data_1SKW
# 
_entry.id   1SKW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SKW         
NDB   PD0524       
RCSB  RCSB021800   
WWPDB D_1000021800 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1T7P 'T7 DNA POLYMERASE COMPLEXED TO DNA PRIMER/TEMPLATE, A NUCLEOSIDE TRIPHOSPHATE, AND ITS PROCESSIVITY FACTOR THIOREDOXIN' 
unspecified 
PDB 1SKR 'T7 DNA polymerase complexed primer/template DNA containing a cis-syn thymine dimer on the template' unspecified 
PDB 1SKS 
;Binary 3' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn thymine dimer on the template
;
unspecified 
PDB 1SL0 
;Ternary 3' complex of T7 DNA polymerase with a DNA primer/template containing a disordered cis-syn thymine dimer on the template and an incoming nucleotide
;
unspecified 
PDB 1SL1 
;Binary 5' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn thymine dimer on the template
;
unspecified 
PDB 1SL2 
;Ternary 5' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn thymine dimer on the template and an incoming nucleotide
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SKW 
_pdbx_database_status.recvd_initial_deposition_date   2004-03-05 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, Y.'          1 
'Dutta, S.'       2 
'Doublie, S.'     3 
'Bdour, H.M.'     4 
'Taylor, J.S.'    5 
'Ellenberger, T.' 6 
# 
_citation.id                        primary 
_citation.title                     
'Nucleotide insertion opposite a cis-syn thymine dimer by a replicative DNA polymerase from bacteriophage T7.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            11 
_citation.page_first                784 
_citation.page_last                 790 
_citation.year                      2004 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15235589 
_citation.pdbx_database_id_DOI      10.1038/nsmb792 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, Y.'          1 
primary 'Dutta, S.'       2 
primary 'Doublie, S.'     3 
primary 'Bdour, H.M.'     4 
primary 'Taylor, J.S.'    5 
primary 'Ellenberger, T.' 6 
# 
_cell.entry_id           1SKW 
_cell.length_a           104.718 
_cell.length_b           211.493 
_cell.length_c           52.187 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SKW 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*CP*GP*AP*AP*AP*AP*CP*GP*AP*C*GP*GP*CP*CP*AP*GP*TP*GP*CP*CP*(2DT))-3'"              6426.177  1   ?       
?              ? 'DNA primer'   
2 polymer     syn "5'-D(*CP*CP*CP*(TTD)P*AP*GP*GP*CP*AP*CP*TP*GP*GP*CP*CP*GP*TP*CP*GP*TP*TP*TP*TP*CP*G)-3'" 7922.077  1   ?       
?              ? 'DNA template' 
3 polymer     man 'DNA polymerase'                                                                          79089.789 1   2.7.7.7 
'DEL(118-123)' ? ?              
4 polymer     man 'thioredoxin 1'                                                                           11687.388 1   ?       
?              ? ?              
5 non-polymer syn 'MAGNESIUM ION'                                                                           24.305    1   ?       
?              ? ?              
6 water       nat water                                                                                     18.015    201 ?       
?              ? ?              
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'T7 DNA polymerase' 
# 
_entity_name_sys.entity_id   3 
_entity_name_sys.name        2.7.7.7 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes 
;(DC)(DG)(DA)(DA)(DA)(DA)(DC)(DG)(DA)(DC)(DG)(DG)(DC)(DC)(DA)(DG)(DT)(DG)(DC)(DC)
(2DT)
;
CGAAAACGACGGCCAGTGCCT P ? 
2 polydeoxyribonucleotide no yes 
;(DC)(DC)(DC)(TTD)(DA)(DG)(DG)(DC)(DA)(DC)(DT)(DG)(DG)(DC)(DC)(DG)(DT)(DC)(DG)
(DT)(DT)(DT)(DT)(DC)(DG)
;
CCCTAGGCACTGGCCGTCGTTTTCG T ? 
3 'polypeptide(L)'        no no  
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFNEE
MMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIEELYVEL
AARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREYVAGAPY
TPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSAEGDKAW
LRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAH
FMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTPAIAALR
ESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKHGWDGDF
AYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFNEE
MMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIEELYVEL
AARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREYVAGAPY
TPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSAEGDKAW
LRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAH
FMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTPAIAALR
ESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKHGWDGDF
AYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
A ? 
4 'polypeptide(L)'        no no  
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DG  n 
1 3   DA  n 
1 4   DA  n 
1 5   DA  n 
1 6   DA  n 
1 7   DC  n 
1 8   DG  n 
1 9   DA  n 
1 10  DC  n 
1 11  DG  n 
1 12  DG  n 
1 13  DC  n 
1 14  DC  n 
1 15  DA  n 
1 16  DG  n 
1 17  DT  n 
1 18  DG  n 
1 19  DC  n 
1 20  DC  n 
1 21  2DT n 
2 1   DC  n 
2 2   DC  n 
2 3   DC  n 
2 4   TTD n 
2 5   DA  n 
2 6   DG  n 
2 7   DG  n 
2 8   DC  n 
2 9   DA  n 
2 10  DC  n 
2 11  DT  n 
2 12  DG  n 
2 13  DG  n 
2 14  DC  n 
2 15  DC  n 
2 16  DG  n 
2 17  DT  n 
2 18  DC  n 
2 19  DG  n 
2 20  DT  n 
2 21  DT  n 
2 22  DT  n 
2 23  DT  n 
2 24  DC  n 
2 25  DG  n 
3 1   MET n 
3 2   ILE n 
3 3   VAL n 
3 4   SER n 
3 5   ASP n 
3 6   ILE n 
3 7   GLU n 
3 8   ALA n 
3 9   ASN n 
3 10  ALA n 
3 11  LEU n 
3 12  LEU n 
3 13  GLU n 
3 14  SER n 
3 15  VAL n 
3 16  THR n 
3 17  LYS n 
3 18  PHE n 
3 19  HIS n 
3 20  CYS n 
3 21  GLY n 
3 22  VAL n 
3 23  ILE n 
3 24  TYR n 
3 25  ASP n 
3 26  TYR n 
3 27  SER n 
3 28  THR n 
3 29  ALA n 
3 30  GLU n 
3 31  TYR n 
3 32  VAL n 
3 33  SER n 
3 34  TYR n 
3 35  ARG n 
3 36  PRO n 
3 37  SER n 
3 38  ASP n 
3 39  PHE n 
3 40  GLY n 
3 41  ALA n 
3 42  TYR n 
3 43  LEU n 
3 44  ASP n 
3 45  ALA n 
3 46  LEU n 
3 47  GLU n 
3 48  ALA n 
3 49  GLU n 
3 50  VAL n 
3 51  ALA n 
3 52  ARG n 
3 53  GLY n 
3 54  GLY n 
3 55  LEU n 
3 56  ILE n 
3 57  VAL n 
3 58  PHE n 
3 59  HIS n 
3 60  ASN n 
3 61  GLY n 
3 62  HIS n 
3 63  LYS n 
3 64  TYR n 
3 65  ASP n 
3 66  VAL n 
3 67  PRO n 
3 68  ALA n 
3 69  LEU n 
3 70  THR n 
3 71  LYS n 
3 72  LEU n 
3 73  ALA n 
3 74  LYS n 
3 75  LEU n 
3 76  GLN n 
3 77  LEU n 
3 78  ASN n 
3 79  ARG n 
3 80  GLU n 
3 81  PHE n 
3 82  HIS n 
3 83  LEU n 
3 84  PRO n 
3 85  ARG n 
3 86  GLU n 
3 87  ASN n 
3 88  CYS n 
3 89  ILE n 
3 90  ASP n 
3 91  THR n 
3 92  LEU n 
3 93  VAL n 
3 94  LEU n 
3 95  SER n 
3 96  ARG n 
3 97  LEU n 
3 98  ILE n 
3 99  HIS n 
3 100 SER n 
3 101 ASN n 
3 102 LEU n 
3 103 LYS n 
3 104 ASP n 
3 105 THR n 
3 106 ASP n 
3 107 MET n 
3 108 GLY n 
3 109 LEU n 
3 110 LEU n 
3 111 ARG n 
3 112 SER n 
3 113 GLY n 
3 114 LYS n 
3 115 LEU n 
3 116 PRO n 
3 117 GLY n 
3 118 ALA n 
3 119 LEU n 
3 120 GLU n 
3 121 ALA n 
3 122 TRP n 
3 123 GLY n 
3 124 TYR n 
3 125 ARG n 
3 126 LEU n 
3 127 GLY n 
3 128 GLU n 
3 129 MET n 
3 130 LYS n 
3 131 GLY n 
3 132 GLU n 
3 133 TYR n 
3 134 LYS n 
3 135 ASP n 
3 136 ASP n 
3 137 PHE n 
3 138 LYS n 
3 139 ARG n 
3 140 MET n 
3 141 LEU n 
3 142 GLU n 
3 143 GLU n 
3 144 GLN n 
3 145 GLY n 
3 146 GLU n 
3 147 GLU n 
3 148 TYR n 
3 149 VAL n 
3 150 ASP n 
3 151 GLY n 
3 152 MET n 
3 153 GLU n 
3 154 TRP n 
3 155 TRP n 
3 156 ASN n 
3 157 PHE n 
3 158 ASN n 
3 159 GLU n 
3 160 GLU n 
3 161 MET n 
3 162 MET n 
3 163 ASP n 
3 164 TYR n 
3 165 ASN n 
3 166 VAL n 
3 167 GLN n 
3 168 ASP n 
3 169 VAL n 
3 170 VAL n 
3 171 VAL n 
3 172 THR n 
3 173 LYS n 
3 174 ALA n 
3 175 LEU n 
3 176 LEU n 
3 177 GLU n 
3 178 LYS n 
3 179 LEU n 
3 180 LEU n 
3 181 SER n 
3 182 ASP n 
3 183 LYS n 
3 184 HIS n 
3 185 TYR n 
3 186 PHE n 
3 187 PRO n 
3 188 PRO n 
3 189 GLU n 
3 190 ILE n 
3 191 ASP n 
3 192 PHE n 
3 193 THR n 
3 194 ASP n 
3 195 VAL n 
3 196 GLY n 
3 197 TYR n 
3 198 THR n 
3 199 THR n 
3 200 PHE n 
3 201 TRP n 
3 202 SER n 
3 203 GLU n 
3 204 SER n 
3 205 LEU n 
3 206 GLU n 
3 207 ALA n 
3 208 VAL n 
3 209 ASP n 
3 210 ILE n 
3 211 GLU n 
3 212 HIS n 
3 213 ARG n 
3 214 ALA n 
3 215 ALA n 
3 216 TRP n 
3 217 LEU n 
3 218 LEU n 
3 219 ALA n 
3 220 LYS n 
3 221 GLN n 
3 222 GLU n 
3 223 ARG n 
3 224 ASN n 
3 225 GLY n 
3 226 PHE n 
3 227 PRO n 
3 228 PHE n 
3 229 ASP n 
3 230 THR n 
3 231 LYS n 
3 232 ALA n 
3 233 ILE n 
3 234 GLU n 
3 235 GLU n 
3 236 LEU n 
3 237 TYR n 
3 238 VAL n 
3 239 GLU n 
3 240 LEU n 
3 241 ALA n 
3 242 ALA n 
3 243 ARG n 
3 244 ARG n 
3 245 SER n 
3 246 GLU n 
3 247 LEU n 
3 248 LEU n 
3 249 ARG n 
3 250 LYS n 
3 251 LEU n 
3 252 THR n 
3 253 GLU n 
3 254 THR n 
3 255 PHE n 
3 256 GLY n 
3 257 SER n 
3 258 TRP n 
3 259 TYR n 
3 260 GLN n 
3 261 PRO n 
3 262 LYS n 
3 263 GLY n 
3 264 GLY n 
3 265 THR n 
3 266 GLU n 
3 267 MET n 
3 268 PHE n 
3 269 CYS n 
3 270 HIS n 
3 271 PRO n 
3 272 ARG n 
3 273 THR n 
3 274 GLY n 
3 275 LYS n 
3 276 PRO n 
3 277 LEU n 
3 278 PRO n 
3 279 LYS n 
3 280 TYR n 
3 281 PRO n 
3 282 ARG n 
3 283 ILE n 
3 284 LYS n 
3 285 THR n 
3 286 PRO n 
3 287 LYS n 
3 288 VAL n 
3 289 GLY n 
3 290 GLY n 
3 291 ILE n 
3 292 PHE n 
3 293 LYS n 
3 294 LYS n 
3 295 PRO n 
3 296 LYS n 
3 297 ASN n 
3 298 LYS n 
3 299 ALA n 
3 300 GLN n 
3 301 ARG n 
3 302 GLU n 
3 303 GLY n 
3 304 ARG n 
3 305 GLU n 
3 306 PRO n 
3 307 CYS n 
3 308 GLU n 
3 309 LEU n 
3 310 ASP n 
3 311 THR n 
3 312 ARG n 
3 313 GLU n 
3 314 TYR n 
3 315 VAL n 
3 316 ALA n 
3 317 GLY n 
3 318 ALA n 
3 319 PRO n 
3 320 TYR n 
3 321 THR n 
3 322 PRO n 
3 323 VAL n 
3 324 GLU n 
3 325 HIS n 
3 326 VAL n 
3 327 VAL n 
3 328 PHE n 
3 329 ASN n 
3 330 PRO n 
3 331 SER n 
3 332 SER n 
3 333 ARG n 
3 334 ASP n 
3 335 HIS n 
3 336 ILE n 
3 337 GLN n 
3 338 LYS n 
3 339 LYS n 
3 340 LEU n 
3 341 GLN n 
3 342 GLU n 
3 343 ALA n 
3 344 GLY n 
3 345 TRP n 
3 346 VAL n 
3 347 PRO n 
3 348 THR n 
3 349 LYS n 
3 350 TYR n 
3 351 THR n 
3 352 ASP n 
3 353 LYS n 
3 354 GLY n 
3 355 ALA n 
3 356 PRO n 
3 357 VAL n 
3 358 VAL n 
3 359 ASP n 
3 360 ASP n 
3 361 GLU n 
3 362 VAL n 
3 363 LEU n 
3 364 GLU n 
3 365 GLY n 
3 366 VAL n 
3 367 ARG n 
3 368 VAL n 
3 369 ASP n 
3 370 ASP n 
3 371 PRO n 
3 372 GLU n 
3 373 LYS n 
3 374 GLN n 
3 375 ALA n 
3 376 ALA n 
3 377 ILE n 
3 378 ASP n 
3 379 LEU n 
3 380 ILE n 
3 381 LYS n 
3 382 GLU n 
3 383 TYR n 
3 384 LEU n 
3 385 MET n 
3 386 ILE n 
3 387 GLN n 
3 388 LYS n 
3 389 ARG n 
3 390 ILE n 
3 391 GLY n 
3 392 GLN n 
3 393 SER n 
3 394 ALA n 
3 395 GLU n 
3 396 GLY n 
3 397 ASP n 
3 398 LYS n 
3 399 ALA n 
3 400 TRP n 
3 401 LEU n 
3 402 ARG n 
3 403 TYR n 
3 404 VAL n 
3 405 ALA n 
3 406 GLU n 
3 407 ASP n 
3 408 GLY n 
3 409 LYS n 
3 410 ILE n 
3 411 HIS n 
3 412 GLY n 
3 413 SER n 
3 414 VAL n 
3 415 ASN n 
3 416 PRO n 
3 417 ASN n 
3 418 GLY n 
3 419 ALA n 
3 420 VAL n 
3 421 THR n 
3 422 GLY n 
3 423 ARG n 
3 424 ALA n 
3 425 THR n 
3 426 HIS n 
3 427 ALA n 
3 428 PHE n 
3 429 PRO n 
3 430 ASN n 
3 431 LEU n 
3 432 ALA n 
3 433 GLN n 
3 434 ILE n 
3 435 PRO n 
3 436 GLY n 
3 437 VAL n 
3 438 ARG n 
3 439 SER n 
3 440 PRO n 
3 441 TYR n 
3 442 GLY n 
3 443 GLU n 
3 444 GLN n 
3 445 CYS n 
3 446 ARG n 
3 447 ALA n 
3 448 ALA n 
3 449 PHE n 
3 450 GLY n 
3 451 ALA n 
3 452 GLU n 
3 453 HIS n 
3 454 HIS n 
3 455 LEU n 
3 456 ASP n 
3 457 GLY n 
3 458 ILE n 
3 459 THR n 
3 460 GLY n 
3 461 LYS n 
3 462 PRO n 
3 463 TRP n 
3 464 VAL n 
3 465 GLN n 
3 466 ALA n 
3 467 GLY n 
3 468 ILE n 
3 469 ASP n 
3 470 ALA n 
3 471 SER n 
3 472 GLY n 
3 473 LEU n 
3 474 GLU n 
3 475 LEU n 
3 476 ARG n 
3 477 CYS n 
3 478 LEU n 
3 479 ALA n 
3 480 HIS n 
3 481 PHE n 
3 482 MET n 
3 483 ALA n 
3 484 ARG n 
3 485 PHE n 
3 486 ASP n 
3 487 ASN n 
3 488 GLY n 
3 489 GLU n 
3 490 TYR n 
3 491 ALA n 
3 492 HIS n 
3 493 GLU n 
3 494 ILE n 
3 495 LEU n 
3 496 ASN n 
3 497 GLY n 
3 498 ASP n 
3 499 ILE n 
3 500 HIS n 
3 501 THR n 
3 502 LYS n 
3 503 ASN n 
3 504 GLN n 
3 505 ILE n 
3 506 ALA n 
3 507 ALA n 
3 508 GLU n 
3 509 LEU n 
3 510 PRO n 
3 511 THR n 
3 512 ARG n 
3 513 ASP n 
3 514 ASN n 
3 515 ALA n 
3 516 LYS n 
3 517 THR n 
3 518 PHE n 
3 519 ILE n 
3 520 TYR n 
3 521 GLY n 
3 522 PHE n 
3 523 LEU n 
3 524 TYR n 
3 525 GLY n 
3 526 ALA n 
3 527 GLY n 
3 528 ASP n 
3 529 GLU n 
3 530 LYS n 
3 531 ILE n 
3 532 GLY n 
3 533 GLN n 
3 534 ILE n 
3 535 VAL n 
3 536 GLY n 
3 537 ALA n 
3 538 GLY n 
3 539 LYS n 
3 540 GLU n 
3 541 ARG n 
3 542 GLY n 
3 543 LYS n 
3 544 GLU n 
3 545 LEU n 
3 546 LYS n 
3 547 LYS n 
3 548 LYS n 
3 549 PHE n 
3 550 LEU n 
3 551 GLU n 
3 552 ASN n 
3 553 THR n 
3 554 PRO n 
3 555 ALA n 
3 556 ILE n 
3 557 ALA n 
3 558 ALA n 
3 559 LEU n 
3 560 ARG n 
3 561 GLU n 
3 562 SER n 
3 563 ILE n 
3 564 GLN n 
3 565 GLN n 
3 566 THR n 
3 567 LEU n 
3 568 VAL n 
3 569 GLU n 
3 570 SER n 
3 571 SER n 
3 572 GLN n 
3 573 TRP n 
3 574 VAL n 
3 575 ALA n 
3 576 GLY n 
3 577 GLU n 
3 578 GLN n 
3 579 GLN n 
3 580 VAL n 
3 581 LYS n 
3 582 TRP n 
3 583 LYS n 
3 584 ARG n 
3 585 ARG n 
3 586 TRP n 
3 587 ILE n 
3 588 LYS n 
3 589 GLY n 
3 590 LEU n 
3 591 ASP n 
3 592 GLY n 
3 593 ARG n 
3 594 LYS n 
3 595 VAL n 
3 596 HIS n 
3 597 VAL n 
3 598 ARG n 
3 599 SER n 
3 600 PRO n 
3 601 HIS n 
3 602 ALA n 
3 603 ALA n 
3 604 LEU n 
3 605 ASN n 
3 606 THR n 
3 607 LEU n 
3 608 LEU n 
3 609 GLN n 
3 610 SER n 
3 611 ALA n 
3 612 GLY n 
3 613 ALA n 
3 614 LEU n 
3 615 ILE n 
3 616 CYS n 
3 617 LYS n 
3 618 LEU n 
3 619 TRP n 
3 620 ILE n 
3 621 ILE n 
3 622 LYS n 
3 623 THR n 
3 624 GLU n 
3 625 GLU n 
3 626 MET n 
3 627 LEU n 
3 628 VAL n 
3 629 GLU n 
3 630 LYS n 
3 631 GLY n 
3 632 LEU n 
3 633 LYS n 
3 634 HIS n 
3 635 GLY n 
3 636 TRP n 
3 637 ASP n 
3 638 GLY n 
3 639 ASP n 
3 640 PHE n 
3 641 ALA n 
3 642 TYR n 
3 643 MET n 
3 644 ALA n 
3 645 TRP n 
3 646 VAL n 
3 647 HIS n 
3 648 ASP n 
3 649 GLU n 
3 650 ILE n 
3 651 GLN n 
3 652 VAL n 
3 653 GLY n 
3 654 CYS n 
3 655 ARG n 
3 656 THR n 
3 657 GLU n 
3 658 GLU n 
3 659 ILE n 
3 660 ALA n 
3 661 GLN n 
3 662 VAL n 
3 663 VAL n 
3 664 ILE n 
3 665 GLU n 
3 666 THR n 
3 667 ALA n 
3 668 GLN n 
3 669 GLU n 
3 670 ALA n 
3 671 MET n 
3 672 ARG n 
3 673 TRP n 
3 674 VAL n 
3 675 GLY n 
3 676 ASP n 
3 677 HIS n 
3 678 TRP n 
3 679 ASN n 
3 680 PHE n 
3 681 ARG n 
3 682 CYS n 
3 683 LEU n 
3 684 LEU n 
3 685 ASP n 
3 686 THR n 
3 687 GLU n 
3 688 GLY n 
3 689 LYS n 
3 690 MET n 
3 691 GLY n 
3 692 PRO n 
3 693 ASN n 
3 694 TRP n 
3 695 ALA n 
3 696 ILE n 
3 697 CYS n 
3 698 HIS n 
4 1   SER n 
4 2   ASP n 
4 3   LYS n 
4 4   ILE n 
4 5   ILE n 
4 6   HIS n 
4 7   LEU n 
4 8   THR n 
4 9   ASP n 
4 10  ASP n 
4 11  SER n 
4 12  PHE n 
4 13  ASP n 
4 14  THR n 
4 15  ASP n 
4 16  VAL n 
4 17  LEU n 
4 18  LYS n 
4 19  ALA n 
4 20  ASP n 
4 21  GLY n 
4 22  ALA n 
4 23  ILE n 
4 24  LEU n 
4 25  VAL n 
4 26  ASP n 
4 27  PHE n 
4 28  TRP n 
4 29  ALA n 
4 30  GLU n 
4 31  TRP n 
4 32  CYS n 
4 33  GLY n 
4 34  PRO n 
4 35  CYS n 
4 36  LYS n 
4 37  MET n 
4 38  ILE n 
4 39  ALA n 
4 40  PRO n 
4 41  ILE n 
4 42  LEU n 
4 43  ASP n 
4 44  GLU n 
4 45  ILE n 
4 46  ALA n 
4 47  ASP n 
4 48  GLU n 
4 49  TYR n 
4 50  GLN n 
4 51  GLY n 
4 52  LYS n 
4 53  LEU n 
4 54  THR n 
4 55  VAL n 
4 56  ALA n 
4 57  LYS n 
4 58  LEU n 
4 59  ASN n 
4 60  ILE n 
4 61  ASP n 
4 62  GLN n 
4 63  ASN n 
4 64  PRO n 
4 65  GLY n 
4 66  THR n 
4 67  ALA n 
4 68  PRO n 
4 69  LYS n 
4 70  TYR n 
4 71  GLY n 
4 72  ILE n 
4 73  ARG n 
4 74  GLY n 
4 75  ILE n 
4 76  PRO n 
4 77  THR n 
4 78  LEU n 
4 79  LEU n 
4 80  LEU n 
4 81  PHE n 
4 82  LYS n 
4 83  ASN n 
4 84  GLY n 
4 85  GLU n 
4 86  VAL n 
4 87  ALA n 
4 88  ALA n 
4 89  THR n 
4 90  LYS n 
4 91  VAL n 
4 92  GLY n 
4 93  ALA n 
4 94  LEU n 
4 95  SER n 
4 96  LYS n 
4 97  GLY n 
4 98  GLN n 
4 99  LEU n 
4 100 LYS n 
4 101 GLU n 
4 102 PHE n 
4 103 LEU n 
4 104 ASP n 
4 105 ALA n 
4 106 ASN n 
4 107 LEU n 
4 108 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample ? ? ? ? 'T7-like viruses' 5 ? ? ? ? ? ? 'Enterobacteria phage T7' 10760 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? ? Escherichia       ? ? ? ? ? ? ? 'Escherichia coli'        562   ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOL_BPT7  P00581 3 
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGKRFGSHALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEW
WNFNEEMMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIE
ELYVELAARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREY
VAGAPYTPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSA
EGDKAWLRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLE
LRCLAHFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTP
AIAALRESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKH
GWDGDFAYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
1 ? 
2 UNP THIO_ECOLI P0AA25 4 
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
1 ? 
3 PDB 1SKW       1SKW   1 ? ? ? 
4 PDB 1SKW       1SKW   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1SKW A 1 ? 698 ? P00581 1 ? 704 ? 1 704 
2 2 1SKW B 1 ? 108 ? P0AA25 1 ? 108 ? 1 108 
3 3 1SKW P 1 ? 21  ? 1SKW   1 ? 21  ? 1 21  
4 4 1SKW T 1 ? 25  ? 1SKW   2 ? 26  ? 2 26  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1SKW ? A ? ? UNP P00581 LYS 118 DELETION ? 1 
1 1SKW ? A ? ? UNP P00581 ARG 119 DELETION ? 2 
1 1SKW ? A ? ? UNP P00581 PHE 120 DELETION ? 3 
1 1SKW ? A ? ? UNP P00581 GLY 121 DELETION ? 4 
1 1SKW ? A ? ? UNP P00581 SER 122 DELETION ? 5 
1 1SKW ? A ? ? UNP P00581 HIS 123 DELETION ? 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2DT 'DNA linking'       n "3'-DEOXYTHYMIDINE-5'-MONOPHOSPHATE" "2',3'-DIDEOXYTHYMIDINE-5'-MONOPHOSPHATE" 'C10 H15 N2 O7 P'   
306.209 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TTD 'DNA linking'       n 'CIS-SYN CYCLOBUTANE THYMINE DIMER'  
;[(3S,4S,9S,10R,12R,15AR,18BS,18CS)-3,7-DIHYDROXY-15A,15B-DIMETHYL-7-OXIDO-13,15,16,18-TETRAOXOHEXADECAHYDRO-1H-1,4-EPOXY-9,12-METHANO-6,8,11-TRIOXA-12A,14,17,18A-TETRAAZA-7-PHOSPHACYCLOHEXADECA[1,2,3,4-DEF]BIPHENYLEN-10-YL]METHYL DIHYDROGEN PHOSPHATE
;
'C20 H28 N4 O15 P2' 626.402 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1SKW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.14 
_exptl_crystal.density_percent_sol   60.49 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'VAPOR DIFFUSION, HANGING DROP, pH 7.5' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2002-07-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.916 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             0.916 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1SKW 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.300 
_reflns.number_obs                   51467 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.071 
_reflns.pdbx_netI_over_sigmaI        21.2 
_reflns.B_iso_Wilson_estimate        28.3 
_reflns.pdbx_redundancy              24.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.38 
_reflns_shell.percent_possible_all   97.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.521 
_reflns_shell.meanI_over_sigI_obs    2.6 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1SKW 
_refine.ls_number_reflns_obs                     51467 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    98.2 
_refine.ls_R_factor_obs                          0.239 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.239 
_refine.ls_R_factor_R_free                       0.278 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2539 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               38.2 
_refine.aniso_B[1][1]                            2.95 
_refine.aniso_B[2][2]                            -0.83 
_refine.aniso_B[3][3]                            -2.11 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.325622 
_refine.solvent_model_param_bsol                 29.7686 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'THE TTD IS MISSING DUE TO DISORDER AND IS COVALENTLY LINKED.' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1SKW 
_refine_analyze.Luzzati_coordinate_error_obs    0.31 
_refine_analyze.Luzzati_sigma_a_obs             0.27 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.37 
_refine_analyze.Luzzati_sigma_a_free            0.28 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6008 
_refine_hist.pdbx_number_atoms_nucleic_acid   368 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             201 
_refine_hist.number_atoms_total               6578 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      21.7  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.84  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.57  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.24  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             7.91  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            9.30  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.30 
_refine_ls_shell.d_res_low                        2.44 
_refine_ls_shell.number_reflns_R_work             7592 
_refine_ls_shell.R_factor_R_work                  0.284 
_refine_ls_shell.percent_reflns_obs               92.0 
_refine_ls_shell.R_factor_R_free                  0.315 
_refine_ls_shell.R_factor_R_free_error            0.017 
_refine_ls_shell.percent_reflns_R_free            4.2 
_refine_ls_shell.number_reflns_R_free             331 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1SKW 
_struct.title                     
;Binary 3' complex of T7 DNA polymerase with a DNA primer/template containing a disordered cis-syn thymine dimer on the template
;
_struct.pdbx_descriptor           'DNA POLYMERASE (E.C.2.7.7.7)/THIOREDOXIN 1/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SKW 
_struct_keywords.pdbx_keywords   'TRANSFERASE/ELECTRON TRANSPORT/DNA' 
_struct_keywords.text            
'DNA polymerase, fidelity, lesion bypass, thymine dimer, open, close, TRANSFERASE-ELECTRON TRANSPORT-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU C 11  ? VAL C 15  ? LEU A 11  VAL A 15  5 ? 5  
HELX_P HELX_P2  2  ARG C 35  ? SER C 37  ? ARG A 35  SER A 37  5 ? 3  
HELX_P HELX_P3  3  ASP C 38  ? ARG C 52  ? ASP A 38  ARG A 52  1 ? 15 
HELX_P HELX_P4  4  TYR C 64  ? ASN C 78  ? TYR A 64  ASN A 78  1 ? 15 
HELX_P HELX_P5  5  PRO C 84  ? GLU C 86  ? PRO A 84  GLU A 86  5 ? 3  
HELX_P HELX_P6  6  THR C 91  ? HIS C 99  ? THR A 91  HIS A 99  1 ? 9  
HELX_P HELX_P7  7  ARG C 111 ? LEU C 115 ? ARG A 111 LEU A 115 5 ? 5  
HELX_P HELX_P8  8  GLU C 120 ? GLU C 142 ? GLU A 126 GLU A 148 1 ? 23 
HELX_P HELX_P9  9  GLY C 151 ? TRP C 155 ? GLY A 157 TRP A 161 5 ? 5  
HELX_P HELX_P10 10 ASN C 158 ? SER C 181 ? ASN A 164 SER A 187 1 ? 24 
HELX_P HELX_P11 11 GLY C 196 ? SER C 204 ? GLY A 202 SER A 210 1 ? 9  
HELX_P HELX_P12 12 LEU C 205 ? GLY C 225 ? LEU A 211 GLY A 231 1 ? 21 
HELX_P HELX_P13 13 ASP C 229 ? PHE C 255 ? ASP A 235 PHE A 261 1 ? 27 
HELX_P HELX_P14 14 SER C 332 ? GLU C 342 ? SER A 338 GLU A 348 1 ? 11 
HELX_P HELX_P15 15 ASP C 359 ? VAL C 366 ? ASP A 365 VAL A 372 1 ? 8  
HELX_P HELX_P16 16 ASP C 370 ? ALA C 394 ? ASP A 376 ALA A 400 1 ? 25 
HELX_P HELX_P17 17 ALA C 399 ? VAL C 404 ? ALA A 405 VAL A 410 1 ? 6  
HELX_P HELX_P18 18 TYR C 441 ? ALA C 448 ? TYR A 447 ALA A 454 1 ? 8  
HELX_P HELX_P19 19 PHE C 449 ? PHE C 449 ? PHE A 455 PHE A 455 5 ? 1  
HELX_P HELX_P20 20 GLY C 450 ? HIS C 454 ? GLY A 456 HIS A 460 5 ? 5  
HELX_P HELX_P21 21 GLY C 472 ? ASN C 487 ? GLY A 478 ASN A 493 1 ? 16 
HELX_P HELX_P22 22 GLY C 488 ? ASN C 496 ? GLY A 494 ASN A 502 1 ? 9  
HELX_P HELX_P23 23 ASP C 498 ? ALA C 507 ? ASP A 504 ALA A 513 1 ? 10 
HELX_P HELX_P24 24 THR C 511 ? TYR C 524 ? THR A 517 TYR A 530 1 ? 14 
HELX_P HELX_P25 25 ILE C 531 ? VAL C 535 ? ILE A 537 VAL A 541 5 ? 5  
HELX_P HELX_P26 26 GLY C 538 ? THR C 553 ? GLY A 544 THR A 559 1 ? 16 
HELX_P HELX_P27 27 THR C 553 ? VAL C 568 ? THR A 559 VAL A 574 1 ? 16 
HELX_P HELX_P28 28 SER C 599 ? HIS C 601 ? SER A 605 HIS A 607 5 ? 3  
HELX_P HELX_P29 29 ALA C 602 ? LYS C 630 ? ALA A 608 LYS A 636 1 ? 29 
HELX_P HELX_P30 30 THR C 656 ? TRP C 678 ? THR A 662 TRP A 684 1 ? 23 
HELX_P HELX_P31 31 SER D 11  ? VAL D 16  ? SER B 11  VAL B 16  1 ? 6  
HELX_P HELX_P32 32 CYS D 32  ? TYR D 49  ? CYS B 32  TYR B 49  1 ? 18 
HELX_P HELX_P33 33 THR D 66  ? GLY D 71  ? THR B 66  GLY B 71  5 ? 6  
HELX_P HELX_P34 34 SER D 95  ? LEU D 107 ? SER B 95  LEU B 107 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E MG  .  MG    ? ? ? 1_555 H HOH .  O   ? ? A MG  4003 A HOH 5203 1_555 ? ? ? ? ? ? ?            2.438 ? 
metalc2  metalc ? ? E MG  .  MG    ? ? ? 1_555 H HOH .  O   ? ? A MG  4003 A HOH 5030 1_555 ? ? ? ? ? ? ?            2.596 ? 
metalc3  metalc ? ? E MG  .  MG    ? ? ? 1_555 H HOH .  O   ? ? A MG  4003 A HOH 5202 1_555 ? ? ? ? ? ? ?            2.357 ? 
metalc4  metalc ? ? E MG  .  MG    ? ? ? 1_555 C ASP 5  OD1 ? ? A MG  4003 A ASP 5    1_555 ? ? ? ? ? ? ?            2.446 ? 
metalc5  metalc ? ? E MG  .  MG    ? ? ? 1_555 H HOH .  O   ? ? A MG  4003 A HOH 5204 1_555 ? ? ? ? ? ? ?            2.461 ? 
metalc6  metalc ? ? E MG  .  MG    ? ? ? 1_555 H HOH .  O   ? ? A MG  4003 A HOH 5206 1_555 ? ? ? ? ? ? ?            2.516 ? 
covale1  covale ? ? A DC  20 "O3'" ? ? ? 1_555 A 2DT 21 P   ? ? P DC  20   P 2DT 21   1_555 ? ? ? ? ? ? ?            1.606 ? 
hydrog1  hydrog ? ? A DC  14 N3    ? ? ? 1_555 B DG  12 N1  ? ? P DC  14   T DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DC  14 N4    ? ? ? 1_555 B DG  12 O6  ? ? P DC  14   T DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DC  14 O2    ? ? ? 1_555 B DG  12 N2  ? ? P DC  14   T DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DA  15 N1    ? ? ? 1_555 B DT  11 N3  ? ? P DA  15   T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DA  15 N6    ? ? ? 1_555 B DT  11 O4  ? ? P DA  15   T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DG  16 N1    ? ? ? 1_555 B DC  10 N3  ? ? P DG  16   T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DG  16 N2    ? ? ? 1_555 B DC  10 O2  ? ? P DG  16   T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DG  16 O6    ? ? ? 1_555 B DC  10 N4  ? ? P DG  16   T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DT  17 N3    ? ? ? 1_555 B DA  9  N1  ? ? P DT  17   T DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DT  17 O4    ? ? ? 1_555 B DA  9  N6  ? ? P DT  17   T DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG  18 N1    ? ? ? 1_555 B DC  8  N3  ? ? P DG  18   T DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG  18 N2    ? ? ? 1_555 B DC  8  O2  ? ? P DG  18   T DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DG  18 O6    ? ? ? 1_555 B DC  8  N4  ? ? P DG  18   T DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DC  19 N3    ? ? ? 1_555 B DG  7  N1  ? ? P DC  19   T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DC  19 N4    ? ? ? 1_555 B DG  7  O6  ? ? P DC  19   T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DC  19 O2    ? ? ? 1_555 B DG  7  N2  ? ? P DC  19   T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DC  20 N3    ? ? ? 1_555 B DG  6  N1  ? ? P DC  20   T DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DC  20 N4    ? ? ? 1_555 B DG  6  O6  ? ? P DC  20   T DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DC  20 O2    ? ? ? 1_555 B DG  6  N2  ? ? P DC  20   T DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A 2DT 21 N3    ? ? ? 1_555 B DA  5  N1  ? ? P 2DT 21   T DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A 2DT 21 O4    ? ? ? 1_555 B DA  5  N6  ? ? P 2DT 21   T DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 428 C . ? PHE 434 A PRO 429 C ? PRO 435 A 1 -0.56 
2 ILE 75  D . ? ILE 75  B PRO 76  D ? PRO 76  B 1 0.05  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 3 ? 
D ? 2 ? 
E ? 4 ? 
F ? 2 ? 
G ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR C 31  ? TYR C 34  ? TYR A 31  TYR A 34  
A 2 PHE C 18  ? ASP C 25  ? PHE A 18  ASP A 25  
A 3 ILE C 2   ? ALA C 8   ? ILE A 2   ALA A 8   
A 4 ILE C 56  ? PHE C 58  ? ILE A 56  PHE A 58  
A 5 CYS C 88  ? ASP C 90  ? CYS A 88  ASP A 90  
B 1 PHE C 226 ? PRO C 227 ? PHE A 232 PRO A 233 
B 2 LYS C 409 ? ILE C 410 ? LYS A 415 ILE A 416 
C 1 TRP C 258 ? PRO C 261 ? TRP A 264 PRO A 267 
C 2 THR C 321 ? VAL C 326 ? THR A 327 VAL A 332 
C 3 GLY D 74  ? ILE D 75  ? GLY B 74  ILE B 75  
D 1 SER C 413 ? ASN C 415 ? SER A 419 ASN A 421 
D 2 THR C 425 ? ALA C 427 ? THR A 431 ALA A 433 
E 1 PHE C 640 ? TRP C 645 ? PHE A 646 TRP A 651 
E 2 GLU C 649 ? CYS C 654 ? GLU A 655 CYS A 660 
E 3 VAL C 464 ? ALA C 470 ? VAL A 470 ALA A 476 
E 4 THR C 686 ? GLY C 691 ? THR A 692 GLY A 697 
F 1 TRP C 586 ? LYS C 588 ? TRP A 592 LYS A 594 
F 2 LYS C 594 ? HIS C 596 ? LYS A 600 HIS A 602 
G 1 ILE D 5   ? HIS D 6   ? ILE B 5   HIS B 6   
G 2 LEU D 53  ? ASN D 59  ? LEU B 53  ASN B 59  
G 3 ALA D 22  ? TRP D 28  ? ALA B 22  TRP B 28  
G 4 THR D 77  ? LYS D 82  ? THR B 77  LYS B 82  
G 5 GLU D 85  ? VAL D 91  ? GLU B 85  VAL B 91  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR C 34  ? O TYR A 34  N GLY C 21  ? N GLY A 21  
A 2 3 O CYS C 20  ? O CYS A 20  N GLU C 7   ? N GLU A 7   
A 3 4 N SER C 4   ? N SER A 4   O VAL C 57  ? O VAL A 57  
A 4 5 N ILE C 56  ? N ILE A 56  O ILE C 89  ? O ILE A 89  
B 1 2 N PHE C 226 ? N PHE A 232 O ILE C 410 ? O ILE A 416 
C 1 2 N GLN C 260 ? N GLN A 266 O GLU C 324 ? O GLU A 330 
C 2 3 N THR C 321 ? N THR A 327 O ILE D 75  ? O ILE B 75  
D 1 2 N ASN C 415 ? N ASN A 421 O THR C 425 ? O THR A 431 
E 1 2 N ALA C 641 ? N ALA A 647 O GLY C 653 ? O GLY A 659 
E 2 3 O CYS C 654 ? O CYS A 660 N VAL C 464 ? N VAL A 470 
E 3 4 N GLN C 465 ? N GLN A 471 O GLY C 691 ? O GLY A 697 
F 1 2 N ILE C 587 ? N ILE A 593 O VAL C 595 ? O VAL A 601 
G 1 2 N ILE D 5   ? N ILE B 5   O LYS D 57  ? O LYS B 57  
G 2 3 O ALA D 56  ? O ALA B 56  N LEU D 24  ? N LEU B 24  
G 3 4 N VAL D 25  ? N VAL B 25  O LEU D 79  ? O LEU B 79  
G 4 5 N LEU D 78  ? N LEU B 78  O LYS D 90  ? O LYS B 90  
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE MG A 4003' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 ASP C 5 ? ASP A 5    . ? 1_555 ? 
2 AC1 6 HOH H . ? HOH A 5030 . ? 1_555 ? 
3 AC1 6 HOH H . ? HOH A 5202 . ? 1_555 ? 
4 AC1 6 HOH H . ? HOH A 5203 . ? 1_555 ? 
5 AC1 6 HOH H . ? HOH A 5204 . ? 1_555 ? 
6 AC1 6 HOH H . ? HOH A 5206 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1SKW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SKW 
_atom_sites.fract_transf_matrix[1][1]   0.009549 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004728 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019162 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    P  P     . DC  A 1 14  ? 60.281 41.879  21.075  1.00 64.02 ? 14   DC  P P     1 
ATOM   2    O  OP1   . DC  A 1 14  ? 61.355 42.474  20.165  1.00 63.89 ? 14   DC  P OP1   1 
ATOM   3    O  OP2   . DC  A 1 14  ? 59.564 40.697  20.439  1.00 63.71 ? 14   DC  P OP2   1 
ATOM   4    O  "O5'" . DC  A 1 14  ? 59.147 43.037  21.244  1.00 63.48 ? 14   DC  P "O5'" 1 
ATOM   5    C  "C5'" . DC  A 1 14  ? 59.104 44.144  20.329  1.00 61.58 ? 14   DC  P "C5'" 1 
ATOM   6    C  "C4'" . DC  A 1 14  ? 57.719 44.745  20.277  1.00 59.88 ? 14   DC  P "C4'" 1 
ATOM   7    O  "O4'" . DC  A 1 14  ? 57.679 45.642  19.145  1.00 58.56 ? 14   DC  P "O4'" 1 
ATOM   8    C  "C3'" . DC  A 1 14  ? 56.563 43.769  20.064  1.00 59.13 ? 14   DC  P "C3'" 1 
ATOM   9    O  "O3'" . DC  A 1 14  ? 55.396 44.312  20.701  1.00 59.46 ? 14   DC  P "O3'" 1 
ATOM   10   C  "C2'" . DC  A 1 14  ? 56.423 43.726  18.550  1.00 57.82 ? 14   DC  P "C2'" 1 
ATOM   11   C  "C1'" . DC  A 1 14  ? 56.818 45.138  18.131  1.00 57.03 ? 14   DC  P "C1'" 1 
ATOM   12   N  N1    . DC  A 1 14  ? 57.540 45.258  16.848  1.00 54.69 ? 14   DC  P N1    1 
ATOM   13   C  C2    . DC  A 1 14  ? 57.303 46.384  16.050  1.00 52.92 ? 14   DC  P C2    1 
ATOM   14   O  O2    . DC  A 1 14  ? 56.469 47.223  16.423  1.00 52.64 ? 14   DC  P O2    1 
ATOM   15   N  N3    . DC  A 1 14  ? 57.986 46.532  14.895  1.00 51.83 ? 14   DC  P N3    1 
ATOM   16   C  C4    . DC  A 1 14  ? 58.871 45.610  14.521  1.00 51.35 ? 14   DC  P C4    1 
ATOM   17   N  N4    . DC  A 1 14  ? 59.532 45.810  13.380  1.00 51.20 ? 14   DC  P N4    1 
ATOM   18   C  C5    . DC  A 1 14  ? 59.121 44.444  15.302  1.00 52.07 ? 14   DC  P C5    1 
ATOM   19   C  C6    . DC  A 1 14  ? 58.440 44.308  16.447  1.00 52.75 ? 14   DC  P C6    1 
ATOM   20   P  P     . DA  A 1 15  ? 53.968 43.582  20.550  1.00 61.84 ? 15   DA  P P     1 
ATOM   21   O  OP1   . DA  A 1 15  ? 53.339 43.518  21.897  1.00 61.23 ? 15   DA  P OP1   1 
ATOM   22   O  OP2   . DA  A 1 15  ? 54.142 42.334  19.758  1.00 61.07 ? 15   DA  P OP2   1 
ATOM   23   O  "O5'" . DA  A 1 15  ? 53.112 44.607  19.680  1.00 59.15 ? 15   DA  P "O5'" 1 
ATOM   24   C  "C5'" . DA  A 1 15  ? 52.833 45.919  20.172  1.00 55.04 ? 15   DA  P "C5'" 1 
ATOM   25   C  "C4'" . DA  A 1 15  ? 51.974 46.683  19.191  1.00 51.33 ? 15   DA  P "C4'" 1 
ATOM   26   O  "O4'" . DA  A 1 15  ? 52.705 46.859  17.955  1.00 50.51 ? 15   DA  P "O4'" 1 
ATOM   27   C  "C3'" . DA  A 1 15  ? 50.649 46.020  18.813  1.00 50.63 ? 15   DA  P "C3'" 1 
ATOM   28   O  "O3'" . DA  A 1 15  ? 49.634 47.030  18.705  1.00 49.20 ? 15   DA  P "O3'" 1 
ATOM   29   C  "C2'" . DA  A 1 15  ? 50.953 45.362  17.477  1.00 49.51 ? 15   DA  P "C2'" 1 
ATOM   30   C  "C1'" . DA  A 1 15  ? 51.989 46.296  16.865  1.00 48.33 ? 15   DA  P "C1'" 1 
ATOM   31   N  N9    . DA  A 1 15  ? 52.967 45.650  15.988  1.00 46.79 ? 15   DA  P N9    1 
ATOM   32   C  C8    . DA  A 1 15  ? 53.623 44.453  16.183  1.00 45.97 ? 15   DA  P C8    1 
ATOM   33   N  N7    . DA  A 1 15  ? 54.467 44.151  15.228  1.00 45.65 ? 15   DA  P N7    1 
ATOM   34   C  C5    . DA  A 1 15  ? 54.362 45.214  14.340  1.00 46.13 ? 15   DA  P C5    1 
ATOM   35   C  C6    . DA  A 1 15  ? 55.010 45.501  13.121  1.00 45.07 ? 15   DA  P C6    1 
ATOM   36   N  N6    . DA  A 1 15  ? 55.931 44.710  12.566  1.00 43.85 ? 15   DA  P N6    1 
ATOM   37   N  N1    . DA  A 1 15  ? 54.676 46.646  12.487  1.00 44.75 ? 15   DA  P N1    1 
ATOM   38   C  C2    . DA  A 1 15  ? 53.757 47.444  13.047  1.00 45.36 ? 15   DA  P C2    1 
ATOM   39   N  N3    . DA  A 1 15  ? 53.083 47.287  14.186  1.00 45.81 ? 15   DA  P N3    1 
ATOM   40   C  C4    . DA  A 1 15  ? 53.435 46.141  14.793  1.00 45.93 ? 15   DA  P C4    1 
ATOM   41   P  P     . DG  A 1 16  ? 48.113 46.623  18.357  1.00 50.81 ? 16   DG  P P     1 
ATOM   42   O  OP1   . DG  A 1 16  ? 47.245 47.695  18.912  1.00 52.14 ? 16   DG  P OP1   1 
ATOM   43   O  OP2   . DG  A 1 16  ? 47.858 45.208  18.731  1.00 49.55 ? 16   DG  P OP2   1 
ATOM   44   O  "O5'" . DG  A 1 16  ? 48.074 46.707  16.765  1.00 48.16 ? 16   DG  P "O5'" 1 
ATOM   45   C  "C5'" . DG  A 1 16  ? 48.374 47.931  16.098  1.00 44.90 ? 16   DG  P "C5'" 1 
ATOM   46   C  "C4'" . DG  A 1 16  ? 48.144 47.802  14.609  1.00 42.42 ? 16   DG  P "C4'" 1 
ATOM   47   O  "O4'" . DG  A 1 16  ? 49.284 47.204  13.946  1.00 40.09 ? 16   DG  P "O4'" 1 
ATOM   48   C  "C3'" . DG  A 1 16  ? 46.916 46.995  14.176  1.00 41.29 ? 16   DG  P "C3'" 1 
ATOM   49   O  "O3'" . DG  A 1 16  ? 46.245 47.726  13.143  1.00 40.38 ? 16   DG  P "O3'" 1 
ATOM   50   C  "C2'" . DG  A 1 16  ? 47.520 45.694  13.660  1.00 39.57 ? 16   DG  P "C2'" 1 
ATOM   51   C  "C1'" . DG  A 1 16  ? 48.839 46.177  13.076  1.00 39.06 ? 16   DG  P "C1'" 1 
ATOM   52   N  N9    . DG  A 1 16  ? 49.917 45.195  12.943  1.00 39.53 ? 16   DG  P N9    1 
ATOM   53   C  C8    . DG  A 1 16  ? 50.171 44.108  13.748  1.00 39.26 ? 16   DG  P C8    1 
ATOM   54   N  N7    . DG  A 1 16  ? 51.222 43.426  13.371  1.00 39.40 ? 16   DG  P N7    1 
ATOM   55   C  C5    . DG  A 1 16  ? 51.688 44.096  12.249  1.00 38.61 ? 16   DG  P C5    1 
ATOM   56   C  C6    . DG  A 1 16  ? 52.805 43.822  11.403  1.00 38.33 ? 16   DG  P C6    1 
ATOM   57   O  O6    . DG  A 1 16  ? 53.619 42.899  11.472  1.00 37.80 ? 16   DG  P O6    1 
ATOM   58   N  N1    . DG  A 1 16  ? 52.919 44.763  10.389  1.00 39.82 ? 16   DG  P N1    1 
ATOM   59   C  C2    . DG  A 1 16  ? 52.071 45.826  10.198  1.00 39.93 ? 16   DG  P C2    1 
ATOM   60   N  N2    . DG  A 1 16  ? 52.352 46.621  9.158   1.00 39.62 ? 16   DG  P N2    1 
ATOM   61   N  N3    . DG  A 1 16  ? 51.026 46.088  10.968  1.00 40.44 ? 16   DG  P N3    1 
ATOM   62   C  C4    . DG  A 1 16  ? 50.895 45.190  11.968  1.00 39.39 ? 16   DG  P C4    1 
ATOM   63   P  P     . DT  A 1 17  ? 44.834 47.218  12.566  1.00 41.27 ? 17   DT  P P     1 
ATOM   64   O  OP1   . DT  A 1 17  ? 43.930 48.392  12.476  1.00 41.77 ? 17   DT  P OP1   1 
ATOM   65   O  OP2   . DT  A 1 17  ? 44.396 46.008  13.311  1.00 39.73 ? 17   DT  P OP2   1 
ATOM   66   O  "O5'" . DT  A 1 17  ? 45.207 46.800  11.079  1.00 41.02 ? 17   DT  P "O5'" 1 
ATOM   67   C  "C5'" . DT  A 1 17  ? 46.468 46.211  10.817  1.00 41.78 ? 17   DT  P "C5'" 1 
ATOM   68   C  "C4'" . DT  A 1 17  ? 46.771 46.221  9.342   1.00 40.97 ? 17   DT  P "C4'" 1 
ATOM   69   O  "O4'" . DT  A 1 17  ? 48.109 45.692  9.219   1.00 40.42 ? 17   DT  P "O4'" 1 
ATOM   70   C  "C3'" . DT  A 1 17  ? 45.862 45.318  8.509   1.00 39.46 ? 17   DT  P "C3'" 1 
ATOM   71   O  "O3'" . DT  A 1 17  ? 45.522 45.927  7.265   1.00 37.90 ? 17   DT  P "O3'" 1 
ATOM   72   C  "C2'" . DT  A 1 17  ? 46.664 44.045  8.322   1.00 38.82 ? 17   DT  P "C2'" 1 
ATOM   73   C  "C1'" . DT  A 1 17  ? 48.114 44.464  8.522   1.00 39.49 ? 17   DT  P "C1'" 1 
ATOM   74   N  N1    . DT  A 1 17  ? 48.899 43.499  9.322   1.00 38.27 ? 17   DT  P N1    1 
ATOM   75   C  C2    . DT  A 1 17  ? 50.136 43.134  8.854   1.00 37.52 ? 17   DT  P C2    1 
ATOM   76   O  O2    . DT  A 1 17  ? 50.641 43.621  7.860   1.00 37.82 ? 17   DT  P O2    1 
ATOM   77   N  N3    . DT  A 1 17  ? 50.770 42.174  9.602   1.00 38.13 ? 17   DT  P N3    1 
ATOM   78   C  C4    . DT  A 1 17  ? 50.307 41.567  10.753  1.00 37.48 ? 17   DT  P C4    1 
ATOM   79   O  O4    . DT  A 1 17  ? 50.983 40.703  11.298  1.00 37.11 ? 17   DT  P O4    1 
ATOM   80   C  C5    . DT  A 1 17  ? 49.014 42.028  11.214  1.00 38.05 ? 17   DT  P C5    1 
ATOM   81   C  C7    . DT  A 1 17  ? 48.434 41.443  12.464  1.00 38.04 ? 17   DT  P C7    1 
ATOM   82   C  C6    . DT  A 1 17  ? 48.387 42.962  10.489  1.00 36.50 ? 17   DT  P C6    1 
ATOM   83   P  P     . DG  A 1 18  ? 44.509 45.181  6.260   1.00 36.94 ? 18   DG  P P     1 
ATOM   84   O  OP1   . DG  A 1 18  ? 43.755 46.233  5.535   1.00 38.43 ? 18   DG  P OP1   1 
ATOM   85   O  OP2   . DG  A 1 18  ? 43.770 44.104  6.969   1.00 34.61 ? 18   DG  P OP2   1 
ATOM   86   O  "O5'" . DG  A 1 18  ? 45.498 44.477  5.231   1.00 35.29 ? 18   DG  P "O5'" 1 
ATOM   87   C  "C5'" . DG  A 1 18  ? 46.418 45.249  4.462   1.00 33.67 ? 18   DG  P "C5'" 1 
ATOM   88   C  "C4'" . DG  A 1 18  ? 47.242 44.343  3.580   1.00 33.90 ? 18   DG  P "C4'" 1 
ATOM   89   O  "O4'" . DG  A 1 18  ? 48.192 43.590  4.378   1.00 34.35 ? 18   DG  P "O4'" 1 
ATOM   90   C  "C3'" . DG  A 1 18  ? 46.410 43.306  2.828   1.00 34.48 ? 18   DG  P "C3'" 1 
ATOM   91   O  "O3'" . DG  A 1 18  ? 46.973 43.106  1.543   1.00 38.31 ? 18   DG  P "O3'" 1 
ATOM   92   C  "C2'" . DG  A 1 18  ? 46.592 42.046  3.653   1.00 32.94 ? 18   DG  P "C2'" 1 
ATOM   93   C  "C1'" . DG  A 1 18  ? 48.025 42.207  4.119   1.00 32.97 ? 18   DG  P "C1'" 1 
ATOM   94   N  N9    . DG  A 1 18  ? 48.377 41.466  5.324   1.00 32.17 ? 18   DG  P N9    1 
ATOM   95   C  C8    . DG  A 1 18  ? 47.641 41.338  6.479   1.00 33.78 ? 18   DG  P C8    1 
ATOM   96   N  N7    . DG  A 1 18  ? 48.208 40.566  7.365   1.00 33.12 ? 18   DG  P N7    1 
ATOM   97   C  C5    . DG  A 1 18  ? 49.395 40.172  6.764   1.00 32.66 ? 18   DG  P C5    1 
ATOM   98   C  C6    . DG  A 1 18  ? 50.424 39.321  7.237   1.00 31.70 ? 18   DG  P C6    1 
ATOM   99   O  O6    . DG  A 1 18  ? 50.488 38.721  8.308   1.00 31.38 ? 18   DG  P O6    1 
ATOM   100  N  N1    . DG  A 1 18  ? 51.453 39.194  6.307   1.00 32.89 ? 18   DG  P N1    1 
ATOM   101  C  C2    . DG  A 1 18  ? 51.482 39.801  5.076   1.00 31.65 ? 18   DG  P C2    1 
ATOM   102  N  N2    . DG  A 1 18  ? 52.557 39.557  4.322   1.00 29.08 ? 18   DG  P N2    1 
ATOM   103  N  N3    . DG  A 1 18  ? 50.524 40.589  4.618   1.00 31.92 ? 18   DG  P N3    1 
ATOM   104  C  C4    . DG  A 1 18  ? 49.519 40.730  5.509   1.00 32.22 ? 18   DG  P C4    1 
ATOM   105  P  P     . DC  A 1 19  ? 46.059 42.556  0.351   1.00 42.90 ? 19   DC  P P     1 
ATOM   106  O  OP1   . DC  A 1 19  ? 45.867 43.697  -0.573  1.00 44.08 ? 19   DC  P OP1   1 
ATOM   107  O  OP2   . DC  A 1 19  ? 44.876 41.827  0.899   1.00 40.67 ? 19   DC  P OP2   1 
ATOM   108  O  "O5'" . DC  A 1 19  ? 46.998 41.475  -0.346  1.00 42.77 ? 19   DC  P "O5'" 1 
ATOM   109  C  "C5'" . DC  A 1 19  ? 48.333 41.798  -0.723  1.00 38.44 ? 19   DC  P "C5'" 1 
ATOM   110  C  "C4'" . DC  A 1 19  ? 49.118 40.534  -0.978  1.00 35.75 ? 19   DC  P "C4'" 1 
ATOM   111  O  "O4'" . DC  A 1 19  ? 49.805 40.184  0.248   1.00 35.18 ? 19   DC  P "O4'" 1 
ATOM   112  C  "C3'" . DC  A 1 19  ? 48.221 39.344  -1.316  1.00 34.15 ? 19   DC  P "C3'" 1 
ATOM   113  O  "O3'" . DC  A 1 19  ? 48.261 38.874  -2.640  1.00 31.37 ? 19   DC  P "O3'" 1 
ATOM   114  C  "C2'" . DC  A 1 19  ? 48.687 38.215  -0.427  1.00 34.02 ? 19   DC  P "C2'" 1 
ATOM   115  C  "C1'" . DC  A 1 19  ? 49.780 38.777  0.451   1.00 33.44 ? 19   DC  P "C1'" 1 
ATOM   116  N  N1    . DC  A 1 19  ? 49.364 38.504  1.835   1.00 30.45 ? 19   DC  P N1    1 
ATOM   117  C  C2    . DC  A 1 19  ? 50.060 37.547  2.568   1.00 30.01 ? 19   DC  P C2    1 
ATOM   118  O  O2    . DC  A 1 19  ? 51.059 37.018  2.061   1.00 29.10 ? 19   DC  P O2    1 
ATOM   119  N  N3    . DC  A 1 19  ? 49.616 37.210  3.802   1.00 30.51 ? 19   DC  P N3    1 
ATOM   120  C  C4    . DC  A 1 19  ? 48.519 37.792  4.301   1.00 30.71 ? 19   DC  P C4    1 
ATOM   121  N  N4    . DC  A 1 19  ? 48.098 37.415  5.510   1.00 27.86 ? 19   DC  P N4    1 
ATOM   122  C  C5    . DC  A 1 19  ? 47.804 38.787  3.582   1.00 31.36 ? 19   DC  P C5    1 
ATOM   123  C  C6    . DC  A 1 19  ? 48.267 39.124  2.373   1.00 32.22 ? 19   DC  P C6    1 
ATOM   124  P  P     . DC  A 1 20  ? 47.125 37.839  -3.108  1.00 30.12 ? 20   DC  P P     1 
ATOM   125  O  OP1   . DC  A 1 20  ? 46.912 38.028  -4.569  1.00 33.51 ? 20   DC  P OP1   1 
ATOM   126  O  OP2   . DC  A 1 20  ? 45.978 37.966  -2.182  1.00 28.27 ? 20   DC  P OP2   1 
ATOM   127  O  "O5'" . DC  A 1 20  ? 47.773 36.404  -2.818  1.00 31.16 ? 20   DC  P "O5'" 1 
ATOM   128  C  "C5'" . DC  A 1 20  ? 48.985 35.999  -3.457  1.00 28.82 ? 20   DC  P "C5'" 1 
ATOM   129  C  "C4'" . DC  A 1 20  ? 49.529 34.727  -2.828  1.00 27.92 ? 20   DC  P "C4'" 1 
ATOM   130  O  "O4'" . DC  A 1 20  ? 49.861 34.973  -1.440  1.00 27.17 ? 20   DC  P "O4'" 1 
ATOM   131  C  "C3'" . DC  A 1 20  ? 48.602 33.520  -2.792  1.00 27.94 ? 20   DC  P "C3'" 1 
ATOM   132  O  "O3'" . DC  A 1 20  ? 48.699 32.794  -4.009  1.00 27.64 ? 20   DC  P "O3'" 1 
ATOM   133  C  "C2'" . DC  A 1 20  ? 49.163 32.696  -1.637  1.00 25.80 ? 20   DC  P "C2'" 1 
ATOM   134  C  "C1'" . DC  A 1 20  ? 49.691 33.783  -0.695  1.00 26.93 ? 20   DC  P "C1'" 1 
ATOM   135  N  N1    . DC  A 1 20  ? 48.808 34.063  0.449   1.00 29.15 ? 20   DC  P N1    1 
ATOM   136  C  C2    . DC  A 1 20  ? 48.910 33.257  1.587   1.00 27.42 ? 20   DC  P C2    1 
ATOM   137  O  O2    . DC  A 1 20  ? 49.719 32.325  1.590   1.00 26.93 ? 20   DC  P O2    1 
ATOM   138  N  N3    . DC  A 1 20  ? 48.126 33.517  2.654   1.00 30.37 ? 20   DC  P N3    1 
ATOM   139  C  C4    . DC  A 1 20  ? 47.260 34.533  2.615   1.00 31.35 ? 20   DC  P C4    1 
ATOM   140  N  N4    . DC  A 1 20  ? 46.515 34.757  3.699   1.00 33.54 ? 20   DC  P N4    1 
ATOM   141  C  C5    . DC  A 1 20  ? 47.123 35.363  1.466   1.00 30.69 ? 20   DC  P C5    1 
ATOM   142  C  C6    . DC  A 1 20  ? 47.908 35.095  0.414   1.00 30.71 ? 20   DC  P C6    1 
HETATM 143  P  P     . 2DT A 1 21  ? 47.413 32.023  -4.583  1.00 31.52 ? 21   2DT P P     1 
HETATM 144  O  OP1   . 2DT A 1 21  ? 47.642 31.787  -6.032  1.00 32.51 ? 21   2DT P OP1   1 
HETATM 145  O  OP2   . 2DT A 1 21  ? 46.205 32.770  -4.146  1.00 32.15 ? 21   2DT P OP2   1 
