1   1 
ATOM   5622 C  CD2   . HIS C 3 677 ? 53.399 6.217   -1.385  1.00 24.22 ? 683  HIS A CD2   1 
ATOM   5623 C  CE1   . HIS C 3 677 ? 54.836 4.559   -1.389  1.00 24.01 ? 683  HIS A CE1   1 
ATOM   5624 N  NE2   . HIS C 3 677 ? 54.469 5.649   -0.737  1.00 25.49 ? 683  HIS A NE2   1 
ATOM   5625 N  N     . TRP C 3 678 ? 49.587 5.514   -1.542  1.00 24.33 ? 684  TRP A N     1 
ATOM   5626 C  CA    . TRP C 3 678 ? 49.071 5.569   -0.182  1.00 24.19 ? 684  TRP A CA    1 
ATOM   5627 C  C     . TRP C 3 678 ? 47.617 5.127   -0.077  1.00 25.38 ? 684  TRP A C     1 
ATOM   5628 O  O     . TRP C 3 678 ? 46.904 5.540   0.833   1.00 25.55 ? 684  TRP A O     1 
ATOM   5629 C  CB    . TRP C 3 678 ? 49.240 6.978   0.406   1.00 24.38 ? 684  TRP A CB    1 
ATOM   5630 C  CG    . TRP C 3 678 ? 50.643 7.268   0.878   1.00 24.05 ? 684  TRP A CG    1 
ATOM   5631 C  CD1   . TRP C 3 678 ? 51.485 6.400   1.522   1.00 23.72 ? 684  TRP A CD1   1 
ATOM   5632 C  CD2   . TRP C 3 678 ? 51.348 8.520   0.793   1.00 24.38 ? 684  TRP A CD2   1 
ATOM   5633 N  NE1   . TRP C 3 678 ? 52.665 7.031   1.842   1.00 25.37 ? 684  TRP A NE1   1 
ATOM   5634 C  CE2   . TRP C 3 678 ? 52.611 8.331   1.409   1.00 23.53 ? 684  TRP A CE2   1 
ATOM   5635 C  CE3   . TRP C 3 678 ? 51.036 9.779   0.261   1.00 24.18 ? 684  TRP A CE3   1 
ATOM   5636 C  CZ2   . TRP C 3 678 ? 53.562 9.354   1.506   1.00 22.83 ? 684  TRP A CZ2   1 
ATOM   5637 C  CZ3   . TRP C 3 678 ? 51.982 10.801  0.358   1.00 24.11 ? 684  TRP A CZ3   1 
ATOM   5638 C  CH2   . TRP C 3 678 ? 53.232 10.579  0.977   1.00 23.93 ? 684  TRP A CH2   1 
ATOM   5639 N  N     . ASN C 3 679 ? 47.198 4.270   -1.006  1.00 26.39 ? 685  ASN A N     1 
ATOM   5640 C  CA    . ASN C 3 679 ? 45.835 3.740   -1.046  1.00 27.71 ? 685  ASN A CA    1 
ATOM   5641 C  C     . ASN C 3 679 ? 44.802 4.800   -0.710  1.00 26.36 ? 685  ASN A C     1 
ATOM   5642 O  O     . ASN C 3 679 ? 43.873 4.543   0.054   1.00 26.63 ? 685  ASN A O     1 
ATOM   5643 C  CB    . ASN C 3 679 ? 45.673 2.575   -0.064  1.00 26.73 ? 685  ASN A CB    1 
ATOM   5644 C  CG    . ASN C 3 679 ? 46.786 1.560   -0.173  1.00 29.92 ? 685  ASN A CG    1 
ATOM   5645 O  OD1   . ASN C 3 679 ? 47.065 1.042   -1.254  1.00 31.48 ? 685  ASN A OD1   1 
ATOM   5646 N  ND2   . ASN C 3 679 ? 47.431 1.262   0.957   1.00 30.78 ? 685  ASN A ND2   1 
ATOM   5647 N  N     . PHE C 3 680 ? 44.948 5.982   -1.294  1.00 28.02 ? 686  PHE A N     1 
ATOM   5648 C  CA    . PHE C 3 680 ? 44.020 7.069   -1.003  1.00 27.50 ? 686  PHE A CA    1 
ATOM   5649 C  C     . PHE C 3 680 ? 42.599 6.738   -1.419  1.00 27.13 ? 686  PHE A C     1 
ATOM   5650 O  O     . PHE C 3 680 ? 42.362 6.211   -2.500  1.00 26.93 ? 686  PHE A O     1 
ATOM   5651 C  CB    . PHE C 3 680 ? 44.476 8.358   -1.679  1.00 26.30 ? 686  PHE A CB    1 
ATOM   5652 C  CG    . PHE C 3 680 ? 44.366 9.567   -0.799  1.00 24.94 ? 686  PHE A CG    1 
ATOM   5653 C  CD1   . PHE C 3 680 ? 45.074 9.635   0.393   1.00 22.20 ? 686  PHE A CD1   1 
ATOM   5654 C  CD2   . PHE C 3 680 ? 43.573 10.647  -1.170  1.00 24.82 ? 686  PHE A CD2   1 
ATOM   5655 C  CE1   . PHE C 3 680 ? 44.998 10.764  1.203   1.00 22.00 ? 686  PHE A CE1   1 
ATOM   5656 C  CE2   . PHE C 3 680 ? 43.490 11.783  -0.364  1.00 23.92 ? 686  PHE A CE2   1 
ATOM   5657 C  CZ    . PHE C 3 680 ? 44.205 11.839  0.824   1.00 21.19 ? 686  PHE A CZ    1 
ATOM   5658 N  N     . ARG C 3 681 ? 41.657 7.071   -0.545  1.00 29.18 ? 687  ARG A N     1 
ATOM   5659 C  CA    . ARG C 3 681 ? 40.245 6.800   -0.773  1.00 30.13 ? 687  ARG A CA    1 
ATOM   5660 C  C     . ARG C 3 681 ? 39.518 7.808   -1.662  1.00 30.30 ? 687  ARG A C     1 
ATOM   5661 O  O     . ARG C 3 681 ? 38.302 7.733   -1.814  1.00 31.58 ? 687  ARG A O     1 
ATOM   5662 C  CB    . ARG C 3 681 ? 39.537 6.679   0.575   1.00 31.06 ? 687  ARG A CB    1 
ATOM   5663 C  CG    . ARG C 3 681 ? 39.915 5.421   1.325   1.00 31.40 ? 687  ARG A CG    1 
ATOM   5664 C  CD    . ARG C 3 681 ? 38.791 4.403   1.241   1.00 32.30 ? 687  ARG A CD    1 
ATOM   5665 N  NE    . ARG C 3 681 ? 38.108 4.297   2.525   1.00 33.38 ? 687  ARG A NE    1 
ATOM   5666 C  CZ    . ARG C 3 681 ? 36.887 3.804   2.696   1.00 31.98 ? 687  ARG A CZ    1 
ATOM   5667 N  NH1   . ARG C 3 681 ? 36.185 3.362   1.662   1.00 31.37 ? 687  ARG A NH1   1 
ATOM   5668 N  NH2   . ARG C 3 681 ? 36.374 3.751   3.914   1.00 33.54 ? 687  ARG A NH2   1 
ATOM   5669 N  N     . CYS C 3 682 ? 40.257 8.756   -2.230  1.00 28.61 ? 688  CYS A N     1 
ATOM   5670 C  CA    . CYS C 3 682 ? 39.675 9.739   -3.137  1.00 27.45 ? 688  CYS A CA    1 
ATOM   5671 C  C     . CYS C 3 682 ? 40.663 9.918   -4.275  1.00 27.79 ? 688  CYS A C     1 
ATOM   5672 O  O     . CYS C 3 682 ? 41.857 10.077  -4.038  1.00 28.95 ? 688  CYS A O     1 
ATOM   5673 C  CB    . CYS C 3 682 ? 39.440 11.086  -2.446  1.00 27.20 ? 688  CYS A CB    1 
ATOM   5674 S  SG    . CYS C 3 682 ? 38.681 12.363  -3.531  1.00 29.44 ? 688  CYS A SG    1 
ATOM   5675 N  N     . LEU C 3 683 ? 40.167 9.869   -5.505  1.00 26.99 ? 689  LEU A N     1 
ATOM   5676 C  CA    . LEU C 3 683 ? 41.012 10.031  -6.686  1.00 27.30 ? 689  LEU A CA    1 
ATOM   5677 C  C     . LEU C 3 683 ? 41.702 11.406  -6.676  1.00 27.04 ? 689  LEU A C     1 
ATOM   5678 O  O     . LEU C 3 683 ? 41.072 12.418  -6.351  1.00 26.93 ? 689  LEU A O     1 
ATOM   5679 C  CB    . LEU C 3 683 ? 40.152 9.888   -7.943  1.00 26.25 ? 689  LEU A CB    1 
ATOM   5680 C  CG    . LEU C 3 683 ? 40.869 9.710   -9.279  1.00 29.16 ? 689  LEU A CG    1 
ATOM   5681 C  CD1   . LEU C 3 683 ? 41.662 8.385   -9.277  1.00 25.77 ? 689  LEU A CD1   1 
ATOM   5682 C  CD2   . LEU C 3 683 ? 39.831 9.730   -10.403 1.00 27.50 ? 689  LEU A CD2   1 
ATOM   5683 N  N     . LEU C 3 684 ? 42.984 11.450  -7.039  1.00 27.06 ? 690  LEU A N     1 
ATOM   5684 C  CA    . LEU C 3 684 ? 43.719 12.723  -7.054  1.00 27.18 ? 690  LEU A CA    1 
ATOM   5685 C  C     . LEU C 3 684 ? 43.993 13.260  -8.462  1.00 26.51 ? 690  LEU A C     1 
ATOM   5686 O  O     . LEU C 3 684 ? 44.319 12.502  -9.372  1.00 25.92 ? 690  LEU A O     1 
ATOM   5687 C  CB    . LEU C 3 684 ? 45.047 12.574  -6.308  1.00 26.97 ? 690  LEU A CB    1 
ATOM   5688 C  CG    . LEU C 3 684 ? 44.986 12.045  -4.875  1.00 25.61 ? 690  LEU A CG    1 
ATOM   5689 C  CD1   . LEU C 3 684 ? 46.399 11.922  -4.325  1.00 27.96 ? 690  LEU A CD1   1 
ATOM   5690 C  CD2   . LEU C 3 684 ? 44.160 12.978  -4.014  1.00 27.39 ? 690  LEU A CD2   1 
ATOM   5691 N  N     . ASP C 3 685 ? 43.875 14.573  -8.635  1.00 26.60 ? 691  ASP A N     1 
ATOM   5692 C  CA    . ASP C 3 685 ? 44.112 15.187  -9.938  1.00 27.52 ? 691  ASP A CA    1 
ATOM   5693 C  C     . ASP C 3 685 ? 44.954 16.460  -9.917  1.00 27.71 ? 691  ASP A C     1 
ATOM   5694 O  O     . ASP C 3 685 ? 45.253 17.019  -8.856  1.00 26.00 ? 691  ASP A O     1 
ATOM   5695 C  CB    . ASP C 3 685 ? 42.775 15.492  -10.632 1.00 27.39 ? 691  ASP A CB    1 
ATOM   5696 C  CG    . ASP C 3 685 ? 42.087 14.239  -11.153 1.00 28.07 ? 691  ASP A CG    1 
ATOM   5697 O  OD1   . ASP C 3 685 ? 42.684 13.557  -12.010 1.00 27.50 ? 691  ASP A OD1   1 
ATOM   5698 O  OD2   . ASP C 3 685 ? 40.960 13.934  -10.701 1.00 28.88 ? 691  ASP A OD2   1 
ATOM   5699 N  N     . THR C 3 686 ? 45.323 16.905  -11.115 1.00 28.12 ? 692  THR A N     1 
ATOM   5700 C  CA    . THR C 3 686 ? 46.102 18.120  -11.308 1.00 29.43 ? 692  THR A CA    1 
ATOM   5701 C  C     . THR C 3 686 ? 45.602 18.829  -12.562 1.00 30.55 ? 692  THR A C     1 
ATOM   5702 O  O     . THR C 3 686 ? 45.023 18.209  -13.456 1.00 30.06 ? 692  THR A O     1 
ATOM   5703 C  CB    . THR C 3 686 ? 47.595 17.828  -11.534 1.00 30.03 ? 692  THR A CB    1 
ATOM   5704 O  OG1   . THR C 3 686 ? 47.758 17.159  -12.789 1.00 30.48 ? 692  THR A OG1   1 
ATOM   5705 C  CG2   . THR C 3 686 ? 48.159 16.964  -10.407 1.00 30.03 ? 692  THR A CG2   1 
ATOM   5706 N  N     . GLU C 3 687 ? 45.829 20.135  -12.614 1.00 31.46 ? 693  GLU A N     1 
ATOM   5707 C  CA    . GLU C 3 687 ? 45.449 20.945  -13.757 1.00 32.71 ? 693  GLU A CA    1 
ATOM   5708 C  C     . GLU C 3 687 ? 46.739 21.616  -14.206 1.00 31.79 ? 693  GLU A C     1 
ATOM   5709 O  O     . GLU C 3 687 ? 47.451 22.198  -13.388 1.00 30.07 ? 693  GLU A O     1 
ATOM   5710 C  CB    . GLU C 3 687 ? 44.418 22.005  -13.351 1.00 36.19 ? 693  GLU A CB    1 
ATOM   5711 C  CG    . GLU C 3 687 ? 43.975 22.907  -14.503 1.00 42.14 ? 693  GLU A CG    1 
ATOM   5712 C  CD    . GLU C 3 687 ? 42.928 23.931  -14.084 1.00 46.90 ? 693  GLU A CD    1 
ATOM   5713 O  OE1   . GLU C 3 687 ? 43.224 24.770  -13.199 1.00 47.49 ? 693  GLU A OE1   1 
ATOM   5714 O  OE2   . GLU C 3 687 ? 41.804 23.895  -14.641 1.00 48.43 ? 693  GLU A OE2   1 
ATOM   5715 N  N     . GLY C 3 688 ? 47.051 21.525  -15.495 1.00 31.39 ? 694  GLY A N     1 
ATOM   5716 C  CA    . GLY C 3 688 ? 48.273 22.125  -15.994 1.00 30.20 ? 694  GLY A CA    1 
ATOM   5717 C  C     . GLY C 3 688 ? 48.051 23.235  -16.995 1.00 31.23 ? 694  GLY A C     1 
ATOM   5718 O  O     . GLY C 3 688 ? 47.043 23.257  -17.698 1.00 31.94 ? 694  GLY A O     1 
ATOM   5719 N  N     . LYS C 3 689 ? 48.996 24.167  -17.052 1.00 32.61 ? 695  LYS A N     1 
ATOM   5720 C  CA    . LYS C 3 689 ? 48.928 25.287  -17.984 1.00 32.12 ? 695  LYS A CA    1 
ATOM   5721 C  C     . LYS C 3 689 ? 50.300 25.584  -18.574 1.00 30.88 ? 695  LYS A C     1 
ATOM   5722 O  O     . LYS C 3 689 ? 51.314 25.565  -17.872 1.00 30.21 ? 695  LYS A O     1 
ATOM   5723 C  CB    . LYS C 3 689 ? 48.415 26.548  -17.288 1.00 34.55 ? 695  LYS A CB    1 
ATOM   5724 C  CG    . LYS C 3 689 ? 47.018 26.433  -16.715 1.00 37.68 ? 695  LYS A CG    1 
ATOM   5725 C  CD    . LYS C 3 689 ? 46.564 27.778  -16.178 1.00 40.84 ? 695  LYS A CD    1 
ATOM   5726 C  CE    . LYS C 3 689 ? 45.253 27.661  -15.435 1.00 42.20 ? 695  LYS A CE    1 
ATOM   5727 N  NZ    . LYS C 3 689 ? 45.415 26.813  -14.225 1.00 46.84 ? 695  LYS A NZ    1 
ATOM   5728 N  N     . MET C 3 690 ? 50.321 25.867  -19.869 1.00 31.04 ? 696  MET A N     1 
ATOM   5729 C  CA    . MET C 3 690 ? 51.554 26.190  -20.571 1.00 30.87 ? 696  MET A CA    1 
ATOM   5730 C  C     . MET C 3 690 ? 51.505 27.656  -20.993 1.00 30.51 ? 696  MET A C     1 
ATOM   5731 O  O     . MET C 3 690 ? 50.485 28.132  -21.485 1.00 31.18 ? 696  MET A O     1 
ATOM   5732 C  CB    . MET C 3 690 ? 51.696 25.304  -21.806 1.00 32.41 ? 696  MET A CB    1 
ATOM   5733 C  CG    . MET C 3 690 ? 53.003 25.476  -22.571 1.00 34.34 ? 696  MET A CG    1 
ATOM   5734 S  SD    . MET C 3 690 ? 53.026 24.450  -24.062 1.00 35.32 ? 696  MET A SD    1 
ATOM   5735 C  CE    . MET C 3 690 ? 52.366 22.911  -23.395 1.00 35.05 ? 696  MET A CE    1 
ATOM   5736 N  N     . GLY C 3 691 ? 52.610 28.367  -20.804 1.00 28.82 ? 697  GLY A N     1 
ATOM   5737 C  CA    . GLY C 3 691 ? 52.646 29.768  -21.169 1.00 26.51 ? 697  GLY A CA    1 
ATOM   5738 C  C     . GLY C 3 691 ? 54.023 30.351  -20.949 1.00 25.19 ? 697  GLY A C     1 
ATOM   5739 O  O     . GLY C 3 691 ? 54.939 29.622  -20.588 1.00 27.33 ? 697  GLY A O     1 
ATOM   5740 N  N     . PRO C 3 692 ? 54.205 31.661  -21.160 1.00 24.48 ? 698  PRO A N     1 
ATOM   5741 C  CA    . PRO C 3 692 ? 55.514 32.295  -20.966 1.00 24.32 ? 698  PRO A CA    1 
ATOM   5742 C  C     . PRO C 3 692 ? 55.825 32.743  -19.532 1.00 25.00 ? 698  PRO A C     1 
ATOM   5743 O  O     . PRO C 3 692 ? 56.994 32.901  -19.172 1.00 26.97 ? 698  PRO A O     1 
ATOM   5744 C  CB    . PRO C 3 692 ? 55.464 33.479  -21.935 1.00 23.28 ? 698  PRO A CB    1 
ATOM   5745 C  CG    . PRO C 3 692 ? 54.035 33.914  -21.833 1.00 21.76 ? 698  PRO A CG    1 
ATOM   5746 C  CD    . PRO C 3 692 ? 53.273 32.578  -21.847 1.00 23.36 ? 698  PRO A CD    1 
ATOM   5747 N  N     . ASN C 3 693 ? 54.799 32.958  -18.712 1.00 23.65 ? 699  ASN A N     1 
ATOM   5748 C  CA    . ASN C 3 693 ? 55.050 33.409  -17.342 1.00 24.44 ? 699  ASN A CA    1 
ATOM   5749 C  C     . ASN C 3 693 ? 54.008 32.984  -16.301 1.00 23.51 ? 699  ASN A C     1 
ATOM   5750 O  O     . ASN C 3 693 ? 53.018 32.326  -16.623 1.00 21.94 ? 699  ASN A O     1 
ATOM   5751 C  CB    . ASN C 3 693 ? 55.213 34.940  -17.312 1.00 24.20 ? 699  ASN A CB    1 
ATOM   5752 C  CG    . ASN C 3 693 ? 53.997 35.665  -17.852 1.00 27.22 ? 699  ASN A CG    1 
ATOM   5753 O  OD1   . ASN C 3 693 ? 52.868 35.421  -17.415 1.00 27.39 ? 699  ASN A OD1   1 
ATOM   5754 N  ND2   . ASN C 3 693 ? 54.220 36.569  -18.809 1.00 28.20 ? 699  ASN A ND2   1 
ATOM   5755 N  N     . TRP C 3 694 ? 54.237 33.389  -15.051 1.00 23.38 ? 700  TRP A N     1 
ATOM   5756 C  CA    . TRP C 3 694 ? 53.351 33.019  -13.954 1.00 23.11 ? 700  TRP A CA    1 
ATOM   5757 C  C     . TRP C 3 694 ? 51.960 33.643  -14.086 1.00 23.71 ? 700  TRP A C     1 
ATOM   5758 O  O     . TRP C 3 694 ? 50.993 33.106  -13.561 1.00 20.32 ? 700  TRP A O     1 
ATOM   5759 C  CB    . TRP C 3 694 ? 53.985 33.396  -12.603 1.00 20.39 ? 700  TRP A CB    1 
ATOM   5760 C  CG    . TRP C 3 694 ? 53.696 32.412  -11.478 1.00 20.94 ? 700  TRP A CG    1 
ATOM   5761 C  CD1   . TRP C 3 694 ? 52.696 31.479  -11.437 1.00 19.54 ? 700  TRP A CD1   1 
ATOM   5762 C  CD2   . TRP C 3 694 ? 54.388 32.306  -10.221 1.00 20.18 ? 700  TRP A CD2   1 
ATOM   5763 N  NE1   . TRP C 3 694 ? 52.721 30.809  -10.244 1.00 19.36 ? 700  TRP A NE1   1 
ATOM   5764 C  CE2   . TRP C 3 694 ? 53.747 31.293  -9.476  1.00 19.41 ? 700  TRP A CE2   1 
ATOM   5765 C  CE3   . TRP C 3 694 ? 55.483 32.972  -9.654  1.00 18.94 ? 700  TRP A CE3   1 
ATOM   5766 C  CZ2   . TRP C 3 694 ? 54.164 30.923  -8.188  1.00 19.86 ? 700  TRP A CZ2   1 
ATOM   5767 C  CZ3   . TRP C 3 694 ? 55.900 32.611  -8.375  1.00 20.65 ? 700  TRP A CZ3   1 
ATOM   5768 C  CH2   . TRP C 3 694 ? 55.238 31.590  -7.655  1.00 21.70 ? 700  TRP A CH2   1 
ATOM   5769 N  N     . ALA C 3 695 ? 51.853 34.762  -14.797 1.00 24.90 ? 701  ALA A N     1 
ATOM   5770 C  CA    . ALA C 3 695 ? 50.553 35.413  -14.974 1.00 27.48 ? 701  ALA A CA    1 
ATOM   5771 C  C     . ALA C 3 695 ? 49.618 34.529  -15.796 1.00 29.05 ? 701  ALA A C     1 
ATOM   5772 O  O     . ALA C 3 695 ? 48.413 34.469  -15.548 1.00 30.12 ? 701  ALA A O     1 
ATOM   5773 C  CB    . ALA C 3 695 ? 50.725 36.771  -15.664 1.00 27.85 ? 701  ALA A CB    1 
ATOM   5774 N  N     . ILE C 3 696 ? 50.189 33.838  -16.774 1.00 29.12 ? 702  ILE A N     1 
ATOM   5775 C  CA    . ILE C 3 696 ? 49.426 32.960  -17.642 1.00 30.07 ? 702  ILE A CA    1 
ATOM   5776 C  C     . ILE C 3 696 ? 49.363 31.514  -17.138 1.00 30.88 ? 702  ILE A C     1 
ATOM   5777 O  O     . ILE C 3 696 ? 48.375 30.816  -17.374 1.00 31.00 ? 702  ILE A O     1 
ATOM   5778 C  CB    . ILE C 3 696 ? 50.019 32.981  -19.069 1.00 31.37 ? 702  ILE A CB    1 
ATOM   5779 C  CG1   . ILE C 3 696 ? 50.016 34.420  -19.594 1.00 33.95 ? 702  ILE A CG1   1 
ATOM   5780 C  CG2   . ILE C 3 696 ? 49.208 32.085  -20.001 1.00 30.44 ? 702  ILE A CG2   1 
ATOM   5781 C  CD1   . ILE C 3 696 ? 50.774 34.602  -20.883 1.00 37.51 ? 702  ILE A CD1   1 
ATOM   5782 N  N     . CYS C 3 697 ? 50.396 31.065  -16.429 1.00 30.45 ? 703  CYS A N     1 
ATOM   5783 C  CA    . CYS C 3 697 ? 50.415 29.687  -15.945 1.00 30.79 ? 703  CYS A CA    1 
ATOM   5784 C  C     . CYS C 3 697 ? 49.817 29.427  -14.568 1.00 32.57 ? 703  CYS A C     1 
ATOM   5785 O  O     . CYS C 3 697 ? 50.172 28.446  -13.915 1.00 32.96 ? 703  CYS A O     1 
ATOM   5786 C  CB    . CYS C 3 697 ? 51.838 29.143  -15.991 1.00 29.24 ? 703  CYS A CB    1 
ATOM   5787 S  SG    . CYS C 3 697 ? 52.550 29.126  -17.652 1.00 30.04 ? 703  CYS A SG    1 
ATOM   5788 N  N     . HIS C 3 698 ? 48.914 30.291  -14.116 1.00 34.39 ? 704  HIS A N     1 
ATOM   5789 C  CA    . HIS C 3 698 ? 48.275 30.084  -12.815 1.00 37.25 ? 704  HIS A CA    1 
ATOM   5790 C  C     . HIS C 3 698 ? 47.047 30.963  -12.666 1.00 37.11 ? 704  HIS A C     1 
ATOM   5791 O  O     . HIS C 3 698 ? 45.997 30.361  -12.366 1.00 38.40 ? 704  HIS A O     1 
ATOM   5792 C  CB    . HIS C 3 698 ? 49.257 30.366  -11.665 1.00 38.99 ? 704  HIS A CB    1 
ATOM   5793 C  CG    . HIS C 3 698 ? 48.731 29.999  -10.306 1.00 40.75 ? 704  HIS A CG    1 
ATOM   5794 N  ND1   . HIS C 3 698 ? 48.457 28.699  -9.936  1.00 42.69 ? 704  HIS A ND1   1 
ATOM   5795 C  CD2   . HIS C 3 698 ? 48.454 30.763  -9.220  1.00 41.13 ? 704  HIS A CD2   1 
ATOM   5796 C  CE1   . HIS C 3 698 ? 48.038 28.676  -8.681  1.00 40.64 ? 704  HIS A CE1   1 
ATOM   5797 N  NE2   . HIS C 3 698 ? 48.028 29.916  -8.224  1.00 40.95 ? 704  HIS A NE2   1 
ATOM   5798 N  N     . LYS D 4 3   ? 39.311 92.681  24.498  1.00 50.42 ? 3    LYS B N     1 
ATOM   5799 C  CA    . LYS D 4 3   ? 40.548 93.504  24.372  1.00 50.84 ? 3    LYS B CA    1 
ATOM   5800 C  C     . LYS D 4 3   ? 41.647 92.780  23.595  1.00 50.25 ? 3    LYS B C     1 
ATOM   5801 O  O     . LYS D 4 3   ? 42.566 93.410  23.071  1.00 50.13 ? 3    LYS B O     1 
ATOM   5802 C  CB    . LYS D 4 3   ? 41.068 93.885  25.761  1.00 53.13 ? 3    LYS B CB    1 
ATOM   5803 C  CG    . LYS D 4 3   ? 40.075 94.698  26.584  1.00 56.61 ? 3    LYS B CG    1 
ATOM   5804 C  CD    . LYS D 4 3   ? 40.695 95.194  27.887  1.00 58.35 ? 3    LYS B CD    1 
ATOM   5805 C  CE    . LYS D 4 3   ? 39.728 96.071  28.678  1.00 58.91 ? 3    LYS B CE    1 
ATOM   5806 N  NZ    . LYS D 4 3   ? 38.513 95.325  29.107  1.00 58.35 ? 3    LYS B NZ    1 
ATOM   5807 N  N     . ILE D 4 4   ? 41.557 91.455  23.520  1.00 48.43 ? 4    ILE B N     1 
ATOM   5808 C  CA    . ILE D 4 4   ? 42.558 90.684  22.795  1.00 46.32 ? 4    ILE B CA    1 
ATOM   5809 C  C     . ILE D 4 4   ? 42.091 90.343  21.384  1.00 44.38 ? 4    ILE B C     1 
ATOM   5810 O  O     . ILE D 4 4   ? 40.901 90.145  21.139  1.00 43.51 ? 4    ILE B O     1 
ATOM   5811 C  CB    . ILE D 4 4   ? 42.920 89.385  23.554  1.00 46.63 ? 4    ILE B CB    1 
ATOM   5812 C  CG1   . ILE D 4 4   ? 43.775 89.739  24.777  1.00 46.29 ? 4    ILE B CG1   1 
ATOM   5813 C  CG2   . ILE D 4 4   ? 43.653 88.408  22.626  1.00 45.13 ? 4    ILE B CG2   1 
ATOM   5814 C  CD1   . ILE D 4 4   ? 44.206 88.542  25.608  1.00 47.61 ? 4    ILE B CD1   1 
ATOM   5815 N  N     . ILE D 4 5   ? 43.043 90.290  20.459  1.00 41.99 ? 5    ILE B N     1 
ATOM   5816 C  CA    . ILE D 4 5   ? 42.750 89.980  19.068  1.00 39.93 ? 5    ILE B CA    1 
ATOM   5817 C  C     . ILE D 4 5   ? 42.977 88.502  18.774  1.00 38.20 ? 5    ILE B C     1 
ATOM   5818 O  O     . ILE D 4 5   ? 44.096 88.002  18.874  1.00 37.25 ? 5    ILE B O     1 
ATOM   5819 C  CB    . ILE D 4 5   ? 43.629 90.820  18.113  1.00 39.41 ? 5    ILE B CB    1 
ATOM   5820 C  CG1   . ILE D 4 5   ? 43.299 92.305  18.276  1.00 40.41 ? 5    ILE B CG1   1 
ATOM   5821 C  CG2   . ILE D 4 5   ? 43.403 90.387  16.681  1.00 39.25 ? 5    ILE B CG2   1 
ATOM   5822 C  CD1   . ILE D 4 5   ? 44.017 93.205  17.287  1.00 40.81 ? 5    ILE B CD1   1 
ATOM   5823 N  N     . HIS D 4 6   ? 41.900 87.818  18.409  1.00 36.08 ? 6    HIS B N     1 
ATOM   5824 C  CA    . HIS D 4 6   ? 41.943 86.404  18.088  1.00 34.48 ? 6    HIS B CA    1 
ATOM   5825 C  C     . HIS D 4 6   ? 42.130 86.238  16.582  1.00 33.19 ? 6    HIS B C     1 
ATOM   5826 O  O     . HIS D 4 6   ? 41.205 86.453  15.798  1.00 31.59 ? 6    HIS B O     1 
ATOM   5827 C  CB    . HIS D 4 6   ? 40.644 85.754  18.551  1.00 37.44 ? 6    HIS B CB    1 
ATOM   5828 C  CG    . HIS D 4 6   ? 40.374 85.946  20.009  1.00 39.49 ? 6    HIS B CG    1 
ATOM   5829 N  ND1   . HIS D 4 6   ? 40.997 85.197  20.986  1.00 41.51 ? 6    HIS B ND1   1 
ATOM   5830 C  CD2   . HIS D 4 6   ? 39.600 86.846  20.660  1.00 40.08 ? 6    HIS B CD2   1 
ATOM   5831 C  CE1   . HIS D 4 6   ? 40.618 85.630  22.176  1.00 42.08 ? 6    HIS B CE1   1 
ATOM   5832 N  NE2   . HIS D 4 6   ? 39.771 86.630  22.006  1.00 41.37 ? 6    HIS B NE2   1 
ATOM   5833 N  N     . LEU D 4 7   ? 43.340 85.845  16.196  1.00 30.67 ? 7    LEU B N     1 
ATOM   5834 C  CA    . LEU D 4 7   ? 43.711 85.671  14.800  1.00 28.27 ? 7    LEU B CA    1 
ATOM   5835 C  C     . LEU D 4 7   ? 43.280 84.343  14.186  1.00 27.32 ? 7    LEU B C     1 
ATOM   5836 O  O     . LEU D 4 7   ? 42.969 83.385  14.895  1.00 26.86 ? 7    LEU B O     1 
ATOM   5837 C  CB    . LEU D 4 7   ? 45.231 85.787  14.671  1.00 26.73 ? 7    LEU B CB    1 
ATOM   5838 C  CG    . LEU D 4 7   ? 45.901 87.040  15.242  1.00 28.02 ? 7    LEU B CG    1 
ATOM   5839 C  CD1   . LEU D 4 7   ? 47.377 86.761  15.556  1.00 24.13 ? 7    LEU B CD1   1 
ATOM   5840 C  CD2   . LEU D 4 7   ? 45.736 88.186  14.252  1.00 26.98 ? 7    LEU B CD2   1 
ATOM   5841 N  N     . THR D 4 8   ? 43.265 84.300  12.858  1.00 25.89 ? 8    THR B N     1 
ATOM   5842 C  CA    . THR D 4 8   ? 42.953 83.069  12.129  1.00 27.13 ? 8    THR B CA    1 
ATOM   5843 C  C     . THR D 4 8   ? 44.065 83.008  11.114  1.00 26.88 ? 8    THR B C     1 
ATOM   5844 O  O     . THR D 4 8   ? 44.769 83.997  10.922  1.00 27.50 ? 8    THR B O     1 
ATOM   5845 C  CB    . THR D 4 8   ? 41.604 83.110  11.350  1.00 25.53 ? 8    THR B CB    1 
ATOM   5846 O  OG1   . THR D 4 8   ? 41.638 84.167  10.388  1.00 26.28 ? 8    THR B OG1   1 
ATOM   5847 C  CG2   . THR D 4 8   ? 40.423 83.306  12.296  1.00 25.48 ? 8    THR B CG2   1 
ATOM   5848 N  N     . ASP D 4 9   ? 44.246 81.864  10.472  1.00 28.69 ? 9    ASP B N     1 
ATOM   5849 C  CA    . ASP D 4 9   ? 45.287 81.774  9.460   1.00 30.01 ? 9    ASP B CA    1 
ATOM   5850 C  C     . ASP D 4 9   ? 45.050 82.808  8.363   1.00 30.58 ? 9    ASP B C     1 
ATOM   5851 O  O     . ASP D 4 9   ? 45.988 83.470  7.917   1.00 30.50 ? 9    ASP B O     1 
ATOM   5852 C  CB    . ASP D 4 9   ? 45.342 80.369  8.839   1.00 31.15 ? 9    ASP B CB    1 
ATOM   5853 C  CG    . ASP D 4 9   ? 46.123 79.373  9.699   1.00 31.65 ? 9    ASP B CG    1 
ATOM   5854 O  OD1   . ASP D 4 9   ? 47.140 79.777  10.309  1.00 28.70 ? 9    ASP B OD1   1 
ATOM   5855 O  OD2   . ASP D 4 9   ? 45.729 78.186  9.748   1.00 31.54 ? 9    ASP B OD2   1 
ATOM   5856 N  N     . ASP D 4 10  ? 43.792 82.960  7.951   1.00 30.72 ? 10   ASP B N     1 
ATOM   5857 C  CA    . ASP D 4 10  ? 43.437 83.895  6.884   1.00 31.48 ? 10   ASP B CA    1 
ATOM   5858 C  C     . ASP D 4 10  ? 43.448 85.374  7.237   1.00 32.28 ? 10   ASP B C     1 
ATOM   5859 O  O     . ASP D 4 10  ? 43.502 86.216  6.343   1.00 31.68 ? 10   ASP B O     1 
ATOM   5860 C  CB    . ASP D 4 10  ? 42.064 83.547  6.304   1.00 31.89 ? 10   ASP B CB    1 
ATOM   5861 C  CG    . ASP D 4 10  ? 42.059 82.215  5.589   1.00 33.35 ? 10   ASP B CG    1 
ATOM   5862 O  OD1   . ASP D 4 10  ? 43.156 81.720  5.251   1.00 34.77 ? 10   ASP B OD1   1 
ATOM   5863 O  OD2   . ASP D 4 10  ? 40.961 81.669  5.358   1.00 33.73 ? 10   ASP B OD2   1 
ATOM   5864 N  N     . SER D 4 11  ? 43.391 85.703  8.523   1.00 32.18 ? 11   SER B N     1 
ATOM   5865 C  CA    . SER D 4 11  ? 43.393 87.107  8.916   1.00 33.18 ? 11   SER B CA    1 
ATOM   5866 C  C     . SER D 4 11  ? 44.762 87.573  9.401   1.00 33.41 ? 11   SER B C     1 
ATOM   5867 O  O     . SER D 4 11  ? 44.959 88.757  9.669   1.00 33.91 ? 11   SER B O     1 
ATOM   5868 C  CB    . SER D 4 11  ? 42.358 87.355  10.022  1.00 32.93 ? 11   SER B CB    1 
ATOM   5869 O  OG    . SER D 4 11  ? 42.841 86.947  11.291  1.00 31.78 ? 11   SER B OG    1 
ATOM   5870 N  N     . PHE D 4 12  ? 45.709 86.645  9.495   1.00 34.01 ? 12   PHE B N     1 
ATOM   5871 C  CA    . PHE D 4 12  ? 47.037 86.968  9.995   1.00 34.25 ? 12   PHE B CA    1 
ATOM   5872 C  C     . PHE D 4 12  ? 47.765 88.081  9.248   1.00 34.99 ? 12   PHE B C     1 
ATOM   5873 O  O     . PHE D 4 12  ? 48.195 89.060  9.855   1.00 34.51 ? 12   PHE B O     1 
ATOM   5874 C  CB    . PHE D 4 12  ? 47.908 85.712  10.022  1.00 33.46 ? 12   PHE B CB    1 
ATOM   5875 C  CG    . PHE D 4 12  ? 49.135 85.846  10.887  1.00 32.19 ? 12   PHE B CG    1 