HETATM 146  O  "O5'" . 2DT A 1 21  ? 47.404 30.622  -3.815  1.00 29.50 ? 21   2DT P "O5'" 1 
HETATM 147  N  N1    . 2DT A 1 21  ? 47.000 29.440  -0.037  1.00 29.05 ? 21   2DT P N1    1 
HETATM 148  C  C6    . 2DT A 1 21  ? 46.437 30.498  -0.722  1.00 29.35 ? 21   2DT P C6    1 
HETATM 149  C  C2    . 2DT A 1 21  ? 46.878 29.331  1.334   1.00 29.61 ? 21   2DT P C2    1 
HETATM 150  O  O2    . 2DT A 1 21  ? 47.323 28.390  1.974   1.00 30.56 ? 21   2DT P O2    1 
HETATM 151  N  N3    . 2DT A 1 21  ? 46.206 30.365  1.933   1.00 28.76 ? 21   2DT P N3    1 
HETATM 152  C  C4    . 2DT A 1 21  ? 45.637 31.462  1.318   1.00 29.75 ? 21   2DT P C4    1 
HETATM 153  O  O4    . 2DT A 1 21  ? 45.082 32.323  2.000   1.00 32.08 ? 21   2DT P O4    1 
HETATM 154  C  C5    . 2DT A 1 21  ? 45.762 31.493  -0.127  1.00 29.80 ? 21   2DT P C5    1 
HETATM 155  C  C5M   . 2DT A 1 21  ? 45.131 32.617  -0.891  1.00 28.17 ? 21   2DT P C5M   1 
HETATM 156  C  "C2'" . 2DT A 1 21  ? 46.902 27.355  -1.473  1.00 26.64 ? 21   2DT P "C2'" 1 
HETATM 157  C  "C5'" . 2DT A 1 21  ? 48.409 29.635  -4.047  1.00 27.11 ? 21   2DT P "C5'" 1 
HETATM 158  C  "C4'" . 2DT A 1 21  ? 48.282 28.509  -3.037  1.00 26.87 ? 21   2DT P "C4'" 1 
HETATM 159  O  "O4'" . 2DT A 1 21  ? 48.602 29.013  -1.714  1.00 27.66 ? 21   2DT P "O4'" 1 
HETATM 160  C  "C1'" . 2DT A 1 21  ? 47.768 28.389  -0.748  1.00 28.42 ? 21   2DT P "C1'" 1 
HETATM 161  C  "C3'" . 2DT A 1 21  ? 46.891 27.899  -2.899  1.00 27.13 ? 21   2DT P "C3'" 1 
ATOM   162  P  P     . DA  B 2 5   ? 43.029 30.797  12.630  1.00 66.29 ? 6    DA  T P     1 
ATOM   163  O  OP1   . DA  B 2 5   ? 42.155 31.828  11.920  1.00 65.50 ? 6    DA  T OP1   1 
ATOM   164  O  OP2   . DA  B 2 5   ? 44.488 31.228  12.698  1.00 65.69 ? 6    DA  T OP2   1 
ATOM   165  O  "O5'" . DA  B 2 5   ? 43.001 29.468  11.683  1.00 62.77 ? 6    DA  T "O5'" 1 
ATOM   166  C  "C5'" . DA  B 2 5   ? 43.134 28.146  12.239  1.00 58.41 ? 6    DA  T "C5'" 1 
ATOM   167  C  "C4'" . DA  B 2 5   ? 43.937 27.267  11.304  1.00 56.37 ? 6    DA  T "C4'" 1 
ATOM   168  O  "O4'" . DA  B 2 5   ? 43.406 27.395  9.955   1.00 54.87 ? 6    DA  T "O4'" 1 
ATOM   169  C  "C3'" . DA  B 2 5   ? 45.410 27.641  11.180  1.00 54.73 ? 6    DA  T "C3'" 1 
ATOM   170  O  "O3'" . DA  B 2 5   ? 46.180 26.996  12.194  1.00 52.53 ? 6    DA  T "O3'" 1 
ATOM   171  C  "C2'" . DA  B 2 5   ? 45.764 27.129  9.790   1.00 54.28 ? 6    DA  T "C2'" 1 
ATOM   172  C  "C1'" . DA  B 2 5   ? 44.473 27.419  9.019   1.00 54.52 ? 6    DA  T "C1'" 1 
ATOM   173  N  N9    . DA  B 2 5   ? 44.467 28.718  8.339   1.00 52.79 ? 6    DA  T N9    1 
ATOM   174  C  C8    . DA  B 2 5   ? 43.975 29.914  8.807   1.00 52.98 ? 6    DA  T C8    1 
ATOM   175  N  N7    . DA  B 2 5   ? 44.083 30.902  7.951   1.00 52.77 ? 6    DA  T N7    1 
ATOM   176  C  C5    . DA  B 2 5   ? 44.689 30.323  6.847   1.00 51.46 ? 6    DA  T C5    1 
ATOM   177  C  C6    . DA  B 2 5   ? 45.064 30.840  5.593   1.00 51.08 ? 6    DA  T C6    1 
ATOM   178  N  N6    . DA  B 2 5   ? 44.850 32.104  5.214   1.00 49.55 ? 6    DA  T N6    1 
ATOM   179  N  N1    . DA  B 2 5   ? 45.665 29.999  4.723   1.00 50.62 ? 6    DA  T N1    1 
ATOM   180  C  C2    . DA  B 2 5   ? 45.856 28.726  5.090   1.00 51.32 ? 6    DA  T C2    1 
ATOM   181  N  N3    . DA  B 2 5   ? 45.534 28.119  6.230   1.00 51.73 ? 6    DA  T N3    1 
ATOM   182  C  C4    . DA  B 2 5   ? 44.947 28.982  7.077   1.00 52.16 ? 6    DA  T C4    1 
ATOM   183  P  P     . DG  B 2 6   ? 47.566 27.654  12.687  1.00 51.49 ? 7    DG  T P     1 
ATOM   184  O  OP1   . DG  B 2 6   ? 48.068 26.850  13.833  1.00 51.17 ? 7    DG  T OP1   1 
ATOM   185  O  OP2   . DG  B 2 6   ? 47.372 29.122  12.847  1.00 52.54 ? 7    DG  T OP2   1 
ATOM   186  O  "O5'" . DG  B 2 6   ? 48.548 27.437  11.453  1.00 49.43 ? 7    DG  T "O5'" 1 
ATOM   187  C  "C5'" . DG  B 2 6   ? 48.828 26.129  10.956  1.00 45.39 ? 7    DG  T "C5'" 1 
ATOM   188  C  "C4'" . DG  B 2 6   ? 49.605 26.226  9.667   1.00 43.92 ? 7    DG  T "C4'" 1 
ATOM   189  O  "O4'" . DG  B 2 6   ? 48.764 26.829  8.647   1.00 43.10 ? 7    DG  T "O4'" 1 
ATOM   190  C  "C3'" . DG  B 2 6   ? 50.828 27.131  9.726   1.00 42.41 ? 7    DG  T "C3'" 1 
ATOM   191  O  "O3'" . DG  B 2 6   ? 51.949 26.425  10.241  1.00 39.04 ? 7    DG  T "O3'" 1 
ATOM   192  C  "C2'" . DG  B 2 6   ? 51.016 27.515  8.264   1.00 43.32 ? 7    DG  T "C2'" 1 
ATOM   193  C  "C1'" . DG  B 2 6   ? 49.565 27.620  7.786   1.00 42.98 ? 7    DG  T "C1'" 1 
ATOM   194  N  N9    . DG  B 2 6   ? 49.031 28.981  7.749   1.00 41.72 ? 7    DG  T N9    1 
ATOM   195  C  C8    . DG  B 2 6   ? 48.392 29.676  8.751   1.00 42.08 ? 7    DG  T C8    1 
ATOM   196  N  N7    . DG  B 2 6   ? 47.993 30.867  8.376   1.00 42.39 ? 7    DG  T N7    1 
ATOM   197  C  C5    . DG  B 2 6   ? 48.403 30.965  7.049   1.00 40.98 ? 7    DG  T C5    1 
ATOM   198  C  C6    . DG  B 2 6   ? 48.241 32.019  6.096   1.00 40.37 ? 7    DG  T C6    1 
ATOM   199  O  O6    . DG  B 2 6   ? 47.663 33.107  6.228   1.00 40.68 ? 7    DG  T O6    1 
ATOM   200  N  N1    . DG  B 2 6   ? 48.831 31.698  4.879   1.00 37.51 ? 7    DG  T N1    1 
ATOM   201  C  C2    . DG  B 2 6   ? 49.478 30.523  4.603   1.00 37.18 ? 7    DG  T C2    1 
ATOM   202  N  N2    . DG  B 2 6   ? 49.997 30.402  3.382   1.00 35.21 ? 7    DG  T N2    1 
ATOM   203  N  N3    . DG  B 2 6   ? 49.612 29.534  5.464   1.00 38.99 ? 7    DG  T N3    1 
ATOM   204  C  C4    . DG  B 2 6   ? 49.060 29.819  6.656   1.00 40.64 ? 7    DG  T C4    1 
ATOM   205  P  P     . DG  B 2 7   ? 53.222 27.238  10.790  1.00 35.84 ? 8    DG  T P     1 
ATOM   206  O  OP1   . DG  B 2 7   ? 54.197 26.236  11.298  1.00 37.38 ? 8    DG  T OP1   1 
ATOM   207  O  OP2   . DG  B 2 7   ? 52.762 28.335  11.682  1.00 35.87 ? 8    DG  T OP2   1 
ATOM   208  O  "O5'" . DG  B 2 7   ? 53.824 27.891  9.471   1.00 37.90 ? 8    DG  T "O5'" 1 
ATOM   209  C  "C5'" . DG  B 2 7   ? 54.285 29.237  9.450   1.00 33.51 ? 8    DG  T "C5'" 1 
ATOM   210  C  "C4'" . DG  B 2 7   ? 54.651 29.619  8.038   1.00 33.41 ? 8    DG  T "C4'" 1 
ATOM   211  O  "O4'" . DG  B 2 7   ? 53.412 29.856  7.322   1.00 33.67 ? 8    DG  T "O4'" 1 
ATOM   212  C  "C3'" . DG  B 2 7   ? 55.449 30.911  7.939   1.00 31.60 ? 8    DG  T "C3'" 1 
ATOM   213  O  "O3'" . DG  B 2 7   ? 56.793 30.713  7.555   1.00 29.54 ? 8    DG  T "O3'" 1 
ATOM   214  C  "C2'" . DG  B 2 7   ? 54.766 31.738  6.871   1.00 32.44 ? 8    DG  T "C2'" 1 
ATOM   215  C  "C1'" . DG  B 2 7   ? 53.502 31.007  6.490   1.00 33.42 ? 8    DG  T "C1'" 1 
ATOM   216  N  N9    . DG  B 2 7   ? 52.417 31.918  6.844   1.00 34.13 ? 8    DG  T N9    1 
ATOM   217  C  C8    . DG  B 2 7   ? 51.792 32.038  8.064   1.00 33.38 ? 8    DG  T C8    1 
ATOM   218  N  N7    . DG  B 2 7   ? 50.979 33.057  8.122   1.00 34.50 ? 8    DG  T N7    1 
ATOM   219  C  C5    . DG  B 2 7   ? 51.041 33.621  6.854   1.00 33.67 ? 8    DG  T C5    1 
ATOM   220  C  C6    . DG  B 2 7   ? 50.381 34.757  6.318   1.00 33.82 ? 8    DG  T C6    1 
ATOM   221  O  O6    . DG  B 2 7   ? 49.588 35.521  6.874   1.00 33.10 ? 8    DG  T O6    1 
ATOM   222  N  N1    . DG  B 2 7   ? 50.727 34.966  4.987   1.00 32.59 ? 8    DG  T N1    1 
ATOM   223  C  C2    . DG  B 2 7   ? 51.587 34.180  4.263   1.00 33.52 ? 8    DG  T C2    1 
ATOM   224  N  N2    . DG  B 2 7   ? 51.780 34.530  2.978   1.00 32.96 ? 8    DG  T N2    1 
ATOM   225  N  N3    . DG  B 2 7   ? 52.210 33.125  4.754   1.00 32.83 ? 8    DG  T N3    1 
ATOM   226  C  C4    . DG  B 2 7   ? 51.895 32.907  6.044   1.00 33.28 ? 8    DG  T C4    1 
ATOM   227  P  P     . DC  B 2 8   ? 57.873 31.815  7.965   1.00 28.28 ? 9    DC  T P     1 
ATOM   228  O  OP1   . DC  B 2 8   ? 59.211 31.212  7.783   1.00 31.25 ? 9    DC  T OP1   1 
ATOM   229  O  OP2   . DC  B 2 8   ? 57.495 32.377  9.286   1.00 28.86 ? 9    DC  T OP2   1 
ATOM   230  O  "O5'" . DC  B 2 8   ? 57.667 32.961  6.879   1.00 26.98 ? 9    DC  T "O5'" 1 
ATOM   231  C  "C5'" . DC  B 2 8   ? 57.740 32.656  5.491   1.00 26.41 ? 9    DC  T "C5'" 1 
ATOM   232  C  "C4'" . DC  B 2 8   ? 57.736 33.924  4.672   1.00 26.15 ? 9    DC  T "C4'" 1 
ATOM   233  O  "O4'" . DC  B 2 8   ? 56.437 34.551  4.738   1.00 27.47 ? 9    DC  T "O4'" 1 
ATOM   234  C  "C3'" . DC  B 2 8   ? 58.748 34.981  5.097   1.00 25.79 ? 9    DC  T "C3'" 1 
ATOM   235  O  "O3'" . DC  B 2 8   ? 59.350 35.534  3.923   1.00 24.61 ? 9    DC  T "O3'" 1 
ATOM   236  C  "C2'" . DC  B 2 8   ? 57.915 35.985  5.883   1.00 25.65 ? 9    DC  T "C2'" 1 
ATOM   237  C  "C1'" . DC  B 2 8   ? 56.521 35.855  5.284   1.00 26.93 ? 9    DC  T "C1'" 1 
ATOM   238  N  N1    . DC  B 2 8   ? 55.399 36.000  6.240   1.00 29.91 ? 9    DC  T N1    1 
ATOM   239  C  C2    . DC  B 2 8   ? 54.427 36.989  6.008   1.00 29.23 ? 9    DC  T C2    1 
ATOM   240  O  O2    . DC  B 2 8   ? 54.533 37.718  5.010   1.00 29.38 ? 9    DC  T O2    1 
ATOM   241  N  N3    . DC  B 2 8   ? 53.395 37.119  6.874   1.00 28.96 ? 9    DC  T N3    1 
ATOM   242  C  C4    . DC  B 2 8   ? 53.304 36.310  7.934   1.00 29.56 ? 9    DC  T C4    1 
ATOM   243  N  N4    . DC  B 2 8   ? 52.265 36.478  8.761   1.00 28.64 ? 9    DC  T N4    1 
ATOM   244  C  C5    . DC  B 2 8   ? 54.272 35.293  8.195   1.00 28.08 ? 9    DC  T C5    1 
ATOM   245  C  C6    . DC  B 2 8   ? 55.295 35.177  7.334   1.00 30.04 ? 9    DC  T C6    1 
ATOM   246  P  P     . DA  B 2 9   ? 60.522 36.617  4.054   1.00 25.46 ? 10   DA  T P     1 
ATOM   247  O  OP1   . DA  B 2 9   ? 61.236 36.658  2.754   1.00 24.66 ? 10   DA  T OP1   1 
ATOM   248  O  OP2   . DA  B 2 9   ? 61.287 36.381  5.292   1.00 25.93 ? 10   DA  T OP2   1 
ATOM   249  O  "O5'" . DA  B 2 9   ? 59.715 37.976  4.218   1.00 26.65 ? 10   DA  T "O5'" 1 
ATOM   250  C  "C5'" . DA  B 2 9   ? 58.846 38.413  3.178   1.00 28.55 ? 10   DA  T "C5'" 1 
ATOM   251  C  "C4'" . DA  B 2 9   ? 58.249 39.758  3.513   1.00 30.12 ? 10   DA  T "C4'" 1 
ATOM   252  O  "O4'" . DA  B 2 9   ? 57.131 39.642  4.428   1.00 30.73 ? 10   DA  T "O4'" 1 
ATOM   253  C  "C3'" . DA  B 2 9   ? 59.214 40.761  4.142   1.00 30.01 ? 10   DA  T "C3'" 1 
ATOM   254  O  "O3'" . DA  B 2 9   ? 58.927 42.024  3.572   1.00 29.98 ? 10   DA  T "O3'" 1 
ATOM   255  C  "C2'" . DA  B 2 9   ? 58.790 40.773  5.601   1.00 27.97 ? 10   DA  T "C2'" 1 
ATOM   256  C  "C1'" . DA  B 2 9   ? 57.290 40.598  5.454   1.00 29.04 ? 10   DA  T "C1'" 1 
ATOM   257  N  N9    . DA  B 2 9   ? 56.566 40.127  6.635   1.00 29.69 ? 10   DA  T N9    1 
ATOM   258  C  C8    . DA  B 2 9   ? 56.924 39.165  7.546   1.00 29.97 ? 10   DA  T C8    1 
ATOM   259  N  N7    . DA  B 2 9   ? 56.042 38.984  8.495   1.00 31.71 ? 10   DA  T N7    1 
ATOM   260  C  C5    . DA  B 2 9   ? 55.035 39.891  8.194   1.00 31.49 ? 10   DA  T C5    1 
ATOM   261  C  C6    . DA  B 2 9   ? 53.811 40.199  8.825   1.00 31.06 ? 10   DA  T C6    1 
ATOM   262  N  N6    . DA  B 2 9   ? 53.369 39.586  9.929   1.00 30.09 ? 10   DA  T N6    1 
ATOM   263  N  N1    . DA  B 2 9   ? 53.044 41.163  8.271   1.00 30.53 ? 10   DA  T N1    1 
ATOM   264  C  C2    . DA  B 2 9   ? 53.476 41.761  7.153   1.00 32.43 ? 10   DA  T C2    1 
ATOM   265  N  N3    . DA  B 2 9   ? 54.599 41.557  6.466   1.00 31.06 ? 10   DA  T N3    1 
ATOM   266  C  C4    . DA  B 2 9   ? 55.344 40.600  7.048   1.00 30.64 ? 10   DA  T C4    1 
ATOM   267  P  P     . DC  B 2 10  ? 60.086 43.107  3.372   1.00 28.99 ? 11   DC  T P     1 
ATOM   268  O  OP1   . DC  B 2 10  ? 60.707 42.887  2.041   1.00 32.19 ? 11   DC  T OP1   1 
ATOM   269  O  OP2   . DC  B 2 10  ? 60.942 43.181  4.571   1.00 30.13 ? 11   DC  T OP2   1 
ATOM   270  O  "O5'" . DC  B 2 10  ? 59.223 44.427  3.284   1.00 31.87 ? 11   DC  T "O5'" 1 
ATOM   271  C  "C5'" . DC  B 2 10  ? 58.066 44.467  2.449   1.00 34.72 ? 11   DC  T "C5'" 1 
ATOM   272  C  "C4'" . DC  B 2 10  ? 57.114 45.525  2.943   1.00 37.47 ? 11   DC  T "C4'" 1 
ATOM   273  O  "O4'" . DC  B 2 10  ? 56.287 44.996  4.012   1.00 36.53 ? 11   DC  T "O4'" 1 
ATOM   274  C  "C3'" . DC  B 2 10  ? 57.864 46.729  3.511   1.00 38.38 ? 11   DC  T "C3'" 1 
ATOM   275  O  "O3'" . DC  B 2 10  ? 57.431 47.954  2.945   1.00 40.22 ? 11   DC  T "O3'" 1 
ATOM   276  C  "C2'" . DC  B 2 10  ? 57.627 46.663  5.007   1.00 38.52 ? 11   DC  T "C2'" 1 
ATOM   277  C  "C1'" . DC  B 2 10  ? 56.344 45.850  5.143   1.00 38.74 ? 11   DC  T "C1'" 1 
ATOM   278  N  N1    . DC  B 2 10  ? 56.313 45.011  6.362   1.00 36.92 ? 11   DC  T N1    1 
ATOM   279  C  C2    . DC  B 2 10  ? 55.256 45.179  7.278   1.00 37.67 ? 11   DC  T C2    1 
ATOM   280  O  O2    . DC  B 2 10  ? 54.343 45.979  7.012   1.00 38.08 ? 11   DC  T O2    1 
ATOM   281  N  N3    . DC  B 2 10  ? 55.257 44.460  8.425   1.00 37.00 ? 11   DC  T N3    1 
ATOM   282  C  C4    . DC  B 2 10  ? 56.241 43.589  8.668   1.00 36.49 ? 11   DC  T C4    1 
ATOM   283  N  N4    . DC  B 2 10  ? 56.198 42.907  9.813   1.00 35.77 ? 11   DC  T N4    1 
ATOM   284  C  C5    . DC  B 2 10  ? 57.311 43.379  7.746   1.00 34.64 ? 11   DC  T C5    1 
ATOM   285  C  C6    . DC  B 2 10  ? 57.306 44.101  6.616   1.00 36.03 ? 11   DC  T C6    1 
ATOM   286  P  P     . DT  B 2 11  ? 58.347 49.259  3.112   1.00 41.03 ? 12   DT  T P     1 
ATOM   287  O  OP1   . DT  B 2 11  ? 58.323 50.024  1.839   1.00 44.73 ? 12   DT  T OP1   1 
ATOM   288  O  OP2   . DT  B 2 11  ? 59.653 48.867  3.701   1.00 40.27 ? 12   DT  T OP2   1 
ATOM   289  O  "O5'" . DT  B 2 11  ? 57.528 50.080  4.200   1.00 42.96 ? 12   DT  T "O5'" 1 
ATOM   290  C  "C5'" . DT  B 2 11  ? 56.123 50.275  4.033   1.00 40.78 ? 12   DT  T "C5'" 1 
ATOM   291  C  "C4'" . DT  B 2 11  ? 55.520 50.870  5.282   1.00 40.86 ? 12   DT  T "C4'" 1 
ATOM   292  O  "O4'" . DT  B 2 11  ? 55.330 49.855  6.304   1.00 40.60 ? 12   DT  T "O4'" 1 
ATOM   293  C  "C3'" . DT  B 2 11  ? 56.361 51.983  5.910   1.00 41.19 ? 12   DT  T "C3'" 1 
ATOM   294  O  "O3'" . DT  B 2 11  ? 55.537 53.114  6.212   1.00 38.51 ? 12   DT  T "O3'" 1 
ATOM   295  C  "C2'" . DT  B 2 11  ? 56.930 51.342  7.167   1.00 41.52 ? 12   DT  T "C2'" 1 
ATOM   296  C  "C1'" . DT  B 2 11  ? 55.871 50.309  7.539   1.00 42.87 ? 12   DT  T "C1'" 1 
ATOM   297  N  N1    . DT  B 2 11  ? 56.380 49.125  8.293   1.00 43.29 ? 12   DT  T N1    1 
ATOM   298  C  C2    . DT  B 2 11  ? 55.654 48.654  9.378   1.00 43.22 ? 12   DT  T C2    1 
ATOM   299  O  O2    . DT  B 2 11  ? 54.601 49.143  9.752   1.00 41.74 ? 12   DT  T O2    1 
ATOM   300  N  N3    . DT  B 2 11  ? 56.213 47.568  10.013  1.00 43.18 ? 12   DT  T N3    1 
ATOM   301  C  C4    . DT  B 2 11  ? 57.385 46.918  9.681   1.00 43.90 ? 12   DT  T C4    1 
ATOM   302  O  O4    . DT  B 2 11  ? 57.753 45.949  10.341  1.00 45.26 ? 12   DT  T O4    1 
ATOM   303  C  C5    . DT  B 2 11  ? 58.090 47.464  8.539   1.00 44.24 ? 12   DT  T C5    1 
ATOM   304  C  C7    . DT  B 2 11  ? 59.379 46.837  8.107   1.00 44.70 ? 12   DT  T C7    1 
ATOM   305  C  C6    . DT  B 2 11  ? 57.556 48.518  7.912   1.00 43.37 ? 12   DT  T C6    1 
ATOM   306  P  P     . DG  B 2 12  ? 56.189 54.441  6.854   1.00 38.86 ? 13   DG  T P     1 
ATOM   307  O  OP1   . DG  B 2 12  ? 55.647 55.597  6.089   1.00 39.02 ? 13   DG  T OP1   1 
ATOM   308  O  OP2   . DG  B 2 12  ? 57.660 54.285  7.000   1.00 36.48 ? 13   DG  T OP2   1 
ATOM   309  O  "O5'" . DG  B 2 12  ? 55.570 54.452  8.322   1.00 37.31 ? 13   DG  T "O5'" 1 
ATOM   310  C  "C5'" . DG  B 2 12  ? 54.174 54.225  8.526   1.00 36.62 ? 13   DG  T "C5'" 1 
ATOM   311  C  "C4'" . DG  B 2 12  ? 53.862 54.140  10.002  1.00 38.10 ? 13   DG  T "C4'" 1 
ATOM   312  O  "O4'" . DG  B 2 12  ? 54.383 52.908  10.564  1.00 36.58 ? 13   DG  T "O4'" 1 
ATOM   313  C  "C3'" . DG  B 2 12  ? 54.455 55.276  10.834  1.00 37.16 ? 13   DG  T "C3'" 1 
ATOM   314  O  "O3'" . DG  B 2 12  ? 53.506 55.701  11.819  1.00 39.68 ? 13   DG  T "O3'" 1 
ATOM   315  C  "C2'" . DG  B 2 12  ? 55.692 54.650  11.457  1.00 37.11 ? 13   DG  T "C2'" 1 
ATOM   316  C  "C1'" . DG  B 2 12  ? 55.282 53.197  11.631  1.00 37.98 ? 13   DG  T "C1'" 1 
ATOM   317  N  N9    . DG  B 2 12  ? 56.368 52.221  11.569  1.00 40.90 ? 13   DG  T N9    1 
ATOM   318  C  C8    . DG  B 2 12  ? 57.395 52.165  10.652  1.00 42.11 ? 13   DG  T C8    1 
ATOM   319  N  N7    . DG  B 2 12  ? 58.165 51.121  10.807  1.00 43.58 ? 13   DG  T N7    1 
ATOM   320  C  C5    . DG  B 2 12  ? 57.623 50.454  11.900  1.00 43.66 ? 13   DG  T C5    1 
ATOM   321  C  C6    . DG  B 2 12  ? 58.014 49.238  12.522  1.00 43.62 ? 13   DG  T C6    1 
ATOM   322  O  O6    . DG  B 2 12  ? 58.931 48.469  12.206  1.00 45.27 ? 13   DG  T O6    1 
ATOM   323  N  N1    . DG  B 2 12  ? 57.204 48.940  13.613  1.00 42.84 ? 13   DG  T N1    1 
ATOM   324  C  C2    . DG  B 2 12  ? 56.147 49.704  14.044  1.00 43.34 ? 13   DG  T C2    1 
ATOM   325  N  N2    . DG  B 2 12  ? 55.490 49.257  15.125  1.00 41.44 ? 13   DG  T N2    1 
ATOM   326  N  N3    . DG  B 2 12  ? 55.761 50.827  13.460  1.00 42.45 ? 13   DG  T N3    1 
ATOM   327  C  C4    . DG  B 2 12  ? 56.535 51.138  12.401  1.00 41.83 ? 13   DG  T C4    1 
ATOM   328  P  P     . DG  B 2 13  ? 53.802 57.008  12.710  1.00 39.57 ? 14   DG  T P     1 
ATOM   329  O  OP1   . DG  B 2 13  ? 52.505 57.644  13.042  1.00 40.01 ? 14   DG  T OP1   1 
ATOM   330  O  OP2   . DG  B 2 13  ? 54.869 57.812  12.050  1.00 37.83 ? 14   DG  T OP2   1 
ATOM   331  O  "O5'" . DG  B 2 13  ? 54.415 56.393  14.044  1.00 43.49 ? 14   DG  T "O5'" 1 
ATOM   332  C  "C5'" . DG  B 2 13  ? 53.628 55.549  14.882  1.00 46.97 ? 14   DG  T "C5'" 1 
ATOM   333  C  "C4'" . DG  B 2 13  ? 54.452 55.042  16.043  1.00 50.69 ? 14   DG  T "C4'" 1 
ATOM   334  O  "O4'" . DG  B 2 13  ? 55.380 54.015  15.611  1.00 50.67 ? 14   DG  T "O4'" 1 
ATOM   335  C  "C3'" . DG  B 2 13  ? 55.291 56.099  16.769  1.00 52.36 ? 14   DG  T "C3'" 1 
ATOM   336  O  "O3'" . DG  B 2 13  ? 55.212 55.876  18.178  1.00 57.06 ? 14   DG  T "O3'" 1 
ATOM   337  C  "C2'" . DG  B 2 13  ? 56.703 55.815  16.285  1.00 52.23 ? 14   DG  T "C2'" 1 
ATOM   338  C  "C1'" . DG  B 2 13  ? 56.663 54.305  16.135  1.00 51.43 ? 14   DG  T "C1'" 1 
ATOM   339  N  N9    . DG  B 2 13  ? 57.670 53.701  15.264  1.00 51.01 ? 14   DG  T N9    1 
ATOM   340  C  C8    . DG  B 2 13  ? 58.226 54.226  14.120  1.00 51.75 ? 14   DG  T C8    1 
ATOM   341  N  N7    . DG  B 2 13  ? 59.128 53.445  13.584  1.00 51.85 ? 14   DG  T N7    1 
ATOM   342  C  C5    . DG  B 2 13  ? 59.162 52.335  14.419  1.00 51.34 ? 14   DG  T C5    1 
ATOM   343  C  C6    . DG  B 2 13  ? 59.949 51.149  14.351  1.00 52.52 ? 14   DG  T C6    1 
ATOM   344  O  O6    . DG  B 2 13  ? 60.804 50.833  13.510  1.00 52.80 ? 14   DG  T O6    1 
ATOM   345  N  N1    . DG  B 2 13  ? 59.662 50.286  15.403  1.00 51.26 ? 14   DG  T N1    1 
ATOM   346  C  C2    . DG  B 2 13  ? 58.744 50.527  16.395  1.00 51.03 ? 14   DG  T C2    1 
ATOM   347  N  N2    . DG  B 2 13  ? 58.616 49.575  17.330  1.00 51.04 ? 14   DG  T N2    1 
ATOM   348  N  N3    . DG  B 2 13  ? 58.006 51.621  16.469  1.00 51.22 ? 14   DG  T N3    1 
ATOM   349  C  C4    . DG  B 2 13  ? 58.266 52.476  15.457  1.00 50.89 ? 14   DG  T C4    1 
ATOM   350  P  P     . DC  B 2 14  ? 55.660 57.030  19.206  1.00 58.81 ? 15   DC  T P     1 
ATOM   351  O  OP1   . DC  B 2 14  ? 54.431 57.500  19.898  1.00 57.93 ? 15   DC  T OP1   1 
ATOM   352  O  OP2   . DC  B 2 14  ? 56.529 58.009  18.495  1.00 58.61 ? 15   DC  T OP2   1 
ATOM   353  O  "O5'" . DC  B 2 14  ? 56.573 56.249  20.257  1.00 60.31 ? 15   DC  T "O5'" 1 
ATOM   354  C  "C5'" . DC  B 2 14  ? 56.074 55.096  20.944  1.00 60.51 ? 15   DC  T "C5'" 1 
ATOM   355  C  "C4'" . DC  B 2 14  ? 57.210 54.216  21.420  1.00 60.50 ? 15   DC  T "C4'" 1 
ATOM   356  O  "O4'" . DC  B 2 14  ? 57.886 53.611  20.286  1.00 60.02 ? 15   DC  T "O4'" 1 
ATOM   357  C  "C3'" . DC  B 2 14  ? 58.294 54.916  22.249  1.00 60.81 ? 15   DC  T "C3'" 1 
ATOM   358  O  "O3'" . DC  B 2 14  ? 58.665 54.111  23.380  1.00 61.29 ? 15   DC  T "O3'" 1 
ATOM   359  C  "C2'" . DC  B 2 14  ? 59.461 55.025  21.284  1.00 60.02 ? 15   DC  T "C2'" 1 
ATOM   360  C  "C1'" . DC  B 2 14  ? 59.288 53.768  20.445  1.00 59.75 ? 15   DC  T "C1'" 1 
ATOM   361  N  N1    . DC  B 2 14  ? 59.915 53.796  19.106  1.00 58.28 ? 15   DC  T N1    1 
ATOM   362  C  C2    . DC  B 2 14  ? 60.729 52.717  18.718  1.00 58.44 ? 15   DC  T C2    1 
ATOM   363  O  O2    . DC  B 2 14  ? 60.875 51.757  19.494  1.00 59.99 ? 15   DC  T O2    1 
ATOM   364  N  N3    . DC  B 2 14  ? 61.333 52.746  17.508  1.00 57.38 ? 15   DC  T N3    1 
ATOM   365  C  C4    . DC  B 2 14  ? 61.151 53.788  16.697  1.00 57.28 ? 15   DC  T C4    1 
ATOM   366  N  N4    . DC  B 2 14  ? 61.774 53.776  15.515  1.00 56.66 ? 15   DC  T N4    1 
ATOM   367  C  C5    . DC  B 2 14  ? 60.321 54.891  17.059  1.00 57.34 ? 15   DC  T C5    1 
ATOM   368  C  C6    . DC  B 2 14  ? 59.727 54.853  18.258  1.00 57.52 ? 15   DC  T C6    1 
ATOM   369  N  N     . MET C 3 1   ? 78.996 4.092   7.242   1.00 29.87 ? 1    MET A N     1 
ATOM   370  C  CA    . MET C 3 1   ? 78.455 5.473   7.391   1.00 27.96 ? 1    MET A CA    1 
ATOM   371  C  C     . MET C 3 1   ? 79.519 6.412   7.932   1.00 28.35 ? 1    MET A C     1 
ATOM   372  O  O     . MET C 3 1   ? 80.264 6.066   8.849   1.00 27.85 ? 1    MET A O     1 
ATOM   373  C  CB    . MET C 3 1   ? 77.255 5.490   8.338   1.00 27.42 ? 1    MET A CB    1 
ATOM   374  C  CG    . MET C 3 1   ? 76.783 6.897   8.710   1.00 27.50 ? 1    MET A CG    1 
ATOM   375  S  SD    . MET C 3 1   ? 75.396 6.958   9.896   1.00 31.17 ? 1    MET A SD    1 
ATOM   376  C  CE    . MET C 3 1   ? 74.026 6.556   8.859   1.00 26.60 ? 1    MET A CE    1 
ATOM   377  N  N     . ILE C 3 2   ? 79.588 7.600   7.345   1.00 27.95 ? 2    ILE A N     1 
ATOM   378  C  CA    . ILE C 3 2   ? 80.536 8.608   7.779   1.00 28.02 ? 2    ILE A CA    1 
ATOM   379  C  C     . ILE C 3 2   ? 79.773 9.907   7.983   1.00 27.12 ? 2    ILE A C     1 
ATOM   380  O  O     . ILE C 3 2   ? 78.705 10.112  7.403   1.00 27.67 ? 2    ILE A O     1 
ATOM   381  C  CB    . ILE C 3 2   ? 81.664 8.817   6.740   1.00 28.40 ? 2    ILE A CB    1 
ATOM   382  C  CG1   . ILE C 3 2   ? 81.092 9.397   5.450   1.00 27.48 ? 2    ILE A CG1   1 
ATOM   383  C  CG2   . ILE C 3 2   ? 82.354 7.490   6.454   1.00 25.70 ? 2    ILE A CG2   1 
ATOM   384  C  CD1   . ILE C 3 2   ? 82.144 9.762   4.422   1.00 28.02 ? 2    ILE A CD1   1 
ATOM   385  N  N     . VAL C 3 3   ? 80.321 10.772  8.824   1.00 26.58 ? 3    VAL A N     1 
ATOM   386  C  CA    . VAL C 3 3   ? 79.708 12.052  9.136   1.00 26.60 ? 3    VAL A CA    1 
ATOM   387  C  C     . VAL C 3 3   ? 80.724 13.094  8.713   1.00 27.21 ? 3    VAL A C     1 
ATOM   388  O  O     . VAL C 3 3   ? 81.896 13.005  9.087   1.00 29.89 ? 3    VAL A O     1 
ATOM   389  C  CB    . VAL C 3 3   ? 79.425 12.163  10.657  1.00 27.74 ? 3    VAL A CB    1 
ATOM   390  C  CG1   . VAL C 3 3   ? 78.719 13.475  10.988  1.00 27.21 ? 3    VAL A CG1   1 
ATOM   391  C  CG2   . VAL C 3 3   ? 78.577 10.977  11.101  1.00 28.79 ? 3    VAL A CG2   1 
ATOM   392  N  N     . SER C 3 4   ? 80.284 14.089  7.951   1.00 24.91 ? 4    SER A N     1 
ATOM   393  C  CA    . SER C 3 4   ? 81.214 15.089  7.472   1.00 24.23 ? 4    SER A CA    1 
ATOM   394  C  C     . SER C 3 4   ? 80.701 16.531  7.450   1.00 24.11 ? 4    SER A C     1 
ATOM   395  O  O     . SER C 3 4   ? 79.530 16.805  7.694   1.00 24.72 ? 4    SER A O     1 
ATOM   396  C  CB    . SER C 3 4   ? 81.694 14.680  6.075   1.00 22.90 ? 4    SER A CB    1 
ATOM   397  O  OG    . SER C 3 4   ? 82.798 15.457  5.671   1.00 26.24 ? 4    SER A OG    1 
ATOM   398  N  N     . ASP C 3 5   ? 81.612 17.450  7.158   1.00 24.28 ? 5    ASP A N     1 
ATOM   399  C  CA    . ASP C 3 5   ? 81.309 18.871  7.089   1.00 25.10 ? 5    ASP A CA    1 
ATOM   400  C  C     . ASP C 3 5   ? 82.512 19.581  6.486   1.00 25.54 ? 5    ASP A C     1 
ATOM   401  O  O     . ASP C 3 5   ? 83.645 19.132  6.647   1.00 26.72 ? 5    ASP A O     1 
ATOM   402  C  CB    . ASP C 3 5   ? 81.059 19.434  8.484   1.00 24.59 ? 5    ASP A CB    1 
ATOM   403  C  CG    . ASP C 3 5   ? 80.713 20.901  8.460   1.00 26.21 ? 5    ASP A CG    1 
ATOM   404  O  OD1   . ASP C 3 5   ? 79.695 21.268  7.833   1.00 27.56 ? 5    ASP A OD1   1 
ATOM   405  O  OD2   . ASP C 3 5   ? 81.461 21.695  9.066   1.00 30.60 ? 5    ASP A OD2   1 
ATOM   406  N  N     . ILE C 3 6   ? 82.270 20.688  5.800   1.00 25.41 ? 6    ILE A N     1 
ATOM   407  C  CA    . ILE C 3 6   ? 83.362 21.431  5.216   1.00 25.96 ? 6    ILE A CA    1 
ATOM   408  C  C     . ILE C 3 6   ? 83.256 22.904  5.551   1.00 26.89 ? 6    ILE A C     1 
ATOM   409  O  O     . ILE C 3 6   ? 82.222 23.391  5.996   1.00 26.47 ? 6    ILE A O     1 
ATOM   410  C  CB    . ILE C 3 6   ? 83.382 21.305  3.688   1.00 25.34 ? 6    ILE A CB    1 
ATOM   411  C  CG1   . ILE C 3 6   ? 82.251 22.142  3.086   1.00 27.36 ? 6    ILE A CG1   1 
ATOM   412  C  CG2   . ILE C 3 6   ? 83.234 19.848  3.289   1.00 26.16 ? 6    ILE A CG2   1 
ATOM   413  C  CD1   . ILE C 3 6   ? 82.300 22.261  1.573   1.00 27.65 ? 6    ILE A CD1   1 
ATOM   414  N  N     . GLU C 3 7   ? 84.358 23.606  5.349   1.00 26.98 ? 7    GLU A N     1 
ATOM   415  C  CA    . GLU C 3 7   ? 84.400 25.038  5.557   1.00 26.37 ? 7    GLU A CA    1 
ATOM   416  C  C     . GLU C 3 7   ? 84.902 25.555  4.209   1.00 26.31 ? 7    GLU A C     1 
ATOM   417  O  O     . GLU C 3 7   ? 85.867 25.025  3.664   1.00 25.73 ? 7    GLU A O     1 
ATOM   418  C  CB    . GLU C 3 7   ? 85.392 25.395  6.667   1.00 28.86 ? 7    GLU A CB    1 
ATOM   419  C  CG    . GLU C 3 7   ? 85.081 24.800  8.042   1.00 30.27 ? 7    GLU A CG    1 
ATOM   420  C  CD    . GLU C 3 7   ? 83.722 25.223  8.586   1.00 34.15 ? 7    GLU A CD    1 
ATOM   421  O  OE1   . GLU C 3 7   ? 83.179 26.259  8.142   1.00 34.14 ? 7    GLU A OE1   1 
ATOM   422  O  OE2   . GLU C 3 7   ? 83.199 24.522  9.478   1.00 38.92 ? 7    GLU A OE2   1 
ATOM   423  N  N     . ALA C 3 8   ? 84.236 26.561  3.659   1.00 26.12 ? 8    ALA A N     1 
ATOM   424  C  CA    . ALA C 3 8   ? 84.642 27.128  2.376   1.00 25.23 ? 8    ALA A CA    1 
ATOM   425  C  C     . ALA C 3 8   ? 84.625 28.647  2.510   1.00 25.81 ? 8    ALA A C     1 
ATOM   426  O  O     . ALA C 3 8   ? 84.238 29.170  3.552   1.00 25.89 ? 8    ALA A O     1 
ATOM   427  C  CB    . ALA C 3 8   ? 83.696 26.665  1.267   1.00 23.99 ? 8    ALA A CB    1 
ATOM   428  N  N     . ASN C 3 9   ? 85.005 29.354  1.453   1.00 26.11 ? 9    ASN A N     1 
ATOM   429  C  CA    . ASN C 3 9   ? 85.100 30.815  1.510   1.00 28.11 ? 9    ASN A CA    1 
ATOM   430  C  C     . ASN C 3 9   ? 83.870 31.671  1.237   1.00 29.38 ? 9    ASN A C     1 
ATOM   431  O  O     . ASN C 3 9   ? 83.982 32.894  1.195   1.00 32.17 ? 9    ASN A O     1 
ATOM   432  C  CB    . ASN C 3 9   ? 86.230 31.279  0.587   1.00 28.58 ? 9    ASN A CB    1 
ATOM   433  C  CG    . ASN C 3 9   ? 85.858 31.197  -0.882  1.00 28.17 ? 9    ASN A CG    1 
ATOM   434  O  OD1   . ASN C 3 9   ? 84.989 30.420  -1.276  1.00 27.80 ? 9    ASN A OD1   1 
ATOM   435  N  ND2   . ASN C 3 9   ? 86.530 31.992  -1.704  1.00 31.41 ? 9    ASN A ND2   1 
ATOM   436  N  N     . ALA C 3 10  ? 82.706 31.063  1.046   1.00 29.13 ? 10   ALA A N     1 
ATOM   437  C  CA    . ALA C 3 10  ? 81.495 31.844  0.798   1.00 29.19 ? 10   ALA A CA    1 
ATOM   438  C  C     . ALA C 3 10  ? 80.256 30.956  0.687   1.00 29.74 ? 10   ALA A C     1 
ATOM   439  O  O     . ALA C 3 10  ? 80.340 29.736  0.831   1.00 29.35 ? 10   ALA A O     1 
ATOM   440  C  CB    . ALA C 3 10  ? 81.655 32.686  -0.482  1.00 26.79 ? 10   ALA A CB    1 
ATOM   441  N  N     . LEU C 3 11  ? 79.106 31.584  0.456   1.00 29.23 ? 11   LEU A N     1 
ATOM   442  C  CA    . LEU C 3 11  ? 77.849 30.864  0.289   1.00 29.47 ? 11   LEU A CA    1 
ATOM   443  C  C     . LEU C 3 11  ? 77.912 30.201  -1.095  1.00 28.70 ? 11   LEU A C     1 
ATOM   444  O  O     . LEU C 3 11  ? 78.689 30.626  -1.953  1.00 28.59 ? 11   LEU A O     1 
ATOM   445  C  CB    . LEU C 3 11  ? 76.659 31.842  0.369   1.00 28.98 ? 11   LEU A CB    1 
ATOM   446  C  CG    . LEU C 3 11  ? 76.494 32.622  1.687   1.00 30.29 ? 11   LEU A CG    1 
ATOM   447  C  CD1   . LEU C 3 11  ? 75.373 33.645  1.549   1.00 31.89 ? 11   LEU A CD1   1 
ATOM   448  C  CD2   . LEU C 3 11  ? 76.203 31.667  2.839   1.00 28.58 ? 11   LEU A CD2   1 
ATOM   449  N  N     . LEU C 3 12  ? 77.094 29.172  -1.305  1.00 29.39 ? 12   LEU A N     1 
ATOM   450  C  CA    . LEU C 3 12  ? 77.070 28.431  -2.569  1.00 29.28 ? 12   LEU A CA    1 
ATOM   451  C  C     . LEU C 3 12  ? 77.205 29.308  -3.809  1.00 30.74 ? 12   LEU A C     1 
ATOM   452  O  O     . LEU C 3 12  ? 78.005 29.021  -4.703  1.00 29.94 ? 12   LEU A O     1 
ATOM   453  C  CB    . LEU C 3 12  ? 75.781 27.618  -2.679  1.00 26.57 ? 12   LEU A CB    1 
ATOM   454  C  CG    . LEU C 3 12  ? 75.601 26.769  -3.943  1.00 27.36 ? 12   LEU A CG    1 
ATOM   455  C  CD1   . LEU C 3 12  ? 76.772 25.791  -4.091  1.00 26.96 ? 12   LEU A CD1   1 
ATOM   456  C  CD2   . LEU C 3 12  ? 74.279 26.010  -3.862  1.00 26.92 ? 12   LEU A CD2   1 
ATOM   457  N  N     . GLU C 3 13  ? 76.414 30.374  -3.846  1.00 31.46 ? 13   GLU A N     1 
ATOM   458  C  CA    . GLU C 3 13  ? 76.391 31.304  -4.963  1.00 33.76 ? 13   GLU A CA    1 
ATOM   459  C  C     . GLU C 3 13  ? 77.768 31.752  -5.474  1.00 32.80 ? 13   GLU A C     1 
ATOM   460  O  O     . GLU C 3 13  ? 77.989 31.826  -6.685  1.00 29.71 ? 13   GLU A O     1 
ATOM   461  C  CB    . GLU C 3 13  ? 75.556 32.540  -4.586  1.00 36.89 ? 13   GLU A CB    1 
ATOM   462  C  CG    . GLU C 3 13  ? 74.148 32.208  -4.080  1.00 42.36 ? 13   GLU A CG    1 
ATOM   463  C  CD    . GLU C 3 13  ? 74.063 32.073  -2.557  1.00 44.85 ? 13   GLU A CD    1 
ATOM   464  O  OE1   . GLU C 3 13  ? 74.042 33.128  -1.871  1.00 45.41 ? 13   GLU A OE1   1 
ATOM   465  O  OE2   . GLU C 3 13  ? 74.018 30.922  -2.051  1.00 42.34 ? 13   GLU A OE2   1 
ATOM   466  N  N     . SER C 3 14  ? 78.691 32.040  -4.562  1.00 30.83 ? 14   SER A N     1 
ATOM   467  C  CA    . SER C 3 14  ? 80.007 32.506  -4.982  1.00 30.78 ? 14   SER A CA    1 
ATOM   468  C  C     . SER C 3 14  ? 81.228 31.765  -4.439  1.00 30.07 ? 14   SER A C     1 
ATOM   469  O  O     . SER C 3 14  ? 82.348 32.251  -4.585  1.00 29.45 ? 14   SER A O     1 
ATOM   470  C  CB    . SER C 3 14  ? 80.145 33.994  -4.647  1.00 32.18 ? 14   SER A CB    1 
ATOM   471  O  OG    . SER C 3 14  ? 79.864 34.237  -3.277  1.00 35.81 ? 14   SER A OG    1 
ATOM   472  N  N     . VAL C 3 15  ? 81.029 30.597  -3.836  1.00 28.07 ? 15   VAL A N     1 
ATOM   473  C  CA    . VAL C 3 15  ? 82.144 29.849  -3.267  1.00 26.98 ? 15   VAL A CA    1 
ATOM   474  C  C     . VAL C 3 15  ? 83.188 29.488  -4.338  1.00 28.22 ? 15   VAL A C     1 
ATOM   475  O  O     . VAL C 3 15  ? 82.835 29.071  -5.440  1.00 27.85 ? 15   VAL A O     1 
ATOM   476  C  CB    . VAL C 3 15  ? 81.638 28.562  -2.537  1.00 25.22 ? 15   VAL A CB    1 
ATOM   477  C  CG1   . VAL C 3 15  ? 81.147 27.511  -3.547  1.00 22.70 ? 15   VAL A CG1   1 
ATOM   478  C  CG2   . VAL C 3 15  ? 82.731 28.007  -1.658  1.00 23.51 ? 15   VAL A CG2   1 
ATOM   479  N  N     . THR C 3 16  ? 84.469 29.670  -4.015  1.00 28.53 ? 16   THR A N     1 
ATOM   480  C  CA    . THR C 3 16  ? 85.549 29.361  -4.956  1.00 29.75 ? 16   THR A CA    1 
ATOM   481  C  C     . THR C 3 16  ? 86.699 28.583  -4.327  1.00 30.54 ? 16   THR A C     1 
ATOM   482  O  O     . THR C 3 16  ? 87.513 27.999  -5.034  1.00 31.94 ? 16   THR A O     1 
ATOM   483  C  CB    . THR C 3 16  ? 86.177 30.626  -5.557  1.00 28.76 ? 16   THR A CB    1 
ATOM   484  O  OG1   . THR C 3 16  ? 86.715 31.424  -4.498  1.00 29.08 ? 16   THR A OG1   1 
ATOM   485  C  CG2   . THR C 3 16  ? 85.149 31.424  -6.354  1.00 28.35 ? 16   THR A CG2   1 
ATOM   486  N  N     . LYS C 3 17  ? 86.784 28.587  -3.004  1.00 30.46 ? 17   LYS A N     1 
ATOM   487  C  CA    . LYS C 3 17  ? 87.865 27.876  -2.344  1.00 32.07 ? 17   LYS A CA    1 
ATOM   488  C  C     . LYS C 3 17  ? 87.427 26.957  -1.220  1.00 30.86 ? 17   LYS A C     1 
ATOM   489  O  O     . LYS C 3 17  ? 86.645 27.342  -0.357  1.00 30.08 ? 17   LYS A O     1 
ATOM   490  C  CB    . LYS C 3 17  ? 88.912 28.866  -1.795  1.00 34.58 ? 17   LYS A CB    1 
ATOM   491  C  CG    . LYS C 3 17  ? 89.859 29.436  -2.859  1.00 39.84 ? 17   LYS A CG    1 
ATOM   492  C  CD    . LYS C 3 17  ? 91.184 29.920  -2.257  1.00 41.59 ? 17   LYS A CD    1 
ATOM   493  C  CE    . LYS C 3 17  ? 91.068 31.305  -1.624  1.00 43.70 ? 17   LYS A CE    1 
ATOM   494  N  NZ    . LYS C 3 17  ? 90.927 32.396  -2.643  1.00 43.26 ? 17   LYS A NZ    1 
ATOM   495  N  N     . PHE C 3 18  ? 87.947 25.735  -1.248  1.00 31.06 ? 18   PHE A N     1 
ATOM   496  C  CA    . PHE C 3 18  ? 87.683 24.749  -0.213  1.00 29.88 ? 18   PHE A CA    1 
ATOM   497  C  C     . PHE C 3 18  ? 88.731 25.042  0.864   1.00 30.54 ? 18   PHE A C     1 
ATOM   498  O  O     . PHE C 3 18  ? 89.932 25.004  0.585   1.00 32.34 ? 18   PHE A O     1 
ATOM   499  C  CB    . PHE C 3 18  ? 87.897 23.341  -0.776  1.00 29.70 ? 18   PHE A CB    1 
ATOM   500  C  CG    . PHE C 3 18  ? 87.924 22.252  0.271   1.00 30.57 ? 18   PHE A CG    1 
ATOM   501  C  CD1   . PHE C 3 18  ? 86.740 21.702  0.763   1.00 28.06 ? 18   PHE A CD1   1 
ATOM   502  C  CD2   . PHE C 3 18  ? 89.137 21.768  0.754   1.00 29.80 ? 18   PHE A CD2   1 
ATOM   503  C  CE1   . PHE C 3 18  ? 86.759 20.684  1.718   1.00 27.31 ? 18   PHE A CE1   1 
ATOM   504  C  CE2   . PHE C 3 18  ? 89.170 20.749  1.711   1.00 31.47 ? 18   PHE A CE2   1 
ATOM   505  C  CZ    . PHE C 3 18  ? 87.970 20.204  2.194   1.00 29.41 ? 18   PHE A CZ    1 
ATOM   506  N  N     . HIS C 3 19  ? 88.301 25.363  2.078   1.00 29.17 ? 19   HIS A N     1 
ATOM   507  C  CA    . HIS C 3 19  ? 89.265 25.622  3.139   1.00 29.11 ? 19   HIS A CA    1 
ATOM   508  C  C     . HIS C 3 19  ? 89.651 24.315  3.825   1.00 29.09 ? 19   HIS A C     1 
ATOM   509  O  O     . HIS C 3 19  ? 90.825 23.976  3.909   1.00 28.71 ? 19   HIS A O     1 
ATOM   510  C  CB    . HIS C 3 19  ? 88.708 26.600  4.177   1.00 28.90 ? 19   HIS A CB    1 
ATOM   511  C  CG    . HIS C 3 19  ? 88.586 28.009  3.687   1.00 28.75 ? 19   HIS A CG    1 
ATOM   512  N  ND1   . HIS C 3 19  ? 89.569 28.627  2.942   1.00 30.54 ? 19   HIS A ND1   1 
ATOM   513  C  CD2   . HIS C 3 19  ? 87.613 28.934  3.868   1.00 29.06 ? 19   HIS A CD2   1 
ATOM   514  C  CE1   . HIS C 3 19  ? 89.206 29.872  2.684   1.00 31.37 ? 19   HIS A CE1   1 
ATOM   515  N  NE2   . HIS C 3 19  ? 88.023 30.085  3.235   1.00 32.17 ? 19   HIS A NE2   1 
ATOM   516  N  N     . CYS C 3 20  ? 88.664 23.575  4.316   1.00 29.44 ? 20   CYS A N     1 
ATOM   517  C  CA    . CYS C 3 20  ? 88.955 22.316  4.987   1.00 28.65 ? 20   CYS A CA    1 
ATOM   518  C  C     . CYS C 3 20  ? 87.719 21.474  5.177   1.00 27.61 ? 20   CYS A C     1 
ATOM   519  O  O     . CYS C 3 20  ? 86.600 21.928  4.960   1.00 27.59 ? 20   CYS A O     1 
ATOM   520  C  CB    . CYS C 3 20  ? 89.599 22.569  6.357   1.00 28.30 ? 20   CYS A CB    1 
ATOM   521  S  SG    . CYS C 3 20  ? 88.558 23.464  7.518   1.00 30.76 ? 20   CYS A SG    1 
ATOM   522  N  N     . GLY C 3 21  ? 87.938 20.233  5.589   1.00 27.69 ? 21   GLY A N     1 
ATOM   523  C  CA    . GLY C 3 21  ? 86.840 19.321  5.823   1.00 28.06 ? 21   GLY A CA    1 
ATOM   524  C  C     . GLY C 3 21  ? 87.214 18.304  6.880   1.00 29.43 ? 21   GLY A C     1 
ATOM   525  O  O     . GLY C 3 21  ? 88.403 18.068  7.135   1.00 29.46 ? 21   GLY A O     1 
ATOM   526  N  N     . VAL C 3 22  ? 86.205 17.709  7.508   1.00 28.47 ? 22   VAL A N     1 
ATOM   527  C  CA    . VAL C 3 22  ? 86.443 16.703  8.527   1.00 28.83 ? 22   VAL A CA    1 
ATOM   528  C  C     . VAL C 3 22  ? 85.542 15.507  8.272   1.00 28.78 ? 22   VAL A C     1 
ATOM   529  O  O     . VAL C 3 22  ? 84.410 15.654  7.807   1.00 28.73 ? 22   VAL A O     1 
ATOM   530  C  CB    . VAL C 3 22  ? 86.161 17.246  9.953   1.00 29.55 ? 22   VAL A CB    1 
ATOM   531  C  CG1   . VAL C 3 22  ? 86.310 16.114  10.978  1.00 30.06 ? 22   VAL A CG1   1 
ATOM   532  C  CG2   . VAL C 3 22  ? 87.113 18.382  10.282  1.00 27.10 ? 22   VAL A CG2   1 
ATOM   533  N  N     . ILE C 3 23  ? 86.048 14.321  8.573   1.00 29.69 ? 23   ILE A N     1 
ATOM   534  C  CA    . ILE C 3 23  ? 85.280 13.107  8.382   1.00 29.08 ? 23   ILE A CA    1 
ATOM   535  C  C     . ILE C 3 23  ? 85.379 12.177  9.585   1.00 31.41 ? 23   ILE A C     1 
ATOM   536  O  O     . ILE C 3 23  ? 86.474 11.900  10.086  1.00 31.90 ? 23   ILE A O     1 
ATOM   537  C  CB    . ILE C 3 23  ? 85.766 12.302  7.157   1.00 28.30 ? 23   ILE A CB    1 
ATOM   538  C  CG1   . ILE C 3 23  ? 85.616 13.130  5.878   1.00 27.99 ? 23   ILE A CG1   1 
ATOM   539  C  CG2   . ILE C 3 23  ? 84.989 10.971  7.071   1.00 24.70 ? 23   ILE A CG2   1 
ATOM   540  C  CD1   . ILE C 3 23  ? 86.014 12.378  4.609   1.00 25.05 ? 23   ILE A CD1   1 
ATOM   541  N  N     . TYR C 3 24  ? 84.226 11.703  10.044  1.00 31.69 ? 24   TYR A N     1 
ATOM   542  C  CA    . TYR C 3 24  ? 84.175 10.741  11.134  1.00 30.97 ? 24   TYR A CA    1 
ATOM   543  C  C     . TYR C 3 24  ? 83.632 9.494   10.462  1.00 31.31 ? 24   TYR A C     1 
ATOM   544  O  O     . TYR C 3 24  ? 82.617 9.550   9.767   1.00 31.57 ? 24   TYR A O     1 
ATOM   545  C  CB    . TYR C 3 24  ? 83.217 11.180  12.243  1.00 31.04 ? 24   TYR A CB    1 
ATOM   546  C  CG    . TYR C 3 24  ? 83.041 10.111  13.299  1.00 33.37 ? 24   TYR A CG    1 
ATOM   547  C  CD1   . TYR C 3 24  ? 84.014 9.898   14.278  1.00 33.13 ? 24   TYR A CD1   1 
ATOM   548  C  CD2   . TYR C 3 24  ? 81.921 9.272   13.288  1.00 33.90 ? 24   TYR A CD2   1 
ATOM   549  C  CE1   . TYR C 3 24  ? 83.875 8.871   15.222  1.00 34.77 ? 24   TYR A CE1   1 
ATOM   550  C  CE2   . TYR C 3 24  ? 81.773 8.250   14.217  1.00 35.09 ? 24   TYR A CE2   1 
ATOM   551  C  CZ    . TYR C 3 24  ? 82.750 8.049   15.182  1.00 35.95 ? 24   TYR A CZ    1 
ATOM   552  O  OH    . TYR C 3 24  ? 82.601 7.016   16.088  1.00 36.21 ? 24   TYR A OH    1 
ATOM   553  N  N     . ASP C 3 25  ? 84.312 8.373   10.646  1.00 32.94 ? 25   ASP A N     1 
ATOM   554  C  CA    . ASP C 3 25  ? 83.885 7.125   10.038  1.00 34.69 ? 25   ASP A CA    1 
ATOM   555  C  C     . ASP C 3 25  ? 83.454 6.159   11.151  1.00 36.58 ? 25   ASP A C     1 
ATOM   556  O  O     . ASP C 3 25  ? 84.235 5.858   12.053  1.00 37.17 ? 25   ASP A O     1 
ATOM   557  C  CB    . ASP C 3 25  ? 85.052 6.537   9.233   1.00 35.34 ? 25   ASP A CB    1 
ATOM   558  C  CG    . ASP C 3 25  ? 84.637 5.366   8.368   1.00 35.60 ? 25   ASP A CG    1 
ATOM   559  O  OD1   . ASP C 3 25  ? 83.635 4.700   8.702   1.00 37.47 ? 25   ASP A OD1   1 
ATOM   560  O  OD2   . ASP C 3 25  ? 85.319 5.106   7.355   1.00 37.33 ? 25   ASP A OD2   1 
ATOM   561  N  N     . TYR C 3 26  ? 82.215 5.679   11.101  1.00 37.79 ? 26   TYR A N     1 
ATOM   562  C  CA    . TYR C 3 26  ? 81.742 4.763   12.135  1.00 38.10 ? 26   TYR A CA    1 
ATOM   563  C  C     . TYR C 3 26  ? 82.499 3.446   12.152  1.00 39.40 ? 26   TYR A C     1 
ATOM   564  O  O     . TYR C 3 26  ? 82.666 2.836   13.213  1.00 39.77 ? 26   TYR A O     1 
ATOM   565  C  CB    . TYR C 3 26  ? 80.244 4.489   11.974  1.00 36.80 ? 26   TYR A CB    1 
ATOM   566  C  CG    . TYR C 3 26  ? 79.377 5.519   12.660  1.00 35.59 ? 26   TYR A CG    1 
ATOM   567  C  CD1   . TYR C 3 26  ? 79.139 5.455   14.035  1.00 34.30 ? 26   TYR A CD1   1 
ATOM   568  C  CD2   . TYR C 3 26  ? 78.838 6.593   11.945  1.00 33.19 ? 26   TYR A CD2   1 
ATOM   569  C  CE1   . TYR C 3 26  ? 78.384 6.437   14.680  1.00 33.62 ? 26   TYR A CE1   1 
ATOM   570  C  CE2   . TYR C 3 26  ? 78.089 7.576   12.575  1.00 29.84 ? 26   TYR A CE2   1 
ATOM   571  C  CZ    . TYR C 3 26  ? 77.863 7.497   13.937  1.00 32.02 ? 26   TYR A CZ    1 
ATOM   572  O  OH    . TYR C 3 26  ? 77.107 8.465   14.553  1.00 29.26 ? 26   TYR A OH    1 
ATOM   573  N  N     . SER C 3 27  ? 82.967 3.014   10.984  1.00 39.33 ? 27   SER A N     1 
ATOM   574  C  CA    . SER C 3 27  ? 83.700 1.756   10.884  1.00 40.78 ? 27   SER A CA    1 
ATOM   575  C  C     . SER C 3 27  ? 85.112 1.805   11.496  1.00 41.58 ? 27   SER A C     1 
ATOM   576  O  O     . SER C 3 27  ? 85.729 0.757   11.698  1.00 43.04 ? 27   SER A O     1 
ATOM   577  C  CB    . SER C 3 27  ? 83.801 1.322   9.422   1.00 39.46 ? 27   SER A CB    1 
ATOM   578  O  OG    . SER C 3 27  ? 84.774 2.102   8.751   1.00 42.73 ? 27   SER A OG    1 
ATOM   579  N  N     . THR C 3 28  ? 85.621 3.002   11.789  1.00 40.63 ? 28   THR A N     1 
ATOM   580  C  CA    . THR C 3 28  ? 86.956 3.140   12.376  1.00 40.61 ? 28   THR A CA    1 
ATOM   581  C  C     . THR C 3 28  ? 86.923 3.962   13.660  1.00 40.06 ? 28   THR A C     1 
ATOM   582  O  O     . THR C 3 28  ? 87.878 3.957   14.433  1.00 39.60 ? 28   THR A O     1 
ATOM   583  C  CB    . THR C 3 28  ? 87.955 3.833   11.408  1.00 41.05 ? 28   THR A CB    1 
ATOM   584  O  OG1   . THR C 3 28  ? 87.604 5.217   11.266  1.00 44.09 ? 28   THR A OG1   1 
ATOM   585  C  CG2   . THR C 3 28  ? 87.932 3.171   10.047  1.00 41.12 ? 28   THR A CG2   1 
ATOM   586  N  N     . ALA C 3 29  ? 85.824 4.677   13.866  1.00 40.59 ? 29   ALA A N     1 
ATOM   587  C  CA    . ALA C 3 29  ? 85.636 5.516   15.042  1.00 39.84 ? 29   ALA A CA    1 
ATOM   588  C  C     . ALA C 3 29  ? 86.641 6.660   15.126  1.00 40.71 ? 29   ALA A C     1 
ATOM   589  O  O     . ALA C 3 29  ? 86.884 7.201   16.209  1.00 40.28 ? 29   ALA A O     1 
ATOM   590  C  CB    . ALA C 3 29  ? 85.703 4.664   16.311  1.00 41.04 ? 29   ALA A CB    1 
ATOM   591  N  N     . GLU C 3 30  ? 87.220 7.049   13.995  1.00 41.12 ? 30   GLU A N     1 
ATOM   592  C  CA    . GLU C 3 30  ? 88.179 8.146   14.018  1.00 42.12 ? 30   GLU A CA    1 
ATOM   593  C  C     . GLU C 3 30  ? 87.821 9.382   13.192  1.00 40.39 ? 30   GLU A C     1 
ATOM   594  O  O     . GLU C 3 30  ? 87.135 9.294   12.172  1.00 37.90 ? 30   GLU A O     1 
ATOM   595  C  CB    . GLU C 3 30  ? 89.570 7.645   13.611  1.00 45.49 ? 30   GLU A CB    1 
ATOM   596  C  CG    . GLU C 3 30  ? 90.262 6.840   14.704  1.00 50.73 ? 30   GLU A CG    1 
ATOM   597  C  CD    . GLU C 3 30  ? 91.775 6.918   14.621  1.00 54.57 ? 30   GLU A CD    1 
ATOM   598  O  OE1   . GLU C 3 30  ? 92.325 8.046   14.696  1.00 54.94 ? 30   GLU A OE1   1 
ATOM   599  O  OE2   . GLU C 3 30  ? 92.413 5.851   14.486  1.00 56.58 ? 30   GLU A OE2   1 
ATOM   600  N  N     . TYR C 3 31  ? 88.282 10.536  13.671  1.00 39.29 ? 31   TYR A N     1 
ATOM   601  C  CA    . TYR C 3 31  ? 88.071 11.810  12.995  1.00 37.79 ? 31   TYR A CA    1 
ATOM   602  C  C     . TYR C 3 31  ? 89.310 12.109  12.166  1.00 38.43 ? 31   TYR A C     1 
ATOM   603  O  O     . TYR C 3 31  ? 90.433 12.022  12.667  1.00 38.90 ? 31   TYR A O     1 
ATOM   604  C  CB    . TYR C 3 31  ? 87.907 12.952  13.996  1.00 37.39 ? 31   TYR A CB    1 
ATOM   605  C  CG    . TYR C 3 31  ? 86.646 12.904  14.805  1.00 38.60 ? 31   TYR A CG    1 
ATOM   606  C  CD1   . TYR C 3 31  ? 86.483 11.969  15.820  1.00 39.67 ? 31   TYR A CD1   1 
ATOM   607  C  CD2   . TYR C 3 31  ? 85.605 13.793  14.552  1.00 38.75 ? 31   TYR A CD2   1 
ATOM   608  C  CE1   . TYR C 3 31  ? 85.308 11.920  16.568  1.00 41.22 ? 31   TYR A CE1   1 
ATOM   609  C  CE2   . TYR C 3 31  ? 84.431 13.752  15.288  1.00 39.19 ? 31   TYR A CE2   1 
ATOM   610  C  CZ    . TYR C 3 31  ? 84.286 12.813  16.295  1.00 39.78 ? 31   TYR A CZ    1 
ATOM   611  O  OH    . TYR C 3 31  ? 83.117 12.749  17.013  1.00 40.05 ? 31   TYR A OH    1 
ATOM   612  N  N     . VAL C 3 32  ? 89.114 12.464  10.902  1.00 37.55 ? 32   VAL A N     1 
ATOM   613  C  CA    . VAL C 3 32  ? 90.239 12.803  10.041  1.00 35.60 ? 32   VAL A CA    1 
ATOM   614  C  C     . VAL C 3 32  ? 90.042 14.214  9.503   1.00 34.92 ? 32   VAL A C     1 
ATOM   615  O  O     . VAL C 3 32  ? 88.977 14.555  8.978   1.00 33.82 ? 32   VAL A O     1 
ATOM   616  C  CB    . VAL C 3 32  ? 90.370 11.827  8.867   1.00 35.69 ? 32   VAL A CB    1 
ATOM   617  C  CG1   . VAL C 3 32  ? 91.480 12.289  7.942   1.00 36.08 ? 32   VAL A CG1   1 
ATOM   618  C  CG2   . VAL C 3 32  ? 90.657 10.416  9.388   1.00 34.89 ? 32   VAL A CG2   1 
ATOM   619  N  N     . SER C 3 33  ? 91.070 15.038  9.655   1.00 32.78 ? 33   SER A N     1 
ATOM   620  C  CA    . SER C 3 33  ? 91.011 16.406  9.195   1.00 31.36 ? 33   SER A CA    1 
ATOM   621  C  C     . SER C 3 33  ? 91.683 16.547  7.844   1.00 32.28 ? 33   SER A C     1 
ATOM   622  O  O     . SER C 3 33  ? 92.707 15.914  7.575   1.00 32.69 ? 33   SER A O     1 
ATOM   623  C  CB    . SER C 3 33  ? 91.682 17.324  10.209  1.00 31.88 ? 33   SER A CB    1 
ATOM   624  O  OG    . SER C 3 33  ? 90.895 17.424  11.378  1.00 31.97 ? 33   SER A OG    1 
ATOM   625  N  N     . TYR C 3 34  ? 91.091 17.371  6.987   1.00 31.05 ? 34   TYR A N     1 
ATOM   626  C  CA    . TYR C 3 34  ? 91.638 17.605  5.664   1.00 29.86 ? 34   TYR A CA    1 
ATOM   627  C  C     . TYR C 3 34  ? 91.836 19.092  5.505   1.00 29.46 ? 34   TYR A C     1 
ATOM   628  O  O     . TYR C 3 34  ? 90.888 19.864  5.621   1.00 29.54 ? 34   TYR A O     1 
ATOM   629  C  CB    . TYR C 3 34  ? 90.688 17.100  4.580   1.00 28.84 ? 34   TYR A CB    1 
ATOM   630  C  CG    . TYR C 3 34  ? 90.449 15.619  4.623   1.00 29.14 ? 34   TYR A CG    1 
ATOM   631  C  CD1   . TYR C 3 34  ? 89.671 15.050  5.630   1.00 28.75 ? 34   TYR A CD1   1 
ATOM   632  C  CD2   . TYR C 3 34  ? 91.004 14.776  3.659   1.00 28.61 ? 34   TYR A CD2   1 
ATOM   633  C  CE1   . TYR C 3 34  ? 89.453 13.678  5.677   1.00 28.78 ? 34   TYR A CE1   1 
ATOM   634  C  CE2   . TYR C 3 34  ? 90.793 13.402  3.696   1.00 28.61 ? 34   TYR A CE2   1 
ATOM   635  C  CZ    . TYR C 3 34  ? 90.015 12.860  4.710   1.00 28.62 ? 34   TYR A CZ    1 
ATOM   636  O  OH    . TYR C 3 34  ? 89.793 11.504  4.754   1.00 28.53 ? 34   TYR A OH    1 
ATOM   637  N  N     . ARG C 3 35  ? 93.072 19.494  5.242   1.00 30.68 ? 35   ARG A N     1 
ATOM   638  C  CA    . ARG C 3 35  ? 93.379 20.905  5.070   1.00 30.64 ? 35   ARG A CA    1 
ATOM   639  C  C     . ARG C 3 35  ? 93.273 21.332  3.599   1.00 29.10 ? 35   ARG A C     1 
ATOM   640  O  O     . ARG C 3 35  ? 93.003 20.509  2.731   1.00 27.67 ? 35   ARG A O     1 
ATOM   641  C  CB    . ARG C 3 35  ? 94.756 21.185  5.673   1.00 33.07 ? 35   ARG A CB    1 
ATOM   642  C  CG    . ARG C 3 35  ? 94.699 21.107  7.196   1.00 36.75 ? 35   ARG A CG    1 
ATOM   643  C  CD    . ARG C 3 35  ? 96.027 21.334  7.895   1.00 36.75 ? 35   ARG A CD    1 
ATOM   644  N  NE    . ARG C 3 35  ? 95.828 21.374  9.347   1.00 38.26 ? 35   ARG A NE    1 
ATOM   645  C  CZ    . ARG C 3 35  ? 95.437 20.334  10.079  1.00 38.15 ? 35   ARG A CZ    1 
ATOM   646  N  NH1   . ARG C 3 35  ? 95.211 19.159  9.505   1.00 38.68 ? 35   ARG A NH1   1 
ATOM   647  N  NH2   . ARG C 3 35  ? 95.250 20.472  11.384  1.00 39.69 ? 35   ARG A NH2   1 
ATOM   648  N  N     . PRO C 3 36  ? 93.467 22.626  3.304   1.00 28.73 ? 36   PRO A N     1 
ATOM   649  C  CA    . PRO C 3 36  ? 93.371 23.114  1.923   1.00 29.89 ? 36   PRO A CA    1 
ATOM   650  C  C     . PRO C 3 36  ? 93.976 22.224  0.834   1.00 31.38 ? 36   PRO A C     1 
ATOM   651  O  O     . PRO C 3 36  ? 93.350 21.992  -0.200  1.00 31.40 ? 36   PRO A O     1 
ATOM   652  C  CB    . PRO C 3 36  ? 94.046 24.478  1.998   1.00 30.76 ? 36   PRO A CB    1 
ATOM   653  C  CG    . PRO C 3 36  ? 93.660 24.947  3.370   1.00 29.64 ? 36   PRO A CG    1 
ATOM   654  C  CD    . PRO C 3 36  ? 93.895 23.706  4.209   1.00 28.23 ? 36   PRO A CD    1 
ATOM   655  N  N     . SER C 3 37  ? 95.180 21.718  1.070   1.00 31.04 ? 37   SER A N     1 
ATOM   656  C  CA    . SER C 3 37  ? 95.855 20.881  0.086   1.00 33.46 ? 37   SER A CA    1 
ATOM   657  C  C     . SER C 3 37  ? 95.422 19.409  0.048   1.00 32.93 ? 37   SER A C     1 
ATOM   658  O  O     . SER C 3 37  ? 95.899 18.646  -0.792  1.00 31.75 ? 37   SER A O     1 
ATOM   659  C  CB    . SER C 3 37  ? 97.371 20.973  0.301   1.00 33.99 ? 37   SER A CB    1 
ATOM   660  O  OG    . SER C 3 37  ? 97.691 20.741  1.664   1.00 38.13 ? 37   SER A OG    1 
ATOM   661  N  N     . ASP C 3 38  ? 94.518 19.016  0.944   1.00 32.82 ? 38   ASP A N     1 
ATOM   662  C  CA    . ASP C 3 38  ? 94.029 17.638  1.006   1.00 32.01 ? 38   ASP A CA    1 
ATOM   663  C  C     . ASP C 3 38  ? 92.647 17.502  0.369   1.00 32.05 ? 38   ASP A C     1 
ATOM   664  O  O     . ASP C 3 38  ? 91.971 16.485  0.555   1.00 32.25 ? 38   ASP A O     1 
ATOM   665  C  CB    . ASP C 3 38  ? 93.926 17.169  2.463   1.00 34.62 ? 38   ASP A CB    1 
ATOM   666  C  CG    . ASP C 3 38  ? 95.267 17.133  3.174   1.00 35.57 ? 38   ASP A CG    1 
ATOM   667  O  OD1   . ASP C 3 38  ? 96.193 16.468  2.668   1.00 35.57 ? 38   ASP A OD1   1 
ATOM   668  O  OD2   . ASP C 3 38  ? 95.389 17.758  4.250   1.00 37.55 ? 38   ASP A OD2   1 
ATOM   669  N  N     . PHE C 3 39  ? 92.230 18.518  -0.380  1.00 30.49 ? 39   PHE A N     1 
ATOM   670  C  CA    . PHE C 3 39  ? 90.911 18.515  -0.998  1.00 29.19 ? 39   PHE A CA    1 
ATOM   671  C  C     . PHE C 3 39  ? 90.628 17.296  -1.872  1.00 29.03 ? 39   PHE A C     1 
ATOM   672  O  O     . PHE C 3 39  ? 89.560 16.691  -1.777  1.00 28.27 ? 39   PHE A O     1 
ATOM   673  C  CB    . PHE C 3 39  ? 90.694 19.821  -1.790  1.00 28.10 ? 39   PHE A CB    1 
ATOM   674  C  CG    . PHE C 3 39  ? 89.302 19.973  -2.347  1.00 27.11 ? 39   PHE A CG    1 
ATOM   675  C  CD1   . PHE C 3 39  ? 88.194 19.501  -1.641  1.00 27.04 ? 39   PHE A CD1   1 
ATOM   676  C  CD2   . PHE C 3 39  ? 89.095 20.590  -3.574  1.00 26.37 ? 39   PHE A CD2   1 
ATOM   677  C  CE1   . PHE C 3 39  ? 86.895 19.639  -2.158  1.00 26.89 ? 39   PHE A CE1   1 
ATOM   678  C  CE2   . PHE C 3 39  ? 87.799 20.735  -4.101  1.00 26.43 ? 39   PHE A CE2   1 
ATOM   679  C  CZ    . PHE C 3 39  ? 86.697 20.256  -3.392  1.00 24.29 ? 39   PHE A CZ    1 
ATOM   680  N  N     . GLY C 3 40  ? 91.577 16.929  -2.724  1.00 29.12 ? 40   GLY A N     1 
ATOM   681  C  CA    . GLY C 3 40  ? 91.370 15.766  -3.569  1.00 28.55 ? 40   GLY A CA    1 
ATOM   682  C  C     . GLY C 3 40  ? 91.163 14.514  -2.732  1.00 28.80 ? 40   GLY A C     1 
ATOM   683  O  O     . GLY C 3 40  ? 90.297 13.693  -3.032  1.00 30.09 ? 40   GLY A O     1 
ATOM   684  N  N     . ALA C 3 41  ? 91.960 14.364  -1.678  1.00 27.64 ? 41   ALA A N     1 
ATOM   685  C  CA    . ALA C 3 41  ? 91.858 13.203  -0.794  1.00 27.03 ? 41   ALA A CA    1 
ATOM   686  C  C     . ALA C 3 41  ? 90.511 13.198  -0.067  1.00 27.48 ? 41   ALA A C     1 
ATOM   687  O  O     . ALA C 3 41  ? 89.921 12.138  0.152   1.00 28.17 ? 41   ALA A O     1 
ATOM   688  C  CB    . ALA C 3 41  ? 93.008 13.209  0.223   1.00 25.63 ? 41   ALA A CB    1 
ATOM   689  N  N     . TYR C 3 42  ? 90.035 14.381  0.311   1.00 26.84 ? 42   TYR A N     1 
ATOM   690  C  CA    . TYR C 3 42  ? 88.745 14.498  0.992   1.00 27.77 ? 42   TYR A CA    1 
ATOM   691  C  C     . TYR C 3 42  ? 87.673 13.945  0.046   1.00 28.40 ? 42   TYR A C     1 
ATOM   692  O  O     . TYR C 3 42  ? 86.856 13.102  0.425   1.00 30.14 ? 42   TYR A O     1 
ATOM   693  C  CB    . TYR C 3 42  ? 88.449 15.973  1.334   1.00 26.30 ? 42   TYR A CB    1 
ATOM   694  C  CG    . TYR C 3 42  ? 87.059 16.209  1.900   1.00 26.58 ? 42   TYR A CG    1 
ATOM   695  C  CD1   . TYR C 3 42  ? 86.739 15.841  3.212   1.00 25.57 ? 42   TYR A CD1   1 
ATOM   696  C  CD2   . TYR C 3 42  ? 86.048 16.735  1.100   1.00 24.31 ? 42   TYR A CD2   1 
ATOM   697  C  CE1   . TYR C 3 42  ? 85.439 15.984  3.709   1.00 24.37 ? 42   TYR A CE1   1 
ATOM   698  C  CE2   . TYR C 3 42  ? 84.760 16.883  1.578   1.00 24.76 ? 42   TYR A CE2   1 
ATOM   699  C  CZ    . TYR C 3 42  ? 84.455 16.504  2.880   1.00 26.58 ? 42   TYR A CZ    1 
ATOM   700  O  OH    . TYR C 3 42  ? 83.161 16.624  3.327   1.00 23.06 ? 42   TYR A OH    1 
ATOM   701  N  N     . LEU C 3 43  ? 87.683 14.416  -1.194  1.00 27.94 ? 43   LEU A N     1 
ATOM   702  C  CA    . LEU C 3 43  ? 86.721 13.947  -2.178  1.00 28.32 ? 43   LEU A CA    1 
ATOM   703  C  C     . LEU C 3 43  ? 86.851 12.432  -2.396  1.00 28.24 ? 43   LEU A C     1 
ATOM   704  O  O     . LEU C 3 43  ? 85.844 11.732  -2.495  1.00 28.94 ? 43   LEU A O     1 
ATOM   705  C  CB    . LEU C 3 43  ? 86.922 14.685  -3.511  1.00 27.36 ? 43   LEU A CB    1 
ATOM   706  C  CG    . LEU C 3 43  ? 86.711 16.206  -3.522  1.00 27.08 ? 43   LEU A CG    1 
ATOM   707  C  CD1   . LEU C 3 43  ? 87.016 16.759  -4.906  1.00 23.13 ? 43   LEU A CD1   1 
ATOM   708  C  CD2   . LEU C 3 43  ? 85.269 16.533  -3.121  1.00 26.63 ? 43   LEU A CD2   1 
ATOM   709  N  N     . ASP C 3 44  ? 88.081 11.928  -2.484  1.00 28.87 ? 44   ASP A N     1 
ATOM   710  C  CA    . ASP C 3 44  ? 88.285 10.493  -2.693  1.00 30.30 ? 44   ASP A CA    1 
ATOM   711  C  C     . ASP C 3 44  ? 87.655 9.713   -1.540  1.00 29.37 ? 44   ASP A C     1 
ATOM   712  O  O     . ASP C 3 44  ? 87.075 8.648   -1.745  1.00 28.69 ? 44   ASP A O     1 
ATOM   713  C  CB    . ASP C 3 44  ? 89.780 10.133  -2.786  1.00 31.33 ? 44   ASP A CB    1 
ATOM   714  C  CG    . ASP C 3 44  ? 90.441 10.662  -4.053  1.00 34.18 ? 44   ASP A CG    1 
ATOM   715  O  OD1   . ASP C 3 44  ? 89.724 10.955  -5.034  1.00 36.18 ? 44   ASP A OD1   1 
ATOM   716  O  OD2   . ASP C 3 44  ? 91.687 10.769  -4.070  1.00 33.62 ? 44   ASP A OD2   1 
ATOM   717  N  N     . ALA C 3 45  ? 87.772 10.252  -0.329  1.00 28.45 ? 45   ALA A N     1 
ATOM   718  C  CA    . ALA C 3 45  ? 87.196 9.599   0.845   1.00 28.02 ? 45   ALA A CA    1 
ATOM   719  C  C     . ALA C 3 45  ? 85.667 9.520   0.744   1.00 28.41 ? 45   ALA A C     1 
ATOM   720  O  O     . ALA C 3 45  ? 85.076 8.510   1.115   1.00 28.65 ? 45   ALA A O     1 
ATOM   721  C  CB    . ALA C 3 45  ? 87.600 10.338  2.101   1.00 25.69 ? 45   ALA A CB    1 
ATOM   722  N  N     . LEU C 3 46  ? 85.033 10.578  0.236   1.00 27.83 ? 46   LEU A N     1 
ATOM   723  C  CA    . LEU C 3 46  ? 83.578 10.595  0.089   1.00 28.04 ? 46   LEU A CA    1 
ATOM   724  C  C     . LEU C 3 46  ? 83.126 9.594   -0.967  1.00 28.12 ? 46   LEU A C     1 
ATOM   725  O  O     . LEU C 3 46  ? 82.158 8.865   -0.759  1.00 28.82 ? 46   LEU A O     1 
ATOM   726  C  CB    . LEU C 3 46  ? 83.069 11.997  -0.280  1.00 24.30 ? 46   LEU A CB    1 
ATOM   727  C  CG    . LEU C 3 46  ? 83.351 13.076  0.772   1.00 26.38 ? 46   LEU A CG    1 
ATOM   728  C  CD1   . LEU C 3 46  ? 82.694 14.400  0.367   1.00 22.10 ? 46   LEU A CD1   1 
ATOM   729  C  CD2   . LEU C 3 46  ? 82.827 12.611  2.137   1.00 23.93 ? 46   LEU A CD2   1 
ATOM   730  N  N     . GLU C 3 47  ? 83.825 9.556   -2.095  1.00 28.32 ? 47   GLU A N     1 
ATOM   731  C  CA    . GLU C 3 47  ? 83.472 8.620   -3.148  1.00 30.30 ? 47   GLU A CA    1 
ATOM   732  C  C     . GLU C 3 47  ? 83.748 7.170   -2.751  1.00 31.58 ? 47   GLU A C     1 
ATOM   733  O  O     . GLU C 3 47  ? 83.116 6.248   -3.278  1.00 33.24 ? 47   GLU A O     1 
ATOM   734  C  CB    . GLU C 3 47  ? 84.209 8.971   -4.443  1.00 32.16 ? 47   GLU A CB    1 
ATOM   735  C  CG    . GLU C 3 47  ? 83.724 10.284  -5.030  1.00 35.15 ? 47   GLU A CG    1 
ATOM   736  C  CD    . GLU C 3 47  ? 84.342 10.608  -6.362  1.00 35.45 ? 47   GLU A CD    1 
ATOM   737  O  OE1   . GLU C 3 47  ? 85.589 10.627  -6.460  1.00 35.85 ? 47   GLU A OE1   1 
ATOM   738  O  OE2   . GLU C 3 47  ? 83.573 10.852  -7.315  1.00 39.34 ? 47   GLU A OE2   1 
ATOM   739  N  N     . ALA C 3 48  ? 84.680 6.962   -1.826  1.00 30.62 ? 48   ALA A N     1 
ATOM   740  C  CA    . ALA C 3 48  ? 84.985 5.608   -1.378  1.00 33.29 ? 48   ALA A CA    1 
ATOM   741  C  C     . ALA C 3 48  ? 83.778 5.081   -0.586  1.00 33.63 ? 48   ALA A C     1 
ATOM   742  O  O     . ALA C 3 48  ? 83.406 3.911   -0.698  1.00 35.42 ? 48   ALA A O     1 
ATOM   743  C  CB    . ALA C 3 48  ? 86.249 5.600   -0.503  1.00 30.98 ? 48   ALA A CB    1 
ATOM   744  N  N     . GLU C 3 49  ? 83.165 5.956   0.208   1.00 33.53 ? 49   GLU A N     1 
ATOM   745  C  CA    . GLU C 3 49  ? 81.994 5.573   0.987   1.00 31.69 ? 49   GLU A CA    1 
ATOM   746  C  C     . GLU C 3 49  ? 80.852 5.275   0.013   1.00 30.07 ? 49   GLU A C     1 
ATOM   747  O  O     . GLU C 3 49  ? 80.052 4.386   0.253   1.00 30.49 ? 49   GLU A O     1 
ATOM   748  C  CB    . GLU C 3 49  ? 81.615 6.698   1.958   1.00 31.46 ? 49   GLU A CB    1 
ATOM   749  C  CG    . GLU C 3 49  ? 80.387 6.429   2.832   1.00 33.33 ? 49   GLU A CG    1 
ATOM   750  C  CD    . GLU C 3 49  ? 80.565 5.252   3.797   1.00 36.33 ? 49   GLU A CD    1 
ATOM   751  O  OE1   . GLU C 3 49  ? 81.710 4.969   4.217   1.00 37.01 ? 49   GLU A OE1   1 
ATOM   752  O  OE2   . GLU C 3 49  ? 79.547 4.621   4.154   1.00 38.16 ? 49   GLU A OE2   1 
ATOM   753  N  N     . VAL C 3 50  ? 80.785 6.009   -1.093  1.00 29.69 ? 50   VAL A N     1 
ATOM   754  C  CA    . VAL C 3 50  ? 79.741 5.773   -2.093  1.00 29.49 ? 50   VAL A CA    1 
ATOM   755  C  C     . VAL C 3 50  ? 79.953 4.416   -2.762  1.00 31.13 ? 50   VAL A C     1 
ATOM   756  O  O     . VAL C 3 50  ? 79.000 3.672   -2.992  1.00 31.33 ? 50   VAL A O     1 
ATOM   757  C  CB    . VAL C 3 50  ? 79.746 6.864   -3.192  1.00 28.49 ? 50   VAL A CB    1 
ATOM   758  C  CG1   . VAL C 3 50  ? 78.782 6.496   -4.315  1.00 24.51 ? 50   VAL A CG1   1 
ATOM   759  C  CG2   . VAL C 3 50  ? 79.358 8.197   -2.587  1.00 27.82 ? 50   VAL A CG2   1 
ATOM   760  N  N     . ALA C 3 51  ? 81.206 4.102   -3.075  1.00 30.89 ? 51   ALA A N     1 
ATOM   761  C  CA    . ALA C 3 51  ? 81.543 2.832   -3.715  1.00 33.32 ? 51   ALA A CA    1 
ATOM   762  C  C     . ALA C 3 51  ? 81.139 1.631   -2.852  1.00 34.26 ? 51   ALA A C     1 
ATOM   763  O  O     . ALA C 3 51  ? 80.800 0.573   -3.377  1.00 35.22 ? 51   ALA A O     1 
ATOM   764  C  CB    . ALA C 3 51  ? 83.052 2.778   -4.020  1.00 31.64 ? 51   ALA A CB    1 
ATOM   765  N  N     . ARG C 3 52  ? 81.174 1.798   -1.531  1.00 35.41 ? 52   ARG A N     1 
ATOM   766  C  CA    . ARG C 3 52  ? 80.804 0.721   -0.615  1.00 35.59 ? 52   ARG A CA    1 
ATOM   767  C  C     . ARG C 3 52  ? 79.295 0.609   -0.423  1.00 35.30 ? 52   ARG A C     1 
ATOM   768  O  O     . ARG C 3 52  ? 78.831 -0.250  0.324   1.00 36.85 ? 52   ARG A O     1 
ATOM   769  C  CB    . ARG C 3 52  ? 81.400 0.951   0.773   1.00 38.05 ? 52   ARG A CB    1 
ATOM   770  C  CG    . ARG C 3 52  ? 82.902 1.028   0.880   1.00 39.54 ? 52   ARG A CG    1 
ATOM   771  C  CD    . ARG C 3 52  ? 83.282 1.111   2.358   1.00 41.40 ? 52   ARG A CD    1 
ATOM   772  N  NE    . ARG C 3 52  ? 84.588 1.733   2.549   1.00 44.58 ? 52   ARG A NE    1 
ATOM   773  C  CZ    . ARG C 3 52  ? 84.789 3.045   2.625   1.00 45.16 ? 52   ARG A CZ    1 
ATOM   774  N  NH1   . ARG C 3 52  ? 83.766 3.880   2.534   1.00 46.38 ? 52   ARG A NH1   1 
ATOM   775  N  NH2   . ARG C 3 52  ? 86.017 3.524   2.775   1.00 45.29 ? 52   ARG A NH2   1 
ATOM   776  N  N     . GLY C 3 53  ? 78.528 1.475   -1.073  1.00 33.78 ? 53   GLY A N     1 
ATOM   777  C  CA    . GLY C 3 53  ? 77.090 1.446   -0.873  1.00 31.22 ? 53   GLY A CA    1 
ATOM   778  C  C     . GLY C 3 53  ? 76.807 2.038   0.502   1.00 29.80 ? 53   GLY A C     1 
ATOM   779  O  O     . GLY C 3 53  ? 75.840 1.668   1.172   1.00 30.49 ? 53   GLY A O     1 
ATOM   780  N  N     . GLY C 3 54  ? 77.660 2.973   0.918   1.00 26.82 ? 54   GLY A N     1 
ATOM   781  C  CA    . GLY C 3 54  ? 77.526 3.587   2.227   1.00 24.81 ? 54   GLY A CA    1 
ATOM   782  C  C     . GLY C 3 54  ? 76.655 4.830   2.326   1.00 24.72 ? 54   GLY A C     1 
ATOM   783  O  O     . GLY C 3 54  ? 75.829 5.106   1.459   1.00 25.93 ? 54   GLY A O     1 
ATOM   784  N  N     . LEU C 3 55  ? 76.845 5.587   3.400   1.00 23.36 ? 55   LEU A N     1 
ATOM   785  C  CA    . LEU C 3 55  ? 76.057 6.784   3.635   1.00 23.82 ? 55   LEU A CA    1 
ATOM   786  C  C     . LEU C 3 55  ? 76.919 7.926   4.139   1.00 23.41 ? 55   LEU A C     1 
ATOM   787  O  O     . LEU C 3 55  ? 77.900 7.708   4.852   1.00 21.59 ? 55   LEU A O     1 
ATOM   788  C  CB    . LEU C 3 55  ? 74.947 6.485   4.655   1.00 23.85 ? 55   LEU A CB    1 
ATOM   789  C  CG    . LEU C 3 55  ? 73.766 5.639   4.158   1.00 24.70 ? 55   LEU A CG    1 
ATOM   790  C  CD1   . LEU C 3 55  ? 73.035 4.978   5.325   1.00 23.84 ? 55   LEU A CD1   1 
ATOM   791  C  CD2   . LEU C 3 55  ? 72.821 6.533   3.361   1.00 22.83 ? 55   LEU A CD2   1 
ATOM   792  N  N     . ILE C 3 56  ? 76.544 9.147   3.771   1.00 23.28 ? 56   ILE A N     1 
ATOM   793  C  CA    . ILE C 3 56  ? 77.286 10.325  4.202   1.00 22.45 ? 56   ILE A CA    1 
ATOM   794  C  C     . ILE C 3 56  ? 76.324 11.315  4.844   1.00 23.40 ? 56   ILE A C     1 
ATOM   795  O  O     . ILE C 3 56  ? 75.343 11.732  4.229   1.00 23.28 ? 56   ILE A O     1 
ATOM   796  C  CB    . ILE C 3 56  ? 77.986 10.990  3.018   1.00 23.96 ? 56   ILE A CB    1 
ATOM   797  C  CG1   . ILE C 3 56  ? 78.858 9.956   2.303   1.00 24.99 ? 56   ILE A CG1   1 
ATOM   798  C  CG2   . ILE C 3 56  ? 78.823 12.170  3.498   1.00 22.62 ? 56   ILE A CG2   1 
ATOM   799  C  CD1   . ILE C 3 56  ? 79.401 10.431  0.979   1.00 26.91 ? 56   ILE A CD1   1 
ATOM   800  N  N     . VAL C 3 57  ? 76.623 11.689  6.082   1.00 22.98 ? 57   VAL A N     1 
ATOM   801  C  CA    . VAL C 3 57  ? 75.788 12.604  6.833   1.00 22.67 ? 57   VAL A CA    1 
ATOM   802  C  C     . VAL C 3 57  ? 76.406 13.987  6.922   1.00 23.63 ? 57   VAL A C     1 
ATOM   803  O  O     . VAL C 3 57  ? 77.548 14.141  7.339   1.00 24.28 ? 57   VAL A O     1 
ATOM   804  C  CB    . VAL C 3 57  ? 75.572 12.085  8.277   1.00 25.53 ? 57   VAL A CB    1 
ATOM   805  C  CG1   . VAL C 3 57  ? 74.681 13.041  9.051   1.00 23.29 ? 57   VAL A CG1   1 
ATOM   806  C  CG2   . VAL C 3 57  ? 74.981 10.668  8.247   1.00 24.51 ? 57   VAL A CG2   1 
ATOM   807  N  N     . PHE C 3 58  ? 75.638 14.990  6.517   1.00 21.48 ? 58   PHE A N     1 
ATOM   808  C  CA    . PHE C 3 58  ? 76.060 16.379  6.585   1.00 20.50 ? 58   PHE A CA    1 
ATOM   809  C  C     . PHE C 3 58  ? 74.913 17.062  7.313   1.00 21.21 ? 58   PHE A C     1 
ATOM   810  O  O     . PHE C 3 58  ? 73.808 16.534  7.353   1.00 21.95 ? 58   PHE A O     1 
ATOM   811  C  CB    . PHE C 3 58  ? 76.122 17.012  5.195   1.00 21.73 ? 58   PHE A CB    1 
ATOM   812  C  CG    . PHE C 3 58  ? 77.287 16.595  4.359   1.00 19.63 ? 58   PHE A CG    1 
ATOM   813  C  CD1   . PHE C 3 58  ? 78.552 17.111  4.600   1.00 20.01 ? 58   PHE A CD1   1 
ATOM   814  C  CD2   . PHE C 3 58  ? 77.102 15.755  3.269   1.00 22.25 ? 58   PHE A CD2   1 
ATOM   815  C  CE1   . PHE C 3 58  ? 79.616 16.806  3.765   1.00 20.32 ? 58   PHE A CE1   1 
ATOM   816  C  CE2   . PHE C 3 58  ? 78.161 15.440  2.417   1.00 22.74 ? 58   PHE A CE2   1 
ATOM   817  C  CZ    . PHE C 3 58  ? 79.421 15.966  2.662   1.00 20.48 ? 58   PHE A CZ    1 
ATOM   818  N  N     . HIS C 3 59  ? 75.161 18.217  7.905   1.00 22.03 ? 59   HIS A N     1 
ATOM   819  C  CA    . HIS C 3 59  ? 74.064 18.961  8.513   1.00 22.29 ? 59   HIS A CA    1 
ATOM   820  C  C     . HIS C 3 59  ? 73.871 20.034  7.451   1.00 22.05 ? 59   HIS A C     1 
ATOM   821  O  O     . HIS C 3 59  ? 74.785 20.808  7.203   1.00 20.73 ? 59   HIS A O     1 
ATOM   822  C  CB    . HIS C 3 59  ? 74.467 19.628  9.814   1.00 21.52 ? 59   HIS A CB    1 
ATOM   823  C  CG    . HIS C 3 59  ? 73.344 20.370  10.471  1.00 22.89 ? 59   HIS A CG    1 
ATOM   824  N  ND1   . HIS C 3 59  ? 72.294 19.728  11.094  1.00 21.51 ? 59   HIS A ND1   1 
ATOM   825  C  CD2   . HIS C 3 59  ? 73.118 21.697  10.618  1.00 20.20 ? 59   HIS A CD2   1 
ATOM   826  C  CE1   . HIS C 3 59  ? 71.473 20.629  11.604  1.00 20.52 ? 59   HIS A CE1   1 
ATOM   827  N  NE2   . HIS C 3 59  ? 71.951 21.831  11.330  1.00 22.78 ? 59   HIS A NE2   1 
ATOM   828  N  N     . ASN C 3 60  ? 72.704 20.054  6.811   1.00 21.72 ? 60   ASN A N     1 
ATOM   829  C  CA    . ASN C 3 60  ? 72.411 21.009  5.741   1.00 22.07 ? 60   ASN A CA    1 
ATOM   830  C  C     . ASN C 3 60  ? 73.272 20.743  4.486   1.00 21.42 ? 60   ASN A C     1 
ATOM   831  O  O     . ASN C 3 60  ? 73.576 21.656  3.713   1.00 20.41 ? 60   ASN A O     1 
ATOM   832  C  CB    . ASN C 3 60  ? 72.621 22.458  6.221   1.00 22.61 ? 60   ASN A CB    1 
ATOM   833  C  CG    . ASN C 3 60  ? 72.090 23.481  5.220   1.00 23.89 ? 60   ASN A CG    1 
ATOM   834  O  OD1   . ASN C 3 60  ? 70.941 23.404  4.793   1.00 26.45 ? 60   ASN A OD1   1 
ATOM   835  N  ND2   . ASN C 3 60  ? 72.924 24.430  4.840   1.00 22.36 ? 60   ASN A ND2   1 
ATOM   836  N  N     . GLY C 3 61  ? 73.642 19.484  4.279   1.00 20.07 ? 61   GLY A N     1 
ATOM   837  C  CA    . GLY C 3 61  ? 74.453 19.133  3.129   1.00 19.86 ? 61   GLY A CA    1 
ATOM   838  C  C     . GLY C 3 61  ? 73.689 19.203  1.825   1.00 19.94 ? 61   GLY A C     1 
ATOM   839  O  O     . GLY C 3 61  ? 74.260 19.486  0.773   1.00 21.16 ? 61   GLY A O     1 
ATOM   840  N  N     . HIS C 3 62  ? 72.388 18.958  1.885   1.00 19.32 ? 62   HIS A N     1 
ATOM   841  C  CA    . HIS C 3 62  ? 71.579 18.997  0.675   1.00 19.81 ? 62   HIS A CA    1 
ATOM   842  C  C     . HIS C 3 62  ? 71.572 20.349  -0.012  1.00 19.68 ? 62   HIS A C     1 
ATOM   843  O  O     . HIS C 3 62  ? 71.571 20.421  -1.239  1.00 19.07 ? 62   HIS A O     1 
ATOM   844  C  CB    . HIS C 3 62  ? 70.148 18.564  0.987   1.00 18.50 ? 62   HIS A CB    1 
ATOM   845  C  CG    . HIS C 3 62  ? 69.979 17.081  1.017   1.00 17.88 ? 62   HIS A CG    1 
ATOM   846  N  ND1   . HIS C 3 62  ? 70.905 16.245  1.599   1.00 16.13 ? 62   HIS A ND1   1 
ATOM   847  C  CD2   . HIS C 3 62  ? 69.003 16.283  0.528   1.00 16.12 ? 62   HIS A CD2   1 
ATOM   848  C  CE1   . HIS C 3 62  ? 70.506 14.994  1.468   1.00 17.69 ? 62   HIS A CE1   1 
ATOM   849  N  NE2   . HIS C 3 62  ? 69.355 14.989  0.822   1.00 16.94 ? 62   HIS A NE2   1 
ATOM   850  N  N     . LYS C 3 63  ? 71.571 21.422  0.770   1.00 19.61 ? 63   LYS A N     1 
ATOM   851  C  CA    . LYS C 3 63  ? 71.550 22.748  0.172   1.00 21.32 ? 63   LYS A CA    1 
ATOM   852  C  C     . LYS C 3 63  ? 72.917 23.383  -0.006  1.00 21.09 ? 63   LYS A C     1 
ATOM   853  O  O     . LYS C 3 63  ? 73.096 24.225  -0.892  1.00 21.86 ? 63   LYS A O     1 
ATOM   854  C  CB    . LYS C 3 63  ? 70.645 23.682  0.979   1.00 23.07 ? 63   LYS A CB    1 
ATOM   855  C  CG    . LYS C 3 63  ? 69.170 23.346  0.818   1.00 28.22 ? 63   LYS A CG    1 
ATOM   856  C  CD    . LYS C 3 63  ? 68.251 24.287  1.599   1.00 30.47 ? 63   LYS A CD    1 
ATOM   857  C  CE    . LYS C 3 63  ? 68.291 25.707  1.059   1.00 33.04 ? 63   LYS A CE    1 
ATOM   858  N  NZ    . LYS C 3 63  ? 67.135 26.488  1.590   1.00 35.55 ? 63   LYS A NZ    1 
ATOM   859  N  N     . TYR C 3 64  ? 73.882 22.976  0.812   1.00 19.51 ? 64   TYR A N     1 
ATOM   860  C  CA    . TYR C 3 64  ? 75.213 23.555  0.718   1.00 20.91 ? 64   TYR A CA    1 
ATOM   861  C  C     . TYR C 3 64  ? 76.398 22.620  0.410   1.00 21.34 ? 64   TYR A C     1 
ATOM   862  O  O     . TYR C 3 64  ? 76.877 22.580  -0.721  1.00 20.37 ? 64   TYR A O     1 
ATOM   863  C  CB    . TYR C 3 64  ? 75.532 24.347  1.990   1.00 21.72 ? 64   TYR A CB    1 
ATOM   864  C  CG    . TYR C 3 64  ? 76.834 25.115  1.881   1.00 24.15 ? 64   TYR A CG    1 
ATOM   865  C  CD1   . TYR C 3 64  ? 76.934 26.230  1.052   1.00 26.08 ? 64   TYR A CD1   1 
ATOM   866  C  CD2   . TYR C 3 64  ? 77.977 24.700  2.572   1.00 23.80 ? 64   TYR A CD2   1 
ATOM   867  C  CE1   . TYR C 3 64  ? 78.144 26.918  0.909   1.00 26.41 ? 64   TYR A CE1   1 
ATOM   868  C  CE2   . TYR C 3 64  ? 79.180 25.371  2.438   1.00 23.77 ? 64   TYR A CE2   1 
ATOM   869  C  CZ    . TYR C 3 64  ? 79.260 26.481  1.603   1.00 24.88 ? 64   TYR A CZ    1 
ATOM   870  O  OH    . TYR C 3 64  ? 80.453 27.139  1.445   1.00 24.10 ? 64   TYR A OH    1 
ATOM   871  N  N     . ASP C 3 65  ? 76.874 21.886  1.416   1.00 20.04 ? 65   ASP A N     1 
ATOM   872  C  CA    . ASP C 3 65  ? 78.034 21.005  1.236   1.00 21.25 ? 65   ASP A CA    1 
ATOM   873  C  C     . ASP C 3 65  ? 78.116 20.191  -0.051  1.00 21.95 ? 65   ASP A C     1 
ATOM   874  O  O     . ASP C 3 65  ? 79.148 20.208  -0.721  1.00 22.10 ? 65   ASP A O     1 
ATOM   875  C  CB    . ASP C 3 65  ? 78.167 20.061  2.427   1.00 20.25 ? 65   ASP A CB    1 
ATOM   876  C  CG    . ASP C 3 65  ? 78.177 20.804  3.739   1.00 21.61 ? 65   ASP A CG    1 
ATOM   877  O  OD1   . ASP C 3 65  ? 77.160 21.467  4.019   1.00 23.44 ? 65   ASP A OD1   1 
ATOM   878  O  OD2   . ASP C 3 65  ? 79.192 20.745  4.472   1.00 22.56 ? 65   ASP A OD2   1 
ATOM   879  N  N     . VAL C 3 66  ? 77.044 19.476  -0.389  1.00 22.16 ? 66   VAL A N     1 
ATOM   880  C  CA    . VAL C 3 66  ? 77.028 18.652  -1.587  1.00 22.85 ? 66   VAL A CA    1 
ATOM   881  C  C     . VAL C 3 66  ? 77.140 19.461  -2.883  1.00 23.47 ? 66   VAL A C     1 
ATOM   882  O  O     . VAL C 3 66  ? 78.053 19.236  -3.667  1.00 24.24 ? 66   VAL A O     1 
ATOM   883  C  CB    . VAL C 3 66  ? 75.778 17.738  -1.606  1.00 23.32 ? 66   VAL A CB    1 
ATOM   884  C  CG1   . VAL C 3 66  ? 75.671 16.993  -2.942  1.00 22.64 ? 66   VAL A CG1   1 
ATOM   885  C  CG2   . VAL C 3 66  ? 75.884 16.735  -0.465  1.00 22.35 ? 66   VAL A CG2   1 
ATOM   886  N  N     . PRO C 3 67  ? 76.207 20.392  -3.142  1.00 23.16 ? 67   PRO A N     1 
ATOM   887  C  CA    . PRO C 3 67  ? 76.387 21.139  -4.395  1.00 21.48 ? 67   PRO A CA    1 
ATOM   888  C  C     . PRO C 3 67  ? 77.695 21.945  -4.354  1.00 22.91 ? 67   PRO A C     1 
ATOM   889  O  O     . PRO C 3 67  ? 78.359 22.131  -5.378  1.00 22.92 ? 67   PRO A O     1 
ATOM   890  C  CB    . PRO C 3 67  ? 75.146 22.036  -4.456  1.00 21.51 ? 67   PRO A CB    1 
ATOM   891  C  CG    . PRO C 3 67  ? 74.771 22.217  -3.001  1.00 22.52 ? 67   PRO A CG    1 
ATOM   892  C  CD    . PRO C 3 67  ? 74.981 20.816  -2.440  1.00 22.07 ? 67   PRO A CD    1 
ATOM   893  N  N     . ALA C 3 68  ? 78.071 22.420  -3.171  1.00 20.78 ? 68   ALA A N     1 
ATOM   894  C  CA    . ALA C 3 68  ? 79.316 23.171  -3.057  1.00 22.85 ? 68   ALA A CA    1 
ATOM   895  C  C     . ALA C 3 68  ? 80.519 22.303  -3.450  1.00 22.15 ? 68   ALA A C     1 
ATOM   896  O  O     . ALA C 3 68  ? 81.433 22.776  -4.129  1.00 21.49 ? 68   ALA A O     1 
ATOM   897  C  CB    . ALA C 3 68  ? 79.499 23.724  -1.630  1.00 20.93 ? 68   ALA A CB    1 
ATOM   898  N  N     . LEU C 3 69  ? 80.520 21.039  -3.032  1.00 21.99 ? 69   LEU A N     1 
ATOM   899  C  CA    . LEU C 3 69  ? 81.627 20.151  -3.373  1.00 23.53 ? 69   LEU A CA    1 
ATOM   900  C  C     . LEU C 3 69  ? 81.690 19.909  -4.887  1.00 25.82 ? 69   LEU A C     1 
ATOM   901  O  O     . LEU C 3 69  ? 82.778 19.814  -5.469  1.00 26.11 ? 69   LEU A O     1 
ATOM   902  C  CB    . LEU C 3 69  ? 81.502 18.822  -2.625  1.00 23.84 ? 69   LEU A CB    1 
ATOM   903  C  CG    . LEU C 3 69  ? 81.896 18.855  -1.146  1.00 25.72 ? 69   LEU A CG    1 
ATOM   904  C  CD1   . LEU C 3 69  ? 81.576 17.510  -0.512  1.00 23.80 ? 69   LEU A CD1   1 
ATOM   905  C  CD2   . LEU C 3 69  ? 83.390 19.187  -1.002  1.00 24.18 ? 69   LEU A CD2   1 
ATOM   906  N  N     . THR C 3 70  ? 80.527 19.805  -5.522  1.00 25.53 ? 70   THR A N     1 
ATOM   907  C  CA    . THR C 3 70  ? 80.470 19.611  -6.961  1.00 25.82 ? 70   THR A CA    1 
ATOM   908  C  C     . THR C 3 70  ? 81.103 20.824  -7.638  1.00 27.01 ? 70   THR A C     1 
ATOM   909  O  O     . THR C 3 70  ? 81.916 20.691  -8.554  1.00 27.03 ? 70   THR A O     1 
ATOM   910  C  CB    . THR C 3 70  ? 79.019 19.490  -7.454  1.00 25.96 ? 70   THR A CB    1 
ATOM   911  O  OG1   . THR C 3 70  ? 78.457 18.260  -6.984  1.00 28.39 ? 70   THR A OG1   1 
ATOM   912  C  CG2   . THR C 3 70  ? 78.965 19.524  -8.980  1.00 24.44 ? 70   THR A CG2   1 
ATOM   913  N  N     . LYS C 3 71  ? 80.721 22.009  -7.171  1.00 26.59 ? 71   LYS A N     1 
ATOM   914  C  CA    . LYS C 3 71  ? 81.235 23.254  -7.720  1.00 26.36 ? 71   LYS A CA    1 
ATOM   915  C  C     . LYS C 3 71  ? 82.736 23.437  -7.480  1.00 26.06 ? 71   LYS A C     1 
ATOM   916  O  O     . LYS C 3 71  ? 83.476 23.735  -8.407  1.00 26.61 ? 71   LYS A O     1 
ATOM   917  C  CB    . LYS C 3 71  ? 80.462 24.435  -7.132  1.00 27.46 ? 71   LYS A CB    1 
ATOM   918  C  CG    . LYS C 3 71  ? 80.954 25.792  -7.594  1.00 29.63 ? 71   LYS A CG    1 
ATOM   919  C  CD    . LYS C 3 71  ? 79.961 26.904  -7.262  1.00 30.23 ? 71   LYS A CD    1 
ATOM   920  C  CE    . LYS C 3 71  ? 80.459 28.232  -7.796  1.00 29.87 ? 71   LYS A CE    1 
ATOM   921  N  NZ    . LYS C 3 71  ? 79.614 29.361  -7.347  1.00 32.66 ? 71   LYS A NZ    1 
ATOM   922  N  N     . LEU C 3 72  ? 83.186 23.256  -6.244  1.00 25.43 ? 72   LEU A N     1 
ATOM   923  C  CA    . LEU C 3 72  ? 84.600 23.430  -5.934  1.00 26.31 ? 72   LEU A CA    1 
ATOM   924  C  C     . LEU C 3 72  ? 85.489 22.400  -6.612  1.00 27.23 ? 72   LEU A C     1 
ATOM   925  O  O     . LEU C 3 72  ? 86.615 22.709  -6.996  1.00 28.41 ? 72   LEU A O     1 
ATOM   926  C  CB    . LEU C 3 72  ? 84.824 23.395  -4.422  1.00 24.43 ? 72   LEU A CB    1 
ATOM   927  C  CG    . LEU C 3 72  ? 84.117 24.551  -3.719  1.00 25.84 ? 72   LEU A CG    1 
ATOM   928  C  CD1   . LEU C 3 72  ? 84.265 24.426  -2.211  1.00 23.92 ? 72   LEU A CD1   1 
ATOM   929  C  CD2   . LEU C 3 72  ? 84.695 25.865  -4.225  1.00 24.38 ? 72   LEU A CD2   1 
ATOM   930  N  N     . ALA C 3 73  ? 84.988 21.179  -6.766  1.00 27.53 ? 73   ALA A N     1 
ATOM   931  C  CA    . ALA C 3 73  ? 85.774 20.134  -7.411  1.00 27.43 ? 73   ALA A CA    1 
ATOM   932  C  C     . ALA C 3 73  ? 86.095 20.552  -8.850  1.00 28.63 ? 73   ALA A C     1 
ATOM   933  O  O     . ALA C 3 73  ? 87.225 20.415  -9.307  1.00 28.67 ? 73   ALA A O     1 
ATOM   934  C  CB    . ALA C 3 73  ? 85.008 18.808  -7.394  1.00 26.07 ? 73   ALA A CB    1 
ATOM   935  N  N     . LYS C 3 74  ? 85.098 21.075  -9.552  1.00 29.57 ? 74   LYS A N     1 
ATOM   936  C  CA    . LYS C 3 74  ? 85.281 21.508  -10.927 1.00 31.62 ? 74   LYS A CA    1 
ATOM   937  C  C     . LYS C 3 74  ? 86.215 22.718  -11.017 1.00 32.22 ? 74   LYS A C     1 
ATOM   938  O  O     . LYS C 3 74  ? 87.144 22.732  -11.817 1.00 31.02 ? 74   LYS A O     1 
ATOM   939  C  CB    . LYS C 3 74  ? 83.928 21.852  -11.563 1.00 32.16 ? 74   LYS A CB    1 
ATOM   940  C  CG    . LYS C 3 74  ? 84.021 22.247  -13.033 1.00 33.62 ? 74   LYS A CG    1 
ATOM   941  C  CD    . LYS C 3 74  ? 84.598 21.106  -13.858 1.00 38.67 ? 74   LYS A CD    1 
ATOM   942  C  CE    . LYS C 3 74  ? 84.984 21.558  -15.264 1.00 42.62 ? 74   LYS A CE    1 
ATOM   943  N  NZ    . LYS C 3 74  ? 85.658 20.465  -16.041 1.00 43.50 ? 74   LYS A NZ    1 
ATOM   944  N  N     . LEU C 3 75  ? 85.966 23.729  -10.189 1.00 31.97 ? 75   LEU A N     1 
ATOM   945  C  CA    . LEU C 3 75  ? 86.790 24.932  -10.190 1.00 32.79 ? 75   LEU A CA    1 
ATOM   946  C  C     . LEU C 3 75  ? 88.248 24.711  -9.788  1.00 31.37 ? 75   LEU A C     1 
ATOM   947  O  O     . LEU C 3 75  ? 89.167 25.089  -10.516 1.00 30.10 ? 75   LEU A O     1 
ATOM   948  C  CB    . LEU C 3 75  ? 86.187 25.988  -9.262  1.00 32.90 ? 75   LEU A CB    1 
ATOM   949  C  CG    . LEU C 3 75  ? 85.047 26.834  -9.823  1.00 36.93 ? 75   LEU A CG    1 
ATOM   950  C  CD1   . LEU C 3 75  ? 84.335 27.551  -8.667  1.00 36.77 ? 75   LEU A CD1   1 
ATOM   951  C  CD2   . LEU C 3 75  ? 85.601 27.833  -10.845 1.00 35.30 ? 75   LEU A CD2   1 
ATOM   952  N  N     . GLN C 3 76  ? 88.455 24.094  -8.632  1.00 30.81 ? 76   GLN A N     1 
ATOM   953  C  CA    . GLN C 3 76  ? 89.799 23.873  -8.122  1.00 31.21 ? 76   GLN A CA    1 
ATOM   954  C  C     . GLN C 3 76  ? 90.595 22.714  -8.692  1.00 31.40 ? 76   GLN A C     1 
ATOM   955  O  O     . GLN C 3 76  ? 91.819 22.800  -8.785  1.00 31.65 ? 76   GLN A O     1 
ATOM   956  C  CB    . GLN C 3 76  ? 89.762 23.734  -6.601  1.00 30.18 ? 76   GLN A CB    1 
ATOM   957  C  CG    . GLN C 3 76  ? 89.433 25.028  -5.886  1.00 32.14 ? 76   GLN A CG    1 
ATOM   958  C  CD    . GLN C 3 76  ? 89.488 24.899  -4.380  1.00 33.28 ? 76   GLN A CD    1 
ATOM   959  O  OE1   . GLN C 3 76  ? 88.582 24.349  -3.755  1.00 34.02 ? 76   GLN A OE1   1 
ATOM   960  N  NE2   . GLN C 3 76  ? 90.560 25.404  -3.786  1.00 35.93 ? 76   GLN A NE2   1 
ATOM   961  N  N     . LEU C 3 77  ? 89.917 21.639  -9.078  1.00 31.55 ? 77   LEU A N     1 
ATOM   962  C  CA    . LEU C 3 77  ? 90.611 20.459  -9.578  1.00 32.62 ? 77   LEU A CA    1 
ATOM   963  C  C     . LEU C 3 77  ? 90.188 20.013  -10.956 1.00 33.52 ? 77   LEU A C     1 
ATOM   964  O  O     . LEU C 3 77  ? 90.702 19.028  -11.477 1.00 33.96 ? 77   LEU A O     1 
ATOM   965  C  CB    . LEU C 3 77  ? 90.383 19.303  -8.613  1.00 33.55 ? 77   LEU A CB    1 
ATOM   966  C  CG    . LEU C 3 77  ? 90.800 19.573  -7.175  1.00 33.34 ? 77   LEU A CG    1 
ATOM   967  C  CD1   . LEU C 3 77  ? 90.258 18.482  -6.262  1.00 34.17 ? 77   LEU A CD1   1 
ATOM   968  C  CD2   . LEU C 3 77  ? 92.309 19.643  -7.117  1.00 34.28 ? 77   LEU A CD2   1 
ATOM   969  N  N     . ASN C 3 78  ? 89.251 20.734  -11.551 1.00 35.46 ? 78   ASN A N     1 
ATOM   970  C  CA    . ASN C 3 78  ? 88.746 20.357  -12.858 1.00 36.18 ? 78   ASN A CA    1 
ATOM   971  C  C     . ASN C 3 78  ? 88.340 18.884  -12.791 1.00 35.51 ? 78   ASN A C     1 
ATOM   972  O  O     . ASN C 3 78  ? 88.716 18.075  -13.641 1.00 35.62 ? 78   ASN A O     1 
ATOM   973  C  CB    . ASN C 3 78  ? 89.811 20.580  -13.937 1.00 37.51 ? 78   ASN A CB    1 
ATOM   974  C  CG    . ASN C 3 78  ? 89.275 20.336  -15.327 1.00 40.19 ? 78   ASN A CG    1 
ATOM   975  O  OD1   . ASN C 3 78  ? 88.113 20.639  -15.614 1.00 42.28 ? 78   ASN A OD1   1 
ATOM   976  N  ND2   . ASN C 3 78  ? 90.114 19.799  -16.204 1.00 42.02 ? 78   ASN A ND2   1 
ATOM   977  N  N     . ARG C 3 79  ? 87.581 18.545  -11.751 1.00 34.08 ? 79   ARG A N     1 
ATOM   978  C  CA    . ARG C 3 79  ? 87.105 17.181  -11.555 1.00 32.25 ? 79   ARG A CA    1 
ATOM   979  C  C     . ARG C 3 79  ? 85.583 17.160  -11.475 1.00 31.73 ? 79   ARG A C     1 
ATOM   980  O  O     . ARG C 3 79  ? 84.971 18.089  -10.940 1.00 31.07 ? 79   ARG A O     1 
ATOM   981  C  CB    . ARG C 3 79  ? 87.666 16.584  -10.254 1.00 32.87 ? 79   ARG A CB    1 
ATOM   982  C  CG    . ARG C 3 79  ? 87.254 15.130  -10.050 1.00 32.49 ? 79   ARG A CG    1 
ATOM   983  C  CD    . ARG C 3 79  ? 87.050 14.712  -8.597  1.00 31.59 ? 79   ARG A CD    1 
ATOM   984  N  NE    . ARG C 3 79  ? 88.274 14.617  -7.812  1.00 30.88 ? 79   ARG A NE    1 
ATOM   985  C  CZ    . ARG C 3 79  ? 88.497 13.684  -6.887  1.00 29.66 ? 79   ARG A CZ    1 
ATOM   986  N  NH1   . ARG C 3 79  ? 87.584 12.749  -6.635  1.00 28.82 ? 79   ARG A NH1   1 
ATOM   987  N  NH2   . ARG C 3 79  ? 89.621 13.704  -6.184  1.00 26.53 ? 79   ARG A NH2   1 
ATOM   988  N  N     . GLU C 3 80  ? 84.982 16.098  -12.011 1.00 31.39 ? 80   GLU A N     1 
ATOM   989  C  CA    . GLU C 3 80  ? 83.534 15.914  -11.974 1.00 30.63 ? 80   GLU A CA    1 
ATOM   990  C  C     . GLU C 3 80  ? 83.244 15.109  -10.703 1.00 30.05 ? 80   GLU A C     1 
ATOM   991  O  O     . GLU C 3 80  ? 83.739 13.993  -10.536 1.00 30.66 ? 80   GLU A O     1 
ATOM   992  C  CB    . GLU C 3 80  ? 83.052 15.140  -13.206 1.00 31.53 ? 80   GLU A CB    1 
ATOM   993  C  CG    . GLU C 3 80  ? 83.119 15.910  -14.529 1.00 37.53 ? 80   GLU A CG    1 
ATOM   994  C  CD    . GLU C 3 80  ? 82.232 17.157  -14.560 1.00 41.48 ? 80   GLU A CD    1 
ATOM   995  O  OE1   . GLU C 3 80  ? 81.124 17.128  -13.984 1.00 42.42 ? 80   GLU A OE1   1 
ATOM   996  O  OE2   . GLU C 3 80  ? 82.633 18.169  -15.179 1.00 45.60 ? 80   GLU A OE2   1 
ATOM   997  N  N     . PHE C 3 81  ? 82.448 15.678  -9.806  1.00 28.08 ? 81   PHE A N     1 
ATOM   998  C  CA    . PHE C 3 81  ? 82.123 15.025  -8.542  1.00 26.70 ? 81   PHE A CA    1 
ATOM   999  C  C     . PHE C 3 81  ? 80.638 15.245  -8.253  1.00 27.41 ? 81   PHE A C     1 
ATOM   1000 O  O     . PHE C 3 81  ? 80.173 16.383  -8.128  1.00 27.24 ? 81   PHE A O     1 
ATOM   1001 C  CB    . PHE C 3 81  ? 82.990 15.637  -7.440  1.00 28.25 ? 81   PHE A CB    1 
ATOM   1002 C  CG    . PHE C 3 81  ? 82.692 15.127  -6.064  1.00 28.37 ? 81   PHE A CG    1 
ATOM   1003 C  CD1   . PHE C 3 81  ? 83.298 13.968  -5.588  1.00 25.90 ? 81   PHE A CD1   1 
ATOM   1004 C  CD2   . PHE C 3 81  ? 81.834 15.831  -5.222  1.00 27.18 ? 81   PHE A CD2   1 
ATOM   1005 C  CE1   . PHE C 3 81  ? 83.060 13.522  -4.294  1.00 26.67 ? 81   PHE A CE1   1 
ATOM   1006 C  CE2   . PHE C 3 81  ? 81.591 15.389  -3.920  1.00 27.99 ? 81   PHE A CE2   1 
ATOM   1007 C  CZ    . PHE C 3 81  ? 82.208 14.232  -3.455  1.00 25.23 ? 81   PHE A CZ    1 
ATOM   1008 N  N     . HIS C 3 82  ? 79.891 14.152  -8.159  1.00 27.05 ? 82   HIS A N     1 
ATOM   1009 C  CA    . HIS C 3 82  ? 78.460 14.231  -7.911  1.00 27.19 ? 82   HIS A CA    1 
ATOM   1010 C  C     . HIS C 3 82  ? 78.007 13.147  -6.946  1.00 26.73 ? 82   HIS A C     1 
ATOM   1011 O  O     . HIS C 3 82  ? 77.818 11.998  -7.341  1.00 25.42 ? 82   HIS A O     1 
ATOM   1012 C  CB    . HIS C 3 82  ? 77.701 14.081  -9.237  1.00 28.06 ? 82   HIS A CB    1 
ATOM   1013 C  CG    . HIS C 3 82  ? 78.202 14.988  -10.319 1.00 30.87 ? 82   HIS A CG    1 
ATOM   1014 N  ND1   . HIS C 3 82  ? 77.687 16.249  -10.535 1.00 30.63 ? 82   HIS A ND1   1 
ATOM   1015 C  CD2   . HIS C 3 82  ? 79.221 14.842  -11.198 1.00 31.18 ? 82   HIS A CD2   1 
ATOM   1016 C  CE1   . HIS C 3 82  ? 78.368 16.841  -11.499 1.00 29.85 ? 82   HIS A CE1   1 
ATOM   1017 N  NE2   . HIS C 3 82  ? 79.305 16.010  -11.918 1.00 30.72 ? 82   HIS A NE2   1 
ATOM   1018 N  N     . LEU C 3 83  ? 77.860 13.498  -5.671  1.00 27.62 ? 83   LEU A N     1 
ATOM   1019 C  CA    . LEU C 3 83  ? 77.384 12.515  -4.702  1.00 25.48 ? 83   LEU A CA    1 
ATOM   1020 C  C     . LEU C 3 83  ? 75.940 12.197  -5.070  1.00 24.15 ? 83   LEU A C     1 
ATOM   1021 O  O     . LEU C 3 83  ? 75.139 13.096  -5.307  1.00 22.98 ? 83   LEU A O     1 
ATOM   1022 C  CB    . LEU C 3 83  ? 77.442 13.073  -3.279  1.00 24.95 ? 83   LEU A CB    1 
ATOM   1023 C  CG    . LEU C 3 83  ? 78.853 13.286  -2.735  1.00 26.22 ? 83   LEU A CG    1 
ATOM   1024 C  CD1   . LEU C 3 83  ? 78.800 13.984  -1.397  1.00 23.43 ? 83   LEU A CD1   1 
ATOM   1025 C  CD2   . LEU C 3 83  ? 79.554 11.940  -2.625  1.00 27.01 ? 83   LEU A CD2   1 
ATOM   1026 N  N     . PRO C 3 84  ? 75.599 10.908  -5.166  1.00 24.89 ? 84   PRO A N     1 
ATOM   1027 C  CA    . PRO C 3 84  ? 74.223 10.542  -5.511  1.00 24.79 ? 84   PRO A CA    1 
ATOM   1028 C  C     . PRO C 3 84  ? 73.288 10.805  -4.317  1.00 25.76 ? 84   PRO A C     1 
ATOM   1029 O  O     . PRO C 3 84  ? 73.655 10.593  -3.167  1.00 26.65 ? 84   PRO A O     1 
ATOM   1030 C  CB    . PRO C 3 84  ? 74.335 9.050   -5.843  1.00 25.98 ? 84   PRO A CB    1 
ATOM   1031 C  CG    . PRO C 3 84  ? 75.785 8.871   -6.231  1.00 23.69 ? 84   PRO A CG    1 
ATOM   1032 C  CD    . PRO C 3 84  ? 76.484 9.733   -5.213  1.00 24.49 ? 84   PRO A CD    1 
ATOM   1033 N  N     . ARG C 3 85  ? 72.088 11.285  -4.607  1.00 26.17 ? 85   ARG A N     1 
ATOM   1034 C  CA    . ARG C 3 85  ? 71.080 11.589  -3.596  1.00 26.59 ? 85   ARG A CA    1 
ATOM   1035 C  C     . ARG C 3 85  ? 70.858 10.469  -2.564  1.00 26.94 ? 85   ARG A C     1 
ATOM   1036 O  O     . ARG C 3 85  ? 70.797 10.725  -1.354  1.00 24.82 ? 85   ARG A O     1 
ATOM   1037 C  CB    . ARG C 3 85  ? 69.759 11.894  -4.304  1.00 27.56 ? 85   ARG A CB    1 
ATOM   1038 C  CG    . ARG C 3 85  ? 68.624 12.313  -3.411  1.00 29.25 ? 85   ARG A CG    1 
ATOM   1039 C  CD    . ARG C 3 85  ? 67.408 11.484  -3.719  1.00 33.21 ? 85   ARG A CD    1 
ATOM   1040 N  NE    . ARG C 3 85  ? 67.360 10.319  -2.849  1.00 36.09 ? 85   ARG A NE    1 
ATOM   1041 C  CZ    . ARG C 3 85  ? 66.977 9.106   -3.229  1.00 35.01 ? 85   ARG A CZ    1 
ATOM   1042 N  NH1   . ARG C 3 85  ? 66.607 8.877   -4.483  1.00 32.94 ? 85   ARG A NH1   1 
ATOM   1043 N  NH2   . ARG C 3 85  ? 66.958 8.124   -2.340  1.00 35.43 ? 85   ARG A NH2   1 
ATOM   1044 N  N     . GLU C 3 86  ? 70.733 9.237   -3.047  1.00 26.10 ? 86   GLU A N     1 
ATOM   1045 C  CA    . GLU C 3 86  ? 70.496 8.086   -2.181  1.00 26.70 ? 86   GLU A CA    1 
ATOM   1046 C  C     . GLU C 3 86  ? 71.595 7.807   -1.146  1.00 26.32 ? 86   GLU A C     1 
ATOM   1047 O  O     . GLU C 3 86  ? 71.351 7.118   -0.163  1.00 25.39 ? 86   GLU A O     1 
ATOM   1048 C  CB    . GLU C 3 86  ? 70.262 6.823   -3.025  1.00 28.27 ? 86   GLU A CB    1 
ATOM   1049 C  CG    . GLU C 3 86  ? 71.442 6.430   -3.896  1.00 31.75 ? 86   GLU A CG    1 
ATOM   1050 C  CD    . GLU C 3 86  ? 71.259 6.818   -5.352  1.00 37.31 ? 86   GLU A CD    1 
ATOM   1051 O  OE1   . GLU C 3 86  ? 70.791 7.957   -5.626  1.00 36.49 ? 86   GLU A OE1   1 
ATOM   1052 O  OE2   . GLU C 3 86  ? 71.599 5.978   -6.224  1.00 36.96 ? 86   GLU A OE2   1 
ATOM   1053 N  N     . ASN C 3 87  ? 72.796 8.338   -1.349  1.00 25.23 ? 87   ASN A N     1 
ATOM   1054 C  CA    . ASN C 3 87  ? 73.870 8.096   -0.388  1.00 24.21 ? 87   ASN A CA    1 
ATOM   1055 C  C     . ASN C 3 87  ? 74.013 9.207   0.642   1.00 23.32 ? 87   ASN A C     1 
ATOM   1056 O  O     . ASN C 3 87  ? 74.904 9.143   1.488   1.00 20.59 ? 87   ASN A O     1 
ATOM   1057 C  CB    . ASN C 3 87  ? 75.225 7.944   -1.096  1.00 26.20 ? 87   ASN A CB    1 
ATOM   1058 C  CG    . ASN C 3 87  ? 75.251 6.797   -2.088  1.00 26.26 ? 87   ASN A CG    1 
ATOM   1059 O  OD1   . ASN C 3 87  ? 74.991 6.983   -3.276  1.00 26.92 ? 87   ASN A OD1   1 
ATOM   1060 N  ND2   . ASN C 3 87  ? 75.562 5.598   -1.598  1.00 25.82 ? 87   ASN A ND2   1 
ATOM   1061 N  N     . CYS C 3 88  ? 73.143 10.214  0.579   1.00 21.88 ? 88   CYS A N     1 
ATOM   1062 C  CA    . CYS C 3 88  ? 73.250 11.341  1.493   1.00 21.89 ? 88   CYS A CA    1 
ATOM   1063 C  C     . CYS C 3 88  ? 72.143 11.516  2.514   1.00 21.17 ? 88   CYS A C     1 
ATOM   1064 O  O     . CYS C 3 88  ? 70.959 11.437  2.192   1.00 19.10 ? 88   CYS A O     1 
ATOM   1065 C  CB    . CYS C 3 88  ? 73.373 12.636  0.691   1.00 23.37 ? 88   CYS A CB    1 
ATOM   1066 S  SG    . CYS C 3 88  ? 74.821 12.709  -0.382  1.00 28.70 ? 88   CYS A SG    1 
ATOM   1067 N  N     . ILE C 3 89  ? 72.548 11.776  3.750   1.00 20.08 ? 89   ILE A N     1 
ATOM   1068 C  CA    . ILE C 3 89  ? 71.605 12.016  4.834   1.00 20.84 ? 89   ILE A CA    1 
ATOM   1069 C  C     . ILE C 3 89  ? 71.870 13.450  5.291   1.00 20.73 ? 89   ILE A C     1 
ATOM   1070 O  O     . ILE C 3 89  ? 72.996 13.931  5.204   1.00 21.70 ? 89   ILE A O     1 
ATOM   1071 C  CB    . ILE C 3 89  ? 71.832 11.034  6.009   1.00 23.34 ? 89   ILE A CB    1 
ATOM   1072 C  CG1   . ILE C 3 89  ? 71.466 9.616   5.571   1.00 23.89 ? 89   ILE A CG1   1 
ATOM   1073 C  CG2   . ILE C 3 89  ? 70.992 11.456  7.231   1.00 23.96 ? 89   ILE A CG2   1 
ATOM   1074 C  CD1   . ILE C 3 89  ? 71.899 8.543   6.562   1.00 26.47 ? 89   ILE A CD1   1 
ATOM   1075 N  N     . ASP C 3 90  ? 70.834 14.134  5.759   1.00 21.27 ? 90   ASP A N     1 
ATOM   1076 C  CA    . ASP C 3 90  ? 70.970 15.514  6.202   1.00 20.88 ? 90   ASP A CA    1 
ATOM   1077 C  C     . ASP C 3 90  ? 70.297 15.661  7.573   1.00 21.59 ? 90   ASP A C     1 
ATOM   1078 O  O     . ASP C 3 90  ? 69.072 15.555  7.685   1.00 20.05 ? 90   ASP A O     1 
ATOM   1079 C  CB    . ASP C 3 90  ? 70.299 16.443  5.178   1.00 23.95 ? 90   ASP A CB    1 
ATOM   1080 C  CG    . ASP C 3 90  ? 70.610 17.914  5.418   1.00 28.56 ? 90   ASP A CG    1 
ATOM   1081 O  OD1   . ASP C 3 90  ? 70.585 18.351  6.590   1.00 30.87 ? 90   ASP A OD1   1 
ATOM   1082 O  OD2   . ASP C 3 90  ? 70.863 18.643  4.431   1.00 29.64 ? 90   ASP A OD2   1 
ATOM   1083 N  N     . THR C 3 91  ? 71.092 15.905  8.609   1.00 20.26 ? 91   THR A N     1 
ATOM   1084 C  CA    . THR C 3 91  ? 70.537 16.057  9.940   1.00 20.85 ? 91   THR A CA    1 
ATOM   1085 C  C     . THR C 3 91  ? 69.633 17.281  10.084  1.00 21.93 ? 91   THR A C     1 
ATOM   1086 O  O     . THR C 3 91  ? 68.799 17.323  10.978  1.00 23.25 ? 91   THR A O     1 
ATOM   1087 C  CB    . THR C 3 91  ? 71.639 16.100  11.011  1.00 19.65 ? 91   THR A CB    1 
ATOM   1088 O  OG1   . THR C 3 91  ? 72.623 17.083  10.661  1.00 19.96 ? 91   THR A OG1   1 
ATOM   1089 C  CG2   . THR C 3 91  ? 72.287 14.714  11.145  1.00 19.48 ? 91   THR A CG2   1 
ATOM   1090 N  N     . LEU C 3 92  ? 69.781 18.281  9.226   1.00 22.01 ? 92   LEU A N     1 
ATOM   1091 C  CA    . LEU C 3 92  ? 68.892 19.432  9.339   1.00 23.91 ? 92   LEU A CA    1 
ATOM   1092 C  C     . LEU C 3 92  ? 67.516 18.997  8.838   1.00 24.81 ? 92   LEU A C     1 