ATOM   5876 C  CD1   . PHE D 4 12  ? 50.306 86.405  10.383  1.00 32.19 ? 12   PHE B CD1   1 
ATOM   5877 C  CD2   . PHE D 4 12  ? 49.108 85.430  12.218  1.00 30.78 ? 12   PHE B CD2   1 
ATOM   5878 C  CE1   . PHE D 4 12  ? 51.433 86.549  11.191  1.00 31.51 ? 12   PHE B CE1   1 
ATOM   5879 C  CE2   . PHE D 4 12  ? 50.224 85.569  13.030  1.00 30.46 ? 12   PHE B CE2   1 
ATOM   5880 C  CZ    . PHE D 4 12  ? 51.390 86.130  12.518  1.00 30.27 ? 12   PHE B CZ    1 
ATOM   5881 N  N     . ASP D 4 13  ? 47.900 87.935  7.938   1.00 35.62 ? 13   ASP B N     1 
ATOM   5882 C  CA    . ASP D 4 13  ? 48.600 88.934  7.145   1.00 37.55 ? 13   ASP B CA    1 
ATOM   5883 C  C     . ASP D 4 13  ? 48.125 90.365  7.389   1.00 37.63 ? 13   ASP B C     1 
ATOM   5884 O  O     . ASP D 4 13  ? 48.912 91.211  7.819   1.00 36.83 ? 13   ASP B O     1 
ATOM   5885 C  CB    . ASP D 4 13  ? 48.498 88.589  5.655   1.00 39.75 ? 13   ASP B CB    1 
ATOM   5886 C  CG    . ASP D 4 13  ? 49.418 89.438  4.797   1.00 42.01 ? 13   ASP B CG    1 
ATOM   5887 O  OD1   . ASP D 4 13  ? 49.136 90.645  4.627   1.00 44.39 ? 13   ASP B OD1   1 
ATOM   5888 O  OD2   . ASP D 4 13  ? 50.431 88.901  4.297   1.00 43.14 ? 13   ASP B OD2   1 
ATOM   5889 N  N     . THR D 4 14  ? 46.845 90.641  7.145   1.00 38.41 ? 14   THR B N     1 
ATOM   5890 C  CA    . THR D 4 14  ? 46.335 92.002  7.340   1.00 39.36 ? 14   THR B CA    1 
ATOM   5891 C  C     . THR D 4 14  ? 46.268 92.450  8.807   1.00 38.63 ? 14   THR B C     1 
ATOM   5892 O  O     . THR D 4 14  ? 46.432 93.635  9.097   1.00 39.55 ? 14   THR B O     1 
ATOM   5893 C  CB    . THR D 4 14  ? 44.924 92.198  6.691   1.00 40.00 ? 14   THR B CB    1 
ATOM   5894 O  OG1   . THR D 4 14  ? 43.917 91.619  7.524   1.00 41.88 ? 14   THR B OG1   1 
ATOM   5895 C  CG2   . THR D 4 14  ? 44.866 91.541  5.324   1.00 39.64 ? 14   THR B CG2   1 
ATOM   5896 N  N     . ASP D 4 15  ? 46.031 91.520  9.732   1.00 37.94 ? 15   ASP B N     1 
ATOM   5897 C  CA    . ASP D 4 15  ? 45.949 91.882  11.152  1.00 38.04 ? 15   ASP B CA    1 
ATOM   5898 C  C     . ASP D 4 15  ? 47.297 92.049  11.851  1.00 37.90 ? 15   ASP B C     1 
ATOM   5899 O  O     . ASP D 4 15  ? 47.409 92.805  12.817  1.00 38.81 ? 15   ASP B O     1 
ATOM   5900 C  CB    . ASP D 4 15  ? 45.121 90.858  11.938  1.00 38.30 ? 15   ASP B CB    1 
ATOM   5901 C  CG    . ASP D 4 15  ? 43.625 91.051  11.764  1.00 38.57 ? 15   ASP B CG    1 
ATOM   5902 O  OD1   . ASP D 4 15  ? 43.206 92.192  11.479  1.00 38.54 ? 15   ASP B OD1   1 
ATOM   5903 O  OD2   . ASP D 4 15  ? 42.867 90.070  11.932  1.00 38.69 ? 15   ASP B OD2   1 
ATOM   5904 N  N     . VAL D 4 16  ? 48.319 91.352  11.369  1.00 37.57 ? 16   VAL B N     1 
ATOM   5905 C  CA    . VAL D 4 16  ? 49.634 91.435  11.987  1.00 37.25 ? 16   VAL B CA    1 
ATOM   5906 C  C     . VAL D 4 16  ? 50.684 92.071  11.087  1.00 38.16 ? 16   VAL B C     1 
ATOM   5907 O  O     . VAL D 4 16  ? 51.228 93.128  11.408  1.00 38.66 ? 16   VAL B O     1 
ATOM   5908 C  CB    . VAL D 4 16  ? 50.150 90.025  12.409  1.00 36.97 ? 16   VAL B CB    1 
ATOM   5909 C  CG1   . VAL D 4 16  ? 51.466 90.158  13.167  1.00 35.12 ? 16   VAL B CG1   1 
ATOM   5910 C  CG2   . VAL D 4 16  ? 49.113 89.313  13.266  1.00 34.99 ? 16   VAL B CG2   1 
ATOM   5911 N  N     . LEU D 4 17  ? 50.960 91.422  9.960   1.00 38.38 ? 17   LEU B N     1 
ATOM   5912 C  CA    . LEU D 4 17  ? 51.972 91.885  9.018   1.00 40.01 ? 17   LEU B CA    1 
ATOM   5913 C  C     . LEU D 4 17  ? 51.745 93.261  8.387   1.00 41.69 ? 17   LEU B C     1 
ATOM   5914 O  O     . LEU D 4 17  ? 52.655 93.815  7.773   1.00 42.41 ? 17   LEU B O     1 
ATOM   5915 C  CB    . LEU D 4 17  ? 52.162 90.841  7.909   1.00 38.38 ? 17   LEU B CB    1 
ATOM   5916 C  CG    . LEU D 4 17  ? 52.578 89.429  8.345   1.00 39.08 ? 17   LEU B CG    1 
ATOM   5917 C  CD1   . LEU D 4 17  ? 52.859 88.576  7.110   1.00 36.53 ? 17   LEU B CD1   1 
ATOM   5918 C  CD2   . LEU D 4 17  ? 53.818 89.493  9.237   1.00 38.42 ? 17   LEU B CD2   1 
ATOM   5919 N  N     . LYS D 4 18  ? 50.548 93.818  8.534   1.00 43.64 ? 18   LYS B N     1 
ATOM   5920 C  CA    . LYS D 4 18  ? 50.258 95.124  7.952   1.00 45.73 ? 18   LYS B CA    1 
ATOM   5921 C  C     . LYS D 4 18  ? 49.690 96.098  8.969   1.00 48.02 ? 18   LYS B C     1 
ATOM   5922 O  O     . LYS D 4 18  ? 49.381 97.238  8.632   1.00 49.18 ? 18   LYS B O     1 
ATOM   5923 C  CB    . LYS D 4 18  ? 49.248 94.991  6.814   1.00 45.95 ? 18   LYS B CB    1 
ATOM   5924 C  CG    . LYS D 4 18  ? 49.697 94.167  5.626   1.00 46.82 ? 18   LYS B CG    1 
ATOM   5925 C  CD    . LYS D 4 18  ? 48.579 94.143  4.590   1.00 48.02 ? 18   LYS B CD    1 
ATOM   5926 C  CE    . LYS D 4 18  ? 48.920 93.263  3.401   1.00 49.83 ? 18   LYS B CE    1 
ATOM   5927 N  NZ    . LYS D 4 18  ? 47.790 93.203  2.426   1.00 50.74 ? 18   LYS B NZ    1 
ATOM   5928 N  N     . ALA D 4 19  ? 49.538 95.655  10.210  1.00 50.00 ? 19   ALA B N     1 
ATOM   5929 C  CA    . ALA D 4 19  ? 48.977 96.516  11.242  1.00 52.38 ? 19   ALA B CA    1 
ATOM   5930 C  C     . ALA D 4 19  ? 49.873 97.701  11.571  1.00 54.32 ? 19   ALA B C     1 
ATOM   5931 O  O     . ALA D 4 19  ? 49.476 98.588  12.329  1.00 54.87 ? 19   ALA B O     1 
ATOM   5932 C  CB    . ALA D 4 19  ? 48.700 95.709  12.499  1.00 52.76 ? 19   ALA B CB    1 
ATOM   5933 N  N     . ASP D 4 20  ? 51.074 97.713  10.997  1.00 56.10 ? 20   ASP B N     1 
ATOM   5934 C  CA    . ASP D 4 20  ? 52.036 98.787  11.233  1.00 58.25 ? 20   ASP B CA    1 
ATOM   5935 C  C     . ASP D 4 20  ? 51.864 99.431  12.611  1.00 57.92 ? 20   ASP B C     1 
ATOM   5936 O  O     . ASP D 4 20  ? 51.130 100.410 12.787  1.00 57.13 ? 20   ASP B O     1 
ATOM   5937 C  CB    . ASP D 4 20  ? 51.937 99.837  10.119  1.00 60.63 ? 20   ASP B CB    1 
ATOM   5938 C  CG    . ASP D 4 20  ? 52.571 99.363  8.815   1.00 62.57 ? 20   ASP B CG    1 
ATOM   5939 O  OD1   . ASP D 4 20  ? 52.207 98.263  8.339   1.00 63.01 ? 20   ASP B OD1   1 
ATOM   5940 O  OD2   . ASP D 4 20  ? 53.435 100.087 8.269   1.00 62.70 ? 20   ASP B OD2   1 
ATOM   5941 N  N     . GLY D 4 21  ? 52.558 98.845  13.582  1.00 57.81 ? 21   GLY B N     1 
ATOM   5942 C  CA    . GLY D 4 21  ? 52.513 99.296  14.961  1.00 55.51 ? 21   GLY B CA    1 
ATOM   5943 C  C     . GLY D 4 21  ? 53.069 98.141  15.771  1.00 54.37 ? 21   GLY B C     1 
ATOM   5944 O  O     . GLY D 4 21  ? 53.637 97.213  15.193  1.00 54.69 ? 21   GLY B O     1 
ATOM   5945 N  N     . ALA D 4 22  ? 52.916 98.172  17.091  1.00 51.80 ? 22   ALA B N     1 
ATOM   5946 C  CA    . ALA D 4 22  ? 53.432 97.081  17.914  1.00 50.39 ? 22   ALA B CA    1 
ATOM   5947 C  C     . ALA D 4 22  ? 52.370 96.008  18.167  1.00 48.82 ? 22   ALA B C     1 
ATOM   5948 O  O     . ALA D 4 22  ? 51.305 96.289  18.730  1.00 48.56 ? 22   ALA B O     1 
ATOM   5949 C  CB    . ALA D 4 22  ? 53.959 97.624  19.235  1.00 50.30 ? 22   ALA B CB    1 
ATOM   5950 N  N     . ILE D 4 23  ? 52.667 94.779  17.747  1.00 46.78 ? 23   ILE B N     1 
ATOM   5951 C  CA    . ILE D 4 23  ? 51.742 93.662  17.925  1.00 44.29 ? 23   ILE B CA    1 
ATOM   5952 C  C     . ILE D 4 23  ? 52.420 92.450  18.567  1.00 41.38 ? 23   ILE B C     1 
ATOM   5953 O  O     . ILE D 4 23  ? 53.380 91.904  18.027  1.00 39.60 ? 23   ILE B O     1 
ATOM   5954 C  CB    . ILE D 4 23  ? 51.142 93.192  16.571  1.00 45.26 ? 23   ILE B CB    1 
ATOM   5955 C  CG1   . ILE D 4 23  ? 50.645 94.387  15.756  1.00 45.47 ? 23   ILE B CG1   1 
ATOM   5956 C  CG2   . ILE D 4 23  ? 49.988 92.228  16.827  1.00 44.52 ? 23   ILE B CG2   1 
ATOM   5957 C  CD1   . ILE D 4 23  ? 49.476 95.121  16.379  1.00 47.58 ? 23   ILE B CD1   1 
ATOM   5958 N  N     . LEU D 4 24  ? 51.916 92.030  19.720  1.00 39.26 ? 24   LEU B N     1 
ATOM   5959 C  CA    . LEU D 4 24  ? 52.468 90.860  20.394  1.00 37.80 ? 24   LEU B CA    1 
ATOM   5960 C  C     . LEU D 4 24  ? 51.596 89.648  20.063  1.00 36.78 ? 24   LEU B C     1 
ATOM   5961 O  O     . LEU D 4 24  ? 50.424 89.603  20.444  1.00 35.72 ? 24   LEU B O     1 
ATOM   5962 C  CB    . LEU D 4 24  ? 52.486 91.064  21.910  1.00 37.79 ? 24   LEU B CB    1 
ATOM   5963 C  CG    . LEU D 4 24  ? 52.968 89.828  22.672  1.00 38.19 ? 24   LEU B CG    1 
ATOM   5964 C  CD1   . LEU D 4 24  ? 54.419 89.558  22.319  1.00 37.10 ? 24   LEU B CD1   1 
ATOM   5965 C  CD2   . LEU D 4 24  ? 52.807 90.040  24.166  1.00 38.83 ? 24   LEU B CD2   1 
ATOM   5966 N  N     . VAL D 4 25  ? 52.162 88.673  19.357  1.00 35.26 ? 25   VAL B N     1 
ATOM   5967 C  CA    . VAL D 4 25  ? 51.410 87.475  18.988  1.00 34.23 ? 25   VAL B CA    1 
ATOM   5968 C  C     . VAL D 4 25  ? 51.775 86.279  19.858  1.00 33.16 ? 25   VAL B C     1 
ATOM   5969 O  O     . VAL D 4 25  ? 52.954 85.981  20.072  1.00 33.70 ? 25   VAL B O     1 
ATOM   5970 C  CB    . VAL D 4 25  ? 51.646 87.079  17.512  1.00 33.33 ? 25   VAL B CB    1 
ATOM   5971 C  CG1   . VAL D 4 25  ? 50.860 85.814  17.182  1.00 32.14 ? 25   VAL B CG1   1 
ATOM   5972 C  CG2   . VAL D 4 25  ? 51.229 88.216  16.594  1.00 33.61 ? 25   VAL B CG2   1 
ATOM   5973 N  N     . ASP D 4 26  ? 50.750 85.597  20.351  1.00 31.61 ? 26   ASP B N     1 
ATOM   5974 C  CA    . ASP D 4 26  ? 50.941 84.423  21.182  1.00 31.04 ? 26   ASP B CA    1 
ATOM   5975 C  C     . ASP D 4 26  ? 50.423 83.147  20.506  1.00 30.41 ? 26   ASP B C     1 
ATOM   5976 O  O     . ASP D 4 26  ? 49.220 82.965  20.346  1.00 30.07 ? 26   ASP B O     1 
ATOM   5977 C  CB    . ASP D 4 26  ? 50.252 84.634  22.534  1.00 29.82 ? 26   ASP B CB    1 
ATOM   5978 C  CG    . ASP D 4 26  ? 50.037 83.336  23.298  1.00 29.58 ? 26   ASP B CG    1 
ATOM   5979 O  OD1   . ASP D 4 26  ? 50.916 82.450  23.255  1.00 29.76 ? 26   ASP B OD1   1 
ATOM   5980 O  OD2   . ASP D 4 26  ? 48.987 83.207  23.958  1.00 29.86 ? 26   ASP B OD2   1 
ATOM   5981 N  N     . PHE D 4 27  ? 51.343 82.279  20.093  1.00 29.72 ? 27   PHE B N     1 
ATOM   5982 C  CA    . PHE D 4 27  ? 50.979 81.006  19.476  1.00 30.38 ? 27   PHE B CA    1 
ATOM   5983 C  C     . PHE D 4 27  ? 50.769 79.994  20.598  1.00 30.94 ? 27   PHE B C     1 
ATOM   5984 O  O     . PHE D 4 27  ? 51.698 79.685  21.341  1.00 31.23 ? 27   PHE B O     1 
ATOM   5985 C  CB    . PHE D 4 27  ? 52.085 80.527  18.542  1.00 29.81 ? 27   PHE B CB    1 
ATOM   5986 C  CG    . PHE D 4 27  ? 52.319 81.438  17.379  1.00 30.66 ? 27   PHE B CG    1 
ATOM   5987 C  CD1   . PHE D 4 27  ? 53.076 82.593  17.527  1.00 31.60 ? 27   PHE B CD1   1 
ATOM   5988 C  CD2   . PHE D 4 27  ? 51.755 81.160  16.140  1.00 31.46 ? 27   PHE B CD2   1 
ATOM   5989 C  CE1   . PHE D 4 27  ? 53.270 83.458  16.458  1.00 31.99 ? 27   PHE B CE1   1 
ATOM   5990 C  CE2   . PHE D 4 27  ? 51.941 82.019  15.060  1.00 32.17 ? 27   PHE B CE2   1 
ATOM   5991 C  CZ    . PHE D 4 27  ? 52.701 83.172  15.220  1.00 33.29 ? 27   PHE B CZ    1 
ATOM   5992 N  N     . TRP D 4 28  ? 49.550 79.480  20.720  1.00 31.31 ? 28   TRP B N     1 
ATOM   5993 C  CA    . TRP D 4 28  ? 49.236 78.546  21.793  1.00 32.42 ? 28   TRP B CA    1 
ATOM   5994 C  C     . TRP D 4 28  ? 48.346 77.375  21.370  1.00 33.65 ? 28   TRP B C     1 
ATOM   5995 O  O     . TRP D 4 28  ? 47.842 77.329  20.244  1.00 33.72 ? 28   TRP B O     1 
ATOM   5996 C  CB    . TRP D 4 28  ? 48.543 79.305  22.929  1.00 31.45 ? 28   TRP B CB    1 
ATOM   5997 C  CG    . TRP D 4 28  ? 47.233 79.882  22.506  1.00 30.76 ? 28   TRP B CG    1 
ATOM   5998 C  CD1   . TRP D 4 28  ? 47.031 80.926  21.647  1.00 30.26 ? 28   TRP B CD1   1 
ATOM   5999 C  CD2   . TRP D 4 28  ? 45.934 79.396  22.859  1.00 30.46 ? 28   TRP B CD2   1 
ATOM   6000 N  NE1   . TRP D 4 28  ? 45.684 81.116  21.439  1.00 28.81 ? 28   TRP B NE1   1 
ATOM   6001 C  CE2   . TRP D 4 28  ? 44.989 80.191  22.173  1.00 29.42 ? 28   TRP B CE2   1 
ATOM   6002 C  CE3   . TRP D 4 28  ? 45.477 78.365  23.690  1.00 32.76 ? 28   TRP B CE3   1 
ATOM   6003 C  CZ2   . TRP D 4 28  ? 43.612 79.986  22.291  1.00 30.62 ? 28   TRP B CZ2   1 
ATOM   6004 C  CZ3   . TRP D 4 28  ? 44.098 78.161  23.809  1.00 33.63 ? 28   TRP B CZ3   1 
ATOM   6005 C  CH2   . TRP D 4 28  ? 43.187 78.970  23.112  1.00 31.85 ? 28   TRP B CH2   1 
ATOM   6006 N  N     . ALA D 4 29  ? 48.155 76.441  22.301  1.00 34.10 ? 29   ALA B N     1 
ATOM   6007 C  CA    . ALA D 4 29  ? 47.324 75.255  22.094  1.00 35.96 ? 29   ALA B CA    1 
ATOM   6008 C  C     . ALA D 4 29  ? 46.665 74.964  23.433  1.00 37.17 ? 29   ALA B C     1 
ATOM   6009 O  O     . ALA D 4 29  ? 47.291 75.146  24.475  1.00 37.67 ? 29   ALA B O     1 
ATOM   6010 C  CB    . ALA D 4 29  ? 48.182 74.068  21.652  1.00 34.68 ? 29   ALA B CB    1 
ATOM   6011 N  N     . GLU D 4 30  ? 45.413 74.510  23.404  1.00 38.82 ? 30   GLU B N     1 
ATOM   6012 C  CA    . GLU D 4 30  ? 44.661 74.229  24.626  1.00 40.70 ? 30   GLU B CA    1 
ATOM   6013 C  C     . GLU D 4 30  ? 45.277 73.165  25.535  1.00 40.88 ? 30   GLU B C     1 
ATOM   6014 O  O     . GLU D 4 30  ? 45.088 73.202  26.752  1.00 40.92 ? 30   GLU B O     1 
ATOM   6015 C  CB    . GLU D 4 30  ? 43.221 73.812  24.287  1.00 43.20 ? 30   GLU B CB    1 
ATOM   6016 C  CG    . GLU D 4 30  ? 42.495 74.732  23.307  1.00 47.72 ? 30   GLU B CG    1 
ATOM   6017 C  CD    . GLU D 4 30  ? 40.977 74.527  23.305  1.00 49.67 ? 30   GLU B CD    1 
ATOM   6018 O  OE1   . GLU D 4 30  ? 40.304 75.052  24.221  1.00 49.62 ? 30   GLU B OE1   1 
ATOM   6019 O  OE2   . GLU D 4 30  ? 40.458 73.837  22.394  1.00 50.34 ? 30   GLU B OE2   1 
ATOM   6020 N  N     . TRP D 4 31  ? 46.005 72.219  24.951  1.00 39.97 ? 31   TRP B N     1 
ATOM   6021 C  CA    . TRP D 4 31  ? 46.613 71.143  25.729  1.00 39.17 ? 31   TRP B CA    1 
ATOM   6022 C  C     . TRP D 4 31  ? 47.979 71.469  26.317  1.00 38.92 ? 31   TRP B C     1 
ATOM   6023 O  O     . TRP D 4 31  ? 48.686 70.571  26.770  1.00 37.75 ? 31   TRP B O     1 
ATOM   6024 C  CB    . TRP D 4 31  ? 46.735 69.875  24.876  1.00 39.29 ? 31   TRP B CB    1 
ATOM   6025 C  CG    . TRP D 4 31  ? 47.158 70.142  23.468  1.00 38.64 ? 31   TRP B CG    1 
ATOM   6026 C  CD1   . TRP D 4 31  ? 46.343 70.356  22.397  1.00 38.35 ? 31   TRP B CD1   1 
ATOM   6027 C  CD2   . TRP D 4 31  ? 48.500 70.264  22.983  1.00 38.93 ? 31   TRP B CD2   1 
ATOM   6028 N  NE1   . TRP D 4 31  ? 47.090 70.604  21.273  1.00 38.19 ? 31   TRP B NE1   1 
ATOM   6029 C  CE2   . TRP D 4 31  ? 48.418 70.554  21.602  1.00 38.84 ? 31   TRP B CE2   1 
ATOM   6030 C  CE3   . TRP D 4 31  ? 49.763 70.162  23.581  1.00 39.03 ? 31   TRP B CE3   1 
ATOM   6031 C  CZ2   . TRP D 4 31  ? 49.553 70.741  20.806  1.00 38.47 ? 31   TRP B CZ2   1 
ATOM   6032 C  CZ3   . TRP D 4 31  ? 50.894 70.349  22.790  1.00 39.77 ? 31   TRP B CZ3   1 
ATOM   6033 C  CH2   . TRP D 4 31  ? 50.778 70.636  21.415  1.00 39.91 ? 31   TRP B CH2   1 
ATOM   6034 N  N     . CYS D 4 32  ? 48.350 72.743  26.323  1.00 38.36 ? 32   CYS B N     1 
ATOM   6035 C  CA    . CYS D 4 32  ? 49.648 73.132  26.854  1.00 37.79 ? 32   CYS B CA    1 
ATOM   6036 C  C     . CYS D 4 32  ? 49.547 73.815  28.217  1.00 38.20 ? 32   CYS B C     1 
ATOM   6037 O  O     . CYS D 4 32  ? 48.865 74.830  28.366  1.00 38.11 ? 32   CYS B O     1 
ATOM   6038 C  CB    . CYS D 4 32  ? 50.359 74.054  25.861  1.00 36.73 ? 32   CYS B CB    1 
ATOM   6039 S  SG    . CYS D 4 32  ? 51.966 74.643  26.427  1.00 35.50 ? 32   CYS B SG    1 
ATOM   6040 N  N     . GLY D 4 33  ? 50.234 73.250  29.207  1.00 38.19 ? 33   GLY B N     1 
ATOM   6041 C  CA    . GLY D 4 33  ? 50.221 73.814  30.546  1.00 37.94 ? 33   GLY B CA    1 
ATOM   6042 C  C     . GLY D 4 33  ? 50.723 75.248  30.579  1.00 38.35 ? 33   GLY B C     1 
ATOM   6043 O  O     . GLY D 4 33  ? 50.010 76.138  31.040  1.00 38.03 ? 33   GLY B O     1 
ATOM   6044 N  N     . PRO D 4 34  ? 51.953 75.509  30.103  1.00 38.36 ? 34   PRO B N     1 
ATOM   6045 C  CA    . PRO D 4 34  ? 52.496 76.871  30.102  1.00 37.41 ? 34   PRO B CA    1 
ATOM   6046 C  C     . PRO D 4 34  ? 51.568 77.864  29.392  1.00 37.37 ? 34   PRO B C     1 
ATOM   6047 O  O     . PRO D 4 34  ? 51.391 78.999  29.852  1.00 35.40 ? 34   PRO B O     1 
ATOM   6048 C  CB    . PRO D 4 34  ? 53.836 76.706  29.385  1.00 37.75 ? 34   PRO B CB    1 
ATOM   6049 C  CG    . PRO D 4 34  ? 54.256 75.321  29.781  1.00 37.39 ? 34   PRO B CG    1 
ATOM   6050 C  CD    . PRO D 4 34  ? 52.964 74.538  29.644  1.00 38.22 ? 34   PRO B CD    1 
ATOM   6051 N  N     . CYS D 4 35  ? 50.985 77.437  28.271  1.00 37.77 ? 35   CYS B N     1 
ATOM   6052 C  CA    . CYS D 4 35  ? 50.068 78.295  27.510  1.00 38.90 ? 35   CYS B CA    1 
ATOM   6053 C  C     . CYS D 4 35  ? 48.909 78.725  28.401  1.00 39.84 ? 35   CYS B C     1 
ATOM   6054 O  O     . CYS D 4 35  ? 48.484 79.880  28.371  1.00 40.36 ? 35   CYS B O     1 
ATOM   6055 C  CB    . CYS D 4 35  ? 49.518 77.562  26.276  1.00 36.13 ? 35   CYS B CB    1 
ATOM   6056 S  SG    . CYS D 4 35  ? 50.678 77.409  24.895  1.00 34.28 ? 35   CYS B SG    1 
ATOM   6057 N  N     . LYS D 4 36  ? 48.403 77.788  29.194  1.00 41.27 ? 36   LYS B N     1 
ATOM   6058 C  CA    . LYS D 4 36  ? 47.306 78.078  30.102  1.00 43.68 ? 36   LYS B CA    1 
ATOM   6059 C  C     . LYS D 4 36  ? 47.783 79.011  31.214  1.00 44.07 ? 36   LYS B C     1 
ATOM   6060 O  O     . LYS D 4 36  ? 46.988 79.730  31.815  1.00 43.72 ? 36   LYS B O     1 
ATOM   6061 C  CB    . LYS D 4 36  ? 46.760 76.783  30.710  1.00 45.47 ? 36   LYS B CB    1 
ATOM   6062 C  CG    . LYS D 4 36  ? 45.655 77.021  31.728  1.00 49.94 ? 36   LYS B CG    1 
ATOM   6063 C  CD    . LYS D 4 36  ? 45.131 75.726  32.339  1.00 52.40 ? 36   LYS B CD    1 
ATOM   6064 C  CE    . LYS D 4 36  ? 44.112 76.017  33.439  1.00 52.70 ? 36   LYS B CE    1 
ATOM   6065 N  NZ    . LYS D 4 36  ? 43.596 74.772  34.072  1.00 54.41 ? 36   LYS B NZ    1 
ATOM   6066 N  N     . MET D 4 37  ? 49.089 78.998  31.473  1.00 45.12 ? 37   MET B N     1 
ATOM   6067 C  CA    . MET D 4 37  ? 49.685 79.834  32.512  1.00 45.85 ? 37   MET B CA    1 
ATOM   6068 C  C     . MET D 4 37  ? 49.791 81.312  32.143  1.00 45.74 ? 37   MET B C     1 
ATOM   6069 O  O     . MET D 4 37  ? 49.331 82.171  32.886  1.00 46.57 ? 37   MET B O     1 
ATOM   6070 C  CB    . MET D 4 37  ? 51.084 79.318  32.875  1.00 46.85 ? 37   MET B CB    1 
ATOM   6071 C  CG    . MET D 4 37  ? 51.106 78.071  33.752  1.00 47.50 ? 37   MET B CG    1 
ATOM   6072 S  SD    . MET D 4 37  ? 52.780 77.388  33.905  1.00 50.60 ? 37   MET B SD    1 
ATOM   6073 C  CE    . MET D 4 37  ? 53.590 78.651  34.884  1.00 48.58 ? 37   MET B CE    1 
ATOM   6074 N  N     . ILE D 4 38  ? 50.403 81.608  31.001  1.00 45.31 ? 38   ILE B N     1 
ATOM   6075 C  CA    . ILE D 4 38  ? 50.583 82.991  30.576  1.00 44.59 ? 38   ILE B CA    1 
ATOM   6076 C  C     . ILE D 4 38  ? 49.306 83.642  30.036  1.00 44.44 ? 38   ILE B C     1 
ATOM   6077 O  O     . ILE D 4 38  ? 49.272 84.853  29.795  1.00 42.73 ? 38   ILE B O     1 
ATOM   6078 C  CB    . ILE D 4 38  ? 51.679 83.098  29.495  1.00 44.51 ? 38   ILE B CB    1 
ATOM   6079 C  CG1   . ILE D 4 38  ? 52.125 84.554  29.353  1.00 44.19 ? 38   ILE B CG1   1 
ATOM   6080 C  CG2   . ILE D 4 38  ? 51.145 82.587  28.155  1.00 44.51 ? 38   ILE B CG2   1 
ATOM   6081 C  CD1   . ILE D 4 38  ? 53.323 84.741  28.449  1.00 44.42 ? 38   ILE B CD1   1 
ATOM   6082 N  N     . ALA D 4 39  ? 48.261 82.840  29.852  1.00 43.62 ? 39   ALA B N     1 
ATOM   6083 C  CA    . ALA D 4 39  ? 46.992 83.347  29.334  1.00 43.51 ? 39   ALA B CA    1 
ATOM   6084 C  C     . ALA D 4 39  ? 46.430 84.494  30.183  1.00 44.09 ? 39   ALA B C     1 
ATOM   6085 O  O     . ALA D 4 39  ? 46.159 85.582  29.667  1.00 43.48 ? 39   ALA B O     1 
ATOM   6086 C  CB    . ALA D 4 39  ? 45.974 82.210  29.240  1.00 43.79 ? 39   ALA B CB    1 
ATOM   6087 N  N     . PRO D 4 40  ? 46.243 84.265  31.495  1.00 43.66 ? 40   PRO B N     1 
ATOM   6088 C  CA    . PRO D 4 40  ? 45.709 85.322  32.359  1.00 43.48 ? 40   PRO B CA    1 
ATOM   6089 C  C     . PRO D 4 40  ? 46.585 86.566  32.306  1.00 43.77 ? 40   PRO B C     1 
ATOM   6090 O  O     . PRO D 4 40  ? 46.085 87.691  32.341  1.00 44.63 ? 40   PRO B O     1 
ATOM   6091 C  CB    . PRO D 4 40  ? 45.715 84.671  33.741  1.00 43.69 ? 40   PRO B CB    1 
ATOM   6092 C  CG    . PRO D 4 40  ? 45.509 83.223  33.431  1.00 43.66 ? 40   PRO B CG    1 
ATOM   6093 C  CD    . PRO D 4 40  ? 46.442 83.023  32.260  1.00 43.36 ? 40   PRO B CD    1 
ATOM   6094 N  N     . ILE D 4 41  ? 47.895 86.355  32.213  1.00 43.51 ? 41   ILE B N     1 
ATOM   6095 C  CA    . ILE D 4 41  ? 48.845 87.462  32.157  1.00 43.79 ? 41   ILE B CA    1 
ATOM   6096 C  C     . ILE D 4 41  ? 48.593 88.341  30.941  1.00 43.89 ? 41   ILE B C     1 
ATOM   6097 O  O     . ILE D 4 41  ? 48.668 89.564  31.024  1.00 44.90 ? 41   ILE B O     1 
ATOM   6098 C  CB    . ILE D 4 41  ? 50.309 86.964  32.082  1.00 43.51 ? 41   ILE B CB    1 
ATOM   6099 C  CG1   . ILE D 4 41  ? 50.633 86.073  33.286  1.00 43.32 ? 41   ILE B CG1   1 
ATOM   6100 C  CG2   . ILE D 4 41  ? 51.256 88.158  32.032  1.00 43.78 ? 41   ILE B CG2   1 
ATOM   6101 C  CD1   . ILE D 4 41  ? 50.516 86.769  34.618  1.00 44.35 ? 41   ILE B CD1   1 
ATOM   6102 N  N     . LEU D 4 42  ? 48.298 87.704  29.813  1.00 44.61 ? 42   LEU B N     1 
ATOM   6103 C  CA    . LEU D 4 42  ? 48.047 88.409  28.561  1.00 45.05 ? 42   LEU B CA    1 
ATOM   6104 C  C     . LEU D 4 42  ? 46.782 89.265  28.587  1.00 45.81 ? 42   LEU B C     1 
ATOM   6105 O  O     . LEU D 4 42  ? 46.728 90.316  27.948  1.00 44.76 ? 42   LEU B O     1 
ATOM   6106 C  CB    . LEU D 4 42  ? 47.970 87.401  27.413  1.00 44.08 ? 42   LEU B CB    1 
ATOM   6107 C  CG    . LEU D 4 42  ? 49.260 86.623  27.151  1.00 43.35 ? 42   LEU B CG    1 
ATOM   6108 C  CD1   . LEU D 4 42  ? 49.019 85.560  26.097  1.00 43.50 ? 42   LEU B CD1   1 
ATOM   6109 C  CD2   . LEU D 4 42  ? 50.350 87.586  26.700  1.00 43.49 ? 42   LEU B CD2   1 
ATOM   6110 N  N     . ASP D 4 43  ? 45.766 88.814  29.318  1.00 47.70 ? 43   ASP B N     1 
ATOM   6111 C  CA    . ASP D 4 43  ? 44.519 89.562  29.418  1.00 49.31 ? 43   ASP B CA    1 
ATOM   6112 C  C     . ASP D 4 43  ? 44.752 90.902  30.104  1.00 50.33 ? 43   ASP B C     1 
ATOM   6113 O  O     . ASP D 4 43  ? 44.103 91.897  29.779  1.00 50.19 ? 43   ASP B O     1 
ATOM   6114 C  CB    . ASP D 4 43  ? 43.478 88.772  30.210  1.00 50.42 ? 43   ASP B CB    1 
ATOM   6115 C  CG    . ASP D 4 43  ? 43.031 87.523  29.494  1.00 52.46 ? 43   ASP B CG    1 
ATOM   6116 O  OD1   . ASP D 4 43  ? 42.676 87.619  28.300  1.00 53.31 ? 43   ASP B OD1   1 
ATOM   6117 O  OD2   . ASP D 4 43  ? 43.027 86.444  30.126  1.00 54.42 ? 43   ASP B OD2   1 
ATOM   6118 N  N     . GLU D 4 44  ? 45.685 90.916  31.052  1.00 51.43 ? 44   GLU B N     1 
ATOM   6119 C  CA    . GLU D 4 44  ? 46.005 92.124  31.802  1.00 53.15 ? 44   GLU B CA    1 
ATOM   6120 C  C     . GLU D 4 44  ? 46.939 93.026  31.016  1.00 53.03 ? 44   GLU B C     1 
ATOM   6121 O  O     . GLU D 4 44  ? 46.747 94.240  30.980  1.00 54.28 ? 44   GLU B O     1 
ATOM   6122 C  CB    . GLU D 4 44  ? 46.631 91.755  33.151  1.00 54.51 ? 44   GLU B CB    1 
ATOM   6123 C  CG    . GLU D 4 44  ? 45.704 90.923  34.031  1.00 56.32 ? 44   GLU B CG    1 
ATOM   6124 C  CD    . GLU D 4 44  ? 46.351 90.457  35.325  1.00 58.00 ? 44   GLU B CD    1 
ATOM   6125 O  OE1   . GLU D 4 44  ? 45.702 89.678  36.057  1.00 58.88 ? 44   GLU B OE1   1 
ATOM   6126 O  OE2   . GLU D 4 44  ? 47.499 90.865  35.613  1.00 58.68 ? 44   GLU B OE2   1 
ATOM   6127 N  N     . ILE D 4 45  ? 47.950 92.438  30.388  1.00 52.64 ? 45   ILE B N     1 
ATOM   6128 C  CA    . ILE D 4 45  ? 48.883 93.223  29.591  1.00 52.35 ? 45   ILE B CA    1 