ATOM   1093 O  O     . LEU C 3 92  ? 66.491 19.318  9.443   1.00 26.02 ? 92   LEU A O     1 
ATOM   1094 C  CB    . LEU C 3 92  ? 69.386 20.623  8.515   1.00 22.00 ? 92   LEU A CB    1 
ATOM   1095 C  CG    . LEU C 3 92  ? 68.436 21.828  8.603   1.00 24.77 ? 92   LEU A CG    1 
ATOM   1096 C  CD1   . LEU C 3 92  ? 68.256 22.242  10.085  1.00 23.90 ? 92   LEU A CD1   1 
ATOM   1097 C  CD2   . LEU C 3 92  ? 68.990 23.003  7.786   1.00 24.17 ? 92   LEU A CD2   1 
ATOM   1098 N  N     . VAL C 3 93  ? 67.512 18.256  7.730   1.00 24.68 ? 93   VAL A N     1 
ATOM   1099 C  CA    . VAL C 3 93  ? 66.289 17.738  7.142   1.00 23.35 ? 93   VAL A CA    1 
ATOM   1100 C  C     . VAL C 3 93  ? 65.598 16.813  8.143   1.00 24.58 ? 93   VAL A C     1 
ATOM   1101 O  O     . VAL C 3 93  ? 64.380 16.856  8.290   1.00 24.28 ? 93   VAL A O     1 
ATOM   1102 C  CB    . VAL C 3 93  ? 66.599 16.948  5.840   1.00 24.73 ? 93   VAL A CB    1 
ATOM   1103 C  CG1   . VAL C 3 93  ? 65.384 16.121  5.415   1.00 19.83 ? 93   VAL A CG1   1 
ATOM   1104 C  CG2   . VAL C 3 93  ? 67.001 17.930  4.717   1.00 23.46 ? 93   VAL A CG2   1 
ATOM   1105 N  N     . LEU C 3 94  ? 66.376 15.977  8.828   1.00 24.58 ? 94   LEU A N     1 
ATOM   1106 C  CA    . LEU C 3 94  ? 65.820 15.053  9.819   1.00 26.53 ? 94   LEU A CA    1 
ATOM   1107 C  C     . LEU C 3 94  ? 65.204 15.797  11.005  1.00 26.03 ? 94   LEU A C     1 
ATOM   1108 O  O     . LEU C 3 94  ? 64.112 15.458  11.452  1.00 26.31 ? 94   LEU A O     1 
ATOM   1109 C  CB    . LEU C 3 94  ? 66.902 14.101  10.340  1.00 27.62 ? 94   LEU A CB    1 
ATOM   1110 C  CG    . LEU C 3 94  ? 67.044 12.729  9.690   1.00 30.51 ? 94   LEU A CG    1 
ATOM   1111 C  CD1   . LEU C 3 94  ? 68.115 11.943  10.434  1.00 31.24 ? 94   LEU A CD1   1 
ATOM   1112 C  CD2   . LEU C 3 94  ? 65.712 11.981  9.754   1.00 32.98 ? 94   LEU A CD2   1 
ATOM   1113 N  N     . SER C 3 95  ? 65.917 16.799  11.514  1.00 24.83 ? 95   SER A N     1 
ATOM   1114 C  CA    . SER C 3 95  ? 65.445 17.602  12.639  1.00 24.57 ? 95   SER A CA    1 
ATOM   1115 C  C     . SER C 3 95  ? 64.116 18.270  12.342  1.00 23.53 ? 95   SER A C     1 
ATOM   1116 O  O     . SER C 3 95  ? 63.211 18.279  13.183  1.00 22.53 ? 95   SER A O     1 
ATOM   1117 C  CB    . SER C 3 95  ? 66.460 18.699  12.993  1.00 26.05 ? 95   SER A CB    1 
ATOM   1118 O  OG    . SER C 3 95  ? 67.638 18.156  13.551  1.00 31.08 ? 95   SER A OG    1 
ATOM   1119 N  N     . ARG C 3 96  ? 64.013 18.850  11.149  1.00 23.16 ? 96   ARG A N     1 
ATOM   1120 C  CA    . ARG C 3 96  ? 62.802 19.541  10.743  1.00 24.04 ? 96   ARG A CA    1 
ATOM   1121 C  C     . ARG C 3 96  ? 61.629 18.587  10.615  1.00 24.68 ? 96   ARG A C     1 
ATOM   1122 O  O     . ARG C 3 96  ? 60.469 19.011  10.679  1.00 25.62 ? 96   ARG A O     1 
ATOM   1123 C  CB    . ARG C 3 96  ? 63.043 20.285  9.430   1.00 24.98 ? 96   ARG A CB    1 
ATOM   1124 C  CG    . ARG C 3 96  ? 63.898 21.522  9.646   1.00 25.70 ? 96   ARG A CG    1 
ATOM   1125 C  CD    . ARG C 3 96  ? 64.299 22.208  8.367   1.00 26.91 ? 96   ARG A CD    1 
ATOM   1126 N  NE    . ARG C 3 96  ? 64.884 23.514  8.665   1.00 30.57 ? 96   ARG A NE    1 
ATOM   1127 C  CZ    . ARG C 3 96  ? 65.406 24.322  7.748   1.00 31.97 ? 96   ARG A CZ    1 
ATOM   1128 N  NH1   . ARG C 3 96  ? 65.417 23.953  6.474   1.00 30.51 ? 96   ARG A NH1   1 
ATOM   1129 N  NH2   . ARG C 3 96  ? 65.915 25.497  8.104   1.00 31.94 ? 96   ARG A NH2   1 
ATOM   1130 N  N     . LEU C 3 97  ? 61.933 17.304  10.438  1.00 23.21 ? 97   LEU A N     1 
ATOM   1131 C  CA    . LEU C 3 97  ? 60.897 16.291  10.333  1.00 25.74 ? 97   LEU A CA    1 
ATOM   1132 C  C     . LEU C 3 97  ? 60.483 15.833  11.723  1.00 26.50 ? 97   LEU A C     1 
ATOM   1133 O  O     . LEU C 3 97  ? 59.313 15.859  12.071  1.00 28.25 ? 97   LEU A O     1 
ATOM   1134 C  CB    . LEU C 3 97  ? 61.382 15.067  9.534   1.00 23.34 ? 97   LEU A CB    1 
ATOM   1135 C  CG    . LEU C 3 97  ? 60.463 13.832  9.627   1.00 23.56 ? 97   LEU A CG    1 
ATOM   1136 C  CD1   . LEU C 3 97  ? 59.079 14.159  9.053   1.00 19.24 ? 97   LEU A CD1   1 
ATOM   1137 C  CD2   . LEU C 3 97  ? 61.090 12.648  8.879   1.00 20.68 ? 97   LEU A CD2   1 
ATOM   1138 N  N     . ILE C 3 98  ? 61.460 15.422  12.518  1.00 28.68 ? 98   ILE A N     1 
ATOM   1139 C  CA    . ILE C 3 98  ? 61.196 14.922  13.856  1.00 31.14 ? 98   ILE A CA    1 
ATOM   1140 C  C     . ILE C 3 98  ? 60.794 15.999  14.873  1.00 33.05 ? 98   ILE A C     1 
ATOM   1141 O  O     . ILE C 3 98  ? 59.919 15.765  15.709  1.00 33.74 ? 98   ILE A O     1 
ATOM   1142 C  CB    . ILE C 3 98  ? 62.409 14.106  14.332  1.00 31.85 ? 98   ILE A CB    1 
ATOM   1143 C  CG1   . ILE C 3 98  ? 62.600 12.937  13.354  1.00 30.64 ? 98   ILE A CG1   1 
ATOM   1144 C  CG2   . ILE C 3 98  ? 62.213 13.631  15.775  1.00 31.32 ? 98   ILE A CG2   1 
ATOM   1145 C  CD1   . ILE C 3 98  ? 63.739 11.998  13.675  1.00 32.91 ? 98   ILE A CD1   1 
ATOM   1146 N  N     . HIS C 3 99  ? 61.410 17.175  14.796  1.00 33.96 ? 99   HIS A N     1 
ATOM   1147 C  CA    . HIS C 3 99  ? 61.075 18.278  15.695  1.00 35.71 ? 99   HIS A CA    1 
ATOM   1148 C  C     . HIS C 3 99  ? 60.314 19.355  14.918  1.00 36.84 ? 99   HIS A C     1 
ATOM   1149 O  O     . HIS C 3 99  ? 60.594 20.553  15.042  1.00 37.60 ? 99   HIS A O     1 
ATOM   1150 C  CB    . HIS C 3 99  ? 62.351 18.864  16.306  1.00 36.06 ? 99   HIS A CB    1 
ATOM   1151 C  CG    . HIS C 3 99  ? 63.121 17.883  17.131  1.00 38.78 ? 99   HIS A CG    1 
ATOM   1152 N  ND1   . HIS C 3 99  ? 62.584 17.263  18.240  1.00 39.90 ? 99   HIS A ND1   1 
ATOM   1153 C  CD2   . HIS C 3 99  ? 64.370 17.378  16.986  1.00 39.66 ? 99   HIS A CD2   1 
ATOM   1154 C  CE1   . HIS C 3 99  ? 63.467 16.416  18.741  1.00 41.16 ? 99   HIS A CE1   1 
ATOM   1155 N  NE2   . HIS C 3 99  ? 64.559 16.466  17.998  1.00 41.40 ? 99   HIS A NE2   1 
ATOM   1156 N  N     . SER C 3 100 ? 59.351 18.904  14.116  1.00 37.79 ? 100  SER A N     1 
ATOM   1157 C  CA    . SER C 3 100 ? 58.528 19.776  13.277  1.00 38.93 ? 100  SER A CA    1 
ATOM   1158 C  C     . SER C 3 100 ? 57.723 20.807  14.062  1.00 39.40 ? 100  SER A C     1 
ATOM   1159 O  O     . SER C 3 100 ? 57.172 21.757  13.492  1.00 37.87 ? 100  SER A O     1 
ATOM   1160 C  CB    . SER C 3 100 ? 57.582 18.921  12.432  1.00 38.92 ? 100  SER A CB    1 
ATOM   1161 O  OG    . SER C 3 100 ? 56.966 17.922  13.232  1.00 39.06 ? 100  SER A OG    1 
ATOM   1162 N  N     . ASN C 3 101 ? 57.659 20.606  15.371  1.00 39.90 ? 101  ASN A N     1 
ATOM   1163 C  CA    . ASN C 3 101 ? 56.940 21.504  16.269  1.00 41.76 ? 101  ASN A CA    1 
ATOM   1164 C  C     . ASN C 3 101 ? 57.844 22.645  16.720  1.00 41.74 ? 101  ASN A C     1 
ATOM   1165 O  O     . ASN C 3 101 ? 57.420 23.521  17.476  1.00 42.79 ? 101  ASN A O     1 
ATOM   1166 C  CB    . ASN C 3 101 ? 56.466 20.727  17.493  1.00 41.89 ? 101  ASN A CB    1 
ATOM   1167 C  CG    . ASN C 3 101 ? 57.587 19.937  18.137  1.00 43.99 ? 101  ASN A CG    1 
ATOM   1168 O  OD1   . ASN C 3 101 ? 58.272 19.151  17.469  1.00 43.79 ? 101  ASN A OD1   1 
ATOM   1169 N  ND2   . ASN C 3 101 ? 57.786 20.136  19.439  1.00 45.35 ? 101  ASN A ND2   1 
ATOM   1170 N  N     . LEU C 3 102 ? 59.092 22.630  16.262  1.00 41.65 ? 102  LEU A N     1 
ATOM   1171 C  CA    . LEU C 3 102 ? 60.048 23.669  16.634  1.00 41.30 ? 102  LEU A CA    1 
ATOM   1172 C  C     . LEU C 3 102 ? 60.548 24.479  15.442  1.00 41.68 ? 102  LEU A C     1 
ATOM   1173 O  O     . LEU C 3 102 ? 60.536 24.014  14.304  1.00 40.35 ? 102  LEU A O     1 
ATOM   1174 C  CB    . LEU C 3 102 ? 61.259 23.051  17.340  1.00 39.34 ? 102  LEU A CB    1 
ATOM   1175 C  CG    . LEU C 3 102 ? 61.028 22.163  18.568  1.00 38.49 ? 102  LEU A CG    1 
ATOM   1176 C  CD1   . LEU C 3 102 ? 62.385 21.698  19.091  1.00 36.47 ? 102  LEU A CD1   1 
ATOM   1177 C  CD2   . LEU C 3 102 ? 60.264 22.928  19.648  1.00 35.74 ? 102  LEU A CD2   1 
ATOM   1178 N  N     . LYS C 3 103 ? 60.989 25.701  15.719  1.00 43.17 ? 103  LYS A N     1 
ATOM   1179 C  CA    . LYS C 3 103 ? 61.539 26.576  14.690  1.00 43.63 ? 103  LYS A CA    1 
ATOM   1180 C  C     . LYS C 3 103 ? 63.049 26.325  14.684  1.00 43.48 ? 103  LYS A C     1 
ATOM   1181 O  O     . LYS C 3 103 ? 63.548 25.441  15.385  1.00 44.07 ? 103  LYS A O     1 
ATOM   1182 C  CB    . LYS C 3 103 ? 61.289 28.046  15.045  1.00 44.92 ? 103  LYS A CB    1 
ATOM   1183 C  CG    . LYS C 3 103 ? 59.829 28.449  15.204  1.00 48.23 ? 103  LYS A CG    1 
ATOM   1184 C  CD    . LYS C 3 103 ? 59.119 28.567  13.861  1.00 50.27 ? 103  LYS A CD    1 
ATOM   1185 C  CE    . LYS C 3 103 ? 57.680 29.025  14.055  1.00 53.51 ? 103  LYS A CE    1 
ATOM   1186 N  NZ    . LYS C 3 103 ? 56.937 29.157  12.768  1.00 54.65 ? 103  LYS A NZ    1 
ATOM   1187 N  N     . ASP C 3 104 ? 63.766 27.098  13.880  1.00 42.88 ? 104  ASP A N     1 
ATOM   1188 C  CA    . ASP C 3 104 ? 65.219 27.023  13.811  1.00 42.47 ? 104  ASP A CA    1 
ATOM   1189 C  C     . ASP C 3 104 ? 65.646 28.273  13.057  1.00 42.33 ? 104  ASP A C     1 
ATOM   1190 O  O     . ASP C 3 104 ? 64.852 28.859  12.317  1.00 41.79 ? 104  ASP A O     1 
ATOM   1191 C  CB    . ASP C 3 104 ? 65.709 25.744  13.108  1.00 42.29 ? 104  ASP A CB    1 
ATOM   1192 C  CG    . ASP C 3 104 ? 65.286 25.667  11.652  1.00 43.06 ? 104  ASP A CG    1 
ATOM   1193 O  OD1   . ASP C 3 104 ? 65.535 26.640  10.907  1.00 43.58 ? 104  ASP A OD1   1 
ATOM   1194 O  OD2   . ASP C 3 104 ? 64.717 24.626  11.252  1.00 40.88 ? 104  ASP A OD2   1 
ATOM   1195 N  N     . THR C 3 105 ? 66.889 28.690  13.257  1.00 42.79 ? 105  THR A N     1 
ATOM   1196 C  CA    . THR C 3 105 ? 67.399 29.902  12.629  1.00 43.56 ? 105  THR A CA    1 
ATOM   1197 C  C     . THR C 3 105 ? 67.718 29.781  11.141  1.00 44.48 ? 105  THR A C     1 
ATOM   1198 O  O     . THR C 3 105 ? 68.279 30.704  10.544  1.00 45.33 ? 105  THR A O     1 
ATOM   1199 C  CB    . THR C 3 105 ? 68.654 30.377  13.362  1.00 42.67 ? 105  THR A CB    1 
ATOM   1200 O  OG1   . THR C 3 105 ? 69.658 29.357  13.291  1.00 41.97 ? 105  THR A OG1   1 
ATOM   1201 C  CG2   . THR C 3 105 ? 68.329 30.661  14.826  1.00 43.29 ? 105  THR A CG2   1 
ATOM   1202 N  N     . ASP C 3 106 ? 67.355 28.653  10.543  1.00 45.18 ? 106  ASP A N     1 
ATOM   1203 C  CA    . ASP C 3 106 ? 67.627 28.413  9.131   1.00 46.24 ? 106  ASP A CA    1 
ATOM   1204 C  C     . ASP C 3 106 ? 69.119 28.649  8.883   1.00 45.77 ? 106  ASP A C     1 
ATOM   1205 O  O     . ASP C 3 106 ? 69.521 29.424  8.006   1.00 44.52 ? 106  ASP A O     1 
ATOM   1206 C  CB    . ASP C 3 106 ? 66.761 29.335  8.259   1.00 46.81 ? 106  ASP A CB    1 
ATOM   1207 C  CG    . ASP C 3 106 ? 66.812 28.965  6.784   1.00 48.56 ? 106  ASP A CG    1 
ATOM   1208 O  OD1   . ASP C 3 106 ? 67.106 27.790  6.463   1.00 45.98 ? 106  ASP A OD1   1 
ATOM   1209 O  OD2   . ASP C 3 106 ? 66.540 29.851  5.941   1.00 50.71 ? 106  ASP A OD2   1 
ATOM   1210 N  N     . MET C 3 107 ? 69.927 27.968  9.691   1.00 45.42 ? 107  MET A N     1 
ATOM   1211 C  CA    . MET C 3 107 ? 71.383 28.048  9.632   1.00 46.33 ? 107  MET A CA    1 
ATOM   1212 C  C     . MET C 3 107 ? 71.959 29.455  9.779   1.00 46.88 ? 107  MET A C     1 
ATOM   1213 O  O     . MET C 3 107 ? 72.874 29.841  9.051   1.00 47.27 ? 107  MET A O     1 
ATOM   1214 C  CB    . MET C 3 107 ? 71.901 27.396  8.342   1.00 44.97 ? 107  MET A CB    1 
ATOM   1215 C  CG    . MET C 3 107 ? 71.853 25.869  8.363   1.00 43.12 ? 107  MET A CG    1 
ATOM   1216 S  SD    . MET C 3 107 ? 72.825 25.140  9.721   1.00 42.87 ? 107  MET A SD    1 
ATOM   1217 C  CE    . MET C 3 107 ? 74.290 24.522  8.854   1.00 41.87 ? 107  MET A CE    1 
ATOM   1218 N  N     . GLY C 3 108 ? 71.423 30.220  10.725  1.00 46.91 ? 108  GLY A N     1 
ATOM   1219 C  CA    . GLY C 3 108 ? 71.928 31.560  10.961  1.00 47.65 ? 108  GLY A CA    1 
ATOM   1220 C  C     . GLY C 3 108 ? 71.345 32.708  10.154  1.00 47.22 ? 108  GLY A C     1 
ATOM   1221 O  O     . GLY C 3 108 ? 71.798 33.843  10.299  1.00 47.24 ? 108  GLY A O     1 
ATOM   1222 N  N     . LEU C 3 109 ? 70.354 32.439  9.310   1.00 47.35 ? 109  LEU A N     1 
ATOM   1223 C  CA    . LEU C 3 109 ? 69.746 33.507  8.518   1.00 47.10 ? 109  LEU A CA    1 
ATOM   1224 C  C     . LEU C 3 109 ? 68.694 34.263  9.325   1.00 46.55 ? 109  LEU A C     1 
ATOM   1225 O  O     . LEU C 3 109 ? 68.335 35.389  8.991   1.00 46.67 ? 109  LEU A O     1 
ATOM   1226 C  CB    . LEU C 3 109 ? 69.120 32.945  7.237   1.00 46.72 ? 109  LEU A CB    1 
ATOM   1227 C  CG    . LEU C 3 109 ? 70.117 32.391  6.211   1.00 47.22 ? 109  LEU A CG    1 
ATOM   1228 C  CD1   . LEU C 3 109 ? 69.377 31.963  4.954   1.00 46.12 ? 109  LEU A CD1   1 
ATOM   1229 C  CD2   . LEU C 3 109 ? 71.163 33.457  5.879   1.00 46.73 ? 109  LEU A CD2   1 
ATOM   1230 N  N     . LEU C 3 110 ? 68.197 33.636  10.386  1.00 46.40 ? 110  LEU A N     1 
ATOM   1231 C  CA    . LEU C 3 110 ? 67.201 34.264  11.245  1.00 47.04 ? 110  LEU A CA    1 
ATOM   1232 C  C     . LEU C 3 110 ? 67.787 34.399  12.653  1.00 47.64 ? 110  LEU A C     1 
ATOM   1233 O  O     . LEU C 3 110 ? 68.520 33.522  13.118  1.00 47.13 ? 110  LEU A O     1 
ATOM   1234 C  CB    . LEU C 3 110 ? 65.919 33.422  11.278  1.00 46.61 ? 110  LEU A CB    1 
ATOM   1235 C  CG    . LEU C 3 110 ? 65.152 33.252  9.956   1.00 46.72 ? 110  LEU A CG    1 
ATOM   1236 C  CD1   . LEU C 3 110 ? 63.999 32.279  10.163  1.00 46.31 ? 110  LEU A CD1   1 
ATOM   1237 C  CD2   . LEU C 3 110 ? 64.629 34.598  9.463   1.00 44.04 ? 110  LEU A CD2   1 
ATOM   1238 N  N     . ARG C 3 111 ? 67.480 35.506  13.319  1.00 48.11 ? 111  ARG A N     1 
ATOM   1239 C  CA    . ARG C 3 111 ? 67.977 35.744  14.668  1.00 50.32 ? 111  ARG A CA    1 
ATOM   1240 C  C     . ARG C 3 111 ? 67.168 34.936  15.685  1.00 49.83 ? 111  ARG A C     1 
ATOM   1241 O  O     . ARG C 3 111 ? 65.934 34.959  15.678  1.00 49.69 ? 111  ARG A O     1 
ATOM   1242 C  CB    . ARG C 3 111 ? 67.901 37.239  15.000  1.00 52.14 ? 111  ARG A CB    1 
ATOM   1243 C  CG    . ARG C 3 111 ? 68.757 38.117  14.099  1.00 55.34 ? 111  ARG A CG    1 
ATOM   1244 C  CD    . ARG C 3 111 ? 68.471 39.598  14.327  1.00 59.42 ? 111  ARG A CD    1 
ATOM   1245 N  NE    . ARG C 3 111 ? 67.047 39.903  14.179  1.00 61.41 ? 111  ARG A NE    1 
ATOM   1246 C  CZ    . ARG C 3 111 ? 66.533 41.131  14.182  1.00 62.24 ? 111  ARG A CZ    1 
ATOM   1247 N  NH1   . ARG C 3 111 ? 67.324 42.191  14.324  1.00 60.89 ? 111  ARG A NH1   1 
ATOM   1248 N  NH2   . ARG C 3 111 ? 65.222 41.299  14.047  1.00 61.82 ? 111  ARG A NH2   1 
ATOM   1249 N  N     . SER C 3 112 ? 67.875 34.223  16.557  1.00 49.86 ? 112  SER A N     1 
ATOM   1250 C  CA    . SER C 3 112 ? 67.242 33.386  17.576  1.00 49.25 ? 112  SER A CA    1 
ATOM   1251 C  C     . SER C 3 112 ? 66.158 34.104  18.370  1.00 48.05 ? 112  SER A C     1 
ATOM   1252 O  O     . SER C 3 112 ? 65.046 33.596  18.522  1.00 46.20 ? 112  SER A O     1 
ATOM   1253 C  CB    . SER C 3 112 ? 68.300 32.857  18.542  1.00 49.89 ? 112  SER A CB    1 
ATOM   1254 O  OG    . SER C 3 112 ? 69.304 32.150  17.842  1.00 53.81 ? 112  SER A OG    1 
ATOM   1255 N  N     . GLY C 3 113 ? 66.495 35.285  18.880  1.00 48.20 ? 113  GLY A N     1 
ATOM   1256 C  CA    . GLY C 3 113 ? 65.551 36.056  19.670  1.00 48.05 ? 113  GLY A CA    1 
ATOM   1257 C  C     . GLY C 3 113 ? 64.150 36.179  19.099  1.00 47.76 ? 113  GLY A C     1 
ATOM   1258 O  O     . GLY C 3 113 ? 63.168 36.096  19.841  1.00 48.84 ? 113  GLY A O     1 
ATOM   1259 N  N     . LYS C 3 114 ? 64.050 36.366  17.785  1.00 48.17 ? 114  LYS A N     1 
ATOM   1260 C  CA    . LYS C 3 114 ? 62.757 36.521  17.118  1.00 48.32 ? 114  LYS A CA    1 
ATOM   1261 C  C     . LYS C 3 114 ? 61.935 35.233  17.019  1.00 48.02 ? 114  LYS A C     1 
ATOM   1262 O  O     . LYS C 3 114 ? 60.702 35.275  16.991  1.00 48.72 ? 114  LYS A O     1 
ATOM   1263 C  CB    . LYS C 3 114 ? 62.961 37.100  15.711  1.00 48.30 ? 114  LYS A CB    1 
ATOM   1264 N  N     . LEU C 3 115 ? 62.609 34.090  16.959  1.00 47.12 ? 115  LEU A N     1 
ATOM   1265 C  CA    . LEU C 3 115 ? 61.906 32.816  16.851  1.00 46.39 ? 115  LEU A CA    1 
ATOM   1266 C  C     . LEU C 3 115 ? 61.112 32.488  18.109  1.00 46.03 ? 115  LEU A C     1 
ATOM   1267 O  O     . LEU C 3 115 ? 61.608 32.628  19.225  1.00 46.10 ? 115  LEU A O     1 
ATOM   1268 C  CB    . LEU C 3 115 ? 62.899 31.685  16.576  1.00 45.34 ? 115  LEU A CB    1 
ATOM   1269 C  CG    . LEU C 3 115 ? 63.668 31.759  15.255  1.00 45.02 ? 115  LEU A CG    1 
ATOM   1270 C  CD1   . LEU C 3 115 ? 64.760 30.704  15.252  1.00 44.27 ? 115  LEU A CD1   1 
ATOM   1271 C  CD2   . LEU C 3 115 ? 62.708 31.567  14.079  1.00 43.55 ? 115  LEU A CD2   1 
ATOM   1272 N  N     . PRO C 3 116 ? 59.851 32.070  17.944  1.00 45.50 ? 116  PRO A N     1 
ATOM   1273 C  CA    . PRO C 3 116 ? 59.044 31.732  19.121  1.00 45.44 ? 116  PRO A CA    1 
ATOM   1274 C  C     . PRO C 3 116 ? 59.409 30.331  19.630  1.00 44.69 ? 116  PRO A C     1 
ATOM   1275 O  O     . PRO C 3 116 ? 60.112 29.579  18.947  1.00 44.20 ? 116  PRO A O     1 
ATOM   1276 C  CB    . PRO C 3 116 ? 57.614 31.808  18.586  1.00 46.48 ? 116  PRO A CB    1 
ATOM   1277 C  CG    . PRO C 3 116 ? 57.773 31.358  17.156  1.00 45.54 ? 116  PRO A CG    1 
ATOM   1278 C  CD    . PRO C 3 116 ? 59.025 32.099  16.723  1.00 45.01 ? 116  PRO A CD    1 
ATOM   1279 N  N     . GLY C 3 117 ? 58.942 29.995  20.831  1.00 43.61 ? 117  GLY A N     1 
ATOM   1280 C  CA    . GLY C 3 117 ? 59.218 28.684  21.402  1.00 42.11 ? 117  GLY A CA    1 
ATOM   1281 C  C     . GLY C 3 117 ? 60.685 28.374  21.659  1.00 41.40 ? 117  GLY A C     1 
ATOM   1282 O  O     . GLY C 3 117 ? 61.540 29.260  21.607  1.00 42.44 ? 117  GLY A O     1 
ATOM   1283 N  N     . ALA C 3 118 ? 60.977 27.106  21.937  1.00 39.23 ? 124  ALA A N     1 
ATOM   1284 C  CA    . ALA C 3 118 ? 62.342 26.675  22.212  1.00 37.90 ? 124  ALA A CA    1 
ATOM   1285 C  C     . ALA C 3 118 ? 63.054 26.182  20.952  1.00 36.90 ? 124  ALA A C     1 
ATOM   1286 O  O     . ALA C 3 118 ? 62.437 26.018  19.901  1.00 37.49 ? 124  ALA A O     1 
ATOM   1287 C  CB    . ALA C 3 118 ? 62.339 25.580  23.269  1.00 35.31 ? 124  ALA A CB    1 
ATOM   1288 N  N     . LEU C 3 119 ? 64.360 25.953  21.071  1.00 36.05 ? 125  LEU A N     1 
ATOM   1289 C  CA    . LEU C 3 119 ? 65.171 25.479  19.954  1.00 35.92 ? 125  LEU A CA    1 
ATOM   1290 C  C     . LEU C 3 119 ? 65.979 24.271  20.387  1.00 35.89 ? 125  LEU A C     1 
ATOM   1291 O  O     . LEU C 3 119 ? 66.548 24.264  21.477  1.00 35.44 ? 125  LEU A O     1 
ATOM   1292 C  CB    . LEU C 3 119 ? 66.133 26.580  19.472  1.00 35.05 ? 125  LEU A CB    1 
ATOM   1293 C  CG    . LEU C 3 119 ? 65.486 27.873  18.971  1.00 35.22 ? 125  LEU A CG    1 
ATOM   1294 C  CD1   . LEU C 3 119 ? 66.550 28.897  18.612  1.00 32.57 ? 125  LEU A CD1   1 
ATOM   1295 C  CD2   . LEU C 3 119 ? 64.606 27.550  17.765  1.00 36.52 ? 125  LEU A CD2   1 
ATOM   1296 N  N     . GLU C 3 120 ? 66.025 23.248  19.536  1.00 36.85 ? 126  GLU A N     1 
ATOM   1297 C  CA    . GLU C 3 120 ? 66.793 22.048  19.843  1.00 36.14 ? 126  GLU A CA    1 
ATOM   1298 C  C     . GLU C 3 120 ? 68.245 22.520  20.006  1.00 35.71 ? 126  GLU A C     1 
ATOM   1299 O  O     . GLU C 3 120 ? 68.774 23.247  19.164  1.00 36.00 ? 126  GLU A O     1 
ATOM   1300 C  CB    . GLU C 3 120 ? 66.642 21.033  18.706  1.00 36.93 ? 126  GLU A CB    1 
ATOM   1301 C  CG    . GLU C 3 120 ? 67.167 19.641  19.020  1.00 38.55 ? 126  GLU A CG    1 
ATOM   1302 C  CD    . GLU C 3 120 ? 68.674 19.582  19.003  1.00 38.31 ? 126  GLU A CD    1 
ATOM   1303 O  OE1   . GLU C 3 120 ? 69.257 19.921  17.957  1.00 39.59 ? 126  GLU A OE1   1 
ATOM   1304 O  OE2   . GLU C 3 120 ? 69.278 19.200  20.026  1.00 41.98 ? 126  GLU A OE2   1 
ATOM   1305 N  N     . ALA C 3 121 ? 68.875 22.114  21.103  1.00 35.10 ? 127  ALA A N     1 
ATOM   1306 C  CA    . ALA C 3 121 ? 70.236 22.537  21.425  1.00 33.66 ? 127  ALA A CA    1 
ATOM   1307 C  C     . ALA C 3 121 ? 71.338 22.294  20.389  1.00 33.92 ? 127  ALA A C     1 
ATOM   1308 O  O     . ALA C 3 121 ? 72.072 23.222  20.039  1.00 33.68 ? 127  ALA A O     1 
ATOM   1309 C  CB    . ALA C 3 121 ? 70.650 21.936  22.772  1.00 30.99 ? 127  ALA A CB    1 
ATOM   1310 N  N     . TRP C 3 122 ? 71.474 21.059  19.917  1.00 32.71 ? 128  TRP A N     1 
ATOM   1311 C  CA    . TRP C 3 122 ? 72.518 20.741  18.950  1.00 33.25 ? 128  TRP A CA    1 
ATOM   1312 C  C     . TRP C 3 122 ? 72.332 21.492  17.636  1.00 32.98 ? 128  TRP A C     1 
ATOM   1313 O  O     . TRP C 3 122 ? 73.293 22.015  17.068  1.00 32.34 ? 128  TRP A O     1 
ATOM   1314 C  CB    . TRP C 3 122 ? 72.554 19.235  18.690  1.00 34.05 ? 128  TRP A CB    1 
ATOM   1315 C  CG    . TRP C 3 122 ? 72.959 18.413  19.878  1.00 36.79 ? 128  TRP A CG    1 
ATOM   1316 C  CD1   . TRP C 3 122 ? 72.328 17.299  20.351  1.00 37.83 ? 128  TRP A CD1   1 
ATOM   1317 C  CD2   . TRP C 3 122 ? 74.115 18.600  20.706  1.00 37.35 ? 128  TRP A CD2   1 
ATOM   1318 N  NE1   . TRP C 3 122 ? 73.018 16.779  21.419  1.00 39.16 ? 128  TRP A NE1   1 
ATOM   1319 C  CE2   . TRP C 3 122 ? 74.118 17.557  21.660  1.00 37.35 ? 128  TRP A CE2   1 
ATOM   1320 C  CE3   . TRP C 3 122 ? 75.150 19.546  20.733  1.00 39.47 ? 128  TRP A CE3   1 
ATOM   1321 C  CZ2   . TRP C 3 122 ? 75.115 17.430  22.632  1.00 38.27 ? 128  TRP A CZ2   1 
ATOM   1322 C  CZ3   . TRP C 3 122 ? 76.149 19.420  21.705  1.00 40.32 ? 128  TRP A CZ3   1 
ATOM   1323 C  CH2   . TRP C 3 122 ? 76.120 18.366  22.639  1.00 40.08 ? 128  TRP A CH2   1 
ATOM   1324 N  N     . GLY C 3 123 ? 71.097 21.538  17.153  1.00 32.54 ? 129  GLY A N     1 
ATOM   1325 C  CA    . GLY C 3 123 ? 70.817 22.239  15.917  1.00 32.53 ? 129  GLY A CA    1 
ATOM   1326 C  C     . GLY C 3 123 ? 71.075 23.722  16.100  1.00 32.44 ? 129  GLY A C     1 
ATOM   1327 O  O     . GLY C 3 123 ? 71.454 24.425  15.157  1.00 29.92 ? 129  GLY A O     1 
ATOM   1328 N  N     . TYR C 3 124 ? 70.867 24.206  17.321  1.00 32.79 ? 130  TYR A N     1 
ATOM   1329 C  CA    . TYR C 3 124 ? 71.097 25.619  17.597  1.00 35.40 ? 130  TYR A CA    1 
ATOM   1330 C  C     . TYR C 3 124 ? 72.588 25.936  17.489  1.00 36.08 ? 130  TYR A C     1 
ATOM   1331 O  O     . TYR C 3 124 ? 72.974 26.911  16.846  1.00 36.06 ? 130  TYR A O     1 
ATOM   1332 C  CB    . TYR C 3 124 ? 70.610 26.003  18.997  1.00 35.22 ? 130  TYR A CB    1 
ATOM   1333 C  CG    . TYR C 3 124 ? 70.925 27.441  19.325  1.00 35.61 ? 130  TYR A CG    1 
ATOM   1334 C  CD1   . TYR C 3 124 ? 70.168 28.479  18.785  1.00 36.47 ? 130  TYR A CD1   1 
ATOM   1335 C  CD2   . TYR C 3 124 ? 72.020 27.768  20.127  1.00 36.01 ? 130  TYR A CD2   1 
ATOM   1336 C  CE1   . TYR C 3 124 ? 70.493 29.815  19.035  1.00 38.53 ? 130  TYR A CE1   1 
ATOM   1337 C  CE2   . TYR C 3 124 ? 72.357 29.094  20.380  1.00 38.06 ? 130  TYR A CE2   1 
ATOM   1338 C  CZ    . TYR C 3 124 ? 71.590 30.113  19.832  1.00 39.04 ? 130  TYR A CZ    1 
ATOM   1339 O  OH    . TYR C 3 124 ? 71.924 31.424  20.069  1.00 40.83 ? 130  TYR A OH    1 
ATOM   1340 N  N     . ARG C 3 125 ? 73.414 25.111  18.131  1.00 37.12 ? 131  ARG A N     1 
ATOM   1341 C  CA    . ARG C 3 125 ? 74.857 25.298  18.097  1.00 39.34 ? 131  ARG A CA    1 
ATOM   1342 C  C     . ARG C 3 125 ? 75.387 25.269  16.665  1.00 38.80 ? 131  ARG A C     1 
ATOM   1343 O  O     . ARG C 3 125 ? 76.260 26.057  16.307  1.00 39.80 ? 131  ARG A O     1 
ATOM   1344 C  CB    . ARG C 3 125 ? 75.559 24.222  18.937  1.00 41.35 ? 131  ARG A CB    1 
ATOM   1345 C  CG    . ARG C 3 125 ? 75.543 24.501  20.448  1.00 45.56 ? 131  ARG A CG    1 
ATOM   1346 C  CD    . ARG C 3 125 ? 76.368 25.748  20.790  1.00 48.67 ? 131  ARG A CD    1 
ATOM   1347 N  NE    . ARG C 3 125 ? 76.278 26.127  22.203  1.00 51.75 ? 131  ARG A NE    1 
ATOM   1348 C  CZ    . ARG C 3 125 ? 76.948 27.141  22.749  1.00 53.52 ? 131  ARG A CZ    1 
ATOM   1349 N  NH1   . ARG C 3 125 ? 77.763 27.878  22.003  1.00 54.17 ? 131  ARG A NH1   1 
ATOM   1350 N  NH2   . ARG C 3 125 ? 76.798 27.428  24.038  1.00 53.78 ? 131  ARG A NH2   1 
ATOM   1351 N  N     . LEU C 3 126 ? 74.854 24.366  15.847  1.00 37.53 ? 132  LEU A N     1 
ATOM   1352 C  CA    . LEU C 3 126 ? 75.285 24.256  14.457  1.00 36.37 ? 132  LEU A CA    1 
ATOM   1353 C  C     . LEU C 3 126 ? 74.939 25.507  13.638  1.00 36.83 ? 132  LEU A C     1 
ATOM   1354 O  O     . LEU C 3 126 ? 75.706 25.915  12.765  1.00 36.94 ? 132  LEU A O     1 
ATOM   1355 C  CB    . LEU C 3 126 ? 74.661 23.007  13.816  1.00 33.28 ? 132  LEU A CB    1 
ATOM   1356 C  CG    . LEU C 3 126 ? 75.132 21.669  14.416  1.00 34.00 ? 132  LEU A CG    1 
ATOM   1357 C  CD1   . LEU C 3 126 ? 74.291 20.519  13.892  1.00 30.29 ? 132  LEU A CD1   1 
ATOM   1358 C  CD2   . LEU C 3 126 ? 76.606 21.446  14.078  1.00 31.20 ? 132  LEU A CD2   1 
ATOM   1359 N  N     . GLY C 3 127 ? 73.793 26.116  13.932  1.00 37.07 ? 133  GLY A N     1 
ATOM   1360 C  CA    . GLY C 3 127 ? 73.369 27.301  13.209  1.00 37.75 ? 133  GLY A CA    1 
ATOM   1361 C  C     . GLY C 3 127 ? 74.026 28.594  13.663  1.00 39.41 ? 133  GLY A C     1 
ATOM   1362 O  O     . GLY C 3 127 ? 73.993 29.593  12.942  1.00 39.54 ? 133  GLY A O     1 
ATOM   1363 N  N     . GLU C 3 128 ? 74.630 28.582  14.849  1.00 40.22 ? 134  GLU A N     1 
ATOM   1364 C  CA    . GLU C 3 128 ? 75.284 29.771  15.384  1.00 42.75 ? 134  GLU A CA    1 
ATOM   1365 C  C     . GLU C 3 128 ? 76.807 29.727  15.244  1.00 43.26 ? 134  GLU A C     1 
ATOM   1366 O  O     . GLU C 3 128 ? 77.492 30.673  15.636  1.00 42.32 ? 134  GLU A O     1 
ATOM   1367 C  CB    . GLU C 3 128 ? 74.933 29.948  16.867  1.00 44.45 ? 134  GLU A CB    1 
ATOM   1368 C  CG    . GLU C 3 128 ? 73.444 30.081  17.176  1.00 46.72 ? 134  GLU A CG    1 
ATOM   1369 C  CD    . GLU C 3 128 ? 72.809 31.330  16.576  1.00 48.35 ? 134  GLU A CD    1 
ATOM   1370 O  OE1   . GLU C 3 128 ? 73.359 32.437  16.782  1.00 49.06 ? 134  GLU A OE1   1 
ATOM   1371 O  OE2   . GLU C 3 128 ? 71.753 31.206  15.908  1.00 47.94 ? 134  GLU A OE2   1 
ATOM   1372 N  N     . MET C 3 129 ? 77.336 28.635  14.695  1.00 44.06 ? 135  MET A N     1 
ATOM   1373 C  CA    . MET C 3 129 ? 78.785 28.485  14.538  1.00 45.35 ? 135  MET A CA    1 
ATOM   1374 C  C     . MET C 3 129 ? 79.442 29.608  13.739  1.00 43.85 ? 135  MET A C     1 
ATOM   1375 O  O     . MET C 3 129 ? 80.486 30.113  14.136  1.00 43.95 ? 135  MET A O     1 
ATOM   1376 C  CB    . MET C 3 129 ? 79.127 27.133  13.891  1.00 47.20 ? 135  MET A CB    1 
ATOM   1377 C  CG    . MET C 3 129 ? 78.806 25.901  14.753  1.00 53.01 ? 135  MET A CG    1 
ATOM   1378 S  SD    . MET C 3 129 ? 79.897 25.600  16.198  1.00 56.82 ? 135  MET A SD    1 
ATOM   1379 C  CE    . MET C 3 129 ? 79.048 26.570  17.491  1.00 57.04 ? 135  MET A CE    1 
ATOM   1380 N  N     . LYS C 3 130 ? 78.847 29.998  12.616  1.00 43.29 ? 136  LYS A N     1 
ATOM   1381 C  CA    . LYS C 3 130 ? 79.432 31.067  11.809  1.00 43.26 ? 136  LYS A CA    1 
ATOM   1382 C  C     . LYS C 3 130 ? 79.547 32.362  12.602  1.00 42.65 ? 136  LYS A C     1 
ATOM   1383 O  O     . LYS C 3 130 ? 80.581 33.023  12.563  1.00 43.17 ? 136  LYS A O     1 
ATOM   1384 C  CB    . LYS C 3 130 ? 78.615 31.303  10.533  1.00 43.20 ? 136  LYS A CB    1 
ATOM   1385 C  CG    . LYS C 3 130 ? 78.667 30.133  9.561   1.00 44.08 ? 136  LYS A CG    1 
ATOM   1386 C  CD    . LYS C 3 130 ? 77.989 30.442  8.232   1.00 44.64 ? 136  LYS A CD    1 
ATOM   1387 C  CE    . LYS C 3 130 ? 78.758 31.492  7.430   1.00 44.95 ? 136  LYS A CE    1 
ATOM   1388 N  NZ    . LYS C 3 130 ? 78.195 31.670  6.055   1.00 44.68 ? 136  LYS A NZ    1 
ATOM   1389 N  N     . GLY C 3 131 ? 78.488 32.719  13.321  1.00 42.29 ? 137  GLY A N     1 
ATOM   1390 C  CA    . GLY C 3 131 ? 78.508 33.930  14.123  1.00 42.55 ? 137  GLY A CA    1 
ATOM   1391 C  C     . GLY C 3 131 ? 79.474 33.818  15.293  1.00 43.48 ? 137  GLY A C     1 
ATOM   1392 O  O     . GLY C 3 131 ? 80.097 34.801  15.706  1.00 42.57 ? 137  GLY A O     1 
ATOM   1393 N  N     . GLU C 3 132 ? 79.611 32.610  15.826  1.00 43.95 ? 138  GLU A N     1 
ATOM   1394 C  CA    . GLU C 3 132 ? 80.511 32.381  16.946  1.00 45.47 ? 138  GLU A CA    1 
ATOM   1395 C  C     . GLU C 3 132 ? 81.961 32.447  16.470  1.00 44.66 ? 138  GLU A C     1 
ATOM   1396 O  O     . GLU C 3 132 ? 82.815 33.063  17.113  1.00 43.49 ? 138  GLU A O     1 
ATOM   1397 C  CB    . GLU C 3 132 ? 80.229 31.016  17.570  1.00 48.60 ? 138  GLU A CB    1 
ATOM   1398 C  CG    . GLU C 3 132 ? 80.830 30.839  18.954  1.00 52.52 ? 138  GLU A CG    1 
ATOM   1399 C  CD    . GLU C 3 132 ? 80.588 29.453  19.513  1.00 55.35 ? 138  GLU A CD    1 
ATOM   1400 O  OE1   . GLU C 3 132 ? 79.417 29.007  19.497  1.00 56.86 ? 138  GLU A OE1   1 
ATOM   1401 O  OE2   . GLU C 3 132 ? 81.567 28.816  19.968  1.00 55.55 ? 138  GLU A OE2   1 
ATOM   1402 N  N     . TYR C 3 133 ? 82.232 31.800  15.341  1.00 44.05 ? 139  TYR A N     1 
ATOM   1403 C  CA    . TYR C 3 133 ? 83.568 31.794  14.767  1.00 43.53 ? 139  TYR A CA    1 
ATOM   1404 C  C     . TYR C 3 133 ? 83.924 33.235  14.440  1.00 43.31 ? 139  TYR A C     1 
ATOM   1405 O  O     . TYR C 3 133 ? 85.055 33.669  14.646  1.00 42.67 ? 139  TYR A O     1 
ATOM   1406 C  CB    . TYR C 3 133 ? 83.595 30.922  13.500  1.00 44.31 ? 139  TYR A CB    1 
ATOM   1407 C  CG    . TYR C 3 133 ? 84.790 31.158  12.590  1.00 43.62 ? 139  TYR A CG    1 
ATOM   1408 C  CD1   . TYR C 3 133 ? 86.096 31.002  13.059  1.00 42.61 ? 139  TYR A CD1   1 
ATOM   1409 C  CD2   . TYR C 3 133 ? 84.608 31.565  11.268  1.00 42.64 ? 139  TYR A CD2   1 
ATOM   1410 C  CE1   . TYR C 3 133 ? 87.189 31.250  12.236  1.00 42.81 ? 139  TYR A CE1   1 
ATOM   1411 C  CE2   . TYR C 3 133 ? 85.696 31.819  10.433  1.00 43.49 ? 139  TYR A CE2   1 
ATOM   1412 C  CZ    . TYR C 3 133 ? 86.984 31.664  10.924  1.00 43.39 ? 139  TYR A CZ    1 
ATOM   1413 O  OH    . TYR C 3 133 ? 88.060 31.960  10.119  1.00 41.12 ? 139  TYR A OH    1 
ATOM   1414 N  N     . LYS C 3 134 ? 82.939 33.977  13.944  1.00 43.62 ? 140  LYS A N     1 
ATOM   1415 C  CA    . LYS C 3 134 ? 83.140 35.373  13.597  1.00 45.11 ? 140  LYS A CA    1 
ATOM   1416 C  C     . LYS C 3 134 ? 83.494 36.190  14.832  1.00 46.60 ? 140  LYS A C     1 
ATOM   1417 O  O     . LYS C 3 134 ? 84.453 36.958  14.817  1.00 46.48 ? 140  LYS A O     1 
ATOM   1418 C  CB    . LYS C 3 134 ? 81.881 35.951  12.951  1.00 45.37 ? 140  LYS A CB    1 
ATOM   1419 C  CG    . LYS C 3 134 ? 81.938 37.457  12.731  1.00 46.06 ? 140  LYS A CG    1 
ATOM   1420 C  CD    . LYS C 3 134 ? 80.667 37.971  12.096  1.00 46.60 ? 140  LYS A CD    1 
ATOM   1421 C  CE    . LYS C 3 134 ? 80.686 39.482  11.994  1.00 48.99 ? 140  LYS A CE    1 
ATOM   1422 N  NZ    . LYS C 3 134 ? 79.485 40.006  11.275  1.00 51.70 ? 140  LYS A NZ    1 
ATOM   1423 N  N     . ASP C 3 135 ? 82.720 36.025  15.902  1.00 48.75 ? 141  ASP A N     1 
ATOM   1424 C  CA    . ASP C 3 135 ? 82.979 36.768  17.131  1.00 50.28 ? 141  ASP A CA    1 
ATOM   1425 C  C     . ASP C 3 135 ? 84.376 36.490  17.670  1.00 50.12 ? 141  ASP A C     1 
ATOM   1426 O  O     . ASP C 3 135 ? 85.052 37.395  18.162  1.00 49.72 ? 141  ASP A O     1 
ATOM   1427 C  CB    . ASP C 3 135 ? 81.942 36.432  18.213  1.00 50.86 ? 141  ASP A CB    1 
ATOM   1428 C  CG    . ASP C 3 135 ? 80.576 37.016  17.911  1.00 53.49 ? 141  ASP A CG    1 
ATOM   1429 O  OD1   . ASP C 3 135 ? 80.516 38.086  17.268  1.00 55.66 ? 141  ASP A OD1   1 
ATOM   1430 O  OD2   . ASP C 3 135 ? 79.560 36.416  18.327  1.00 54.26 ? 141  ASP A OD2   1 
ATOM   1431 N  N     . ASP C 3 136 ? 84.809 35.239  17.577  1.00 50.28 ? 142  ASP A N     1 
ATOM   1432 C  CA    . ASP C 3 136 ? 86.128 34.874  18.070  1.00 51.12 ? 142  ASP A CA    1 
ATOM   1433 C  C     . ASP C 3 136 ? 87.231 35.448  17.173  1.00 50.98 ? 142  ASP A C     1 
ATOM   1434 O  O     . ASP C 3 136 ? 88.270 35.891  17.666  1.00 50.71 ? 142  ASP A O     1 
ATOM   1435 C  CB    . ASP C 3 136 ? 86.245 33.353  18.158  1.00 52.64 ? 142  ASP A CB    1 
ATOM   1436 C  CG    . ASP C 3 136 ? 87.465 32.908  18.942  1.00 55.37 ? 142  ASP A CG    1 
ATOM   1437 O  OD1   . ASP C 3 136 ? 87.536 31.710  19.301  1.00 56.36 ? 142  ASP A OD1   1 
ATOM   1438 O  OD2   . ASP C 3 136 ? 88.353 33.753  19.198  1.00 56.71 ? 142  ASP A OD2   1 
ATOM   1439 N  N     . PHE C 3 137 ? 86.998 35.446  15.862  1.00 49.69 ? 143  PHE A N     1 
ATOM   1440 C  CA    . PHE C 3 137 ? 87.974 35.973  14.915  1.00 49.10 ? 143  PHE A CA    1 
ATOM   1441 C  C     . PHE C 3 137 ? 88.236 37.445  15.225  1.00 50.22 ? 143  PHE A C     1 
ATOM   1442 O  O     . PHE C 3 137 ? 89.386 37.869  15.312  1.00 49.75 ? 143  PHE A O     1 
ATOM   1443 C  CB    . PHE C 3 137 ? 87.454 35.839  13.481  1.00 46.89 ? 143  PHE A CB    1 
ATOM   1444 C  CG    . PHE C 3 137 ? 88.506 36.061  12.424  1.00 44.30 ? 143  PHE A CG    1 
ATOM   1445 C  CD1   . PHE C 3 137 ? 89.439 35.069  12.132  1.00 43.88 ? 143  PHE A CD1   1 
ATOM   1446 C  CD2   . PHE C 3 137 ? 88.553 37.253  11.708  1.00 43.07 ? 143  PHE A CD2   1 
ATOM   1447 C  CE1   . PHE C 3 137 ? 90.401 35.257  11.137  1.00 42.46 ? 143  PHE A CE1   1 
ATOM   1448 C  CE2   . PHE C 3 137 ? 89.510 37.453  10.711  1.00 42.70 ? 143  PHE A CE2   1 
ATOM   1449 C  CZ    . PHE C 3 137 ? 90.435 36.452  10.425  1.00 42.11 ? 143  PHE A CZ    1 
ATOM   1450 N  N     . LYS C 3 138 ? 87.165 38.220  15.387  1.00 51.82 ? 144  LYS A N     1 
ATOM   1451 C  CA    . LYS C 3 138 ? 87.289 39.642  15.697  1.00 54.64 ? 144  LYS A CA    1 
ATOM   1452 C  C     . LYS C 3 138 ? 88.079 39.811  16.988  1.00 56.13 ? 144  LYS A C     1 
ATOM   1453 O  O     . LYS C 3 138 ? 89.052 40.560  17.044  1.00 56.68 ? 144  LYS A O     1 
ATOM   1454 C  CB    . LYS C 3 138 ? 85.912 40.284  15.882  1.00 54.80 ? 144  LYS A CB    1 
ATOM   1455 C  CG    . LYS C 3 138 ? 85.018 40.235  14.667  1.00 55.32 ? 144  LYS A CG    1 
ATOM   1456 C  CD    . LYS C 3 138 ? 83.652 40.861  14.951  1.00 56.78 ? 144  LYS A CD    1 
ATOM   1457 C  CE    . LYS C 3 138 ? 83.712 42.381  15.037  1.00 58.54 ? 144  LYS A CE    1 
ATOM   1458 N  NZ    . LYS C 3 138 ? 84.571 42.863  16.150  1.00 59.63 ? 144  LYS A NZ    1 
ATOM   1459 N  N     . ARG C 3 139 ? 87.637 39.105  18.025  1.00 57.92 ? 145  ARG A N     1 
ATOM   1460 C  CA    . ARG C 3 139 ? 88.277 39.152  19.332  1.00 58.95 ? 145  ARG A CA    1 
ATOM   1461 C  C     . ARG C 3 139 ? 89.782 39.070  19.177  1.00 59.41 ? 145  ARG A C     1 
ATOM   1462 O  O     . ARG C 3 139 ? 90.510 39.935  19.664  1.00 59.96 ? 145  ARG A O     1 
ATOM   1463 C  CB    . ARG C 3 139 ? 87.784 37.993  20.196  1.00 59.69 ? 145  ARG A CB    1 
ATOM   1464 C  CG    . ARG C 3 139 ? 88.307 38.000  21.624  1.00 61.04 ? 145  ARG A CG    1 
ATOM   1465 C  CD    . ARG C 3 139 ? 87.448 37.096  22.491  1.00 61.90 ? 145  ARG A CD    1 
ATOM   1466 N  NE    . ARG C 3 139 ? 86.034 37.258  22.152  1.00 63.49 ? 145  ARG A NE    1 
ATOM   1467 C  CZ    . ARG C 3 139 ? 85.373 38.415  22.196  1.00 63.35 ? 145  ARG A CZ    1 
ATOM   1468 N  NH1   . ARG C 3 139 ? 85.992 39.526  22.576  1.00 63.53 ? 145  ARG A NH1   1 
ATOM   1469 N  NH2   . ARG C 3 139 ? 84.098 38.469  21.829  1.00 62.61 ? 145  ARG A NH2   1 
ATOM   1470 N  N     . MET C 3 140 ? 90.246 38.032  18.488  1.00 59.19 ? 146  MET A N     1 
ATOM   1471 C  CA    . MET C 3 140 ? 91.673 37.853  18.278  1.00 59.82 ? 146  MET A CA    1 
ATOM   1472 C  C     . MET C 3 140 ? 92.259 39.030  17.499  1.00 59.83 ? 146  MET A C     1 
ATOM   1473 O  O     . MET C 3 140 ? 93.367 39.483  17.787  1.00 59.49 ? 146  MET A O     1 
ATOM   1474 C  CB    . MET C 3 140 ? 91.934 36.529  17.552  1.00 59.81 ? 146  MET A CB    1 
ATOM   1475 C  CG    . MET C 3 140 ? 91.441 35.314  18.341  1.00 61.34 ? 146  MET A CG    1 
ATOM   1476 S  SD    . MET C 3 140 ? 91.788 33.712  17.570  1.00 64.52 ? 146  MET A SD    1 
ATOM   1477 C  CE    . MET C 3 140 ? 93.029 33.046  18.700  1.00 62.24 ? 146  MET A CE    1 
ATOM   1478 N  N     . LEU C 3 141 ? 91.509 39.536  16.524  1.00 60.03 ? 147  LEU A N     1 
ATOM   1479 C  CA    . LEU C 3 141 ? 91.974 40.672  15.732  1.00 61.55 ? 147  LEU A CA    1 
ATOM   1480 C  C     . LEU C 3 141 ? 92.106 41.929  16.589  1.00 62.03 ? 147  LEU A C     1 
ATOM   1481 O  O     . LEU C 3 141 ? 93.210 42.433  16.801  1.00 61.83 ? 147  LEU A O     1 
ATOM   1482 C  CB    . LEU C 3 141 ? 91.017 40.958  14.572  1.00 61.35 ? 147  LEU A CB    1 
ATOM   1483 C  CG    . LEU C 3 141 ? 91.244 40.227  13.249  1.00 60.85 ? 147  LEU A CG    1 
ATOM   1484 C  CD1   . LEU C 3 141 ? 90.183 40.674  12.252  1.00 60.89 ? 147  LEU A CD1   1 
ATOM   1485 C  CD2   . LEU C 3 141 ? 92.639 40.534  12.713  1.00 60.38 ? 147  LEU A CD2   1 
ATOM   1486 N  N     . GLU C 3 142 ? 90.972 42.424  17.079  1.00 62.94 ? 148  GLU A N     1 
ATOM   1487 C  CA    . GLU C 3 142 ? 90.935 43.621  17.912  1.00 63.91 ? 148  GLU A CA    1 
ATOM   1488 C  C     . GLU C 3 142 ? 91.633 43.352  19.245  1.00 63.99 ? 148  GLU A C     1 
ATOM   1489 O  O     . GLU C 3 142 ? 91.378 44.024  20.244  1.00 65.14 ? 148  GLU A O     1 
ATOM   1490 C  CB    . GLU C 3 142 ? 89.481 44.048  18.153  1.00 64.24 ? 148  GLU A CB    1 
ATOM   1491 C  CG    . GLU C 3 142 ? 88.619 44.066  16.886  1.00 65.19 ? 148  GLU A CG    1 
ATOM   1492 C  CD    . GLU C 3 142 ? 87.163 44.439  17.154  1.00 66.48 ? 148  GLU A CD    1 
ATOM   1493 O  OE1   . GLU C 3 142 ? 86.599 43.963  18.169  1.00 66.36 ? 148  GLU A OE1   1 
ATOM   1494 O  OE2   . GLU C 3 142 ? 86.579 45.196  16.342  1.00 64.80 ? 148  GLU A OE2   1 
ATOM   1495 N  N     . GLU C 3 143 ? 92.509 42.354  19.242  1.00 63.73 ? 149  GLU A N     1 
ATOM   1496 C  CA    . GLU C 3 143 ? 93.278 41.967  20.418  1.00 63.95 ? 149  GLU A CA    1 
ATOM   1497 C  C     . GLU C 3 143 ? 94.741 42.210  20.050  1.00 63.44 ? 149  GLU A C     1 
ATOM   1498 O  O     . GLU C 3 143 ? 95.608 42.343  20.916  1.00 63.74 ? 149  GLU A O     1 
ATOM   1499 C  CB    . GLU C 3 143 ? 93.039 40.485  20.725  1.00 64.96 ? 149  GLU A CB    1 
ATOM   1500 C  CG    . GLU C 3 143 ? 93.507 40.015  22.091  1.00 65.65 ? 149  GLU A CG    1 
ATOM   1501 C  CD    . GLU C 3 143 ? 93.062 38.588  22.389  1.00 67.05 ? 149  GLU A CD    1 
ATOM   1502 O  OE1   . GLU C 3 143 ? 93.463 37.668  21.641  1.00 67.25 ? 149  GLU A OE1   1 
ATOM   1503 O  OE2   . GLU C 3 143 ? 92.304 38.385  23.365  1.00 67.30 ? 149  GLU A OE2   1 
ATOM   1504 N  N     . GLN C 3 144 ? 94.996 42.259  18.746  1.00 62.61 ? 150  GLN A N     1 
ATOM   1505 C  CA    . GLN C 3 144 ? 96.328 42.511  18.212  1.00 62.48 ? 150  GLN A CA    1 
ATOM   1506 C  C     . GLN C 3 144 ? 96.297 43.879  17.528  1.00 62.50 ? 150  GLN A C     1 
ATOM   1507 O  O     . GLN C 3 144 ? 97.096 44.153  16.628  1.00 62.27 ? 150  GLN A O     1 
ATOM   1508 C  CB    . GLN C 3 144 ? 96.712 41.438  17.187  1.00 61.61 ? 150  GLN A CB    1 
ATOM   1509 C  CG    . GLN C 3 144 ? 96.792 40.024  17.741  1.00 61.45 ? 150  GLN A CG    1 
ATOM   1510 C  CD    . GLN C 3 144 ? 97.826 39.886  18.840  1.00 61.97 ? 150  GLN A CD    1 
ATOM   1511 O  OE1   . GLN C 3 144 ? 98.982 40.279  18.671  1.00 61.92 ? 150  GLN A OE1   1 
ATOM   1512 N  NE2   . GLN C 3 144 ? 97.418 39.319  19.973  1.00 61.50 ? 150  GLN A NE2   1 
ATOM   1513 N  N     . GLY C 3 145 ? 95.364 44.727  17.960  1.00 62.55 ? 151  GLY A N     1 
ATOM   1514 C  CA    . GLY C 3 145 ? 95.226 46.051  17.378  1.00 62.84 ? 151  GLY A CA    1 
ATOM   1515 C  C     . GLY C 3 145 ? 95.132 45.980  15.866  1.00 62.85 ? 151  GLY A C     1 
ATOM   1516 O  O     . GLY C 3 145 ? 95.852 46.686  15.156  1.00 63.07 ? 151  GLY A O     1 
ATOM   1517 N  N     . GLU C 3 146 ? 94.236 45.128  15.375  1.00 62.73 ? 152  GLU A N     1 
ATOM   1518 C  CA    . GLU C 3 146 ? 94.048 44.934  13.939  1.00 62.05 ? 152  GLU A CA    1 
ATOM   1519 C  C     . GLU C 3 146 ? 92.566 45.075  13.569  1.00 61.17 ? 152  GLU A C     1 
ATOM   1520 O  O     . GLU C 3 146 ? 91.724 44.308  14.043  1.00 61.60 ? 152  GLU A O     1 
ATOM   1521 C  CB    . GLU C 3 146 ? 94.564 43.542  13.554  1.00 62.80 ? 152  GLU A CB    1 
ATOM   1522 C  CG    . GLU C 3 146 ? 94.990 43.382  12.099  1.00 63.75 ? 152  GLU A CG    1 
ATOM   1523 C  CD    . GLU C 3 146 ? 95.574 42.001  11.820  1.00 63.98 ? 152  GLU A CD    1 
ATOM   1524 O  OE1   . GLU C 3 146 ? 96.540 41.609  12.512  1.00 64.45 ? 152  GLU A OE1   1 
ATOM   1525 O  OE2   . GLU C 3 146 ? 95.068 41.310  10.909  1.00 63.60 ? 152  GLU A OE2   1 
ATOM   1526 N  N     . GLU C 3 147 ? 92.259 46.054  12.719  1.00 59.62 ? 153  GLU A N     1 
ATOM   1527 C  CA    . GLU C 3 147 ? 90.885 46.321  12.286  1.00 59.07 ? 153  GLU A CA    1 
ATOM   1528 C  C     . GLU C 3 147 ? 90.152 45.157  11.616  1.00 57.52 ? 153  GLU A C     1 
ATOM   1529 O  O     . GLU C 3 147 ? 90.713 44.439  10.784  1.00 56.47 ? 153  GLU A O     1 
ATOM   1530 C  CB    . GLU C 3 147 ? 90.865 47.536  11.351  1.00 60.21 ? 153  GLU A CB    1 
ATOM   1531 C  CG    . GLU C 3 147 ? 91.011 48.869  12.078  1.00 62.80 ? 153  GLU A CG    1 
ATOM   1532 C  CD    . GLU C 3 147 ? 91.241 50.044  11.137  1.00 65.03 ? 153  GLU A CD    1 
ATOM   1533 O  OE1   . GLU C 3 147 ? 90.477 50.189  10.153  1.00 65.41 ? 153  GLU A OE1   1 
ATOM   1534 O  OE2   . GLU C 3 147 ? 92.185 50.830  11.392  1.00 64.86 ? 153  GLU A OE2   1 
ATOM   1535 N  N     . TYR C 3 148 ? 88.884 44.987  11.988  1.00 55.80 ? 154  TYR A N     1 
ATOM   1536 C  CA    . TYR C 3 148 ? 88.046 43.932  11.430  1.00 54.22 ? 154  TYR A CA    1 
ATOM   1537 C  C     . TYR C 3 148 ? 87.333 44.423  10.175  1.00 54.24 ? 154  TYR A C     1 
ATOM   1538 O  O     . TYR C 3 148 ? 86.913 45.581  10.102  1.00 54.27 ? 154  TYR A O     1 
ATOM   1539 C  CB    . TYR C 3 148 ? 86.987 43.487  12.442  1.00 52.41 ? 154  TYR A CB    1 
ATOM   1540 C  CG    . TYR C 3 148 ? 86.007 42.488  11.864  1.00 50.01 ? 154  TYR A CG    1 
ATOM   1541 C  CD1   . TYR C 3 148 ? 86.375 41.158  11.669  1.00 48.76 ? 154  TYR A CD1   1 
ATOM   1542 C  CD2   . TYR C 3 148 ? 84.725 42.882  11.470  1.00 48.55 ? 154  TYR A CD2   1 
ATOM   1543 C  CE1   . TYR C 3 148 ? 85.497 40.242  11.095  1.00 48.16 ? 154  TYR A CE1   1 
ATOM   1544 C  CE2   . TYR C 3 148 ? 83.838 41.975  10.893  1.00 47.76 ? 154  TYR A CE2   1 
ATOM   1545 C  CZ    . TYR C 3 148 ? 84.233 40.655  10.711  1.00 47.94 ? 154  TYR A CZ    1 
ATOM   1546 O  OH    . TYR C 3 148 ? 83.370 39.744  10.152  1.00 46.97 ? 154  TYR A OH    1 
ATOM   1547 N  N     . VAL C 3 149 ? 87.183 43.535  9.196   1.00 54.03 ? 155  VAL A N     1 
ATOM   1548 C  CA    . VAL C 3 149 ? 86.506 43.880  7.949   1.00 52.98 ? 155  VAL A CA    1 
ATOM   1549 C  C     . VAL C 3 149 ? 85.325 42.948  7.675   1.00 52.31 ? 155  VAL A C     1 
ATOM   1550 O  O     . VAL C 3 149 ? 85.425 41.737  7.864   1.00 50.88 ? 155  VAL A O     1 
ATOM   1551 C  CB    . VAL C 3 149 ? 87.479 43.812  6.748   1.00 52.57 ? 155  VAL A CB    1 
ATOM   1552 C  CG1   . VAL C 3 149 ? 86.728 44.079  5.454   1.00 52.49 ? 155  VAL A CG1   1 
ATOM   1553 C  CG2   . VAL C 3 149 ? 88.597 44.823  6.929   1.00 51.93 ? 155  VAL A CG2   1 
ATOM   1554 N  N     . ASP C 3 150 ? 84.216 43.537  7.228   1.00 52.14 ? 156  ASP A N     1 
ATOM   1555 C  CA    . ASP C 3 150 ? 82.982 42.821  6.896   1.00 52.22 ? 156  ASP A CA    1 
ATOM   1556 C  C     . ASP C 3 150 ? 82.972 41.347  7.290   1.00 51.65 ? 156  ASP A C     1 
ATOM   1557 O  O     . ASP C 3 150 ? 82.468 40.990  8.357   1.00 52.99 ? 156  ASP A O     1 
ATOM   1558 C  CB    . ASP C 3 150 ? 82.699 42.940  5.395   1.00 53.45 ? 156  ASP A CB    1 
ATOM   1559 N  N     . GLY C 3 151 ? 83.519 40.497  6.427   1.00 48.95 ? 157  GLY A N     1 
ATOM   1560 C  CA    . GLY C 3 151 ? 83.554 39.071  6.714   1.00 47.00 ? 157  GLY A CA    1 
ATOM   1561 C  C     . GLY C 3 151 ? 84.858 38.412  6.295   1.00 45.62 ? 157  GLY A C     1 
ATOM   1562 O  O     . GLY C 3 151 ? 84.864 37.434  5.547   1.00 44.83 ? 157  GLY A O     1 
ATOM   1563 N  N     . MET C 3 152 ? 85.970 38.940  6.795   1.00 44.16 ? 158  MET A N     1 
ATOM   1564 C  CA    . MET C 3 152 ? 87.287 38.416  6.460   1.00 42.63 ? 158  MET A CA    1 
ATOM   1565 C  C     . MET C 3 152 ? 87.597 37.088  7.134   1.00 39.90 ? 158  MET A C     1 
ATOM   1566 O  O     . MET C 3 152 ? 88.599 36.448  6.814   1.00 39.17 ? 158  MET A O     1 
ATOM   1567 C  CB    . MET C 3 152 ? 88.370 39.443  6.817   1.00 43.56 ? 158  MET A CB    1 
ATOM   1568 C  CG    . MET C 3 152 ? 88.560 39.674  8.305   1.00 44.95 ? 158  MET A CG    1 
ATOM   1569 S  SD    . MET C 3 152 ? 89.651 41.079  8.630   1.00 48.16 ? 158  MET A SD    1 
ATOM   1570 C  CE    . MET C 3 152 ? 91.301 40.311  8.464   1.00 45.40 ? 158  MET A CE    1 
ATOM   1571 N  N     . GLU C 3 153 ? 86.742 36.675  8.066   1.00 37.81 ? 159  GLU A N     1 
ATOM   1572 C  CA    . GLU C 3 153 ? 86.947 35.414  8.766   1.00 36.13 ? 159  GLU A CA    1 
ATOM   1573 C  C     . GLU C 3 153 ? 86.839 34.224  7.806   1.00 34.60 ? 159  GLU A C     1 
ATOM   1574 O  O     . GLU C 3 153 ? 87.312 33.136  8.105   1.00 35.72 ? 159  GLU A O     1 
ATOM   1575 C  CB    . GLU C 3 153 ? 85.921 35.242  9.898   1.00 37.13 ? 159  GLU A CB    1 
ATOM   1576 C  CG    . GLU C 3 153 ? 84.483 35.030  9.426   1.00 37.67 ? 159  GLU A CG    1 
ATOM   1577 C  CD    . GLU C 3 153 ? 83.689 36.320  9.346   1.00 39.83 ? 159  GLU A CD    1 
ATOM   1578 O  OE1   . GLU C 3 153 ? 84.300 37.383  9.092   1.00 40.84 ? 159  GLU A OE1   1 
ATOM   1579 O  OE2   . GLU C 3 153 ? 82.450 36.271  9.525   1.00 38.38 ? 159  GLU A OE2   1 
ATOM   1580 N  N     . TRP C 3 154 ? 86.228 34.430  6.647   1.00 33.68 ? 160  TRP A N     1 
ATOM   1581 C  CA    . TRP C 3 154 ? 86.077 33.340  5.690   1.00 34.55 ? 160  TRP A CA    1 
ATOM   1582 C  C     . TRP C 3 154 ? 87.033 33.374  4.498   1.00 34.57 ? 160  TRP A C     1 
ATOM   1583 O  O     . TRP C 3 154 ? 87.030 32.455  3.673   1.00 33.58 ? 160  TRP A O     1 
ATOM   1584 C  CB    . TRP C 3 154 ? 84.627 33.293  5.191   1.00 33.11 ? 160  TRP A CB    1 
ATOM   1585 C  CG    . TRP C 3 154 ? 83.684 32.949  6.287   1.00 31.64 ? 160  TRP A CG    1 
ATOM   1586 C  CD1   . TRP C 3 154 ? 82.776 33.776  6.888   1.00 30.81 ? 160  TRP A CD1   1 
ATOM   1587 C  CD2   . TRP C 3 154 ? 83.634 31.711  6.999   1.00 30.52 ? 160  TRP A CD2   1 
ATOM   1588 N  NE1   . TRP C 3 154 ? 82.169 33.126  7.940   1.00 30.07 ? 160  TRP A NE1   1 
ATOM   1589 C  CE2   . TRP C 3 154 ? 82.678 31.857  8.028   1.00 30.21 ? 160  TRP A CE2   1 
ATOM   1590 C  CE3   . TRP C 3 154 ? 84.311 30.493  6.871   1.00 30.16 ? 160  TRP A CE3   1 
ATOM   1591 C  CZ2   . TRP C 3 154 ? 82.379 30.828  8.924   1.00 31.06 ? 160  TRP A CZ2   1 
ATOM   1592 C  CZ3   . TRP C 3 154 ? 84.016 29.469  7.763   1.00 31.70 ? 160  TRP A CZ3   1 
ATOM   1593 C  CH2   . TRP C 3 154 ? 83.055 29.645  8.779   1.00 31.31 ? 160  TRP A CH2   1 
ATOM   1594 N  N     . TRP C 3 155 ? 87.862 34.413  4.421   1.00 35.16 ? 161  TRP A N     1 
ATOM   1595 C  CA    . TRP C 3 155 ? 88.786 34.556  3.301   1.00 36.03 ? 161  TRP A CA    1 
ATOM   1596 C  C     . TRP C 3 155 ? 89.889 33.517  3.254   1.00 36.02 ? 161  TRP A C     1 
ATOM   1597 O  O     . TRP C 3 155 ? 90.163 32.958  2.199   1.00 36.31 ? 161  TRP A O     1 
ATOM   1598 C  CB    . TRP C 3 155 ? 89.442 35.939  3.302   1.00 37.53 ? 161  TRP A CB    1 
ATOM   1599 C  CG    . TRP C 3 155 ? 88.497 37.098  3.235   1.00 41.05 ? 161  TRP A CG    1 
ATOM   1600 C  CD1   . TRP C 3 155 ? 87.175 37.075  2.878   1.00 41.07 ? 161  TRP A CD1   1 
ATOM   1601 C  CD2   . TRP C 3 155 ? 88.824 38.472  3.473   1.00 42.42 ? 161  TRP A CD2   1 
ATOM   1602 N  NE1   . TRP C 3 155 ? 86.662 38.353  2.878   1.00 41.40 ? 161  TRP A NE1   1 
ATOM   1603 C  CE2   . TRP C 3 155 ? 87.653 39.228  3.238   1.00 43.28 ? 161  TRP A CE2   1 
ATOM   1604 C  CE3   . TRP C 3 155 ? 89.996 39.138  3.860   1.00 44.63 ? 161  TRP A CE3   1 
ATOM   1605 C  CZ2   . TRP C 3 155 ? 87.622 40.622  3.376   1.00 44.15 ? 161  TRP A CZ2   1 
ATOM   1606 C  CZ3   . TRP C 3 155 ? 89.963 40.528  3.996   1.00 44.74 ? 161  TRP A CZ3   1 
ATOM   1607 C  CH2   . TRP C 3 155 ? 88.783 41.251  3.754   1.00 44.16 ? 161  TRP A CH2   1 
ATOM   1608 N  N     . ASN C 3 156 ? 90.528 33.270  4.394   1.00 36.33 ? 162  ASN A N     1 
ATOM   1609 C  CA    . ASN C 3 156 ? 91.631 32.316  4.450   1.00 37.84 ? 162  ASN A CA    1 
ATOM   1610 C  C     . ASN C 3 156 ? 91.439 31.216  5.483   1.00 37.79 ? 162  ASN A C     1 
ATOM   1611 O  O     . ASN C 3 156 ? 90.742 31.385  6.477   1.00 38.11 ? 162  ASN A O     1 
ATOM   1612 C  CB    . ASN C 3 156 ? 92.945 33.046  4.767   1.00 39.06 ? 162  ASN A CB    1 
ATOM   1613 C  CG    . ASN C 3 156 ? 93.280 34.125  3.753   1.00 40.64 ? 162  ASN A CG    1 
ATOM   1614 O  OD1   . ASN C 3 156 ? 93.655 33.835  2.614   1.00 40.45 ? 162  ASN A OD1   1 
ATOM   1615 N  ND2   . ASN C 3 156 ? 93.140 35.385  4.165   1.00 41.78 ? 162  ASN A ND2   1 
ATOM   1616 N  N     . PHE C 3 157 ? 92.077 30.083  5.238   1.00 38.05 ? 163  PHE A N     1 
ATOM   1617 C  CA    . PHE C 3 157 ? 92.013 28.970  6.159   1.00 38.16 ? 163  PHE A CA    1 
ATOM   1618 C  C     . PHE C 3 157 ? 92.902 29.328  7.357   1.00 38.95 ? 163  PHE A C     1 
ATOM   1619 O  O     . PHE C 3 157 ? 93.816 30.143  7.236   1.00 38.16 ? 163  PHE A O     1 
ATOM   1620 C  CB    . PHE C 3 157 ? 92.537 27.708  5.475   1.00 37.75 ? 163  PHE A CB    1 
ATOM   1621 C  CG    . PHE C 3 157 ? 92.902 26.606  6.431   1.00 39.25 ? 163  PHE A CG    1 
ATOM   1622 C  CD1   . PHE C 3 157 ? 91.920 25.918  7.134   1.00 39.64 ? 163  PHE A CD1   1 
ATOM   1623 C  CD2   . PHE C 3 157 ? 94.234 26.268  6.641   1.00 40.29 ? 163  PHE A CD2   1 
ATOM   1624 C  CE1   . PHE C 3 157 ? 92.259 24.909  8.032   1.00 39.85 ? 163  PHE A CE1   1 
ATOM   1625 C  CE2   . PHE C 3 157 ? 94.586 25.261  7.537   1.00 39.35 ? 163  PHE A CE2   1 
ATOM   1626 C  CZ    . PHE C 3 157 ? 93.597 24.581  8.234   1.00 40.36 ? 163  PHE A CZ    1 
ATOM   1627 N  N     . ASN C 3 158 ? 92.613 28.732  8.509   1.00 38.87 ? 164  ASN A N     1 
ATOM   1628 C  CA    . ASN C 3 158 ? 93.391 28.943  9.728   1.00 39.78 ? 164  ASN A CA    1 
ATOM   1629 C  C     . ASN C 3 158 ? 92.930 27.866  10.695  1.00 40.22 ? 164  ASN A C     1 
ATOM   1630 O  O     . ASN C 3 158 ? 91.848 27.307  10.515  1.00 39.22 ? 164  ASN A O     1 
ATOM   1631 C  CB    . ASN C 3 158 ? 93.131 30.330  10.324  1.00 39.58 ? 164  ASN A CB    1 
ATOM   1632 C  CG    . ASN C 3 158 ? 91.690 30.517  10.760  1.00 40.84 ? 164  ASN A CG    1 
ATOM   1633 O  OD1   . ASN C 3 158 ? 91.209 29.825  11.659  1.00 41.62 ? 164  ASN A OD1   1 
ATOM   1634 N  ND2   . ASN C 3 158 ? 90.993 31.449  10.123  1.00 36.51 ? 164  ASN A ND2   1 
ATOM   1635 N  N     . GLU C 3 159 ? 93.745 27.573  11.707  1.00 40.84 ? 165  GLU A N     1 
ATOM   1636 C  CA    . GLU C 3 159 ? 93.413 26.543  12.686  1.00 41.27 ? 165  GLU A CA    1 
ATOM   1637 C  C     . GLU C 3 159 ? 92.136 26.803  13.481  1.00 40.14 ? 165  GLU A C     1 
ATOM   1638 O  O     . GLU C 3 159 ? 91.463 25.861  13.887  1.00 40.88 ? 165  GLU A O     1 
ATOM   1639 C  CB    . GLU C 3 159 ? 94.583 26.319  13.646  1.00 42.95 ? 165  GLU A CB    1 
ATOM   1640 C  CG    . GLU C 3 159 ? 95.796 25.650  13.002  1.00 44.58 ? 165  GLU A CG    1 
ATOM   1641 C  CD    . GLU C 3 159 ? 95.460 24.332  12.311  1.00 45.87 ? 165  GLU A CD    1 
ATOM   1642 O  OE1   . GLU C 3 159 ? 94.816 23.461  12.940  1.00 47.22 ? 165  GLU A OE1   1 
ATOM   1643 O  OE2   . GLU C 3 159 ? 95.848 24.163  11.136  1.00 46.92 ? 165  GLU A OE2   1 
ATOM   1644 N  N     . GLU C 3 160 ? 91.796 28.067  13.709  1.00 39.56 ? 166  GLU A N     1 
ATOM   1645 C  CA    . GLU C 3 160 ? 90.565 28.382  14.435  1.00 39.67 ? 166  GLU A CA    1 
ATOM   1646 C  C     . GLU C 3 160 ? 89.380 27.865  13.607  1.00 38.89 ? 166  GLU A C     1 
ATOM   1647 O  O     . GLU C 3 160 ? 88.364 27.433  14.151  1.00 39.91 ? 166  GLU A O     1 
ATOM   1648 C  CB    . GLU C 3 160 ? 90.434 29.897  14.653  1.00 39.60 ? 166  GLU A CB    1 
ATOM   1649 N  N     . MET C 3 161 ? 89.526 27.909  12.287  1.00 37.14 ? 167  MET A N     1 
ATOM   1650 C  CA    . MET C 3 161 ? 88.486 27.438  11.369  1.00 35.85 ? 167  MET A CA    1 
ATOM   1651 C  C     . MET C 3 161 ? 88.462 25.904  11.378  1.00 34.53 ? 167  MET A C     1 
ATOM   1652 O  O     . MET C 3 161 ? 87.398 25.291  11.387  1.00 33.31 ? 167  MET A O     1 
ATOM   1653 C  CB    . MET C 3 161 ? 88.766 27.955  9.954   1.00 33.73 ? 167  MET A CB    1 
ATOM   1654 C  CG    . MET C 3 161 ? 87.718 27.585  8.913   1.00 31.74 ? 167  MET A CG    1 
ATOM   1655 S  SD    . MET C 3 161 ? 88.213 28.088  7.240   1.00 31.38 ? 167  MET A SD    1 
ATOM   1656 C  CE    . MET C 3 161 ? 88.032 29.901  7.347   1.00 23.59 ? 167  MET A CE    1 
ATOM   1657 N  N     . MET C 3 162 ? 89.646 25.298  11.386  1.00 33.78 ? 168  MET A N     1 
ATOM   1658 C  CA    . MET C 3 162 ? 89.782 23.847  11.412  1.00 35.27 ? 168  MET A CA    1 
ATOM   1659 C  C     . MET C 3 162 ? 89.174 23.271  12.698  1.00 36.69 ? 168  MET A C     1 
ATOM   1660 O  O     . MET C 3 162 ? 88.527 22.219  12.669  1.00 37.03 ? 168  MET A O     1 
ATOM   1661 C  CB    . MET C 3 162 ? 91.265 23.460  11.332  1.00 34.72 ? 168  MET A CB    1 
ATOM   1662 C  CG    . MET C 3 162 ? 91.541 21.960  11.259  1.00 34.05 ? 168  MET A CG    1 
ATOM   1663 S  SD    . MET C 3 162 ? 91.360 21.279  9.590   1.00 38.90 ? 168  MET A SD    1 
ATOM   1664 C  CE    . MET C 3 162 ? 89.668 20.662  9.634   1.00 37.36 ? 168  MET A CE    1 
ATOM   1665 N  N     . ASP C 3 163 ? 89.385 23.952  13.824  1.00 37.19 ? 169  ASP A N     1 
ATOM   1666 C  CA    . ASP C 3 163 ? 88.851 23.475  15.101  1.00 38.67 ? 169  ASP A CA    1 
ATOM   1667 C  C     . ASP C 3 163 ? 87.325 23.526  15.111  1.00 37.80 ? 169  ASP A C     1 
ATOM   1668 O  O     . ASP C 3 163 ? 86.666 22.615  15.613  1.00 37.10 ? 169  ASP A O     1 
ATOM   1669 C  CB    . ASP C 3 163 ? 89.415 24.295  16.273  1.00 40.92 ? 169  ASP A CB    1 
ATOM   1670 C  CG    . ASP C 3 163 ? 90.900 24.047  16.499  1.00 44.54 ? 169  ASP A CG    1 
ATOM   1671 O  OD1   . ASP C 3 163 ? 91.425 23.038  15.976  1.00 47.09 ? 169  ASP A OD1   1 
ATOM   1672 O  OD2   . ASP C 3 163 ? 91.545 24.852  17.209  1.00 47.92 ? 169  ASP A OD2   1 
ATOM   1673 N  N     . TYR C 3 164 ? 86.766 24.594  14.555  1.00 36.96 ? 170  TYR A N     1 
ATOM   1674 C  CA    . TYR C 3 164 ? 85.319 24.726  14.479  1.00 36.27 ? 170  TYR A CA    1 
ATOM   1675 C  C     . TYR C 3 164 ? 84.756 23.646  13.558  1.00 34.45 ? 170  TYR A C     1 
ATOM   1676 O  O     . TYR C 3 164 ? 83.682 23.109  13.814  1.00 33.38 ? 170  TYR A O     1 
ATOM   1677 C  CB    . TYR C 3 164 ? 84.937 26.105  13.943  1.00 38.00 ? 170  TYR A CB    1 
ATOM   1678 C  CG    . TYR C 3 164 ? 84.643 27.140  15.008  1.00 41.67 ? 170  TYR A CG    1 
ATOM   1679 C  CD1   . TYR C 3 164 ? 83.441 27.113  15.726  1.00 42.87 ? 170  TYR A CD1   1 
ATOM   1680 C  CD2   . TYR C 3 164 ? 85.542 28.175  15.269  1.00 42.25 ? 170  TYR A CD2   1 
ATOM   1681 C  CE1   . TYR C 3 164 ? 83.142 28.100  16.671  1.00 44.23 ? 170  TYR A CE1   1 
ATOM   1682 C  CE2   . TYR C 3 164 ? 85.255 29.160  16.210  1.00 44.06 ? 170  TYR A CE2   1 
ATOM   1683 C  CZ    . TYR C 3 164 ? 84.053 29.119  16.904  1.00 44.52 ? 170  TYR A CZ    1 
ATOM   1684 O  OH    . TYR C 3 164 ? 83.761 30.110  17.812  1.00 45.38 ? 170  TYR A OH    1 
ATOM   1685 N  N     . ASN C 3 165 ? 85.482 23.331  12.487  1.00 33.89 ? 171  ASN A N     1 
ATOM   1686 C  CA    . ASN C 3 165 ? 85.039 22.310  11.539  1.00 34.45 ? 171  ASN A CA    1 
ATOM   1687 C  C     . ASN C 3 165 ? 84.942 20.965  12.256  1.00 33.65 ? 171  ASN A C     1 
ATOM   1688 O  O     . ASN C 3 165 ? 83.976 20.224  12.082  1.00 32.06 ? 171  ASN A O     1 
ATOM   1689 C  CB    . ASN C 3 165 ? 86.019 22.201  10.366  1.00 35.04 ? 171  ASN A CB    1 
ATOM   1690 C  CG    . ASN C 3 165 ? 85.490 21.329  9.231   1.00 36.60 ? 171  ASN A CG    1 
ATOM   1691 O  OD1   . ASN C 3 165 ? 86.176 21.106  8.232   1.00 37.79 ? 171  ASN A OD1   1 
ATOM   1692 N  ND2   . ASN C 3 165 ? 84.264 20.839  9.377   1.00 37.40 ? 171  ASN A ND2   1 
ATOM   1693 N  N     . VAL C 3 166 ? 85.950 20.662  13.068  1.00 34.79 ? 172  VAL A N     1 
ATOM   1694 C  CA    . VAL C 3 166 ? 85.973 19.412  13.826  1.00 35.91 ? 172  VAL A CA    1 
ATOM   1695 C  C     . VAL C 3 166 ? 84.815 19.366  14.814  1.00 35.29 ? 172  VAL A C     1 
ATOM   1696 O  O     . VAL C 3 166 ? 84.172 18.339  14.972  1.00 35.43 ? 172  VAL A O     1 
ATOM   1697 C  CB    . VAL C 3 166 ? 87.298 19.254  14.620  1.00 37.00 ? 172  VAL A CB    1 
ATOM   1698 C  CG1   . VAL C 3 166 ? 87.190 18.094  15.614  1.00 36.87 ? 172  VAL A CG1   1 
ATOM   1699 C  CG2   . VAL C 3 166 ? 88.451 19.008  13.658  1.00 37.44 ? 172  VAL A CG2   1 
ATOM   1700 N  N     . GLN C 3 167 ? 84.554 20.490  15.473  1.00 36.51 ? 173  GLN A N     1 
ATOM   1701 C  CA    . GLN C 3 167 ? 83.475 20.571  16.458  1.00 38.22 ? 173  GLN A CA    1 
ATOM   1702 C  C     . GLN C 3 167 ? 82.105 20.397  15.795  1.00 36.80 ? 173  GLN A C     1 
ATOM   1703 O  O     . GLN C 3 167 ? 81.178 19.859  16.396  1.00 35.44 ? 173  GLN A O     1 
ATOM   1704 C  CB    . GLN C 3 167 ? 83.539 21.916  17.201  1.00 41.06 ? 173  GLN A CB    1 
ATOM   1705 C  CG    . GLN C 3 167 ? 82.840 21.915  18.557  1.00 47.88 ? 173  GLN A CG    1 
ATOM   1706 C  CD    . GLN C 3 167 ? 83.282 20.747  19.441  1.00 51.77 ? 173  GLN A CD    1 
ATOM   1707 O  OE1   . GLN C 3 167 ? 84.474 20.419  19.512  1.00 53.00 ? 173  GLN A OE1   1 
ATOM   1708 N  NE2   . GLN C 3 167 ? 82.323 20.120  20.123  1.00 51.71 ? 173  GLN A NE2   1 
ATOM   1709 N  N     . ASP C 3 168 ? 81.984 20.863  14.556  1.00 34.93 ? 174  ASP A N     1 
ATOM   1710 C  CA    . ASP C 3 168 ? 80.737 20.730  13.820  1.00 33.82 ? 174  ASP A CA    1 
ATOM   1711 C  C     . ASP C 3 168 ? 80.427 19.253  13.581  1.00 31.01 ? 174  ASP A C     1 
ATOM   1712 O  O     . ASP C 3 168 ? 79.284 18.832  13.673  1.00 31.31 ? 174  ASP A O     1 
ATOM   1713 C  CB    . ASP C 3 168 ? 80.831 21.469  12.485  1.00 35.03 ? 174  ASP A CB    1 
ATOM   1714 C  CG    . ASP C 3 168 ? 80.136 22.813  12.516  1.00 40.43 ? 174  ASP A CG    1 
ATOM   1715 O  OD1   . ASP C 3 168 ? 80.048 23.424  13.607  1.00 44.01 ? 174  ASP A OD1   1 
ATOM   1716 O  OD2   . ASP C 3 168 ? 79.684 23.271  11.446  1.00 42.44 ? 174  ASP A OD2   1 
ATOM   1717 N  N     . VAL C 3 169 ? 81.447 18.464  13.279  1.00 28.88 ? 175  VAL A N     1 
ATOM   1718 C  CA    . VAL C 3 169 ? 81.226 17.049  13.037  1.00 27.59 ? 175  VAL A CA    1 
ATOM   1719 C  C     . VAL C 3 169 ? 80.893 16.293  14.326  1.00 27.64 ? 175  VAL A C     1 
ATOM   1720 O  O     . VAL C 3 169 ? 80.143 15.324  14.288  1.00 26.92 ? 175  VAL A O     1 
ATOM   1721 C  CB    . VAL C 3 169 ? 82.447 16.396  12.358  1.00 26.91 ? 175  VAL A CB    1 
ATOM   1722 C  CG1   . VAL C 3 169 ? 82.155 14.938  12.079  1.00 24.27 ? 175  VAL A CG1   1 
ATOM   1723 C  CG2   . VAL C 3 169 ? 82.771 17.121  11.061  1.00 28.28 ? 175  VAL A CG2   1 
ATOM   1724 N  N     . VAL C 3 170 ? 81.448 16.721  15.462  1.00 28.30 ? 176  VAL A N     1 
ATOM   1725 C  CA    . VAL C 3 170 ? 81.131 16.041  16.717  1.00 29.82 ? 176  VAL A CA    1 
ATOM   1726 C  C     . VAL C 3 170 ? 79.668 16.344  17.084  1.00 28.93 ? 176  VAL A C     1 
ATOM   1727 O  O     . VAL C 3 170 ? 78.931 15.456  17.498  1.00 29.92 ? 176  VAL A O     1 
ATOM   1728 C  CB    . VAL C 3 170 ? 82.064 16.480  17.907  1.00 30.56 ? 176  VAL A CB    1 
ATOM   1729 C  CG1   . VAL C 3 170 ? 83.525 16.290  17.545  1.00 29.63 ? 176  VAL A CG1   1 
ATOM   1730 C  CG2   . VAL C 3 170 ? 81.806 17.906  18.283  1.00 32.11 ? 176  VAL A CG2   1 
ATOM   1731 N  N     . VAL C 3 171 ? 79.252 17.596  16.917  1.00 29.52 ? 177  VAL A N     1 
ATOM   1732 C  CA    . VAL C 3 171 ? 77.878 17.997  17.218  1.00 30.63 ? 177  VAL A CA    1 
ATOM   1733 C  C     . VAL C 3 171 ? 76.877 17.345  16.256  1.00 30.47 ? 177  VAL A C     1 
ATOM   1734 O  O     . VAL C 3 171 ? 75.806 16.903  16.670  1.00 31.71 ? 177  VAL A O     1 
ATOM   1735 C  CB    . VAL C 3 171 ? 77.727 19.538  17.157  1.00 31.11 ? 177  VAL A CB    1 
ATOM   1736 C  CG1   . VAL C 3 171 ? 76.262 19.939  17.319  1.00 29.94 ? 177  VAL A CG1   1 
ATOM   1737 C  CG2   . VAL C 3 171 ? 78.569 20.176  18.263  1.00 30.61 ? 177  VAL A CG2   1 
ATOM   1738 N  N     . THR C 3 172 ? 77.233 17.290  14.977  1.00 29.22 ? 178  THR A N     1 
ATOM   1739 C  CA    . THR C 3 172 ? 76.384 16.684  13.954  1.00 27.76 ? 178  THR A CA    1 
ATOM   1740 C  C     . THR C 3 172 ? 76.219 15.196  14.227  1.00 29.04 ? 178  THR A C     1 
ATOM   1741 O  O     . THR C 3 172 ? 75.148 14.629  14.008  1.00 29.50 ? 178  THR A O     1 
ATOM   1742 C  CB    . THR C 3 172 ? 76.992 16.858  12.551  1.00 26.43 ? 178  THR A CB    1 
ATOM   1743 O  OG1   . THR C 3 172 ? 77.000 18.252  12.214  1.00 25.00 ? 178  THR A OG1   1 
ATOM   1744 C  CG2   . THR C 3 172 ? 76.188 16.081  11.508  1.00 22.56 ? 178  THR A CG2   1 
ATOM   1745 N  N     . LYS C 3 173 ? 77.293 14.574  14.702  1.00 28.88 ? 179  LYS A N     1 
ATOM   1746 C  CA    . LYS C 3 173 ? 77.290 13.156  15.034  1.00 29.23 ? 179  LYS A CA    1 
ATOM   1747 C  C     . LYS C 3 173 ? 76.321 12.923  16.195  1.00 29.55 ? 179  LYS A C     1 
ATOM   1748 O  O     . LYS C 3 173 ? 75.558 11.961  16.188  1.00 30.17 ? 179  LYS A O     1 
ATOM   1749 C  CB    . LYS C 3 173 ? 78.701 12.713  15.438  1.00 29.68 ? 179  LYS A CB    1 
ATOM   1750 C  CG    . LYS C 3 173 ? 78.824 11.255  15.877  1.00 31.98 ? 179  LYS A CG    1 
ATOM   1751 C  CD    . LYS C 3 173 ? 80.234 10.974  16.409  1.00 34.36 ? 179  LYS A CD    1 
ATOM   1752 C  CE    . LYS C 3 173 ? 80.388 9.548   16.928  1.00 35.31 ? 179  LYS A CE    1 
ATOM   1753 N  NZ    . LYS C 3 173 ? 79.512 9.254   18.098  1.00 36.04 ? 179  LYS A NZ    1 
ATOM   1754 N  N     . ALA C 3 174 ? 76.356 13.814  17.182  1.00 28.05 ? 180  ALA A N     1 
ATOM   1755 C  CA    . ALA C 3 174 ? 75.482 13.705  18.341  1.00 29.17 ? 180  ALA A CA    1 
ATOM   1756 C  C     . ALA C 3 174 ? 74.017 13.974  17.963  1.00 29.32 ? 180  ALA A C     1 
ATOM   1757 O  O     . ALA C 3 174 ? 73.113 13.308  18.475  1.00 30.88 ? 180  ALA A O     1 
ATOM   1758 C  CB    . ALA C 3 174 ? 75.939 14.678  19.449  1.00 27.91 ? 180  ALA A CB    1 
ATOM   1759 N  N     . LEU C 3 175 ? 73.776 14.937  17.075  1.00 27.61 ? 181  LEU A N     1 
ATOM   1760 C  CA    . LEU C 3 175 ? 72.406 15.234  16.658  1.00 27.62 ? 181  LEU A CA    1 
ATOM   1761 C  C     . LEU C 3 175 ? 71.853 13.996  15.962  1.00 27.88 ? 181  LEU A C     1 
ATOM   1762 O  O     . LEU C 3 175 ? 70.716 13.580  16.214  1.00 27.41 ? 181  LEU A O     1 
ATOM   1763 C  CB    . LEU C 3 175 ? 72.374 16.392  15.664  1.00 28.38 ? 181  LEU A CB    1 
ATOM   1764 C  CG    . LEU C 3 175 ? 71.172 17.335  15.629  1.00 29.24 ? 181  LEU A CG    1 
ATOM   1765 C  CD1   . LEU C 3 175 ? 71.132 17.973  14.250  1.00 29.40 ? 181  LEU A CD1   1 
ATOM   1766 C  CD2   . LEU C 3 175 ? 69.874 16.618  15.919  1.00 30.62 ? 181  LEU A CD2   1 
ATOM   1767 N  N     . LEU C 3 176 ? 72.673 13.425  15.080  1.00 26.71 ? 182  LEU A N     1 
ATOM   1768 C  CA    . LEU C 3 176 ? 72.304 12.242  14.318  1.00 27.20 ? 182  LEU A CA    1 
ATOM   1769 C  C     . LEU C 3 176 ? 71.850 11.116  15.237  1.00 29.49 ? 182  LEU A C     1 
ATOM   1770 O  O     . LEU C 3 176 ? 70.730 10.625  15.109  1.00 29.80 ? 182  LEU A O     1 
ATOM   1771 C  CB    . LEU C 3 176 ? 73.486 11.760  13.467  1.00 26.68 ? 182  LEU A CB    1 
ATOM   1772 C  CG    . LEU C 3 176 ? 73.262 10.450  12.696  1.00 28.29 ? 182  LEU A CG    1 
ATOM   1773 C  CD1   . LEU C 3 176 ? 72.168 10.649  11.648  1.00 25.79 ? 182  LEU A CD1   1 
ATOM   1774 C  CD2   . LEU C 3 176 ? 74.568 9.994   12.039  1.00 25.51 ? 182  LEU A CD2   1 
ATOM   1775 N  N     . GLU C 3 177 ? 72.717 10.714  16.165  1.00 31.00 ? 183  GLU A N     1 
ATOM   1776 C  CA    . GLU C 3 177 ? 72.386 9.636   17.090  1.00 32.58 ? 183  GLU A CA    1 
ATOM   1777 C  C     . GLU C 3 177 ? 71.107 9.948   17.869  1.00 32.00 ? 183  GLU A C     1 
ATOM   1778 O  O     . GLU C 3 177 ? 70.261 9.075   18.067  1.00 32.33 ? 183  GLU A O     1 
ATOM   1779 C  CB    . GLU C 3 177 ? 73.571 9.367   18.020  1.00 33.00 ? 183  GLU A CB    1 
ATOM   1780 C  CG    . GLU C 3 177 ? 74.600 8.435   17.384  1.00 37.74 ? 183  GLU A CG    1 
ATOM   1781 C  CD    . GLU C 3 177 ? 75.989 8.554   17.988  1.00 40.21 ? 183  GLU A CD    1 
ATOM   1782 O  OE1   . GLU C 3 177 ? 76.090 8.903   19.185  1.00 43.10 ? 183  GLU A OE1   1 
ATOM   1783 O  OE2   . GLU C 3 177 ? 76.979 8.280   17.270  1.00 39.98 ? 183  GLU A OE2   1 
ATOM   1784 N  N     . LYS C 3 178 ? 70.957 11.202  18.274  1.00 31.82 ? 184  LYS A N     1 
ATOM   1785 C  CA    . LYS C 3 178 ? 69.769 11.640  18.991  1.00 32.35 ? 184  LYS A CA    1 
ATOM   1786 C  C     . LYS C 3 178 ? 68.541 11.437  18.097  1.00 31.70 ? 184  LYS A C     1 
ATOM   1787 O  O     . LYS C 3 178 ? 67.520 10.925  18.543  1.00 32.37 ? 184  LYS A O     1 
ATOM   1788 C  CB    . LYS C 3 178 ? 69.917 13.114  19.359  1.00 34.87 ? 184  LYS A CB    1 
ATOM   1789 C  CG    . LYS C 3 178 ? 68.792 13.691  20.200  1.00 39.19 ? 184  LYS A CG    1 
ATOM   1790 C  CD    . LYS C 3 178 ? 69.000 15.198  20.391  1.00 40.58 ? 184  LYS A CD    1 
ATOM   1791 C  CE    . LYS C 3 178 ? 67.973 15.796  21.337  1.00 42.10 ? 184  LYS A CE    1 
ATOM   1792 N  NZ    . LYS C 3 178 ? 68.120 17.279  21.445  1.00 44.64 ? 184  LYS A NZ    1 
ATOM   1793 N  N     . LEU C 3 179 ? 68.646 11.838  16.831  1.00 31.29 ? 185  LEU A N     1 
ATOM   1794 C  CA    . LEU C 3 179 ? 67.549 11.684  15.881  1.00 29.66 ? 185  LEU A CA    1 
ATOM   1795 C  C     . LEU C 3 179 ? 67.240 10.215  15.609  1.00 28.88 ? 185  LEU A C     1 
ATOM   1796 O  O     . LEU C 3 179 ? 66.082 9.823   15.538  1.00 29.09 ? 185  LEU A O     1 
ATOM   1797 C  CB    . LEU C 3 179 ? 67.880 12.398  14.560  1.00 28.66 ? 185  LEU A CB    1 
ATOM   1798 C  CG    . LEU C 3 179 ? 67.957 13.923  14.681  1.00 30.47 ? 185  LEU A CG    1 
ATOM   1799 C  CD1   . LEU C 3 179 ? 68.522 14.550  13.409  1.00 26.51 ? 185  LEU A CD1   1 
ATOM   1800 C  CD2   . LEU C 3 179 ? 66.562 14.463  14.996  1.00 29.25 ? 185  LEU A CD2   1 
ATOM   1801 N  N     . LEU C 3 180 ? 68.274 9.401   15.451  1.00 28.46 ? 186  LEU A N     1 
ATOM   1802 C  CA    . LEU C 3 180 ? 68.073 7.981   15.185  1.00 30.13 ? 186  LEU A CA    1 
ATOM   1803 C  C     . LEU C 3 180 ? 67.511 7.231   16.400  1.00 31.30 ? 186  LEU A C     1 
ATOM   1804 O  O     . LEU C 3 180 ? 67.019 6.113   16.264  1.00 30.87 ? 186  LEU A O     1 
ATOM   1805 C  CB    . LEU C 3 180 ? 69.388 7.326   14.745  1.00 28.66 ? 186  LEU A CB    1 
ATOM   1806 C  CG    . LEU C 3 180 ? 70.022 7.823   13.444  1.00 29.01 ? 186  LEU A CG    1 
ATOM   1807 C  CD1   . LEU C 3 180 ? 71.327 7.071   13.200  1.00 28.59 ? 186  LEU A CD1   1 
ATOM   1808 C  CD2   . LEU C 3 180 ? 69.049 7.623   12.280  1.00 28.25 ? 186  LEU A CD2   1 
ATOM   1809 N  N     . SER C 3 181 ? 67.587 7.837   17.582  1.00 32.11 ? 187  SER A N     1 
ATOM   1810 C  CA    . SER C 3 181 ? 67.064 7.187   18.781  1.00 33.81 ? 187  SER A CA    1 
ATOM   1811 C  C     . SER C 3 181 ? 65.542 7.331   18.869  1.00 34.73 ? 187  SER A C     1 
ATOM   1812 O  O     . SER C 3 181 ? 64.928 6.842   19.819  1.00 35.62 ? 187  SER A O     1 
ATOM   1813 C  CB    . SER C 3 181 ? 67.700 7.774   20.048  1.00 33.37 ? 187  SER A CB    1 
ATOM   1814 O  OG    . SER C 3 181 ? 67.065 8.980   20.441  1.00 34.72 ? 187  SER A OG    1 
ATOM   1815 N  N     . ASP C 3 182 ? 64.936 8.004   17.890  1.00 34.00 ? 188  ASP A N     1 
ATOM   1816 C  CA    . ASP C 3 182 ? 63.482 8.174   17.884  1.00 33.65 ? 188  ASP A CA    1 
ATOM   1817 C  C     . ASP C 3 182 ? 62.822 6.967   17.219  1.00 32.66 ? 188  ASP A C     1 
ATOM   1818 O  O     . ASP C 3 182 ? 62.730 6.888   15.988  1.00 30.58 ? 188  ASP A O     1 
ATOM   1819 C  CB    . ASP C 3 182 ? 63.080 9.452   17.141  1.00 34.72 ? 188  ASP A CB    1 
ATOM   1820 C  CG    . ASP C 3 182 ? 61.618 9.803   17.342  1.00 34.77 ? 188  ASP A CG    1 
ATOM   1821 O  OD1   . ASP C 3 182 ? 60.759 8.908   17.201  1.00 36.98 ? 188  ASP A OD1   1 
ATOM   1822 O  OD2   . ASP C 3 182 ? 61.323 10.977  17.636  1.00 37.03 ? 188  ASP A OD2   1 
ATOM   1823 N  N     . LYS C 3 183 ? 62.352 6.041   18.055  1.00 33.27 ? 189  LYS A N     1 
ATOM   1824 C  CA    . LYS C 3 183 ? 61.715 4.799   17.614  1.00 32.16 ? 189  LYS A CA    1 
ATOM   1825 C  C     . LYS C 3 183 ? 60.547 4.929   16.638  1.00 31.18 ? 189  LYS A C     1 
ATOM   1826 O  O     . LYS C 3 183 ? 60.298 4.016   15.854  1.00 30.82 ? 189  LYS A O     1 
ATOM   1827 C  CB    . LYS C 3 183 ? 61.262 3.992   18.838  1.00 33.94 ? 189  LYS A CB    1 
ATOM   1828 N  N     . HIS C 3 184 ? 59.822 6.042   16.681  1.00 30.89 ? 190  HIS A N     1 
ATOM   1829 C  CA    . HIS C 3 184 ? 58.695 6.227   15.758  1.00 29.68 ? 190  HIS A CA    1 
ATOM   1830 C  C     . HIS C 3 184 ? 59.196 6.285   14.312  1.00 28.12 ? 190  HIS A C     1 
ATOM   1831 O  O     . HIS C 3 184 ? 58.565 5.756   13.404  1.00 29.30 ? 190  HIS A O     1 
ATOM   1832 C  CB    . HIS C 3 184 ? 57.934 7.522   16.077  1.00 30.30 ? 190  HIS A CB    1 
ATOM   1833 C  CG    . HIS C 3 184 ? 56.792 7.803   15.143  1.00 32.48 ? 190  HIS A CG    1 
ATOM   1834 N  ND1   . HIS C 3 184 ? 55.526 7.286   15.332  1.00 33.79 ? 190  HIS A ND1   1 
ATOM   1835 C  CD2   . HIS C 3 184 ? 56.728 8.544   14.010  1.00 30.49 ? 190  HIS A CD2   1 
ATOM   1836 C  CE1   . HIS C 3 184 ? 54.732 7.699   14.357  1.00 32.30 ? 190  HIS A CE1   1 
ATOM   1837 N  NE2   . HIS C 3 184 ? 55.437 8.463   13.542  1.00 28.29 ? 190  HIS A NE2   1 
ATOM   1838 N  N     . TYR C 3 185 ? 60.336 6.930   14.101  1.00 26.50 ? 191  TYR A N     1 
ATOM   1839 C  CA    . TYR C 3 185 ? 60.881 7.052   12.756  1.00 25.97 ? 191  TYR A CA    1 
ATOM   1840 C  C     . TYR C 3 185 ? 61.911 5.978   12.396  1.00 26.40 ? 191  TYR A C     1 
ATOM   1841 O  O     . TYR C 3 185 ? 62.081 5.649   11.227  1.00 27.31 ? 191  TYR A O     1 
ATOM   1842 C  CB    . TYR C 3 185 ? 61.494 8.443   12.571  1.00 24.95 ? 191  TYR A CB    1 
ATOM   1843 C  CG    . TYR C 3 185 ? 60.489 9.573   12.704  1.00 24.12 ? 191  TYR A CG    1 
ATOM   1844 C  CD1   . TYR C 3 185 ? 60.153 10.097  13.954  1.00 23.41 ? 191  TYR A CD1   1 
ATOM   1845 C  CD2   . TYR C 3 185 ? 59.849 10.088  11.580  1.00 21.36 ? 191  TYR A CD2   1 
ATOM   1846 C  CE1   . TYR C 3 185 ? 59.194 11.110  14.075  1.00 24.79 ? 191  TYR A CE1   1 
ATOM   1847 C  CE2   . TYR C 3 185 ? 58.893 11.091  11.687  1.00 22.45 ? 191  TYR A CE2   1 
ATOM   1848 C  CZ    . TYR C 3 185 ? 58.567 11.598  12.934  1.00 24.93 ? 191  TYR A CZ    1 
ATOM   1849 O  OH    . TYR C 3 185 ? 57.607 12.576  13.031  1.00 25.43 ? 191  TYR A OH    1 
ATOM   1850 N  N     . PHE C 3 186 ? 62.585 5.425   13.399  1.00 27.76 ? 192  PHE A N     1 
ATOM   1851 C  CA    . PHE C 3 186 ? 63.606 4.408   13.165  1.00 29.55 ? 192  PHE A CA    1 
ATOM   1852 C  C     . PHE C 3 186 ? 63.436 3.179   14.070  1.00 32.90 ? 192  PHE A C     1 
ATOM   1853 O  O     . PHE C 3 186 ? 63.660 3.256   15.281  1.00 32.80 ? 192  PHE A O     1 
ATOM   1854 C  CB    . PHE C 3 186 ? 64.994 5.020   13.401  1.00 27.02 ? 192  PHE A CB    1 
ATOM   1855 C  CG    . PHE C 3 186 ? 65.328 6.157   12.469  1.00 27.65 ? 192  PHE A CG    1 
ATOM   1856 C  CD1   . PHE C 3 186 ? 65.725 5.906   11.155  1.00 28.23 ? 192  PHE A CD1   1 
ATOM   1857 C  CD2   . PHE C 3 186 ? 65.212 7.481   12.896  1.00 26.08 ? 192  PHE A CD2   1 
ATOM   1858 C  CE1   . PHE C 3 186 ? 65.999 6.961   10.272  1.00 29.37 ? 192  PHE A CE1   1 
ATOM   1859 C  CE2   . PHE C 3 186 ? 65.482 8.547   12.027  1.00 27.08 ? 192  PHE A CE2   1 
ATOM   1860 C  CZ    . PHE C 3 186 ? 65.874 8.289   10.713  1.00 27.77 ? 192  PHE A CZ    1 
ATOM   1861 N  N     . PRO C 3 187 ? 63.034 2.031   13.496  1.00 36.44 ? 193  PRO A N     1 
ATOM   1862 C  CA    . PRO C 3 187 ? 62.858 0.806   14.302  1.00 39.26 ? 193  PRO A CA    1 
ATOM   1863 C  C     . PRO C 3 187 ? 64.054 0.551   15.238  1.00 42.46 ? 193  PRO A C     1 
ATOM   1864 O  O     . PRO C 3 187 ? 65.211 0.551   14.807  1.00 42.20 ? 193  PRO A O     1 
ATOM   1865 C  CB    . PRO C 3 187 ? 62.707 -0.282  13.246  1.00 37.57 ? 193  PRO A CB    1 
ATOM   1866 C  CG    . PRO C 3 187 ? 61.937 0.440   12.158  1.00 38.04 ? 193  PRO A CG    1 
ATOM   1867 C  CD    . PRO C 3 187 ? 62.605 1.820   12.100  1.00 35.79 ? 193  PRO A CD    1 
ATOM   1868 N  N     . PRO C 3 188 ? 63.784 0.328   16.534  1.00 44.89 ? 194  PRO A N     1 
ATOM   1869 C  CA    . PRO C 3 188 ? 64.818 0.075   17.547  1.00 46.78 ? 194  PRO A CA    1 
ATOM   1870 C  C     . PRO C 3 188 ? 65.742 -1.126  17.289  1.00 47.47 ? 194  PRO A C     1 
ATOM   1871 O  O     . PRO C 3 188 ? 66.913 -1.108  17.679  1.00 46.85 ? 194  PRO A O     1 
ATOM   1872 C  CB    . PRO C 3 188 ? 64.006 -0.099  18.834  1.00 47.31 ? 194  PRO A CB    1 
ATOM   1873 C  CG    . PRO C 3 188 ? 62.772 0.719   18.577  1.00 47.16 ? 194  PRO A CG    1 
ATOM   1874 C  CD    . PRO C 3 188 ? 62.447 0.349   17.151  1.00 45.33 ? 194  PRO A CD    1 
ATOM   1875 N  N     . GLU C 3 189 ? 65.221 -2.160  16.636  1.00 48.02 ? 195  GLU A N     1 
ATOM   1876 C  CA    . GLU C 3 189 ? 66.009 -3.361  16.361  1.00 48.75 ? 195  GLU A CA    1 
ATOM   1877 C  C     . GLU C 3 189 ? 67.209 -3.131  15.435  1.00 48.33 ? 195  GLU A C     1 
ATOM   1878 O  O     . GLU C 3 189 ? 68.140 -3.938  15.402  1.00 47.99 ? 195  GLU A O     1 
ATOM   1879 C  CB    . GLU C 3 189 ? 65.125 -4.454  15.737  1.00 49.78 ? 195  GLU A CB    1 
ATOM   1880 C  CG    . GLU C 3 189 ? 63.627 -4.166  15.738  1.00 53.87 ? 195  GLU A CG    1 
ATOM   1881 C  CD    . GLU C 3 189 ? 63.009 -4.241  14.342  1.00 55.75 ? 195  GLU A CD    1 
ATOM   1882 O  OE1   . GLU C 3 189 ? 63.255 -5.236  13.623  1.00 55.26 ? 195  GLU A OE1   1 
ATOM   1883 O  OE2   . GLU C 3 189 ? 62.266 -3.307  13.965  1.00 57.23 ? 195  GLU A OE2   1 
ATOM   1884 N  N     . ILE C 3 190 ? 67.195 -2.030  14.691  1.00 47.43 ? 196  ILE A N     1 
ATOM   1885 C  CA    . ILE C 3 190 ? 68.262 -1.759  13.734  1.00 44.47 ? 196  ILE A CA    1 
ATOM   1886 C  C     . ILE C 3 190 ? 69.237 -0.651  14.111  1.00 42.42 ? 196  ILE A C     1 
ATOM   1887 O  O     . ILE C 3 190 ? 68.819 0.432   14.507  1.00 42.30 ? 196  ILE A O     1 
ATOM   1888 C  CB    . ILE C 3 190 ? 67.648 -1.399  12.364  1.00 45.76 ? 196  ILE A CB    1 
ATOM   1889 C  CG1   . ILE C 3 190 ? 66.600 -2.446  11.981  1.00 46.55 ? 196  ILE A CG1   1 
ATOM   1890 C  CG2   . ILE C 3 190 ? 68.732 -1.309  11.307  1.00 44.86 ? 196  ILE A CG2   1 
ATOM   1891 C  CD1   . ILE C 3 190 ? 65.760 -2.068  10.766  1.00 48.67 ? 196  ILE A CD1   1 
ATOM   1892 N  N     . ASP C 3 191 ? 70.535 -0.930  13.991  1.00 39.55 ? 197  ASP A N     1 
ATOM   1893 C  CA    . ASP C 3 191 ? 71.558 0.081   14.254  1.00 38.02 ? 197  ASP A CA    1 
ATOM   1894 C  C     . ASP C 3 191 ? 71.687 0.818   12.921  1.00 36.04 ? 197  ASP A C     1 
ATOM   1895 O  O     . ASP C 3 191 ? 72.313 0.313   11.980  1.00 33.68 ? 197  ASP A O     1 
ATOM   1896 C  CB    . ASP C 3 191 ? 72.911 -0.551  14.594  1.00 38.41 ? 197  ASP A CB    1 
ATOM   1897 C  CG    . ASP C 3 191 ? 73.977 0.497   14.913  1.00 40.72 ? 197  ASP A CG    1 
ATOM   1898 O  OD1   . ASP C 3 191 ? 73.761 1.685   14.583  1.00 40.58 ? 197  ASP A OD1   1 
ATOM   1899 O  OD2   . ASP C 3 191 ? 75.033 0.144   15.487  1.00 42.15 ? 197  ASP A OD2   1 
ATOM   1900 N  N     . PHE C 3 192 ? 71.092 2.001   12.826  1.00 34.35 ? 198  PHE A N     1 
ATOM   1901 C  CA    . PHE C 3 192 ? 71.144 2.727   11.567  1.00 32.07 ? 198  PHE A CA    1 
ATOM   1902 C  C     . PHE C 3 192 ? 72.479 3.370   11.197  1.00 31.45 ? 198  PHE A C     1 
ATOM   1903 O  O     . PHE C 3 192 ? 72.617 3.917   10.106  1.00 29.86 ? 198  PHE A O     1 
ATOM   1904 C  CB    . PHE C 3 192 ? 70.003 3.742   11.501  1.00 29.25 ? 198  PHE A CB    1 
ATOM   1905 C  CG    . PHE C 3 192 ? 68.664 3.107   11.258  1.00 28.66 ? 198  PHE A CG    1 
ATOM   1906 C  CD1   . PHE C 3 192 ? 67.937 2.543   12.313  1.00 28.11 ? 198  PHE A CD1   1 
ATOM   1907 C  CD2   . PHE C 3 192 ? 68.153 3.009   9.965   1.00 28.49 ? 198  PHE A CD2   1 
ATOM   1908 C  CE1   . PHE C 3 192 ? 66.728 1.892   12.079  1.00 25.08 ? 198  PHE A CE1   1 
ATOM   1909 C  CE2   . PHE C 3 192 ? 66.942 2.354   9.720   1.00 27.55 ? 198  PHE A CE2   1 
ATOM   1910 C  CZ    . PHE C 3 192 ? 66.231 1.795   10.783  1.00 27.06 ? 198  PHE A CZ    1 
ATOM   1911 N  N     . THR C 3 193 ? 73.464 3.295   12.084  1.00 31.69 ? 199  THR A N     1 
ATOM   1912 C  CA    . THR C 3 193 ? 74.783 3.841   11.769  1.00 32.77 ? 199  THR A CA    1 
ATOM   1913 C  C     . THR C 3 193 ? 75.634 2.690   11.255  1.00 33.53 ? 199  THR A C     1 
ATOM   1914 O  O     . THR C 3 193 ? 76.840 2.835   11.070  1.00 33.59 ? 199  THR A O     1 
ATOM   1915 C  CB    . THR C 3 193 ? 75.511 4.410   13.002  1.00 33.99 ? 199  THR A CB    1 
ATOM   1916 O  OG1   . THR C 3 193 ? 75.845 3.334   13.891  1.00 34.50 ? 199  THR A OG1   1 
ATOM   1917 C  CG2   . THR C 3 193 ? 74.641 5.430   13.725  1.00 33.38 ? 199  THR A CG2   1 
ATOM   1918 N  N     . ASP C 3 194 ? 75.004 1.543   11.028  1.00 33.52 ? 200  ASP A N     1 
ATOM   1919 C  CA    . ASP C 3 194 ? 75.730 0.374   10.559  1.00 35.07 ? 200  ASP A CA    1 
ATOM   1920 C  C     . ASP C 3 194 ? 74.994 -0.388  9.454   1.00 33.72 ? 200  ASP A C     1 
ATOM   1921 O  O     . ASP C 3 194 ? 75.018 -1.612  9.410   1.00 33.44 ? 200  ASP A O     1 
ATOM   1922 C  CB    . ASP C 3 194 ? 76.019 -0.555  11.751  1.00 37.57 ? 200  ASP A CB    1 
ATOM   1923 C  CG    . ASP C 3 194 ? 76.931 -1.715  11.385  1.00 41.37 ? 200  ASP A CG    1 
ATOM   1924 O  OD1   . ASP C 3 194 ? 78.081 -1.462  10.955  1.00 43.24 ? 200  ASP A OD1   1 
ATOM   1925 O  OD2   . ASP C 3 194 ? 76.495 -2.879  11.525  1.00 42.34 ? 200  ASP A OD2   1 
ATOM   1926 N  N     . VAL C 3 195 ? 74.344 0.342   8.558   1.00 33.11 ? 201  VAL A N     1 
ATOM   1927 C  CA    . VAL C 3 195 ? 73.621 -0.284  7.457   1.00 31.80 ? 201  VAL A CA    1 
ATOM   1928 C  C     . VAL C 3 195 ? 73.951 0.424   6.149   1.00 32.70 ? 201  VAL A C     1 
ATOM   1929 O  O     . VAL C 3 195 ? 74.469 1.547   6.154   1.00 32.00 ? 201  VAL A O     1 
ATOM   1930 C  CB    . VAL C 3 195 ? 72.093 -0.211  7.671   1.00 31.55 ? 201  VAL A CB    1 
ATOM   1931 C  CG1   . VAL C 3 195 ? 71.705 -0.948  8.974   1.00 31.03 ? 201  VAL A CG1   1 
ATOM   1932 C  CG2   . VAL C 3 195 ? 71.640 1.259   7.712   1.00 29.86 ? 201  VAL A CG2   1 
ATOM   1933 N  N     . GLY C 3 196 ? 73.646 -0.241  5.036   1.00 33.08 ? 202  GLY A N     1 
ATOM   1934 C  CA    . GLY C 3 196 ? 73.888 0.331   3.723   1.00 31.34 ? 202  GLY A CA    1 
ATOM   1935 C  C     . GLY C 3 196 ? 72.784 1.318   3.401   1.00 31.54 ? 202  GLY A C     1 
ATOM   1936 O  O     . GLY C 3 196 ? 71.765 1.340   4.087   1.00 31.76 ? 202  GLY A O     1 
ATOM   1937 N  N     . TYR C 3 197 ? 72.958 2.112   2.348   1.00 31.00 ? 203  TYR A N     1 
ATOM   1938 C  CA    . TYR C 3 197 ? 71.963 3.120   2.003   1.00 30.85 ? 203  TYR A CA    1 
ATOM   1939 C  C     . TYR C 3 197 ? 70.583 2.560   1.668   1.00 31.19 ? 203  TYR A C     1 
ATOM   1940 O  O     . TYR C 3 197 ? 69.577 3.105   2.117   1.00 32.42 ? 203  TYR A O     1 
ATOM   1941 C  CB    . TYR C 3 197 ? 72.484 4.032   0.863   1.00 29.25 ? 203  TYR A CB    1 
ATOM   1942 C  CG    . TYR C 3 197 ? 72.365 3.472   -0.541  1.00 26.69 ? 203  TYR A CG    1 
ATOM   1943 C  CD1   . TYR C 3 197 ? 71.174 3.585   -1.249  1.00 26.00 ? 203  TYR A CD1   1 
ATOM   1944 C  CD2   . TYR C 3 197 ? 73.444 2.819   -1.156  1.00 27.97 ? 203  TYR A CD2   1 
ATOM   1945 C  CE1   . TYR C 3 197 ? 71.038 3.068   -2.540  1.00 26.74 ? 203  TYR A CE1   1 
ATOM   1946 C  CE2   . TYR C 3 197 ? 73.324 2.288   -2.452  1.00 27.99 ? 203  TYR A CE2   1 
ATOM   1947 C  CZ    . TYR C 3 197 ? 72.111 2.416   -3.137  1.00 28.63 ? 203  TYR A CZ    1 
ATOM   1948 O  OH    . TYR C 3 197 ? 71.940 1.866   -4.395  1.00 30.57 ? 203  TYR A OH    1 
ATOM   1949 N  N     . THR C 3 198 ? 70.510 1.480   0.898   1.00 31.65 ? 204  THR A N     1 
ATOM   1950 C  CA    . THR C 3 198 ? 69.191 0.937   0.575   1.00 31.72 ? 204  THR A CA    1 
ATOM   1951 C  C     . THR C 3 198 ? 68.453 0.461   1.840   1.00 29.80 ? 204  THR A C     1 
ATOM   1952 O  O     . THR C 3 198 ? 67.243 0.624   1.947   1.00 29.84 ? 204  THR A O     1 
ATOM   1953 C  CB    . THR C 3 198 ? 69.277 -0.221  -0.413  1.00 31.84 ? 204  THR A CB    1 
ATOM   1954 O  OG1   . THR C 3 198 ? 69.784 -1.380  0.256   1.00 38.80 ? 204  THR A OG1   1 
ATOM   1955 C  CG2   . THR C 3 198 ? 70.189 0.139   -1.558  1.00 32.39 ? 204  THR A CG2   1 
ATOM   1956 N  N     . THR C 3 199 ? 69.179 -0.115  2.794   1.00 27.28 ? 205  THR A N     1 
ATOM   1957 C  CA    . THR C 3 199 ? 68.553 -0.566  4.028   1.00 26.67 ? 205  THR A CA    1 
ATOM   1958 C  C     . THR C 3 199 ? 68.087 0.650   4.819   1.00 27.38 ? 205  THR A C     1 
ATOM   1959 O  O     . THR C 3 199 ? 66.981 0.663   5.366   1.00 27.05 ? 205  THR A O     1 
ATOM   1960 C  CB    . THR C 3 199 ? 69.529 -1.380  4.907   1.00 26.67 ? 205  THR A CB    1 
ATOM   1961 O  OG1   . THR C 3 199 ? 69.785 -2.648  4.295   1.00 27.10 ? 205  THR A OG1   1 
ATOM   1962 C  CG2   . THR C 3 199 ? 68.947 -1.605  6.293   1.00 28.13 ? 205  THR A CG2   1 
ATOM   1963 N  N     . PHE C 3 200 ? 68.930 1.676   4.870   1.00 25.62 ? 206  PHE A N     1 
ATOM   1964 C  CA    . PHE C 3 200 ? 68.586 2.885   5.596   1.00 24.87 ? 206  PHE A CA    1 
ATOM   1965 C  C     . PHE C 3 200 ? 67.243 3.452   5.161   1.00 25.98 ? 206  PHE A C     1 
ATOM   1966 O  O     . PHE C 3 200 ? 66.383 3.732   5.995   1.00 26.42 ? 206  PHE A O     1 
ATOM   1967 C  CB    . PHE C 3 200 ? 69.679 3.947   5.428   1.00 25.86 ? 206  PHE A CB    1 
ATOM   1968 C  CG    . PHE C 3 200 ? 69.459 5.176   6.270   1.00 25.74 ? 206  PHE A CG    1 
ATOM   1969 C  CD1   . PHE C 3 200 ? 68.666 6.225   5.803   1.00 24.60 ? 206  PHE A CD1   1 
ATOM   1970 C  CD2   . PHE C 3 200 ? 70.014 5.266   7.547   1.00 24.51 ? 206  PHE A CD2   1 
ATOM   1971 C  CE1   . PHE C 3 200 ? 68.427 7.354   6.600   1.00 25.65 ? 206  PHE A CE1   1 
ATOM   1972 C  CE2   . PHE C 3 200 ? 69.783 6.387   8.353   1.00 25.72 ? 206  PHE A CE2   1 
ATOM   1973 C  CZ    . PHE C 3 200 ? 68.986 7.436   7.878   1.00 25.34 ? 206  PHE A CZ    1 
ATOM   1974 N  N     . TRP C 3 201 ? 67.059 3.631   3.858   1.00 26.19 ? 207  TRP A N     1 
ATOM   1975 C  CA    . TRP C 3 201 ? 65.802 4.169   3.360   1.00 27.59 ? 207  TRP A CA    1 
ATOM   1976 C  C     . TRP C 3 201 ? 64.656 3.179   3.471   1.00 29.00 ? 207  TRP A C     1 
ATOM   1977 O  O     . TRP C 3 201 ? 63.528 3.561   3.761   1.00 31.18 ? 207  TRP A O     1 
ATOM   1978 C  CB    . TRP C 3 201 ? 65.930 4.596   1.893   1.00 27.09 ? 207  TRP A CB    1 
ATOM   1979 C  CG    . TRP C 3 201 ? 67.024 5.575   1.654   1.00 26.24 ? 207  TRP A CG    1 
ATOM   1980 C  CD1   . TRP C 3 201 ? 68.104 5.410   0.834   1.00 24.64 ? 207  TRP A CD1   1 
ATOM   1981 C  CD2   . TRP C 3 201 ? 67.175 6.858   2.266   1.00 24.92 ? 207  TRP A CD2   1 
ATOM   1982 N  NE1   . TRP C 3 201 ? 68.916 6.503   0.901   1.00 24.71 ? 207  TRP A NE1   1 
ATOM   1983 C  CE2   . TRP C 3 201 ? 68.373 7.414   1.771   1.00 25.59 ? 207  TRP A CE2   1 
ATOM   1984 C  CE3   . TRP C 3 201 ? 66.416 7.593   3.186   1.00 24.20 ? 207  TRP A CE3   1 
ATOM   1985 C  CZ2   . TRP C 3 201 ? 68.836 8.678   2.164   1.00 23.36 ? 207  TRP A CZ2   1 
ATOM   1986 C  CZ3   . TRP C 3 201 ? 66.879 8.854   3.583   1.00 25.15 ? 207  TRP A CZ3   1 
ATOM   1987 C  CH2   . TRP C 3 201 ? 68.077 9.380   3.069   1.00 22.81 ? 207  TRP A CH2   1 
ATOM   1988 N  N     . SER C 3 202 ? 64.931 1.902   3.253   1.00 30.47 ? 208  SER A N     1 
ATOM   1989 C  CA    . SER C 3 202 ? 63.852 0.932   3.301   1.00 31.92 ? 208  SER A CA    1 
ATOM   1990 C  C     . SER C 3 202 ? 63.352 0.560   4.696   1.00 31.23 ? 208  SER A C     1 
ATOM   1991 O  O     . SER C 3 202 ? 62.170 0.285   4.865   1.00 32.45 ? 208  SER A O     1 
ATOM   1992 C  CB    . SER C 3 202 ? 64.244 -0.325  2.523   1.00 30.85 ? 208  SER A CB    1 
ATOM   1993 O  OG    . SER C 3 202 ? 65.311 -1.010  3.156   1.00 38.90 ? 208  SER A OG    1 
ATOM   1994 N  N     . GLU C 3 203 ? 64.226 0.575   5.697   1.00 31.57 ? 209  GLU A N     1 
ATOM   1995 C  CA    . GLU C 3 203 ? 63.811 0.202   7.048   1.00 32.66 ? 209  GLU A CA    1 
ATOM   1996 C  C     . GLU C 3 203 ? 63.278 1.352   7.905   1.00 31.35 ? 209  GLU A C     1 
ATOM   1997 O  O     . GLU C 3 203 ? 62.705 1.117   8.965   1.00 29.91 ? 209  GLU A O     1 
ATOM   1998 C  CB    . GLU C 3 203 ? 64.966 -0.477  7.793   1.00 35.38 ? 209  GLU A CB    1 
ATOM   1999 C  CG    . GLU C 3 203 ? 65.575 -1.664  7.058   1.00 41.85 ? 209  GLU A CG    1 
ATOM   2000 C  CD    . GLU C 3 203 ? 64.548 -2.703  6.666   1.00 44.57 ? 209  GLU A CD    1 
ATOM   2001 O  OE1   . GLU C 3 203 ? 63.910 -3.285  7.570   1.00 46.43 ? 209  GLU A OE1   1 
ATOM   2002 O  OE2   . GLU C 3 203 ? 64.378 -2.935  5.447   1.00 47.08 ? 209  GLU A OE2   1 
ATOM   2003 N  N     . SER C 3 204 ? 63.466 2.593   7.469   1.00 30.02 ? 210  SER A N     1 
ATOM   2004 C  CA    . SER C 3 204 ? 62.969 3.716   8.262   1.00 28.64 ? 210  SER A CA    1 
ATOM   2005 C  C     . SER C 3 204 ? 61.584 4.142   7.791   1.00 26.80 ? 210  SER A C     1 
ATOM   2006 O  O     . SER C 3 204 ? 61.126 3.734   6.729   1.00 26.89 ? 210  SER A O     1 
ATOM   2007 C  CB    . SER C 3 204 ? 63.941 4.903   8.198   1.00 27.18 ? 210  SER A CB    1 
ATOM   2008 O  OG    . SER C 3 204 ? 64.042 5.416   6.886   1.00 28.42 ? 210  SER A OG    1 
ATOM   2009 N  N     . LEU C 3 205 ? 60.916 4.958   8.594   1.00 27.24 ? 211  LEU A N     1 
ATOM   2010 C  CA    . LEU C 3 205 ? 59.586 5.432   8.248   1.00 28.04 ? 211  LEU A CA    1 
ATOM   2011 C  C     . LEU C 3 205 ? 59.664 6.109   6.882   1.00 27.86 ? 211  LEU A C     1 
ATOM   2012 O  O     . LEU C 3 205 ? 60.630 6.815   6.584   1.00 29.82 ? 211  LEU A O     1 
ATOM   2013 C  CB    . LEU C 3 205 ? 59.083 6.422   9.308   1.00 26.28 ? 211  LEU A CB    1 
ATOM   2014 C  CG    . LEU C 3 205 ? 57.560 6.590   9.423   1.00 27.72 ? 211  LEU A CG    1 
ATOM   2015 C  CD1   . LEU C 3 205 ? 56.905 5.267   9.864   1.00 25.20 ? 211  LEU A CD1   1 
ATOM   2016 C  CD2   . LEU C 3 205 ? 57.252 7.687   10.433  1.00 26.32 ? 211  LEU A CD2   1 
ATOM   2017 N  N     . GLU C 3 206 ? 58.653 5.881   6.054   1.00 27.42 ? 212  GLU A N     1 
ATOM   2018 C  CA    . GLU C 3 206 ? 58.602 6.453   4.715   1.00 27.28 ? 212  GLU A CA    1 
ATOM   2019 C  C     . GLU C 3 206 ? 58.910 7.960   4.688   1.00 26.61 ? 212  GLU A C     1 
ATOM   2020 O  O     . GLU C 3 206 ? 59.551 8.443   3.757   1.00 25.69 ? 212  GLU A O     1 
ATOM   2021 C  CB    . GLU C 3 206 ? 57.229 6.178   4.089   1.00 27.60 ? 212  GLU A CB    1 
ATOM   2022 C  CG    . GLU C 3 206 ? 57.006 6.851   2.738   1.00 32.71 ? 212  GLU A CG    1 
ATOM   2023 C  CD    . GLU C 3 206 ? 55.675 6.474   2.097   1.00 34.97 ? 212  GLU A CD    1 
ATOM   2024 O  OE1   . GLU C 3 206 ? 54.653 6.368   2.812   1.00 36.78 ? 212  GLU A OE1   1 
ATOM   2025 O  OE2   . GLU C 3 206 ? 55.646 6.294   0.866   1.00 39.25 ? 212  GLU A OE2   1 
ATOM   2026 N  N     . ALA C 3 207 ? 58.462 8.686   5.713   1.00 24.87 ? 213  ALA A N     1 
ATOM   2027 C  CA    . ALA C 3 207 ? 58.688 10.129  5.812   1.00 24.65 ? 213  ALA A CA    1 
ATOM   2028 C  C     . ALA C 3 207 ? 60.159 10.545  5.671   1.00 23.59 ? 213  ALA A C     1 
ATOM   2029 O  O     . ALA C 3 207 ? 60.453 11.577  5.073   1.00 24.25 ? 213  ALA A O     1 
ATOM   2030 C  CB    . ALA C 3 207 ? 58.127 10.664  7.142   1.00 21.95 ? 213  ALA A CB    1 
ATOM   2031 N  N     . VAL C 3 208 ? 61.072 9.751   6.230   1.00 22.65 ? 214  VAL A N     1 
ATOM   2032 C  CA    . VAL C 3 208 ? 62.503 10.050  6.170   1.00 22.12 ? 214  VAL A CA    1 
ATOM   2033 C  C     . VAL C 3 208 ? 62.973 10.109  4.711   1.00 22.56 ? 214  VAL A C     1 
ATOM   2034 O  O     . VAL C 3 208 ? 63.642 11.052  4.284   1.00 22.40 ? 214  VAL A O     1 
ATOM   2035 C  CB    . VAL C 3 208 ? 63.316 8.980   6.950   1.00 22.73 ? 214  VAL A CB    1 
ATOM   2036 C  CG1   . VAL C 3 208 ? 64.802 9.207   6.778   1.00 21.59 ? 214  VAL A CG1   1 
ATOM   2037 C  CG2   . VAL C 3 208 ? 62.948 9.030   8.436   1.00 21.75 ? 214  VAL A CG2   1 
ATOM   2038 N  N     . ASP C 3 209 ? 62.598 9.101   3.948   1.00 22.58 ? 215  ASP A N     1 
ATOM   2039 C  CA    . ASP C 3 209 ? 62.962 9.034   2.551   1.00 23.54 ? 215  ASP A CA    1 