ATOM   6129 C  C     . ILE D 4 45  ? 48.088 93.986  28.538  1.00 53.06 ? 45   ILE B C     1 
ATOM   6130 O  O     . ILE D 4 45  ? 48.356 95.154  28.268  1.00 53.63 ? 45   ILE B O     1 
ATOM   6131 C  CB    . ILE D 4 45  ? 49.912 92.326  28.867  1.00 52.08 ? 45   ILE B CB    1 
ATOM   6132 C  CG1   . ILE D 4 45  ? 50.790 91.595  29.888  1.00 52.76 ? 45   ILE B CG1   1 
ATOM   6133 C  CG2   . ILE D 4 45  ? 50.762 93.166  27.927  1.00 51.37 ? 45   ILE B CG2   1 
ATOM   6134 C  CD1   . ILE D 4 45  ? 51.623 92.511  30.767  1.00 52.24 ? 45   ILE B CD1   1 
ATOM   6135 N  N     . ALA D 4 46  ? 47.095 93.314  27.963  1.00 53.60 ? 46   ALA B N     1 
ATOM   6136 C  CA    . ALA D 4 46  ? 46.254 93.899  26.927  1.00 54.57 ? 46   ALA B CA    1 
ATOM   6137 C  C     . ALA D 4 46  ? 45.768 95.313  27.247  1.00 54.91 ? 46   ALA B C     1 
ATOM   6138 O  O     . ALA D 4 46  ? 46.204 96.267  26.606  1.00 55.04 ? 46   ALA B O     1 
ATOM   6139 C  CB    . ALA D 4 46  ? 45.061 92.982  26.642  1.00 54.36 ? 46   ALA B CB    1 
ATOM   6140 N  N     . ASP D 4 47  ? 44.877 95.461  28.228  1.00 55.15 ? 47   ASP B N     1 
ATOM   6141 C  CA    . ASP D 4 47  ? 44.365 96.792  28.564  1.00 55.60 ? 47   ASP B CA    1 
ATOM   6142 C  C     . ASP D 4 47  ? 45.403 97.738  29.158  1.00 55.56 ? 47   ASP B C     1 
ATOM   6143 O  O     . ASP D 4 47  ? 45.297 98.952  28.989  1.00 55.74 ? 47   ASP B O     1 
ATOM   6144 C  CB    . ASP D 4 47  ? 43.150 96.705  29.501  1.00 56.38 ? 47   ASP B CB    1 
ATOM   6145 C  CG    . ASP D 4 47  ? 43.377 95.784  30.678  1.00 57.02 ? 47   ASP B CG    1 
ATOM   6146 O  OD1   . ASP D 4 47  ? 43.537 94.567  30.449  1.00 57.56 ? 47   ASP B OD1   1 
ATOM   6147 O  OD2   . ASP D 4 47  ? 43.391 96.274  31.830  1.00 56.87 ? 47   ASP B OD2   1 
ATOM   6148 N  N     . GLU D 4 48  ? 46.406 97.191  29.841  1.00 55.39 ? 48   GLU B N     1 
ATOM   6149 C  CA    . GLU D 4 48  ? 47.456 98.017  30.436  1.00 55.72 ? 48   GLU B CA    1 
ATOM   6150 C  C     . GLU D 4 48  ? 48.327 98.706  29.385  1.00 55.90 ? 48   GLU B C     1 
ATOM   6151 O  O     . GLU D 4 48  ? 48.802 99.822  29.601  1.00 56.19 ? 48   GLU B O     1 
ATOM   6152 C  CB    . GLU D 4 48  ? 48.344 97.179  31.360  1.00 55.73 ? 48   GLU B CB    1 
ATOM   6153 C  CG    . GLU D 4 48  ? 47.765 96.953  32.745  1.00 55.92 ? 48   GLU B CG    1 
ATOM   6154 C  CD    . GLU D 4 48  ? 48.650 96.073  33.610  1.00 57.00 ? 48   GLU B CD    1 
ATOM   6155 O  OE1   . GLU D 4 48  ? 49.879 96.314  33.651  1.00 57.23 ? 48   GLU B OE1   1 
ATOM   6156 O  OE2   . GLU D 4 48  ? 48.115 95.147  34.257  1.00 57.59 ? 48   GLU B OE2   1 
ATOM   6157 N  N     . TYR D 4 49  ? 48.548 98.039  28.255  1.00 55.61 ? 49   TYR B N     1 
ATOM   6158 C  CA    . TYR D 4 49  ? 49.360 98.610  27.184  1.00 55.80 ? 49   TYR B CA    1 
ATOM   6159 C  C     . TYR D 4 49  ? 48.471 99.107  26.054  1.00 55.48 ? 49   TYR B C     1 
ATOM   6160 O  O     . TYR D 4 49  ? 48.945 99.466  24.973  1.00 54.34 ? 49   TYR B O     1 
ATOM   6161 C  CB    . TYR D 4 49  ? 50.363 97.575  26.663  1.00 56.24 ? 49   TYR B CB    1 
ATOM   6162 C  CG    . TYR D 4 49  ? 51.565 97.402  27.568  1.00 56.77 ? 49   TYR B CG    1 
ATOM   6163 C  CD1   . TYR D 4 49  ? 51.414 96.981  28.891  1.00 55.90 ? 49   TYR B CD1   1 
ATOM   6164 C  CD2   . TYR D 4 49  ? 52.851 97.700  27.114  1.00 56.78 ? 49   TYR B CD2   1 
ATOM   6165 C  CE1   . TYR D 4 49  ? 52.513 96.867  29.741  1.00 56.82 ? 49   TYR B CE1   1 
ATOM   6166 C  CE2   . TYR D 4 49  ? 53.958 97.589  27.956  1.00 56.95 ? 49   TYR B CE2   1 
ATOM   6167 C  CZ    . TYR D 4 49  ? 53.782 97.173  29.266  1.00 56.97 ? 49   TYR B CZ    1 
ATOM   6168 O  OH    . TYR D 4 49  ? 54.871 97.068  30.102  1.00 57.20 ? 49   TYR B OH    1 
ATOM   6169 N  N     . GLN D 4 50  ? 47.172 99.125  26.331  1.00 56.44 ? 50   GLN B N     1 
ATOM   6170 C  CA    . GLN D 4 50  ? 46.170 99.578  25.382  1.00 57.60 ? 50   GLN B CA    1 
ATOM   6171 C  C     . GLN D 4 50  ? 46.534 100.987 24.943  1.00 57.91 ? 50   GLN B C     1 
ATOM   6172 O  O     . GLN D 4 50  ? 46.293 101.953 25.666  1.00 58.24 ? 50   GLN B O     1 
ATOM   6173 C  CB    . GLN D 4 50  ? 44.795 99.574  26.049  1.00 59.24 ? 50   GLN B CB    1 
ATOM   6174 C  CG    . GLN D 4 50  ? 43.633 99.818  25.107  1.00 62.09 ? 50   GLN B CG    1 
ATOM   6175 C  CD    . GLN D 4 50  ? 42.287 99.590  25.776  1.00 63.55 ? 50   GLN B CD    1 
ATOM   6176 O  OE1   . GLN D 4 50  ? 41.236 99.705  25.140  1.00 64.15 ? 50   GLN B OE1   1 
ATOM   6177 N  NE2   . GLN D 4 50  ? 42.313 99.264  27.067  1.00 64.02 ? 50   GLN B NE2   1 
ATOM   6178 N  N     . GLY D 4 51  ? 47.132 101.093 23.762  1.00 57.98 ? 51   GLY B N     1 
ATOM   6179 C  CA    . GLY D 4 51  ? 47.534 102.387 23.250  1.00 57.74 ? 51   GLY B CA    1 
ATOM   6180 C  C     . GLY D 4 51  ? 48.913 102.316 22.629  1.00 57.81 ? 51   GLY B C     1 
ATOM   6181 O  O     . GLY D 4 51  ? 49.168 102.920 21.583  1.00 58.09 ? 51   GLY B O     1 
ATOM   6182 N  N     . LYS D 4 52  ? 49.810 101.572 23.268  1.00 56.87 ? 52   LYS B N     1 
ATOM   6183 C  CA    . LYS D 4 52  ? 51.170 101.430 22.758  1.00 56.53 ? 52   LYS B CA    1 
ATOM   6184 C  C     . LYS D 4 52  ? 51.461 100.012 22.279  1.00 55.02 ? 52   LYS B C     1 
ATOM   6185 O  O     . LYS D 4 52  ? 52.577 99.705  21.861  1.00 55.07 ? 52   LYS B O     1 
ATOM   6186 C  CB    . LYS D 4 52  ? 52.186 101.849 23.830  1.00 57.75 ? 52   LYS B CB    1 
ATOM   6187 C  CG    . LYS D 4 52  ? 51.921 101.287 25.223  1.00 58.98 ? 52   LYS B CG    1 
ATOM   6188 C  CD    . LYS D 4 52  ? 52.975 101.772 26.223  1.00 59.62 ? 52   LYS B CD    1 
ATOM   6189 C  CE    . LYS D 4 52  ? 52.686 101.275 27.637  1.00 59.87 ? 52   LYS B CE    1 
ATOM   6190 N  NZ    . LYS D 4 52  ? 53.735 101.680 28.621  1.00 58.68 ? 52   LYS B NZ    1 
ATOM   6191 N  N     . LEU D 4 53  ? 50.450 99.151  22.329  1.00 53.42 ? 53   LEU B N     1 
ATOM   6192 C  CA    . LEU D 4 53  ? 50.622 97.771  21.897  1.00 52.00 ? 53   LEU B CA    1 
ATOM   6193 C  C     . LEU D 4 53  ? 49.297 97.047  21.699  1.00 51.24 ? 53   LEU B C     1 
ATOM   6194 O  O     . LEU D 4 53  ? 48.282 97.400  22.308  1.00 51.67 ? 53   LEU B O     1 
ATOM   6195 C  CB    . LEU D 4 53  ? 51.456 97.000  22.922  1.00 51.82 ? 53   LEU B CB    1 
ATOM   6196 C  CG    . LEU D 4 53  ? 51.709 95.525  22.600  1.00 50.72 ? 53   LEU B CG    1 
ATOM   6197 C  CD1   . LEU D 4 53  ? 52.678 95.418  21.434  1.00 50.49 ? 53   LEU B CD1   1 
ATOM   6198 C  CD2   . LEU D 4 53  ? 52.270 94.822  23.821  1.00 51.49 ? 53   LEU B CD2   1 
ATOM   6199 N  N     . THR D 4 54  ? 49.322 96.026  20.846  1.00 49.75 ? 54   THR B N     1 
ATOM   6200 C  CA    . THR D 4 54  ? 48.144 95.210  20.566  1.00 47.64 ? 54   THR B CA    1 
ATOM   6201 C  C     . THR D 4 54  ? 48.477 93.745  20.863  1.00 44.86 ? 54   THR B C     1 
ATOM   6202 O  O     . THR D 4 54  ? 49.501 93.235  20.406  1.00 43.86 ? 54   THR B O     1 
ATOM   6203 C  CB    . THR D 4 54  ? 47.723 95.326  19.084  1.00 48.88 ? 54   THR B CB    1 
ATOM   6204 O  OG1   . THR D 4 54  ? 47.557 96.707  18.734  1.00 50.13 ? 54   THR B OG1   1 
ATOM   6205 C  CG2   . THR D 4 54  ? 46.413 94.590  18.847  1.00 48.60 ? 54   THR B CG2   1 
ATOM   6206 N  N     . VAL D 4 55  ? 47.618 93.076  21.628  1.00 43.21 ? 55   VAL B N     1 
ATOM   6207 C  CA    . VAL D 4 55  ? 47.831 91.671  21.975  1.00 40.69 ? 55   VAL B CA    1 
ATOM   6208 C  C     . VAL D 4 55  ? 46.931 90.754  21.148  1.00 39.34 ? 55   VAL B C     1 
ATOM   6209 O  O     . VAL D 4 55  ? 45.697 90.820  21.234  1.00 38.38 ? 55   VAL B O     1 
ATOM   6210 C  CB    . VAL D 4 55  ? 47.566 91.405  23.479  1.00 41.18 ? 55   VAL B CB    1 
ATOM   6211 C  CG1   . VAL D 4 55  ? 47.794 89.931  23.795  1.00 40.44 ? 55   VAL B CG1   1 
ATOM   6212 C  CG2   . VAL D 4 55  ? 48.486 92.263  24.330  1.00 40.98 ? 55   VAL B CG2   1 
ATOM   6213 N  N     . ALA D 4 56  ? 47.566 89.895  20.356  1.00 37.05 ? 56   ALA B N     1 
ATOM   6214 C  CA    . ALA D 4 56  ? 46.865 88.957  19.492  1.00 34.59 ? 56   ALA B CA    1 
ATOM   6215 C  C     . ALA D 4 56  ? 47.236 87.511  19.826  1.00 34.58 ? 56   ALA B C     1 
ATOM   6216 O  O     . ALA D 4 56  ? 48.380 87.217  20.171  1.00 33.61 ? 56   ALA B O     1 
ATOM   6217 C  CB    . ALA D 4 56  ? 47.204 89.257  18.039  1.00 33.08 ? 56   ALA B CB    1 
ATOM   6218 N  N     . LYS D 4 57  ? 46.261 86.613  19.710  1.00 33.76 ? 57   LYS B N     1 
ATOM   6219 C  CA    . LYS D 4 57  ? 46.466 85.195  19.995  1.00 33.81 ? 57   LYS B CA    1 
ATOM   6220 C  C     . LYS D 4 57  ? 46.044 84.328  18.821  1.00 33.58 ? 57   LYS B C     1 
ATOM   6221 O  O     . LYS D 4 57  ? 45.046 84.603  18.158  1.00 33.95 ? 57   LYS B O     1 
ATOM   6222 C  CB    . LYS D 4 57  ? 45.669 84.776  21.235  1.00 33.98 ? 57   LYS B CB    1 
ATOM   6223 C  CG    . LYS D 4 57  ? 46.160 85.404  22.527  1.00 35.04 ? 57   LYS B CG    1 
ATOM   6224 C  CD    . LYS D 4 57  ? 45.262 85.069  23.702  1.00 35.59 ? 57   LYS B CD    1 
ATOM   6225 C  CE    . LYS D 4 57  ? 45.309 83.596  24.062  1.00 35.75 ? 57   LYS B CE    1 
ATOM   6226 N  NZ    . LYS D 4 57  ? 44.435 83.321  25.244  1.00 36.64 ? 57   LYS B NZ    1 
ATOM   6227 N  N     . LEU D 4 58  ? 46.815 83.276  18.574  1.00 33.41 ? 58   LEU B N     1 
ATOM   6228 C  CA    . LEU D 4 58  ? 46.532 82.352  17.488  1.00 32.55 ? 58   LEU B CA    1 
ATOM   6229 C  C     . LEU D 4 58  ? 46.654 80.910  17.969  1.00 32.38 ? 58   LEU B C     1 
ATOM   6230 O  O     . LEU D 4 58  ? 47.749 80.439  18.282  1.00 31.67 ? 58   LEU B O     1 
ATOM   6231 C  CB    . LEU D 4 58  ? 47.507 82.571  16.329  1.00 33.13 ? 58   LEU B CB    1 
ATOM   6232 C  CG    . LEU D 4 58  ? 47.212 81.713  15.094  1.00 34.13 ? 58   LEU B CG    1 
ATOM   6233 C  CD1   . LEU D 4 58  ? 46.077 82.359  14.295  1.00 35.22 ? 58   LEU B CD1   1 
ATOM   6234 C  CD2   . LEU D 4 58  ? 48.445 81.595  14.232  1.00 33.16 ? 58   LEU B CD2   1 
ATOM   6235 N  N     . ASN D 4 59  ? 45.525 80.216  18.038  1.00 32.74 ? 59   ASN B N     1 
ATOM   6236 C  CA    . ASN D 4 59  ? 45.516 78.819  18.451  1.00 32.76 ? 59   ASN B CA    1 
ATOM   6237 C  C     . ASN D 4 59  ? 46.077 78.019  17.278  1.00 32.10 ? 59   ASN B C     1 
ATOM   6238 O  O     . ASN D 4 59  ? 45.477 77.992  16.210  1.00 32.08 ? 59   ASN B O     1 
ATOM   6239 C  CB    . ASN D 4 59  ? 44.090 78.371  18.751  1.00 33.20 ? 59   ASN B CB    1 
ATOM   6240 C  CG    . ASN D 4 59  ? 44.006 76.897  19.086  1.00 34.52 ? 59   ASN B CG    1 
ATOM   6241 O  OD1   . ASN D 4 59  ? 44.495 76.049  18.334  1.00 34.46 ? 59   ASN B OD1   1 
ATOM   6242 N  ND2   . ASN D 4 59  ? 43.378 76.580  20.216  1.00 34.25 ? 59   ASN B ND2   1 
ATOM   6243 N  N     . ILE D 4 60  ? 47.223 77.371  17.480  1.00 32.09 ? 60   ILE B N     1 
ATOM   6244 C  CA    . ILE D 4 60  ? 47.870 76.611  16.415  1.00 31.43 ? 60   ILE B CA    1 
ATOM   6245 C  C     . ILE D 4 60  ? 47.132 75.364  15.933  1.00 31.38 ? 60   ILE B C     1 
ATOM   6246 O  O     . ILE D 4 60  ? 47.444 74.841  14.869  1.00 31.09 ? 60   ILE B O     1 
ATOM   6247 C  CB    . ILE D 4 60  ? 49.306 76.222  16.808  1.00 31.39 ? 60   ILE B CB    1 
ATOM   6248 C  CG1   . ILE D 4 60  ? 49.283 75.306  18.035  1.00 32.45 ? 60   ILE B CG1   1 
ATOM   6249 C  CG2   . ILE D 4 60  ? 50.111 77.488  17.080  1.00 31.52 ? 60   ILE B CG2   1 
ATOM   6250 C  CD1   . ILE D 4 60  ? 50.625 74.735  18.399  1.00 30.17 ? 60   ILE B CD1   1 
ATOM   6251 N  N     . ASP D 4 61  ? 46.164 74.883  16.706  1.00 31.57 ? 61   ASP B N     1 
ATOM   6252 C  CA    . ASP D 4 61  ? 45.386 73.720  16.286  1.00 32.61 ? 61   ASP B CA    1 
ATOM   6253 C  C     . ASP D 4 61  ? 44.313 74.129  15.277  1.00 32.44 ? 61   ASP B C     1 
ATOM   6254 O  O     . ASP D 4 61  ? 44.080 73.420  14.304  1.00 32.60 ? 61   ASP B O     1 
ATOM   6255 C  CB    . ASP D 4 61  ? 44.720 73.037  17.486  1.00 33.49 ? 61   ASP B CB    1 
ATOM   6256 C  CG    . ASP D 4 61  ? 45.659 72.099  18.215  1.00 33.87 ? 61   ASP B CG    1 
ATOM   6257 O  OD1   . ASP D 4 61  ? 46.814 71.954  17.769  1.00 36.14 ? 61   ASP B OD1   1 
ATOM   6258 O  OD2   . ASP D 4 61  ? 45.246 71.505  19.231  1.00 34.61 ? 61   ASP B OD2   1 
ATOM   6259 N  N     . GLN D 4 62  ? 43.663 75.269  15.513  1.00 31.13 ? 62   GLN B N     1 
ATOM   6260 C  CA    . GLN D 4 62  ? 42.619 75.756  14.610  1.00 31.47 ? 62   GLN B CA    1 
ATOM   6261 C  C     . GLN D 4 62  ? 43.232 76.441  13.391  1.00 31.13 ? 62   GLN B C     1 
ATOM   6262 O  O     . GLN D 4 62  ? 42.621 76.492  12.325  1.00 31.09 ? 62   GLN B O     1 
ATOM   6263 C  CB    . GLN D 4 62  ? 41.701 76.742  15.340  1.00 31.98 ? 62   GLN B CB    1 
ATOM   6264 C  CG    . GLN D 4 62  ? 41.104 76.180  16.616  1.00 36.44 ? 62   GLN B CG    1 
ATOM   6265 C  CD    . GLN D 4 62  ? 40.434 77.236  17.475  1.00 39.79 ? 62   GLN B CD    1 
ATOM   6266 O  OE1   . GLN D 4 62  ? 40.118 76.986  18.638  1.00 43.48 ? 62   GLN B OE1   1 
ATOM   6267 N  NE2   . GLN D 4 62  ? 40.209 78.418  16.910  1.00 41.52 ? 62   GLN B NE2   1 
ATOM   6268 N  N     . ASN D 4 63  ? 44.441 76.969  13.558  1.00 30.31 ? 63   ASN B N     1 
ATOM   6269 C  CA    . ASN D 4 63  ? 45.140 77.651  12.477  1.00 30.14 ? 63   ASN B CA    1 
ATOM   6270 C  C     . ASN D 4 63  ? 46.541 77.057  12.354  1.00 30.77 ? 63   ASN B C     1 
ATOM   6271 O  O     . ASN D 4 63  ? 47.514 77.594  12.885  1.00 29.22 ? 63   ASN B O     1 
ATOM   6272 C  CB    . ASN D 4 63  ? 45.192 79.143  12.780  1.00 29.60 ? 63   ASN B CB    1 
ATOM   6273 C  CG    . ASN D 4 63  ? 43.820 79.705  13.082  1.00 29.02 ? 63   ASN B CG    1 
ATOM   6274 O  OD1   . ASN D 4 63  ? 42.972 79.830  12.193  1.00 28.50 ? 63   ASN B OD1   1 
ATOM   6275 N  ND2   . ASN D 4 63  ? 43.584 80.023  14.343  1.00 28.94 ? 63   ASN B ND2   1 
ATOM   6276 N  N     . PRO D 4 64  ? 46.650 75.933  11.631  1.00 31.62 ? 64   PRO B N     1 
ATOM   6277 C  CA    . PRO D 4 64  ? 47.890 75.192  11.397  1.00 32.81 ? 64   PRO B CA    1 
ATOM   6278 C  C     . PRO D 4 64  ? 48.846 75.703  10.331  1.00 33.32 ? 64   PRO B C     1 
ATOM   6279 O  O     . PRO D 4 64  ? 49.931 75.148  10.159  1.00 35.17 ? 64   PRO B O     1 
ATOM   6280 C  CB    . PRO D 4 64  ? 47.378 73.793  11.068  1.00 33.17 ? 64   PRO B CB    1 
ATOM   6281 C  CG    . PRO D 4 64  ? 46.155 74.093  10.251  1.00 30.35 ? 64   PRO B CG    1 
ATOM   6282 C  CD    . PRO D 4 64  ? 45.496 75.212  11.052  1.00 32.13 ? 64   PRO B CD    1 
ATOM   6283 N  N     . GLY D 4 65  ? 48.477 76.756  9.620   1.00 34.07 ? 65   GLY B N     1 
ATOM   6284 C  CA    . GLY D 4 65  ? 49.359 77.220  8.562   1.00 34.87 ? 65   GLY B CA    1 
ATOM   6285 C  C     . GLY D 4 65  ? 50.326 78.344  8.863   1.00 35.70 ? 65   GLY B C     1 
ATOM   6286 O  O     . GLY D 4 65  ? 51.306 78.529  8.142   1.00 36.91 ? 65   GLY B O     1 
ATOM   6287 N  N     . THR D 4 66  ? 50.068 79.092  9.926   1.00 36.15 ? 66   THR B N     1 
ATOM   6288 C  CA    . THR D 4 66  ? 50.916 80.222  10.267  1.00 36.28 ? 66   THR B CA    1 
ATOM   6289 C  C     . THR D 4 66  ? 52.185 79.923  11.071  1.00 36.30 ? 66   THR B C     1 
ATOM   6290 O  O     . THR D 4 66  ? 53.271 80.355  10.687  1.00 36.55 ? 66   THR B O     1 
ATOM   6291 C  CB    . THR D 4 66  ? 50.102 81.284  11.013  1.00 36.04 ? 66   THR B CB    1 
ATOM   6292 O  OG1   . THR D 4 66  ? 48.930 81.595  10.251  1.00 37.46 ? 66   THR B OG1   1 
ATOM   6293 C  CG2   . THR D 4 66  ? 50.923 82.547  11.205  1.00 36.09 ? 66   THR B CG2   1 
ATOM   6294 N  N     . ALA D 4 67  ? 52.059 79.190  12.172  1.00 34.98 ? 67   ALA B N     1 
ATOM   6295 C  CA    . ALA D 4 67  ? 53.221 78.893  13.010  1.00 36.16 ? 67   ALA B CA    1 
ATOM   6296 C  C     . ALA D 4 67  ? 54.442 78.313  12.278  1.00 35.93 ? 67   ALA B C     1 
ATOM   6297 O  O     . ALA D 4 67  ? 55.569 78.752  12.500  1.00 34.70 ? 67   ALA B O     1 
ATOM   6298 C  CB    . ALA D 4 67  ? 52.816 77.970  14.159  1.00 35.61 ? 67   ALA B CB    1 
ATOM   6299 N  N     . PRO D 4 68  ? 54.233 77.322  11.396  1.00 36.79 ? 68   PRO B N     1 
ATOM   6300 C  CA    . PRO D 4 68  ? 55.370 76.734  10.678  1.00 37.50 ? 68   PRO B CA    1 
ATOM   6301 C  C     . PRO D 4 68  ? 56.236 77.754  9.938   1.00 38.19 ? 68   PRO B C     1 
ATOM   6302 O  O     . PRO D 4 68  ? 57.456 77.608  9.851   1.00 38.43 ? 68   PRO B O     1 
ATOM   6303 C  CB    . PRO D 4 68  ? 54.702 75.739  9.732   1.00 36.57 ? 68   PRO B CB    1 
ATOM   6304 C  CG    . PRO D 4 68  ? 53.490 75.303  10.517  1.00 37.36 ? 68   PRO B CG    1 
ATOM   6305 C  CD    . PRO D 4 68  ? 52.979 76.619  11.063  1.00 36.58 ? 68   PRO B CD    1 
ATOM   6306 N  N     . LYS D 4 69  ? 55.608 78.793  9.410   1.00 38.58 ? 69   LYS B N     1 
ATOM   6307 C  CA    . LYS D 4 69  ? 56.352 79.805  8.682   1.00 38.87 ? 69   LYS B CA    1 
ATOM   6308 C  C     . LYS D 4 69  ? 57.285 80.585  9.600   1.00 39.87 ? 69   LYS B C     1 
ATOM   6309 O  O     . LYS D 4 69  ? 58.132 81.343  9.126   1.00 40.95 ? 69   LYS B O     1 
ATOM   6310 C  CB    . LYS D 4 69  ? 55.392 80.762  7.986   1.00 39.41 ? 69   LYS B CB    1 
ATOM   6311 C  CG    . LYS D 4 69  ? 54.518 80.101  6.934   1.00 39.04 ? 69   LYS B CG    1 
ATOM   6312 C  CD    . LYS D 4 69  ? 53.559 81.116  6.345   1.00 39.67 ? 69   LYS B CD    1 
ATOM   6313 C  CE    . LYS D 4 69  ? 52.631 80.483  5.334   1.00 39.17 ? 69   LYS B CE    1 
ATOM   6314 N  NZ    . LYS D 4 69  ? 51.704 81.507  4.801   1.00 39.75 ? 69   LYS B NZ    1 
ATOM   6315 N  N     . TYR D 4 70  ? 57.130 80.393  10.908  1.00 39.43 ? 70   TYR B N     1 
ATOM   6316 C  CA    . TYR D 4 70  ? 57.960 81.078  11.893  1.00 39.33 ? 70   TYR B CA    1 
ATOM   6317 C  C     . TYR D 4 70  ? 58.859 80.128  12.695  1.00 39.46 ? 70   TYR B C     1 
ATOM   6318 O  O     . TYR D 4 70  ? 59.502 80.531  13.664  1.00 39.71 ? 70   TYR B O     1 
ATOM   6319 C  CB    . TYR D 4 70  ? 57.065 81.895  12.827  1.00 39.84 ? 70   TYR B CB    1 
ATOM   6320 C  CG    . TYR D 4 70  ? 56.439 83.084  12.127  1.00 40.49 ? 70   TYR B CG    1 
ATOM   6321 C  CD1   . TYR D 4 70  ? 57.189 84.232  11.854  1.00 38.51 ? 70   TYR B CD1   1 
ATOM   6322 C  CD2   . TYR D 4 70  ? 55.121 83.033  11.670  1.00 39.78 ? 70   TYR B CD2   1 
ATOM   6323 C  CE1   . TYR D 4 70  ? 56.646 85.294  11.138  1.00 38.65 ? 70   TYR B CE1   1 
ATOM   6324 C  CE2   . TYR D 4 70  ? 54.569 84.089  10.953  1.00 39.53 ? 70   TYR B CE2   1 
ATOM   6325 C  CZ    . TYR D 4 70  ? 55.337 85.215  10.687  1.00 39.90 ? 70   TYR B CZ    1 
ATOM   6326 O  OH    . TYR D 4 70  ? 54.798 86.247  9.953   1.00 39.84 ? 70   TYR B OH    1 
ATOM   6327 N  N     . GLY D 4 71  ? 58.897 78.865  12.280  1.00 39.72 ? 71   GLY B N     1 
ATOM   6328 C  CA    . GLY D 4 71  ? 59.732 77.877  12.939  1.00 39.81 ? 71   GLY B CA    1 
ATOM   6329 C  C     . GLY D 4 71  ? 59.415 77.560  14.387  1.00 40.60 ? 71   GLY B C     1 
ATOM   6330 O  O     . GLY D 4 71  ? 60.316 77.232  15.157  1.00 41.44 ? 71   GLY B O     1 
ATOM   6331 N  N     . ILE D 4 72  ? 58.145 77.656  14.767  1.00 40.37 ? 72   ILE B N     1 
ATOM   6332 C  CA    . ILE D 4 72  ? 57.738 77.352  16.133  1.00 40.53 ? 72   ILE B CA    1 
ATOM   6333 C  C     . ILE D 4 72  ? 58.347 76.010  16.542  1.00 41.15 ? 72   ILE B C     1 
ATOM   6334 O  O     . ILE D 4 72  ? 58.292 75.036  15.792  1.00 39.09 ? 72   ILE B O     1 
ATOM   6335 C  CB    . ILE D 4 72  ? 56.197 77.268  16.246  1.00 41.35 ? 72   ILE B CB    1 
ATOM   6336 C  CG1   . ILE D 4 72  ? 55.584 78.642  15.972  1.00 41.70 ? 72   ILE B CG1   1 
ATOM   6337 C  CG2   . ILE D 4 72  ? 55.789 76.743  17.609  1.00 40.22 ? 72   ILE B CG2   1 
ATOM   6338 C  CD1   . ILE D 4 72  ? 56.104 79.736  16.869  1.00 43.94 ? 72   ILE B CD1   1 
ATOM   6339 N  N     . ARG D 4 73  ? 58.932 75.968  17.734  1.00 41.85 ? 73   ARG B N     1 
ATOM   6340 C  CA    . ARG D 4 73  ? 59.560 74.751  18.232  1.00 42.57 ? 73   ARG B CA    1 
ATOM   6341 C  C     . ARG D 4 73  ? 59.049 74.415  19.635  1.00 40.82 ? 73   ARG B C     1 
ATOM   6342 O  O     . ARG D 4 73  ? 59.278 73.324  20.151  1.00 40.37 ? 73   ARG B O     1 
ATOM   6343 C  CB    . ARG D 4 73  ? 61.082 74.930  18.238  1.00 45.31 ? 73   ARG B CB    1 
ATOM   6344 C  CG    . ARG D 4 73  ? 61.838 73.864  17.466  1.00 50.49 ? 73   ARG B CG    1 
ATOM   6345 C  CD    . ARG D 4 73  ? 61.647 72.503  18.128  1.00 56.33 ? 73   ARG B CD    1 
ATOM   6346 N  NE    . ARG D 4 73  ? 61.977 72.564  19.552  1.00 60.01 ? 73   ARG B NE    1 
ATOM   6347 C  CZ    . ARG D 4 73  ? 61.717 71.600  20.429  1.00 60.32 ? 73   ARG B CZ    1 
ATOM   6348 N  NH1   . ARG D 4 73  ? 61.118 70.482  20.034  1.00 60.26 ? 73   ARG B NH1   1 
ATOM   6349 N  NH2   . ARG D 4 73  ? 62.050 71.761  21.704  1.00 60.44 ? 73   ARG B NH2   1 
ATOM   6350 N  N     . GLY D 4 74  ? 58.349 75.368  20.240  1.00 39.27 ? 74   GLY B N     1 
ATOM   6351 C  CA    . GLY D 4 74  ? 57.795 75.174  21.567  1.00 37.42 ? 74   GLY B CA    1 
ATOM   6352 C  C     . GLY D 4 74  ? 56.727 76.224  21.810  1.00 37.77 ? 74   GLY B C     1 
ATOM   6353 O  O     . GLY D 4 74  ? 56.671 77.233  21.104  1.00 36.60 ? 74   GLY B O     1 
ATOM   6354 N  N     . ILE D 4 75  ? 55.870 75.996  22.799  1.00 35.96 ? 75   ILE B N     1 
ATOM   6355 C  CA    . ILE D 4 75  ? 54.816 76.952  23.106  1.00 34.29 ? 75   ILE B CA    1 
ATOM   6356 C  C     . ILE D 4 75  ? 54.693 77.180  24.606  1.00 33.94 ? 75   ILE B C     1 
ATOM   6357 O  O     . ILE D 4 75  ? 55.066 76.320  25.407  1.00 34.29 ? 75   ILE B O     1 
ATOM   6358 C  CB    . ILE D 4 75  ? 53.453 76.487  22.540  1.00 34.54 ? 75   ILE B CB    1 
ATOM   6359 C  CG1   . ILE D 4 75  ? 53.189 75.028  22.920  1.00 33.90 ? 75   ILE B CG1   1 
ATOM   6360 C  CG2   . ILE D 4 75  ? 53.441 76.649  21.024  1.00 35.08 ? 75   ILE B CG2   1 
ATOM   6361 C  CD1   . ILE D 4 75  ? 51.834 74.512  22.455  1.00 32.89 ? 75   ILE B CD1   1 
ATOM   6362 N  N     . PRO D 4 76  ? 54.150 78.342  25.008  1.00 33.27 ? 76   PRO B N     1 
ATOM   6363 C  CA    . PRO D 4 76  ? 53.667 79.393  24.108  1.00 32.77 ? 76   PRO B CA    1 
ATOM   6364 C  C     . PRO D 4 76  ? 54.796 80.222  23.507  1.00 32.38 ? 76   PRO B C     1 
ATOM   6365 O  O     . PRO D 4 76  ? 55.774 80.530  24.186  1.00 31.87 ? 76   PRO B O     1 
ATOM   6366 C  CB    . PRO D 4 76  ? 52.774 80.225  25.018  1.00 32.96 ? 76   PRO B CB    1 
ATOM   6367 C  CG    . PRO D 4 76  ? 53.538 80.192  26.309  1.00 32.92 ? 76   PRO B CG    1 
ATOM   6368 C  CD    . PRO D 4 76  ? 53.949 78.730  26.419  1.00 32.04 ? 76   PRO B CD    1 
ATOM   6369 N  N     . THR D 4 77  ? 54.667 80.575  22.233  1.00 31.52 ? 77   THR B N     1 
ATOM   6370 C  CA    . THR D 4 77  ? 55.683 81.403  21.597  1.00 32.96 ? 77   THR B CA    1 
ATOM   6371 C  C     . THR D 4 77  ? 55.164 82.827  21.471  1.00 33.36 ? 77   THR B C     1 
ATOM   6372 O  O     . THR D 4 77  ? 54.074 83.065  20.953  1.00 33.94 ? 77   THR B O     1 
ATOM   6373 C  CB    . THR D 4 77  ? 56.074 80.881  20.201  1.00 32.75 ? 77   THR B CB    1 
ATOM   6374 O  OG1   . THR D 4 77  ? 56.777 79.642  20.334  1.00 32.82 ? 77   THR B OG1   1 
ATOM   6375 C  CG2   . THR D 4 77  ? 56.979 81.877  19.502  1.00 34.05 ? 77   THR B CG2   1 
ATOM   6376 N  N     . LEU D 4 78  ? 55.955 83.773  21.960  1.00 35.96 ? 78   LEU B N     1 
ATOM   6377 C  CA    . LEU D 4 78  ? 55.590 85.181  21.929  1.00 36.01 ? 78   LEU B CA    1 
ATOM   6378 C  C     . LEU D 4 78  ? 56.403 85.941  20.888  1.00 38.08 ? 78   LEU B C     1 
ATOM   6379 O  O     . LEU D 4 78  ? 57.618 86.106  21.031  1.00 38.24 ? 78   LEU B O     1 
ATOM   6380 C  CB    . LEU D 4 78  ? 55.820 85.802  23.304  1.00 34.06 ? 78   LEU B CB    1 
ATOM   6381 C  CG    . LEU D 4 78  ? 55.135 85.121  24.488  1.00 34.28 ? 78   LEU B CG    1 
ATOM   6382 C  CD1   . LEU D 4 78  ? 55.545 85.825  25.766  1.00 33.49 ? 78   LEU B CD1   1 