ATOM   2040 C  C     . ASP C 3 209 ? 62.354 10.206  1.780   1.00 22.78 ? 215  ASP A C     1 
ATOM   2041 O  O     . ASP C 3 209 ? 63.045 10.893  1.023   1.00 23.49 ? 215  ASP A O     1 
ATOM   2042 C  CB    . ASP C 3 209 ? 62.493 7.698   1.970   1.00 25.00 ? 215  ASP A CB    1 
ATOM   2043 C  CG    . ASP C 3 209 ? 62.786 7.573   0.495   1.00 29.75 ? 215  ASP A CG    1 
ATOM   2044 O  OD1   . ASP C 3 209 ? 63.899 7.957   0.069   1.00 29.72 ? 215  ASP A OD1   1 
ATOM   2045 O  OD2   . ASP C 3 209 ? 61.900 7.082   -0.239  1.00 34.62 ? 215  ASP A OD2   1 
ATOM   2046 N  N     . ILE C 3 210 ? 61.065 10.439  1.989   1.00 22.18 ? 216  ILE A N     1 
ATOM   2047 C  CA    . ILE C 3 210 ? 60.356 11.519  1.315   1.00 22.15 ? 216  ILE A CA    1 
ATOM   2048 C  C     . ILE C 3 210 ? 60.925 12.913  1.609   1.00 22.56 ? 216  ILE A C     1 
ATOM   2049 O  O     . ILE C 3 210 ? 61.081 13.716  0.696   1.00 23.18 ? 216  ILE A O     1 
ATOM   2050 C  CB    . ILE C 3 210 ? 58.860 11.498  1.688   1.00 22.87 ? 216  ILE A CB    1 
ATOM   2051 C  CG1   . ILE C 3 210 ? 58.192 10.264  1.067   1.00 23.07 ? 216  ILE A CG1   1 
ATOM   2052 C  CG2   . ILE C 3 210 ? 58.178 12.793  1.237   1.00 22.21 ? 216  ILE A CG2   1 
ATOM   2053 C  CD1   . ILE C 3 210 ? 56.750 10.091  1.494   1.00 24.15 ? 216  ILE A CD1   1 
ATOM   2054 N  N     . GLU C 3 211 ? 61.220 13.210  2.871   1.00 23.02 ? 217  GLU A N     1 
ATOM   2055 C  CA    . GLU C 3 211 ? 61.774 14.515  3.203   1.00 21.73 ? 217  GLU A CA    1 
ATOM   2056 C  C     . GLU C 3 211 ? 63.144 14.711  2.552   1.00 21.44 ? 217  GLU A C     1 
ATOM   2057 O  O     . GLU C 3 211 ? 63.452 15.805  2.108   1.00 21.85 ? 217  GLU A O     1 
ATOM   2058 C  CB    . GLU C 3 211 ? 61.886 14.696  4.724   1.00 23.27 ? 217  GLU A CB    1 
ATOM   2059 C  CG    . GLU C 3 211 ? 60.567 15.004  5.424   1.00 24.68 ? 217  GLU A CG    1 
ATOM   2060 C  CD    . GLU C 3 211 ? 59.847 16.202  4.830   1.00 27.10 ? 217  GLU A CD    1 
ATOM   2061 O  OE1   . GLU C 3 211 ? 60.496 17.249  4.624   1.00 32.08 ? 217  GLU A OE1   1 
ATOM   2062 O  OE2   . GLU C 3 211 ? 58.630 16.105  4.571   1.00 27.21 ? 217  GLU A OE2   1 
ATOM   2063 N  N     . HIS C 3 212 ? 63.965 13.659  2.492   1.00 22.22 ? 218  HIS A N     1 
ATOM   2064 C  CA    . HIS C 3 212 ? 65.282 13.772  1.857   1.00 22.07 ? 218  HIS A CA    1 
ATOM   2065 C  C     . HIS C 3 212 ? 65.177 13.974  0.347   1.00 21.42 ? 218  HIS A C     1 
ATOM   2066 O  O     . HIS C 3 212 ? 65.984 14.689  -0.235  1.00 22.70 ? 218  HIS A O     1 
ATOM   2067 C  CB    . HIS C 3 212 ? 66.173 12.555  2.160   1.00 21.52 ? 218  HIS A CB    1 
ATOM   2068 C  CG    . HIS C 3 212 ? 66.827 12.618  3.505   1.00 23.59 ? 218  HIS A CG    1 
ATOM   2069 N  ND1   . HIS C 3 212 ? 66.181 12.246  4.667   1.00 24.36 ? 218  HIS A ND1   1 
ATOM   2070 C  CD2   . HIS C 3 212 ? 68.038 13.093  3.883   1.00 23.04 ? 218  HIS A CD2   1 
ATOM   2071 C  CE1   . HIS C 3 212 ? 66.967 12.492  5.700   1.00 24.41 ? 218  HIS A CE1   1 
ATOM   2072 N  NE2   . HIS C 3 212 ? 68.099 13.007  5.253   1.00 23.34 ? 218  HIS A NE2   1 
ATOM   2073 N  N     . ARG C 3 213 ? 64.194 13.348  -0.286  1.00 20.96 ? 219  ARG A N     1 
ATOM   2074 C  CA    . ARG C 3 213 ? 64.011 13.524  -1.727  1.00 21.75 ? 219  ARG A CA    1 
ATOM   2075 C  C     . ARG C 3 213 ? 63.471 14.932  -1.966  1.00 21.51 ? 219  ARG A C     1 
ATOM   2076 O  O     . ARG C 3 213 ? 63.850 15.598  -2.920  1.00 21.04 ? 219  ARG A O     1 
ATOM   2077 C  CB    . ARG C 3 213 ? 63.027 12.491  -2.293  1.00 20.82 ? 219  ARG A CB    1 
ATOM   2078 C  CG    . ARG C 3 213 ? 63.582 11.074  -2.386  1.00 24.88 ? 219  ARG A CG    1 
ATOM   2079 C  CD    . ARG C 3 213 ? 62.481 10.106  -2.759  1.00 28.01 ? 219  ARG A CD    1 
ATOM   2080 N  NE    . ARG C 3 213 ? 62.944 8.741   -2.962  1.00 32.76 ? 219  ARG A NE    1 
ATOM   2081 C  CZ    . ARG C 3 213 ? 63.416 8.265   -4.113  1.00 35.59 ? 219  ARG A CZ    1 
ATOM   2082 N  NH1   . ARG C 3 213 ? 63.497 9.049   -5.186  1.00 33.94 ? 219  ARG A NH1   1 
ATOM   2083 N  NH2   . ARG C 3 213 ? 63.782 6.989   -4.196  1.00 37.49 ? 219  ARG A NH2   1 
ATOM   2084 N  N     . ALA C 3 214 ? 62.583 15.389  -1.090  1.00 22.29 ? 220  ALA A N     1 
ATOM   2085 C  CA    . ALA C 3 214 ? 62.036 16.735  -1.231  1.00 22.79 ? 220  ALA A CA    1 
ATOM   2086 C  C     . ALA C 3 214 ? 63.132 17.802  -1.082  1.00 22.21 ? 220  ALA A C     1 
ATOM   2087 O  O     . ALA C 3 214 ? 63.207 18.746  -1.871  1.00 24.32 ? 220  ALA A O     1 
ATOM   2088 C  CB    . ALA C 3 214 ? 60.943 16.966  -0.202  1.00 22.90 ? 220  ALA A CB    1 
ATOM   2089 N  N     . ALA C 3 215 ? 63.988 17.650  -0.080  1.00 21.49 ? 221  ALA A N     1 
ATOM   2090 C  CA    . ALA C 3 215 ? 65.051 18.624  0.140   1.00 20.55 ? 221  ALA A CA    1 
ATOM   2091 C  C     . ALA C 3 215 ? 66.037 18.641  -1.036  1.00 21.02 ? 221  ALA A C     1 
ATOM   2092 O  O     . ALA C 3 215 ? 66.490 19.706  -1.461  1.00 20.37 ? 221  ALA A O     1 
ATOM   2093 C  CB    . ALA C 3 215 ? 65.778 18.322  1.454   1.00 16.82 ? 221  ALA A CB    1 
ATOM   2094 N  N     . TRP C 3 216 ? 66.355 17.463  -1.565  1.00 20.50 ? 222  TRP A N     1 
ATOM   2095 C  CA    . TRP C 3 216 ? 67.282 17.361  -2.693  1.00 21.35 ? 222  TRP A CA    1 
ATOM   2096 C  C     . TRP C 3 216 ? 66.734 18.082  -3.929  1.00 22.28 ? 222  TRP A C     1 
ATOM   2097 O  O     . TRP C 3 216 ? 67.436 18.864  -4.570  1.00 24.60 ? 222  TRP A O     1 
ATOM   2098 C  CB    . TRP C 3 216 ? 67.546 15.884  -3.020  1.00 20.84 ? 222  TRP A CB    1 
ATOM   2099 C  CG    . TRP C 3 216 ? 68.684 15.635  -3.973  1.00 21.99 ? 222  TRP A CG    1 
ATOM   2100 C  CD1   . TRP C 3 216 ? 68.620 15.586  -5.335  1.00 22.25 ? 222  TRP A CD1   1 
ATOM   2101 C  CD2   . TRP C 3 216 ? 70.054 15.371  -3.628  1.00 23.26 ? 222  TRP A CD2   1 
ATOM   2102 N  NE1   . TRP C 3 216 ? 69.861 15.303  -5.862  1.00 22.32 ? 222  TRP A NE1   1 
ATOM   2103 C  CE2   . TRP C 3 216 ? 70.759 15.167  -4.838  1.00 22.08 ? 222  TRP A CE2   1 
ATOM   2104 C  CE3   . TRP C 3 216 ? 70.753 15.285  -2.415  1.00 23.04 ? 222  TRP A CE3   1 
ATOM   2105 C  CZ2   . TRP C 3 216 ? 72.127 14.879  -4.873  1.00 20.94 ? 222  TRP A CZ2   1 
ATOM   2106 C  CZ3   . TRP C 3 216 ? 72.122 14.999  -2.450  1.00 23.68 ? 222  TRP A CZ3   1 
ATOM   2107 C  CH2   . TRP C 3 216 ? 72.791 14.799  -3.676  1.00 20.36 ? 222  TRP A CH2   1 
ATOM   2108 N  N     . LEU C 3 217 ? 65.473 17.828  -4.255  1.00 20.91 ? 223  LEU A N     1 
ATOM   2109 C  CA    . LEU C 3 217 ? 64.851 18.453  -5.410  1.00 20.93 ? 223  LEU A CA    1 
ATOM   2110 C  C     . LEU C 3 217 ? 64.625 19.962  -5.228  1.00 20.61 ? 223  LEU A C     1 
ATOM   2111 O  O     . LEU C 3 217 ? 64.810 20.751  -6.159  1.00 21.05 ? 223  LEU A O     1 
ATOM   2112 C  CB    . LEU C 3 217 ? 63.520 17.759  -5.702  1.00 21.68 ? 223  LEU A CB    1 
ATOM   2113 C  CG    . LEU C 3 217 ? 62.580 18.429  -6.708  1.00 22.80 ? 223  LEU A CG    1 
ATOM   2114 C  CD1   . LEU C 3 217 ? 63.166 18.344  -8.107  1.00 18.43 ? 223  LEU A CD1   1 
ATOM   2115 C  CD2   . LEU C 3 217 ? 61.221 17.722  -6.652  1.00 24.88 ? 223  LEU A CD2   1 
ATOM   2116 N  N     . LEU C 3 218 ? 64.223 20.366  -4.029  1.00 20.13 ? 224  LEU A N     1 
ATOM   2117 C  CA    . LEU C 3 218 ? 63.976 21.776  -3.778  1.00 19.15 ? 224  LEU A CA    1 
ATOM   2118 C  C     . LEU C 3 218 ? 65.280 22.569  -3.707  1.00 19.72 ? 224  LEU A C     1 
ATOM   2119 O  O     . LEU C 3 218 ? 65.299 23.778  -3.977  1.00 18.82 ? 224  LEU A O     1 
ATOM   2120 C  CB    . LEU C 3 218 ? 63.128 21.933  -2.514  1.00 19.21 ? 224  LEU A CB    1 
ATOM   2121 C  CG    . LEU C 3 218 ? 61.727 21.361  -2.808  1.00 22.85 ? 224  LEU A CG    1 
ATOM   2122 C  CD1   . LEU C 3 218 ? 60.934 21.110  -1.524  1.00 25.02 ? 224  LEU A CD1   1 
ATOM   2123 C  CD2   . LEU C 3 218 ? 60.992 22.333  -3.724  1.00 22.66 ? 224  LEU A CD2   1 
ATOM   2124 N  N     . ALA C 3 219 ? 66.370 21.890  -3.350  1.00 18.93 ? 225  ALA A N     1 
ATOM   2125 C  CA    . ALA C 3 219 ? 67.674 22.544  -3.323  1.00 19.37 ? 225  ALA A CA    1 
ATOM   2126 C  C     . ALA C 3 219 ? 68.003 22.869  -4.788  1.00 19.37 ? 225  ALA A C     1 
ATOM   2127 O  O     . ALA C 3 219 ? 68.525 23.935  -5.109  1.00 20.28 ? 225  ALA A O     1 
ATOM   2128 C  CB    . ALA C 3 219 ? 68.730 21.610  -2.741  1.00 18.67 ? 225  ALA A CB    1 
ATOM   2129 N  N     . LYS C 3 220 ? 67.685 21.932  -5.671  1.00 19.54 ? 226  LYS A N     1 
ATOM   2130 C  CA    . LYS C 3 220 ? 67.914 22.108  -7.098  1.00 20.05 ? 226  LYS A CA    1 
ATOM   2131 C  C     . LYS C 3 220 ? 67.015 23.232  -7.622  1.00 21.80 ? 226  LYS A C     1 
ATOM   2132 O  O     . LYS C 3 220 ? 67.432 24.037  -8.465  1.00 21.70 ? 226  LYS A O     1 
ATOM   2133 C  CB    . LYS C 3 220 ? 67.610 20.794  -7.827  1.00 21.89 ? 226  LYS A CB    1 
ATOM   2134 C  CG    . LYS C 3 220 ? 67.603 20.876  -9.355  1.00 23.10 ? 226  LYS A CG    1 
ATOM   2135 C  CD    . LYS C 3 220 ? 68.985 21.157  -9.923  1.00 24.43 ? 226  LYS A CD    1 
ATOM   2136 C  CE    . LYS C 3 220 ? 68.958 21.030  -11.445 1.00 27.93 ? 226  LYS A CE    1 
ATOM   2137 N  NZ    . LYS C 3 220 ? 70.319 20.870  -12.034 1.00 29.55 ? 226  LYS A NZ    1 
ATOM   2138 N  N     . GLN C 3 221 ? 65.780 23.296  -7.116  1.00 22.27 ? 227  GLN A N     1 
ATOM   2139 C  CA    . GLN C 3 221 ? 64.855 24.344  -7.529  1.00 22.14 ? 227  GLN A CA    1 
ATOM   2140 C  C     . GLN C 3 221 ? 65.423 25.734  -7.214  1.00 23.73 ? 227  GLN A C     1 
ATOM   2141 O  O     . GLN C 3 221 ? 65.356 26.639  -8.054  1.00 23.36 ? 227  GLN A O     1 
ATOM   2142 C  CB    . GLN C 3 221 ? 63.492 24.185  -6.843  1.00 22.70 ? 227  GLN A CB    1 
ATOM   2143 C  CG    . GLN C 3 221 ? 62.510 25.310  -7.212  1.00 24.67 ? 227  GLN A CG    1 
ATOM   2144 C  CD    . GLN C 3 221 ? 61.125 25.112  -6.627  1.00 27.52 ? 227  GLN A CD    1 
ATOM   2145 O  OE1   . GLN C 3 221 ? 60.373 24.237  -7.061  1.00 28.33 ? 227  GLN A OE1   1 
ATOM   2146 N  NE2   . GLN C 3 221 ? 60.781 25.926  -5.632  1.00 26.55 ? 227  GLN A NE2   1 
ATOM   2147 N  N     . GLU C 3 222 ? 65.966 25.903  -6.008  1.00 24.32 ? 228  GLU A N     1 
ATOM   2148 C  CA    . GLU C 3 222 ? 66.553 27.181  -5.600  1.00 25.43 ? 228  GLU A CA    1 
ATOM   2149 C  C     . GLU C 3 222 ? 67.724 27.554  -6.523  1.00 25.38 ? 228  GLU A C     1 
ATOM   2150 O  O     . GLU C 3 222 ? 67.868 28.711  -6.920  1.00 24.99 ? 228  GLU A O     1 
ATOM   2151 C  CB    . GLU C 3 222 ? 67.061 27.116  -4.154  1.00 25.55 ? 228  GLU A CB    1 
ATOM   2152 C  CG    . GLU C 3 222 ? 66.004 26.869  -3.100  1.00 29.48 ? 228  GLU A CG    1 
ATOM   2153 C  CD    . GLU C 3 222 ? 66.554 27.027  -1.682  1.00 30.93 ? 228  GLU A CD    1 
ATOM   2154 O  OE1   . GLU C 3 222 ? 67.746 27.368  -1.521  1.00 32.91 ? 228  GLU A OE1   1 
ATOM   2155 O  OE2   . GLU C 3 222 ? 65.794 26.822  -0.724  1.00 31.46 ? 228  GLU A OE2   1 
ATOM   2156 N  N     . ARG C 3 223 ? 68.563 26.573  -6.840  1.00 24.22 ? 229  ARG A N     1 
ATOM   2157 C  CA    . ARG C 3 223 ? 69.703 26.786  -7.736  1.00 25.20 ? 229  ARG A CA    1 
ATOM   2158 C  C     . ARG C 3 223 ? 69.232 27.199  -9.136  1.00 24.19 ? 229  ARG A C     1 
ATOM   2159 O  O     . ARG C 3 223 ? 69.885 28.004  -9.789  1.00 23.01 ? 229  ARG A O     1 
ATOM   2160 C  CB    . ARG C 3 223 ? 70.549 25.509  -7.858  1.00 24.79 ? 229  ARG A CB    1 
ATOM   2161 C  CG    . ARG C 3 223 ? 71.723 25.417  -6.892  1.00 29.11 ? 229  ARG A CG    1 
ATOM   2162 C  CD    . ARG C 3 223 ? 72.415 24.059  -7.020  1.00 28.03 ? 229  ARG A CD    1 
ATOM   2163 N  NE    . ARG C 3 223 ? 72.065 23.257  -5.864  1.00 33.61 ? 229  ARG A NE    1 
ATOM   2164 C  CZ    . ARG C 3 223 ? 71.725 21.975  -5.879  1.00 29.97 ? 229  ARG A CZ    1 
ATOM   2165 N  NH1   . ARG C 3 223 ? 71.679 21.285  -7.010  1.00 28.69 ? 229  ARG A NH1   1 
ATOM   2166 N  NH2   . ARG C 3 223 ? 71.425 21.395  -4.731  1.00 31.69 ? 229  ARG A NH2   1 
ATOM   2167 N  N     . ASN C 3 224 ? 68.118 26.629  -9.598  1.00 23.32 ? 230  ASN A N     1 
ATOM   2168 C  CA    . ASN C 3 224 ? 67.591 26.990  -10.908 1.00 23.47 ? 230  ASN A CA    1 
ATOM   2169 C  C     . ASN C 3 224 ? 67.192 28.452  -10.863 1.00 24.87 ? 230  ASN A C     1 
ATOM   2170 O  O     . ASN C 3 224 ? 67.572 29.246  -11.734 1.00 24.28 ? 230  ASN A O     1 
ATOM   2171 C  CB    . ASN C 3 224 ? 66.353 26.160  -11.279 1.00 22.61 ? 230  ASN A CB    1 
ATOM   2172 C  CG    . ASN C 3 224 ? 66.665 24.682  -11.482 1.00 21.99 ? 230  ASN A CG    1 
ATOM   2173 O  OD1   . ASN C 3 224 ? 67.790 24.305  -11.803 1.00 25.80 ? 230  ASN A OD1   1 
ATOM   2174 N  ND2   . ASN C 3 224 ? 65.658 23.843  -11.314 1.00 20.55 ? 230  ASN A ND2   1 
ATOM   2175 N  N     . GLY C 3 225 ? 66.442 28.805  -9.821  1.00 24.94 ? 231  GLY A N     1 
ATOM   2176 C  CA    . GLY C 3 225 ? 65.970 30.166  -9.673  1.00 23.29 ? 231  GLY A CA    1 
ATOM   2177 C  C     . GLY C 3 225 ? 64.745 30.352  -10.551 1.00 23.82 ? 231  GLY A C     1 
ATOM   2178 O  O     . GLY C 3 225 ? 64.388 29.461  -11.326 1.00 22.96 ? 231  GLY A O     1 
ATOM   2179 N  N     . PHE C 3 226 ? 64.094 31.503  -10.431 1.00 22.65 ? 232  PHE A N     1 
ATOM   2180 C  CA    . PHE C 3 226 ? 62.913 31.798  -11.227 1.00 21.85 ? 232  PHE A CA    1 
ATOM   2181 C  C     . PHE C 3 226 ? 63.262 32.974  -12.148 1.00 22.64 ? 232  PHE A C     1 
ATOM   2182 O  O     . PHE C 3 226 ? 63.603 34.063  -11.671 1.00 21.43 ? 232  PHE A O     1 
ATOM   2183 C  CB    . PHE C 3 226 ? 61.744 32.181  -10.299 1.00 21.48 ? 232  PHE A CB    1 
ATOM   2184 C  CG    . PHE C 3 226 ? 60.369 31.885  -10.863 1.00 20.39 ? 232  PHE A CG    1 
ATOM   2185 C  CD1   . PHE C 3 226 ? 60.079 32.106  -12.210 1.00 20.48 ? 232  PHE A CD1   1 
ATOM   2186 C  CD2   . PHE C 3 226 ? 59.350 31.437  -10.025 1.00 17.60 ? 232  PHE A CD2   1 
ATOM   2187 C  CE1   . PHE C 3 226 ? 58.795 31.887  -12.710 1.00 18.71 ? 232  PHE A CE1   1 
ATOM   2188 C  CE2   . PHE C 3 226 ? 58.064 31.215  -10.512 1.00 18.30 ? 232  PHE A CE2   1 
ATOM   2189 C  CZ    . PHE C 3 226 ? 57.784 31.441  -11.862 1.00 20.44 ? 232  PHE A CZ    1 
ATOM   2190 N  N     . PRO C 3 227 ? 63.210 32.763  -13.478 1.00 23.39 ? 233  PRO A N     1 
ATOM   2191 C  CA    . PRO C 3 227 ? 63.525 33.837  -14.432 1.00 22.83 ? 233  PRO A CA    1 
ATOM   2192 C  C     . PRO C 3 227 ? 62.654 35.037  -14.110 1.00 22.61 ? 233  PRO A C     1 
ATOM   2193 O  O     . PRO C 3 227 ? 61.440 34.913  -13.977 1.00 22.75 ? 233  PRO A O     1 
ATOM   2194 C  CB    . PRO C 3 227 ? 63.197 33.209  -15.783 1.00 24.30 ? 233  PRO A CB    1 
ATOM   2195 C  CG    . PRO C 3 227 ? 63.566 31.777  -15.567 1.00 24.66 ? 233  PRO A CG    1 
ATOM   2196 C  CD    . PRO C 3 227 ? 62.962 31.495  -14.186 1.00 24.64 ? 233  PRO A CD    1 
ATOM   2197 N  N     . PHE C 3 228 ? 63.290 36.196  -14.003 1.00 23.06 ? 234  PHE A N     1 
ATOM   2198 C  CA    . PHE C 3 228 ? 62.623 37.429  -13.609 1.00 23.79 ? 234  PHE A CA    1 
ATOM   2199 C  C     . PHE C 3 228 ? 62.895 38.592  -14.574 1.00 24.40 ? 234  PHE A C     1 
ATOM   2200 O  O     . PHE C 3 228 ? 64.033 38.831  -14.962 1.00 24.54 ? 234  PHE A O     1 
ATOM   2201 C  CB    . PHE C 3 228 ? 63.127 37.776  -12.209 1.00 24.12 ? 234  PHE A CB    1 
ATOM   2202 C  CG    . PHE C 3 228 ? 62.535 39.022  -11.624 1.00 24.26 ? 234  PHE A CG    1 
ATOM   2203 C  CD1   . PHE C 3 228 ? 61.264 39.008  -11.067 1.00 23.43 ? 234  PHE A CD1   1 
ATOM   2204 C  CD2   . PHE C 3 228 ? 63.292 40.189  -11.551 1.00 23.12 ? 234  PHE A CD2   1 
ATOM   2205 C  CE1   . PHE C 3 228 ? 60.760 40.140  -10.427 1.00 25.70 ? 234  PHE A CE1   1 
ATOM   2206 C  CE2   . PHE C 3 228 ? 62.800 41.316  -10.921 1.00 23.02 ? 234  PHE A CE2   1 
ATOM   2207 C  CZ    . PHE C 3 228 ? 61.530 41.291  -10.352 1.00 24.60 ? 234  PHE A CZ    1 
ATOM   2208 N  N     . ASP C 3 229 ? 61.841 39.314  -14.943 1.00 26.16 ? 235  ASP A N     1 
ATOM   2209 C  CA    . ASP C 3 229 ? 61.945 40.443  -15.868 1.00 26.49 ? 235  ASP A CA    1 
ATOM   2210 C  C     . ASP C 3 229 ? 62.266 41.719  -15.091 1.00 27.32 ? 235  ASP A C     1 
ATOM   2211 O  O     . ASP C 3 229 ? 61.378 42.499  -14.767 1.00 26.78 ? 235  ASP A O     1 
ATOM   2212 C  CB    . ASP C 3 229 ? 60.620 40.598  -16.613 1.00 28.75 ? 235  ASP A CB    1 
ATOM   2213 C  CG    . ASP C 3 229 ? 60.689 41.600  -17.768 1.00 31.25 ? 235  ASP A CG    1 
ATOM   2214 O  OD1   . ASP C 3 229 ? 61.721 42.290  -17.939 1.00 29.61 ? 235  ASP A OD1   1 
ATOM   2215 O  OD2   . ASP C 3 229 ? 59.680 41.694  -18.501 1.00 30.15 ? 235  ASP A OD2   1 
ATOM   2216 N  N     . THR C 3 230 ? 63.545 41.924  -14.798 1.00 28.66 ? 236  THR A N     1 
ATOM   2217 C  CA    . THR C 3 230 ? 63.988 43.086  -14.040 1.00 29.13 ? 236  THR A CA    1 
ATOM   2218 C  C     . THR C 3 230 ? 63.502 44.404  -14.625 1.00 30.38 ? 236  THR A C     1 
ATOM   2219 O  O     . THR C 3 230 ? 63.027 45.285  -13.903 1.00 31.11 ? 236  THR A O     1 
ATOM   2220 C  CB    . THR C 3 230 ? 65.519 43.115  -13.954 1.00 29.93 ? 236  THR A CB    1 
ATOM   2221 O  OG1   . THR C 3 230 ? 65.976 41.904  -13.341 1.00 31.16 ? 236  THR A OG1   1 
ATOM   2222 C  CG2   . THR C 3 230 ? 65.991 44.310  -13.127 1.00 30.97 ? 236  THR A CG2   1 
ATOM   2223 N  N     . LYS C 3 231 ? 63.618 44.541  -15.936 1.00 31.47 ? 237  LYS A N     1 
ATOM   2224 C  CA    . LYS C 3 231 ? 63.192 45.763  -16.601 1.00 32.55 ? 237  LYS A CA    1 
ATOM   2225 C  C     . LYS C 3 231 ? 61.708 46.038  -16.387 1.00 30.53 ? 237  LYS A C     1 
ATOM   2226 O  O     . LYS C 3 231 ? 61.316 47.158  -16.066 1.00 31.09 ? 237  LYS A O     1 
ATOM   2227 C  CB    . LYS C 3 231 ? 63.490 45.673  -18.099 1.00 34.59 ? 237  LYS A CB    1 
ATOM   2228 C  CG    . LYS C 3 231 ? 63.385 46.991  -18.834 1.00 38.41 ? 237  LYS A CG    1 
ATOM   2229 C  CD    . LYS C 3 231 ? 64.102 46.915  -20.184 1.00 42.21 ? 237  LYS A CD    1 
ATOM   2230 C  CE    . LYS C 3 231 ? 63.289 46.166  -21.229 1.00 43.01 ? 237  LYS A CE    1 
ATOM   2231 N  NZ    . LYS C 3 231 ? 62.170 47.020  -21.734 1.00 44.46 ? 237  LYS A NZ    1 
ATOM   2232 N  N     . ALA C 3 232 ? 60.883 45.013  -16.552 1.00 30.21 ? 238  ALA A N     1 
ATOM   2233 C  CA    . ALA C 3 232 ? 59.448 45.183  -16.394 1.00 30.82 ? 238  ALA A CA    1 
ATOM   2234 C  C     . ALA C 3 232 ? 59.107 45.682  -15.006 1.00 31.20 ? 238  ALA A C     1 
ATOM   2235 O  O     . ALA C 3 232 ? 58.242 46.539  -14.850 1.00 32.86 ? 238  ALA A O     1 
ATOM   2236 C  CB    . ALA C 3 232 ? 58.720 43.873  -16.674 1.00 31.02 ? 238  ALA A CB    1 
ATOM   2237 N  N     . ILE C 3 233 ? 59.790 45.156  -13.997 1.00 31.17 ? 239  ILE A N     1 
ATOM   2238 C  CA    . ILE C 3 233 ? 59.517 45.574  -12.631 1.00 29.99 ? 239  ILE A CA    1 
ATOM   2239 C  C     . ILE C 3 233 ? 60.047 46.967  -12.308 1.00 29.59 ? 239  ILE A C     1 
ATOM   2240 O  O     . ILE C 3 233 ? 59.451 47.679  -11.505 1.00 28.34 ? 239  ILE A O     1 
ATOM   2241 C  CB    . ILE C 3 233 ? 60.051 44.534  -11.617 1.00 28.94 ? 239  ILE A CB    1 
ATOM   2242 C  CG1   . ILE C 3 233 ? 59.302 43.215  -11.826 1.00 28.52 ? 239  ILE A CG1   1 
ATOM   2243 C  CG2   . ILE C 3 233 ? 59.819 45.013  -10.177 1.00 27.64 ? 239  ILE A CG2   1 
ATOM   2244 C  CD1   . ILE C 3 233 ? 57.788 43.367  -11.789 1.00 26.69 ? 239  ILE A CD1   1 
ATOM   2245 N  N     . GLU C 3 234 ? 61.152 47.366  -12.926 1.00 30.67 ? 240  GLU A N     1 
ATOM   2246 C  CA    . GLU C 3 234 ? 61.685 48.702  -12.676 1.00 33.30 ? 240  GLU A CA    1 
ATOM   2247 C  C     . GLU C 3 234 ? 60.706 49.722  -13.236 1.00 33.18 ? 240  GLU A C     1 
ATOM   2248 O  O     . GLU C 3 234 ? 60.489 50.786  -12.654 1.00 33.39 ? 240  GLU A O     1 
ATOM   2249 C  CB    . GLU C 3 234 ? 63.065 48.873  -13.318 1.00 34.41 ? 240  GLU A CB    1 
ATOM   2250 C  CG    . GLU C 3 234 ? 64.100 47.945  -12.713 1.00 38.02 ? 240  GLU A CG    1 
ATOM   2251 C  CD    . GLU C 3 234 ? 65.459 48.067  -13.362 1.00 40.43 ? 240  GLU A CD    1 
ATOM   2252 O  OE1   . GLU C 3 234 ? 65.509 48.188  -14.605 1.00 42.39 ? 240  GLU A OE1   1 
ATOM   2253 O  OE2   . GLU C 3 234 ? 66.479 48.023  -12.634 1.00 41.00 ? 240  GLU A OE2   1 
ATOM   2254 N  N     . GLU C 3 235 ? 60.094 49.382  -14.360 1.00 34.13 ? 241  GLU A N     1 
ATOM   2255 C  CA    . GLU C 3 235 ? 59.121 50.270  -14.974 1.00 35.50 ? 241  GLU A CA    1 
ATOM   2256 C  C     . GLU C 3 235 ? 57.857 50.319  -14.119 1.00 35.51 ? 241  GLU A C     1 
ATOM   2257 O  O     . GLU C 3 235 ? 57.271 51.382  -13.940 1.00 37.07 ? 241  GLU A O     1 
ATOM   2258 C  CB    . GLU C 3 235 ? 58.821 49.801  -16.403 1.00 39.26 ? 241  GLU A CB    1 
ATOM   2259 C  CG    . GLU C 3 235 ? 59.871 50.284  -17.414 1.00 45.03 ? 241  GLU A CG    1 
ATOM   2260 C  CD    . GLU C 3 235 ? 60.151 49.292  -18.542 1.00 48.89 ? 241  GLU A CD    1 
ATOM   2261 O  OE1   . GLU C 3 235 ? 59.213 48.573  -18.971 1.00 49.50 ? 241  GLU A OE1   1 
ATOM   2262 O  OE2   . GLU C 3 235 ? 61.316 49.248  -19.010 1.00 49.57 ? 241  GLU A OE2   1 
ATOM   2263 N  N     . LEU C 3 236 ? 57.433 49.176  -13.583 1.00 33.72 ? 242  LEU A N     1 
ATOM   2264 C  CA    . LEU C 3 236 ? 56.255 49.157  -12.722 1.00 32.67 ? 242  LEU A CA    1 
ATOM   2265 C  C     . LEU C 3 236 ? 56.573 50.000  -11.485 1.00 31.43 ? 242  LEU A C     1 
ATOM   2266 O  O     . LEU C 3 236 ? 55.697 50.655  -10.919 1.00 30.32 ? 242  LEU A O     1 
ATOM   2267 C  CB    . LEU C 3 236 ? 55.914 47.728  -12.280 1.00 33.72 ? 242  LEU A CB    1 
ATOM   2268 C  CG    . LEU C 3 236 ? 54.802 47.647  -11.222 1.00 34.07 ? 242  LEU A CG    1 
ATOM   2269 C  CD1   . LEU C 3 236 ? 53.473 48.008  -11.853 1.00 33.45 ? 242  LEU A CD1   1 
ATOM   2270 C  CD2   . LEU C 3 236 ? 54.733 46.245  -10.633 1.00 35.16 ? 242  LEU A CD2   1 
ATOM   2271 N  N     . TYR C 3 237 ? 57.834 49.970  -11.064 1.00 30.22 ? 243  TYR A N     1 
ATOM   2272 C  CA    . TYR C 3 237 ? 58.257 50.737  -9.903  1.00 29.98 ? 243  TYR A CA    1 
ATOM   2273 C  C     . TYR C 3 237 ? 58.104 52.231  -10.183 1.00 30.88 ? 243  TYR A C     1 
ATOM   2274 O  O     . TYR C 3 237 ? 57.642 52.978  -9.326  1.00 32.67 ? 243  TYR A O     1 
ATOM   2275 C  CB    . TYR C 3 237 ? 59.709 50.399  -9.544  1.00 27.29 ? 243  TYR A CB    1 
ATOM   2276 C  CG    . TYR C 3 237 ? 60.268 51.186  -8.378  1.00 26.28 ? 243  TYR A CG    1 
ATOM   2277 C  CD1   . TYR C 3 237 ? 59.444 51.619  -7.332  1.00 25.14 ? 243  TYR A CD1   1 
ATOM   2278 C  CD2   . TYR C 3 237 ? 61.632 51.479  -8.304  1.00 25.36 ? 243  TYR A CD2   1 
ATOM   2279 C  CE1   . TYR C 3 237 ? 59.972 52.327  -6.244  1.00 24.07 ? 243  TYR A CE1   1 
ATOM   2280 C  CE2   . TYR C 3 237 ? 62.165 52.178  -7.225  1.00 23.92 ? 243  TYR A CE2   1 
ATOM   2281 C  CZ    . TYR C 3 237 ? 61.330 52.599  -6.202  1.00 24.72 ? 243  TYR A CZ    1 
ATOM   2282 O  OH    . TYR C 3 237 ? 61.863 53.297  -5.133  1.00 30.25 ? 243  TYR A OH    1 
ATOM   2283 N  N     . VAL C 3 238 ? 58.484 52.664  -11.380 1.00 32.25 ? 244  VAL A N     1 
ATOM   2284 C  CA    . VAL C 3 238 ? 58.355 54.073  -11.742 1.00 33.79 ? 244  VAL A CA    1 
ATOM   2285 C  C     . VAL C 3 238 ? 56.879 54.468  -11.726 1.00 34.02 ? 244  VAL A C     1 
ATOM   2286 O  O     . VAL C 3 238 ? 56.512 55.509  -11.174 1.00 34.28 ? 244  VAL A O     1 
ATOM   2287 C  CB    . VAL C 3 238 ? 58.956 54.353  -13.140 1.00 34.11 ? 244  VAL A CB    1 
ATOM   2288 C  CG1   . VAL C 3 238 ? 58.511 55.736  -13.642 1.00 33.10 ? 244  VAL A CG1   1 
ATOM   2289 C  CG2   . VAL C 3 238 ? 60.489 54.285  -13.061 1.00 32.26 ? 244  VAL A CG2   1 
ATOM   2290 N  N     . GLU C 3 239 ? 56.041 53.618  -12.310 1.00 32.45 ? 245  GLU A N     1 
ATOM   2291 C  CA    . GLU C 3 239 ? 54.605 53.853  -12.362 1.00 34.71 ? 245  GLU A CA    1 
ATOM   2292 C  C     . GLU C 3 239 ? 53.976 53.982  -10.972 1.00 34.80 ? 245  GLU A C     1 
ATOM   2293 O  O     . GLU C 3 239 ? 53.212 54.911  -10.702 1.00 36.11 ? 245  GLU A O     1 
ATOM   2294 C  CB    . GLU C 3 239 ? 53.918 52.705  -13.101 1.00 36.80 ? 245  GLU A CB    1 
ATOM   2295 C  CG    . GLU C 3 239 ? 52.419 52.887  -13.275 1.00 40.61 ? 245  GLU A CG    1 
ATOM   2296 C  CD    . GLU C 3 239 ? 51.733 51.632  -13.790 1.00 43.44 ? 245  GLU A CD    1 
ATOM   2297 O  OE1   . GLU C 3 239 ? 52.402 50.806  -14.448 1.00 46.69 ? 245  GLU A OE1   1 
ATOM   2298 O  OE2   . GLU C 3 239 ? 50.518 51.476  -13.548 1.00 44.81 ? 245  GLU A OE2   1 
ATOM   2299 N  N     . LEU C 3 240 ? 54.285 53.028  -10.100 1.00 34.87 ? 246  LEU A N     1 
ATOM   2300 C  CA    . LEU C 3 240 ? 53.745 53.012  -8.747  1.00 33.01 ? 246  LEU A CA    1 
ATOM   2301 C  C     . LEU C 3 240 ? 54.221 54.211  -7.949  1.00 32.24 ? 246  LEU A C     1 
ATOM   2302 O  O     . LEU C 3 240 ? 53.453 54.817  -7.217  1.00 32.38 ? 246  LEU A O     1 
ATOM   2303 C  CB    . LEU C 3 240 ? 54.160 51.723  -8.030  1.00 30.40 ? 246  LEU A CB    1 
ATOM   2304 C  CG    . LEU C 3 240 ? 53.583 50.413  -8.570  1.00 30.42 ? 246  LEU A CG    1 
ATOM   2305 C  CD1   . LEU C 3 240 ? 54.265 49.219  -7.888  1.00 28.92 ? 246  LEU A CD1   1 
ATOM   2306 C  CD2   . LEU C 3 240 ? 52.077 50.384  -8.336  1.00 30.23 ? 246  LEU A CD2   1 
ATOM   2307 N  N     . ALA C 3 241 ? 55.497 54.544  -8.089  1.00 33.19 ? 247  ALA A N     1 
ATOM   2308 C  CA    . ALA C 3 241 ? 56.066 55.668  -7.367  1.00 34.98 ? 247  ALA A CA    1 
ATOM   2309 C  C     . ALA C 3 241 ? 55.366 56.979  -7.744  1.00 35.28 ? 247  ALA A C     1 
ATOM   2310 O  O     . ALA C 3 241 ? 55.201 57.869  -6.902  1.00 36.43 ? 247  ALA A O     1 
ATOM   2311 C  CB    . ALA C 3 241 ? 57.568 55.761  -7.645  1.00 34.04 ? 247  ALA A CB    1 
ATOM   2312 N  N     . ALA C 3 242 ? 54.948 57.088  -9.003  1.00 34.16 ? 248  ALA A N     1 
ATOM   2313 C  CA    . ALA C 3 242 ? 54.263 58.289  -9.487  1.00 34.45 ? 248  ALA A CA    1 
ATOM   2314 C  C     . ALA C 3 242 ? 52.845 58.363  -8.928  1.00 34.19 ? 248  ALA A C     1 
ATOM   2315 O  O     . ALA C 3 242 ? 52.348 59.450  -8.615  1.00 33.66 ? 248  ALA A O     1 
ATOM   2316 C  CB    . ALA C 3 242 ? 54.225 58.302  -11.020 1.00 33.80 ? 248  ALA A CB    1 
ATOM   2317 N  N     . ARG C 3 243 ? 52.194 57.212  -8.802  1.00 32.63 ? 249  ARG A N     1 
ATOM   2318 C  CA    . ARG C 3 243 ? 50.840 57.180  -8.264  1.00 34.07 ? 249  ARG A CA    1 
ATOM   2319 C  C     . ARG C 3 243 ? 50.900 57.473  -6.773  1.00 32.87 ? 249  ARG A C     1 
ATOM   2320 O  O     . ARG C 3 243 ? 49.977 58.068  -6.208  1.00 32.98 ? 249  ARG A O     1 
ATOM   2321 C  CB    . ARG C 3 243 ? 50.202 55.813  -8.492  1.00 34.12 ? 249  ARG A CB    1 
ATOM   2322 C  CG    . ARG C 3 243 ? 48.897 55.851  -9.268  1.00 39.53 ? 249  ARG A CG    1 
ATOM   2323 C  CD    . ARG C 3 243 ? 47.702 56.317  -8.429  1.00 40.07 ? 249  ARG A CD    1 
ATOM   2324 N  NE    . ARG C 3 243 ? 47.219 57.628  -8.848  1.00 40.56 ? 249  ARG A NE    1 
ATOM   2325 C  CZ    . ARG C 3 243 ? 45.986 58.086  -8.634  1.00 41.17 ? 249  ARG A CZ    1 
ATOM   2326 N  NH1   . ARG C 3 243 ? 45.084 57.343  -8.003  1.00 39.39 ? 249  ARG A NH1   1 
ATOM   2327 N  NH2   . ARG C 3 243 ? 45.658 59.301  -9.051  1.00 40.83 ? 249  ARG A NH2   1 
ATOM   2328 N  N     . ARG C 3 244 ? 51.991 57.050  -6.143  1.00 31.51 ? 250  ARG A N     1 
ATOM   2329 C  CA    . ARG C 3 244 ? 52.179 57.283  -4.717  1.00 31.88 ? 250  ARG A CA    1 
ATOM   2330 C  C     . ARG C 3 244 ? 52.346 58.778  -4.468  1.00 31.53 ? 250  ARG A C     1 
ATOM   2331 O  O     . ARG C 3 244 ? 51.702 59.334  -3.586  1.00 33.04 ? 250  ARG A O     1 
ATOM   2332 C  CB    . ARG C 3 244 ? 53.411 56.521  -4.191  1.00 29.46 ? 250  ARG A CB    1 
ATOM   2333 C  CG    . ARG C 3 244 ? 53.703 56.773  -2.714  1.00 28.69 ? 250  ARG A CG    1 
ATOM   2334 C  CD    . ARG C 3 244 ? 54.791 55.862  -2.164  1.00 27.81 ? 250  ARG A CD    1 
ATOM   2335 N  NE    . ARG C 3 244 ? 56.080 56.052  -2.825  1.00 27.78 ? 250  ARG A NE    1 
ATOM   2336 C  CZ    . ARG C 3 244 ? 57.182 55.365  -2.532  1.00 28.83 ? 250  ARG A CZ    1 
ATOM   2337 N  NH1   . ARG C 3 244 ? 57.169 54.430  -1.581  1.00 26.62 ? 250  ARG A NH1   1 
ATOM   2338 N  NH2   . ARG C 3 244 ? 58.300 55.602  -3.200  1.00 26.37 ? 250  ARG A NH2   1 
ATOM   2339 N  N     . SER C 3 245 ? 53.213 59.421  -5.244  1.00 32.62 ? 251  SER A N     1 
ATOM   2340 C  CA    . SER C 3 245 ? 53.448 60.863  -5.104  1.00 35.45 ? 251  SER A CA    1 
ATOM   2341 C  C     . SER C 3 245 ? 52.143 61.638  -5.272  1.00 35.36 ? 251  SER A C     1 
ATOM   2342 O  O     . SER C 3 245 ? 51.773 62.445  -4.424  1.00 36.07 ? 251  SER A O     1 
ATOM   2343 C  CB    . SER C 3 245 ? 54.450 61.361  -6.163  1.00 37.41 ? 251  SER A CB    1 
ATOM   2344 O  OG    . SER C 3 245 ? 55.776 60.938  -5.884  1.00 39.11 ? 251  SER A OG    1 
ATOM   2345 N  N     . GLU C 3 246 ? 51.449 61.379  -6.374  1.00 35.03 ? 252  GLU A N     1 
ATOM   2346 C  CA    . GLU C 3 246 ? 50.199 62.060  -6.670  1.00 35.81 ? 252  GLU A CA    1 
ATOM   2347 C  C     . GLU C 3 246 ? 49.166 61.866  -5.573  1.00 34.95 ? 252  GLU A C     1 
ATOM   2348 O  O     . GLU C 3 246 ? 48.419 62.791  -5.255  1.00 35.57 ? 252  GLU A O     1 
ATOM   2349 C  CB    . GLU C 3 246 ? 49.653 61.582  -8.023  1.00 38.18 ? 252  GLU A CB    1 
ATOM   2350 C  CG    . GLU C 3 246 ? 48.352 62.258  -8.488  1.00 41.64 ? 252  GLU A CG    1 
ATOM   2351 C  CD    . GLU C 3 246 ? 48.382 63.787  -8.392  1.00 42.73 ? 252  GLU A CD    1 
ATOM   2352 O  OE1   . GLU C 3 246 ? 49.460 64.399  -8.564  1.00 41.45 ? 252  GLU A OE1   1 
ATOM   2353 O  OE2   . GLU C 3 246 ? 47.305 64.375  -8.158  1.00 44.04 ? 252  GLU A OE2   1 
ATOM   2354 N  N     . LEU C 3 247 ? 49.121 60.671  -4.988  1.00 34.36 ? 253  LEU A N     1 
ATOM   2355 C  CA    . LEU C 3 247 ? 48.171 60.402  -3.912  1.00 32.56 ? 253  LEU A CA    1 
ATOM   2356 C  C     . LEU C 3 247 ? 48.624 61.128  -2.644  1.00 32.95 ? 253  LEU A C     1 
ATOM   2357 O  O     . LEU C 3 247 ? 47.804 61.488  -1.804  1.00 32.87 ? 253  LEU A O     1 
ATOM   2358 C  CB    . LEU C 3 247 ? 48.067 58.896  -3.641  1.00 31.31 ? 253  LEU A CB    1 
ATOM   2359 C  CG    . LEU C 3 247 ? 47.342 58.042  -4.692  1.00 30.57 ? 253  LEU A CG    1 
ATOM   2360 C  CD1   . LEU C 3 247 ? 47.545 56.575  -4.372  1.00 29.88 ? 253  LEU A CD1   1 
ATOM   2361 C  CD2   . LEU C 3 247 ? 45.865 58.371  -4.721  1.00 28.39 ? 253  LEU A CD2   1 
ATOM   2362 N  N     . LEU C 3 248 ? 49.931 61.340  -2.512  1.00 32.58 ? 254  LEU A N     1 
ATOM   2363 C  CA    . LEU C 3 248 ? 50.477 62.029  -1.352  1.00 33.23 ? 254  LEU A CA    1 
ATOM   2364 C  C     . LEU C 3 248 ? 50.135 63.512  -1.467  1.00 34.36 ? 254  LEU A C     1 
ATOM   2365 O  O     . LEU C 3 248 ? 49.679 64.134  -0.504  1.00 34.22 ? 254  LEU A O     1 
ATOM   2366 C  CB    . LEU C 3 248 ? 52.003 61.846  -1.276  1.00 31.15 ? 254  LEU A CB    1 
ATOM   2367 C  CG    . LEU C 3 248 ? 52.746 62.573  -0.143  1.00 31.30 ? 254  LEU A CG    1 
ATOM   2368 C  CD1   . LEU C 3 248 ? 52.121 62.231  1.203   1.00 29.72 ? 254  LEU A CD1   1 
ATOM   2369 C  CD2   . LEU C 3 248 ? 54.211 62.184  -0.151  1.00 28.93 ? 254  LEU A CD2   1 
ATOM   2370 N  N     . ARG C 3 249 ? 50.346 64.063  -2.657  1.00 35.03 ? 255  ARG A N     1 
ATOM   2371 C  CA    . ARG C 3 249 ? 50.059 65.468  -2.912  1.00 37.47 ? 255  ARG A CA    1 
ATOM   2372 C  C     . ARG C 3 249 ? 48.595 65.755  -2.574  1.00 37.79 ? 255  ARG A C     1 
ATOM   2373 O  O     . ARG C 3 249 ? 48.298 66.690  -1.834  1.00 37.40 ? 255  ARG A O     1 
ATOM   2374 C  CB    . ARG C 3 249 ? 50.336 65.801  -4.384  1.00 39.20 ? 255  ARG A CB    1 
ATOM   2375 C  CG    . ARG C 3 249 ? 50.244 67.285  -4.742  1.00 39.43 ? 255  ARG A CG    1 
ATOM   2376 C  CD    . ARG C 3 249 ? 50.330 67.488  -6.252  1.00 40.26 ? 255  ARG A CD    1 
ATOM   2377 N  NE    . ARG C 3 249 ? 49.168 66.937  -6.946  1.00 41.43 ? 255  ARG A NE    1 
ATOM   2378 C  CZ    . ARG C 3 249 ? 47.954 67.482  -6.932  1.00 43.01 ? 255  ARG A CZ    1 
ATOM   2379 N  NH1   . ARG C 3 249 ? 47.735 68.607  -6.261  1.00 44.99 ? 255  ARG A NH1   1 
ATOM   2380 N  NH2   . ARG C 3 249 ? 46.951 66.895  -7.577  1.00 42.70 ? 255  ARG A NH2   1 
ATOM   2381 N  N     . LYS C 3 250 ? 47.688 64.939  -3.106  1.00 38.67 ? 256  LYS A N     1 
ATOM   2382 C  CA    . LYS C 3 250 ? 46.257 65.107  -2.854  1.00 40.30 ? 256  LYS A CA    1 
ATOM   2383 C  C     . LYS C 3 250 ? 45.855 64.926  -1.394  1.00 40.31 ? 256  LYS A C     1 
ATOM   2384 O  O     . LYS C 3 250 ? 44.979 65.632  -0.892  1.00 41.02 ? 256  LYS A O     1 
ATOM   2385 C  CB    . LYS C 3 250 ? 45.436 64.132  -3.699  1.00 41.77 ? 256  LYS A CB    1 
ATOM   2386 C  CG    . LYS C 3 250 ? 45.292 64.516  -5.157  1.00 45.02 ? 256  LYS A CG    1 
ATOM   2387 C  CD    . LYS C 3 250 ? 44.217 63.673  -5.824  1.00 48.86 ? 256  LYS A CD    1 
ATOM   2388 C  CE    . LYS C 3 250 ? 43.975 64.115  -7.261  1.00 51.84 ? 256  LYS A CE    1 
ATOM   2389 N  NZ    . LYS C 3 250 ? 42.784 63.443  -7.856  1.00 53.44 ? 256  LYS A NZ    1 
ATOM   2390 N  N     . LEU C 3 251 ? 46.478 63.970  -0.716  1.00 38.90 ? 257  LEU A N     1 
ATOM   2391 C  CA    . LEU C 3 251 ? 46.146 63.718  0.675   1.00 38.02 ? 257  LEU A CA    1 
ATOM   2392 C  C     . LEU C 3 251 ? 46.725 64.770  1.607   1.00 38.04 ? 257  LEU A C     1 
ATOM   2393 O  O     . LEU C 3 251 ? 46.160 65.044  2.662   1.00 38.33 ? 257  LEU A O     1 
ATOM   2394 C  CB    . LEU C 3 251 ? 46.601 62.311  1.079   1.00 35.58 ? 257  LEU A CB    1 
ATOM   2395 C  CG    . LEU C 3 251 ? 45.643 61.241  0.536   1.00 36.21 ? 257  LEU A CG    1 
ATOM   2396 C  CD1   . LEU C 3 251 ? 46.258 59.856  0.666   1.00 34.07 ? 257  LEU A CD1   1 
ATOM   2397 C  CD2   . LEU C 3 251 ? 44.314 61.323  1.281   1.00 30.13 ? 257  LEU A CD2   1 
ATOM   2398 N  N     . THR C 3 252 ? 47.848 65.360  1.216   1.00 38.61 ? 258  THR A N     1 
ATOM   2399 C  CA    . THR C 3 252 ? 48.471 66.393  2.023   1.00 39.77 ? 258  THR A CA    1 
ATOM   2400 C  C     . THR C 3 252 ? 47.676 67.692  1.863   1.00 40.63 ? 258  THR A C     1 
ATOM   2401 O  O     . THR C 3 252 ? 47.694 68.555  2.742   1.00 40.77 ? 258  THR A O     1 
ATOM   2402 C  CB    . THR C 3 252 ? 49.938 66.613  1.613   1.00 40.05 ? 258  THR A CB    1 
ATOM   2403 O  OG1   . THR C 3 252 ? 50.027 66.702  0.191   1.00 42.97 ? 258  THR A OG1   1 
ATOM   2404 C  CG2   . THR C 3 252 ? 50.802 65.454  2.087   1.00 40.37 ? 258  THR A CG2   1 
ATOM   2405 N  N     . GLU C 3 253 ? 46.966 67.819  0.747   1.00 40.98 ? 259  GLU A N     1 
ATOM   2406 C  CA    . GLU C 3 253 ? 46.144 69.002  0.506   1.00 41.65 ? 259  GLU A CA    1 
ATOM   2407 C  C     . GLU C 3 253 ? 44.865 68.867  1.320   1.00 41.91 ? 259  GLU A C     1 
ATOM   2408 O  O     . GLU C 3 253 ? 44.362 69.843  1.875   1.00 42.09 ? 259  GLU A O     1 
ATOM   2409 C  CB    . GLU C 3 253 ? 45.787 69.130  -0.978  1.00 41.04 ? 259  GLU A CB    1 
ATOM   2410 N  N     . THR C 3 254 ? 44.348 67.646  1.398   1.00 41.45 ? 260  THR A N     1 
ATOM   2411 C  CA    . THR C 3 254 ? 43.127 67.394  2.149   1.00 41.66 ? 260  THR A CA    1 
ATOM   2412 C  C     . THR C 3 254 ? 43.342 67.418  3.667   1.00 41.62 ? 260  THR A C     1 
ATOM   2413 O  O     . THR C 3 254 ? 42.581 68.050  4.403   1.00 42.03 ? 260  THR A O     1 
ATOM   2414 C  CB    . THR C 3 254 ? 42.506 66.037  1.748   1.00 40.69 ? 260  THR A CB    1 
ATOM   2415 O  OG1   . THR C 3 254 ? 42.026 66.113  0.399   1.00 39.79 ? 260  THR A OG1   1 
ATOM   2416 C  CG2   . THR C 3 254 ? 41.355 65.676  2.675   1.00 38.40 ? 260  THR A CG2   1 
ATOM   2417 N  N     . PHE C 3 255 ? 44.376 66.727  4.131   1.00 40.82 ? 261  PHE A N     1 
ATOM   2418 C  CA    . PHE C 3 255 ? 44.667 66.666  5.558   1.00 40.40 ? 261  PHE A CA    1 
ATOM   2419 C  C     . PHE C 3 255 ? 45.955 67.422  5.832   1.00 41.32 ? 261  PHE A C     1 
ATOM   2420 O  O     . PHE C 3 255 ? 47.041 66.885  5.648   1.00 43.27 ? 261  PHE A O     1 
ATOM   2421 C  CB    . PHE C 3 255 ? 44.814 65.205  6.003   1.00 37.47 ? 261  PHE A CB    1 
ATOM   2422 C  CG    . PHE C 3 255 ? 43.597 64.361  5.737   1.00 35.01 ? 261  PHE A CG    1 
ATOM   2423 C  CD1   . PHE C 3 255 ? 42.406 64.597  6.417   1.00 35.37 ? 261  PHE A CD1   1 
ATOM   2424 C  CD2   . PHE C 3 255 ? 43.643 63.326  4.804   1.00 33.85 ? 261  PHE A CD2   1 
ATOM   2425 C  CE1   . PHE C 3 255 ? 41.272 63.810  6.173   1.00 34.86 ? 261  PHE A CE1   1 
ATOM   2426 C  CE2   . PHE C 3 255 ? 42.519 62.533  4.552   1.00 33.63 ? 261  PHE A CE2   1 
ATOM   2427 C  CZ    . PHE C 3 255 ? 41.333 62.773  5.235   1.00 34.10 ? 261  PHE A CZ    1 
ATOM   2428 N  N     . GLY C 3 256 ? 45.832 68.667  6.274   1.00 42.73 ? 262  GLY A N     1 
ATOM   2429 C  CA    . GLY C 3 256 ? 47.011 69.472  6.546   1.00 42.97 ? 262  GLY A CA    1 
ATOM   2430 C  C     . GLY C 3 256 ? 47.865 68.963  7.692   1.00 42.73 ? 262  GLY A C     1 
ATOM   2431 O  O     . GLY C 3 256 ? 47.442 68.103  8.464   1.00 43.21 ? 262  GLY A O     1 
ATOM   2432 N  N     . SER C 3 257 ? 49.078 69.496  7.799   1.00 42.52 ? 263  SER A N     1 
ATOM   2433 C  CA    . SER C 3 257 ? 49.997 69.101  8.854   1.00 41.67 ? 263  SER A CA    1 
ATOM   2434 C  C     . SER C 3 257 ? 49.592 69.718  10.190  1.00 41.15 ? 263  SER A C     1 
ATOM   2435 O  O     . SER C 3 257 ? 48.760 70.621  10.234  1.00 42.36 ? 263  SER A O     1 
ATOM   2436 C  CB    . SER C 3 257 ? 51.417 69.522  8.482   1.00 41.78 ? 263  SER A CB    1 
ATOM   2437 O  OG    . SER C 3 257 ? 51.484 70.913  8.240   1.00 43.19 ? 263  SER A OG    1 
ATOM   2438 N  N     . TRP C 3 258 ? 50.177 69.223  11.277  1.00 40.79 ? 264  TRP A N     1 
ATOM   2439 C  CA    . TRP C 3 258 ? 49.864 69.723  12.617  1.00 40.76 ? 264  TRP A CA    1 
ATOM   2440 C  C     . TRP C 3 258 ? 51.069 69.604  13.550  1.00 39.77 ? 264  TRP A C     1 
ATOM   2441 O  O     . TRP C 3 258 ? 52.152 69.184  13.132  1.00 40.31 ? 264  TRP A O     1 
ATOM   2442 C  CB    . TRP C 3 258 ? 48.687 68.939  13.200  1.00 40.81 ? 264  TRP A CB    1 
ATOM   2443 C  CG    . TRP C 3 258 ? 48.989 67.486  13.416  1.00 43.01 ? 264  TRP A CG    1 
ATOM   2444 C  CD1   . TRP C 3 258 ? 49.447 66.903  14.566  1.00 42.72 ? 264  TRP A CD1   1 
ATOM   2445 C  CD2   . TRP C 3 258 ? 48.878 66.435  12.450  1.00 42.49 ? 264  TRP A CD2   1 
ATOM   2446 N  NE1   . TRP C 3 258 ? 49.625 65.554  14.373  1.00 43.87 ? 264  TRP A NE1   1 
ATOM   2447 C  CE2   . TRP C 3 258 ? 49.283 65.239  13.084  1.00 43.44 ? 264  TRP A CE2   1 
ATOM   2448 C  CE3   . TRP C 3 258 ? 48.479 66.387  11.107  1.00 43.78 ? 264  TRP A CE3   1 
ATOM   2449 C  CZ2   . TRP C 3 258 ? 49.300 64.005  12.419  1.00 42.94 ? 264  TRP A CZ2   1 
ATOM   2450 C  CZ3   . TRP C 3 258 ? 48.498 65.156  10.444  1.00 41.21 ? 264  TRP A CZ3   1 
ATOM   2451 C  CH2   . TRP C 3 258 ? 48.905 63.986  11.103  1.00 41.02 ? 264  TRP A CH2   1 
ATOM   2452 N  N     . TYR C 3 259 ? 50.878 69.973  14.814  1.00 37.86 ? 265  TYR A N     1 
ATOM   2453 C  CA    . TYR C 3 259 ? 51.960 69.897  15.783  1.00 36.49 ? 265  TYR A CA    1 
ATOM   2454 C  C     . TYR C 3 259 ? 51.731 68.855  16.851  1.00 36.24 ? 265  TYR A C     1 
ATOM   2455 O  O     . TYR C 3 259 ? 50.602 68.620  17.276  1.00 35.37 ? 265  TYR A O     1 
ATOM   2456 C  CB    . TYR C 3 259 ? 52.195 71.249  16.464  1.00 35.75 ? 265  TYR A CB    1 
ATOM   2457 C  CG    . TYR C 3 259 ? 52.890 72.241  15.578  1.00 35.49 ? 265  TYR A CG    1 
ATOM   2458 C  CD1   . TYR C 3 259 ? 52.164 73.091  14.753  1.00 33.78 ? 265  TYR A CD1   1 
ATOM   2459 C  CD2   . TYR C 3 259 ? 54.280 72.299  15.531  1.00 34.52 ? 265  TYR A CD2   1 
ATOM   2460 C  CE1   . TYR C 3 259 ? 52.803 73.975  13.903  1.00 34.68 ? 265  TYR A CE1   1 
ATOM   2461 C  CE2   . TYR C 3 259 ? 54.929 73.181  14.684  1.00 36.06 ? 265  TYR A CE2   1 
ATOM   2462 C  CZ    . TYR C 3 259 ? 54.182 74.017  13.873  1.00 35.10 ? 265  TYR A CZ    1 
ATOM   2463 O  OH    . TYR C 3 259 ? 54.815 74.901  13.033  1.00 36.61 ? 265  TYR A OH    1 
ATOM   2464 N  N     . GLN C 3 260 ? 52.826 68.241  17.283  1.00 36.40 ? 266  GLN A N     1 
ATOM   2465 C  CA    . GLN C 3 260 ? 52.784 67.228  18.321  1.00 38.38 ? 266  GLN A CA    1 
ATOM   2466 C  C     . GLN C 3 260 ? 53.913 67.441  19.312  1.00 37.44 ? 266  GLN A C     1 
ATOM   2467 O  O     . GLN C 3 260 ? 55.021 67.823  18.936  1.00 36.29 ? 266  GLN A O     1 
ATOM   2468 C  CB    . GLN C 3 260 ? 52.910 65.831  17.715  1.00 39.31 ? 266  GLN A CB    1 
ATOM   2469 C  CG    . GLN C 3 260 ? 51.658 65.343  17.018  1.00 42.94 ? 266  GLN A CG    1 
ATOM   2470 C  CD    . GLN C 3 260 ? 51.794 63.917  16.508  1.00 44.40 ? 266  GLN A CD    1 
ATOM   2471 O  OE1   . GLN C 3 260 ? 50.828 63.329  16.015  1.00 45.06 ? 266  GLN A OE1   1 
ATOM   2472 N  NE2   . GLN C 3 260 ? 52.999 63.356  16.622  1.00 43.71 ? 266  GLN A NE2   1 
ATOM   2473 N  N     . PRO C 3 261 ? 53.644 67.191  20.599  1.00 37.90 ? 267  PRO A N     1 
ATOM   2474 C  CA    . PRO C 3 261 ? 54.663 67.359  21.636  1.00 39.28 ? 267  PRO A CA    1 
ATOM   2475 C  C     . PRO C 3 261 ? 55.757 66.319  21.426  1.00 40.58 ? 267  PRO A C     1 
ATOM   2476 O  O     . PRO C 3 261 ? 55.467 65.159  21.123  1.00 40.41 ? 267  PRO A O     1 
ATOM   2477 C  CB    . PRO C 3 261 ? 53.875 67.135  22.925  1.00 39.05 ? 267  PRO A CB    1 
ATOM   2478 C  CG    . PRO C 3 261 ? 52.848 66.137  22.511  1.00 38.19 ? 267  PRO A CG    1 
ATOM   2479 C  CD    . PRO C 3 261 ? 52.392 66.663  21.170  1.00 37.60 ? 267  PRO A CD    1 
ATOM   2480 N  N     . LYS C 3 262 ? 57.011 66.732  21.574  1.00 42.16 ? 268  LYS A N     1 
ATOM   2481 C  CA    . LYS C 3 262 ? 58.126 65.812  21.384  1.00 43.84 ? 268  LYS A CA    1 
ATOM   2482 C  C     . LYS C 3 262 ? 59.425 66.331  21.987  1.00 44.45 ? 268  LYS A C     1 
ATOM   2483 O  O     . LYS C 3 262 ? 59.824 67.466  21.736  1.00 44.65 ? 268  LYS A O     1 
ATOM   2484 C  CB    . LYS C 3 262 ? 58.333 65.546  19.887  1.00 44.90 ? 268  LYS A CB    1 
ATOM   2485 C  CG    . LYS C 3 262 ? 59.558 64.695  19.559  1.00 43.51 ? 268  LYS A CG    1 
ATOM   2486 N  N     . GLY C 3 263 ? 60.081 65.490  22.781  1.00 45.25 ? 269  GLY A N     1 
ATOM   2487 C  CA    . GLY C 3 263 ? 61.339 65.879  23.388  1.00 46.04 ? 269  GLY A CA    1 
ATOM   2488 C  C     . GLY C 3 263 ? 61.205 66.440  24.786  1.00 47.14 ? 269  GLY A C     1 
ATOM   2489 O  O     . GLY C 3 263 ? 62.161 67.001  25.331  1.00 46.66 ? 269  GLY A O     1 
ATOM   2490 N  N     . GLY C 3 264 ? 60.016 66.305  25.365  1.00 47.63 ? 270  GLY A N     1 
ATOM   2491 C  CA    . GLY C 3 264 ? 59.799 66.800  26.710  1.00 49.24 ? 270  GLY A CA    1 
ATOM   2492 C  C     . GLY C 3 264 ? 60.486 65.870  27.687  1.00 50.47 ? 270  GLY A C     1 
ATOM   2493 O  O     . GLY C 3 264 ? 60.327 64.652  27.600  1.00 49.88 ? 270  GLY A O     1 
ATOM   2494 N  N     . THR C 3 265 ? 61.255 66.437  28.611  1.00 52.10 ? 271  THR A N     1 
ATOM   2495 C  CA    . THR C 3 265 ? 61.977 65.640  29.598  1.00 53.87 ? 271  THR A CA    1 
ATOM   2496 C  C     . THR C 3 265 ? 61.360 65.734  30.985  1.00 54.40 ? 271  THR A C     1 
ATOM   2497 O  O     . THR C 3 265 ? 61.133 64.718  31.644  1.00 54.95 ? 271  THR A O     1 
ATOM   2498 C  CB    . THR C 3 265 ? 63.454 66.076  29.699  1.00 54.61 ? 271  THR A CB    1 
ATOM   2499 O  OG1   . THR C 3 265 ? 63.522 67.453  30.097  1.00 55.71 ? 271  THR A OG1   1 
ATOM   2500 C  CG2   . THR C 3 265 ? 64.155 65.902  28.352  1.00 54.46 ? 271  THR A CG2   1 
ATOM   2501 N  N     . GLU C 3 266 ? 61.083 66.953  31.430  1.00 55.15 ? 272  GLU A N     1 
ATOM   2502 C  CA    . GLU C 3 266 ? 60.503 67.148  32.750  1.00 55.85 ? 272  GLU A CA    1 
ATOM   2503 C  C     . GLU C 3 266 ? 58.981 67.050  32.753  1.00 54.24 ? 272  GLU A C     1 
ATOM   2504 O  O     . GLU C 3 266 ? 58.312 67.445  31.800  1.00 54.56 ? 272  GLU A O     1 
ATOM   2505 C  CB    . GLU C 3 266 ? 60.944 68.500  33.328  1.00 57.48 ? 272  GLU A CB    1 
ATOM   2506 C  CG    . GLU C 3 266 ? 60.382 68.796  34.711  1.00 62.16 ? 272  GLU A CG    1 
ATOM   2507 C  CD    . GLU C 3 266 ? 60.907 70.099  35.294  1.00 65.18 ? 272  GLU A CD    1 
ATOM   2508 O  OE1   . GLU C 3 266 ? 60.816 71.135  34.598  1.00 66.89 ? 272  GLU A OE1   1 
ATOM   2509 O  OE2   . GLU C 3 266 ? 61.404 70.090  36.447  1.00 65.28 ? 272  GLU A OE2   1 
ATOM   2510 N  N     . MET C 3 267 ? 58.454 66.507  33.843  1.00 52.76 ? 273  MET A N     1 
ATOM   2511 C  CA    . MET C 3 267 ? 57.020 66.339  34.048  1.00 51.23 ? 273  MET A CA    1 
ATOM   2512 C  C     . MET C 3 267 ? 56.371 67.706  34.281  1.00 49.68 ? 273  MET A C     1 