ATOM   6383 C  CD2   . LEU D 4 78  ? 53.632 85.162  24.323  1.00 33.02 ? 78   LEU B CD2   1 
ATOM   6384 N  N     . LEU D 4 79  ? 55.729 86.405  19.841  1.00 38.56 ? 79   LEU B N     1 
ATOM   6385 C  CA    . LEU D 4 79  ? 56.391 87.162  18.789  1.00 39.87 ? 79   LEU B CA    1 
ATOM   6386 C  C     . LEU D 4 79  ? 55.866 88.592  18.749  1.00 41.22 ? 79   LEU B C     1 
ATOM   6387 O  O     . LEU D 4 79  ? 54.666 88.823  18.589  1.00 41.62 ? 79   LEU B O     1 
ATOM   6388 C  CB    . LEU D 4 79  ? 56.167 86.501  17.430  1.00 38.41 ? 79   LEU B CB    1 
ATOM   6389 C  CG    . LEU D 4 79  ? 57.280 85.617  16.869  1.00 40.21 ? 79   LEU B CG    1 
ATOM   6390 C  CD1   . LEU D 4 79  ? 57.725 84.603  17.912  1.00 39.08 ? 79   LEU B CD1   1 
ATOM   6391 C  CD2   . LEU D 4 79  ? 56.776 84.924  15.602  1.00 38.44 ? 79   LEU B CD2   1 
ATOM   6392 N  N     . LEU D 4 80  ? 56.772 89.550  18.903  1.00 42.99 ? 80   LEU B N     1 
ATOM   6393 C  CA    . LEU D 4 80  ? 56.401 90.954  18.864  1.00 44.37 ? 80   LEU B CA    1 
ATOM   6394 C  C     . LEU D 4 80  ? 56.773 91.475  17.482  1.00 45.28 ? 80   LEU B C     1 
ATOM   6395 O  O     . LEU D 4 80  ? 57.957 91.644  17.171  1.00 45.68 ? 80   LEU B O     1 
ATOM   6396 C  CB    . LEU D 4 80  ? 57.148 91.736  19.950  1.00 44.79 ? 80   LEU B CB    1 
ATOM   6397 C  CG    . LEU D 4 80  ? 56.569 93.109  20.316  1.00 45.73 ? 80   LEU B CG    1 
ATOM   6398 C  CD1   . LEU D 4 80  ? 57.244 93.639  21.571  1.00 46.63 ? 80   LEU B CD1   1 
ATOM   6399 C  CD2   . LEU D 4 80  ? 56.757 94.075  19.164  1.00 46.18 ? 80   LEU B CD2   1 
ATOM   6400 N  N     . PHE D 4 81  ? 55.758 91.702  16.651  1.00 45.62 ? 81   PHE B N     1 
ATOM   6401 C  CA    . PHE D 4 81  ? 55.971 92.201  15.297  1.00 47.42 ? 81   PHE B CA    1 
ATOM   6402 C  C     . PHE D 4 81  ? 55.977 93.724  15.261  1.00 49.21 ? 81   PHE B C     1 
ATOM   6403 O  O     . PHE D 4 81  ? 55.385 94.383  16.117  1.00 49.64 ? 81   PHE B O     1 
ATOM   6404 C  CB    . PHE D 4 81  ? 54.878 91.709  14.339  1.00 45.19 ? 81   PHE B CB    1 
ATOM   6405 C  CG    . PHE D 4 81  ? 54.894 90.232  14.086  1.00 43.21 ? 81   PHE B CG    1 
ATOM   6406 C  CD1   . PHE D 4 81  ? 54.454 89.336  15.060  1.00 41.52 ? 81   PHE B CD1   1 
ATOM   6407 C  CD2   . PHE D 4 81  ? 55.318 89.733  12.856  1.00 41.75 ? 81   PHE B CD2   1 
ATOM   6408 C  CE1   . PHE D 4 81  ? 54.433 87.967  14.808  1.00 41.06 ? 81   PHE B CE1   1 
ATOM   6409 C  CE2   . PHE D 4 81  ? 55.302 88.360  12.595  1.00 40.44 ? 81   PHE B CE2   1 
ATOM   6410 C  CZ    . PHE D 4 81  ? 54.858 87.477  13.572  1.00 40.29 ? 81   PHE B CZ    1 
ATOM   6411 N  N     . LYS D 4 82  ? 56.643 94.266  14.247  1.00 50.78 ? 82   LYS B N     1 
ATOM   6412 C  CA    . LYS D 4 82  ? 56.740 95.705  14.046  1.00 53.38 ? 82   LYS B CA    1 
ATOM   6413 C  C     . LYS D 4 82  ? 56.862 95.935  12.543  1.00 54.33 ? 82   LYS B C     1 
ATOM   6414 O  O     . LYS D 4 82  ? 57.833 95.501  11.915  1.00 55.08 ? 82   LYS B O     1 
ATOM   6415 C  CB    . LYS D 4 82  ? 57.966 96.263  14.773  1.00 54.42 ? 82   LYS B CB    1 
ATOM   6416 C  CG    . LYS D 4 82  ? 58.078 97.776  14.722  1.00 56.59 ? 82   LYS B CG    1 
ATOM   6417 C  CD    . LYS D 4 82  ? 56.886 98.448  15.400  1.00 58.21 ? 82   LYS B CD    1 
ATOM   6418 C  CE    . LYS D 4 82  ? 56.982 99.969  15.314  1.00 58.03 ? 82   LYS B CE    1 
ATOM   6419 N  NZ    . LYS D 4 82  ? 57.024 100.445 13.900  1.00 57.12 ? 82   LYS B NZ    1 
ATOM   6420 N  N     . ASN D 4 83  ? 55.868 96.607  11.970  1.00 55.07 ? 83   ASN B N     1 
ATOM   6421 C  CA    . ASN D 4 83  ? 55.847 96.872  10.535  1.00 55.37 ? 83   ASN B CA    1 
ATOM   6422 C  C     . ASN D 4 83  ? 55.986 95.577  9.748   1.00 55.01 ? 83   ASN B C     1 
ATOM   6423 O  O     . ASN D 4 83  ? 56.843 95.452  8.868   1.00 54.15 ? 83   ASN B O     1 
ATOM   6424 C  CB    . ASN D 4 83  ? 56.964 97.843  10.152  1.00 57.06 ? 83   ASN B CB    1 
ATOM   6425 C  CG    . ASN D 4 83  ? 56.764 99.214  10.758  1.00 58.76 ? 83   ASN B CG    1 
ATOM   6426 O  OD1   . ASN D 4 83  ? 55.702 99.824  10.601  1.00 59.48 ? 83   ASN B OD1   1 
ATOM   6427 N  ND2   . ASN D 4 83  ? 57.780 99.709  11.458  1.00 59.68 ? 83   ASN B ND2   1 
ATOM   6428 N  N     . GLY D 4 84  ? 55.137 94.612  10.093  1.00 54.59 ? 84   GLY B N     1 
ATOM   6429 C  CA    . GLY D 4 84  ? 55.126 93.325  9.421   1.00 54.49 ? 84   GLY B CA    1 
ATOM   6430 C  C     . GLY D 4 84  ? 56.343 92.440  9.590   1.00 54.08 ? 84   GLY B C     1 
ATOM   6431 O  O     . GLY D 4 84  ? 56.512 91.472  8.843   1.00 54.23 ? 84   GLY B O     1 
ATOM   6432 N  N     . GLU D 4 85  ? 57.192 92.752  10.565  1.00 53.97 ? 85   GLU B N     1 
ATOM   6433 C  CA    . GLU D 4 85  ? 58.389 91.950  10.786  1.00 53.09 ? 85   GLU B CA    1 
ATOM   6434 C  C     . GLU D 4 85  ? 58.611 91.650  12.261  1.00 50.83 ? 85   GLU B C     1 
ATOM   6435 O  O     . GLU D 4 85  ? 58.232 92.434  13.128  1.00 50.24 ? 85   GLU B O     1 
ATOM   6436 C  CB    . GLU D 4 85  ? 59.609 92.674  10.217  1.00 55.78 ? 85   GLU B CB    1 
ATOM   6437 C  CG    . GLU D 4 85  ? 59.397 93.206  8.806   1.00 59.51 ? 85   GLU B CG    1 
ATOM   6438 C  CD    . GLU D 4 85  ? 60.691 93.624  8.134   1.00 61.91 ? 85   GLU B CD    1 
ATOM   6439 O  OE1   . GLU D 4 85  ? 61.461 94.399  8.748   1.00 63.16 ? 85   GLU B OE1   1 
ATOM   6440 O  OE2   . GLU D 4 85  ? 60.934 93.180  6.989   1.00 62.45 ? 85   GLU B OE2   1 
ATOM   6441 N  N     . VAL D 4 86  ? 59.221 90.504  12.543  1.00 49.05 ? 86   VAL B N     1 
ATOM   6442 C  CA    . VAL D 4 86  ? 59.496 90.116  13.919  1.00 47.59 ? 86   VAL B CA    1 
ATOM   6443 C  C     . VAL D 4 86  ? 60.628 90.969  14.487  1.00 47.36 ? 86   VAL B C     1 
ATOM   6444 O  O     . VAL D 4 86  ? 61.738 90.994  13.950  1.00 46.50 ? 86   VAL B O     1 
ATOM   6445 C  CB    . VAL D 4 86  ? 59.895 88.629  14.020  1.00 46.72 ? 86   VAL B CB    1 
ATOM   6446 C  CG1   . VAL D 4 86  ? 60.235 88.288  15.459  1.00 45.95 ? 86   VAL B CG1   1 
ATOM   6447 C  CG2   . VAL D 4 86  ? 58.755 87.745  13.525  1.00 46.31 ? 86   VAL B CG2   1 
ATOM   6448 N  N     . ALA D 4 87  ? 60.337 91.663  15.581  1.00 47.15 ? 87   ALA B N     1 
ATOM   6449 C  CA    . ALA D 4 87  ? 61.322 92.523  16.220  1.00 46.59 ? 87   ALA B CA    1 
ATOM   6450 C  C     . ALA D 4 87  ? 61.935 91.872  17.458  1.00 46.06 ? 87   ALA B C     1 
ATOM   6451 O  O     . ALA D 4 87  ? 63.008 92.273  17.906  1.00 46.80 ? 87   ALA B O     1 
ATOM   6452 C  CB    . ALA D 4 87  ? 60.676 93.854  16.592  1.00 46.75 ? 87   ALA B CB    1 
ATOM   6453 N  N     . ALA D 4 88  ? 61.256 90.867  18.005  1.00 45.00 ? 88   ALA B N     1 
ATOM   6454 C  CA    . ALA D 4 88  ? 61.740 90.169  19.194  1.00 44.03 ? 88   ALA B CA    1 
ATOM   6455 C  C     . ALA D 4 88  ? 60.844 88.979  19.522  1.00 43.62 ? 88   ALA B C     1 
ATOM   6456 O  O     . ALA D 4 88  ? 59.633 89.020  19.298  1.00 41.95 ? 88   ALA B O     1 
ATOM   6457 C  CB    . ALA D 4 88  ? 61.793 91.130  20.388  1.00 43.22 ? 88   ALA B CB    1 
ATOM   6458 N  N     . THR D 4 89  ? 61.444 87.924  20.065  1.00 42.73 ? 89   THR B N     1 
ATOM   6459 C  CA    . THR D 4 89  ? 60.693 86.728  20.416  1.00 43.08 ? 89   THR B CA    1 
ATOM   6460 C  C     . THR D 4 89  ? 61.093 86.117  21.754  1.00 43.55 ? 89   THR B C     1 
ATOM   6461 O  O     . THR D 4 89  ? 62.239 86.229  22.187  1.00 43.79 ? 89   THR B O     1 
ATOM   6462 C  CB    . THR D 4 89  ? 60.824 85.652  19.316  1.00 43.20 ? 89   THR B CB    1 
ATOM   6463 O  OG1   . THR D 4 89  ? 60.684 84.354  19.901  1.00 43.23 ? 89   THR B OG1   1 
ATOM   6464 C  CG2   . THR D 4 89  ? 62.165 85.753  18.617  1.00 43.39 ? 89   THR B CG2   1 
ATOM   6465 N  N     . LYS D 4 90  ? 60.131 85.466  22.398  1.00 44.04 ? 90   LYS B N     1 
ATOM   6466 C  CA    . LYS D 4 90  ? 60.347 84.817  23.685  1.00 44.55 ? 90   LYS B CA    1 
ATOM   6467 C  C     . LYS D 4 90  ? 59.436 83.592  23.795  1.00 43.64 ? 90   LYS B C     1 
ATOM   6468 O  O     . LYS D 4 90  ? 58.259 83.654  23.438  1.00 43.95 ? 90   LYS B O     1 
ATOM   6469 C  CB    . LYS D 4 90  ? 60.039 85.800  24.817  1.00 46.17 ? 90   LYS B CB    1 
ATOM   6470 C  CG    . LYS D 4 90  ? 61.121 85.891  25.884  1.00 48.59 ? 90   LYS B CG    1 
ATOM   6471 C  CD    . LYS D 4 90  ? 62.438 86.415  25.313  1.00 49.89 ? 90   LYS B CD    1 
ATOM   6472 C  CE    . LYS D 4 90  ? 63.516 86.484  26.393  1.00 51.38 ? 90   LYS B CE    1 
ATOM   6473 N  NZ    . LYS D 4 90  ? 64.788 87.092  25.914  1.00 53.44 ? 90   LYS B NZ    1 
ATOM   6474 N  N     . VAL D 4 91  ? 59.981 82.482  24.285  1.00 42.79 ? 91   VAL B N     1 
ATOM   6475 C  CA    . VAL D 4 91  ? 59.212 81.245  24.433  1.00 41.58 ? 91   VAL B CA    1 
ATOM   6476 C  C     . VAL D 4 91  ? 59.075 80.829  25.899  1.00 41.67 ? 91   VAL B C     1 
ATOM   6477 O  O     . VAL D 4 91  ? 60.053 80.837  26.644  1.00 41.13 ? 91   VAL B O     1 
ATOM   6478 C  CB    . VAL D 4 91  ? 59.877 80.078  23.669  1.00 40.67 ? 91   VAL B CB    1 
ATOM   6479 C  CG1   . VAL D 4 91  ? 59.021 78.830  23.784  1.00 41.18 ? 91   VAL B CG1   1 
ATOM   6480 C  CG2   . VAL D 4 91  ? 60.080 80.454  22.211  1.00 39.84 ? 91   VAL B CG2   1 
ATOM   6481 N  N     . GLY D 4 92  ? 57.862 80.464  26.307  1.00 40.61 ? 92   GLY B N     1 
ATOM   6482 C  CA    . GLY D 4 92  ? 57.644 80.050  27.679  1.00 41.27 ? 92   GLY B CA    1 
ATOM   6483 C  C     . GLY D 4 92  ? 56.697 80.954  28.446  1.00 42.17 ? 92   GLY B C     1 
ATOM   6484 O  O     . GLY D 4 92  ? 56.437 82.088  28.038  1.00 43.11 ? 92   GLY B O     1 
ATOM   6485 N  N     . ALA D 4 93  ? 56.186 80.448  29.565  1.00 42.29 ? 93   ALA B N     1 
ATOM   6486 C  CA    . ALA D 4 93  ? 55.257 81.193  30.408  1.00 42.64 ? 93   ALA B CA    1 
ATOM   6487 C  C     . ALA D 4 93  ? 55.978 82.180  31.325  1.00 43.17 ? 93   ALA B C     1 
ATOM   6488 O  O     . ALA D 4 93  ? 56.425 81.821  32.417  1.00 43.74 ? 93   ALA B O     1 
ATOM   6489 C  CB    . ALA D 4 93  ? 54.424 80.224  31.244  1.00 41.50 ? 93   ALA B CB    1 
ATOM   6490 N  N     . LEU D 4 94  ? 56.087 83.425  30.877  1.00 43.82 ? 94   LEU B N     1 
ATOM   6491 C  CA    . LEU D 4 94  ? 56.742 84.457  31.667  1.00 44.47 ? 94   LEU B CA    1 
ATOM   6492 C  C     . LEU D 4 94  ? 55.747 85.045  32.663  1.00 44.18 ? 94   LEU B C     1 
ATOM   6493 O  O     . LEU D 4 94  ? 54.550 85.109  32.394  1.00 43.28 ? 94   LEU B O     1 
ATOM   6494 C  CB    . LEU D 4 94  ? 57.255 85.591  30.772  1.00 43.19 ? 94   LEU B CB    1 
ATOM   6495 C  CG    . LEU D 4 94  ? 57.975 85.302  29.454  1.00 44.61 ? 94   LEU B CG    1 
ATOM   6496 C  CD1   . LEU D 4 94  ? 58.548 86.615  28.933  1.00 43.59 ? 94   LEU B CD1   1 
ATOM   6497 C  CD2   . LEU D 4 94  ? 59.084 84.281  29.643  1.00 44.50 ? 94   LEU B CD2   1 
ATOM   6498 N  N     . SER D 4 95  ? 56.252 85.468  33.814  1.00 45.08 ? 95   SER B N     1 
ATOM   6499 C  CA    . SER D 4 95  ? 55.419 86.088  34.837  1.00 46.78 ? 95   SER B CA    1 
ATOM   6500 C  C     . SER D 4 95  ? 55.038 87.452  34.273  1.00 47.06 ? 95   SER B C     1 
ATOM   6501 O  O     . SER D 4 95  ? 55.641 87.909  33.301  1.00 46.91 ? 95   SER B O     1 
ATOM   6502 C  CB    . SER D 4 95  ? 56.227 86.288  36.116  1.00 47.44 ? 95   SER B CB    1 
ATOM   6503 O  OG    . SER D 4 95  ? 57.282 87.218  35.893  1.00 48.15 ? 95   SER B OG    1 
ATOM   6504 N  N     . LYS D 4 96  ? 54.059 88.112  34.879  1.00 47.55 ? 96   LYS B N     1 
ATOM   6505 C  CA    . LYS D 4 96  ? 53.648 89.427  34.397  1.00 47.96 ? 96   LYS B CA    1 
ATOM   6506 C  C     . LYS D 4 96  ? 54.822 90.396  34.458  1.00 48.09 ? 96   LYS B C     1 
ATOM   6507 O  O     . LYS D 4 96  ? 55.008 91.229  33.566  1.00 48.24 ? 96   LYS B O     1 
ATOM   6508 C  CB    . LYS D 4 96  ? 52.487 89.968  35.232  1.00 49.29 ? 96   LYS B CB    1 
ATOM   6509 C  CG    . LYS D 4 96  ? 51.925 91.281  34.709  1.00 50.32 ? 96   LYS B CG    1 
ATOM   6510 C  CD    . LYS D 4 96  ? 50.610 91.632  35.385  1.00 51.67 ? 96   LYS B CD    1 
ATOM   6511 C  CE    . LYS D 4 96  ? 50.054 92.934  34.840  1.00 52.44 ? 96   LYS B CE    1 
ATOM   6512 N  NZ    . LYS D 4 96  ? 51.027 94.057  34.999  1.00 53.05 ? 96   LYS B NZ    1 
ATOM   6513 N  N     . GLY D 4 97  ? 55.621 90.273  35.512  1.00 48.10 ? 97   GLY B N     1 
ATOM   6514 C  CA    . GLY D 4 97  ? 56.769 91.144  35.670  1.00 48.32 ? 97   GLY B CA    1 
ATOM   6515 C  C     . GLY D 4 97  ? 57.734 91.060  34.504  1.00 48.92 ? 97   GLY B C     1 
ATOM   6516 O  O     . GLY D 4 97  ? 58.104 92.076  33.915  1.00 49.08 ? 97   GLY B O     1 
ATOM   6517 N  N     . GLN D 4 98  ? 58.146 89.844  34.165  1.00 49.59 ? 98   GLN B N     1 
ATOM   6518 C  CA    . GLN D 4 98  ? 59.080 89.643  33.063  1.00 49.82 ? 98   GLN B CA    1 
ATOM   6519 C  C     . GLN D 4 98  ? 58.505 90.133  31.732  1.00 49.73 ? 98   GLN B C     1 
ATOM   6520 O  O     . GLN D 4 98  ? 59.219 90.717  30.913  1.00 48.74 ? 98   GLN B O     1 
ATOM   6521 C  CB    . GLN D 4 98  ? 59.453 88.162  32.973  1.00 50.98 ? 98   GLN B CB    1 
ATOM   6522 C  CG    . GLN D 4 98  ? 60.059 87.619  34.259  1.00 51.74 ? 98   GLN B CG    1 
ATOM   6523 C  CD    . GLN D 4 98  ? 60.138 86.107  34.275  1.00 52.80 ? 98   GLN B CD    1 
ATOM   6524 O  OE1   . GLN D 4 98  ? 59.123 85.422  34.144  1.00 52.77 ? 98   GLN B OE1   1 
ATOM   6525 N  NE2   . GLN D 4 98  ? 61.346 85.576  34.437  1.00 52.45 ? 98   GLN B NE2   1 
ATOM   6526 N  N     . LEU D 4 99  ? 57.212 89.905  31.515  1.00 49.99 ? 99   LEU B N     1 
ATOM   6527 C  CA    . LEU D 4 99  ? 56.591 90.347  30.273  1.00 49.62 ? 99   LEU B CA    1 
ATOM   6528 C  C     . LEU D 4 99  ? 56.661 91.865  30.175  1.00 49.77 ? 99   LEU B C     1 
ATOM   6529 O  O     . LEU D 4 99  ? 57.081 92.405  29.152  1.00 49.20 ? 99   LEU B O     1 
ATOM   6530 C  CB    . LEU D 4 99  ? 55.130 89.898  30.196  1.00 48.28 ? 99   LEU B CB    1 
ATOM   6531 C  CG    . LEU D 4 99  ? 54.746 89.056  28.972  1.00 47.84 ? 99   LEU B CG    1 
ATOM   6532 C  CD1   . LEU D 4 99  ? 53.233 88.964  28.892  1.00 47.62 ? 99   LEU B CD1   1 
ATOM   6533 C  CD2   . LEU D 4 99  ? 55.294 89.672  27.700  1.00 45.72 ? 99   LEU B CD2   1 
ATOM   6534 N  N     . LYS D 4 100 ? 56.254 92.552  31.241  1.00 50.41 ? 100  LYS B N     1 
ATOM   6535 C  CA    . LYS D 4 100 ? 56.288 94.011  31.244  1.00 50.78 ? 100  LYS B CA    1 
ATOM   6536 C  C     . LYS D 4 100 ? 57.686 94.495  30.891  1.00 50.59 ? 100  LYS B C     1 
ATOM   6537 O  O     . LYS D 4 100 ? 57.842 95.486  30.179  1.00 50.14 ? 100  LYS B O     1 
ATOM   6538 C  CB    . LYS D 4 100 ? 55.858 94.566  32.608  1.00 51.31 ? 100  LYS B CB    1 
ATOM   6539 C  CG    . LYS D 4 100 ? 54.382 94.319  32.932  1.00 52.63 ? 100  LYS B CG    1 
ATOM   6540 C  CD    . LYS D 4 100 ? 53.913 95.034  34.206  1.00 53.36 ? 100  LYS B CD    1 
ATOM   6541 C  CE    . LYS D 4 100 ? 53.744 96.538  34.011  1.00 53.62 ? 100  LYS B CE    1 
ATOM   6542 N  NZ    . LYS D 4 100 ? 55.025 97.233  33.700  1.00 53.75 ? 100  LYS B NZ    1 
ATOM   6543 N  N     . GLU D 4 101 ? 58.702 93.783  31.373  1.00 51.21 ? 101  GLU B N     1 
ATOM   6544 C  CA    . GLU D 4 101 ? 60.089 94.148  31.085  1.00 51.72 ? 101  GLU B CA    1 
ATOM   6545 C  C     . GLU D 4 101 ? 60.360 94.027  29.592  1.00 51.20 ? 101  GLU B C     1 
ATOM   6546 O  O     . GLU D 4 101 ? 60.828 94.971  28.952  1.00 50.79 ? 101  GLU B O     1 
ATOM   6547 C  CB    . GLU D 4 101 ? 61.062 93.233  31.832  1.00 52.77 ? 101  GLU B CB    1 
ATOM   6548 C  CG    . GLU D 4 101 ? 61.070 93.387  33.338  1.00 54.03 ? 101  GLU B CG    1 
ATOM   6549 C  CD    . GLU D 4 101 ? 62.232 92.643  33.977  1.00 55.66 ? 101  GLU B CD    1 
ATOM   6550 O  OE1   . GLU D 4 101 ? 63.392 92.905  33.581  1.00 55.04 ? 101  GLU B OE1   1 
ATOM   6551 O  OE2   . GLU D 4 101 ? 61.989 91.799  34.871  1.00 55.72 ? 101  GLU B OE2   1 
ATOM   6552 N  N     . PHE D 4 102 ? 60.068 92.843  29.058  1.00 51.22 ? 102  PHE B N     1 
ATOM   6553 C  CA    . PHE D 4 102 ? 60.254 92.519  27.645  1.00 50.16 ? 102  PHE B CA    1 
ATOM   6554 C  C     . PHE D 4 102 ? 59.594 93.561  26.742  1.00 49.54 ? 102  PHE B C     1 
ATOM   6555 O  O     . PHE D 4 102 ? 60.190 94.025  25.769  1.00 48.65 ? 102  PHE B O     1 
ATOM   6556 C  CB    . PHE D 4 102 ? 59.653 91.136  27.369  1.00 50.15 ? 102  PHE B CB    1 
ATOM   6557 C  CG    . PHE D 4 102 ? 59.836 90.651  25.956  1.00 49.70 ? 102  PHE B CG    1 
ATOM   6558 C  CD1   . PHE D 4 102 ? 61.107 90.431  25.438  1.00 49.49 ? 102  PHE B CD1   1 
ATOM   6559 C  CD2   . PHE D 4 102 ? 58.728 90.363  25.159  1.00 50.78 ? 102  PHE B CD2   1 
ATOM   6560 C  CE1   . PHE D 4 102 ? 61.274 89.923  24.144  1.00 50.61 ? 102  PHE B CE1   1 
ATOM   6561 C  CE2   . PHE D 4 102 ? 58.886 89.855  23.863  1.00 49.73 ? 102  PHE B CE2   1 
ATOM   6562 C  CZ    . PHE D 4 102 ? 60.160 89.635  23.357  1.00 49.47 ? 102  PHE B CZ    1 
ATOM   6563 N  N     . LEU D 4 103 ? 58.360 93.925  27.078  1.00 49.24 ? 103  LEU B N     1 
ATOM   6564 C  CA    . LEU D 4 103 ? 57.607 94.903  26.302  1.00 49.72 ? 103  LEU B CA    1 
ATOM   6565 C  C     . LEU D 4 103 ? 58.156 96.323  26.427  1.00 50.01 ? 103  LEU B C     1 
ATOM   6566 O  O     . LEU D 4 103 ? 58.380 96.997  25.421  1.00 49.74 ? 103  LEU B O     1 
ATOM   6567 C  CB    . LEU D 4 103 ? 56.135 94.874  26.716  1.00 49.22 ? 103  LEU B CB    1 
ATOM   6568 C  CG    . LEU D 4 103 ? 55.427 93.568  26.344  1.00 49.69 ? 103  LEU B CG    1 
ATOM   6569 C  CD1   . LEU D 4 103 ? 54.033 93.533  26.958  1.00 49.56 ? 103  LEU B CD1   1 
ATOM   6570 C  CD2   . LEU D 4 103 ? 55.364 93.444  24.826  1.00 49.06 ? 103  LEU B CD2   1 
ATOM   6571 N  N     . ASP D 4 104 ? 58.370 96.783  27.656  1.00 50.13 ? 104  ASP B N     1 
ATOM   6572 C  CA    . ASP D 4 104 ? 58.900 98.126  27.857  1.00 50.16 ? 104  ASP B CA    1 
ATOM   6573 C  C     . ASP D 4 104 ? 60.259 98.244  27.171  1.00 49.75 ? 104  ASP B C     1 
ATOM   6574 O  O     . ASP D 4 104 ? 60.560 99.250  26.528  1.00 48.88 ? 104  ASP B O     1 
ATOM   6575 C  CB    . ASP D 4 104 ? 59.043 98.432  29.351  1.00 50.84 ? 104  ASP B CB    1 
ATOM   6576 C  CG    . ASP D 4 104 ? 57.739 98.260  30.110  1.00 52.33 ? 104  ASP B CG    1 
ATOM   6577 O  OD1   . ASP D 4 104 ? 56.689 98.713  29.608  1.00 53.28 ? 104  ASP B OD1   1 
ATOM   6578 O  OD2   . ASP D 4 104 ? 57.762 97.678  31.215  1.00 54.68 ? 104  ASP B OD2   1 
ATOM   6579 N  N     . ALA D 4 105 ? 61.065 97.194  27.295  1.00 49.45 ? 105  ALA B N     1 
ATOM   6580 C  CA    . ALA D 4 105 ? 62.398 97.169  26.704  1.00 49.37 ? 105  ALA B CA    1 
ATOM   6581 C  C     . ALA D 4 105 ? 62.376 97.150  25.184  1.00 50.07 ? 105  ALA B C     1 
ATOM   6582 O  O     . ALA D 4 105 ? 63.305 97.640  24.539  1.00 50.63 ? 105  ALA B O     1 
ATOM   6583 C  CB    . ALA D 4 105 ? 63.165 95.961  27.221  1.00 49.15 ? 105  ALA B CB    1 
ATOM   6584 N  N     . ASN D 4 106 ? 61.319 96.586  24.608  1.00 50.34 ? 106  ASN B N     1 
ATOM   6585 C  CA    . ASN D 4 106 ? 61.214 96.493  23.156  1.00 50.23 ? 106  ASN B CA    1 
ATOM   6586 C  C     . ASN D 4 106 ? 60.340 97.562  22.514  1.00 50.17 ? 106  ASN B C     1 
ATOM   6587 O  O     . ASN D 4 106 ? 60.267 97.663  21.286  1.00 49.88 ? 106  ASN B O     1 
ATOM   6588 C  CB    . ASN D 4 106 ? 60.730 95.098  22.775  1.00 50.42 ? 106  ASN B CB    1 
ATOM   6589 C  CG    . ASN D 4 106 ? 61.810 94.057  22.948  1.00 50.65 ? 106  ASN B CG    1 
ATOM   6590 O  OD1   . ASN D 4 106 ? 62.765 94.008  22.171  1.00 50.02 ? 106  ASN B OD1   1 
ATOM   6591 N  ND2   . ASN D 4 106 ? 61.679 93.227  23.979  1.00 49.77 ? 106  ASN B ND2   1 
ATOM   6592 N  N     . LEU D 4 107 ? 59.687 98.357  23.353  1.00 49.98 ? 107  LEU B N     1 
ATOM   6593 C  CA    . LEU D 4 107 ? 58.834 99.451  22.900  1.00 50.68 ? 107  LEU B CA    1 
ATOM   6594 C  C     . LEU D 4 107 ? 59.610 100.767 23.032  1.00 50.93 ? 107  LEU B C     1 
ATOM   6595 O  O     . LEU D 4 107 ? 59.208 101.761 22.389  1.00 50.52 ? 107  LEU B O     1 
ATOM   6596 C  CB    . LEU D 4 107 ? 57.556 99.509  23.751  1.00 50.00 ? 107  LEU B CB    1 
ATOM   6597 C  CG    . LEU D 4 107 ? 56.299 98.756  23.292  1.00 49.65 ? 107  LEU B CG    1 
ATOM   6598 C  CD1   . LEU D 4 107 ? 56.667 97.474  22.564  1.00 50.14 ? 107  LEU B CD1   1 
ATOM   6599 C  CD2   . LEU D 4 107 ? 55.428 98.463  24.504  1.00 48.52 ? 107  LEU B CD2   1 
HETATM 6600 MG MG    . MG  E 5 .   ? 45.207 23.534  -6.127  1.00 27.08 ? 4001 MG  A MG    1 
HETATM 6601 MG MG    . MG  F 5 .   ? 47.647 26.307  -5.673  1.00 33.31 ? 4002 MG  A MG    1 
HETATM 6602 MG MG    . MG  G 5 .   ? 78.843 23.952  7.619   1.00 30.94 ? 4003 MG  A MG    1 
HETATM 6603 P  PG    . DAD H 6 .   ? 42.110 24.422  -6.961  1.00 30.83 ? 4004 DAD A PG    1 
HETATM 6604 O  O1G   . DAD H 6 .   ? 43.535 24.540  -7.304  1.00 33.21 ? 4004 DAD A O1G   1 
HETATM 6605 O  O2G   . DAD H 6 .   ? 41.349 23.219  -7.378  1.00 32.50 ? 4004 DAD A O2G   1 
HETATM 6606 O  O3G   . DAD H 6 .   ? 41.465 25.676  -7.529  1.00 32.97 ? 4004 DAD A O3G   1 
HETATM 6607 P  PB    . DAD H 6 .   ? 42.496 23.964  -4.104  1.00 27.75 ? 4004 DAD A PB    1 
HETATM 6608 O  O1B   . DAD H 6 .   ? 41.366 23.483  -3.279  1.00 29.21 ? 4004 DAD A O1B   1 
HETATM 6609 O  O2B   . DAD H 6 .   ? 43.575 23.019  -4.476  1.00 29.43 ? 4004 DAD A O2B   1 
HETATM 6610 O  O3B   . DAD H 6 .   ? 41.897 24.677  -5.399  1.00 30.18 ? 4004 DAD A O3B   1 
HETATM 6611 P  PA    . DAD H 6 .   ? 44.467 26.057  -3.655  1.00 28.16 ? 4004 DAD A PA    1 
HETATM 6612 O  O1A   . DAD H 6 .   ? 45.263 25.403  -4.713  1.00 28.01 ? 4004 DAD A O1A   1 
HETATM 6613 O  O2A   . DAD H 6 .   ? 44.092 27.486  -3.799  1.00 31.04 ? 4004 DAD A O2A   1 
HETATM 6614 O  O3A   . DAD H 6 .   ? 43.141 25.219  -3.365  1.00 29.49 ? 4004 DAD A O3A   1 
HETATM 6615 O  "O5'" . DAD H 6 .   ? 45.202 25.882  -2.250  1.00 28.27 ? 4004 DAD A "O5'" 1 
HETATM 6616 C  "C5'" . DAD H 6 .   ? 45.849 24.659  -1.897  1.00 28.81 ? 4004 DAD A "C5'" 1 
HETATM 6617 C  "C4'" . DAD H 6 .   ? 45.402 24.202  -0.523  1.00 29.06 ? 4004 DAD A "C4'" 1 
HETATM 6618 O  "O4'" . DAD H 6 .   ? 45.732 25.218  0.463   1.00 30.04 ? 4004 DAD A "O4'" 1 
HETATM 6619 C  "C3'" . DAD H 6 .   ? 43.907 23.989  -0.356  1.00 28.72 ? 4004 DAD A "C3'" 1 
HETATM 6620 C  "C2'" . DAD H 6 .   ? 43.726 24.144  1.149   1.00 28.82 ? 4004 DAD A "C2'" 1 
HETATM 6621 C  "C1'" . DAD H 6 .   ? 44.733 25.250  1.468   1.00 29.22 ? 4004 DAD A "C1'" 1 
HETATM 6622 N  N9    . DAD H 6 .   ? 44.110 26.575  1.485   1.00 29.98 ? 4004 DAD A N9    1 
HETATM 6623 C  C8    . DAD H 6 .   ? 43.885 27.438  0.435   1.00 30.25 ? 4004 DAD A C8    1 
HETATM 6624 N  N7    . DAD H 6 .   ? 43.251 28.535  0.780   1.00 29.98 ? 4004 DAD A N7    1 
HETATM 6625 C  C5    . DAD H 6 .   ? 43.053 28.390  2.148   1.00 30.82 ? 4004 DAD A C5    1 
HETATM 6626 C  C6    . DAD H 6 .   ? 42.429 29.208  3.110   1.00 31.46 ? 4004 DAD A C6    1 
HETATM 6627 N  N6    . DAD H 6 .   ? 41.851 30.377  2.825   1.00 32.73 ? 4004 DAD A N6    1 
HETATM 6628 N  N1    . DAD H 6 .   ? 42.414 28.772  4.392   1.00 30.08 ? 4004 DAD A N1    1 
HETATM 6629 C  C2    . DAD H 6 .   ? 42.981 27.596  4.675   1.00 27.66 ? 4004 DAD A C2    1 
HETATM 6630 N  N3    . DAD H 6 .   ? 43.590 26.736  3.862   1.00 27.98 ? 4004 DAD A N3    1 
HETATM 6631 C  C4    . DAD H 6 .   ? 43.592 27.195  2.597   1.00 29.50 ? 4004 DAD A C4    1 
HETATM 6632 O  O     . HOH I 7 .   ? 43.392 33.828  2.147   1.00 33.01 ? 5117 HOH P O     1 
HETATM 6633 O  O     . HOH I 7 .   ? 50.829 45.252  5.673   1.00 43.00 ? 5149 HOH P O     1 
HETATM 6634 O  O     . HOH I 7 .   ? 44.379 36.205  -0.892  1.00 34.37 ? 5188 HOH P O     1 
HETATM 6635 O  O     . HOH I 7 .   ? 46.935 38.590  10.255  1.00 51.73 ? 5197 HOH P O     1 
HETATM 6636 O  O     . HOH I 7 .   ? 44.979 36.365  2.490   1.00 30.66 ? 5242 HOH P O     1 