ATOM   2513 O  O     . MET C 3 267 ? 57.007 68.607  34.836  1.00 48.13 ? 273  MET A O     1 
ATOM   2514 C  CB    . MET C 3 267 ? 56.804 65.449  35.277  1.00 53.19 ? 273  MET A CB    1 
ATOM   2515 C  CG    . MET C 3 267 ? 55.394 65.419  35.825  1.00 55.06 ? 273  MET A CG    1 
ATOM   2516 S  SD    . MET C 3 267 ? 54.337 64.258  34.969  1.00 59.79 ? 273  MET A SD    1 
ATOM   2517 C  CE    . MET C 3 267 ? 54.520 62.805  36.026  1.00 58.48 ? 273  MET A CE    1 
ATOM   2518 N  N     . PHE C 3 268 ? 55.117 67.865  33.851  1.00 48.69 ? 274  PHE A N     1 
ATOM   2519 C  CA    . PHE C 3 268 ? 54.404 69.124  34.061  1.00 47.40 ? 274  PHE A CA    1 
ATOM   2520 C  C     . PHE C 3 268 ? 53.657 69.047  35.383  1.00 47.79 ? 274  PHE A C     1 
ATOM   2521 O  O     . PHE C 3 268 ? 52.931 68.088  35.640  1.00 47.85 ? 274  PHE A O     1 
ATOM   2522 C  CB    . PHE C 3 268 ? 53.400 69.408  32.937  1.00 46.07 ? 274  PHE A CB    1 
ATOM   2523 C  CG    . PHE C 3 268 ? 52.613 70.687  33.135  1.00 43.49 ? 274  PHE A CG    1 
ATOM   2524 C  CD1   . PHE C 3 268 ? 53.265 71.913  33.238  1.00 43.69 ? 274  PHE A CD1   1 
ATOM   2525 C  CD2   . PHE C 3 268 ? 51.225 70.662  33.230  1.00 43.70 ? 274  PHE A CD2   1 
ATOM   2526 C  CE1   . PHE C 3 268 ? 52.546 73.102  33.433  1.00 44.46 ? 274  PHE A CE1   1 
ATOM   2527 C  CE2   . PHE C 3 268 ? 50.494 71.839  33.424  1.00 43.43 ? 274  PHE A CE2   1 
ATOM   2528 C  CZ    . PHE C 3 268 ? 51.157 73.064  33.527  1.00 43.58 ? 274  PHE A CZ    1 
ATOM   2529 N  N     . CYS C 3 269 ? 53.831 70.067  36.215  1.00 48.83 ? 275  CYS A N     1 
ATOM   2530 C  CA    . CYS C 3 269 ? 53.185 70.099  37.518  1.00 50.13 ? 275  CYS A CA    1 
ATOM   2531 C  C     . CYS C 3 269 ? 52.362 71.365  37.715  1.00 51.10 ? 275  CYS A C     1 
ATOM   2532 O  O     . CYS C 3 269 ? 52.799 72.468  37.377  1.00 51.78 ? 275  CYS A O     1 
ATOM   2533 C  CB    . CYS C 3 269 ? 54.244 69.988  38.616  1.00 49.85 ? 275  CYS A CB    1 
ATOM   2534 S  SG    . CYS C 3 269 ? 55.297 68.522  38.447  1.00 52.71 ? 275  CYS A SG    1 
ATOM   2535 N  N     . HIS C 3 270 ? 51.165 71.196  38.266  1.00 51.35 ? 276  HIS A N     1 
ATOM   2536 C  CA    . HIS C 3 270 ? 50.280 72.324  38.510  1.00 52.69 ? 276  HIS A CA    1 
ATOM   2537 C  C     . HIS C 3 270 ? 51.036 73.404  39.282  1.00 53.09 ? 276  HIS A C     1 
ATOM   2538 O  O     . HIS C 3 270 ? 51.576 73.146  40.354  1.00 52.95 ? 276  HIS A O     1 
ATOM   2539 C  CB    . HIS C 3 270 ? 49.052 71.863  39.298  1.00 51.76 ? 276  HIS A CB    1 
ATOM   2540 C  CG    . HIS C 3 270 ? 47.953 72.876  39.345  1.00 52.55 ? 276  HIS A CG    1 
ATOM   2541 N  ND1   . HIS C 3 270 ? 46.626 72.542  39.181  1.00 53.47 ? 276  HIS A ND1   1 
ATOM   2542 C  CD2   . HIS C 3 270 ? 47.983 74.217  39.525  1.00 52.34 ? 276  HIS A CD2   1 
ATOM   2543 C  CE1   . HIS C 3 270 ? 45.886 73.634  39.254  1.00 53.42 ? 276  HIS A CE1   1 
ATOM   2544 N  NE2   . HIS C 3 270 ? 46.686 74.664  39.462  1.00 53.26 ? 276  HIS A NE2   1 
ATOM   2545 N  N     . PRO C 3 271 ? 51.097 74.628  38.731  1.00 54.21 ? 277  PRO A N     1 
ATOM   2546 C  CA    . PRO C 3 271 ? 51.795 75.753  39.372  1.00 54.78 ? 277  PRO A CA    1 
ATOM   2547 C  C     . PRO C 3 271 ? 51.295 76.031  40.788  1.00 55.03 ? 277  PRO A C     1 
ATOM   2548 O  O     . PRO C 3 271 ? 52.047 76.488  41.645  1.00 54.49 ? 277  PRO A O     1 
ATOM   2549 C  CB    . PRO C 3 271 ? 51.511 76.917  38.425  1.00 54.42 ? 277  PRO A CB    1 
ATOM   2550 C  CG    . PRO C 3 271 ? 51.421 76.240  37.089  1.00 54.71 ? 277  PRO A CG    1 
ATOM   2551 C  CD    . PRO C 3 271 ? 50.589 75.017  37.403  1.00 54.04 ? 277  PRO A CD    1 
ATOM   2552 N  N     . ARG C 3 272 ? 50.021 75.743  41.022  1.00 55.87 ? 278  ARG A N     1 
ATOM   2553 C  CA    . ARG C 3 272 ? 49.399 75.961  42.324  1.00 57.45 ? 278  ARG A CA    1 
ATOM   2554 C  C     . ARG C 3 272 ? 49.801 74.869  43.327  1.00 57.37 ? 278  ARG A C     1 
ATOM   2555 O  O     . ARG C 3 272 ? 50.619 75.102  44.220  1.00 57.96 ? 278  ARG A O     1 
ATOM   2556 C  CB    . ARG C 3 272 ? 47.871 75.994  42.152  1.00 58.94 ? 278  ARG A CB    1 
ATOM   2557 C  CG    . ARG C 3 272 ? 47.041 76.412  43.374  1.00 59.65 ? 278  ARG A CG    1 
ATOM   2558 C  CD    . ARG C 3 272 ? 45.537 76.238  43.078  1.00 59.28 ? 278  ARG A CD    1 
ATOM   2559 N  NE    . ARG C 3 272 ? 45.155 76.873  41.813  1.00 59.77 ? 278  ARG A NE    1 
ATOM   2560 C  CZ    . ARG C 3 272 ? 44.366 76.316  40.894  1.00 58.98 ? 278  ARG A CZ    1 
ATOM   2561 N  NH1   . ARG C 3 272 ? 43.863 75.105  41.089  1.00 58.64 ? 278  ARG A NH1   1 
ATOM   2562 N  NH2   . ARG C 3 272 ? 44.092 76.962  39.768  1.00 58.53 ? 278  ARG A NH2   1 
ATOM   2563 N  N     . THR C 3 273 ? 49.242 73.674  43.156  1.00 56.43 ? 279  THR A N     1 
ATOM   2564 C  CA    . THR C 3 273 ? 49.503 72.555  44.058  1.00 56.27 ? 279  THR A CA    1 
ATOM   2565 C  C     . THR C 3 273 ? 50.801 71.771  43.825  1.00 56.17 ? 279  THR A C     1 
ATOM   2566 O  O     . THR C 3 273 ? 51.193 70.954  44.663  1.00 56.60 ? 279  THR A O     1 
ATOM   2567 C  CB    . THR C 3 273 ? 48.331 71.552  44.018  1.00 55.81 ? 279  THR A CB    1 
ATOM   2568 O  OG1   . THR C 3 273 ? 48.194 71.031  42.690  1.00 55.11 ? 279  THR A OG1   1 
ATOM   2569 C  CG2   . THR C 3 273 ? 47.027 72.234  44.416  1.00 55.87 ? 279  THR A CG2   1 
ATOM   2570 N  N     . GLY C 3 274 ? 51.467 72.006  42.701  1.00 54.95 ? 280  GLY A N     1 
ATOM   2571 C  CA    . GLY C 3 274 ? 52.689 71.273  42.426  1.00 53.97 ? 280  GLY A CA    1 
ATOM   2572 C  C     . GLY C 3 274 ? 52.389 69.818  42.101  1.00 53.87 ? 280  GLY A C     1 
ATOM   2573 O  O     . GLY C 3 274 ? 53.297 69.010  41.890  1.00 53.02 ? 280  GLY A O     1 
ATOM   2574 N  N     . LYS C 3 275 ? 51.104 69.482  42.060  1.00 53.86 ? 281  LYS A N     1 
ATOM   2575 C  CA    . LYS C 3 275 ? 50.674 68.123  41.755  1.00 54.94 ? 281  LYS A CA    1 
ATOM   2576 C  C     . LYS C 3 275 ? 51.076 67.724  40.336  1.00 55.46 ? 281  LYS A C     1 
ATOM   2577 O  O     . LYS C 3 275 ? 50.770 68.430  39.377  1.00 55.67 ? 281  LYS A O     1 
ATOM   2578 C  CB    . LYS C 3 275 ? 49.154 68.011  41.899  1.00 55.54 ? 281  LYS A CB    1 
ATOM   2579 N  N     . PRO C 3 276 ? 51.772 66.586  40.185  1.00 55.96 ? 282  PRO A N     1 
ATOM   2580 C  CA    . PRO C 3 276 ? 52.190 66.135  38.854  1.00 55.67 ? 282  PRO A CA    1 
ATOM   2581 C  C     . PRO C 3 276 ? 50.991 65.873  37.947  1.00 55.28 ? 282  PRO A C     1 
ATOM   2582 O  O     . PRO C 3 276 ? 49.992 65.278  38.371  1.00 54.18 ? 282  PRO A O     1 
ATOM   2583 C  CB    . PRO C 3 276 ? 52.978 64.860  39.153  1.00 56.21 ? 282  PRO A CB    1 
ATOM   2584 C  CG    . PRO C 3 276 ? 53.561 65.135  40.512  1.00 56.38 ? 282  PRO A CG    1 
ATOM   2585 C  CD    . PRO C 3 276 ? 52.374 65.742  41.234  1.00 56.88 ? 282  PRO A CD    1 
ATOM   2586 N  N     . LEU C 3 277 ? 51.097 66.330  36.700  1.00 55.19 ? 283  LEU A N     1 
ATOM   2587 C  CA    . LEU C 3 277 ? 50.042 66.150  35.712  1.00 54.22 ? 283  LEU A CA    1 
ATOM   2588 C  C     . LEU C 3 277 ? 50.583 65.293  34.564  1.00 55.36 ? 283  LEU A C     1 
ATOM   2589 O  O     . LEU C 3 277 ? 50.999 65.810  33.522  1.00 55.31 ? 283  LEU A O     1 
ATOM   2590 C  CB    . LEU C 3 277 ? 49.575 67.512  35.194  1.00 53.14 ? 283  LEU A CB    1 
ATOM   2591 C  CG    . LEU C 3 277 ? 48.967 68.460  36.235  1.00 52.63 ? 283  LEU A CG    1 
ATOM   2592 C  CD1   . LEU C 3 277 ? 48.586 69.769  35.577  1.00 50.79 ? 283  LEU A CD1   1 
ATOM   2593 C  CD2   . LEU C 3 277 ? 47.742 67.817  36.868  1.00 51.90 ? 283  LEU A CD2   1 
ATOM   2594 N  N     . PRO C 3 278 ? 50.585 63.960  34.754  1.00 55.70 ? 284  PRO A N     1 
ATOM   2595 C  CA    . PRO C 3 278 ? 51.052 62.926  33.819  1.00 55.39 ? 284  PRO A CA    1 
ATOM   2596 C  C     . PRO C 3 278 ? 50.396 62.892  32.437  1.00 54.45 ? 284  PRO A C     1 
ATOM   2597 O  O     . PRO C 3 278 ? 51.027 62.485  31.459  1.00 53.81 ? 284  PRO A O     1 
ATOM   2598 C  CB    . PRO C 3 278 ? 50.800 61.628  34.589  1.00 55.83 ? 284  PRO A CB    1 
ATOM   2599 C  CG    . PRO C 3 278 ? 50.922 62.048  36.018  1.00 56.45 ? 284  PRO A CG    1 
ATOM   2600 C  CD    . PRO C 3 278 ? 50.156 63.344  36.022  1.00 56.28 ? 284  PRO A CD    1 
ATOM   2601 N  N     . LYS C 3 279 ? 49.133 63.299  32.354  1.00 53.53 ? 285  LYS A N     1 
ATOM   2602 C  CA    . LYS C 3 279 ? 48.422 63.285  31.078  1.00 52.78 ? 285  LYS A CA    1 
ATOM   2603 C  C     . LYS C 3 279 ? 48.861 64.430  30.171  1.00 52.57 ? 285  LYS A C     1 
ATOM   2604 O  O     . LYS C 3 279 ? 48.772 64.337  28.943  1.00 51.74 ? 285  LYS A O     1 
ATOM   2605 C  CB    . LYS C 3 279 ? 46.912 63.360  31.314  1.00 53.42 ? 285  LYS A CB    1 
ATOM   2606 N  N     . TYR C 3 280 ? 49.326 65.515  30.782  1.00 51.85 ? 286  TYR A N     1 
ATOM   2607 C  CA    . TYR C 3 280 ? 49.795 66.673  30.030  1.00 50.23 ? 286  TYR A CA    1 
ATOM   2608 C  C     . TYR C 3 280 ? 51.110 66.321  29.356  1.00 49.05 ? 286  TYR A C     1 
ATOM   2609 O  O     . TYR C 3 280 ? 51.912 65.565  29.904  1.00 48.89 ? 286  TYR A O     1 
ATOM   2610 C  CB    . TYR C 3 280 ? 50.012 67.867  30.964  1.00 51.48 ? 286  TYR A CB    1 
ATOM   2611 C  CG    . TYR C 3 280 ? 48.819 68.787  31.100  1.00 51.11 ? 286  TYR A CG    1 
ATOM   2612 C  CD1   . TYR C 3 280 ? 48.637 69.862  30.229  1.00 51.42 ? 286  TYR A CD1   1 
ATOM   2613 C  CD2   . TYR C 3 280 ? 47.876 68.587  32.103  1.00 51.06 ? 286  TYR A CD2   1 
ATOM   2614 C  CE1   . TYR C 3 280 ? 47.543 70.716  30.361  1.00 51.30 ? 286  TYR A CE1   1 
ATOM   2615 C  CE2   . TYR C 3 280 ? 46.781 69.431  32.241  1.00 51.30 ? 286  TYR A CE2   1 
ATOM   2616 C  CZ    . TYR C 3 280 ? 46.620 70.492  31.371  1.00 50.55 ? 286  TYR A CZ    1 
ATOM   2617 O  OH    . TYR C 3 280 ? 45.544 71.330  31.528  1.00 50.64 ? 286  TYR A OH    1 
ATOM   2618 N  N     . PRO C 3 281 ? 51.343 66.851  28.147  1.00 48.10 ? 287  PRO A N     1 
ATOM   2619 C  CA    . PRO C 3 281 ? 52.591 66.560  27.438  1.00 47.20 ? 287  PRO A CA    1 
ATOM   2620 C  C     . PRO C 3 281 ? 53.790 66.978  28.287  1.00 46.69 ? 287  PRO A C     1 
ATOM   2621 O  O     . PRO C 3 281 ? 53.677 67.875  29.124  1.00 45.02 ? 287  PRO A O     1 
ATOM   2622 C  CB    . PRO C 3 281 ? 52.463 67.397  26.168  1.00 46.97 ? 287  PRO A CB    1 
ATOM   2623 C  CG    . PRO C 3 281 ? 50.982 67.388  25.916  1.00 47.28 ? 287  PRO A CG    1 
ATOM   2624 C  CD    . PRO C 3 281 ? 50.417 67.621  27.296  1.00 47.26 ? 287  PRO A CD    1 
ATOM   2625 N  N     . ARG C 3 282 ? 54.929 66.322  28.074  1.00 47.16 ? 288  ARG A N     1 
ATOM   2626 C  CA    . ARG C 3 282 ? 56.146 66.644  28.814  1.00 47.21 ? 288  ARG A CA    1 
ATOM   2627 C  C     . ARG C 3 282 ? 56.657 68.013  28.398  1.00 46.69 ? 288  ARG A C     1 
ATOM   2628 O  O     . ARG C 3 282 ? 56.602 68.383  27.223  1.00 46.55 ? 288  ARG A O     1 
ATOM   2629 C  CB    . ARG C 3 282 ? 57.241 65.604  28.554  1.00 49.53 ? 288  ARG A CB    1 
ATOM   2630 C  CG    . ARG C 3 282 ? 57.064 64.270  29.273  1.00 52.33 ? 288  ARG A CG    1 
ATOM   2631 C  CD    . ARG C 3 282 ? 57.144 64.432  30.784  1.00 54.83 ? 288  ARG A CD    1 
ATOM   2632 N  NE    . ARG C 3 282 ? 55.833 64.302  31.413  1.00 57.71 ? 288  ARG A NE    1 
ATOM   2633 C  CZ    . ARG C 3 282 ? 55.192 63.148  31.579  1.00 58.52 ? 288  ARG A CZ    1 
ATOM   2634 N  NH1   . ARG C 3 282 ? 55.745 62.014  31.167  1.00 58.74 ? 288  ARG A NH1   1 
ATOM   2635 N  NH2   . ARG C 3 282 ? 53.992 63.130  32.145  1.00 59.40 ? 288  ARG A NH2   1 
ATOM   2636 N  N     . ILE C 3 283 ? 57.162 68.759  29.371  1.00 45.55 ? 289  ILE A N     1 
ATOM   2637 C  CA    . ILE C 3 283 ? 57.681 70.093  29.122  1.00 45.37 ? 289  ILE A CA    1 
ATOM   2638 C  C     . ILE C 3 283 ? 59.192 70.088  29.275  1.00 46.16 ? 289  ILE A C     1 
ATOM   2639 O  O     . ILE C 3 283 ? 59.808 69.043  29.474  1.00 45.59 ? 289  ILE A O     1 
ATOM   2640 C  CB    . ILE C 3 283 ? 57.104 71.098  30.130  1.00 44.53 ? 289  ILE A CB    1 
ATOM   2641 C  CG1   . ILE C 3 283 ? 57.486 70.662  31.553  1.00 43.95 ? 289  ILE A CG1   1 
ATOM   2642 C  CG2   . ILE C 3 283 ? 55.595 71.180  29.972  1.00 41.07 ? 289  ILE A CG2   1 
ATOM   2643 C  CD1   . ILE C 3 283 ? 56.991 71.571  32.651  1.00 45.44 ? 289  ILE A CD1   1 
ATOM   2644 N  N     . LYS C 3 284 ? 59.776 71.274  29.187  1.00 47.63 ? 290  LYS A N     1 
ATOM   2645 C  CA    . LYS C 3 284 ? 61.210 71.456  29.330  1.00 49.07 ? 290  LYS A CA    1 
ATOM   2646 C  C     . LYS C 3 284 ? 61.360 72.821  30.003  1.00 50.25 ? 290  LYS A C     1 
ATOM   2647 O  O     . LYS C 3 284 ? 60.681 73.779  29.625  1.00 50.85 ? 290  LYS A O     1 
ATOM   2648 C  CB    . LYS C 3 284 ? 61.879 71.453  27.951  1.00 50.59 ? 290  LYS A CB    1 
ATOM   2649 C  CG    . LYS C 3 284 ? 63.378 71.155  27.958  1.00 53.24 ? 290  LYS A CG    1 
ATOM   2650 C  CD    . LYS C 3 284 ? 64.153 72.194  28.763  1.00 54.90 ? 290  LYS A CD    1 
ATOM   2651 C  CE    . LYS C 3 284 ? 65.627 71.836  28.908  1.00 53.82 ? 290  LYS A CE    1 
ATOM   2652 N  NZ    . LYS C 3 284 ? 66.307 72.737  29.891  1.00 52.01 ? 290  LYS A NZ    1 
ATOM   2653 N  N     . THR C 3 285 ? 62.219 72.903  31.015  1.00 51.09 ? 291  THR A N     1 
ATOM   2654 C  CA    . THR C 3 285 ? 62.440 74.160  31.731  1.00 52.02 ? 291  THR A CA    1 
ATOM   2655 C  C     . THR C 3 285 ? 63.886 74.603  31.541  1.00 53.07 ? 291  THR A C     1 
ATOM   2656 O  O     . THR C 3 285 ? 64.806 73.961  32.042  1.00 54.14 ? 291  THR A O     1 
ATOM   2657 C  CB    . THR C 3 285 ? 62.171 74.008  33.252  1.00 52.32 ? 291  THR A CB    1 
ATOM   2658 O  OG1   . THR C 3 285 ? 60.818 73.590  33.473  1.00 49.57 ? 291  THR A OG1   1 
ATOM   2659 C  CG2   . THR C 3 285 ? 62.403 75.328  33.960  1.00 52.11 ? 291  THR A CG2   1 
ATOM   2660 N  N     . PRO C 3 286 ? 64.107 75.711  30.816  1.00 54.07 ? 292  PRO A N     1 
ATOM   2661 C  CA    . PRO C 3 286 ? 65.476 76.190  30.594  1.00 54.53 ? 292  PRO A CA    1 
ATOM   2662 C  C     . PRO C 3 286 ? 66.136 76.704  31.874  1.00 55.34 ? 292  PRO A C     1 
ATOM   2663 O  O     . PRO C 3 286 ? 65.486 77.342  32.710  1.00 55.10 ? 292  PRO A O     1 
ATOM   2664 C  CB    . PRO C 3 286 ? 65.287 77.280  29.540  1.00 54.52 ? 292  PRO A CB    1 
ATOM   2665 C  CG    . PRO C 3 286 ? 63.943 77.846  29.890  1.00 54.34 ? 292  PRO A CG    1 
ATOM   2666 C  CD    . PRO C 3 286 ? 63.121 76.605  30.181  1.00 54.28 ? 292  PRO A CD    1 
ATOM   2667 N  N     . LYS C 3 287 ? 67.428 76.417  32.022  1.00 56.20 ? 293  LYS A N     1 
ATOM   2668 C  CA    . LYS C 3 287 ? 68.187 76.836  33.199  1.00 56.44 ? 293  LYS A CA    1 
ATOM   2669 C  C     . LYS C 3 287 ? 69.114 77.996  32.852  1.00 56.66 ? 293  LYS A C     1 
ATOM   2670 O  O     . LYS C 3 287 ? 70.026 78.333  33.612  1.00 56.70 ? 293  LYS A O     1 
ATOM   2671 C  CB    . LYS C 3 287 ? 69.011 75.663  33.736  1.00 56.73 ? 293  LYS A CB    1 
ATOM   2672 N  N     . VAL C 3 288 ? 68.873 78.598  31.694  1.00 56.56 ? 294  VAL A N     1 
ATOM   2673 C  CA    . VAL C 3 288 ? 69.670 79.723  31.217  1.00 55.89 ? 294  VAL A CA    1 
ATOM   2674 C  C     . VAL C 3 288 ? 68.809 80.625  30.338  1.00 54.94 ? 294  VAL A C     1 
ATOM   2675 O  O     . VAL C 3 288 ? 67.860 80.163  29.702  1.00 54.44 ? 294  VAL A O     1 
ATOM   2676 C  CB    . VAL C 3 288 ? 70.889 79.243  30.387  1.00 55.66 ? 294  VAL A CB    1 
ATOM   2677 C  CG1   . VAL C 3 288 ? 71.855 78.474  31.276  1.00 56.10 ? 294  VAL A CG1   1 
ATOM   2678 C  CG2   . VAL C 3 288 ? 70.424 78.359  29.232  1.00 55.87 ? 294  VAL A CG2   1 
ATOM   2679 N  N     . GLY C 3 289 ? 69.139 81.913  30.316  1.00 53.91 ? 295  GLY A N     1 
ATOM   2680 C  CA    . GLY C 3 289 ? 68.390 82.850  29.502  1.00 52.28 ? 295  GLY A CA    1 
ATOM   2681 C  C     . GLY C 3 289 ? 67.554 83.843  30.288  1.00 51.84 ? 295  GLY A C     1 
ATOM   2682 O  O     . GLY C 3 289 ? 67.030 83.540  31.368  1.00 50.61 ? 295  GLY A O     1 
ATOM   2683 N  N     . GLY C 3 290 ? 67.432 85.043  29.731  1.00 50.97 ? 296  GLY A N     1 
ATOM   2684 C  CA    . GLY C 3 290 ? 66.651 86.085  30.364  1.00 50.93 ? 296  GLY A CA    1 
ATOM   2685 C  C     . GLY C 3 290 ? 66.271 87.133  29.338  1.00 51.46 ? 296  GLY A C     1 
ATOM   2686 O  O     . GLY C 3 290 ? 66.576 86.995  28.151  1.00 51.26 ? 296  GLY A O     1 
ATOM   2687 N  N     . ILE C 3 291 ? 65.603 88.184  29.791  1.00 51.15 ? 297  ILE A N     1 
ATOM   2688 C  CA    . ILE C 3 291 ? 65.198 89.258  28.906  1.00 51.59 ? 297  ILE A CA    1 
ATOM   2689 C  C     . ILE C 3 291 ? 66.415 90.116  28.567  1.00 52.01 ? 297  ILE A C     1 
ATOM   2690 O  O     . ILE C 3 291 ? 66.517 90.673  27.473  1.00 51.48 ? 297  ILE A O     1 
ATOM   2691 C  CB    . ILE C 3 291 ? 64.119 90.120  29.566  1.00 50.67 ? 297  ILE A CB    1 
ATOM   2692 C  CG1   . ILE C 3 291 ? 62.898 89.252  29.875  1.00 51.05 ? 297  ILE A CG1   1 
ATOM   2693 C  CG2   . ILE C 3 291 ? 63.746 91.279  28.653  1.00 51.18 ? 297  ILE A CG2   1 
ATOM   2694 N  N     . PHE C 3 292 ? 67.337 90.219  29.518  1.00 53.23 ? 298  PHE A N     1 
ATOM   2695 C  CA    . PHE C 3 292 ? 68.559 90.984  29.314  1.00 54.09 ? 298  PHE A CA    1 
ATOM   2696 C  C     . PHE C 3 292 ? 69.772 90.078  29.487  1.00 55.12 ? 298  PHE A C     1 
ATOM   2697 O  O     . PHE C 3 292 ? 69.804 89.238  30.389  1.00 54.81 ? 298  PHE A O     1 
ATOM   2698 C  CB    . PHE C 3 292 ? 68.660 92.137  30.312  1.00 53.48 ? 298  PHE A CB    1 
ATOM   2699 C  CG    . PHE C 3 292 ? 67.574 93.165  30.177  1.00 53.01 ? 298  PHE A CG    1 
ATOM   2700 C  CD1   . PHE C 3 292 ? 66.434 93.099  30.972  1.00 52.67 ? 298  PHE A CD1   1 
ATOM   2701 C  CD2   . PHE C 3 292 ? 67.706 94.217  29.275  1.00 52.31 ? 298  PHE A CD2   1 
ATOM   2702 C  CE1   . PHE C 3 292 ? 65.441 94.070  30.877  1.00 52.63 ? 298  PHE A CE1   1 
ATOM   2703 C  CE2   . PHE C 3 292 ? 66.721 95.192  29.170  1.00 52.18 ? 298  PHE A CE2   1 
ATOM   2704 C  CZ    . PHE C 3 292 ? 65.585 95.119  29.974  1.00 52.90 ? 298  PHE A CZ    1 
ATOM   2705 N  N     . LYS C 3 293 ? 70.764 90.246  28.616  1.00 56.77 ? 299  LYS A N     1 
ATOM   2706 C  CA    . LYS C 3 293 ? 71.988 89.456  28.695  1.00 57.53 ? 299  LYS A CA    1 
ATOM   2707 C  C     . LYS C 3 293 ? 72.709 89.821  29.997  1.00 58.66 ? 299  LYS A C     1 
ATOM   2708 O  O     . LYS C 3 293 ? 72.471 90.892  30.568  1.00 58.30 ? 299  LYS A O     1 
ATOM   2709 C  CB    . LYS C 3 293 ? 72.890 89.753  27.493  1.00 57.36 ? 299  LYS A CB    1 
ATOM   2710 N  N     . LYS C 3 294 ? 73.578 88.929  30.467  1.00 59.24 ? 300  LYS A N     1 
ATOM   2711 C  CA    . LYS C 3 294 ? 74.322 89.158  31.704  1.00 59.63 ? 300  LYS A CA    1 
ATOM   2712 C  C     . LYS C 3 294 ? 75.088 90.482  31.663  1.00 59.61 ? 300  LYS A C     1 
ATOM   2713 O  O     . LYS C 3 294 ? 75.865 90.733  30.741  1.00 58.75 ? 300  LYS A O     1 
ATOM   2714 C  CB    . LYS C 3 294 ? 75.298 88.002  31.950  1.00 60.12 ? 300  LYS A CB    1 
ATOM   2715 N  N     . PRO C 3 295 ? 74.874 91.349  32.668  1.00 59.89 ? 301  PRO A N     1 
ATOM   2716 C  CA    . PRO C 3 295 ? 75.548 92.651  32.743  1.00 60.75 ? 301  PRO A CA    1 
ATOM   2717 C  C     . PRO C 3 295 ? 77.011 92.535  33.186  1.00 61.46 ? 301  PRO A C     1 
ATOM   2718 O  O     . PRO C 3 295 ? 77.451 91.471  33.624  1.00 61.74 ? 301  PRO A O     1 
ATOM   2719 C  CB    . PRO C 3 295 ? 74.698 93.411  33.753  1.00 60.28 ? 301  PRO A CB    1 
ATOM   2720 C  CG    . PRO C 3 295 ? 74.313 92.323  34.718  1.00 60.09 ? 301  PRO A CG    1 
ATOM   2721 C  CD    . PRO C 3 295 ? 73.937 91.177  33.796  1.00 59.77 ? 301  PRO A CD    1 
ATOM   2722 N  N     . LYS C 3 296 ? 77.760 93.629  33.067  1.00 62.07 ? 302  LYS A N     1 
ATOM   2723 C  CA    . LYS C 3 296 ? 79.169 93.645  33.466  1.00 62.52 ? 302  LYS A CA    1 
ATOM   2724 C  C     . LYS C 3 296 ? 79.680 95.065  33.690  1.00 62.15 ? 302  LYS A C     1 
ATOM   2725 O  O     . LYS C 3 296 ? 80.534 95.547  32.945  1.00 62.78 ? 302  LYS A O     1 
ATOM   2726 C  CB    . LYS C 3 296 ? 80.034 92.958  32.403  1.00 63.15 ? 302  LYS A CB    1 
ATOM   2727 N  N     . ASN C 3 297 ? 79.158 95.730  34.719  1.00 61.61 ? 303  ASN A N     1 
ATOM   2728 C  CA    . ASN C 3 297 ? 79.565 97.095  35.036  1.00 61.02 ? 303  ASN A CA    1 
ATOM   2729 C  C     . ASN C 3 297 ? 78.880 97.586  36.313  1.00 61.15 ? 303  ASN A C     1 
ATOM   2730 O  O     . ASN C 3 297 ? 78.986 98.798  36.606  1.00 60.74 ? 303  ASN A O     1 
ATOM   2731 C  CB    . ASN C 3 297 ? 79.227 98.028  33.864  1.00 59.63 ? 303  ASN A CB    1 
ATOM   2732 N  N     . CYS C 3 307 ? 72.780 97.341  30.078  1.00 60.05 ? 313  CYS A N     1 
ATOM   2733 C  CA    . CYS C 3 307 ? 72.508 95.884  29.891  1.00 60.84 ? 313  CYS A CA    1 
ATOM   2734 C  C     . CYS C 3 307 ? 71.833 95.606  28.543  1.00 60.24 ? 313  CYS A C     1 
ATOM   2735 O  O     . CYS C 3 307 ? 70.704 96.033  28.301  1.00 60.04 ? 313  CYS A O     1 
ATOM   2736 C  CB    . CYS C 3 307 ? 71.635 95.362  31.040  1.00 61.09 ? 313  CYS A CB    1 
ATOM   2737 S  SG    . CYS C 3 307 ? 70.119 96.313  31.333  1.00 64.63 ? 313  CYS A SG    1 
ATOM   2738 N  N     . GLU C 3 308 ? 72.539 94.887  27.674  1.00 59.39 ? 314  GLU A N     1 
ATOM   2739 C  CA    . GLU C 3 308 ? 72.042 94.554  26.340  1.00 59.08 ? 314  GLU A CA    1 
ATOM   2740 C  C     . GLU C 3 308 ? 71.036 93.405  26.339  1.00 58.53 ? 314  GLU A C     1 
ATOM   2741 O  O     . GLU C 3 308 ? 71.189 92.431  27.079  1.00 58.20 ? 314  GLU A O     1 
ATOM   2742 C  CB    . GLU C 3 308 ? 73.216 94.198  25.421  1.00 58.50 ? 314  GLU A CB    1 
ATOM   2743 N  N     . LEU C 3 309 ? 70.013 93.526  25.493  1.00 58.13 ? 315  LEU A N     1 
ATOM   2744 C  CA    . LEU C 3 309 ? 68.970 92.506  25.377  1.00 57.10 ? 315  LEU A CA    1 
ATOM   2745 C  C     . LEU C 3 309 ? 69.503 91.136  24.977  1.00 56.59 ? 315  LEU A C     1 
ATOM   2746 O  O     . LEU C 3 309 ? 70.405 91.019  24.144  1.00 56.57 ? 315  LEU A O     1 
ATOM   2747 C  CB    . LEU C 3 309 ? 67.913 92.935  24.355  1.00 56.48 ? 315  LEU A CB    1 
ATOM   2748 C  CG    . LEU C 3 309 ? 66.861 93.953  24.797  1.00 57.31 ? 315  LEU A CG    1 
ATOM   2749 C  CD1   . LEU C 3 309 ? 66.016 94.372  23.600  1.00 57.27 ? 315  LEU A CD1   1 
ATOM   2750 C  CD2   . LEU C 3 309 ? 65.987 93.345  25.883  1.00 56.56 ? 315  LEU A CD2   1 
ATOM   2751 N  N     . ASP C 3 310 ? 68.937 90.097  25.579  1.00 56.12 ? 316  ASP A N     1 
ATOM   2752 C  CA    . ASP C 3 310 ? 69.334 88.732  25.270  1.00 56.60 ? 316  ASP A CA    1 
ATOM   2753 C  C     . ASP C 3 310 ? 68.619 88.331  23.979  1.00 56.20 ? 316  ASP A C     1 
ATOM   2754 O  O     . ASP C 3 310 ? 67.387 88.291  23.931  1.00 56.11 ? 316  ASP A O     1 
ATOM   2755 C  CB    . ASP C 3 310 ? 68.929 87.795  26.410  1.00 57.04 ? 316  ASP A CB    1 
ATOM   2756 C  CG    . ASP C 3 310 ? 69.463 86.389  26.227  1.00 57.40 ? 316  ASP A CG    1 
ATOM   2757 O  OD1   . ASP C 3 310 ? 69.228 85.545  27.117  1.00 58.28 ? 316  ASP A OD1   1 
ATOM   2758 O  OD2   . ASP C 3 310 ? 70.121 86.128  25.196  1.00 58.93 ? 316  ASP A OD2   1 
ATOM   2759 N  N     . THR C 3 311 ? 69.394 88.052  22.935  1.00 55.86 ? 317  THR A N     1 
ATOM   2760 C  CA    . THR C 3 311 ? 68.824 87.665  21.647  1.00 56.16 ? 317  THR A CA    1 
ATOM   2761 C  C     . THR C 3 311 ? 68.132 86.310  21.738  1.00 55.88 ? 317  THR A C     1 
ATOM   2762 O  O     . THR C 3 311 ? 67.107 86.091  21.093  1.00 56.26 ? 317  THR A O     1 
ATOM   2763 C  CB    . THR C 3 311 ? 69.906 87.587  20.545  1.00 55.51 ? 317  THR A CB    1 
ATOM   2764 N  N     . ARG C 3 312 ? 68.699 85.409  22.539  1.00 55.11 ? 318  ARG A N     1 
ATOM   2765 C  CA    . ARG C 3 312 ? 68.151 84.067  22.726  1.00 54.52 ? 318  ARG A CA    1 
ATOM   2766 C  C     . ARG C 3 312 ? 66.634 84.095  22.892  1.00 54.53 ? 318  ARG A C     1 
ATOM   2767 O  O     . ARG C 3 312 ? 66.044 85.147  23.141  1.00 54.41 ? 318  ARG A O     1 
ATOM   2768 C  CB    . ARG C 3 312 ? 68.789 83.399  23.947  1.00 54.17 ? 318  ARG A CB    1 
ATOM   2769 N  N     . GLU C 3 313 ? 66.005 82.931  22.778  1.00 54.70 ? 319  GLU A N     1 
ATOM   2770 C  CA    . GLU C 3 313 ? 64.555 82.857  22.883  1.00 54.07 ? 319  GLU A CA    1 
ATOM   2771 C  C     . GLU C 3 313 ? 64.026 82.201  24.150  1.00 52.62 ? 319  GLU A C     1 
ATOM   2772 O  O     . GLU C 3 313 ? 62.816 82.076  24.321  1.00 52.67 ? 319  GLU A O     1 
ATOM   2773 C  CB    . GLU C 3 313 ? 63.994 82.129  21.661  1.00 54.97 ? 319  GLU A CB    1 
ATOM   2774 C  CG    . GLU C 3 313 ? 64.364 80.662  21.597  1.00 57.64 ? 319  GLU A CG    1 
ATOM   2775 C  CD    . GLU C 3 313 ? 64.187 80.079  20.205  1.00 59.46 ? 319  GLU A CD    1 
ATOM   2776 O  OE1   . GLU C 3 313 ? 63.160 80.385  19.556  1.00 59.83 ? 319  GLU A OE1   1 
ATOM   2777 O  OE2   . GLU C 3 313 ? 65.071 79.308  19.766  1.00 59.48 ? 319  GLU A OE2   1 
ATOM   2778 N  N     . TYR C 3 314 ? 64.915 81.789  25.046  1.00 51.24 ? 320  TYR A N     1 
ATOM   2779 C  CA    . TYR C 3 314 ? 64.464 81.147  26.274  1.00 50.32 ? 320  TYR A CA    1 
ATOM   2780 C  C     . TYR C 3 314 ? 64.675 81.989  27.521  1.00 49.88 ? 320  TYR A C     1 
ATOM   2781 O  O     . TYR C 3 314 ? 65.488 82.913  27.542  1.00 49.58 ? 320  TYR A O     1 
ATOM   2782 C  CB    . TYR C 3 314 ? 65.145 79.788  26.433  1.00 50.10 ? 320  TYR A CB    1 
ATOM   2783 C  CG    . TYR C 3 314 ? 64.820 78.837  25.303  1.00 50.93 ? 320  TYR A CG    1 
ATOM   2784 C  CD1   . TYR C 3 314 ? 63.534 78.316  25.154  1.00 51.04 ? 320  TYR A CD1   1 
ATOM   2785 C  CD2   . TYR C 3 314 ? 65.787 78.486  24.360  1.00 50.93 ? 320  TYR A CD2   1 
ATOM   2786 C  CE1   . TYR C 3 314 ? 63.215 77.469  24.090  1.00 51.55 ? 320  TYR A CE1   1 
ATOM   2787 C  CE2   . TYR C 3 314 ? 65.480 77.641  23.293  1.00 51.45 ? 320  TYR A CE2   1 
ATOM   2788 C  CZ    . TYR C 3 314 ? 64.192 77.136  23.165  1.00 51.95 ? 320  TYR A CZ    1 
ATOM   2789 O  OH    . TYR C 3 314 ? 63.885 76.295  22.118  1.00 52.77 ? 320  TYR A OH    1 
ATOM   2790 N  N     . VAL C 3 315 ? 63.918 81.660  28.559  1.00 49.44 ? 321  VAL A N     1 
ATOM   2791 C  CA    . VAL C 3 315 ? 63.988 82.360  29.830  1.00 49.56 ? 321  VAL A CA    1 
ATOM   2792 C  C     . VAL C 3 315 ? 64.027 81.343  30.965  1.00 49.80 ? 321  VAL A C     1 
ATOM   2793 O  O     . VAL C 3 315 ? 63.099 80.543  31.130  1.00 49.69 ? 321  VAL A O     1 
ATOM   2794 C  CB    . VAL C 3 315 ? 62.767 83.288  30.017  1.00 48.88 ? 321  VAL A CB    1 
ATOM   2795 C  CG1   . VAL C 3 315 ? 62.749 83.860  31.421  1.00 48.95 ? 321  VAL A CG1   1 
ATOM   2796 C  CG2   . VAL C 3 315 ? 62.814 84.414  28.992  1.00 49.81 ? 321  VAL A CG2   1 
ATOM   2797 N  N     . ALA C 3 316 ? 65.111 81.372  31.738  1.00 49.41 ? 322  ALA A N     1 
ATOM   2798 C  CA    . ALA C 3 316 ? 65.279 80.458  32.863  1.00 47.66 ? 322  ALA A CA    1 
ATOM   2799 C  C     . ALA C 3 316 ? 64.007 80.423  33.693  1.00 47.18 ? 322  ALA A C     1 
ATOM   2800 O  O     . ALA C 3 316 ? 63.456 81.467  34.038  1.00 47.42 ? 322  ALA A O     1 
ATOM   2801 C  CB    . ALA C 3 316 ? 66.452 80.907  33.725  1.00 48.34 ? 322  ALA A CB    1 
ATOM   2802 N  N     . GLY C 3 317 ? 63.532 79.221  34.002  1.00 46.96 ? 323  GLY A N     1 
ATOM   2803 C  CA    . GLY C 3 317 ? 62.324 79.094  34.802  1.00 45.33 ? 323  GLY A CA    1 
ATOM   2804 C  C     . GLY C 3 317 ? 61.012 79.137  34.033  1.00 44.36 ? 323  GLY A C     1 
ATOM   2805 O  O     . GLY C 3 317 ? 59.989 78.668  34.534  1.00 44.78 ? 323  GLY A O     1 
ATOM   2806 N  N     . ALA C 3 318 ? 61.028 79.706  32.830  1.00 43.17 ? 324  ALA A N     1 
ATOM   2807 C  CA    . ALA C 3 318 ? 59.820 79.795  32.006  1.00 41.22 ? 324  ALA A CA    1 
ATOM   2808 C  C     . ALA C 3 318 ? 59.702 78.511  31.182  1.00 39.68 ? 324  ALA A C     1 
ATOM   2809 O  O     . ALA C 3 318 ? 60.388 78.342  30.173  1.00 40.19 ? 324  ALA A O     1 
ATOM   2810 C  CB    . ALA C 3 318 ? 59.900 81.023  31.088  1.00 40.60 ? 324  ALA A CB    1 
ATOM   2811 N  N     . PRO C 3 319 ? 58.820 77.593  31.600  1.00 38.61 ? 325  PRO A N     1 
ATOM   2812 C  CA    . PRO C 3 319 ? 58.614 76.314  30.915  1.00 39.37 ? 325  PRO A CA    1 
ATOM   2813 C  C     . PRO C 3 319 ? 57.823 76.389  29.610  1.00 40.20 ? 325  PRO A C     1 
ATOM   2814 O  O     . PRO C 3 319 ? 56.950 77.242  29.439  1.00 40.54 ? 325  PRO A O     1 
ATOM   2815 C  CB    . PRO C 3 319 ? 57.890 75.492  31.966  1.00 38.22 ? 325  PRO A CB    1 
ATOM   2816 C  CG    . PRO C 3 319 ? 56.973 76.519  32.563  1.00 37.35 ? 325  PRO A CG    1 
ATOM   2817 C  CD    . PRO C 3 319 ? 57.868 77.740  32.717  1.00 38.52 ? 325  PRO A CD    1 
ATOM   2818 N  N     . TYR C 3 320 ? 58.133 75.473  28.700  1.00 40.84 ? 326  TYR A N     1 
ATOM   2819 C  CA    . TYR C 3 320 ? 57.449 75.406  27.416  1.00 41.09 ? 326  TYR A CA    1 
ATOM   2820 C  C     . TYR C 3 320 ? 57.381 73.950  26.979  1.00 39.92 ? 326  TYR A C     1 
ATOM   2821 O  O     . TYR C 3 320 ? 58.167 73.123  27.435  1.00 39.88 ? 326  TYR A O     1 
ATOM   2822 C  CB    . TYR C 3 320 ? 58.201 76.212  26.360  1.00 41.13 ? 326  TYR A CB    1 
ATOM   2823 C  CG    . TYR C 3 320 ? 59.509 75.588  25.937  1.00 42.48 ? 326  TYR A CG    1 
ATOM   2824 C  CD1   . TYR C 3 320 ? 60.654 75.701  26.732  1.00 43.03 ? 326  TYR A CD1   1 
ATOM   2825 C  CD2   . TYR C 3 320 ? 59.602 74.875  24.742  1.00 41.63 ? 326  TYR A CD2   1 
ATOM   2826 C  CE1   . TYR C 3 320 ? 61.862 75.116  26.341  1.00 43.05 ? 326  TYR A CE1   1 
ATOM   2827 C  CE2   . TYR C 3 320 ? 60.799 74.286  24.342  1.00 42.97 ? 326  TYR A CE2   1 
ATOM   2828 C  CZ    . TYR C 3 320 ? 61.925 74.409  25.144  1.00 43.40 ? 326  TYR A CZ    1 
ATOM   2829 O  OH    . TYR C 3 320 ? 63.105 73.821  24.745  1.00 43.79 ? 326  TYR A OH    1 
ATOM   2830 N  N     . THR C 3 321 ? 56.439 73.645  26.091  1.00 38.46 ? 327  THR A N     1 
ATOM   2831 C  CA    . THR C 3 321 ? 56.270 72.291  25.588  1.00 35.77 ? 327  THR A CA    1 
ATOM   2832 C  C     . THR C 3 321 ? 56.905 72.183  24.214  1.00 35.13 ? 327  THR A C     1 
ATOM   2833 O  O     . THR C 3 321 ? 56.372 72.707  23.238  1.00 36.97 ? 327  THR A O     1 
ATOM   2834 C  CB    . THR C 3 321 ? 54.781 71.921  25.463  1.00 34.51 ? 327  THR A CB    1 
ATOM   2835 O  OG1   . THR C 3 321 ? 54.137 72.097  26.729  1.00 33.48 ? 327  THR A OG1   1 
ATOM   2836 C  CG2   . THR C 3 321 ? 54.628 70.473  25.021  1.00 33.89 ? 327  THR A CG2   1 
ATOM   2837 N  N     . PRO C 3 322 ? 58.057 71.501  24.115  1.00 34.98 ? 328  PRO A N     1 
ATOM   2838 C  CA    . PRO C 3 322 ? 58.708 71.369  22.806  1.00 34.53 ? 328  PRO A CA    1 
ATOM   2839 C  C     . PRO C 3 322 ? 57.790 70.580  21.879  1.00 33.81 ? 328  PRO A C     1 
ATOM   2840 O  O     . PRO C 3 322 ? 57.121 69.644  22.310  1.00 33.67 ? 328  PRO A O     1 
ATOM   2841 C  CB    . PRO C 3 322 ? 60.002 70.631  23.134  1.00 33.74 ? 328  PRO A CB    1 
ATOM   2842 C  CG    . PRO C 3 322 ? 59.592 69.761  24.309  1.00 34.58 ? 328  PRO A CG    1 
ATOM   2843 C  CD    . PRO C 3 322 ? 58.735 70.684  25.140  1.00 33.99 ? 328  PRO A CD    1 
ATOM   2844 N  N     . VAL C 3 323 ? 57.750 70.960  20.611  1.00 34.29 ? 329  VAL A N     1 
ATOM   2845 C  CA    . VAL C 3 323 ? 56.878 70.284  19.663  1.00 34.93 ? 329  VAL A CA    1 
ATOM   2846 C  C     . VAL C 3 323 ? 57.550 70.016  18.324  1.00 36.51 ? 329  VAL A C     1 
ATOM   2847 O  O     . VAL C 3 323 ? 58.557 70.633  17.982  1.00 37.87 ? 329  VAL A O     1 
ATOM   2848 C  CB    . VAL C 3 323 ? 55.601 71.120  19.399  1.00 33.29 ? 329  VAL A CB    1 
ATOM   2849 C  CG1   . VAL C 3 323 ? 54.769 71.229  20.662  1.00 32.92 ? 329  VAL A CG1   1 
ATOM   2850 C  CG2   . VAL C 3 323 ? 55.985 72.505  18.916  1.00 33.48 ? 329  VAL A CG2   1 
ATOM   2851 N  N     . GLU C 3 324 ? 56.983 69.084  17.569  1.00 37.65 ? 330  GLU A N     1 
ATOM   2852 C  CA    . GLU C 3 324 ? 57.504 68.757  16.252  1.00 38.59 ? 330  GLU A CA    1 
ATOM   2853 C  C     . GLU C 3 324 ? 56.408 68.998  15.229  1.00 37.16 ? 330  GLU A C     1 
ATOM   2854 O  O     . GLU C 3 324 ? 55.224 68.871  15.529  1.00 35.25 ? 330  GLU A O     1 
ATOM   2855 C  CB    . GLU C 3 324 ? 57.949 67.290  16.180  1.00 40.81 ? 330  GLU A CB    1 
ATOM   2856 C  CG    . GLU C 3 324 ? 56.886 66.296  16.624  1.00 45.21 ? 330  GLU A CG    1 
ATOM   2857 C  CD    . GLU C 3 324 ? 57.248 64.849  16.309  1.00 48.81 ? 330  GLU A CD    1 
ATOM   2858 O  OE1   . GLU C 3 324 ? 58.454 64.558  16.116  1.00 49.78 ? 330  GLU A OE1   1 
ATOM   2859 O  OE2   . GLU C 3 324 ? 56.321 64.002  16.266  1.00 49.19 ? 330  GLU A OE2   1 
ATOM   2860 N  N     . HIS C 3 325 ? 56.806 69.366  14.021  1.00 37.26 ? 331  HIS A N     1 
ATOM   2861 C  CA    . HIS C 3 325 ? 55.839 69.587  12.965  1.00 38.51 ? 331  HIS A CA    1 
ATOM   2862 C  C     . HIS C 3 325 ? 55.702 68.252  12.246  1.00 38.50 ? 331  HIS A C     1 
ATOM   2863 O  O     . HIS C 3 325 ? 56.702 67.631  11.891  1.00 38.81 ? 331  HIS A O     1 
ATOM   2864 C  CB    . HIS C 3 325 ? 56.346 70.643  11.990  1.00 40.17 ? 331  HIS A CB    1 
ATOM   2865 C  CG    . HIS C 3 325 ? 55.318 71.077  10.996  1.00 41.50 ? 331  HIS A CG    1 
ATOM   2866 N  ND1   . HIS C 3 325 ? 55.646 71.521  9.734   1.00 42.41 ? 331  HIS A ND1   1 
ATOM   2867 C  CD2   . HIS C 3 325 ? 53.970 71.159  11.087  1.00 42.59 ? 331  HIS A CD2   1 
ATOM   2868 C  CE1   . HIS C 3 325 ? 54.543 71.859  9.090   1.00 43.75 ? 331  HIS A CE1   1 
ATOM   2869 N  NE2   . HIS C 3 325 ? 53.512 71.650  9.889   1.00 42.99 ? 331  HIS A NE2   1 
ATOM   2870 N  N     . VAL C 3 326 ? 54.475 67.799  12.036  1.00 38.20 ? 332  VAL A N     1 
ATOM   2871 C  CA    . VAL C 3 326 ? 54.277 66.527  11.360  1.00 38.58 ? 332  VAL A CA    1 
ATOM   2872 C  C     . VAL C 3 326 ? 53.345 66.633  10.160  1.00 37.61 ? 332  VAL A C     1 
ATOM   2873 O  O     . VAL C 3 326 ? 52.302 67.287  10.219  1.00 37.01 ? 332  VAL A O     1 
ATOM   2874 C  CB    . VAL C 3 326 ? 53.713 65.459  12.320  1.00 39.90 ? 332  VAL A CB    1 
ATOM   2875 C  CG1   . VAL C 3 326 ? 52.425 65.950  12.943  1.00 41.21 ? 332  VAL A CG1   1 
ATOM   2876 C  CG2   . VAL C 3 326 ? 53.461 64.159  11.558  1.00 40.69 ? 332  VAL A CG2   1 
ATOM   2877 N  N     . VAL C 3 327 ? 53.732 65.981  9.071   1.00 35.71 ? 333  VAL A N     1 
ATOM   2878 C  CA    . VAL C 3 327 ? 52.926 65.992  7.865   1.00 35.60 ? 333  VAL A CA    1 
ATOM   2879 C  C     . VAL C 3 327 ? 52.126 64.699  7.762   1.00 34.63 ? 333  VAL A C     1 
ATOM   2880 O  O     . VAL C 3 327 ? 52.615 63.624  8.111   1.00 34.24 ? 333  VAL A O     1 
ATOM   2881 C  CB    . VAL C 3 327 ? 53.803 66.140  6.614   1.00 36.32 ? 333  VAL A CB    1 
ATOM   2882 C  CG1   . VAL C 3 327 ? 52.922 66.143  5.364   1.00 37.02 ? 333  VAL A CG1   1 
ATOM   2883 C  CG2   . VAL C 3 327 ? 54.619 67.427  6.708   1.00 34.62 ? 333  VAL A CG2   1 
ATOM   2884 N  N     . PHE C 3 328 ? 50.892 64.805  7.287   1.00 33.11 ? 334  PHE A N     1 
ATOM   2885 C  CA    . PHE C 3 328 ? 50.048 63.634  7.148   1.00 32.33 ? 334  PHE A CA    1 
ATOM   2886 C  C     . PHE C 3 328 ? 50.758 62.557  6.332   1.00 32.86 ? 334  PHE A C     1 
ATOM   2887 O  O     . PHE C 3 328 ? 51.212 62.807  5.212   1.00 32.32 ? 334  PHE A O     1 
ATOM   2888 C  CB    . PHE C 3 328 ? 48.739 64.000  6.458   1.00 31.83 ? 334  PHE A CB    1 
ATOM   2889 C  CG    . PHE C 3 328 ? 47.796 62.840  6.306   1.00 33.92 ? 334  PHE A CG    1 
ATOM   2890 C  CD1   . PHE C 3 328 ? 47.050 62.384  7.390   1.00 33.52 ? 334  PHE A CD1   1 
ATOM   2891 C  CD2   . PHE C 3 328 ? 47.668 62.189  5.083   1.00 33.06 ? 334  PHE A CD2   1 
ATOM   2892 C  CE1   . PHE C 3 328 ? 46.187 61.298  7.256   1.00 33.03 ? 334  PHE A CE1   1 
ATOM   2893 C  CE2   . PHE C 3 328 ? 46.812 61.107  4.940   1.00 33.84 ? 334  PHE A CE2   1 
ATOM   2894 C  CZ    . PHE C 3 328 ? 46.069 60.659  6.029   1.00 33.34 ? 334  PHE A CZ    1 
ATOM   2895 N  N     . ASN C 3 329 ? 50.866 61.365  6.908   1.00 32.53 ? 335  ASN A N     1 
ATOM   2896 C  CA    . ASN C 3 329 ? 51.495 60.240  6.225   1.00 33.27 ? 335  ASN A CA    1 
ATOM   2897 C  C     . ASN C 3 329 ? 50.404 59.195  5.985   1.00 33.04 ? 335  ASN A C     1 
ATOM   2898 O  O     . ASN C 3 329 ? 49.872 58.607  6.924   1.00 32.59 ? 335  ASN A O     1 
ATOM   2899 C  CB    . ASN C 3 329 ? 52.629 59.654  7.074   1.00 33.26 ? 335  ASN A CB    1 
ATOM   2900 C  CG    . ASN C 3 329 ? 53.263 58.413  6.438   1.00 34.66 ? 335  ASN A CG    1 
ATOM   2901 O  OD1   . ASN C 3 329 ? 52.942 58.052  5.308   1.00 35.80 ? 335  ASN A OD1   1 
ATOM   2902 N  ND2   . ASN C 3 329 ? 54.167 57.762  7.168   1.00 32.04 ? 335  ASN A ND2   1 
ATOM   2903 N  N     . PRO C 3 330 ? 50.045 58.966  4.718   1.00 32.71 ? 336  PRO A N     1 
ATOM   2904 C  CA    . PRO C 3 330 ? 49.004 57.982  4.411   1.00 33.51 ? 336  PRO A CA    1 
ATOM   2905 C  C     . PRO C 3 330 ? 49.327 56.552  4.865   1.00 32.43 ? 336  PRO A C     1 
ATOM   2906 O  O     . PRO C 3 330 ? 48.437 55.712  4.914   1.00 33.18 ? 336  PRO A O     1 
ATOM   2907 C  CB    . PRO C 3 330 ? 48.857 58.092  2.895   1.00 32.94 ? 336  PRO A CB    1 
ATOM   2908 C  CG    . PRO C 3 330 ? 49.263 59.506  2.613   1.00 33.97 ? 336  PRO A CG    1 
ATOM   2909 C  CD    . PRO C 3 330 ? 50.467 59.683  3.506   1.00 33.48 ? 336  PRO A CD    1 
ATOM   2910 N  N     . SER C 3 331 ? 50.590 56.277  5.184   1.00 31.17 ? 337  SER A N     1 
ATOM   2911 C  CA    . SER C 3 331 ? 50.987 54.939  5.648   1.00 31.98 ? 337  SER A CA    1 
ATOM   2912 C  C     . SER C 3 331 ? 50.814 54.779  7.164   1.00 32.84 ? 337  SER A C     1 
ATOM   2913 O  O     . SER C 3 331 ? 50.936 53.673  7.693   1.00 31.71 ? 337  SER A O     1 
ATOM   2914 C  CB    . SER C 3 331 ? 52.451 54.640  5.289   1.00 29.46 ? 337  SER A CB    1 
ATOM   2915 O  OG    . SER C 3 331 ? 52.624 54.462  3.891   1.00 30.07 ? 337  SER A OG    1 
ATOM   2916 N  N     . SER C 3 332 ? 50.548 55.883  7.860   1.00 32.83 ? 338  SER A N     1 
ATOM   2917 C  CA    . SER C 3 332 ? 50.365 55.834  9.304   1.00 33.21 ? 338  SER A CA    1 
ATOM   2918 C  C     . SER C 3 332 ? 48.918 55.580  9.681   1.00 34.45 ? 338  SER A C     1 
ATOM   2919 O  O     . SER C 3 332 ? 48.022 56.346  9.319   1.00 34.19 ? 338  SER A O     1 
ATOM   2920 C  CB    . SER C 3 332 ? 50.826 57.142  9.954   1.00 34.75 ? 338  SER A CB    1 
ATOM   2921 O  OG    . SER C 3 332 ? 50.495 57.168  11.335  1.00 33.17 ? 338  SER A OG    1 
ATOM   2922 N  N     . ARG C 3 333 ? 48.699 54.496  10.416  1.00 36.51 ? 339  ARG A N     1 
ATOM   2923 C  CA    . ARG C 3 333 ? 47.365 54.128  10.876  1.00 37.24 ? 339  ARG A CA    1 
ATOM   2924 C  C     . ARG C 3 333 ? 46.937 55.162  11.921  1.00 36.99 ? 339  ARG A C     1 
ATOM   2925 O  O     . ARG C 3 333 ? 45.758 55.493  12.030  1.00 36.05 ? 339  ARG A O     1 
ATOM   2926 C  CB    . ARG C 3 333 ? 47.392 52.735  11.511  1.00 37.99 ? 339  ARG A CB    1 
ATOM   2927 C  CG    . ARG C 3 333 ? 48.017 51.642  10.634  1.00 41.60 ? 339  ARG A CG    1 
ATOM   2928 C  CD    . ARG C 3 333 ? 47.043 51.092  9.596   1.00 41.72 ? 339  ARG A CD    1 
ATOM   2929 N  NE    . ARG C 3 333 ? 47.695 50.122  8.723   1.00 42.94 ? 339  ARG A NE    1 
ATOM   2930 C  CZ    . ARG C 3 333 ? 47.116 49.545  7.676   1.00 43.91 ? 339  ARG A CZ    1 
ATOM   2931 N  NH1   . ARG C 3 333 ? 45.857 49.827  7.368   1.00 44.17 ? 339  ARG A NH1   1 
ATOM   2932 N  NH2   . ARG C 3 333 ? 47.808 48.712  6.911   1.00 43.61 ? 339  ARG A NH2   1 
ATOM   2933 N  N     . ASP C 3 334 ? 47.909 55.656  12.689  1.00 37.73 ? 340  ASP A N     1 
ATOM   2934 C  CA    . ASP C 3 334 ? 47.662 56.662  13.722  1.00 38.18 ? 340  ASP A CA    1 
ATOM   2935 C  C     . ASP C 3 334 ? 47.152 57.972  13.091  1.00 37.08 ? 340  ASP A C     1 
ATOM   2936 O  O     . ASP C 3 334 ? 46.153 58.530  13.540  1.00 34.97 ? 340  ASP A O     1 
ATOM   2937 C  CB    . ASP C 3 334 ? 48.951 56.912  14.521  1.00 41.59 ? 340  ASP A CB    1 
ATOM   2938 C  CG    . ASP C 3 334 ? 48.805 58.031  15.563  1.00 46.71 ? 340  ASP A CG    1 
ATOM   2939 O  OD1   . ASP C 3 334 ? 47.888 57.954  16.415  1.00 46.15 ? 340  ASP A OD1   1 
ATOM   2940 O  OD2   . ASP C 3 334 ? 49.618 58.986  15.531  1.00 47.73 ? 340  ASP A OD2   1 
ATOM   2941 N  N     . HIS C 3 335 ? 47.822 58.447  12.040  1.00 35.33 ? 341  HIS A N     1 
ATOM   2942 C  CA    . HIS C 3 335 ? 47.397 59.679  11.376  1.00 33.52 ? 341  HIS A CA    1 
ATOM   2943 C  C     . HIS C 3 335 ? 45.992 59.522  10.816  1.00 34.62 ? 341  HIS A C     1 
ATOM   2944 O  O     . HIS C 3 335 ? 45.149 60.416  10.944  1.00 35.40 ? 341  HIS A O     1 
ATOM   2945 C  CB    . HIS C 3 335 ? 48.340 60.039  10.230  1.00 30.82 ? 341  HIS A CB    1 
ATOM   2946 C  CG    . HIS C 3 335 ? 49.704 60.457  10.674  1.00 28.15 ? 341  HIS A CG    1 
ATOM   2947 N  ND1   . HIS C 3 335 ? 50.645 60.957  9.800   1.00 25.80 ? 341  HIS A ND1   1 
ATOM   2948 C  CD2   . HIS C 3 335 ? 50.285 60.462  11.897  1.00 27.44 ? 341  HIS A CD2   1 
ATOM   2949 C  CE1   . HIS C 3 335 ? 51.747 61.255  10.467  1.00 25.63 ? 341  HIS A CE1   1 
ATOM   2950 N  NE2   . HIS C 3 335 ? 51.555 60.964  11.741  1.00 25.81 ? 341  HIS A NE2   1 
ATOM   2951 N  N     . ILE C 3 336 ? 45.744 58.378  10.189  1.00 34.45 ? 342  ILE A N     1 
ATOM   2952 C  CA    . ILE C 3 336 ? 44.443 58.113  9.602   1.00 34.66 ? 342  ILE A CA    1 
ATOM   2953 C  C     . ILE C 3 336 ? 43.357 58.144  10.679  1.00 35.27 ? 342  ILE A C     1 
ATOM   2954 O  O     . ILE C 3 336 ? 42.303 58.750  10.495  1.00 34.87 ? 342  ILE A O     1 
ATOM   2955 C  CB    . ILE C 3 336 ? 44.445 56.753  8.880   1.00 33.12 ? 342  ILE A CB    1 
ATOM   2956 C  CG1   . ILE C 3 336 ? 45.479 56.783  7.744   1.00 33.07 ? 342  ILE A CG1   1 
ATOM   2957 C  CG2   . ILE C 3 336 ? 43.056 56.453  8.315   1.00 32.42 ? 342  ILE A CG2   1 
ATOM   2958 C  CD1   . ILE C 3 336 ? 45.847 55.406  7.193   1.00 28.40 ? 342  ILE A CD1   1 
ATOM   2959 N  N     . GLN C 3 337 ? 43.626 57.490  11.801  1.00 36.46 ? 343  GLN A N     1 
ATOM   2960 C  CA    . GLN C 3 337 ? 42.690 57.448  12.919  1.00 38.05 ? 343  GLN A CA    1 
ATOM   2961 C  C     . GLN C 3 337 ? 42.470 58.873  13.444  1.00 38.82 ? 343  GLN A C     1 
ATOM   2962 O  O     . GLN C 3 337 ? 41.346 59.294  13.715  1.00 38.00 ? 343  GLN A O     1 
ATOM   2963 C  CB    . GLN C 3 337 ? 43.271 56.546  14.011  1.00 39.84 ? 343  GLN A CB    1 
ATOM   2964 C  CG    . GLN C 3 337 ? 42.647 56.679  15.390  1.00 45.51 ? 343  GLN A CG    1 
ATOM   2965 C  CD    . GLN C 3 337 ? 43.102 57.913  16.136  1.00 46.53 ? 343  GLN A CD    1 
ATOM   2966 O  OE1   . GLN C 3 337 ? 42.420 58.938  16.137  1.00 49.55 ? 343  GLN A OE1   1 
ATOM   2967 N  NE2   . GLN C 3 337 ? 44.271 57.827  16.767  1.00 47.01 ? 343  GLN A NE2   1 
ATOM   2968 N  N     . LYS C 3 338 ? 43.564 59.612  13.571  1.00 39.91 ? 344  LYS A N     1 
ATOM   2969 C  CA    . LYS C 3 338 ? 43.520 60.978  14.059  1.00 41.87 ? 344  LYS A CA    1 
ATOM   2970 C  C     . LYS C 3 338 ? 42.703 61.892  13.154  1.00 42.47 ? 344  LYS A C     1 
ATOM   2971 O  O     . LYS C 3 338 ? 41.818 62.615  13.617  1.00 42.91 ? 344  LYS A O     1 
ATOM   2972 C  CB    . LYS C 3 338 ? 44.947 61.519  14.193  1.00 43.19 ? 344  LYS A CB    1 
ATOM   2973 C  CG    . LYS C 3 338 ? 45.031 62.952  14.677  1.00 45.35 ? 344  LYS A CG    1 
ATOM   2974 C  CD    . LYS C 3 338 ? 46.474 63.371  14.912  1.00 46.70 ? 344  LYS A CD    1 
ATOM   2975 C  CE    . LYS C 3 338 ? 46.543 64.760  15.529  1.00 47.81 ? 344  LYS A CE    1 
ATOM   2976 N  NZ    . LYS C 3 338 ? 45.810 64.796  16.832  1.00 48.94 ? 344  LYS A NZ    1 
ATOM   2977 N  N     . LYS C 3 339 ? 42.993 61.857  11.860  1.00 42.84 ? 345  LYS A N     1 
ATOM   2978 C  CA    . LYS C 3 339 ? 42.286 62.716  10.919  1.00 42.42 ? 345  LYS A CA    1 
ATOM   2979 C  C     . LYS C 3 339 ? 40.832 62.328  10.693  1.00 41.70 ? 345  LYS A C     1 
ATOM   2980 O  O     . LYS C 3 339 ? 39.978 63.199  10.531  1.00 43.25 ? 345  LYS A O     1 
ATOM   2981 C  CB    . LYS C 3 339 ? 43.030 62.753  9.580   1.00 42.67 ? 345  LYS A CB    1 
ATOM   2982 C  CG    . LYS C 3 339 ? 44.345 63.527  9.613   1.00 42.61 ? 345  LYS A CG    1 
ATOM   2983 C  CD    . LYS C 3 339 ? 44.098 65.013  9.850   1.00 43.13 ? 345  LYS A CD    1 
ATOM   2984 C  CE    . LYS C 3 339 ? 45.367 65.839  9.656   1.00 44.41 ? 345  LYS A CE    1 
ATOM   2985 N  NZ    . LYS C 3 339 ? 45.146 67.317  9.833   1.00 44.05 ? 345  LYS A NZ    1 
ATOM   2986 N  N     . LEU C 3 340 ? 40.534 61.035  10.697  1.00 41.20 ? 346  LEU A N     1 