HETATM 6637 O  O     . HOH I 7 .   ? 44.996 43.617  -3.205  1.00 48.10 ? 5262 HOH P O     1 
HETATM 6638 O  O     . HOH I 7 .   ? 45.034 33.258  -0.876  1.00 50.93 ? 5329 HOH P O     1 
HETATM 6639 O  O     . HOH I 7 .   ? 45.331 38.355  6.230   1.00 35.18 ? 5357 HOH P O     1 
HETATM 6640 O  O     . HOH I 7 .   ? 45.272 35.415  -4.488  1.00 44.22 ? 5406 HOH P O     1 
HETATM 6641 O  O     . HOH J 7 .   ? 53.766 32.084  2.874   1.00 15.78 ? 5005 HOH T O     1 
HETATM 6642 O  O     . HOH J 7 .   ? 63.160 29.104  8.153   1.00 29.47 ? 5039 HOH T O     1 
HETATM 6643 O  O     . HOH J 7 .   ? 60.170 28.998  8.262   1.00 29.08 ? 5049 HOH T O     1 
HETATM 6644 O  O     . HOH J 7 .   ? 55.457 51.333  21.149  1.00 45.42 ? 5086 HOH T O     1 
HETATM 6645 O  O     . HOH J 7 .   ? 51.550 30.411  11.319  1.00 24.86 ? 5094 HOH T O     1 
HETATM 6646 O  O     . HOH J 7 .   ? 61.910 35.160  7.478   1.00 22.51 ? 5096 HOH T O     1 
HETATM 6647 O  O     . HOH J 7 .   ? 51.675 27.287  4.475   1.00 31.51 ? 5098 HOH T O     1 
HETATM 6648 O  O     . HOH J 7 .   ? 55.283 36.357  11.382  1.00 36.49 ? 5099 HOH T O     1 
HETATM 6649 O  O     . HOH J 7 .   ? 59.537 49.699  6.529   1.00 31.88 ? 5100 HOH T O     1 
HETATM 6650 O  O     . HOH J 7 .   ? 56.894 26.478  12.463  1.00 27.08 ? 5131 HOH T O     1 
HETATM 6651 O  O     . HOH J 7 .   ? 62.244 41.724  6.962   1.00 32.65 ? 5159 HOH T O     1 
HETATM 6652 O  O     . HOH J 7 .   ? 41.610 34.662  4.428   1.00 38.97 ? 5161 HOH T O     1 
HETATM 6653 O  O     . HOH J 7 .   ? 58.906 54.934  10.054  1.00 34.51 ? 5178 HOH T O     1 
HETATM 6654 O  O     . HOH J 7 .   ? 46.710 30.560  15.156  1.00 36.11 ? 5198 HOH T O     1 
HETATM 6655 O  O     . HOH J 7 .   ? 54.337 43.219  4.118   1.00 45.12 ? 5201 HOH T O     1 
HETATM 6656 O  O     . HOH J 7 .   ? 37.099 36.554  15.458  1.00 42.60 ? 5233 HOH T O     1 
HETATM 6657 O  O     . HOH J 7 .   ? 54.894 59.179  10.240  1.00 37.32 ? 5266 HOH T O     1 
HETATM 6658 O  O     . HOH J 7 .   ? 60.539 44.630  12.702  1.00 40.95 ? 5275 HOH T O     1 
HETATM 6659 O  O     . HOH J 7 .   ? 61.692 32.046  7.266   1.00 42.39 ? 5282 HOH T O     1 
HETATM 6660 O  O     . HOH J 7 .   ? 57.057 57.746  13.980  1.00 41.58 ? 5283 HOH T O     1 
HETATM 6661 O  O     . HOH J 7 .   ? 54.575 61.005  13.646  1.00 46.33 ? 5290 HOH T O     1 
HETATM 6662 O  O     . HOH J 7 .   ? 57.859 35.128  10.337  1.00 39.46 ? 5301 HOH T O     1 
HETATM 6663 O  O     . HOH J 7 .   ? 48.669 35.846  9.609   1.00 37.99 ? 5315 HOH T O     1 
HETATM 6664 O  O     . HOH J 7 .   ? 53.937 32.370  11.761  1.00 47.61 ? 5362 HOH T O     1 
HETATM 6665 O  O     . HOH K 7 .   ? 54.536 28.116  4.687   1.00 10.27 ? 5001 HOH A O     1 
HETATM 6666 O  O     . HOH K 7 .   ? 71.994 24.330  -3.045  1.00 19.19 ? 5002 HOH A O     1 
HETATM 6667 O  O     . HOH K 7 .   ? 66.792 21.920  0.449   1.00 15.55 ? 5003 HOH A O     1 
HETATM 6668 O  O     . HOH K 7 .   ? 70.443 21.328  3.391   1.00 18.62 ? 5004 HOH A O     1 
HETATM 6669 O  O     . HOH K 7 .   ? 55.715 24.499  -1.174  1.00 17.89 ? 5006 HOH A O     1 
HETATM 6670 O  O     . HOH K 7 .   ? 61.324 31.544  -1.547  1.00 19.69 ? 5007 HOH A O     1 
HETATM 6671 O  O     . HOH K 7 .   ? 45.155 24.532  5.178   1.00 20.52 ? 5008 HOH A O     1 
HETATM 6672 O  O     . HOH K 7 .   ? 69.883 12.273  0.466   1.00 16.14 ? 5009 HOH A O     1 
HETATM 6673 O  O     . HOH K 7 .   ? 59.128 27.480  -4.028  1.00 21.80 ? 5010 HOH A O     1 
HETATM 6674 O  O     . HOH K 7 .   ? 63.193 18.196  3.447   1.00 25.10 ? 5011 HOH A O     1 
HETATM 6675 O  O     . HOH K 7 .   ? 65.798 14.118  -4.769  1.00 18.11 ? 5012 HOH A O     1 
HETATM 6676 O  O     . HOH K 7 .   ? 78.696 16.601  -4.990  1.00 22.56 ? 5013 HOH A O     1 
HETATM 6677 O  O     . HOH K 7 .   ? 82.602 18.984  -10.030 1.00 26.97 ? 5014 HOH A O     1 
HETATM 6678 O  O     . HOH K 7 .   ? 51.997 30.879  0.938   1.00 25.45 ? 5015 HOH A O     1 
HETATM 6679 O  O     . HOH K 7 .   ? 65.263 24.331  -0.397  1.00 23.34 ? 5016 HOH A O     1 
HETATM 6680 O  O     . HOH K 7 .   ? 49.892 27.438  -5.259  1.00 31.54 ? 5017 HOH A O     1 
HETATM 6681 O  O     . HOH K 7 .   ? 34.117 10.278  0.837   1.00 26.35 ? 5018 HOH A O     1 
HETATM 6682 O  O     . HOH K 7 .   ? 75.965 25.339  6.138   1.00 24.34 ? 5020 HOH A O     1 
HETATM 6683 O  O     . HOH K 7 .   ? 74.019 16.550  3.370   1.00 19.44 ? 5021 HOH A O     1 
HETATM 6684 O  O     . HOH K 7 .   ? 72.927 -2.009  2.375   1.00 47.99 ? 5022 HOH A O     1 
HETATM 6685 O  O     . HOH K 7 .   ? 61.565 80.391  28.775  1.00 26.24 ? 5023 HOH A O     1 
HETATM 6686 O  O     . HOH K 7 .   ? 50.914 30.922  -6.451  1.00 20.28 ? 5024 HOH A O     1 
HETATM 6687 O  O     . HOH K 7 .   ? 52.933 32.927  -4.797  1.00 29.13 ? 5025 HOH A O     1 
HETATM 6688 O  O     . HOH K 7 .   ? 63.947 28.827  -7.936  1.00 21.22 ? 5026 HOH A O     1 
HETATM 6689 O  O     . HOH K 7 .   ? 66.903 23.824  24.086  1.00 29.84 ? 5027 HOH A O     1 
HETATM 6690 O  O     . HOH K 7 .   ? 68.557 35.709  -5.921  1.00 24.21 ? 5028 HOH A O     1 
HETATM 6691 O  O     . HOH K 7 .   ? 58.446 38.417  0.152   1.00 21.51 ? 5029 HOH A O     1 
HETATM 6692 O  O     . HOH K 7 .   ? 69.487 24.600  -26.759 1.00 29.69 ? 5030 HOH A O     1 
HETATM 6693 O  O     . HOH K 7 .   ? 77.596 22.069  6.567   1.00 32.49 ? 5031 HOH A O     1 
HETATM 6694 O  O     . HOH K 7 .   ? 54.788 23.912  17.048  1.00 31.24 ? 5032 HOH A O     1 
HETATM 6695 O  O     . HOH K 7 .   ? 38.875 18.927  -7.151  1.00 28.44 ? 5033 HOH A O     1 
HETATM 6696 O  O     . HOH K 7 .   ? 69.816 27.881  -21.015 1.00 22.80 ? 5034 HOH A O     1 
HETATM 6697 O  O     . HOH K 7 .   ? 42.279 75.685  38.374  1.00 42.27 ? 5035 HOH A O     1 
HETATM 6698 O  O     . HOH K 7 .   ? 55.954 30.035  3.019   1.00 26.43 ? 5036 HOH A O     1 
HETATM 6699 O  O     . HOH K 7 .   ? 70.834 19.193  -5.193  1.00 28.47 ? 5037 HOH A O     1 
HETATM 6700 O  O     . HOH K 7 .   ? 70.880 24.238  12.616  1.00 27.78 ? 5041 HOH A O     1 
HETATM 6701 O  O     . HOH K 7 .   ? 78.476 19.420  7.915   1.00 21.74 ? 5042 HOH A O     1 
HETATM 6702 O  O     . HOH K 7 .   ? 67.915 15.235  -11.633 1.00 31.92 ? 5043 HOH A O     1 
HETATM 6703 O  O     . HOH K 7 .   ? 80.270 23.489  5.527   1.00 25.72 ? 5044 HOH A O     1 
HETATM 6704 O  O     . HOH K 7 .   ? 46.589 23.092  11.946  1.00 30.77 ? 5045 HOH A O     1 
HETATM 6705 O  O     . HOH K 7 .   ? 73.115 27.232  -0.166  1.00 26.94 ? 5046 HOH A O     1 
HETATM 6706 O  O     . HOH K 7 .   ? 47.916 34.515  -9.617  1.00 23.75 ? 5047 HOH A O     1 
HETATM 6707 O  O     . HOH K 7 .   ? 72.150 12.128  -7.166  1.00 31.64 ? 5048 HOH A O     1 
HETATM 6708 O  O     . HOH K 7 .   ? 28.837 12.656  2.522   1.00 33.73 ? 5050 HOH A O     1 
HETATM 6709 O  O     . HOH K 7 .   ? 64.451 27.508  -25.750 1.00 24.65 ? 5051 HOH A O     1 
HETATM 6710 O  O     . HOH K 7 .   ? 80.935 35.042  9.883   1.00 28.32 ? 5052 HOH A O     1 
HETATM 6711 O  O     . HOH K 7 .   ? 59.467 52.449  1.843   1.00 40.14 ? 5053 HOH A O     1 
HETATM 6712 O  O     . HOH K 7 .   ? 40.490 22.797  12.206  1.00 30.99 ? 5054 HOH A O     1 
HETATM 6713 O  O     . HOH K 7 .   ? 44.800 27.003  -7.983  1.00 32.00 ? 5055 HOH A O     1 
HETATM 6714 O  O     . HOH K 7 .   ? 68.176 20.615  15.565  1.00 26.69 ? 5056 HOH A O     1 
HETATM 6715 O  O     . HOH K 7 .   ? 58.610 6.624   -0.575  1.00 28.78 ? 5057 HOH A O     1 
HETATM 6716 O  O     . HOH K 7 .   ? 58.493 13.745  15.498  1.00 29.62 ? 5058 HOH A O     1 
HETATM 6717 O  O     . HOH K 7 .   ? 57.786 3.537   6.990   1.00 29.30 ? 5059 HOH A O     1 
HETATM 6718 O  O     . HOH K 7 .   ? 49.063 18.098  -15.299 1.00 27.59 ? 5060 HOH A O     1 
HETATM 6719 O  O     . HOH K 7 .   ? 54.316 23.686  1.390   1.00 18.77 ? 5061 HOH A O     1 
HETATM 6720 O  O     . HOH K 7 .   ? 80.222 13.892  19.339  1.00 34.46 ? 5062 HOH A O     1 
HETATM 6721 O  O     . HOH K 7 .   ? 44.004 16.556  -6.390  1.00 25.60 ? 5063 HOH A O     1 
HETATM 6722 O  O     . HOH K 7 .   ? 44.302 67.498  13.186  1.00 36.07 ? 5064 HOH A O     1 
HETATM 6723 O  O     . HOH K 7 .   ? 55.947 39.599  -19.808 1.00 28.26 ? 5065 HOH A O     1 
HETATM 6724 O  O     . HOH K 7 .   ? 78.711 20.415  10.560  1.00 22.23 ? 5066 HOH A O     1 
HETATM 6725 O  O     . HOH K 7 .   ? 47.281 13.463  7.390   1.00 21.74 ? 5067 HOH A O     1 
HETATM 6726 O  O     . HOH K 7 .   ? 64.579 29.152  4.130   1.00 35.26 ? 5068 HOH A O     1 
HETATM 6727 O  O     . HOH K 7 .   ? 86.062 12.832  -8.984  1.00 40.18 ? 5069 HOH A O     1 
HETATM 6728 O  O     . HOH K 7 .   ? 79.516 34.452  4.760   1.00 33.78 ? 5070 HOH A O     1 
HETATM 6729 O  O     . HOH K 7 .   ? 75.907 5.485   -5.201  1.00 29.35 ? 5071 HOH A O     1 
HETATM 6730 O  O     . HOH K 7 .   ? 38.079 17.701  15.759  1.00 37.95 ? 5072 HOH A O     1 
HETATM 6731 O  O     . HOH K 7 .   ? 52.478 21.538  0.227   1.00 35.71 ? 5073 HOH A O     1 
HETATM 6732 O  O     . HOH K 7 .   ? 89.820 7.728   9.920   1.00 34.22 ? 5074 HOH A O     1 
HETATM 6733 O  O     . HOH K 7 .   ? 61.839 29.824  4.733   1.00 23.37 ? 5075 HOH A O     1 
HETATM 6734 O  O     . HOH K 7 .   ? 67.478 17.626  -8.568  1.00 26.62 ? 5076 HOH A O     1 
HETATM 6735 O  O     . HOH K 7 .   ? 47.256 10.909  8.765   1.00 29.09 ? 5077 HOH A O     1 
HETATM 6736 O  O     . HOH K 7 .   ? 70.305 25.006  -22.889 1.00 25.71 ? 5078 HOH A O     1 
HETATM 6737 O  O     . HOH K 7 .   ? 74.042 12.500  21.114  1.00 27.42 ? 5079 HOH A O     1 
HETATM 6738 O  O     . HOH K 7 .   ? 62.496 24.535  10.634  1.00 26.94 ? 5080 HOH A O     1 
HETATM 6739 O  O     . HOH K 7 .   ? 67.035 9.633   0.328   1.00 41.44 ? 5081 HOH A O     1 
HETATM 6740 O  O     . HOH K 7 .   ? 72.715 27.175  2.926   1.00 31.54 ? 5082 HOH A O     1 
HETATM 6741 O  O     . HOH K 7 .   ? 62.860 17.859  7.132   1.00 27.02 ? 5083 HOH A O     1 
HETATM 6742 O  O     . HOH K 7 .   ? 60.515 22.014  11.062  1.00 32.25 ? 5084 HOH A O     1 
HETATM 6743 O  O     . HOH K 7 .   ? 69.074 27.092  15.019  1.00 28.90 ? 5085 HOH A O     1 
HETATM 6744 O  O     . HOH K 7 .   ? 67.944 33.551  -30.855 1.00 31.85 ? 5087 HOH A O     1 
HETATM 6745 O  O     . HOH K 7 .   ? 58.510 57.995  -10.260 1.00 37.68 ? 5088 HOH A O     1 
HETATM 6746 O  O     . HOH K 7 .   ? 62.818 52.089  -11.151 1.00 34.06 ? 5089 HOH A O     1 
HETATM 6747 O  O     . HOH K 7 .   ? 69.127 30.603  -2.500  1.00 42.41 ? 5090 HOH A O     1 
HETATM 6748 O  O     . HOH K 7 .   ? 51.890 43.684  -2.565  1.00 24.41 ? 5091 HOH A O     1 
HETATM 6749 O  O     . HOH K 7 .   ? 51.940 51.381  4.609   1.00 34.86 ? 5092 HOH A O     1 
HETATM 6750 O  O     . HOH K 7 .   ? 59.451 40.656  -1.423  1.00 31.86 ? 5093 HOH A O     1 
HETATM 6751 O  O     . HOH K 7 .   ? 85.159 44.987  0.942   1.00 53.80 ? 5095 HOH A O     1 
HETATM 6752 O  O     . HOH K 7 .   ? 91.975 10.682  1.113   1.00 28.12 ? 5097 HOH A O     1 
HETATM 6753 O  O     . HOH K 7 .   ? 38.153 33.378  -9.100  1.00 33.12 ? 5101 HOH A O     1 
HETATM 6754 O  O     . HOH K 7 .   ? 70.727 25.037  -11.494 1.00 27.87 ? 5102 HOH A O     1 
HETATM 6755 O  O     . HOH K 7 .   ? 77.157 3.515   -3.068  1.00 27.08 ? 5103 HOH A O     1 
HETATM 6756 O  O     . HOH K 7 .   ? 53.878 55.291  2.692   1.00 40.69 ? 5104 HOH A O     1 
HETATM 6757 O  O     . HOH K 7 .   ? 49.450 6.179   4.483   1.00 33.90 ? 5105 HOH A O     1 
HETATM 6758 O  O     . HOH K 7 .   ? 57.531 38.023  -2.723  1.00 24.91 ? 5106 HOH A O     1 
HETATM 6759 O  O     . HOH K 7 .   ? 43.851 7.865   -4.740  1.00 32.33 ? 5107 HOH A O     1 
HETATM 6760 O  O     . HOH K 7 .   ? 71.619 29.058  15.436  1.00 41.89 ? 5108 HOH A O     1 
HETATM 6761 O  O     . HOH K 7 .   ? 70.697 27.017  -2.441  1.00 24.83 ? 5109 HOH A O     1 
HETATM 6762 O  O     . HOH K 7 .   ? 49.090 26.764  -11.776 1.00 36.78 ? 5110 HOH A O     1 
HETATM 6763 O  O     . HOH K 7 .   ? 33.640 29.808  -11.275 1.00 42.11 ? 5111 HOH A O     1 
HETATM 6764 O  O     . HOH K 7 .   ? 92.063 24.630  -1.445  1.00 35.21 ? 5112 HOH A O     1 
HETATM 6765 O  O     . HOH K 7 .   ? 92.120 10.695  4.064   1.00 42.25 ? 5113 HOH A O     1 
HETATM 6766 O  O     . HOH K 7 .   ? 61.069 27.123  11.492  1.00 48.93 ? 5115 HOH A O     1 
HETATM 6767 O  O     . HOH K 7 .   ? 71.225 3.790   15.298  1.00 41.57 ? 5116 HOH A O     1 
HETATM 6768 O  O     . HOH K 7 .   ? 37.210 9.707   -5.663  1.00 41.20 ? 5118 HOH A O     1 
HETATM 6769 O  O     . HOH K 7 .   ? 88.882 33.988  -4.874  1.00 45.57 ? 5119 HOH A O     1 
HETATM 6770 O  O     . HOH K 7 .   ? 44.718 9.116   -7.192  1.00 27.35 ? 5120 HOH A O     1 
HETATM 6771 O  O     . HOH K 7 .   ? 94.586 18.950  -3.545  1.00 31.51 ? 5121 HOH A O     1 
HETATM 6772 O  O     . HOH K 7 .   ? 39.209 8.634   8.859   1.00 42.86 ? 5123 HOH A O     1 
HETATM 6773 O  O     . HOH K 7 .   ? 62.998 13.458  -7.505  1.00 24.41 ? 5124 HOH A O     1 
HETATM 6774 O  O     . HOH K 7 .   ? 33.479 34.736  13.924  1.00 52.45 ? 5125 HOH A O     1 
HETATM 6775 O  O     . HOH K 7 .   ? 89.019 34.060  -0.264  1.00 45.68 ? 5126 HOH A O     1 
HETATM 6776 O  O     . HOH K 7 .   ? 44.972 10.826  -15.383 1.00 32.83 ? 5127 HOH A O     1 
HETATM 6777 O  O     . HOH K 7 .   ? 39.408 63.818  -1.176  1.00 36.03 ? 5129 HOH A O     1 
HETATM 6778 O  O     . HOH K 7 .   ? 34.575 25.916  -2.738  1.00 35.11 ? 5130 HOH A O     1 
HETATM 6779 O  O     . HOH K 7 .   ? 37.022 21.592  12.196  1.00 48.01 ? 5132 HOH A O     1 
HETATM 6780 O  O     . HOH K 7 .   ? 49.559 67.155  6.543   1.00 28.19 ? 5133 HOH A O     1 
HETATM 6781 O  O     . HOH K 7 .   ? 66.289 15.070  -7.429  1.00 29.84 ? 5134 HOH A O     1 
HETATM 6782 O  O     . HOH K 7 .   ? 89.392 4.477   3.247   1.00 41.23 ? 5135 HOH A O     1 
HETATM 6783 O  O     . HOH K 7 .   ? 76.027 32.259  12.890  1.00 32.62 ? 5136 HOH A O     1 
HETATM 6784 O  O     . HOH K 7 .   ? 39.155 16.142  -11.478 1.00 35.83 ? 5137 HOH A O     1 
HETATM 6785 O  O     . HOH K 7 .   ? 82.776 37.363  3.648   1.00 39.79 ? 5138 HOH A O     1 
HETATM 6786 O  O     . HOH K 7 .   ? 97.793 23.669  3.430   1.00 43.19 ? 5139 HOH A O     1 
HETATM 6787 O  O     . HOH K 7 .   ? 38.384 7.026   5.684   1.00 45.83 ? 5140 HOH A O     1 
HETATM 6788 O  O     . HOH K 7 .   ? 95.141 16.626  -1.547  1.00 43.55 ? 5141 HOH A O     1 
HETATM 6789 O  O     . HOH K 7 .   ? 61.641 46.922  4.902   1.00 25.16 ? 5142 HOH A O     1 
HETATM 6790 O  O     . HOH K 7 .   ? 60.866 27.238  18.409  1.00 31.61 ? 5143 HOH A O     1 
HETATM 6791 O  O     . HOH K 7 .   ? 66.186 21.486  5.387   1.00 20.70 ? 5144 HOH A O     1 
HETATM 6792 O  O     . HOH K 7 .   ? 66.344 5.727   -1.406  1.00 44.82 ? 5145 HOH A O     1 
HETATM 6793 O  O     . HOH K 7 .   ? 57.983 31.719  -23.738 1.00 32.51 ? 5146 HOH A O     1 
HETATM 6794 O  O     . HOH K 7 .   ? 32.629 26.605  10.596  1.00 32.38 ? 5147 HOH A O     1 
HETATM 6795 O  O     . HOH K 7 .   ? 52.544 64.731  -7.385  1.00 39.22 ? 5148 HOH A O     1 
HETATM 6796 O  O     . HOH K 7 .   ? 32.485 65.460  8.263   1.00 55.29 ? 5150 HOH A O     1 
HETATM 6797 O  O     . HOH K 7 .   ? 62.934 -1.871  9.786   1.00 42.76 ? 5151 HOH A O     1 
HETATM 6798 O  O     . HOH K 7 .   ? 35.294 32.994  -10.583 1.00 42.10 ? 5152 HOH A O     1 
HETATM 6799 O  O     . HOH K 7 .   ? 81.865 3.835   16.279  1.00 42.29 ? 5153 HOH A O     1 
HETATM 6800 O  O     . HOH K 7 .   ? 51.866 3.645   -6.621  1.00 33.87 ? 5154 HOH A O     1 
HETATM 6801 O  O     . HOH K 7 .   ? 62.315 39.332  -20.661 1.00 29.83 ? 5155 HOH A O     1 
HETATM 6802 O  O     . HOH K 7 .   ? 41.724 22.287  -10.408 1.00 39.54 ? 5156 HOH A O     1 
HETATM 6803 O  O     . HOH K 7 .   ? 91.988 28.155  1.240   1.00 38.74 ? 5157 HOH A O     1 
HETATM 6804 O  O     . HOH K 7 .   ? 56.950 41.082  -17.403 1.00 36.34 ? 5160 HOH A O     1 
HETATM 6805 O  O     . HOH K 7 .   ? 82.421 28.453  5.379   1.00 40.01 ? 5162 HOH A O     1 
HETATM 6806 O  O     . HOH K 7 .   ? 63.151 12.814  19.441  1.00 33.31 ? 5163 HOH A O     1 
HETATM 6807 O  O     . HOH K 7 .   ? 56.243 7.806   20.079  1.00 43.46 ? 5164 HOH A O     1 
HETATM 6808 O  O     . HOH K 7 .   ? 62.996 5.795   4.872   1.00 31.68 ? 5165 HOH A O     1 
HETATM 6809 O  O     . HOH K 7 .   ? 59.750 12.271  17.832  1.00 39.75 ? 5166 HOH A O     1 
HETATM 6810 O  O     . HOH K 7 .   ? 75.603 33.888  6.676   1.00 44.35 ? 5167 HOH A O     1 
HETATM 6811 O  O     . HOH K 7 .   ? 44.521 23.216  -9.870  1.00 42.77 ? 5168 HOH A O     1 
HETATM 6812 O  O     . HOH K 7 .   ? 71.547 27.902  -12.193 1.00 31.21 ? 5169 HOH A O     1 
HETATM 6813 O  O     . HOH K 7 .   ? 45.066 27.873  -11.186 1.00 43.64 ? 5170 HOH A O     1 
HETATM 6814 O  O     . HOH K 7 .   ? 65.926 26.616  -28.180 1.00 25.68 ? 5171 HOH A O     1 
HETATM 6815 O  O     . HOH K 7 .   ? 69.097 15.698  -14.452 1.00 39.24 ? 5172 HOH A O     1 
HETATM 6816 O  O     . HOH K 7 .   ? 36.119 18.876  -8.387  1.00 43.66 ? 5173 HOH A O     1 
HETATM 6817 O  O     . HOH K 7 .   ? 49.360 21.354  13.750  1.00 26.48 ? 5174 HOH A O     1 
HETATM 6818 O  O     . HOH K 7 .   ? 89.190 10.165  6.417   1.00 30.46 ? 5175 HOH A O     1 
HETATM 6819 O  O     . HOH K 7 .   ? 54.474 44.805  1.213   1.00 28.91 ? 5176 HOH A O     1 
HETATM 6820 O  O     . HOH K 7 .   ? 75.643 3.505   8.608   1.00 36.41 ? 5177 HOH A O     1 
HETATM 6821 O  O     . HOH K 7 .   ? 25.878 24.069  -7.127  1.00 40.70 ? 5179 HOH A O     1 
HETATM 6822 O  O     . HOH K 7 .   ? 82.919 25.630  -11.083 1.00 35.00 ? 5180 HOH A O     1 
HETATM 6823 O  O     . HOH K 7 .   ? 75.827 18.002  -9.637  1.00 36.10 ? 5182 HOH A O     1 
HETATM 6824 O  O     . HOH K 7 .   ? 54.145 40.933  1.239   1.00 50.60 ? 5183 HOH A O     1 
HETATM 6825 O  O     . HOH K 7 .   ? 69.505 25.911  4.852   1.00 30.32 ? 5185 HOH A O     1 
HETATM 6826 O  O     . HOH K 7 .   ? 77.846 25.378  11.373  1.00 40.93 ? 5186 HOH A O     1 
HETATM 6827 O  O     . HOH K 7 .   ? 64.736 8.657   -12.050 1.00 38.63 ? 5187 HOH A O     1 
HETATM 6828 O  O     . HOH K 7 .   ? 86.973 7.442   3.212   1.00 33.36 ? 5189 HOH A O     1 
HETATM 6829 O  O     . HOH K 7 .   ? 72.603 18.641  -3.003  1.00 30.18 ? 5192 HOH A O     1 
HETATM 6830 O  O     . HOH K 7 .   ? 46.643 9.317   13.466  1.00 38.98 ? 5193 HOH A O     1 
HETATM 6831 O  O     . HOH K 7 .   ? 61.597 19.301  -27.658 1.00 34.91 ? 5194 HOH A O     1 
HETATM 6832 O  O     . HOH K 7 .   ? 60.878 30.498  -27.688 1.00 32.78 ? 5196 HOH A O     1 
HETATM 6833 O  O     . HOH K 7 .   ? 82.848 4.320   6.925   1.00 30.10 ? 5199 HOH A O     1 
HETATM 6834 O  O     . HOH K 7 .   ? 43.641 39.547  -14.405 1.00 46.50 ? 5202 HOH A O     1 
HETATM 6835 O  O     . HOH K 7 .   ? 59.790 58.559  18.799  1.00 46.95 ? 5203 HOH A O     1 
HETATM 6836 O  O     . HOH K 7 .   ? 45.745 6.595   -13.579 1.00 45.48 ? 5204 HOH A O     1 
HETATM 6837 O  O     . HOH K 7 .   ? 76.562 29.013  10.960  1.00 30.86 ? 5205 HOH A O     1 
HETATM 6838 O  O     . HOH K 7 .   ? 81.930 11.995  -7.721  1.00 30.28 ? 5206 HOH A O     1 
HETATM 6839 O  O     . HOH K 7 .   ? 67.036 41.048  -15.537 1.00 43.55 ? 5207 HOH A O     1 
HETATM 6840 O  O     . HOH K 7 .   ? 48.707 33.390  -12.100 1.00 38.95 ? 5208 HOH A O     1 
HETATM 6841 O  O     . HOH K 7 .   ? 54.051 2.527   -4.661  1.00 38.03 ? 5209 HOH A O     1 
HETATM 6842 O  O     . HOH K 7 .   ? 42.468 30.020  -11.593 1.00 43.64 ? 5210 HOH A O     1 
HETATM 6843 O  O     . HOH K 7 .   ? 29.527 19.781  2.648   1.00 44.82 ? 5211 HOH A O     1 
HETATM 6844 O  O     . HOH K 7 .   ? 68.934 18.304  -24.037 1.00 41.69 ? 5212 HOH A O     1 
HETATM 6845 O  O     . HOH K 7 .   ? 35.042 38.792  11.839  1.00 37.91 ? 5213 HOH A O     1 
HETATM 6846 O  O     . HOH K 7 .   ? 50.706 49.243  3.027   1.00 35.17 ? 5215 HOH A O     1 
HETATM 6847 O  O     . HOH K 7 .   ? 67.385 33.637  -1.106  1.00 34.88 ? 5216 HOH A O     1 
HETATM 6848 O  O     . HOH K 7 .   ? 38.429 59.734  -3.767  1.00 37.75 ? 5217 HOH A O     1 
HETATM 6849 O  O     . HOH K 7 .   ? 48.660 21.137  2.388   1.00 22.57 ? 5218 HOH A O     1 
HETATM 6850 O  O     . HOH K 7 .   ? 59.741 8.829   19.720  1.00 33.10 ? 5219 HOH A O     1 
HETATM 6851 O  O     . HOH K 7 .   ? 49.449 6.898   8.318   1.00 47.05 ? 5220 HOH A O     1 
HETATM 6852 O  O     . HOH K 7 .   ? 62.649 7.032   21.207  1.00 36.67 ? 5221 HOH A O     1 
HETATM 6853 O  O     . HOH K 7 .   ? 39.439 65.556  9.608   1.00 35.78 ? 5224 HOH A O     1 
HETATM 6854 O  O     . HOH K 7 .   ? 41.129 21.295  -14.287 1.00 48.28 ? 5225 HOH A O     1 
HETATM 6855 O  O     . HOH K 7 .   ? 45.086 70.597  42.620  1.00 43.62 ? 5226 HOH A O     1 
HETATM 6856 O  O     . HOH K 7 .   ? 53.795 16.287  20.004  1.00 43.97 ? 5227 HOH A O     1 
HETATM 6857 O  O     . HOH K 7 .   ? 63.316 28.533  -4.805  1.00 46.09 ? 5228 HOH A O     1 
HETATM 6858 O  O     . HOH K 7 .   ? 66.177 22.209  12.459  1.00 34.31 ? 5229 HOH A O     1 
HETATM 6859 O  O     . HOH K 7 .   ? 90.763 10.830  16.101  1.00 39.53 ? 5230 HOH A O     1 
HETATM 6860 O  O     . HOH K 7 .   ? 45.968 52.322  -8.484  1.00 33.06 ? 5232 HOH A O     1 
HETATM 6861 O  O     . HOH K 7 .   ? 32.443 18.622  -7.781  1.00 38.14 ? 5234 HOH A O     1 
HETATM 6862 O  O     . HOH K 7 .   ? 45.190 7.278   5.201   1.00 33.25 ? 5235 HOH A O     1 
HETATM 6863 O  O     . HOH K 7 .   ? 50.870 59.503  15.760  1.00 33.00 ? 5236 HOH A O     1 
HETATM 6864 O  O     . HOH K 7 .   ? 30.831 57.385  12.776  1.00 50.77 ? 5237 HOH A O     1 
HETATM 6865 O  O     . HOH K 7 .   ? 89.174 6.183   7.487   1.00 42.15 ? 5238 HOH A O     1 
HETATM 6866 O  O     . HOH K 7 .   ? 54.143 11.858  -21.482 1.00 48.00 ? 5240 HOH A O     1 
HETATM 6867 O  O     . HOH K 7 .   ? 60.999 35.049  12.310  1.00 39.33 ? 5241 HOH A O     1 
HETATM 6868 O  O     . HOH K 7 .   ? 81.602 31.566  -7.667  1.00 41.46 ? 5243 HOH A O     1 
HETATM 6869 O  O     . HOH K 7 .   ? 64.570 11.587  -5.739  1.00 30.47 ? 5244 HOH A O     1 
HETATM 6870 O  O     . HOH K 7 .   ? 32.378 53.173  10.818  1.00 39.05 ? 5245 HOH A O     1 
HETATM 6871 O  O     . HOH K 7 .   ? 33.139 50.536  9.252   1.00 37.45 ? 5246 HOH A O     1 
HETATM 6872 O  O     . HOH K 7 .   ? 67.835 10.861  -6.523  1.00 53.10 ? 5248 HOH A O     1 
HETATM 6873 O  O     . HOH K 7 .   ? 80.953 20.183  -12.200 1.00 30.20 ? 5249 HOH A O     1 
HETATM 6874 O  O     . HOH K 7 .   ? 41.388 67.556  10.662  1.00 42.76 ? 5250 HOH A O     1 
HETATM 6875 O  O     . HOH K 7 .   ? 43.953 30.040  -2.366  1.00 58.70 ? 5251 HOH A O     1 
HETATM 6876 O  O     . HOH K 7 .   ? 57.462 37.683  14.504  1.00 41.94 ? 5253 HOH A O     1 
HETATM 6877 O  O     . HOH K 7 .   ? 54.550 29.612  13.346  1.00 31.48 ? 5254 HOH A O     1 
HETATM 6878 O  O     . HOH K 7 .   ? 66.495 26.706  4.552   1.00 29.37 ? 5255 HOH A O     1 
HETATM 6879 O  O     . HOH K 7 .   ? 76.838 34.415  17.158  1.00 56.94 ? 5256 HOH A O     1 
HETATM 6880 O  O     . HOH K 7 .   ? 69.508 18.654  24.321  1.00 61.80 ? 5259 HOH A O     1 
HETATM 6881 O  O     . HOH K 7 .   ? 45.797 42.455  -12.317 1.00 54.78 ? 5260 HOH A O     1 
HETATM 6882 O  O     . HOH K 7 .   ? 71.610 30.821  -13.018 1.00 49.07 ? 5261 HOH A O     1 
HETATM 6883 O  O     . HOH K 7 .   ? 75.926 15.818  -6.224  1.00 32.58 ? 5263 HOH A O     1 
HETATM 6884 O  O     . HOH K 7 .   ? 50.076 13.612  6.465   1.00 22.96 ? 5264 HOH A O     1 
HETATM 6885 O  O     . HOH K 7 .   ? 53.496 28.653  -24.596 1.00 32.48 ? 5265 HOH A O     1 
HETATM 6886 O  O     . HOH K 7 .   ? 90.837 16.458  12.924  1.00 35.53 ? 5268 HOH A O     1 
HETATM 6887 O  O     . HOH K 7 .   ? 47.536 25.710  -21.507 1.00 34.13 ? 5270 HOH A O     1 
HETATM 6888 O  O     . HOH K 7 .   ? 68.647 2.497   16.108  1.00 33.74 ? 5271 HOH A O     1 
HETATM 6889 O  O     . HOH K 7 .   ? 77.177 39.729  12.253  1.00 51.35 ? 5272 HOH A O     1 
HETATM 6890 O  O     . HOH K 7 .   ? 53.512 47.978  2.350   1.00 48.65 ? 5274 HOH A O     1 
HETATM 6891 O  O     . HOH K 7 .   ? 65.820 12.292  -10.103 1.00 39.17 ? 5277 HOH A O     1 
HETATM 6892 O  O     . HOH K 7 .   ? 39.457 36.644  -7.025  1.00 36.41 ? 5278 HOH A O     1 
HETATM 6893 O  O     . HOH K 7 .   ? 47.721 22.470  25.256  1.00 46.66 ? 5279 HOH A O     1 
HETATM 6894 O  O     . HOH K 7 .   ? 39.168 20.330  14.337  1.00 40.78 ? 5280 HOH A O     1 
HETATM 6895 O  O     . HOH K 7 .   ? 39.076 21.744  -8.133  1.00 37.56 ? 5284 HOH A O     1 
HETATM 6896 O  O     . HOH K 7 .   ? 54.901 29.011  16.450  1.00 48.12 ? 5285 HOH A O     1 
HETATM 6897 O  O     . HOH K 7 .   ? 79.335 35.019  0.562   1.00 34.60 ? 5288 HOH A O     1 
HETATM 6898 O  O     . HOH K 7 .   ? 24.744 26.975  11.368  1.00 51.97 ? 5291 HOH A O     1 
HETATM 6899 O  O     . HOH K 7 .   ? 73.678 35.544  -10.524 1.00 40.19 ? 5292 HOH A O     1 
HETATM 6900 O  O     . HOH K 7 .   ? 68.708 37.095  2.906   1.00 47.58 ? 5293 HOH A O     1 
HETATM 6901 O  O     . HOH K 7 .   ? 69.007 37.457  6.293   1.00 45.44 ? 5294 HOH A O     1 
HETATM 6902 O  O     . HOH K 7 .   ? 93.959 10.614  -1.591  1.00 47.59 ? 5295 HOH A O     1 
HETATM 6903 O  O     . HOH K 7 .   ? 56.998 4.266   13.568  1.00 31.44 ? 5296 HOH A O     1 
HETATM 6904 O  O     . HOH K 7 .   ? 70.982 14.523  -8.610  1.00 36.29 ? 5297 HOH A O     1 
HETATM 6905 O  O     . HOH K 7 .   ? 92.710 7.351   9.231   1.00 44.12 ? 5300 HOH A O     1 
HETATM 6906 O  O     . HOH K 7 .   ? 66.628 4.171   17.661  1.00 33.75 ? 5302 HOH A O     1 
HETATM 6907 O  O     . HOH K 7 .   ? 64.324 42.852  -17.597 1.00 42.68 ? 5305 HOH A O     1 
HETATM 6908 O  O     . HOH K 7 .   ? 37.473 37.410  -4.729  1.00 42.08 ? 5306 HOH A O     1 
HETATM 6909 O  O     . HOH K 7 .   ? 67.766 41.465  2.873   1.00 45.32 ? 5307 HOH A O     1 
HETATM 6910 O  O     . HOH K 7 .   ? 48.971 12.304  -18.016 1.00 46.95 ? 5311 HOH A O     1 
HETATM 6911 O  O     . HOH K 7 .   ? 91.501 11.309  -7.407  1.00 42.65 ? 5316 HOH A O     1 
HETATM 6912 O  O     . HOH K 7 .   ? 60.855 15.074  18.897  1.00 44.73 ? 5317 HOH A O     1 
HETATM 6913 O  O     . HOH K 7 .   ? 93.988 14.221  -4.597  1.00 40.83 ? 5318 HOH A O     1 
HETATM 6914 O  O     . HOH K 7 .   ? 37.097 23.668  14.807  1.00 45.50 ? 5319 HOH A O     1 
HETATM 6915 O  O     . HOH K 7 .   ? 45.335 20.156  -17.059 1.00 36.71 ? 5320 HOH A O     1 
HETATM 6916 O  O     . HOH K 7 .   ? 55.083 42.926  -15.923 1.00 43.06 ? 5321 HOH A O     1 
HETATM 6917 O  O     . HOH K 7 .   ? 92.464 47.972  18.719  1.00 49.63 ? 5322 HOH A O     1 
HETATM 6918 O  O     . HOH K 7 .   ? 61.110 -0.424  2.852   1.00 50.23 ? 5323 HOH A O     1 
HETATM 6919 O  O     . HOH K 7 .   ? 46.831 21.912  15.443  1.00 35.69 ? 5324 HOH A O     1 
HETATM 6920 O  O     . HOH K 7 .   ? 93.726 9.756   12.110  1.00 47.70 ? 5325 HOH A O     1 
HETATM 6921 O  O     . HOH K 7 .   ? 72.821 29.015  -9.366  1.00 30.16 ? 5326 HOH A O     1 
HETATM 6922 O  O     . HOH K 7 .   ? 83.006 6.713   -5.806  1.00 39.30 ? 5327 HOH A O     1 
HETATM 6923 O  O     . HOH K 7 .   ? 44.754 32.422  -13.925 1.00 45.69 ? 5328 HOH A O     1 
HETATM 6924 O  O     . HOH K 7 .   ? 82.353 29.445  20.250  1.00 42.31 ? 5331 HOH A O     1 
HETATM 6925 O  O     . HOH K 7 .   ? 60.803 -2.220  16.036  1.00 46.53 ? 5332 HOH A O     1 
HETATM 6926 O  O     . HOH K 7 .   ? 54.053 19.170  -28.568 1.00 42.59 ? 5333 HOH A O     1 
HETATM 6927 O  O     . HOH K 7 .   ? 80.405 1.443   12.863  1.00 58.39 ? 5335 HOH A O     1 
HETATM 6928 O  O     . HOH K 7 .   ? 30.568 63.077  10.364  1.00 44.60 ? 5336 HOH A O     1 
HETATM 6929 O  O     . HOH K 7 .   ? 22.112 21.668  2.853   1.00 40.17 ? 5337 HOH A O     1 
HETATM 6930 O  O     . HOH K 7 .   ? 78.376 11.760  21.223  1.00 66.69 ? 5339 HOH A O     1 
HETATM 6931 O  O     . HOH K 7 .   ? 81.984 36.551  0.566   1.00 37.36 ? 5342 HOH A O     1 
HETATM 6932 O  O     . HOH K 7 .   ? 94.056 35.201  -1.599  1.00 44.27 ? 5343 HOH A O     1 
HETATM 6933 O  O     . HOH K 7 .   ? 80.293 43.086  7.519   1.00 43.91 ? 5344 HOH A O     1 
HETATM 6934 O  O     . HOH K 7 .   ? 56.700 69.668  8.969   1.00 52.59 ? 5345 HOH A O     1 
HETATM 6935 O  O     . HOH K 7 .   ? 87.073 8.989   18.846  1.00 62.70 ? 5346 HOH A O     1 
HETATM 6936 O  O     . HOH K 7 .   ? 75.058 29.486  0.415   1.00 35.41 ? 5347 HOH A O     1 
HETATM 6937 O  O     . HOH K 7 .   ? 35.616 70.113  1.184   1.00 44.13 ? 5349 HOH A O     1 
HETATM 6938 O  O     . HOH K 7 .   ? 66.910 35.311  -16.489 1.00 43.24 ? 5351 HOH A O     1 
HETATM 6939 O  O     . HOH K 7 .   ? 34.638 50.472  13.441  1.00 57.40 ? 5352 HOH A O     1 
HETATM 6940 O  O     . HOH K 7 .   ? 69.362 26.618  11.881  1.00 33.02 ? 5353 HOH A O     1 
HETATM 6941 O  O     . HOH K 7 .   ? 26.530 56.627  2.744   1.00 44.02 ? 5354 HOH A O     1 
HETATM 6942 O  O     . HOH K 7 .   ? 91.674 21.782  14.881  1.00 46.50 ? 5358 HOH A O     1 
HETATM 6943 O  O     . HOH K 7 .   ? 52.803 66.133  -1.023  1.00 41.86 ? 5361 HOH A O     1 
HETATM 6944 O  O     . HOH K 7 .   ? 70.808 9.482   -7.468  1.00 50.86 ? 5365 HOH A O     1 
HETATM 6945 O  O     . HOH K 7 .   ? 66.504 38.171  8.197   1.00 51.82 ? 5366 HOH A O     1 
HETATM 6946 O  O     . HOH K 7 .   ? 51.260 56.562  -12.041 1.00 37.47 ? 5368 HOH A O     1 
HETATM 6947 O  O     . HOH K 7 .   ? 62.442 60.465  18.142  1.00 38.98 ? 5369 HOH A O     1 
HETATM 6948 O  O     . HOH K 7 .   ? 60.250 43.927  -20.117 1.00 45.07 ? 5371 HOH A O     1 
HETATM 6949 O  O     . HOH K 7 .   ? 68.431 34.995  -20.125 1.00 44.94 ? 5372 HOH A O     1 
HETATM 6950 O  O     . HOH K 7 .   ? 55.277 62.472  7.267   1.00 40.78 ? 5374 HOH A O     1 
HETATM 6951 O  O     . HOH K 7 .   ? 68.477 15.322  -22.557 1.00 39.69 ? 5375 HOH A O     1 
HETATM 6952 O  O     . HOH K 7 .   ? 56.573 58.445  -4.449  1.00 35.95 ? 5376 HOH A O     1 
HETATM 6953 O  O     . HOH K 7 .   ? 66.119 13.195  18.851  1.00 46.38 ? 5377 HOH A O     1 
HETATM 6954 O  O     . HOH K 7 .   ? 46.000 36.449  -16.596 1.00 50.52 ? 5378 HOH A O     1 
HETATM 6955 O  O     . HOH K 7 .   ? 24.151 21.148  10.790  1.00 47.31 ? 5379 HOH A O     1 
HETATM 6956 O  O     . HOH K 7 .   ? 58.063 26.192  18.490  1.00 52.20 ? 5380 HOH A O     1 
HETATM 6957 O  O     . HOH K 7 .   ? 39.246 12.831  -12.891 1.00 37.97 ? 5384 HOH A O     1 
HETATM 6958 O  O     . HOH K 7 .   ? 23.377 38.428  7.529   1.00 48.09 ? 5385 HOH A O     1 
HETATM 6959 O  O     . HOH K 7 .   ? 87.849 9.913   9.231   1.00 65.72 ? 5387 HOH A O     1 
HETATM 6960 O  O     . HOH K 7 .   ? 36.455 4.202   -1.074  1.00 47.56 ? 5389 HOH A O     1 
HETATM 6961 O  O     . HOH K 7 .   ? 46.078 6.823   20.854  1.00 52.91 ? 5391 HOH A O     1 
HETATM 6962 O  O     . HOH K 7 .   ? 92.970 34.499  8.328   1.00 41.72 ? 5393 HOH A O     1 
HETATM 6963 O  O     . HOH K 7 .   ? 67.812 12.193  -17.551 1.00 50.45 ? 5394 HOH A O     1 
HETATM 6964 O  O     . HOH K 7 .   ? 50.601 6.074   19.415  1.00 39.82 ? 5396 HOH A O     1 
HETATM 6965 O  O     . HOH K 7 .   ? 52.170 23.654  20.527  1.00 33.41 ? 5397 HOH A O     1 
HETATM 6966 O  O     . HOH K 7 .   ? 58.301 14.381  -27.128 1.00 43.71 ? 5399 HOH A O     1 
HETATM 6967 O  O     . HOH K 7 .   ? 59.658 57.921  -4.201  1.00 45.95 ? 5400 HOH A O     1 
HETATM 6968 O  O     . HOH K 7 .   ? 77.814 2.571   17.348  1.00 56.12 ? 5401 HOH A O     1 
HETATM 6969 O  O     . HOH K 7 .   ? 57.139 15.635  11.926  1.00 36.50 ? 5410 HOH A O     1 
HETATM 6970 O  O     . HOH K 7 .   ? 52.507 30.187  -28.363 1.00 59.63 ? 5415 HOH A O     1 
HETATM 6971 O  O     . HOH K 7 .   ? 51.729 37.851  -20.096 1.00 38.47 ? 5416 HOH A O     1 
HETATM 6972 O  O     . HOH K 7 .   ? 50.453 6.695   -12.844 1.00 36.16 ? 5419 HOH A O     1 
HETATM 6973 O  O     . HOH K 7 .   ? 87.042 17.691  -15.931 1.00 58.77 ? 5420 HOH A O     1 
HETATM 6974 O  O     . HOH K 7 .   ? 90.527 35.399  6.744   1.00 52.75 ? 5427 HOH A O     1 
HETATM 6975 O  O     . HOH K 7 .   ? 52.565 59.688  33.074  1.00 48.86 ? 5428 HOH A O     1 
HETATM 6976 O  O     . HOH K 7 .   ? 26.997 36.318  -7.202  1.00 49.27 ? 5429 HOH A O     1 
HETATM 6977 O  O     . HOH K 7 .   ? 27.914 16.054  -6.334  1.00 42.50 ? 5431 HOH A O     1 
HETATM 6978 O  O     . HOH K 7 .   ? 80.823 24.917  8.535   1.00 28.70 ? 5432 HOH A O     1 
HETATM 6979 O  O     . HOH K 7 .   ? 77.695 23.023  9.584   1.00 27.72 ? 5433 HOH A O     1 
HETATM 6980 O  O     . HOH K 7 .   ? 68.298 24.543  16.359  1.00 50.06 ? 5434 HOH A O     1 
HETATM 6981 O  O     . HOH K 7 .   ? 65.448 23.999  16.583  1.00 30.35 ? 5435 HOH A O     1 
HETATM 6982 O  O     . HOH K 7 .   ? 75.636 21.846  -8.230  1.00 40.01 ? 5436 HOH A O     1 
HETATM 6983 O  O     . HOH K 7 .   ? 46.625 8.277   7.556   1.00 31.56 ? 5438 HOH A O     1 
HETATM 6984 O  O     . HOH K 7 .   ? 65.054 21.401  15.160  1.00 39.53 ? 5439 HOH A O     1 
HETATM 6985 O  O     . HOH K 7 .   ? 73.960 18.158  -5.675  1.00 39.38 ? 5440 HOH A O     1 
HETATM 6986 O  O     . HOH K 7 .   ? 76.317 19.211  -6.948  1.00 34.28 ? 5441 HOH A O     1 
HETATM 6987 O  O     . HOH K 7 .   ? 46.450 28.724  -5.786  1.00 35.90 ? 5442 HOH A O     1 
HETATM 6988 O  O     . HOH L 7 .   ? 40.186 90.280  12.290  1.00 42.62 ? 5040 HOH B O     1 
HETATM 6989 O  O     . HOH L 7 .   ? 44.868 85.438  27.104  1.00 30.45 ? 5114 HOH B O     1 
HETATM 6990 O  O     . HOH L 7 .   ? 46.451 85.585  6.419   1.00 31.64 ? 5122 HOH B O     1 
HETATM 6991 O  O     . HOH L 7 .   ? 50.559 72.887  11.603  1.00 34.29 ? 5158 HOH B O     1 
HETATM 6992 O  O     . HOH L 7 .   ? 44.200 73.471  20.866  1.00 40.84 ? 5181 HOH B O     1 
HETATM 6993 O  O     . HOH L 7 .   ? 46.046 96.583  23.943  1.00 39.44 ? 5191 HOH B O     1 
HETATM 6994 O  O     . HOH L 7 .   ? 50.544 79.530  3.107   1.00 43.94 ? 5195 HOH B O     1 
HETATM 6995 O  O     . HOH L 7 .   ? 49.231 99.699  14.760  1.00 51.08 ? 5200 HOH B O     1 
HETATM 6996 O  O     . HOH L 7 .   ? 64.177 91.925  23.286  1.00 38.96 ? 5214 HOH B O     1 
HETATM 6997 O  O     . HOH L 7 .   ? 48.048 81.328  25.879  1.00 31.23 ? 5223 HOH B O     1 
HETATM 6998 O  O     . HOH L 7 .   ? 44.897 88.294  6.334   1.00 35.10 ? 5231 HOH B O     1 
HETATM 6999 O  O     . HOH L 7 .   ? 45.412 99.938  20.918  1.00 46.97 ? 5258 HOH B O     1 
HETATM 7000 O  O     . HOH L 7 .   ? 52.771 86.739  36.877  1.00 58.58 ? 5267 HOH B O     1 
HETATM 7001 O  O     . HOH L 7 .   ? 43.149 81.674  16.956  1.00 30.76 ? 5273 HOH B O     1 
HETATM 7002 O  O     . HOH L 7 .   ? 50.066 77.572  13.126  1.00 56.25 ? 5287 HOH B O     1 
HETATM 7003 O  O     . HOH L 7 .   ? 53.370 94.274  12.176  1.00 42.76 ? 5298 HOH B O     1 
HETATM 7004 O  O     . HOH L 7 .   ? 57.311 75.151  13.453  1.00 52.74 ? 5309 HOH B O     1 
HETATM 7005 O  O     . HOH L 7 .   ? 39.425 90.000  25.124  1.00 44.10 ? 5313 HOH B O     1 
HETATM 7006 O  O     . HOH L 7 .   ? 63.287 71.639  24.204  1.00 52.87 ? 5338 HOH B O     1 
HETATM 7007 O  O     . HOH L 7 .   ? 42.772 70.554  20.082  1.00 49.42 ? 5395 HOH B O     1 
HETATM 7008 O  O     . HOH L 7 .   ? 45.104 70.881  13.573  1.00 56.77 ? 5398 HOH B O     1 
HETATM 7009 O  O     . HOH L 7 .   ? 44.179 80.070  31.464  1.00 52.79 ? 5405 HOH B O     1 
HETATM 7010 O  O     . HOH L 7 .   ? 45.106 94.055  22.421  1.00 58.42 ? 5417 HOH B O     1 
HETATM 7011 O  O     . HOH L 7 .   ? 60.335 89.094  10.492  1.00 61.58 ? 5426 HOH B O     1 
HETATM 7012 O  O     . HOH L 7 .   ? 49.184 81.947  7.002   1.00 40.36 ? 5437 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   1   ?   ?   ?   P . n 
A 1 2   DG  2   2   ?   ?   ?   P . n 
A 1 3   DA  3   3   ?   ?   ?   P . n 
A 1 4   DA  4   4   ?   ?   ?   P . n 
A 1 5   DA  5   5   ?   ?   ?   P . n 
A 1 6   DA  6   6   ?   ?   ?   P . n 
A 1 7   DC  7   7   ?   ?   ?   P . n 
A 1 8   DG  8   8   ?   ?   ?   P . n 
A 1 9   DA  9   9   ?   ?   ?   P . n 
A 1 10  DC  10  10  ?   ?   ?   P . n 
A 1 11  DG  11  11  ?   ?   ?   P . n 
A 1 12  DG  12  12  12  DG  GUA P . n 
A 1 13  DC  13  13  13  DC  CYT P . n 
A 1 14  DC  14  14  14  DC  CYT P . n 
A 1 15  DA  15  15  15  DA  ADE P . n 
A 1 16  DG  16  16  16  DG  GUA P . n 
A 1 17  DT  17  17  17  DT  THY P . n 
A 1 18  DG  18  18  18  DG  GUA P . n 
A 1 19  DC  19  19  19  DC  CYT P . n 
A 1 20  DC  20  20  20  DC  CYT P . n 
A 1 21  DA  21  21  21  DA  ADE P . n 
A 1 22  2DA 22  22  22  2DA 2DA P . n 
B 2 1   DC  1   1   ?   ?   ?   T . n 
B 2 2   DC  2   2   ?   ?   ?   T . n 
B 2 3   DC  3   3   3   DC  CYT T . n 
B 2 4   DT  4   4   4   DT  THY T . n 
B 2 5   DT  5   5   5   DT  THY T . n 
B 2 6   DT  6   6   6   DT  THY T . n 
B 2 7   DG  7   7   7   DG  GUA T . n 
B 2 8   DG  8   8   8   DG  GUA T . n 
B 2 9   DC  9   9   9   DC  CYT T . n 
B 2 10  DA  10  10  10  DA  ADE T . n 
B 2 11  DC  11  11  11  DC  CYT T . n 
B 2 12  DT  12  12  12  DT  THY T . n 
B 2 13  DG  13  13  13  DG  GUA T . n 
B 2 14  DG  14  14  14  DG  GUA T . n 
B 2 15  DC  15  15  15  DC  CYT T . n 
B 2 16  DC  16  16  ?   ?   ?   T . n 
B 2 17  DG  17  17  ?   ?   ?   T . n 
B 2 18  DT  18  18  ?   ?   ?   T . n 
B 2 19  DC  19  19  ?   ?   ?   T . n 
B 2 20  DG  20  20  ?   ?   ?   T . n 
B 2 21  DT  21  21  ?   ?   ?   T . n 
B 2 22  DT  22  22  ?   ?   ?   T . n 
B 2 23  DT  23  23  ?   ?   ?   T . n 
B 2 24  DT  24  24  ?   ?   ?   T . n 
B 2 25  DC  25  25  ?   ?   ?   T . n 
B 2 26  DG  26  26  ?   ?   ?   T . n 
C 3 1   MET 1   1   1   MET MET A . n 
C 3 2   ILE 2   2   2   ILE ILE A . n 
C 3 3   VAL 3   3   3   VAL VAL A . n 
C 3 4   SER 4   4   4   SER SER A . n 
C 3 5   ASP 5   5   5   ASP ASP A . n 
C 3 6   ILE 6   6   6   ILE ILE A . n 
C 3 7   GLU 7   7   7   GLU GLU A . n 
C 3 8   ALA 8   8   8   ALA ALA A . n 
C 3 9   ASN 9   9   9   ASN ASN A . n 
C 3 10  ALA 10  10  10  ALA ALA A . n 
C 3 11  LEU 11  11  11  LEU LEU A . n 
C 3 12  LEU 12  12  12  LEU LEU A . n 
C 3 13  GLU 13  13  13  GLU GLU A . n 
C 3 14  SER 14  14  14  SER SER A . n 
C 3 15  VAL 15  15  15  VAL VAL A . n 
C 3 16  THR 16  16  16  THR THR A . n 
C 3 17  LYS 17  17  17  LYS LYS A . n 
C 3 18  PHE 18  18  18  PHE PHE A . n 
C 3 19  HIS 19  19  19  HIS HIS A . n 
C 3 20  CYS 20  20  20  CYS CYS A . n 
C 3 21  GLY 21  21  21  GLY GLY A . n 
C 3 22  VAL 22  22  22  VAL VAL A . n 
C 3 23  ILE 23  23  23  ILE ILE A . n 
C 3 24  TYR 24  24  24  TYR TYR A . n 
C 3 25  ASP 25  25  25  ASP ASP A . n 
C 3 26  TYR 26  26  26  TYR TYR A . n 
C 3 27  SER 27  27  27  SER SER A . n 
C 3 28  THR 28  28  28  THR THR A . n 
C 3 29  ALA 29  29  29  ALA ALA A . n 
C 3 30  GLU 30  30  30  GLU GLU A . n 
C 3 31  TYR 31  31  31  TYR TYR A . n 
C 3 32  VAL 32  32  32  VAL VAL A . n 
C 3 33  SER 33  33  33  SER SER A . n 
C 3 34  TYR 34  34  34  TYR TYR A . n 
C 3 35  ARG 35  35  35  ARG ARG A . n 
C 3 36  PRO 36  36  36  PRO PRO A . n 
C 3 37  SER 37  37  37  SER SER A . n 
C 3 38  ASP 38  38  38  ASP ASP A . n 
C 3 39  PHE 39  39  39  PHE PHE A . n 
C 3 40  GLY 40  40  40  GLY GLY A . n 
C 3 41  ALA 41  41  41  ALA ALA A . n 
C 3 42  TYR 42  42  42  TYR TYR A . n 
C 3 43  LEU 43  43  43  LEU LEU A . n 
C 3 44  ASP 44  44  44  ASP ASP A . n 
C 3 45  ALA 45  45  45  ALA ALA A . n 
C 3 46  LEU 46  46  46  LEU LEU A . n 
C 3 47  GLU 47  47  47  GLU GLU A . n 
C 3 48  ALA 48  48  48  ALA ALA A . n 
C 3 49  GLU 49  49  49  GLU GLU A . n 
C 3 50  VAL 50  50  50  VAL VAL A . n 
C 3 51  ALA 51  51  51  ALA ALA A . n 
C 3 52  ARG 52  52  52  ARG ARG A . n 
C 3 53  GLY 53  53  53  GLY GLY A . n 
C 3 54  GLY 54  54  54  GLY GLY A . n 
C 3 55  LEU 55  55  55  LEU LEU A . n 
C 3 56  ILE 56  56  56  ILE ILE A . n 
C 3 57  VAL 57  57  57  VAL VAL A . n 
C 3 58  PHE 58  58  58  PHE PHE A . n 
C 3 59  HIS 59  59  59  HIS HIS A . n 
C 3 60  ASN 60  60  60  ASN ASN A . n 
C 3 61  GLY 61  61  61  GLY GLY A . n 
C 3 62  HIS 62  62  62  HIS HIS A . n 
C 3 63  LYS 63  63  63  LYS LYS A . n 
C 3 64  TYR 64  64  64  TYR TYR A . n 
C 3 65  ASP 65  65  65  ASP ASP A . n 
C 3 66  VAL 66  66  66  VAL VAL A . n 
C 3 67  PRO 67  67  67  PRO PRO A . n 
C 3 68  ALA 68  68  68  ALA ALA A . n 
C 3 69  LEU 69  69  69  LEU LEU A . n 
C 3 70  THR 70  70  70  THR THR A . n 
C 3 71  LYS 71  71  71  LYS LYS A . n 
C 3 72  LEU 72  72  72  LEU LEU A . n 
C 3 73  ALA 73  73  73  ALA ALA A . n 
C 3 74  LYS 74  74  74  LYS LYS A . n 
C 3 75  LEU 75  75  75  LEU LEU A . n 
C 3 76  GLN 76  76  76  GLN GLN A . n 
C 3 77  LEU 77  77  77  LEU LEU A . n 
C 3 78  ASN 78  78  78  ASN ASN A . n 
C 3 79  ARG 79  79  79  ARG ARG A . n 
C 3 80  GLU 80  80  80  GLU GLU A . n 
C 3 81  PHE 81  81  81  PHE PHE A . n 
C 3 82  HIS 82  82  82  HIS HIS A . n 
C 3 83  LEU 83  83  83  LEU LEU A . n 
C 3 84  PRO 84  84  84  PRO PRO A . n 
C 3 85  ARG 85  85  85  ARG ARG A . n 
C 3 86  GLU 86  86  86  GLU GLU A . n 
C 3 87  ASN 87  87  87  ASN ASN A . n 
C 3 88  CYS 88  88  88  CYS CYS A . n 
C 3 89  ILE 89  89  89  ILE ILE A . n 
C 3 90  ASP 90  90  90  ASP ASP A . n 
C 3 91  THR 91  91  91  THR THR A . n 
C 3 92  LEU 92  92  92  LEU LEU A . n 
C 3 93  VAL 93  93  93  VAL VAL A . n 
C 3 94  LEU 94  94  94  LEU LEU A . n 
C 3 95  SER 95  95  95  SER SER A . n 
C 3 96  ARG 96  96  96  ARG ARG A . n 
C 3 97  LEU 97  97  97  LEU LEU A . n 
C 3 98  ILE 98  98  98  ILE ILE A . n 
C 3 99  HIS 99  99  99  HIS HIS A . n 
C 3 100 SER 100 100 100 SER SER A . n 
C 3 101 ASN 101 101 101 ASN ASN A . n 
C 3 102 LEU 102 102 102 LEU LEU A . n 
C 3 103 LYS 103 103 103 LYS LYS A . n 
C 3 104 ASP 104 104 104 ASP ASP A . n 
C 3 105 THR 105 105 105 THR THR A . n 
C 3 106 ASP 106 106 106 ASP ASP A . n 
C 3 107 MET 107 107 107 MET MET A . n 
C 3 108 GLY 108 108 108 GLY GLY A . n 
C 3 109 LEU 109 109 109 LEU LEU A . n 
C 3 110 LEU 110 110 110 LEU LEU A . n 
C 3 111 ARG 111 111 111 ARG ARG A . n 
C 3 112 SER 112 112 112 SER SER A . n 
C 3 113 GLY 113 113 113 GLY GLY A . n 
C 3 114 LYS 114 114 114 LYS LYS A . n 
C 3 115 LEU 115 115 115 LEU LEU A . n 
C 3 116 PRO 116 116 116 PRO PRO A . n 
C 3 117 GLY 117 117 117 GLY GLY A . n 
C 3 118 ALA 118 124 124 ALA ALA A . n 
C 3 119 LEU 119 125 125 LEU LEU A . n 
C 3 120 GLU 120 126 126 GLU GLU A . n 
C 3 121 ALA 121 127 127 ALA ALA A . n 
C 3 122 TRP 122 128 128 TRP TRP A . n 
C 3 123 GLY 123 129 129 GLY GLY A . n 
C 3 124 TYR 124 130 130 TYR TYR A . n 
C 3 125 ARG 125 131 131 ARG ARG A . n 
C 3 126 LEU 126 132 132 LEU LEU A . n 
C 3 127 GLY 127 133 133 GLY GLY A . n 
C 3 128 GLU 128 134 134 GLU GLU A . n 
C 3 129 MET 129 135 135 MET MET A . n 
C 3 130 LYS 130 136 136 LYS LYS A . n 
C 3 131 GLY 131 137 137 GLY GLY A . n 
C 3 132 GLU 132 138 138 GLU GLU A . n 
C 3 133 TYR 133 139 139 TYR TYR A . n 
C 3 134 LYS 134 140 140 LYS LYS A . n 
C 3 135 ASP 135 141 141 ASP ASP A . n 
C 3 136 ASP 136 142 142 ASP ASP A . n 
C 3 137 PHE 137 143 143 PHE PHE A . n 
C 3 138 LYS 138 144 144 LYS LYS A . n 
C 3 139 ARG 139 145 145 ARG ARG A . n 
C 3 140 MET 140 146 146 MET MET A . n 
C 3 141 LEU 141 147 147 LEU LEU A . n 
C 3 142 GLU 142 148 148 GLU GLU A . n 
C 3 143 GLU 143 149 149 GLU GLU A . n 
C 3 144 GLN 144 150 150 GLN GLN A . n 
C 3 145 GLY 145 151 151 GLY GLY A . n 
C 3 146 GLU 146 152 152 GLU GLU A . n 
C 3 147 GLU 147 153 153 GLU GLU A . n 
C 3 148 TYR 148 154 154 TYR TYR A . n 
C 3 149 VAL 149 155 155 VAL VAL A . n 
C 3 150 ASP 150 156 156 ASP ASP A . n 
C 3 151 GLY 151 157 157 GLY GLY A . n 
C 3 152 MET 152 158 158 MET MET A . n 
C 3 153 GLU 153 159 159 GLU GLU A . n 
C 3 154 TRP 154 160 160 TRP TRP A . n 
C 3 155 TRP 155 161 161 TRP TRP A . n 
C 3 156 ASN 156 162 162 ASN ASN A . n 
C 3 157 PHE 157 163 163 PHE PHE A . n 
C 3 158 ASN 158 164 164 ASN ASN A . n 
C 3 159 GLU 159 165 165 GLU GLU A . n 
C 3 160 GLU 160 166 166 GLU GLU A . n 
C 3 161 MET 161 167 167 MET MET A . n 
C 3 162 MET 162 168 168 MET MET A . n 
C 3 163 ASP 163 169 169 ASP ASP A . n 
C 3 164 TYR 164 170 170 TYR TYR A . n 
C 3 165 ASN 165 171 171 ASN ASN A . n 
C 3 166 VAL 166 172 172 VAL VAL A . n 
C 3 167 GLN 167 173 173 GLN GLN A . n 
C 3 168 ASP 168 174 174 ASP ASP A . n 
C 3 169 VAL 169 175 175 VAL VAL A . n 
C 3 170 VAL 170 176 176 VAL VAL A . n 
C 3 171 VAL 171 177 177 VAL VAL A . n 
C 3 172 THR 172 178 178 THR THR A . n 
C 3 173 LYS 173 179 179 LYS LYS A . n 
C 3 174 ALA 174 180 180 ALA ALA A . n 
C 3 175 LEU 175 181 181 LEU LEU A . n 
C 3 176 LEU 176 182 182 LEU LEU A . n 
C 3 177 GLU 177 183 183 GLU GLU A . n 
C 3 178 LYS 178 184 184 LYS LYS A . n 
C 3 179 LEU 179 185 185 LEU LEU A . n 
C 3 180 LEU 180 186 186 LEU LEU A . n 
C 3 181 SER 181 187 187 SER SER A . n 
C 3 182 ASP 182 188 188 ASP ASP A . n 
C 3 183 LYS 183 189 189 LYS LYS A . n 
C 3 184 HIS 184 190 190 HIS HIS A . n 
C 3 185 TYR 185 191 191 TYR TYR A . n 
C 3 186 PHE 186 192 192 PHE PHE A . n 
C 3 187 PRO 187 193 193 PRO PRO A . n 
C 3 188 PRO 188 194 194 PRO PRO A . n 
C 3 189 GLU 189 195 195 GLU GLU A . n 
C 3 190 ILE 190 196 196 ILE ILE A . n 
C 3 191 ASP 191 197 197 ASP ASP A . n 
C 3 192 PHE 192 198 198 PHE PHE A . n 
C 3 193 THR 193 199 199 THR THR A . n 
C 3 194 ASP 194 200 200 ASP ASP A . n 
C 3 195 VAL 195 201 201 VAL VAL A . n 
C 3 196 GLY 196 202 202 GLY GLY A . n 
C 3 197 TYR 197 203 203 TYR TYR A . n 
C 3 198 THR 198 204 204 THR THR A . n 
C 3 199 THR 199 205 205 THR THR A . n 
C 3 200 PHE 200 206 206 PHE PHE A . n 
C 3 201 TRP 201 207 207 TRP TRP A . n 
C 3 202 SER 202 208 208 SER SER A . n 
C 3 203 GLU 203 209 209 GLU GLU A . n 
C 3 204 SER 204 210 210 SER SER A . n 
C 3 205 LEU 205 211 211 LEU LEU A . n 
C 3 206 GLU 206 212 212 GLU GLU A . n 
C 3 207 ALA 207 213 213 ALA ALA A . n 
C 3 208 VAL 208 214 214 VAL VAL A . n 
C 3 209 ASP 209 215 215 ASP ASP A . n 
C 3 210 ILE 210 216 216 ILE ILE A . n 
C 3 211 GLU 211 217 217 GLU GLU A . n 
C 3 212 HIS 212 218 218 HIS HIS A . n 
C 3 213 ARG 213 219 219 ARG ARG A . n 
C 3 214 ALA 214 220 220 ALA ALA A . n 
C 3 215 ALA 215 221 221 ALA ALA A . n 
C 3 216 TRP 216 222 222 TRP TRP A . n 
C 3 217 LEU 217 223 223 LEU LEU A . n 
C 3 218 LEU 218 224 224 LEU LEU A . n 
C 3 219 ALA 219 225 225 ALA ALA A . n 
C 3 220 LYS 220 226 226 LYS LYS A . n 
C 3 221 GLN 221 227 227 GLN GLN A . n 
C 3 222 GLU 222 228 228 GLU GLU A . n 
C 3 223 ARG 223 229 229 ARG ARG A . n 
C 3 224 ASN 224 230 230 ASN ASN A . n 
C 3 225 GLY 225 231 231 GLY GLY A . n 
C 3 226 PHE 226 232 232 PHE PHE A . n 
C 3 227 PRO 227 233 233 PRO PRO A . n 
C 3 228 PHE 228 234 234 PHE PHE A . n 
C 3 229 ASP 229 235 235 ASP ASP A . n 
C 3 230 THR 230 236 236 THR THR A . n 
C 3 231 LYS 231 237 237 LYS LYS A . n 
C 3 232 ALA 232 238 238 ALA ALA A . n 
C 3 233 ILE 233 239 239 ILE ILE A . n 
C 3 234 GLU 234 240 240 GLU GLU A . n 
C 3 235 GLU 235 241 241 GLU GLU A . n 
C 3 236 LEU 236 242 242 LEU LEU A . n 
C 3 237 TYR 237 243 243 TYR TYR A . n 
C 3 238 VAL 238 244 244 VAL VAL A . n 
C 3 239 GLU 239 245 245 GLU GLU A . n 
C 3 240 LEU 240 246 246 LEU LEU A . n 
C 3 241 ALA 241 247 247 ALA ALA A . n 
C 3 242 ALA 242 248 248 ALA ALA A . n 
C 3 243 ARG 243 249 249 ARG ARG A . n 
C 3 244 ARG 244 250 250 ARG ARG A . n 
C 3 245 SER 245 251 251 SER SER A . n 
C 3 246 GLU 246 252 252 GLU GLU A . n 
C 3 247 LEU 247 253 253 LEU LEU A . n 
C 3 248 LEU 248 254 254 LEU LEU A . n 
C 3 249 ARG 249 255 255 ARG ARG A . n 
C 3 250 LYS 250 256 256 LYS LYS A . n 
C 3 251 LEU 251 257 257 LEU LEU A . n 
C 3 252 THR 252 258 258 THR THR A . n 
C 3 253 GLU 253 259 259 GLU GLU A . n 
C 3 254 THR 254 260 260 THR THR A . n 
C 3 255 PHE 255 261 261 PHE PHE A . n 
C 3 256 GLY 256 262 262 GLY GLY A . n 
C 3 257 SER 257 263 263 SER SER A . n 
C 3 258 TRP 258 264 264 TRP TRP A . n 
C 3 259 TYR 259 265 265 TYR TYR A . n 
C 3 260 GLN 260 266 266 GLN GLN A . n 
C 3 261 PRO 261 267 267 PRO PRO A . n 
C 3 262 LYS 262 268 268 LYS LYS A . n 
C 3 263 GLY 263 269 269 GLY GLY A . n 
C 3 264 GLY 264 270 270 GLY GLY A . n 
C 3 265 THR 265 271 271 THR THR A . n 
C 3 266 GLU 266 272 272 GLU GLU A . n 
C 3 267 MET 267 273 273 MET MET A . n 
C 3 268 PHE 268 274 274 PHE PHE A . n 
C 3 269 CYS 269 275 275 CYS CYS A . n 
C 3 270 HIS 270 276 276 HIS HIS A . n 
C 3 271 PRO 271 277 277 PRO PRO A . n 
C 3 272 ARG 272 278 278 ARG ARG A . n 
C 3 273 THR 273 279 279 THR THR A . n 
C 3 274 GLY 274 280 280 GLY GLY A . n 
C 3 275 LYS 275 281 281 LYS LYS A . n 
C 3 276 PRO 276 282 282 PRO PRO A . n 
C 3 277 LEU 277 283 283 LEU LEU A . n 
C 3 278 PRO 278 284 284 PRO PRO A . n 
C 3 279 LYS 279 285 285 LYS LYS A . n 
C 3 280 TYR 280 286 286 TYR TYR A . n 
C 3 281 PRO 281 287 287 PRO PRO A . n 
C 3 282 ARG 282 288 288 ARG ARG A . n 
C 3 283 ILE 283 289 289 ILE ILE A . n 
C 3 284 LYS 284 290 290 LYS LYS A . n 
C 3 285 THR 285 291 291 THR THR A . n 
C 3 286 PRO 286 292 292 PRO PRO A . n 
C 3 287 LYS 287 293 293 LYS LYS A . n 
C 3 288 VAL 288 294 294 VAL VAL A . n 
C 3 289 GLY 289 295 295 GLY GLY A . n 
C 3 290 GLY 290 296 296 GLY GLY A . n 
C 3 291 ILE 291 297 297 ILE ILE A . n 
C 3 292 PHE 292 298 ?   ?   ?   A . n 
C 3 293 LYS 293 299 ?   ?   ?   A . n 
C 3 294 LYS 294 300 ?   ?   ?   A . n 
C 3 295 PRO 295 301 ?   ?   ?   A . n 
C 3 296 LYS 296 302 ?   ?   ?   A . n 
C 3 297 ASN 297 303 ?   ?   ?   A . n 
C 3 298 LYS 298 304 ?   ?   ?   A . n 
C 3 299 ALA 299 305 ?   ?   ?   A . n 
C 3 300 GLN 300 306 ?   ?   ?   A . n 
C 3 301 ARG 301 307 ?   ?   ?   A . n 
C 3 302 GLU 302 308 ?   ?   ?   A . n 
C 3 303 GLY 303 309 ?   ?   ?   A . n 
C 3 304 ARG 304 310 ?   ?   ?   A . n 
C 3 305 GLU 305 311 ?   ?   ?   A . n 
C 3 306 PRO 306 312 ?   ?   ?   A . n 
C 3 307 CYS 307 313 ?   ?   ?   A . n 
C 3 308 GLU 308 314 ?   ?   ?   A . n 
C 3 309 LEU 309 315 ?   ?   ?   A . n 
C 3 310 ASP 310 316 316 ASP ASP A . n 
C 3 311 THR 311 317 317 THR THR A . n 
C 3 312 ARG 312 318 318 ARG ARG A . n 
C 3 313 GLU 313 319 319 GLU GLU A . n 
C 3 314 TYR 314 320 320 TYR TYR A . n 
C 3 315 VAL 315 321 321 VAL VAL A . n 
C 3 316 ALA 316 322 322 ALA ALA A . n 
C 3 317 GLY 317 323 323 GLY GLY A . n 
C 3 318 ALA 318 324 324 ALA ALA A . n 
C 3 319 PRO 319 325 325 PRO PRO A . n 
C 3 320 TYR 320 326 326 TYR TYR A . n 
C 3 321 THR 321 327 327 THR THR A . n 
C 3 322 PRO 322 328 328 PRO PRO A . n 
C 3 323 VAL 323 329 329 VAL VAL A . n 
C 3 324 GLU 324 330 330 GLU GLU A . n 
C 3 325 HIS 325 331 331 HIS HIS A . n 
C 3 326 VAL 326 332 332 VAL VAL A . n 
C 3 327 VAL 327 333 333 VAL VAL A . n 
C 3 328 PHE 328 334 334 PHE PHE A . n 
C 3 329 ASN 329 335 335 ASN ASN A . n 
C 3 330 PRO 330 336 336 PRO PRO A . n 
C 3 331 SER 331 337 337 SER SER A . n 
C 3 332 SER 332 338 338 SER SER A . n 
C 3 333 ARG 333 339 339 ARG ARG A . n 
C 3 334 ASP 334 340 340 ASP ASP A . n 
C 3 335 HIS 335 341 341 HIS HIS A . n 
C 3 336 ILE 336 342 342 ILE ILE A . n 
C 3 337 GLN 337 343 343 GLN GLN A . n 
C 3 338 LYS 338 344 344 LYS LYS A . n 
C 3 339 LYS 339 345 345 LYS LYS A . n 
C 3 340 LEU 340 346 346 LEU LEU A . n 
C 3 341 GLN 341 347 347 GLN GLN A . n 
C 3 342 GLU 342 348 348 GLU GLU A . n 
C 3 343 ALA 343 349 349 ALA ALA A . n 
C 3 344 GLY 344 350 350 GLY GLY A . n 
C 3 345 TRP 345 351 351 TRP TRP A . n 
C 3 346 VAL 346 352 352 VAL VAL A . n 
C 3 347 PRO 347 353 353 PRO PRO A . n 
C 3 348 THR 348 354 354 THR THR A . n 
C 3 349 LYS 349 355 355 LYS LYS A . n 
C 3 350 TYR 350 356 356 TYR TYR A . n 
C 3 351 THR 351 357 357 THR THR A . n 
C 3 352 ASP 352 358 358 ASP ASP A . n 
C 3 353 LYS 353 359 359 LYS LYS A . n 
C 3 354 GLY 354 360 360 GLY GLY A . n 
C 3 355 ALA 355 361 361 ALA ALA A . n 
C 3 356 PRO 356 362 362 PRO PRO A . n 
C 3 357 VAL 357 363 363 VAL VAL A . n 
C 3 358 VAL 358 364 364 VAL VAL A . n 
C 3 359 ASP 359 365 365 ASP ASP A . n 
C 3 360 ASP 360 366 366 ASP ASP A . n 
C 3 361 GLU 361 367 367 GLU GLU A . n 
C 3 362 VAL 362 368 368 VAL VAL A . n 
C 3 363 LEU 363 369 369 LEU LEU A . n 
C 3 364 GLU 364 370 370 GLU GLU A . n 
C 3 365 GLY 365 371 371 GLY GLY A . n 
C 3 366 VAL 366 372 372 VAL VAL A . n 
C 3 367 ARG 367 373 373 ARG ARG A . n 
C 3 368 VAL 368 374 374 VAL VAL A . n 
C 3 369 ASP 369 375 375 ASP ASP A . n 
C 3 370 ASP 370 376 376 ASP ASP A . n 
C 3 371 PRO 371 377 377 PRO PRO A . n 
C 3 372 GLU 372 378 378 GLU GLU A . n 
C 3 373 LYS 373 379 379 LYS LYS A . n 
C 3 374 GLN 374 380 380 GLN GLN A . n 
C 3 375 ALA 375 381 381 ALA ALA A . n 
C 3 376 ALA 376 382 382 ALA ALA A . n 
C 3 377 ILE 377 383 383 ILE ILE A . n 
C 3 378 ASP 378 384 384 ASP ASP A . n 
C 3 379 LEU 379 385 385 LEU LEU A . n 
C 3 380 ILE 380 386 386 ILE ILE A . n 
C 3 381 LYS 381 387 387 LYS LYS A . n 
C 3 382 GLU 382 388 388 GLU GLU A . n 
C 3 383 TYR 383 389 389 TYR TYR A . n 
C 3 384 LEU 384 390 390 LEU LEU A . n 
C 3 385 MET 385 391 391 MET MET A . n 
C 3 386 ILE 386 392 392 ILE ILE A . n 
C 3 387 GLN 387 393 393 GLN GLN A . n 
C 3 388 LYS 388 394 394 LYS LYS A . n 
C 3 389 ARG 389 395 395 ARG ARG A . n 
C 3 390 ILE 390 396 396 ILE ILE A . n 
C 3 391 GLY 391 397 397 GLY GLY A . n 
C 3 392 GLN 392 398 398 GLN GLN A . n 
C 3 393 SER 393 399 399 SER SER A . n 
C 3 394 ALA 394 400 400 ALA ALA A . n 
C 3 395 GLU 395 401 401 GLU GLU A . n 
C 3 396 GLY 396 402 402 GLY GLY A . n 
C 3 397 ASP 397 403 403 ASP ASP A . n 
C 3 398 LYS 398 404 404 LYS LYS A . n 
C 3 399 ALA 399 405 405 ALA ALA A . n 
C 3 400 TRP 400 406 406 TRP TRP A . n 
C 3 401 LEU 401 407 407 LEU LEU A . n 
C 3 402 ARG 402 408 408 ARG ARG A . n 
C 3 403 TYR 403 409 409 TYR TYR A . n 
C 3 404 VAL 404 410 410 VAL VAL A . n 
C 3 405 ALA 405 411 411 ALA ALA A . n 
C 3 406 GLU 406 412 412 GLU GLU A . n 
C 3 407 ASP 407 413 413 ASP ASP A . n 
C 3 408 GLY 408 414 414 GLY GLY A . n 
C 3 409 LYS 409 415 415 LYS LYS A . n 
C 3 410 ILE 410 416 416 ILE ILE A . n 
C 3 411 HIS 411 417 417 HIS HIS A . n 
C 3 412 GLY 412 418 418 GLY GLY A . n 
C 3 413 SER 413 419 419 SER SER A . n 
C 3 414 VAL 414 420 420 VAL VAL A . n 
C 3 415 ASN 415 421 421 ASN ASN A . n 
C 3 416 PRO 416 422 422 PRO PRO A . n 
C 3 417 ASN 417 423 423 ASN ASN A . n 
C 3 418 GLY 418 424 424 GLY GLY A . n 
C 3 419 ALA 419 425 425 ALA ALA A . n 
C 3 420 VAL 420 426 426 VAL VAL A . n 
C 3 421 THR 421 427 427 THR THR A . n 
C 3 422 GLY 422 428 428 GLY GLY A . n 
C 3 423 ARG 423 429 429 ARG ARG A . n 
C 3 424 ALA 424 430 430 ALA ALA A . n 
C 3 425 THR 425 431 431 THR THR A . n 
C 3 426 HIS 426 432 432 HIS HIS A . n 
C 3 427 ALA 427 433 433 ALA ALA A . n 
C 3 428 PHE 428 434 434 PHE PHE A . n 
C 3 429 PRO 429 435 435 PRO PRO A . n 
C 3 430 ASN 430 436 436 ASN ASN A . n 
C 3 431 LEU 431 437 437 LEU LEU A . n 
C 3 432 ALA 432 438 438 ALA ALA A . n 
C 3 433 GLN 433 439 439 GLN GLN A . n 
C 3 434 ILE 434 440 440 ILE ILE A . n 
C 3 435 PRO 435 441 441 PRO PRO A . n 
C 3 436 GLY 436 442 442 GLY GLY A . n 
C 3 437 VAL 437 443 443 VAL VAL A . n 
C 3 438 ARG 438 444 444 ARG ARG A . n 
C 3 439 SER 439 445 445 SER SER A . n 
C 3 440 PRO 440 446 446 PRO PRO A . n 
C 3 441 TYR 441 447 447 TYR TYR A . n 
C 3 442 GLY 442 448 448 GLY GLY A . n 
C 3 443 GLU 443 449 449 GLU GLU A . n 
C 3 444 GLN 444 450 450 GLN GLN A . n 
C 3 445 CYS 445 451 451 CYS CYS A . n 
C 3 446 ARG 446 452 452 ARG ARG A . n 
C 3 447 ALA 447 453 453 ALA ALA A . n 
C 3 448 ALA 448 454 454 ALA ALA A . n 
C 3 449 PHE 449 455 455 PHE PHE A . n 
C 3 450 GLY 450 456 456 GLY GLY A . n 
C 3 451 ALA 451 457 457 ALA ALA A . n 
C 3 452 GLU 452 458 458 GLU GLU A . n 
C 3 453 HIS 453 459 459 HIS HIS A . n 
C 3 454 HIS 454 460 460 HIS HIS A . n 
C 3 455 LEU 455 461 461 LEU LEU A . n 
C 3 456 ASP 456 462 462 ASP ASP A . n 
C 3 457 GLY 457 463 463 GLY GLY A . n 
C 3 458 ILE 458 464 464 ILE ILE A . n 
C 3 459 THR 459 465 465 THR THR A . n 
C 3 460 GLY 460 466 466 GLY GLY A . n 
C 3 461 LYS 461 467 467 LYS LYS A . n 
C 3 462 PRO 462 468 468 PRO PRO A . n 
C 3 463 TRP 463 469 469 TRP TRP A . n 
C 3 464 VAL 464 470 470 VAL VAL A . n 
C 3 465 GLN 465 471 471 GLN GLN A . n 
C 3 466 ALA 466 472 472 ALA ALA A . n 
C 3 467 GLY 467 473 473 GLY GLY A . n 
C 3 468 ILE 468 474 474 ILE ILE A . n 
C 3 469 ASP 469 475 475 ASP ASP A . n 
C 3 470 ALA 470 476 476 ALA ALA A . n 
C 3 471 SER 471 477 477 SER SER A . n 
C 3 472 GLY 472 478 478 GLY GLY A . n 
C 3 473 LEU 473 479 479 LEU LEU A . n 
C 3 474 GLU 474 480 480 GLU GLU A . n 
C 3 475 LEU 475 481 481 LEU LEU A . n 
C 3 476 ARG 476 482 482 ARG ARG A . n 
C 3 477 CYS 477 483 483 CYS CYS A . n 
C 3 478 LEU 478 484 484 LEU LEU A . n 
C 3 479 ALA 479 485 485 ALA ALA A . n 
C 3 480 HIS 480 486 486 HIS HIS A . n 
C 3 481 PHE 481 487 487 PHE PHE A . n 
C 3 482 MET 482 488 488 MET MET A . n 
C 3 483 ALA 483 489 489 ALA ALA A . n 
C 3 484 ARG 484 490 490 ARG ARG A . n 
C 3 485 PHE 485 491 491 PHE PHE A . n 
C 3 486 ASP 486 492 492 ASP ASP A . n 
C 3 487 ASN 487 493 493 ASN ASN A . n 
C 3 488 GLY 488 494 494 GLY GLY A . n 
C 3 489 GLU 489 495 495 GLU GLU A . n 
C 3 490 TYR 490 496 496 TYR TYR A . n 
C 3 491 ALA 491 497 497 ALA ALA A . n 
C 3 492 HIS 492 498 498 HIS HIS A . n 
C 3 493 GLU 493 499 499 GLU GLU A . n 
C 3 494 ILE 494 500 500 ILE ILE A . n 
C 3 495 LEU 495 501 501 LEU LEU A . n 
C 3 496 ASN 496 502 502 ASN ASN A . n 
C 3 497 GLY 497 503 503 GLY GLY A . n 
C 3 498 ASP 498 504 504 ASP ASP A . n 
C 3 499 ILE 499 505 505 ILE ILE A . n 
C 3 500 HIS 500 506 506 HIS HIS A . n 
C 3 501 THR 501 507 507 THR THR A . n 
C 3 502 LYS 502 508 508 LYS LYS A . n 
C 3 503 ASN 503 509 509 ASN ASN A . n 
C 3 504 GLN 504 510 510 GLN GLN A . n 
C 3 505 ILE 505 511 511 ILE ILE A . n 
C 3 506 ALA 506 512 512 ALA ALA A . n 
C 3 507 ALA 507 513 513 ALA ALA A . n 
C 3 508 GLU 508 514 514 GLU GLU A . n 
C 3 509 LEU 509 515 515 LEU LEU A . n 
C 3 510 PRO 510 516 516 PRO PRO A . n 
C 3 511 THR 511 517 517 THR THR A . n 
C 3 512 ARG 512 518 518 ARG ARG A . n 
C 3 513 ASP 513 519 519 ASP ASP A . n 
C 3 514 ASN 514 520 520 ASN ASN A . n 
C 3 515 ALA 515 521 521 ALA ALA A . n 
C 3 516 LYS 516 522 522 LYS LYS A . n 
C 3 517 THR 517 523 523 THR THR A . n 
C 3 518 PHE 518 524 524 PHE PHE A . n 
C 3 519 ILE 519 525 525 ILE ILE A . n 
C 3 520 TYR 520 526 526 TYR TYR A . n 
C 3 521 GLY 521 527 527 GLY GLY A . n 
C 3 522 PHE 522 528 528 PHE PHE A . n 
C 3 523 LEU 523 529 529 LEU LEU A . n 
C 3 524 TYR 524 530 530 TYR TYR A . n 
C 3 525 GLY 525 531 531 GLY GLY A . n 
C 3 526 ALA 526 532 532 ALA ALA A . n 
C 3 527 GLY 527 533 533 GLY GLY A . n 
C 3 528 ASP 528 534 534 ASP ASP A . n 
C 3 529 GLU 529 535 535 GLU GLU A . n 
C 3 530 LYS 530 536 536 LYS LYS A . n 
C 3 531 ILE 531 537 537 ILE ILE A . n 
C 3 532 GLY 532 538 538 GLY GLY A . n 
C 3 533 GLN 533 539 539 GLN GLN A . n 
C 3 534 ILE 534 540 540 ILE ILE A . n 
C 3 535 VAL 535 541 541 VAL VAL A . n 
C 3 536 GLY 536 542 542 GLY GLY A . n 
C 3 537 ALA 537 543 543 ALA ALA A . n 
C 3 538 GLY 538 544 544 GLY GLY A . n 
C 3 539 LYS 539 545 545 LYS LYS A . n 
C 3 540 GLU 540 546 546 GLU GLU A . n 
C 3 541 ARG 541 547 547 ARG ARG A . n 
C 3 542 GLY 542 548 548 GLY GLY A . n 
C 3 543 LYS 543 549 549 LYS LYS A . n 
C 3 544 GLU 544 550 550 GLU GLU A . n 
C 3 545 LEU 545 551 551 LEU LEU A . n 
C 3 546 LYS 546 552 552 LYS LYS A . n 
C 3 547 LYS 547 553 553 LYS LYS A . n 
C 3 548 LYS 548 554 554 LYS LYS A . n 
C 3 549 PHE 549 555 555 PHE PHE A . n 
C 3 550 LEU 550 556 556 LEU LEU A . n 
C 3 551 GLU 551 557 557 GLU GLU A . n 
C 3 552 ASN 552 558 558 ASN ASN A . n 
C 3 553 THR 553 559 559 THR THR A . n 
C 3 554 PRO 554 560 560 PRO PRO A . n 
C 3 555 ALA 555 561 561 ALA ALA A . n 
C 3 556 ILE 556 562 562 ILE ILE A . n 
C 3 557 ALA 557 563 563 ALA ALA A . n 
C 3 558 ALA 558 564 564 ALA ALA A . n 
C 3 559 LEU 559 565 565 LEU LEU A . n 
C 3 560 ARG 560 566 566 ARG ARG A . n 
C 3 561 GLU 561 567 567 GLU GLU A . n 
C 3 562 SER 562 568 568 SER SER A . n 
C 3 563 ILE 563 569 569 ILE ILE A . n 
C 3 564 GLN 564 570 570 GLN GLN A . n 
C 3 565 GLN 565 571 571 GLN GLN A . n 
C 3 566 THR 566 572 572 THR THR A . n 
C 3 567 LEU 567 573 573 LEU LEU A . n 
C 3 568 VAL 568 574 574 VAL VAL A . n 
C 3 569 GLU 569 575 575 GLU GLU A . n 
C 3 570 SER 570 576 ?   ?   ?   A . n 
C 3 571 SER 571 577 ?   ?   ?   A . n 
C 3 572 GLN 572 578 ?   ?   ?   A . n 
C 3 573 TRP 573 579 ?   ?   ?   A . n 
C 3 574 VAL 574 580 ?   ?   ?   A . n 
C 3 575 ALA 575 581 ?   ?   ?   A . n 
C 3 576 GLY 576 582 ?   ?   ?   A . n 
C 3 577 GLU 577 583 ?   ?   ?   A . n 
C 3 578 GLN 578 584 ?   ?   ?   A . n 
C 3 579 GLN 579 585 ?   ?   ?   A . n 
C 3 580 VAL 580 586 ?   ?   ?   A . n 
C 3 581 LYS 581 587 587 LYS LYS A . n 
C 3 582 TRP 582 588 588 TRP TRP A . n 
C 3 583 LYS 583 589 589 LYS LYS A . n 
C 3 584 ARG 584 590 590 ARG ARG A . n 
C 3 585 ARG 585 591 591 ARG ARG A . n 
C 3 586 TRP 586 592 592 TRP TRP A . n 
C 3 587 ILE 587 593 593 ILE ILE A . n 
C 3 588 LYS 588 594 594 LYS LYS A . n 
C 3 589 GLY 589 595 595 GLY GLY A . n 
C 3 590 LEU 590 596 596 LEU LEU A . n 
C 3 591 ASP 591 597 597 ASP ASP A . n 
C 3 592 GLY 592 598 598 GLY GLY A . n 
C 3 593 ARG 593 599 599 ARG ARG A . n 
C 3 594 LYS 594 600 600 LYS LYS A . n 
C 3 595 VAL 595 601 601 VAL VAL A . n 
C 3 596 HIS 596 602 602 HIS HIS A . n 
C 3 597 VAL 597 603 603 VAL VAL A . n 
C 3 598 ARG 598 604 604 ARG ARG A . n 
C 3 599 SER 599 605 605 SER SER A . n 
C 3 600 PRO 600 606 606 PRO PRO A . n 
C 3 601 HIS 601 607 607 HIS HIS A . n 
C 3 602 ALA 602 608 608 ALA ALA A . n 
C 3 603 ALA 603 609 609 ALA ALA A . n 
C 3 604 LEU 604 610 610 LEU LEU A . n 
C 3 605 ASN 605 611 611 ASN ASN A . n 
C 3 606 THR 606 612 612 THR THR A . n 
C 3 607 LEU 607 613 613 LEU LEU A . n 
C 3 608 LEU 608 614 614 LEU LEU A . n 
C 3 609 GLN 609 615 615 GLN GLN A . n 
C 3 610 SER 610 616 616 SER SER A . n 
C 3 611 ALA 611 617 617 ALA ALA A . n 
C 3 612 GLY 612 618 618 GLY GLY A . n 
C 3 613 ALA 613 619 619 ALA ALA A . n 
C 3 614 LEU 614 620 620 LEU LEU A . n 
C 3 615 ILE 615 621 621 ILE ILE A . n 
C 3 616 CYS 616 622 622 CYS CYS A . n 
C 3 617 LYS 617 623 623 LYS LYS A . n 
C 3 618 LEU 618 624 624 LEU LEU A . n 
C 3 619 TRP 619 625 625 TRP TRP A . n 
C 3 620 ILE 620 626 626 ILE ILE A . n 
C 3 621 ILE 621 627 627 ILE ILE A . n 
C 3 622 LYS 622 628 628 LYS LYS A . n 
C 3 623 THR 623 629 629 THR THR A . n 
C 3 624 GLU 624 630 630 GLU GLU A . n 
C 3 625 GLU 625 631 631 GLU GLU A . n 
C 3 626 MET 626 632 632 MET MET A . n 
C 3 627 LEU 627 633 633 LEU LEU A . n 
C 3 628 VAL 628 634 634 VAL VAL A . n 
C 3 629 GLU 629 635 635 GLU GLU A . n 
C 3 630 LYS 630 636 636 LYS LYS A . n 
C 3 631 GLY 631 637 637 GLY GLY A . n 
C 3 632 LEU 632 638 638 LEU LEU A . n 
C 3 633 LYS 633 639 639 LYS LYS A . n 
C 3 634 HIS 634 640 640 HIS HIS A . n 
C 3 635 GLY 635 641 641 GLY GLY A . n 
C 3 636 TRP 636 642 642 TRP TRP A . n 
C 3 637 ASP 637 643 643 ASP ASP A . n 
C 3 638 GLY 638 644 644 GLY GLY A . n 
C 3 639 ASP 639 645 645 ASP ASP A . n 
C 3 640 PHE 640 646 646 PHE PHE A . n 
C 3 641 ALA 641 647 647 ALA ALA A . n 
C 3 642 TYR 642 648 648 TYR TYR A . n 
C 3 643 MET 643 649 649 MET MET A . n 
C 3 644 ALA 644 650 650 ALA ALA A . n 
C 3 645 TRP 645 651 651 TRP TRP A . n 
C 3 646 VAL 646 652 652 VAL VAL A . n 
C 3 647 HIS 647 653 653 HIS HIS A . n 
C 3 648 ASP 648 654 654 ASP ASP A . n 
C 3 649 GLU 649 655 655 GLU GLU A . n 
C 3 650 ILE 650 656 656 ILE ILE A . n 
C 3 651 GLN 651 657 657 GLN GLN A . n 
C 3 652 VAL 652 658 658 VAL VAL A . n 
C 3 653 GLY 653 659 659 GLY GLY A . n 
C 3 654 CYS 654 660 660 CYS CYS A . n 
C 3 655 ARG 655 661 661 ARG ARG A . n 
C 3 656 THR 656 662 662 THR THR A . n 
C 3 657 GLU 657 663 663 GLU GLU A . n 
C 3 658 GLU 658 664 664 GLU GLU A . n 
C 3 659 ILE 659 665 665 ILE ILE A . n 
C 3 660 ALA 660 666 666 ALA ALA A . n 
C 3 661 GLN 661 667 667 GLN GLN A . n 
C 3 662 VAL 662 668 668 VAL VAL A . n 
C 3 663 VAL 663 669 669 VAL VAL A . n 
C 3 664 ILE 664 670 670 ILE ILE A . n 
C 3 665 GLU 665 671 671 GLU GLU A . n 
C 3 666 THR 666 672 672 THR THR A . n 
C 3 667 ALA 667 673 673 ALA ALA A . n 
C 3 668 GLN 668 674 674 GLN GLN A . n 
C 3 669 GLU 669 675 675 GLU GLU A . n 
C 3 670 ALA 670 676 676 ALA ALA A . n 
C 3 671 MET 671 677 677 MET MET A . n 
C 3 672 ARG 672 678 678 ARG ARG A . n 
C 3 673 TRP 673 679 679 TRP TRP A . n 
C 3 674 VAL 674 680 680 VAL VAL A . n 
C 3 675 GLY 675 681 681 GLY GLY A . n 
C 3 676 ASP 676 682 682 ASP ASP A . n 
C 3 677 HIS 677 683 683 HIS HIS A . n 
C 3 678 TRP 678 684 684 TRP TRP A . n 
C 3 679 ASN 679 685 685 ASN ASN A . n 
C 3 680 PHE 680 686 686 PHE PHE A . n 
C 3 681 ARG 681 687 687 ARG ARG A . n 
C 3 682 CYS 682 688 688 CYS CYS A . n 
C 3 683 LEU 683 689 689 LEU LEU A . n 
C 3 684 LEU 684 690 690 LEU LEU A . n 
C 3 685 ASP 685 691 691 ASP ASP A . n 
C 3 686 THR 686 692 692 THR THR A . n 
C 3 687 GLU 687 693 693 GLU GLU A . n 
C 3 688 GLY 688 694 694 GLY GLY A . n 
C 3 689 LYS 689 695 695 LYS LYS A . n 
C 3 690 MET 690 696 696 MET MET A . n 
C 3 691 GLY 691 697 697 GLY GLY A . n 
C 3 692 PRO 692 698 698 PRO PRO A . n 
C 3 693 ASN 693 699 699 ASN ASN A . n 
C 3 694 TRP 694 700 700 TRP TRP A . n 
C 3 695 ALA 695 701 701 ALA ALA A . n 
C 3 696 ILE 696 702 702 ILE ILE A . n 
C 3 697 CYS 697 703 703 CYS CYS A . n 
C 3 698 HIS 698 704 704 HIS HIS A . n 
D 4 1   SER 1   1   ?   ?   ?   B . n 
D 4 2   ASP 2   2   ?   ?   ?   B . n 
D 4 3   LYS 3   3   3   LYS LYS B . n 
D 4 4   ILE 4   4   4   ILE ILE B . n 
D 4 5   ILE 5   5   5   ILE ILE B . n 
D 4 6   HIS 6   6   6   HIS HIS B . n 
D 4 7   LEU 7   7   7   LEU LEU B . n 
D 4 8   THR 8   8   8   THR THR B . n 
D 4 9   ASP 9   9   9   ASP ASP B . n 
D 4 10  ASP 10  10  10  ASP ASP B . n 
D 4 11  SER 11  11  11  SER SER B . n 
D 4 12  PHE 12  12  12  PHE PHE B . n 
D 4 13  ASP 13  13  13  ASP ASP B . n 
D 4 14  THR 14  14  14  THR THR B . n 
D 4 15  ASP 15  15  15  ASP ASP B . n 
D 4 16  VAL 16  16  16  VAL VAL B . n 
D 4 17  LEU 17  17  17  LEU LEU B . n 
D 4 18  LYS 18  18  18  LYS LYS B . n 
D 4 19  ALA 19  19  19  ALA ALA B . n 
D 4 20  ASP 20  20  20  ASP ASP B . n 
D 4 21  GLY 21  21  21  GLY GLY B . n 
D 4 22  ALA 22  22  22  ALA ALA B . n 
D 4 23  ILE 23  23  23  ILE ILE B . n 
D 4 24  LEU 24  24  24  LEU LEU B . n 
D 4 25  VAL 25  25  25  VAL VAL B . n 
D 4 26  ASP 26  26  26  ASP ASP B . n 
D 4 27  PHE 27  27  27  PHE PHE B . n 
D 4 28  TRP 28  28  28  TRP TRP B . n 
D 4 29  ALA 29  29  29  ALA ALA B . n 
D 4 30  GLU 30  30  30  GLU GLU B . n 
D 4 31  TRP 31  31  31  TRP TRP B . n 
D 4 32  CYS 32  32  32  CYS CYS B . n 
D 4 33  GLY 33  33  33  GLY GLY B . n 
D 4 34  PRO 34  34  34  PRO PRO B . n 
D 4 35  CYS 35  35  35  CYS CYS B . n 
D 4 36  LYS 36  36  36  LYS LYS B . n 
D 4 37  MET 37  37  37  MET MET B . n 
D 4 38  ILE 38  38  38  ILE ILE B . n 
D 4 39  ALA 39  39  39  ALA ALA B . n 
D 4 40  PRO 40  40  40  PRO PRO B . n 
D 4 41  ILE 41  41  41  ILE ILE B . n 
D 4 42  LEU 42  42  42  LEU LEU B . n 
D 4 43  ASP 43  43  43  ASP ASP B . n 
D 4 44  GLU 44  44  44  GLU GLU B . n 
D 4 45  ILE 45  45  45  ILE ILE B . n 
D 4 46  ALA 46  46  46  ALA ALA B . n 
D 4 47  ASP 47  47  47  ASP ASP B . n 
D 4 48  GLU 48  48  48  GLU GLU B . n 
D 4 49  TYR 49  49  49  TYR TYR B . n 
D 4 50  GLN 50  50  50  GLN GLN B . n 
D 4 51  GLY 51  51  51  GLY GLY B . n 
D 4 52  LYS 52  52  52  LYS LYS B . n 
D 4 53  LEU 53  53  53  LEU LEU B . n 
D 4 54  THR 54  54  54  THR THR B . n 
D 4 55  VAL 55  55  55  VAL VAL B . n 
D 4 56  ALA 56  56  56  ALA ALA B . n 
D 4 57  LYS 57  57  57  LYS LYS B . n 
D 4 58  LEU 58  58  58  LEU LEU B . n 
D 4 59  ASN 59  59  59  ASN ASN B . n 
D 4 60  ILE 60  60  60  ILE ILE B . n 
D 4 61  ASP 61  61  61  ASP ASP B . n 
D 4 62  GLN 62  62  62  GLN GLN B . n 
D 4 63  ASN 63  63  63  ASN ASN B . n 
D 4 64  PRO 64  64  64  PRO PRO B . n 
D 4 65  GLY 65  65  65  GLY GLY B . n 
D 4 66  THR 66  66  66  THR THR B . n 
D 4 67  ALA 67  67  67  ALA ALA B . n 
D 4 68  PRO 68  68  68  PRO PRO B . n 
D 4 69  LYS 69  69  69  LYS LYS B . n 
D 4 70  TYR 70  70  70  TYR TYR B . n 
D 4 71  GLY 71  71  71  GLY GLY B . n 
D 4 72  ILE 72  72  72  ILE ILE B . n 
D 4 73  ARG 73  73  73  ARG ARG B . n 
D 4 74  GLY 74  74  74  GLY GLY B . n 
D 4 75  ILE 75  75  75  ILE ILE B . n 
D 4 76  PRO 76  76  76  PRO PRO B . n 
D 4 77  THR 77  77  77  THR THR B . n 
D 4 78  LEU 78  78  78  LEU LEU B . n 
D 4 79  LEU 79  79  79  LEU LEU B . n 
D 4 80  LEU 80  80  80  LEU LEU B . n 
D 4 81  PHE 81  81  81  PHE PHE B . n 
D 4 82  LYS 82  82  82  LYS LYS B . n 
D 4 83  ASN 83  83  83  ASN ASN B . n 
D 4 84  GLY 84  84  84  GLY GLY B . n 
D 4 85  GLU 85  85  85  GLU GLU B . n 
D 4 86  VAL 86  86  86  VAL VAL B . n 
D 4 87  ALA 87  87  87  ALA ALA B . n 
D 4 88  ALA 88  88  88  ALA ALA B . n 
D 4 89  THR 89  89  89  THR THR B . n 
D 4 90  LYS 90  90  90  LYS LYS B . n 
D 4 91  VAL 91  91  91  VAL VAL B . n 
D 4 92  GLY 92  92  92  GLY GLY B . n 
D 4 93  ALA 93  93  93  ALA ALA B . n 
D 4 94  LEU 94  94  94  LEU LEU B . n 
D 4 95  SER 95  95  95  SER SER B . n 
D 4 96  LYS 96  96  96  LYS LYS B . n 
D 4 97  GLY 97  97  97  GLY GLY B . n 
D 4 98  GLN 98  98  98  GLN GLN B . n 
D 4 99  LEU 99  99  99  LEU LEU B . n 
D 4 100 LYS 100 100 100 LYS LYS B . n 
D 4 101 GLU 101 101 101 GLU GLU B . n 
D 4 102 PHE 102 102 102 PHE PHE B . n 
D 4 103 LEU 103 103 103 LEU LEU B . n 
D 4 104 ASP 104 104 104 ASP ASP B . n 
D 4 105 ALA 105 105 105 ALA ALA B . n 
D 4 106 ASN 106 106 106 ASN ASN B . n 
D 4 107 LEU 107 107 107 LEU LEU B . n 
D 4 108 ALA 108 108 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 MG  1   4001 4001 MG  MG  A . 
F 5 MG  1   4002 4002 MG  MG  A . 
G 5 MG  1   4003 4003 MG  MG  A . 
H 6 DAD 1   4004 23   DAD DA3 A . 
I 7 HOH 1   5117 5117 HOH HOH P . 
I 7 HOH 2   5149 5149 HOH HOH P . 
I 7 HOH 3   5188 5188 HOH HOH P . 
I 7 HOH 4   5197 5197 HOH HOH P . 
I 7 HOH 5   5242 5242 HOH HOH P . 
I 7 HOH 6   5262 5262 HOH HOH P . 
I 7 HOH 7   5329 5329 HOH HOH P . 
I 7 HOH 8   5357 5357 HOH HOH P . 
I 7 HOH 9   5406 5406 HOH HOH P . 
J 7 HOH 1   5005 5005 HOH HOH T . 
J 7 HOH 2   5039 5039 HOH HOH T . 
J 7 HOH 3   5049 5049 HOH HOH T . 
J 7 HOH 4   5086 5086 HOH HOH T . 
J 7 HOH 5   5094 5094 HOH HOH T . 
J 7 HOH 6   5096 5096 HOH HOH T . 
J 7 HOH 7   5098 5098 HOH HOH T . 
J 7 HOH 8   5099 5099 HOH HOH T . 
J 7 HOH 9   5100 5100 HOH HOH T . 
J 7 HOH 10  5131 5131 HOH HOH T . 
J 7 HOH 11  5159 5159 HOH HOH T . 
J 7 HOH 12  5161 5161 HOH HOH T . 
J 7 HOH 13  5178 5178 HOH HOH T . 
J 7 HOH 14  5198 5198 HOH HOH T . 
J 7 HOH 15  5201 5201 HOH HOH T . 
J 7 HOH 16  5233 5233 HOH HOH T . 
J 7 HOH 17  5266 5266 HOH HOH T . 
J 7 HOH 18  5275 5275 HOH HOH T . 
J 7 HOH 19  5282 5282 HOH HOH T . 
J 7 HOH 20  5283 5283 HOH HOH T . 
J 7 HOH 21  5290 5290 HOH HOH T . 
J 7 HOH 22  5301 5301 HOH HOH T . 
J 7 HOH 23  5315 5315 HOH HOH T . 
J 7 HOH 24  5362 5362 HOH HOH T . 
K 7 HOH 1   5001 5001 HOH HOH A . 
K 7 HOH 2   5002 5002 HOH HOH A . 
K 7 HOH 3   5003 5003 HOH HOH A . 
K 7 HOH 4   5004 5004 HOH HOH A . 
K 7 HOH 5   5006 5006 HOH HOH A . 
K 7 HOH 6   5007 5007 HOH HOH A . 
K 7 HOH 7   5008 5008 HOH HOH A . 
K 7 HOH 8   5009 5009 HOH HOH A . 
K 7 HOH 9   5010 5010 HOH HOH A . 
K 7 HOH 10  5011 5011 HOH HOH A . 
K 7 HOH 11  5012 5012 HOH HOH A . 
K 7 HOH 12  5013 5013 HOH HOH A . 
K 7 HOH 13  5014 5014 HOH HOH A . 
K 7 HOH 14  5015 5015 HOH HOH A . 
K 7 HOH 15  5016 5016 HOH HOH A . 
K 7 HOH 16  5017 5017 HOH HOH A . 
K 7 HOH 17  5018 5018 HOH HOH A . 
K 7 HOH 18  5020 5020 HOH HOH A . 
K 7 HOH 19  5021 5021 HOH HOH A . 
K 7 HOH 20  5022 5022 HOH HOH A . 
K 7 HOH 21  5023 5023 HOH HOH A . 
K 7 HOH 22  5024 5024 HOH HOH A . 
K 7 HOH 23  5025 5025 HOH HOH A . 
K 7 HOH 24  5026 5026 HOH HOH A . 
K 7 HOH 25  5027 5027 HOH HOH A . 
K 7 HOH 26  5028 5028 HOH HOH A . 
K 7 HOH 27  5029 5029 HOH HOH A . 
K 7 HOH 28  5030 5030 HOH HOH A . 
K 7 HOH 29  5031 5031 HOH HOH A . 
K 7 HOH 30  5032 5032 HOH HOH A . 
K 7 HOH 31  5033 5033 HOH HOH A . 
K 7 HOH 32  5034 5034 HOH HOH A . 
K 7 HOH 33  5035 5035 HOH HOH A . 
K 7 HOH 34  5036 5036 HOH HOH A . 
K 7 HOH 35  5037 5037 HOH HOH A . 
K 7 HOH 36  5041 5041 HOH HOH A . 
K 7 HOH 37  5042 5042 HOH HOH A . 
K 7 HOH 38  5043 5043 HOH HOH A . 
K 7 HOH 39  5044 5044 HOH HOH A . 
K 7 HOH 40  5045 5045 HOH HOH A . 
K 7 HOH 41  5046 5046 HOH HOH A . 
K 7 HOH 42  5047 5047 HOH HOH A . 
K 7 HOH 43  5048 5048 HOH HOH A . 
K 7 HOH 44  5050 5050 HOH HOH A . 
K 7 HOH 45  5051 5051 HOH HOH A . 
K 7 HOH 46  5052 5052 HOH HOH A . 
K 7 HOH 47  5053 5053 HOH HOH A . 
K 7 HOH 48  5054 5054 HOH HOH A . 
K 7 HOH 49  5055 5055 HOH HOH A . 
K 7 HOH 50  5056 5056 HOH HOH A . 
K 7 HOH 51  5057 5057 HOH HOH A . 
K 7 HOH 52  5058 5058 HOH HOH A . 
K 7 HOH 53  5059 5059 HOH HOH A . 
K 7 HOH 54  5060 5060 HOH HOH A . 
K 7 HOH 55  5061 5061 HOH HOH A . 
K 7 HOH 56  5062 5062 HOH HOH A . 
K 7 HOH 57  5063 5063 HOH HOH A . 
K 7 HOH 58  5064 5064 HOH HOH A . 
K 7 HOH 59  5065 5065 HOH HOH A . 
K 7 HOH 60  5066 5066 HOH HOH A . 
K 7 HOH 61  5067 5067 HOH HOH A . 
K 7 HOH 62  5068 5068 HOH HOH A . 
K 7 HOH 63  5069 5069 HOH HOH A . 
K 7 HOH 64  5070 5070 HOH HOH A . 
K 7 HOH 65  5071 5071 HOH HOH A . 
K 7 HOH 66  5072 5072 HOH HOH A . 
K 7 HOH 67  5073 5073 HOH HOH A . 
K 7 HOH 68  5074 5074 HOH HOH A . 
K 7 HOH 69  5075 5075 HOH HOH A . 
K 7 HOH 70  5076 5076 HOH HOH A . 
K 7 HOH 71  5077 5077 HOH HOH A . 
K 7 HOH 72  5078 5078 HOH HOH A . 
K 7 HOH 73  5079 5079 HOH HOH A . 
K 7 HOH 74  5080 5080 HOH HOH A . 
K 7 HOH 75  5081 5081 HOH HOH A . 
K 7 HOH 76  5082 5082 HOH HOH A . 
K 7 HOH 77  5083 5083 HOH HOH A . 
K 7 HOH 78  5084 5084 HOH HOH A . 
K 7 HOH 79  5085 5085 HOH HOH A . 
K 7 HOH 80  5087 5087 HOH HOH A . 
K 7 HOH 81  5088 5088 HOH HOH A . 
K 7 HOH 82  5089 5089 HOH HOH A . 
K 7 HOH 83  5090 5090 HOH HOH A . 
K 7 HOH 84  5091 5091 HOH HOH A . 
K 7 HOH 85  5092 5092 HOH HOH A . 
K 7 HOH 86  5093 5093 HOH HOH A . 
K 7 HOH 87  5095 5095 HOH HOH A . 
K 7 HOH 88  5097 5097 HOH HOH A . 
K 7 HOH 89  5101 5101 HOH HOH A . 
K 7 HOH 90  5102 5102 HOH HOH A . 
K 7 HOH 91  5103 5103 HOH HOH A . 
K 7 HOH 92  5104 5104 HOH HOH A . 
K 7 HOH 93  5105 5105 HOH HOH A . 
K 7 HOH 94  5106 5106 HOH HOH A . 
K 7 HOH 95  5107 5107 HOH HOH A . 
K 7 HOH 96  5108 5108 HOH HOH A . 
K 7 HOH 97  5109 5109 HOH HOH A . 
K 7 HOH 98  5110 5110 HOH HOH A . 
K 7 HOH 99  5111 5111 HOH HOH A . 
K 7 HOH 100 5112 5112 HOH HOH A . 
K 7 HOH 101 5113 5113 HOH HOH A . 
K 7 HOH 102 5115 5115 HOH HOH A . 
K 7 HOH 103 5116 5116 HOH HOH A . 
K 7 HOH 104 5118 5118 HOH HOH A . 
K 7 HOH 105 5119 5119 HOH HOH A . 
K 7 HOH 106 5120 5120 HOH HOH A . 
K 7 HOH 107 5121 5121 HOH HOH A . 
K 7 HOH 108 5123 5123 HOH HOH A . 
K 7 HOH 109 5124 5124 HOH HOH A . 
K 7 HOH 110 5125 5125 HOH HOH A . 
K 7 HOH 111 5126 5126 HOH HOH A . 
K 7 HOH 112 5127 5127 HOH HOH A . 
K 7 HOH 113 5129 5129 HOH HOH A . 
K 7 HOH 114 5130 5130 HOH HOH A . 
K 7 HOH 115 5132 5132 HOH HOH A . 
K 7 HOH 116 5133 5133 HOH HOH A . 
K 7 HOH 117 5134 5134 HOH HOH A . 
K 7 HOH 118 5135 5135 HOH HOH A . 
K 7 HOH 119 5136 5136 HOH HOH A . 
K 7 HOH 120 5137 5137 HOH HOH A . 
K 7 HOH 121 5138 5138 HOH HOH A . 
K 7 HOH 122 5139 5139 HOH HOH A . 
K 7 HOH 123 5140 5140 HOH HOH A . 
K 7 HOH 124 5141 5141 HOH HOH A . 
K 7 HOH 125 5142 5142 HOH HOH A . 
K 7 HOH 126 5143 5143 HOH HOH A . 
K 7 HOH 127 5144 5144 HOH HOH A . 
K 7 HOH 128 5145 5145 HOH HOH A . 
K 7 HOH 129 5146 5146 HOH HOH A . 
K 7 HOH 130 5147 5147 HOH HOH A . 
K 7 HOH 131 5148 5148 HOH HOH A . 
K 7 HOH 132 5150 5150 HOH HOH A . 
K 7 HOH 133 5151 5151 HOH HOH A . 
K 7 HOH 134 5152 5152 HOH HOH A . 
K 7 HOH 135 5153 5153 HOH HOH A . 
K 7 HOH 136 5154 5154 HOH HOH A . 
K 7 HOH 137 5155 5155 HOH HOH A . 
K 7 HOH 138 5156 5156 HOH HOH A . 
K 7 HOH 139 5157 5157 HOH HOH A . 
K 7 HOH 140 5160 5160 HOH HOH A . 
K 7 HOH 141 5162 5162 HOH HOH A . 
K 7 HOH 142 5163 5163 HOH HOH A . 
K 7 HOH 143 5164 5164 HOH HOH A . 
K 7 HOH 144 5165 5165 HOH HOH A . 
K 7 HOH 145 5166 5166 HOH HOH A . 
K 7 HOH 146 5167 5167 HOH HOH A . 
K 7 HOH 147 5168 5168 HOH HOH A . 
K 7 HOH 148 5169 5169 HOH HOH A . 
K 7 HOH 149 5170 5170 HOH HOH A . 
K 7 HOH 150 5171 5171 HOH HOH A . 
K 7 HOH 151 5172 5172 HOH HOH A . 
K 7 HOH 152 5173 5173 HOH HOH A . 
K 7 HOH 153 5174 5174 HOH HOH A . 
K 7 HOH 154 5175 5175 HOH HOH A . 
K 7 HOH 155 5176 5176 HOH HOH A . 
K 7 HOH 156 5177 5177 HOH HOH A . 
K 7 HOH 157 5179 5179 HOH HOH A . 
K 7 HOH 158 5180 5180 HOH HOH A . 
K 7 HOH 159 5182 5182 HOH HOH A . 
K 7 HOH 160 5183 5183 HOH HOH A . 
K 7 HOH 161 5185 5185 HOH HOH A . 
K 7 HOH 162 5186 5186 HOH HOH A . 
K 7 HOH 163 5187 5187 HOH HOH A . 
K 7 HOH 164 5189 5189 HOH HOH A . 
K 7 HOH 165 5192 5192 HOH HOH A . 
K 7 HOH 166 5193 5193 HOH HOH A . 
K 7 HOH 167 5194 5194 HOH HOH A . 
K 7 HOH 168 5196 5196 HOH HOH A . 
K 7 HOH 169 5199 5199 HOH HOH A . 
K 7 HOH 170 5202 5202 HOH HOH A . 
K 7 HOH 171 5203 5203 HOH HOH A . 
K 7 HOH 172 5204 5204 HOH HOH A . 
K 7 HOH 173 5205 5205 HOH HOH A . 
K 7 HOH 174 5206 5206 HOH HOH A . 
K 7 HOH 175 5207 5207 HOH HOH A . 
K 7 HOH 176 5208 5208 HOH HOH A . 
K 7 HOH 177 5209 5209 HOH HOH A . 
K 7 HOH 178 5210 5210 HOH HOH A . 
K 7 HOH 179 5211 5211 HOH HOH A . 
K 7 HOH 180 5212 5212 HOH HOH A . 
K 7 HOH 181 5213 5213 HOH HOH A . 
K 7 HOH 182 5215 5215 HOH HOH A . 
K 7 HOH 183 5216 5216 HOH HOH A . 
K 7 HOH 184 5217 5217 HOH HOH A . 
K 7 HOH 185 5218 5218 HOH HOH A . 
K 7 HOH 186 5219 5219 HOH HOH A . 
K 7 HOH 187 5220 5220 HOH HOH A . 
K 7 HOH 188 5221 5221 HOH HOH A . 
K 7 HOH 189 5224 5224 HOH HOH A . 
K 7 HOH 190 5225 5225 HOH HOH A . 
K 7 HOH 191 5226 5226 HOH HOH A . 
K 7 HOH 192 5227 5227 HOH HOH A . 
K 7 HOH 193 5228 5228 HOH HOH A . 
K 7 HOH 194 5229 5229 HOH HOH A . 
K 7 HOH 195 5230 5230 HOH HOH A . 
K 7 HOH 196 5232 5232 HOH HOH A . 
K 7 HOH 197 5234 5234 HOH HOH A . 
K 7 HOH 198 5235 5235 HOH HOH A . 
K 7 HOH 199 5236 5236 HOH HOH A . 
K 7 HOH 200 5237 5237 HOH HOH A . 
K 7 HOH 201 5238 5238 HOH HOH A . 
K 7 HOH 202 5240 5240 HOH HOH A . 
K 7 HOH 203 5241 5241 HOH HOH A . 
K 7 HOH 204 5243 5243 HOH HOH A . 
K 7 HOH 205 5244 5244 HOH HOH A . 
K 7 HOH 206 5245 5245 HOH HOH A . 
K 7 HOH 207 5246 5246 HOH HOH A . 
K 7 HOH 208 5248 5248 HOH HOH A . 
K 7 HOH 209 5249 5249 HOH HOH A . 
K 7 HOH 210 5250 5250 HOH HOH A . 
K 7 HOH 211 5251 5251 HOH HOH A . 
K 7 HOH 212 5253 5253 HOH HOH A . 
K 7 HOH 213 5254 5254 HOH HOH A . 
K 7 HOH 214 5255 5255 HOH HOH A . 
K 7 HOH 215 5256 5256 HOH HOH A . 
K 7 HOH 216 5259 5259 HOH HOH A . 
K 7 HOH 217 5260 5260 HOH HOH A . 
K 7 HOH 218 5261 5261 HOH HOH A . 
K 7 HOH 219 5263 5263 HOH HOH A . 
K 7 HOH 220 5264 5264 HOH HOH A . 
K 7 HOH 221 5265 5265 HOH HOH A . 
K 7 HOH 222 5268 5268 HOH HOH A . 
K 7 HOH 223 5270 5270 HOH HOH A . 
K 7 HOH 224 5271 5271 HOH HOH A . 
K 7 HOH 225 5272 5272 HOH HOH A . 
K 7 HOH 226 5274 5274 HOH HOH A . 
K 7 HOH 227 5277 5277 HOH HOH A . 
K 7 HOH 228 5278 5278 HOH HOH A . 
K 7 HOH 229 5279 5279 HOH HOH A . 
K 7 HOH 230 5280 5280 HOH HOH A . 
K 7 HOH 231 5284 5284 HOH HOH A . 
K 7 HOH 232 5285 5285 HOH HOH A . 
K 7 HOH 233 5288 5288 HOH HOH A . 
K 7 HOH 234 5291 5291 HOH HOH A . 
K 7 HOH 235 5292 5292 HOH HOH A . 
K 7 HOH 236 5293 5293 HOH HOH A . 
K 7 HOH 237 5294 5294 HOH HOH A . 
K 7 HOH 238 5295 5295 HOH HOH A . 
K 7 HOH 239 5296 5296 HOH HOH A . 
K 7 HOH 240 5297 5297 HOH HOH A . 
K 7 HOH 241 5300 5300 HOH HOH A . 
K 7 HOH 242 5302 5302 HOH HOH A . 
K 7 HOH 243 5305 5305 HOH HOH A . 
K 7 HOH 244 5306 5306 HOH HOH A . 
K 7 HOH 245 5307 5307 HOH HOH A . 
K 7 HOH 246 5311 5311 HOH HOH A . 
K 7 HOH 247 5316 5316 HOH HOH A . 
K 7 HOH 248 5317 5317 HOH HOH A . 
K 7 HOH 249 5318 5318 HOH HOH A . 
K 7 HOH 250 5319 5319 HOH HOH A . 
K 7 HOH 251 5320 5320 HOH HOH A . 
K 7 HOH 252 5321 5321 HOH HOH A . 
K 7 HOH 253 5322 5322 HOH HOH A . 
K 7 HOH 254 5323 5323 HOH HOH A . 
K 7 HOH 255 5324 5324 HOH HOH A . 
K 7 HOH 256 5325 5325 HOH HOH A . 
K 7 HOH 257 5326 5326 HOH HOH A . 
K 7 HOH 258 5327 5327 HOH HOH A . 
K 7 HOH 259 5328 5328 HOH HOH A . 
K 7 HOH 260 5331 5331 HOH HOH A . 
K 7 HOH 261 5332 5332 HOH HOH A . 
K 7 HOH 262 5333 5333 HOH HOH A . 
K 7 HOH 263 5335 5335 HOH HOH A . 
K 7 HOH 264 5336 5336 HOH HOH A . 
K 7 HOH 265 5337 5337 HOH HOH A . 
K 7 HOH 266 5339 5339 HOH HOH A . 
K 7 HOH 267 5342 5342 HOH HOH A . 
K 7 HOH 268 5343 5343 HOH HOH A . 
K 7 HOH 269 5344 5344 HOH HOH A . 
K 7 HOH 270 5345 5345 HOH HOH A . 
K 7 HOH 271 5346 5346 HOH HOH A . 
K 7 HOH 272 5347 5347 HOH HOH A . 
K 7 HOH 273 5349 5349 HOH HOH A . 
K 7 HOH 274 5351 5351 HOH HOH A . 
K 7 HOH 275 5352 5352 HOH HOH A . 
K 7 HOH 276 5353 5353 HOH HOH A . 
K 7 HOH 277 5354 5354 HOH HOH A . 
K 7 HOH 278 5358 5358 HOH HOH A . 
K 7 HOH 279 5361 5361 HOH HOH A . 
K 7 HOH 280 5365 5365 HOH HOH A . 
K 7 HOH 281 5366 5366 HOH HOH A . 
K 7 HOH 282 5368 5368 HOH HOH A . 
K 7 HOH 283 5369 5369 HOH HOH A . 
K 7 HOH 284 5371 5371 HOH HOH A . 
K 7 HOH 285 5372 5372 HOH HOH A . 
K 7 HOH 286 5374 5374 HOH HOH A . 
K 7 HOH 287 5375 5375 HOH HOH A . 
K 7 HOH 288 5376 5376 HOH HOH A . 
K 7 HOH 289 5377 5377 HOH HOH A . 
K 7 HOH 290 5378 5378 HOH HOH A . 
K 7 HOH 291 5379 5379 HOH HOH A . 
K 7 HOH 292 5380 5380 HOH HOH A . 
K 7 HOH 293 5384 5384 HOH HOH A . 
K 7 HOH 294 5385 5385 HOH HOH A . 
K 7 HOH 295 5387 5387 HOH HOH A . 
K 7 HOH 296 5389 5389 HOH HOH A . 
K 7 HOH 297 5391 5391 HOH HOH A . 
K 7 HOH 298 5393 5393 HOH HOH A . 
K 7 HOH 299 5394 5394 HOH HOH A . 
K 7 HOH 300 5396 5396 HOH HOH A . 
K 7 HOH 301 5397 5397 HOH HOH A . 
K 7 HOH 302 5399 5399 HOH HOH A . 
K 7 HOH 303 5400 5400 HOH HOH A . 
K 7 HOH 304 5401 5401 HOH HOH A . 
K 7 HOH 305 5410 5410 HOH HOH A . 
K 7 HOH 306 5415 5415 HOH HOH A . 
K 7 HOH 307 5416 5416 HOH HOH A . 
K 7 HOH 308 5419 5419 HOH HOH A . 
K 7 HOH 309 5420 5420 HOH HOH A . 
K 7 HOH 310 5427 5427 HOH HOH A . 
K 7 HOH 311 5428 5428 HOH HOH A . 
K 7 HOH 312 5429 5429 HOH HOH A . 
K 7 HOH 313 5431 5431 HOH HOH A . 
K 7 HOH 314 5432 5432 HOH HOH A . 
K 7 HOH 315 5433 5433 HOH HOH A . 
K 7 HOH 316 5434 5434 HOH HOH A . 
K 7 HOH 317 5435 5435 HOH HOH A . 
K 7 HOH 318 5436 5436 HOH HOH A . 
K 7 HOH 319 5438 5438 HOH HOH A . 
K 7 HOH 320 5439 5439 HOH HOH A . 
K 7 HOH 321 5440 5440 HOH HOH A . 
K 7 HOH 322 5441 5441 HOH HOH A . 
K 7 HOH 323 5442 5442 HOH HOH A . 
L 7 HOH 1   5040 5040 HOH HOH B . 
L 7 HOH 2   5114 5114 HOH HOH B . 
L 7 HOH 3   5122 5122 HOH HOH B . 
L 7 HOH 4   5158 5158 HOH HOH B . 
L 7 HOH 5   5181 5181 HOH HOH B . 
L 7 HOH 6   5191 5191 HOH HOH B . 
L 7 HOH 7   5195 5195 HOH HOH B . 
L 7 HOH 8   5200 5200 HOH HOH B . 
L 7 HOH 9   5214 5214 HOH HOH B . 
L 7 HOH 10  5223 5223 HOH HOH B . 
L 7 HOH 11  5231 5231 HOH HOH B . 
L 7 HOH 12  5258 5258 HOH HOH B . 
L 7 HOH 13  5267 5267 HOH HOH B . 
L 7 HOH 14  5273 5273 HOH HOH B . 
L 7 HOH 15  5287 5287 HOH HOH B . 
L 7 HOH 16  5298 5298 HOH HOH B . 
L 7 HOH 17  5309 5309 HOH HOH B . 
L 7 HOH 18  5313 5313 HOH HOH B . 
L 7 HOH 19  5338 5338 HOH HOH B . 
L 7 HOH 20  5395 5395 HOH HOH B . 
L 7 HOH 21  5398 5398 HOH HOH B . 
L 7 HOH 22  5405 5405 HOH HOH B . 
L 7 HOH 23  5417 5417 HOH HOH B . 
L 7 HOH 24  5426 5426 HOH HOH B . 
L 7 HOH 25  5437 5437 HOH HOH B . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    2DA 
_pdbx_struct_mod_residue.label_seq_id     22 
_pdbx_struct_mod_residue.auth_asym_id     P 
_pdbx_struct_mod_residue.auth_comp_id     2DA 
_pdbx_struct_mod_residue.auth_seq_id      22 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   DA 
_pdbx_struct_mod_residue.details          "2',3'-DIDEOXYADENOSINE-5'-MONOPHOSPHATE" 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 90.2  ? 
2  O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 88.4  ? 
3  OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 78.3  ? 
4  O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 O1G ? H DAD .   ? A DAD 4004 ? 1_555 99.9  ? 
5  OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 O1G ? H DAD .   ? A DAD 4004 ? 1_555 109.8 ? 
6  OD2 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 O1G ? H DAD .   ? A DAD 4004 ? 1_555 168.1 ? 
7  O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 O2B ? H DAD .   ? A DAD 4004 ? 1_555 85.9  ? 
8  OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 O2B ? H DAD .   ? A DAD 4004 ? 1_555 163.0 ? 
9  OD2 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 O2B ? H DAD .   ? A DAD 4004 ? 1_555 85.0  ? 
10 O1G ? H DAD .   ? A DAD 4004 ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 O2B ? H DAD .   ? A DAD 4004 ? 1_555 87.2  ? 
11 O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 O1A ? H DAD .   ? A DAD 4004 ? 1_555 160.2 ? 
12 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 O1A ? H DAD .   ? A DAD 4004 ? 1_555 103.6 ? 
13 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 O1A ? H DAD .   ? A DAD 4004 ? 1_555 80.8  ? 
14 O1G ? H DAD .   ? A DAD 4004 ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 O1A ? H DAD .   ? A DAD 4004 ? 1_555 88.7  ? 
15 O2B ? H DAD .   ? A DAD 4004 ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 O1A ? H DAD .   ? A DAD 4004 ? 1_555 76.7  ? 
16 O   ? K HOH .   ? A HOH 5017 ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 126.9 ? 
17 O   ? K HOH .   ? A HOH 5017 ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 115.4 ? 
18 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 44.2  ? 
19 O   ? K HOH .   ? A HOH 5017 ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 92.8  ? 
20 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 66.0  ? 
21 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 108.7 ? 
22 O   ? K HOH .   ? A HOH 5017 ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 O1A ? H DAD .   ? A DAD 4004 ? 1_555 149.4 ? 
23 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 O1A ? H DAD .   ? A DAD 4004 ? 1_555 76.1  ? 
24 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 O1A ? H DAD .   ? A DAD 4004 ? 1_555 95.1  ? 
25 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 O1A ? H DAD .   ? A DAD 4004 ? 1_555 78.1  ? 
26 O   ? K HOH .   ? A HOH 5017 ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 O   ? K HOH .   ? A HOH 5442 ? 1_555 90.0  ? 
27 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 O   ? K HOH .   ? A HOH 5442 ? 1_555 131.4 ? 
28 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 O   ? K HOH .   ? A HOH 5442 ? 1_555 94.7  ? 
29 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 O   ? K HOH .   ? A HOH 5442 ? 1_555 152.3 ? 
30 O1A ? H DAD .   ? A DAD 4004 ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 O   ? K HOH .   ? A HOH 5442 ? 1_555 85.6  ? 
31 O   ? K HOH .   ? A HOH 5031 ? 1_555 MG ? G MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 5433 ? 1_555 79.5  ? 
32 O   ? K HOH .   ? A HOH 5031 ? 1_555 MG ? G MG . ? A MG 4003 ? 1_555 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 70.9  ? 
33 O   ? K HOH .   ? A HOH 5433 ? 1_555 MG ? G MG . ? A MG 4003 ? 1_555 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 77.8  ? 
34 O   ? K HOH .   ? A HOH 5031 ? 1_555 MG ? G MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 5044 ? 1_555 78.4  ? 
35 O   ? K HOH .   ? A HOH 5433 ? 1_555 MG ? G MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 5044 ? 1_555 147.2 ? 
36 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 MG ? G MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 5044 ? 1_555 72.2  ? 
37 O   ? K HOH .   ? A HOH 5031 ? 1_555 MG ? G MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 5432 ? 1_555 152.0 ? 
38 O   ? K HOH .   ? A HOH 5433 ? 1_555 MG ? G MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 5432 ? 1_555 103.5 ? 
39 OD1 ? C ASP 5   ? A ASP 5    ? 1_555 MG ? G MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 5432 ? 1_555 82.4  ? 
40 O   ? K HOH .   ? A HOH 5044 ? 1_555 MG ? G MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 5432 ? 1_555 85.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-07-06 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345    'data collection' . ? 1 
SCALEPACK 'data scaling'    . ? 2 
EPMR      phasing           . ? 3 
CNS       refinement        . ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 64  ? ? -110.71 -73.71  
2  1 HIS A 99  ? ? -103.07 50.87   
3  1 ASP A 156 ? ? 10.45   -95.46  
4  1 LYS A 268 ? ? -160.42 116.79  
5  1 PRO A 284 ? ? -44.43  -17.48  
6  1 ASP A 358 ? ? -77.66  45.38   
7  1 LYS A 359 ? ? -157.59 4.81    
8  1 ALA A 400 ? ? -140.75 -39.36  
9  1 LEU A 479 ? ? -39.12  -70.60  
10 1 ALA A 543 ? ? -147.76 -159.19 
11 1 THR A 559 ? ? -154.59 74.92   
12 1 VAL A 652 ? ? -112.19 76.06   
13 1 HIS A 653 ? ? 66.21   -77.07  
14 1 ASP B 20  ? ? 28.61   88.66   
15 1 GLN B 50  ? ? -55.54  100.68  
16 1 ALA B 88  ? ? -174.35 147.11  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DC P 20 ? ? 0.078 'SIDE CHAIN' 
2 1 DG T 7  ? ? 0.060 'SIDE CHAIN' 
# 
loop_
_pdbx_validate_chiral.id 
_pdbx_validate_chiral.PDB_model_num 
_pdbx_validate_chiral.auth_atom_id 
_pdbx_validate_chiral.label_alt_id 
_pdbx_validate_chiral.auth_asym_id 
_pdbx_validate_chiral.auth_comp_id 
_pdbx_validate_chiral.auth_seq_id 
_pdbx_validate_chiral.PDB_ins_code 
_pdbx_validate_chiral.details 
_pdbx_validate_chiral.omega 
1 1 "C4'" ? A DAD 4004 ? 'WRONG HAND' . 
2 1 "C1'" ? A DAD 4004 ? 'WRONG HAND' . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 166 ? CG  ? C GLU 160 CG  
2  1 Y 1 A GLU 166 ? CD  ? C GLU 160 CD  
3  1 Y 1 A GLU 166 ? OE1 ? C GLU 160 OE1 
4  1 Y 1 A GLU 166 ? OE2 ? C GLU 160 OE2 
5  1 Y 1 A LYS 189 ? CG  ? C LYS 183 CG  
6  1 Y 1 A LYS 189 ? CD  ? C LYS 183 CD  
7  1 Y 1 A LYS 189 ? CE  ? C LYS 183 CE  
8  1 Y 1 A LYS 189 ? NZ  ? C LYS 183 NZ  
9  1 Y 1 A LYS 285 ? CG  ? C LYS 279 CG  
10 1 Y 1 A LYS 285 ? CD  ? C LYS 279 CD  
11 1 Y 1 A LYS 285 ? CE  ? C LYS 279 CE  
12 1 Y 1 A LYS 285 ? NZ  ? C LYS 279 NZ  
13 1 Y 1 A LYS 293 ? CG  ? C LYS 287 CG  
14 1 Y 1 A LYS 293 ? CD  ? C LYS 287 CD  
15 1 Y 1 A LYS 293 ? CE  ? C LYS 287 CE  
16 1 Y 1 A LYS 293 ? NZ  ? C LYS 287 NZ  
17 1 Y 1 A ILE 297 ? CD1 ? C ILE 291 CD1 
18 1 Y 1 A ARG 318 ? CG  ? C ARG 312 CG  
19 1 Y 1 A ARG 318 ? CD  ? C ARG 312 CD  
20 1 Y 1 A ARG 318 ? NE  ? C ARG 312 NE  
21 1 Y 1 A ARG 318 ? CZ  ? C ARG 312 CZ  
22 1 Y 1 A ARG 318 ? NH1 ? C ARG 312 NH1 
23 1 Y 1 A ARG 318 ? NH2 ? C ARG 312 NH2 
24 1 Y 1 A GLN 571 ? CG  ? C GLN 565 CG  
25 1 Y 1 A GLN 571 ? CD  ? C GLN 565 CD  
26 1 Y 1 A GLN 571 ? OE1 ? C GLN 565 OE1 
27 1 Y 1 A GLN 571 ? NE2 ? C GLN 565 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 P DC  1   ? A DC  1   
2  1 Y 1 P DG  2   ? A DG  2   
3  1 Y 1 P DA  3   ? A DA  3   
4  1 Y 1 P DA  4   ? A DA  4   
5  1 Y 1 P DA  5   ? A DA  5   
6  1 Y 1 P DA  6   ? A DA  6   
7  1 Y 1 P DC  7   ? A DC  7   
8  1 Y 1 P DG  8   ? A DG  8   
9  1 Y 1 P DA  9   ? A DA  9   
10 1 Y 1 P DC  10  ? A DC  10  
11 1 Y 1 P DG  11  ? A DG  11  
12 1 Y 1 T DC  1   ? B DC  1   
13 1 Y 1 T DC  2   ? B DC  2   
14 1 Y 1 T DC  16  ? B DC  16  
15 1 Y 1 T DG  17  ? B DG  17  
16 1 Y 1 T DT  18  ? B DT  18  
17 1 Y 1 T DC  19  ? B DC  19  
18 1 Y 1 T DG  20  ? B DG  20  
19 1 Y 1 T DT  21  ? B DT  21  
20 1 Y 1 T DT  22  ? B DT  22  
21 1 Y 1 T DT  23  ? B DT  23  
22 1 Y 1 T DT  24  ? B DT  24  
23 1 Y 1 T DC  25  ? B DC  25  
24 1 Y 1 T DG  26  ? B DG  26  
25 1 Y 1 A PHE 298 ? C PHE 292 
26 1 Y 1 A LYS 299 ? C LYS 293 
27 1 Y 1 A LYS 300 ? C LYS 294 
28 1 Y 1 A PRO 301 ? C PRO 295 
29 1 Y 1 A LYS 302 ? C LYS 296 
30 1 Y 1 A ASN 303 ? C ASN 297 
31 1 Y 1 A LYS 304 ? C LYS 298 
32 1 Y 1 A ALA 305 ? C ALA 299 
33 1 Y 1 A GLN 306 ? C GLN 300 
34 1 Y 1 A ARG 307 ? C ARG 301 
35 1 Y 1 A GLU 308 ? C GLU 302 
36 1 Y 1 A GLY 309 ? C GLY 303 
37 1 Y 1 A ARG 310 ? C ARG 304 
38 1 Y 1 A GLU 311 ? C GLU 305 
39 1 Y 1 A PRO 312 ? C PRO 306 
40 1 Y 1 A CYS 313 ? C CYS 307 
41 1 Y 1 A GLU 314 ? C GLU 308 
42 1 Y 1 A LEU 315 ? C LEU 309 
43 1 Y 1 A SER 576 ? C SER 570 
44 1 Y 1 A SER 577 ? C SER 571 
45 1 Y 1 A GLN 578 ? C GLN 572 
46 1 Y 1 A TRP 579 ? C TRP 573 
47 1 Y 1 A VAL 580 ? C VAL 574 
48 1 Y 1 A ALA 581 ? C ALA 575 
49 1 Y 1 A GLY 582 ? C GLY 576 
50 1 Y 1 A GLU 583 ? C GLU 577 
51 1 Y 1 A GLN 584 ? C GLN 578 
52 1 Y 1 A GLN 585 ? C GLN 579 
53 1 Y 1 A VAL 586 ? C VAL 580 
54 1 Y 1 B SER 1   ? D SER 1   
55 1 Y 1 B ASP 2   ? D ASP 2   
56 1 Y 1 B ALA 108 ? D ALA 108 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1SKR 'double helix'        
1SKR 'a-form double helix' 
1SKR 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG  12 1_555 B DC 15 1_555 -0.143 0.554  -0.334 -7.412  5.281   2.599  1  P_DG12:DC15_T P 12 ? T 15 ? ?  ? 
1 A DC  13 1_555 B DG 14 1_555 0.465  0.127  0.085  -3.067  -5.902  -1.390 2  P_DC13:DG14_T P 13 ? T 14 ? 19 1 
1 A DC  14 1_555 B DG 13 1_555 0.005  0.003  -0.123 -5.386  -8.214  -0.043 3  P_DC14:DG13_T P 14 ? T 13 ? 19 1 
1 A DA  15 1_555 B DT 12 1_555 -0.261 0.405  0.208  -6.790  -10.567 -0.538 4  P_DA15:DT12_T P 15 ? T 12 ? 20 1 
1 A DG  16 1_555 B DC 11 1_555 -0.180 0.236  -0.057 -10.378 -14.423 1.332  5  P_DG16:DC11_T P 16 ? T 11 ? 19 1 
1 A DT  17 1_555 B DA 10 1_555 -0.065 0.117  0.035  -1.578  -6.844  3.218  6  P_DT17:DA10_T P 17 ? T 10 ? 20 1 
1 A DG  18 1_555 B DC 9  1_555 -0.320 0.046  -0.521 -5.802  -2.353  1.016  7  P_DG18:DC9_T  P 18 ? T 9  ? 19 1 
1 A DC  19 1_555 B DG 8  1_555 0.138  -0.155 -0.437 9.403   -0.718  -0.952 8  P_DC19:DG8_T  P 19 ? T 8  ? 19 1 
1 A DC  20 1_555 B DG 7  1_555 0.268  -0.328 -0.059 0.654   -5.806  0.311  9  P_DC20:DG7_T  P 20 ? T 7  ? 19 1 
1 A DA  21 1_555 B DT 6  1_555 0.231  -0.242 0.280  -0.204  -11.768 3.201  10 P_DA21:DT6_T  P 21 ? T 6  ? 20 1 
1 A 2DA 22 1_555 B DT 5  1_555 -0.155 -0.071 0.205  0.644   -13.338 4.271  11 P_2DA22:DT5_T P 22 ? T 5  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 12 1_555 B DC 15 1_555 A DC  13 1_555 B DG 14 1_555 -0.497 -0.464 3.269 -3.866  3.231  37.711 -1.123 0.270  3.253 4.971  
5.949  38.034 1  PP_DG12DC13:DG14DC15_TT P 12 ? T 15 ? P 13 ? T 14 ? 
1 A DC 13 1_555 B DG 14 1_555 A DC  14 1_555 B DG 13 1_555 0.560  -0.527 3.295 5.363   7.791  30.983 -2.327 -0.053 3.125 14.176 
-9.758 32.361 2  PP_DC13DC14:DG13DG14_TT P 13 ? T 14 ? P 14 ? T 13 ? 
1 A DC 14 1_555 B DG 13 1_555 A DA  15 1_555 B DT 12 1_555 -0.745 0.201  3.233 -4.260  7.767  31.757 -0.984 0.579  3.260 13.860 
7.601  32.939 3  PP_DC14DA15:DT12DG13_TT P 14 ? T 13 ? P 15 ? T 12 ? 
1 A DA 15 1_555 B DT 12 1_555 A DG  16 1_555 B DC 11 1_555 0.346  -0.197 3.500 0.160   5.176  34.942 -1.141 -0.545 3.438 8.562  
-0.265 35.312 4  PP_DA15DG16:DC11DT12_TT P 15 ? T 12 ? P 16 ? T 11 ? 
1 A DG 16 1_555 B DC 11 1_555 A DT  17 1_555 B DA 10 1_555 0.571  -0.306 3.149 1.647   4.356  30.117 -1.418 -0.771 3.101 8.320  
-3.146 30.467 5  PP_DG16DT17:DA10DC11_TT P 16 ? T 11 ? P 17 ? T 10 ? 
1 A DT 17 1_555 B DA 10 1_555 A DG  18 1_555 B DC 9  1_555 0.865  0.012  3.489 4.053   8.028  29.992 -1.627 -0.772 3.461 15.091 
-7.619 31.282 6  PP_DT17DG18:DC9DA10_TT  P 17 ? T 10 ? P 18 ? T 9  ? 
1 A DG 18 1_555 B DC 9  1_555 A DC  19 1_555 B DG 8  1_555 -0.756 -0.475 2.947 -0.725  2.701  30.520 -1.377 1.302  2.912 5.118  
1.373  30.645 7  PP_DG18DC19:DG8DC9_TT   P 18 ? T 9  ? P 19 ? T 8  ? 
1 A DC 19 1_555 B DG 8  1_555 A DC  20 1_555 B DG 7  1_555 -0.281 -0.877 3.819 -13.046 10.771 39.928 -2.407 -1.092 3.412 14.985 
18.150 43.229 8  PP_DC19DC20:DG7DG8_TT   P 19 ? T 8  ? P 20 ? T 7  ? 
1 A DC 20 1_555 B DG 7  1_555 A DA  21 1_555 B DT 6  1_555 -0.626 -1.652 3.331 -1.809  10.784 23.244 -6.517 0.941  2.381 25.064 
4.204  25.655 9  PP_DC20DA21:DT6DG7_TT   P 20 ? T 7  ? P 21 ? T 6  ? 
1 A DA 21 1_555 B DT 6  1_555 A 2DA 22 1_555 B DT 5  1_555 -0.005 -0.815 3.469 0.543   1.379  33.963 -1.627 0.100  3.433 2.360  
-0.929 33.995 10 PP_DA212DA22:DT5DT6_TT  P 21 ? T 6  ? P 22 ? T 5  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'MAGNESIUM ION'                          MG  
6 "2',3'-DIDEOXYADENOSINE-5'-TRIPHOSPHATE" DAD 
7 water                                    HOH 
#