ATOM   2987 C  CA    . LEU C 3 340 ? 39.162 60.609  10.463  1.00 41.16 ? 346  LEU A CA    1 
ATOM   2988 C  C     . LEU C 3 340 ? 38.210 60.871  11.624  1.00 41.35 ? 346  LEU A C     1 
ATOM   2989 O  O     . LEU C 3 340 ? 37.052 61.223  11.398  1.00 41.51 ? 346  LEU A O     1 
ATOM   2990 C  CB    . LEU C 3 340 ? 39.113 59.132  10.054  1.00 39.65 ? 346  LEU A CB    1 
ATOM   2991 C  CG    . LEU C 3 340 ? 39.733 58.859  8.678   1.00 39.26 ? 346  LEU A CG    1 
ATOM   2992 C  CD1   . LEU C 3 340 ? 39.506 57.410  8.270   1.00 36.09 ? 346  LEU A CD1   1 
ATOM   2993 C  CD2   . LEU C 3 340 ? 39.112 59.796  7.652   1.00 36.52 ? 346  LEU A CD2   1 
ATOM   2994 N  N     . GLN C 3 341 ? 38.670 60.696  12.859  1.00 42.01 ? 347  GLN A N     1 
ATOM   2995 C  CA    . GLN C 3 341 ? 37.784 60.960  13.987  1.00 42.80 ? 347  GLN A CA    1 
ATOM   2996 C  C     . GLN C 3 341 ? 37.506 62.462  14.034  1.00 43.06 ? 347  GLN A C     1 
ATOM   2997 O  O     . GLN C 3 341 ? 36.382 62.878  14.308  1.00 43.58 ? 347  GLN A O     1 
ATOM   2998 C  CB    . GLN C 3 341 ? 38.397 60.480  15.310  1.00 42.38 ? 347  GLN A CB    1 
ATOM   2999 C  CG    . GLN C 3 341 ? 38.552 58.965  15.405  1.00 44.11 ? 347  GLN A CG    1 
ATOM   3000 C  CD    . GLN C 3 341 ? 38.815 58.473  16.825  1.00 44.61 ? 347  GLN A CD    1 
ATOM   3001 O  OE1   . GLN C 3 341 ? 37.889 58.297  17.617  1.00 44.93 ? 347  GLN A OE1   1 
ATOM   3002 N  NE2   . GLN C 3 341 ? 40.082 58.255  17.149  1.00 44.83 ? 347  GLN A NE2   1 
ATOM   3003 N  N     . GLU C 3 342 ? 38.523 63.274  13.747  1.00 42.90 ? 348  GLU A N     1 
ATOM   3004 C  CA    . GLU C 3 342 ? 38.343 64.722  13.743  1.00 43.12 ? 348  GLU A CA    1 
ATOM   3005 C  C     . GLU C 3 342 ? 37.338 65.100  12.659  1.00 43.39 ? 348  GLU A C     1 
ATOM   3006 O  O     . GLU C 3 342 ? 36.895 66.245  12.585  1.00 45.04 ? 348  GLU A O     1 
ATOM   3007 C  CB    . GLU C 3 342 ? 39.664 65.442  13.478  1.00 41.89 ? 348  GLU A CB    1 
ATOM   3008 C  CG    . GLU C 3 342 ? 40.721 65.188  14.527  1.00 45.01 ? 348  GLU A CG    1 
ATOM   3009 C  CD    . GLU C 3 342 ? 42.008 65.941  14.252  1.00 46.93 ? 348  GLU A CD    1 
ATOM   3010 O  OE1   . GLU C 3 342 ? 42.256 66.303  13.081  1.00 48.04 ? 348  GLU A OE1   1 
ATOM   3011 O  OE2   . GLU C 3 342 ? 42.785 66.159  15.206  1.00 49.41 ? 348  GLU A OE2   1 
ATOM   3012 N  N     . ALA C 3 343 ? 36.985 64.135  11.817  1.00 42.93 ? 349  ALA A N     1 
ATOM   3013 C  CA    . ALA C 3 343 ? 36.018 64.369  10.750  1.00 43.91 ? 349  ALA A CA    1 
ATOM   3014 C  C     . ALA C 3 343 ? 34.654 63.835  11.179  1.00 44.10 ? 349  ALA A C     1 
ATOM   3015 O  O     . ALA C 3 343 ? 33.679 63.928  10.434  1.00 43.82 ? 349  ALA A O     1 
ATOM   3016 C  CB    . ALA C 3 343 ? 36.472 63.690  9.457   1.00 44.50 ? 349  ALA A CB    1 
ATOM   3017 N  N     . GLY C 3 344 ? 34.593 63.271  12.383  1.00 45.14 ? 350  GLY A N     1 
ATOM   3018 C  CA    . GLY C 3 344 ? 33.334 62.752  12.892  1.00 46.51 ? 350  GLY A CA    1 
ATOM   3019 C  C     . GLY C 3 344 ? 33.206 61.240  12.951  1.00 47.34 ? 350  GLY A C     1 
ATOM   3020 O  O     . GLY C 3 344 ? 32.118 60.718  13.205  1.00 47.91 ? 350  GLY A O     1 
ATOM   3021 N  N     . TRP C 3 345 ? 34.308 60.533  12.723  1.00 47.40 ? 351  TRP A N     1 
ATOM   3022 C  CA    . TRP C 3 345 ? 34.289 59.077  12.756  1.00 47.61 ? 351  TRP A CA    1 
ATOM   3023 C  C     . TRP C 3 345 ? 34.339 58.533  14.178  1.00 47.66 ? 351  TRP A C     1 
ATOM   3024 O  O     . TRP C 3 345 ? 35.142 58.969  14.998  1.00 48.88 ? 351  TRP A O     1 
ATOM   3025 C  CB    . TRP C 3 345 ? 35.465 58.513  11.950  1.00 47.48 ? 351  TRP A CB    1 
ATOM   3026 C  CG    . TRP C 3 345 ? 35.562 57.012  12.003  1.00 48.33 ? 351  TRP A CG    1 
ATOM   3027 C  CD1   . TRP C 3 345 ? 34.563 56.115  11.740  1.00 47.16 ? 351  TRP A CD1   1 
ATOM   3028 C  CD2   . TRP C 3 345 ? 36.722 56.235  12.328  1.00 49.01 ? 351  TRP A CD2   1 
ATOM   3029 N  NE1   . TRP C 3 345 ? 35.029 54.830  11.881  1.00 47.70 ? 351  TRP A NE1   1 
ATOM   3030 C  CE2   . TRP C 3 345 ? 36.350 54.872  12.241  1.00 48.62 ? 351  TRP A CE2   1 
ATOM   3031 C  CE3   . TRP C 3 345 ? 38.042 56.557  12.682  1.00 49.35 ? 351  TRP A CE3   1 
ATOM   3032 C  CZ2   . TRP C 3 345 ? 37.251 53.829  12.498  1.00 49.01 ? 351  TRP A CZ2   1 
ATOM   3033 C  CZ3   . TRP C 3 345 ? 38.939 55.517  12.938  1.00 50.80 ? 351  TRP A CZ3   1 
ATOM   3034 C  CH2   . TRP C 3 345 ? 38.535 54.170  12.844  1.00 49.26 ? 351  TRP A CH2   1 
ATOM   3035 N  N     . VAL C 3 346 ? 33.474 57.574  14.470  1.00 47.91 ? 352  VAL A N     1 
ATOM   3036 C  CA    . VAL C 3 346 ? 33.447 56.981  15.795  1.00 48.91 ? 352  VAL A CA    1 
ATOM   3037 C  C     . VAL C 3 346 ? 33.866 55.512  15.717  1.00 49.36 ? 352  VAL A C     1 
ATOM   3038 O  O     . VAL C 3 346 ? 33.088 54.659  15.291  1.00 48.62 ? 352  VAL A O     1 
ATOM   3039 C  CB    . VAL C 3 346 ? 32.035 57.086  16.417  1.00 49.22 ? 352  VAL A CB    1 
ATOM   3040 C  CG1   . VAL C 3 346 ? 32.033 56.492  17.821  1.00 47.64 ? 352  VAL A CG1   1 
ATOM   3041 C  CG2   . VAL C 3 346 ? 31.596 58.548  16.455  1.00 49.18 ? 352  VAL A CG2   1 
ATOM   3042 N  N     . PRO C 3 347 ? 35.109 55.204  16.124  1.00 50.03 ? 353  PRO A N     1 
ATOM   3043 C  CA    . PRO C 3 347 ? 35.629 53.832  16.096  1.00 51.20 ? 353  PRO A CA    1 
ATOM   3044 C  C     . PRO C 3 347 ? 34.709 52.835  16.794  1.00 52.79 ? 353  PRO A C     1 
ATOM   3045 O  O     . PRO C 3 347 ? 34.348 53.008  17.962  1.00 53.43 ? 353  PRO A O     1 
ATOM   3046 C  CB    . PRO C 3 347 ? 36.982 53.967  16.786  1.00 49.85 ? 353  PRO A CB    1 
ATOM   3047 C  CG    . PRO C 3 347 ? 37.419 55.334  16.355  1.00 49.20 ? 353  PRO A CG    1 
ATOM   3048 C  CD    . PRO C 3 347 ? 36.155 56.146  16.559  1.00 49.99 ? 353  PRO A CD    1 
ATOM   3049 N  N     . THR C 3 348 ? 34.335 51.787  16.068  1.00 54.70 ? 354  THR A N     1 
ATOM   3050 C  CA    . THR C 3 348 ? 33.443 50.766  16.599  1.00 55.78 ? 354  THR A CA    1 
ATOM   3051 C  C     . THR C 3 348 ? 34.210 49.553  17.109  1.00 55.72 ? 354  THR A C     1 
ATOM   3052 O  O     . THR C 3 348 ? 33.657 48.719  17.829  1.00 55.59 ? 354  THR A O     1 
ATOM   3053 C  CB    . THR C 3 348 ? 32.449 50.303  15.519  1.00 56.32 ? 354  THR A CB    1 
ATOM   3054 O  OG1   . THR C 3 348 ? 31.894 51.451  14.863  1.00 57.15 ? 354  THR A OG1   1 
ATOM   3055 C  CG2   . THR C 3 348 ? 31.320 49.493  16.143  1.00 56.97 ? 354  THR A CG2   1 
ATOM   3056 N  N     . LYS C 3 349 ? 35.483 49.455  16.735  1.00 55.70 ? 355  LYS A N     1 
ATOM   3057 C  CA    . LYS C 3 349 ? 36.314 48.330  17.160  1.00 55.71 ? 355  LYS A CA    1 
ATOM   3058 C  C     . LYS C 3 349 ? 37.779 48.723  17.315  1.00 55.52 ? 355  LYS A C     1 
ATOM   3059 O  O     . LYS C 3 349 ? 38.398 49.253  16.390  1.00 55.94 ? 355  LYS A O     1 
ATOM   3060 C  CB    . LYS C 3 349 ? 36.173 47.169  16.169  1.00 55.11 ? 355  LYS A CB    1 
ATOM   3061 C  CG    . LYS C 3 349 ? 36.352 47.565  14.716  1.00 56.13 ? 355  LYS A CG    1 
ATOM   3062 C  CD    . LYS C 3 349 ? 35.866 46.470  13.769  1.00 56.81 ? 355  LYS A CD    1 
ATOM   3063 C  CE    . LYS C 3 349 ? 36.687 45.192  13.901  1.00 56.91 ? 355  LYS A CE    1 
ATOM   3064 N  NZ    . LYS C 3 349 ? 36.215 44.132  12.958  1.00 55.78 ? 355  LYS A NZ    1 
ATOM   3065 N  N     . TYR C 3 350 ? 38.322 48.459  18.498  1.00 54.99 ? 356  TYR A N     1 
ATOM   3066 C  CA    . TYR C 3 350 ? 39.706 48.792  18.809  1.00 56.01 ? 356  TYR A CA    1 
ATOM   3067 C  C     . TYR C 3 350 ? 40.567 47.533  18.898  1.00 56.68 ? 356  TYR A C     1 
ATOM   3068 O  O     . TYR C 3 350 ? 40.069 46.415  18.771  1.00 56.94 ? 356  TYR A O     1 
ATOM   3069 C  CB    . TYR C 3 350 ? 39.777 49.554  20.144  1.00 54.89 ? 356  TYR A CB    1 
ATOM   3070 C  CG    . TYR C 3 350 ? 39.000 50.861  20.172  1.00 54.18 ? 356  TYR A CG    1 
ATOM   3071 C  CD1   . TYR C 3 350 ? 37.619 50.881  19.981  1.00 53.95 ? 356  TYR A CD1   1 
ATOM   3072 C  CD2   . TYR C 3 350 ? 39.650 52.078  20.384  1.00 53.80 ? 356  TYR A CD2   1 
ATOM   3073 C  CE1   . TYR C 3 350 ? 36.903 52.080  19.998  1.00 54.67 ? 356  TYR A CE1   1 
ATOM   3074 C  CE2   . TYR C 3 350 ? 38.945 53.283  20.404  1.00 54.46 ? 356  TYR A CE2   1 
ATOM   3075 C  CZ    . TYR C 3 350 ? 37.571 53.276  20.209  1.00 54.65 ? 356  TYR A CZ    1 
ATOM   3076 O  OH    . TYR C 3 350 ? 36.865 54.460  20.219  1.00 54.73 ? 356  TYR A OH    1 
ATOM   3077 N  N     . THR C 3 351 ? 41.865 47.727  19.107  1.00 57.29 ? 357  THR A N     1 
ATOM   3078 C  CA    . THR C 3 351 ? 42.796 46.614  19.243  1.00 57.67 ? 357  THR A CA    1 
ATOM   3079 C  C     . THR C 3 351 ? 43.030 46.444  20.737  1.00 58.85 ? 357  THR A C     1 
ATOM   3080 O  O     . THR C 3 351 ? 42.675 47.325  21.521  1.00 58.96 ? 357  THR A O     1 
ATOM   3081 C  CB    . THR C 3 351 ? 44.142 46.924  18.579  1.00 56.67 ? 357  THR A CB    1 
ATOM   3082 O  OG1   . THR C 3 351 ? 44.728 48.067  19.214  1.00 55.86 ? 357  THR A OG1   1 
ATOM   3083 C  CG2   . THR C 3 351 ? 43.953 47.213  17.093  1.00 56.34 ? 357  THR A CG2   1 
ATOM   3084 N  N     . ASP C 3 352 ? 43.625 45.324  21.134  1.00 59.63 ? 358  ASP A N     1 
ATOM   3085 C  CA    . ASP C 3 352 ? 43.892 45.077  22.548  1.00 60.46 ? 358  ASP A CA    1 
ATOM   3086 C  C     . ASP C 3 352 ? 45.116 45.877  22.985  1.00 59.99 ? 358  ASP A C     1 
ATOM   3087 O  O     . ASP C 3 352 ? 46.093 45.327  23.495  1.00 61.06 ? 358  ASP A O     1 
ATOM   3088 C  CB    . ASP C 3 352 ? 44.122 43.583  22.792  1.00 61.58 ? 358  ASP A CB    1 
ATOM   3089 C  CG    . ASP C 3 352 ? 43.018 42.720  22.203  1.00 63.00 ? 358  ASP A CG    1 
ATOM   3090 O  OD1   . ASP C 3 352 ? 41.827 42.995  22.485  1.00 63.30 ? 358  ASP A OD1   1 
ATOM   3091 O  OD2   . ASP C 3 352 ? 43.343 41.768  21.458  1.00 62.51 ? 358  ASP A OD2   1 
ATOM   3092 N  N     . LYS C 3 353 ? 45.051 47.185  22.770  1.00 59.01 ? 359  LYS A N     1 
ATOM   3093 C  CA    . LYS C 3 353 ? 46.137 48.086  23.123  1.00 58.19 ? 359  LYS A CA    1 
ATOM   3094 C  C     . LYS C 3 353 ? 45.579 49.507  23.113  1.00 57.33 ? 359  LYS A C     1 
ATOM   3095 O  O     . LYS C 3 353 ? 46.300 50.478  23.351  1.00 56.81 ? 359  LYS A O     1 
ATOM   3096 C  CB    . LYS C 3 353 ? 47.281 47.951  22.113  1.00 58.25 ? 359  LYS A CB    1 
ATOM   3097 C  CG    . LYS C 3 353 ? 48.530 48.736  22.472  1.00 58.96 ? 359  LYS A CG    1 
ATOM   3098 N  N     . GLY C 3 354 ? 44.281 49.612  22.838  1.00 57.03 ? 360  GLY A N     1 
ATOM   3099 C  CA    . GLY C 3 354 ? 43.624 50.905  22.811  1.00 56.85 ? 360  GLY A CA    1 
ATOM   3100 C  C     . GLY C 3 354 ? 43.449 51.482  21.419  1.00 56.27 ? 360  GLY A C     1 
ATOM   3101 O  O     . GLY C 3 354 ? 42.412 52.073  21.107  1.00 56.30 ? 360  GLY A O     1 
ATOM   3102 N  N     . ALA C 3 355 ? 44.464 51.318  20.578  1.00 54.73 ? 361  ALA A N     1 
ATOM   3103 C  CA    . ALA C 3 355 ? 44.404 51.834  19.218  1.00 53.32 ? 361  ALA A CA    1 
ATOM   3104 C  C     . ALA C 3 355 ? 43.181 51.310  18.478  1.00 51.61 ? 361  ALA A C     1 
ATOM   3105 O  O     . ALA C 3 355 ? 42.847 50.126  18.562  1.00 51.35 ? 361  ALA A O     1 
ATOM   3106 C  CB    . ALA C 3 355 ? 45.680 51.453  18.448  1.00 53.45 ? 361  ALA A CB    1 
ATOM   3107 N  N     . PRO C 3 356 ? 42.479 52.198  17.761  1.00 50.26 ? 362  PRO A N     1 
ATOM   3108 C  CA    . PRO C 3 356 ? 41.295 51.784  17.007  1.00 49.06 ? 362  PRO A CA    1 
ATOM   3109 C  C     . PRO C 3 356 ? 41.745 51.060  15.742  1.00 48.30 ? 362  PRO A C     1 
ATOM   3110 O  O     . PRO C 3 356 ? 42.769 51.412  15.150  1.00 47.67 ? 362  PRO A O     1 
ATOM   3111 C  CB    . PRO C 3 356 ? 40.608 53.107  16.696  1.00 49.06 ? 362  PRO A CB    1 
ATOM   3112 C  CG    . PRO C 3 356 ? 41.755 54.042  16.559  1.00 49.14 ? 362  PRO A CG    1 
ATOM   3113 C  CD    . PRO C 3 356 ? 42.637 53.663  17.722  1.00 50.10 ? 362  PRO A CD    1 
ATOM   3114 N  N     . VAL C 3 357 ? 40.987 50.046  15.339  1.00 46.44 ? 363  VAL A N     1 
ATOM   3115 C  CA    . VAL C 3 357 ? 41.317 49.289  14.148  1.00 45.60 ? 363  VAL A CA    1 
ATOM   3116 C  C     . VAL C 3 357 ? 41.159 50.145  12.898  1.00 45.24 ? 363  VAL A C     1 
ATOM   3117 O  O     . VAL C 3 357 ? 40.120 50.768  12.681  1.00 45.04 ? 363  VAL A O     1 
ATOM   3118 C  CB    . VAL C 3 357 ? 40.425 48.030  14.017  1.00 46.03 ? 363  VAL A CB    1 
ATOM   3119 C  CG1   . VAL C 3 357 ? 40.597 47.401  12.639  1.00 45.91 ? 363  VAL A CG1   1 
ATOM   3120 C  CG2   . VAL C 3 357 ? 40.802 47.020  15.086  1.00 45.75 ? 363  VAL A CG2   1 
ATOM   3121 N  N     . VAL C 3 358 ? 42.205 50.166  12.080  1.00 45.47 ? 364  VAL A N     1 
ATOM   3122 C  CA    . VAL C 3 358 ? 42.209 50.927  10.839  1.00 45.38 ? 364  VAL A CA    1 
ATOM   3123 C  C     . VAL C 3 358 ? 42.686 50.041  9.692   1.00 45.13 ? 364  VAL A C     1 
ATOM   3124 O  O     . VAL C 3 358 ? 43.777 50.233  9.162   1.00 45.08 ? 364  VAL A O     1 
ATOM   3125 C  CB    . VAL C 3 358 ? 43.147 52.159  10.941  1.00 45.90 ? 364  VAL A CB    1 
ATOM   3126 C  CG1   . VAL C 3 358 ? 43.109 52.951  9.645   1.00 46.84 ? 364  VAL A CG1   1 
ATOM   3127 C  CG2   . VAL C 3 358 ? 42.727 53.047  12.116  1.00 46.77 ? 364  VAL A CG2   1 
ATOM   3128 N  N     . ASP C 3 359 ? 41.882 49.050  9.326   1.00 45.24 ? 365  ASP A N     1 
ATOM   3129 C  CA    . ASP C 3 359 ? 42.251 48.177  8.222   1.00 45.31 ? 365  ASP A CA    1 
ATOM   3130 C  C     . ASP C 3 359 ? 41.329 48.476  7.047   1.00 45.35 ? 365  ASP A C     1 
ATOM   3131 O  O     . ASP C 3 359 ? 40.395 49.268  7.175   1.00 44.91 ? 365  ASP A O     1 
ATOM   3132 C  CB    . ASP C 3 359 ? 42.187 46.694  8.622   1.00 45.14 ? 365  ASP A CB    1 
ATOM   3133 C  CG    . ASP C 3 359 ? 40.838 46.281  9.174   1.00 46.90 ? 365  ASP A CG    1 
ATOM   3134 O  OD1   . ASP C 3 359 ? 39.795 46.754  8.670   1.00 47.75 ? 365  ASP A OD1   1 
ATOM   3135 O  OD2   . ASP C 3 359 ? 40.823 45.453  10.110  1.00 48.86 ? 365  ASP A OD2   1 
ATOM   3136 N  N     . ASP C 3 360 ? 41.588 47.851  5.905   1.00 45.72 ? 366  ASP A N     1 
ATOM   3137 C  CA    . ASP C 3 360 ? 40.791 48.108  4.713   1.00 47.06 ? 366  ASP A CA    1 
ATOM   3138 C  C     . ASP C 3 360 ? 39.290 47.901  4.902   1.00 47.01 ? 366  ASP A C     1 
ATOM   3139 O  O     . ASP C 3 360 ? 38.483 48.660  4.357   1.00 46.26 ? 366  ASP A O     1 
ATOM   3140 C  CB    . ASP C 3 360 ? 41.291 47.250  3.545   1.00 47.55 ? 366  ASP A CB    1 
ATOM   3141 C  CG    . ASP C 3 360 ? 40.837 47.788  2.190   1.00 49.17 ? 366  ASP A CG    1 
ATOM   3142 O  OD1   . ASP C 3 360 ? 41.310 48.875  1.792   1.00 47.63 ? 366  ASP A OD1   1 
ATOM   3143 O  OD2   . ASP C 3 360 ? 40.003 47.131  1.526   1.00 50.20 ? 366  ASP A OD2   1 
ATOM   3144 N  N     . GLU C 3 361 ? 38.917 46.888  5.679   1.00 47.72 ? 367  GLU A N     1 
ATOM   3145 C  CA    . GLU C 3 361 ? 37.507 46.597  5.909   1.00 48.62 ? 367  GLU A CA    1 
ATOM   3146 C  C     . GLU C 3 361 ? 36.778 47.699  6.679   1.00 48.29 ? 367  GLU A C     1 
ATOM   3147 O  O     . GLU C 3 361 ? 35.665 48.078  6.307   1.00 48.17 ? 367  GLU A O     1 
ATOM   3148 C  CB    . GLU C 3 361 ? 37.335 45.278  6.658   1.00 50.46 ? 367  GLU A CB    1 
ATOM   3149 C  CG    . GLU C 3 361 ? 35.871 44.886  6.803   1.00 54.89 ? 367  GLU A CG    1 
ATOM   3150 C  CD    . GLU C 3 361 ? 35.610 43.998  8.004   1.00 58.20 ? 367  GLU A CD    1 
ATOM   3151 O  OE1   . GLU C 3 361 ? 35.954 44.415  9.134   1.00 59.54 ? 367  GLU A OE1   1 
ATOM   3152 O  OE2   . GLU C 3 361 ? 35.053 42.889  7.819   1.00 59.05 ? 367  GLU A OE2   1 
ATOM   3153 N  N     . VAL C 3 362 ? 37.382 48.200  7.754   1.00 47.07 ? 368  VAL A N     1 
ATOM   3154 C  CA    . VAL C 3 362 ? 36.748 49.262  8.531   1.00 46.94 ? 368  VAL A CA    1 
ATOM   3155 C  C     . VAL C 3 362 ? 36.712 50.556  7.717   1.00 46.29 ? 368  VAL A C     1 
ATOM   3156 O  O     . VAL C 3 362 ? 35.692 51.244  7.687   1.00 45.47 ? 368  VAL A O     1 
ATOM   3157 C  CB    . VAL C 3 362 ? 37.486 49.535  9.864   1.00 46.45 ? 368  VAL A CB    1 
ATOM   3158 C  CG1   . VAL C 3 362 ? 37.600 48.252  10.664  1.00 45.88 ? 368  VAL A CG1   1 
ATOM   3159 C  CG2   . VAL C 3 362 ? 38.853 50.126  9.597   1.00 48.59 ? 368  VAL A CG2   1 
ATOM   3160 N  N     . LEU C 3 363 ? 37.823 50.882  7.060   1.00 45.03 ? 369  LEU A N     1 
ATOM   3161 C  CA    . LEU C 3 363 ? 37.892 52.087  6.240   1.00 44.84 ? 369  LEU A CA    1 
ATOM   3162 C  C     . LEU C 3 363 ? 36.755 52.039  5.235   1.00 45.04 ? 369  LEU A C     1 
ATOM   3163 O  O     . LEU C 3 363 ? 36.216 53.068  4.825   1.00 45.79 ? 369  LEU A O     1 
ATOM   3164 C  CB    . LEU C 3 363 ? 39.231 52.164  5.500   1.00 43.38 ? 369  LEU A CB    1 
ATOM   3165 C  CG    . LEU C 3 363 ? 40.475 52.422  6.355   1.00 43.27 ? 369  LEU A CG    1 
ATOM   3166 C  CD1   . LEU C 3 363 ? 41.727 52.293  5.509   1.00 43.33 ? 369  LEU A CD1   1 
ATOM   3167 C  CD2   . LEU C 3 363 ? 40.392 53.809  6.968   1.00 43.83 ? 369  LEU A CD2   1 
ATOM   3168 N  N     . GLU C 3 364 ? 36.396 50.822  4.850   1.00 45.86 ? 370  GLU A N     1 
ATOM   3169 C  CA    . GLU C 3 364 ? 35.325 50.599  3.901   1.00 46.58 ? 370  GLU A CA    1 
ATOM   3170 C  C     . GLU C 3 364 ? 33.992 50.999  4.525   1.00 46.23 ? 370  GLU A C     1 
ATOM   3171 O  O     . GLU C 3 364 ? 33.072 51.430  3.827   1.00 46.10 ? 370  GLU A O     1 
ATOM   3172 C  CB    . GLU C 3 364 ? 35.289 49.121  3.498   1.00 49.26 ? 370  GLU A CB    1 
ATOM   3173 C  CG    . GLU C 3 364 ? 34.426 48.851  2.289   1.00 51.63 ? 370  GLU A CG    1 
ATOM   3174 C  CD    . GLU C 3 364 ? 34.840 49.711  1.110   1.00 54.15 ? 370  GLU A CD    1 
ATOM   3175 O  OE1   . GLU C 3 364 ? 36.002 49.582  0.663   1.00 55.91 ? 370  GLU A OE1   1 
ATOM   3176 O  OE2   . GLU C 3 364 ? 34.010 50.521  0.637   1.00 55.27 ? 370  GLU A OE2   1 
ATOM   3177 N  N     . GLY C 3 365 ? 33.899 50.857  5.843   1.00 45.75 ? 371  GLY A N     1 
ATOM   3178 C  CA    . GLY C 3 365 ? 32.671 51.198  6.542   1.00 46.18 ? 371  GLY A CA    1 
ATOM   3179 C  C     . GLY C 3 365 ? 32.569 52.633  7.039   1.00 46.52 ? 371  GLY A C     1 
ATOM   3180 O  O     . GLY C 3 365 ? 31.471 53.116  7.315   1.00 46.85 ? 371  GLY A O     1 
ATOM   3181 N  N     . VAL C 3 366 ? 33.702 53.317  7.150   1.00 46.77 ? 372  VAL A N     1 
ATOM   3182 C  CA    . VAL C 3 366 ? 33.725 54.696  7.627   1.00 47.23 ? 372  VAL A CA    1 
ATOM   3183 C  C     . VAL C 3 366 ? 32.857 55.642  6.797   1.00 48.27 ? 372  VAL A C     1 
ATOM   3184 O  O     . VAL C 3 366 ? 32.910 55.633  5.567   1.00 47.42 ? 372  VAL A O     1 
ATOM   3185 C  CB    . VAL C 3 366 ? 35.166 55.245  7.656   1.00 46.67 ? 372  VAL A CB    1 
ATOM   3186 C  CG1   . VAL C 3 366 ? 35.156 56.733  7.978   1.00 46.40 ? 372  VAL A CG1   1 
ATOM   3187 C  CG2   . VAL C 3 366 ? 35.978 54.495  8.694   1.00 45.43 ? 372  VAL A CG2   1 
ATOM   3188 N  N     . ARG C 3 367 ? 32.064 56.456  7.492   1.00 49.74 ? 373  ARG A N     1 
ATOM   3189 C  CA    . ARG C 3 367 ? 31.171 57.430  6.858   1.00 51.34 ? 373  ARG A CA    1 
ATOM   3190 C  C     . ARG C 3 367 ? 31.270 58.794  7.540   1.00 51.31 ? 373  ARG A C     1 
ATOM   3191 O  O     . ARG C 3 367 ? 30.851 58.949  8.687   1.00 51.23 ? 373  ARG A O     1 
ATOM   3192 C  CB    . ARG C 3 367 ? 29.718 56.950  6.933   1.00 52.46 ? 373  ARG A CB    1 
ATOM   3193 C  CG    . ARG C 3 367 ? 29.417 55.712  6.114   1.00 53.78 ? 373  ARG A CG    1 
ATOM   3194 C  CD    . ARG C 3 367 ? 29.494 56.001  4.626   1.00 55.10 ? 373  ARG A CD    1 
ATOM   3195 N  NE    . ARG C 3 367 ? 29.289 54.790  3.838   1.00 57.31 ? 373  ARG A NE    1 
ATOM   3196 C  CZ    . ARG C 3 367 ? 30.120 53.752  3.837   1.00 57.82 ? 373  ARG A CZ    1 
ATOM   3197 N  NH1   . ARG C 3 367 ? 31.219 53.775  4.579   1.00 58.00 ? 373  ARG A NH1   1 
ATOM   3198 N  NH2   . ARG C 3 367 ? 29.847 52.686  3.099   1.00 57.86 ? 373  ARG A NH2   1 
ATOM   3199 N  N     . VAL C 3 368 ? 31.819 59.778  6.833   1.00 51.37 ? 374  VAL A N     1 
ATOM   3200 C  CA    . VAL C 3 368 ? 31.957 61.128  7.376   1.00 51.11 ? 374  VAL A CA    1 
ATOM   3201 C  C     . VAL C 3 368 ? 31.175 62.125  6.524   1.00 51.03 ? 374  VAL A C     1 
ATOM   3202 O  O     . VAL C 3 368 ? 31.021 61.924  5.318   1.00 51.70 ? 374  VAL A O     1 
ATOM   3203 C  CB    . VAL C 3 368 ? 33.439 61.565  7.429   1.00 50.78 ? 374  VAL A CB    1 
ATOM   3204 C  CG1   . VAL C 3 368 ? 34.192 60.728  8.441   1.00 50.51 ? 374  VAL A CG1   1 
ATOM   3205 C  CG2   . VAL C 3 368 ? 34.072 61.428  6.056   1.00 50.84 ? 374  VAL A CG2   1 
ATOM   3206 N  N     . ASP C 3 369 ? 30.688 63.195  7.154   1.00 50.98 ? 375  ASP A N     1 
ATOM   3207 C  CA    . ASP C 3 369 ? 29.901 64.228  6.468   1.00 50.58 ? 375  ASP A CA    1 
ATOM   3208 C  C     . ASP C 3 369 ? 30.628 64.909  5.314   1.00 49.14 ? 375  ASP A C     1 
ATOM   3209 O  O     . ASP C 3 369 ? 30.090 65.024  4.212   1.00 49.09 ? 375  ASP A O     1 
ATOM   3210 C  CB    . ASP C 3 369 ? 29.448 65.316  7.453   1.00 51.69 ? 375  ASP A CB    1 
ATOM   3211 C  CG    . ASP C 3 369 ? 28.443 64.813  8.462   1.00 52.69 ? 375  ASP A CG    1 
ATOM   3212 O  OD1   . ASP C 3 369 ? 27.461 64.161  8.053   1.00 54.37 ? 375  ASP A OD1   1 
ATOM   3213 O  OD2   . ASP C 3 369 ? 28.630 65.082  9.668   1.00 53.86 ? 375  ASP A OD2   1 
ATOM   3214 N  N     . ASP C 3 370 ? 31.839 65.387  5.581   1.00 48.13 ? 376  ASP A N     1 
ATOM   3215 C  CA    . ASP C 3 370 ? 32.633 66.064  4.564   1.00 46.95 ? 376  ASP A CA    1 
ATOM   3216 C  C     . ASP C 3 370 ? 32.807 65.128  3.369   1.00 47.03 ? 376  ASP A C     1 
ATOM   3217 O  O     . ASP C 3 370 ? 33.368 64.039  3.501   1.00 46.93 ? 376  ASP A O     1 
ATOM   3218 C  CB    . ASP C 3 370 ? 34.003 66.436  5.134   1.00 47.19 ? 376  ASP A CB    1 
ATOM   3219 C  CG    . ASP C 3 370 ? 34.830 67.270  4.175   1.00 47.64 ? 376  ASP A CG    1 
ATOM   3220 O  OD1   . ASP C 3 370 ? 34.965 66.881  2.999   1.00 50.29 ? 376  ASP A OD1   1 
ATOM   3221 O  OD2   . ASP C 3 370 ? 35.356 68.316  4.600   1.00 47.98 ? 376  ASP A OD2   1 
ATOM   3222 N  N     . PRO C 3 371 ? 32.317 65.538  2.188   1.00 46.42 ? 377  PRO A N     1 
ATOM   3223 C  CA    . PRO C 3 371 ? 32.438 64.708  0.988   1.00 45.60 ? 377  PRO A CA    1 
ATOM   3224 C  C     . PRO C 3 371 ? 33.879 64.513  0.504   1.00 45.11 ? 377  PRO A C     1 
ATOM   3225 O  O     . PRO C 3 371 ? 34.242 63.423  0.051   1.00 45.21 ? 377  PRO A O     1 
ATOM   3226 C  CB    . PRO C 3 371 ? 31.563 65.443  -0.028  1.00 45.69 ? 377  PRO A CB    1 
ATOM   3227 C  CG    . PRO C 3 371 ? 31.670 66.878  0.409   1.00 45.99 ? 377  PRO A CG    1 
ATOM   3228 C  CD    . PRO C 3 371 ? 31.551 66.766  1.906   1.00 46.21 ? 377  PRO A CD    1 
ATOM   3229 N  N     . GLU C 3 372 ? 34.700 65.556  0.596   1.00 43.49 ? 378  GLU A N     1 
ATOM   3230 C  CA    . GLU C 3 372 ? 36.088 65.445  0.162   1.00 43.44 ? 378  GLU A CA    1 
ATOM   3231 C  C     . GLU C 3 372 ? 36.877 64.481  1.050   1.00 43.19 ? 378  GLU A C     1 
ATOM   3232 O  O     . GLU C 3 372 ? 37.764 63.769  0.570   1.00 40.74 ? 378  GLU A O     1 
ATOM   3233 C  CB    . GLU C 3 372 ? 36.772 66.811  0.164   1.00 42.97 ? 378  GLU A CB    1 
ATOM   3234 C  CG    . GLU C 3 372 ? 38.287 66.723  0.012   1.00 45.50 ? 378  GLU A CG    1 
ATOM   3235 C  CD    . GLU C 3 372 ? 38.974 68.081  0.015   1.00 46.99 ? 378  GLU A CD    1 
ATOM   3236 O  OE1   . GLU C 3 372 ? 38.482 68.996  0.710   1.00 47.15 ? 378  GLU A OE1   1 
ATOM   3237 O  OE2   . GLU C 3 372 ? 40.016 68.228  -0.665  1.00 48.57 ? 378  GLU A OE2   1 
ATOM   3238 N  N     . LYS C 3 373 ? 36.556 64.467  2.344   1.00 42.94 ? 379  LYS A N     1 
ATOM   3239 C  CA    . LYS C 3 373 ? 37.236 63.580  3.280   1.00 43.64 ? 379  LYS A CA    1 
ATOM   3240 C  C     . LYS C 3 373 ? 36.739 62.153  3.096   1.00 43.08 ? 379  LYS A C     1 
ATOM   3241 O  O     . LYS C 3 373 ? 37.496 61.200  3.263   1.00 43.55 ? 379  LYS A O     1 
ATOM   3242 C  CB    . LYS C 3 373 ? 37.008 64.036  4.725   1.00 44.07 ? 379  LYS A CB    1 
ATOM   3243 C  CG    . LYS C 3 373 ? 37.689 65.362  5.069   1.00 45.85 ? 379  LYS A CG    1 
ATOM   3244 C  CD    . LYS C 3 373 ? 37.446 65.762  6.522   1.00 45.61 ? 379  LYS A CD    1 
ATOM   3245 C  CE    . LYS C 3 373 ? 38.070 67.117  6.839   1.00 44.91 ? 379  LYS A CE    1 
ATOM   3246 N  NZ    . LYS C 3 373 ? 39.522 67.135  6.515   1.00 44.46 ? 379  LYS A NZ    1 
ATOM   3247 N  N     . GLN C 3 374 ? 35.466 62.009  2.749   1.00 42.43 ? 380  GLN A N     1 
ATOM   3248 C  CA    . GLN C 3 374 ? 34.894 60.688  2.527   1.00 41.72 ? 380  GLN A CA    1 
ATOM   3249 C  C     . GLN C 3 374 ? 35.559 60.074  1.294   1.00 40.46 ? 380  GLN A C     1 
ATOM   3250 O  O     . GLN C 3 374 ? 35.832 58.877  1.263   1.00 41.09 ? 380  GLN A O     1 
ATOM   3251 C  CB    . GLN C 3 374 ? 33.382 60.787  2.307   1.00 41.68 ? 380  GLN A CB    1 
ATOM   3252 C  CG    . GLN C 3 374 ? 32.676 59.445  2.123   1.00 42.35 ? 380  GLN A CG    1 
ATOM   3253 C  CD    . GLN C 3 374 ? 32.688 58.596  3.386   1.00 43.80 ? 380  GLN A CD    1 
ATOM   3254 O  OE1   . GLN C 3 374 ? 32.266 59.042  4.455   1.00 44.07 ? 380  GLN A OE1   1 
ATOM   3255 N  NE2   . GLN C 3 374 ? 33.169 57.364  3.267   1.00 43.64 ? 380  GLN A NE2   1 
ATOM   3256 N  N     . ALA C 3 375 ? 35.825 60.901  0.287   1.00 38.21 ? 381  ALA A N     1 
ATOM   3257 C  CA    . ALA C 3 375 ? 36.467 60.425  -0.938  1.00 38.15 ? 381  ALA A CA    1 
ATOM   3258 C  C     . ALA C 3 375 ? 37.955 60.160  -0.708  1.00 37.36 ? 381  ALA A C     1 
ATOM   3259 O  O     . ALA C 3 375 ? 38.555 59.309  -1.367  1.00 38.07 ? 381  ALA A O     1 
ATOM   3260 C  CB    . ALA C 3 375 ? 36.291 61.441  -2.059  1.00 36.52 ? 381  ALA A CB    1 
ATOM   3261 N  N     . ALA C 3 376 ? 38.543 60.893  0.229   1.00 36.44 ? 382  ALA A N     1 
ATOM   3262 C  CA    . ALA C 3 376 ? 39.953 60.734  0.543   1.00 36.20 ? 382  ALA A CA    1 
ATOM   3263 C  C     . ALA C 3 376 ? 40.227 59.339  1.095   1.00 36.18 ? 382  ALA A C     1 
ATOM   3264 O  O     . ALA C 3 376 ? 41.338 58.825  0.967   1.00 36.55 ? 382  ALA A O     1 
ATOM   3265 C  CB    . ALA C 3 376 ? 40.390 61.795  1.549   1.00 33.83 ? 382  ALA A CB    1 
ATOM   3266 N  N     . ILE C 3 377 ? 39.215 58.730  1.706   1.00 35.54 ? 383  ILE A N     1 
ATOM   3267 C  CA    . ILE C 3 377 ? 39.372 57.399  2.269   1.00 36.64 ? 383  ILE A CA    1 
ATOM   3268 C  C     . ILE C 3 377 ? 39.775 56.398  1.185   1.00 36.73 ? 383  ILE A C     1 
ATOM   3269 O  O     . ILE C 3 377 ? 40.635 55.556  1.415   1.00 37.04 ? 383  ILE A O     1 
ATOM   3270 C  CB    . ILE C 3 377 ? 38.078 56.944  2.973   1.00 37.21 ? 383  ILE A CB    1 
ATOM   3271 C  CG1   . ILE C 3 377 ? 37.824 57.848  4.182   1.00 38.32 ? 383  ILE A CG1   1 
ATOM   3272 C  CG2   . ILE C 3 377 ? 38.197 55.494  3.419   1.00 37.74 ? 383  ILE A CG2   1 
ATOM   3273 C  CD1   . ILE C 3 377 ? 36.625 57.467  5.006   1.00 37.62 ? 383  ILE A CD1   1 
ATOM   3274 N  N     . ASP C 3 378 ? 39.172 56.500  0.003   1.00 35.92 ? 384  ASP A N     1 
ATOM   3275 C  CA    . ASP C 3 378 ? 39.521 55.605  -1.091  1.00 35.68 ? 384  ASP A CA    1 
ATOM   3276 C  C     . ASP C 3 378 ? 40.945 55.871  -1.553  1.00 34.60 ? 384  ASP A C     1 
ATOM   3277 O  O     . ASP C 3 378 ? 41.636 54.963  -2.016  1.00 33.87 ? 384  ASP A O     1 
ATOM   3278 C  CB    . ASP C 3 378 ? 38.568 55.769  -2.282  1.00 37.60 ? 384  ASP A CB    1 
ATOM   3279 C  CG    . ASP C 3 378 ? 37.168 55.258  -1.990  1.00 40.66 ? 384  ASP A CG    1 
ATOM   3280 O  OD1   . ASP C 3 378 ? 37.032 54.190  -1.347  1.00 41.85 ? 384  ASP A OD1   1 
ATOM   3281 O  OD2   . ASP C 3 378 ? 36.197 55.920  -2.416  1.00 43.47 ? 384  ASP A OD2   1 
ATOM   3282 N  N     . LEU C 3 379 ? 41.387 57.118  -1.433  1.00 34.58 ? 385  LEU A N     1 
ATOM   3283 C  CA    . LEU C 3 379 ? 42.745 57.457  -1.842  1.00 35.46 ? 385  LEU A CA    1 
ATOM   3284 C  C     . LEU C 3 379 ? 43.725 56.865  -0.836  1.00 35.18 ? 385  LEU A C     1 
ATOM   3285 O  O     . LEU C 3 379 ? 44.844 56.489  -1.185  1.00 34.43 ? 385  LEU A O     1 
ATOM   3286 C  CB    . LEU C 3 379 ? 42.933 58.971  -1.908  1.00 35.77 ? 385  LEU A CB    1 
ATOM   3287 C  CG    . LEU C 3 379 ? 42.012 59.731  -2.866  1.00 37.19 ? 385  LEU A CG    1 
ATOM   3288 C  CD1   . LEU C 3 379 ? 42.398 61.213  -2.864  1.00 35.75 ? 385  LEU A CD1   1 
ATOM   3289 C  CD2   . LEU C 3 379 ? 42.125 59.140  -4.271  1.00 36.11 ? 385  LEU A CD2   1 
ATOM   3290 N  N     . ILE C 3 380 ? 43.296 56.789  0.418   1.00 34.19 ? 386  ILE A N     1 
ATOM   3291 C  CA    . ILE C 3 380 ? 44.133 56.236  1.465   1.00 35.95 ? 386  ILE A CA    1 
ATOM   3292 C  C     . ILE C 3 380 ? 44.224 54.723  1.277   1.00 36.05 ? 386  ILE A C     1 
ATOM   3293 O  O     . ILE C 3 380 ? 45.302 54.136  1.420   1.00 35.95 ? 386  ILE A O     1 
ATOM   3294 C  CB    . ILE C 3 380 ? 43.564 56.587  2.862   1.00 35.78 ? 386  ILE A CB    1 
ATOM   3295 C  CG1   . ILE C 3 380 ? 43.772 58.081  3.126   1.00 34.27 ? 386  ILE A CG1   1 
ATOM   3296 C  CG2   . ILE C 3 380 ? 44.231 55.746  3.944   1.00 33.74 ? 386  ILE A CG2   1 
ATOM   3297 C  CD1   . ILE C 3 380 ? 43.149 58.575  4.408   1.00 33.90 ? 386  ILE A CD1   1 
ATOM   3298 N  N     . LYS C 3 381 ? 43.100 54.100  0.937   1.00 36.85 ? 387  LYS A N     1 
ATOM   3299 C  CA    . LYS C 3 381 ? 43.082 52.658  0.713   1.00 37.70 ? 387  LYS A CA    1 
ATOM   3300 C  C     . LYS C 3 381 ? 43.958 52.291  -0.486  1.00 36.33 ? 387  LYS A C     1 
ATOM   3301 O  O     . LYS C 3 381 ? 44.675 51.292  -0.453  1.00 37.33 ? 387  LYS A O     1 
ATOM   3302 C  CB    . LYS C 3 381 ? 41.650 52.157  0.502   1.00 39.70 ? 387  LYS A CB    1 
ATOM   3303 C  CG    . LYS C 3 381 ? 40.778 52.253  1.748   1.00 42.63 ? 387  LYS A CG    1 
ATOM   3304 C  CD    . LYS C 3 381 ? 39.642 51.225  1.736   1.00 46.34 ? 387  LYS A CD    1 
ATOM   3305 C  CE    . LYS C 3 381 ? 38.549 51.562  0.735   1.00 49.04 ? 387  LYS A CE    1 
ATOM   3306 N  NZ    . LYS C 3 381 ? 37.749 52.750  1.165   1.00 50.55 ? 387  LYS A NZ    1 
ATOM   3307 N  N     . GLU C 3 382 ? 43.904 53.099  -1.542  1.00 34.65 ? 388  GLU A N     1 
ATOM   3308 C  CA    . GLU C 3 382 ? 44.721 52.850  -2.724  1.00 33.29 ? 388  GLU A CA    1 
ATOM   3309 C  C     . GLU C 3 382 ? 46.186 53.088  -2.351  1.00 33.29 ? 388  GLU A C     1 
ATOM   3310 O  O     . GLU C 3 382 ? 47.073 52.347  -2.773  1.00 34.74 ? 388  GLU A O     1 
ATOM   3311 C  CB    . GLU C 3 382 ? 44.324 53.795  -3.862  1.00 34.48 ? 388  GLU A CB    1 
ATOM   3312 C  CG    . GLU C 3 382 ? 44.984 53.499  -5.210  1.00 35.46 ? 388  GLU A CG    1 
ATOM   3313 C  CD    . GLU C 3 382 ? 44.673 54.562  -6.270  1.00 38.18 ? 388  GLU A CD    1 
ATOM   3314 O  OE1   . GLU C 3 382 ? 43.745 55.375  -6.046  1.00 40.15 ? 388  GLU A OE1   1 
ATOM   3315 O  OE2   . GLU C 3 382 ? 45.346 54.583  -7.328  1.00 35.66 ? 388  GLU A OE2   1 
ATOM   3316 N  N     . TYR C 3 383 ? 46.439 54.122  -1.554  1.00 30.90 ? 389  TYR A N     1 
ATOM   3317 C  CA    . TYR C 3 383 ? 47.802 54.430  -1.143  1.00 28.99 ? 389  TYR A CA    1 
ATOM   3318 C  C     . TYR C 3 383 ? 48.454 53.285  -0.364  1.00 28.94 ? 389  TYR A C     1 
ATOM   3319 O  O     . TYR C 3 383 ? 49.602 52.939  -0.624  1.00 28.07 ? 389  TYR A O     1 
ATOM   3320 C  CB    . TYR C 3 383 ? 47.825 55.709  -0.305  1.00 28.59 ? 389  TYR A CB    1 
ATOM   3321 C  CG    . TYR C 3 383 ? 49.214 56.187  0.059   1.00 26.06 ? 389  TYR A CG    1 
ATOM   3322 C  CD1   . TYR C 3 383 ? 49.909 55.633  1.133   1.00 27.23 ? 389  TYR A CD1   1 
ATOM   3323 C  CD2   . TYR C 3 383 ? 49.832 57.198  -0.669  1.00 26.71 ? 389  TYR A CD2   1 
ATOM   3324 C  CE1   . TYR C 3 383 ? 51.186 56.082  1.474   1.00 27.65 ? 389  TYR A CE1   1 
ATOM   3325 C  CE2   . TYR C 3 383 ? 51.108 57.652  -0.339  1.00 27.44 ? 389  TYR A CE2   1 
ATOM   3326 C  CZ    . TYR C 3 383 ? 51.775 57.091  0.738   1.00 26.98 ? 389  TYR A CZ    1 
ATOM   3327 O  OH    . TYR C 3 383 ? 53.015 57.568  1.097   1.00 28.84 ? 389  TYR A OH    1 
ATOM   3328 N  N     . LEU C 3 384 ? 47.725 52.706  0.588   1.00 29.92 ? 390  LEU A N     1 
ATOM   3329 C  CA    . LEU C 3 384 ? 48.250 51.604  1.391   1.00 31.06 ? 390  LEU A CA    1 
ATOM   3330 C  C     . LEU C 3 384 ? 48.552 50.384  0.527   1.00 31.94 ? 390  LEU A C     1 
ATOM   3331 O  O     . LEU C 3 384 ? 49.557 49.717  0.720   1.00 32.76 ? 390  LEU A O     1 
ATOM   3332 C  CB    . LEU C 3 384 ? 47.254 51.226  2.491   1.00 29.89 ? 390  LEU A CB    1 
ATOM   3333 C  CG    . LEU C 3 384 ? 47.084 52.283  3.589   1.00 31.11 ? 390  LEU A CG    1 
ATOM   3334 C  CD1   . LEU C 3 384 ? 45.837 52.004  4.408   1.00 30.91 ? 390  LEU A CD1   1 
ATOM   3335 C  CD2   . LEU C 3 384 ? 48.323 52.294  4.469   1.00 30.66 ? 390  LEU A CD2   1 
ATOM   3336 N  N     . MET C 3 385 ? 47.675 50.107  -0.429  1.00 33.14 ? 391  MET A N     1 
ATOM   3337 C  CA    . MET C 3 385 ? 47.836 48.975  -1.331  1.00 32.84 ? 391  MET A CA    1 
ATOM   3338 C  C     . MET C 3 385 ? 49.061 49.180  -2.222  1.00 32.12 ? 391  MET A C     1 
ATOM   3339 O  O     . MET C 3 385 ? 49.853 48.259  -2.417  1.00 32.39 ? 391  MET A O     1 
ATOM   3340 C  CB    . MET C 3 385 ? 46.558 48.810  -2.169  1.00 33.53 ? 391  MET A CB    1 
ATOM   3341 C  CG    . MET C 3 385 ? 46.607 47.745  -3.243  1.00 36.44 ? 391  MET A CG    1 
ATOM   3342 S  SD    . MET C 3 385 ? 47.046 48.419  -4.862  1.00 39.99 ? 391  MET A SD    1 
ATOM   3343 C  CE    . MET C 3 385 ? 48.680 48.019  -4.951  1.00 39.55 ? 391  MET A CE    1 
ATOM   3344 N  N     . ILE C 3 386 ? 49.222 50.393  -2.748  1.00 30.26 ? 392  ILE A N     1 
ATOM   3345 C  CA    . ILE C 3 386 ? 50.359 50.719  -3.596  1.00 28.24 ? 392  ILE A CA    1 
ATOM   3346 C  C     . ILE C 3 386 ? 51.662 50.643  -2.801  1.00 28.18 ? 392  ILE A C     1 
ATOM   3347 O  O     . ILE C 3 386 ? 52.710 50.297  -3.345  1.00 27.54 ? 392  ILE A O     1 
ATOM   3348 C  CB    . ILE C 3 386 ? 50.184 52.129  -4.234  1.00 29.94 ? 392  ILE A CB    1 
ATOM   3349 C  CG1   . ILE C 3 386 ? 49.207 52.026  -5.412  1.00 33.09 ? 392  ILE A CG1   1 
ATOM   3350 C  CG2   . ILE C 3 386 ? 51.518 52.698  -4.686  1.00 27.00 ? 392  ILE A CG2   1 
ATOM   3351 C  CD1   . ILE C 3 386 ? 48.939 53.322  -6.128  1.00 35.63 ? 392  ILE A CD1   1 
ATOM   3352 N  N     . GLN C 3 387 ? 51.606 50.961  -1.513  1.00 28.44 ? 393  GLN A N     1 
ATOM   3353 C  CA    . GLN C 3 387 ? 52.807 50.879  -0.696  1.00 29.93 ? 393  GLN A CA    1 
ATOM   3354 C  C     . GLN C 3 387 ? 53.174 49.410  -0.490  1.00 29.35 ? 393  GLN A C     1 
ATOM   3355 O  O     . GLN C 3 387 ? 54.354 49.056  -0.453  1.00 27.59 ? 393  GLN A O     1 
ATOM   3356 C  CB    . GLN C 3 387 ? 52.600 51.560  0.661   1.00 32.69 ? 393  GLN A CB    1 
ATOM   3357 C  CG    . GLN C 3 387 ? 53.202 52.939  0.725   1.00 36.83 ? 393  GLN A CG    1 
ATOM   3358 C  CD    . GLN C 3 387 ? 54.693 52.935  0.414   1.00 39.14 ? 393  GLN A CD    1 
ATOM   3359 O  OE1   . GLN C 3 387 ? 55.289 53.984  0.183   1.00 40.01 ? 393  GLN A OE1   1 
ATOM   3360 N  NE2   . GLN C 3 387 ? 55.302 51.752  0.420   1.00 41.89 ? 393  GLN A NE2   1 
ATOM   3361 N  N     . LYS C 3 388 ? 52.155 48.564  -0.359  1.00 28.07 ? 394  LYS A N     1 
ATOM   3362 C  CA    . LYS C 3 388 ? 52.366 47.127  -0.185  1.00 29.24 ? 394  LYS A CA    1 
ATOM   3363 C  C     . LYS C 3 388 ? 53.125 46.576  -1.413  1.00 28.91 ? 394  LYS A C     1 
ATOM   3364 O  O     . LYS C 3 388 ? 54.042 45.771  -1.270  1.00 29.98 ? 394  LYS A O     1 
ATOM   3365 C  CB    . LYS C 3 388 ? 51.009 46.410  -0.046  1.00 30.24 ? 394  LYS A CB    1 
ATOM   3366 C  CG    . LYS C 3 388 ? 51.063 45.003  0.568   1.00 31.96 ? 394  LYS A CG    1 
ATOM   3367 C  CD    . LYS C 3 388 ? 51.287 45.070  2.079   1.00 33.12 ? 394  LYS A CD    1 
ATOM   3368 C  CE    . LYS C 3 388 ? 51.550 43.691  2.687   1.00 34.88 ? 394  LYS A CE    1 
ATOM   3369 N  NZ    . LYS C 3 388 ? 50.533 42.707  2.255   1.00 37.55 ? 394  LYS A NZ    1 
ATOM   3370 N  N     . ARG C 3 389 ? 52.749 47.027  -2.612  1.00 28.52 ? 395  ARG A N     1 
ATOM   3371 C  CA    . ARG C 3 389 ? 53.387 46.565  -3.856  1.00 28.17 ? 395  ARG A CA    1 
ATOM   3372 C  C     . ARG C 3 389 ? 54.787 47.111  -4.058  1.00 27.43 ? 395  ARG A C     1 
ATOM   3373 O  O     . ARG C 3 389 ? 55.677 46.411  -4.532  1.00 27.61 ? 395  ARG A O     1 
ATOM   3374 C  CB    . ARG C 3 389 ? 52.549 46.958  -5.071  1.00 26.56 ? 395  ARG A CB    1 
ATOM   3375 C  CG    . ARG C 3 389 ? 51.159 46.388  -5.058  1.00 24.80 ? 395  ARG A CG    1 
ATOM   3376 C  CD    . ARG C 3 389 ? 51.115 44.912  -5.388  1.00 25.54 ? 395  ARG A CD    1 
ATOM   3377 N  NE    . ARG C 3 389 ? 49.726 44.477  -5.457  1.00 23.97 ? 395  ARG A NE    1 
ATOM   3378 C  CZ    . ARG C 3 389 ? 48.950 44.308  -4.396  1.00 22.54 ? 395  ARG A CZ    1 
ATOM   3379 N  NH1   . ARG C 3 389 ? 49.433 44.516  -3.184  1.00 25.48 ? 395  ARG A NH1   1 
ATOM   3380 N  NH2   . ARG C 3 389 ? 47.677 43.975  -4.551  1.00 23.64 ? 395  ARG A NH2   1 
ATOM   3381 N  N     . ILE C 3 390 ? 54.970 48.374  -3.714  1.00 26.98 ? 396  ILE A N     1 
ATOM   3382 C  CA    . ILE C 3 390 ? 56.261 49.010  -3.863  1.00 27.27 ? 396  ILE A CA    1 
ATOM   3383 C  C     . ILE C 3 390 ? 57.248 48.337  -2.933  1.00 26.64 ? 396  ILE A C     1 
ATOM   3384 O  O     . ILE C 3 390 ? 58.402 48.101  -3.297  1.00 27.13 ? 396  ILE A O     1 
ATOM   3385 C  CB    . ILE C 3 390 ? 56.168 50.513  -3.530  1.00 28.52 ? 396  ILE A CB    1 
ATOM   3386 C  CG1   . ILE C 3 390 ? 55.385 51.225  -4.640  1.00 29.50 ? 396  ILE A CG1   1 
ATOM   3387 C  CG2   . ILE C 3 390 ? 57.558 51.097  -3.334  1.00 28.20 ? 396  ILE A CG2   1 
ATOM   3388 C  CD1   . ILE C 3 390 ? 55.244 52.735  -4.443  1.00 31.09 ? 396  ILE A CD1   1 
ATOM   3389 N  N     . GLY C 3 391 ? 56.783 48.027  -1.727  1.00 26.89 ? 397  GLY A N     1 
ATOM   3390 C  CA    . GLY C 3 391 ? 57.638 47.377  -0.752  1.00 27.11 ? 397  GLY A CA    1 
ATOM   3391 C  C     . GLY C 3 391 ? 58.088 46.004  -1.222  1.00 27.47 ? 397  GLY A C     1 
ATOM   3392 O  O     . GLY C 3 391 ? 59.271 45.664  -1.174  1.00 28.14 ? 397  GLY A O     1 
ATOM   3393 N  N     . GLN C 3 392 ? 57.140 45.217  -1.701  1.00 27.25 ? 398  GLN A N     1 
ATOM   3394 C  CA    . GLN C 3 392 ? 57.444 43.872  -2.159  1.00 27.30 ? 398  GLN A CA    1 
ATOM   3395 C  C     . GLN C 3 392 ? 58.260 43.837  -3.454  1.00 27.45 ? 398  GLN A C     1 
ATOM   3396 O  O     . GLN C 3 392 ? 59.101 42.963  -3.643  1.00 27.10 ? 398  GLN A O     1 
ATOM   3397 C  CB    . GLN C 3 392 ? 56.138 43.095  -2.333  1.00 26.58 ? 398  GLN A CB    1 
ATOM   3398 C  CG    . GLN C 3 392 ? 56.305 41.676  -2.818  1.00 27.54 ? 398  GLN A CG    1 
ATOM   3399 C  CD    . GLN C 3 392 ? 55.020 40.890  -2.704  1.00 28.35 ? 398  GLN A CD    1 
ATOM   3400 O  OE1   . GLN C 3 392 ? 53.931 41.441  -2.866  1.00 29.66 ? 398  GLN A OE1   1 
ATOM   3401 N  NE2   . GLN C 3 392 ? 55.135 39.593  -2.434  1.00 29.64 ? 398  GLN A NE2   1 
ATOM   3402 N  N     . SER C 3 393 ? 58.042 44.806  -4.334  1.00 28.16 ? 399  SER A N     1 
ATOM   3403 C  CA    . SER C 3 393 ? 58.757 44.812  -5.602  1.00 29.06 ? 399  SER A CA    1 
ATOM   3404 C  C     . SER C 3 393 ? 60.087 45.557  -5.628  1.00 30.49 ? 399  SER A C     1 
ATOM   3405 O  O     . SER C 3 393 ? 61.015 45.129  -6.306  1.00 31.99 ? 399  SER A O     1 
ATOM   3406 C  CB    . SER C 3 393 ? 57.853 45.370  -6.713  1.00 29.72 ? 399  SER A CB    1 
ATOM   3407 O  OG    . SER C 3 393 ? 57.524 46.738  -6.485  1.00 29.07 ? 399  SER A OG    1 
ATOM   3408 N  N     . ALA C 3 394 ? 60.207 46.643  -4.875  1.00 31.28 ? 400  ALA A N     1 
ATOM   3409 C  CA    . ALA C 3 394 ? 61.435 47.414  -4.948  1.00 31.20 ? 400  ALA A CA    1 
ATOM   3410 C  C     . ALA C 3 394 ? 62.077 47.990  -3.688  1.00 31.79 ? 400  ALA A C     1 
ATOM   3411 O  O     . ALA C 3 394 ? 63.299 47.970  -3.563  1.00 32.25 ? 400  ALA A O     1 
ATOM   3412 C  CB    . ALA C 3 394 ? 61.231 48.544  -5.954  1.00 30.20 ? 400  ALA A CB    1 
ATOM   3413 N  N     . GLU C 3 395 ? 61.282 48.499  -2.754  1.00 30.97 ? 401  GLU A N     1 
ATOM   3414 C  CA    . GLU C 3 395 ? 61.877 49.140  -1.588  1.00 31.66 ? 401  GLU A CA    1 
ATOM   3415 C  C     . GLU C 3 395 ? 62.097 48.337  -0.324  1.00 31.62 ? 401  GLU A C     1 
ATOM   3416 O  O     . GLU C 3 395 ? 62.963 48.689  0.467   1.00 31.79 ? 401  GLU A O     1 
ATOM   3417 C  CB    . GLU C 3 395 ? 61.094 50.419  -1.251  1.00 30.60 ? 401  GLU A CB    1 
ATOM   3418 C  CG    . GLU C 3 395 ? 60.951 51.350  -2.443  1.00 32.57 ? 401  GLU A CG    1 
ATOM   3419 C  CD    . GLU C 3 395 ? 60.355 52.706  -2.093  1.00 33.55 ? 401  GLU A CD    1 
ATOM   3420 O  OE1   . GLU C 3 395 ? 59.579 52.799  -1.121  1.00 33.18 ? 401  GLU A OE1   1 
ATOM   3421 O  OE2   . GLU C 3 395 ? 60.656 53.683  -2.813  1.00 34.13 ? 401  GLU A OE2   1 
ATOM   3422 N  N     . GLY C 3 396 ? 61.326 47.273  -0.127  1.00 32.14 ? 402  GLY A N     1 
ATOM   3423 C  CA    . GLY C 3 396 ? 61.484 46.472  1.076   1.00 31.31 ? 402  GLY A CA    1 
ATOM   3424 C  C     . GLY C 3 396 ? 62.828 45.774  1.153   1.00 31.02 ? 402  GLY A C     1 
ATOM   3425 O  O     . GLY C 3 396 ? 63.520 45.653  0.142   1.00 30.38 ? 402  GLY A O     1 
ATOM   3426 N  N     . ASP C 3 397 ? 63.197 45.326  2.354   1.00 31.03 ? 403  ASP A N     1 
ATOM   3427 C  CA    . ASP C 3 397 ? 64.461 44.618  2.577   1.00 31.41 ? 403  ASP A CA    1 
ATOM   3428 C  C     . ASP C 3 397 ? 64.545 43.365  1.703   1.00 30.12 ? 403  ASP A C     1 
ATOM   3429 O  O     . ASP C 3 397 ? 65.619 42.999  1.236   1.00 28.92 ? 403  ASP A O     1 
ATOM   3430 C  CB    . ASP C 3 397 ? 64.602 44.191  4.051   1.00 33.96 ? 403  ASP A CB    1 
ATOM   3431 C  CG    . ASP C 3 397 ? 64.818 45.367  5.005   1.00 39.82 ? 403  ASP A CG    1 
ATOM   3432 O  OD1   . ASP C 3 397 ? 64.865 45.124  6.234   1.00 42.10 ? 403  ASP A OD1   1 
ATOM   3433 O  OD2   . ASP C 3 397 ? 64.949 46.529  4.548   1.00 43.00 ? 403  ASP A OD2   1 
ATOM   3434 N  N     . LYS C 3 398 ? 63.407 42.711  1.490   1.00 29.51 ? 404  LYS A N     1 
ATOM   3435 C  CA    . LYS C 3 398 ? 63.354 41.496  0.679   1.00 29.88 ? 404  LYS A CA    1 
ATOM   3436 C  C     . LYS C 3 398 ? 62.708 41.749  -0.694  1.00 29.03 ? 404  LYS A C     1 
ATOM   3437 O  O     . LYS C 3 398 ? 62.108 40.845  -1.282  1.00 27.96 ? 404  LYS A O     1 
ATOM   3438 C  CB    . LYS C 3 398 ? 62.563 40.411  1.421   1.00 30.07 ? 404  LYS A CB    1 
ATOM   3439 C  CG    . LYS C 3 398 ? 62.984 40.202  2.881   1.00 32.26 ? 404  LYS A CG    1 
ATOM   3440 C  CD    . LYS C 3 398 ? 64.359 39.576  2.985   1.00 35.60 ? 404  LYS A CD    1 
ATOM   3441 C  CE    . LYS C 3 398 ? 64.800 39.421  4.437   1.00 36.87 ? 404  LYS A CE    1 
ATOM   3442 N  NZ    . LYS C 3 398 ? 63.804 38.684  5.263   1.00 39.86 ? 404  LYS A NZ    1 
ATOM   3443 N  N     . ALA C 3 399 ? 62.838 42.972  -1.205  1.00 26.71 ? 405  ALA A N     1 
ATOM   3444 C  CA    . ALA C 3 399 ? 62.255 43.314  -2.504  1.00 24.88 ? 405  ALA A CA    1 
ATOM   3445 C  C     . ALA C 3 399 ? 62.833 42.500  -3.659  1.00 23.52 ? 405  ALA A C     1 
ATOM   3446 O  O     . ALA C 3 399 ? 64.005 42.128  -3.662  1.00 24.17 ? 405  ALA A O     1 
ATOM   3447 C  CB    . ALA C 3 399 ? 62.426 44.806  -2.785  1.00 23.28 ? 405  ALA A CB    1 
ATOM   3448 N  N     . TRP C 3 400 ? 61.995 42.226  -4.649  1.00 24.44 ? 406  TRP A N     1 
ATOM   3449 C  CA    . TRP C 3 400 ? 62.430 41.462  -5.812  1.00 23.92 ? 406  TRP A CA    1 
ATOM   3450 C  C     . TRP C 3 400 ? 63.678 42.076  -6.449  1.00 25.26 ? 406  TRP A C     1 
ATOM   3451 O  O     . TRP C 3 400 ? 64.678 41.387  -6.678  1.00 25.89 ? 406  TRP A O     1 
ATOM   3452 C  CB    . TRP C 3 400 ? 61.297 41.381  -6.829  1.00 22.08 ? 406  TRP A CB    1 
ATOM   3453 C  CG    . TRP C 3 400 ? 60.046 40.779  -6.261  1.00 22.14 ? 406  TRP A CG    1 
ATOM   3454 C  CD1   . TRP C 3 400 ? 59.964 39.866  -5.250  1.00 21.44 ? 406  TRP A CD1   1 
ATOM   3455 C  CD2   . TRP C 3 400 ? 58.702 41.019  -6.693  1.00 21.36 ? 406  TRP A CD2   1 
ATOM   3456 N  NE1   . TRP C 3 400 ? 58.659 39.525  -5.026  1.00 21.15 ? 406  TRP A NE1   1 
ATOM   3457 C  CE2   . TRP C 3 400 ? 57.860 40.218  -5.895  1.00 21.65 ? 406  TRP A CE2   1 
ATOM   3458 C  CE3   . TRP C 3 400 ? 58.128 41.833  -7.678  1.00 24.05 ? 406  TRP A CE3   1 
ATOM   3459 C  CZ2   . TRP C 3 400 ? 56.463 40.203  -6.048  1.00 23.78 ? 406  TRP A CZ2   1 
ATOM   3460 C  CZ3   . TRP C 3 400 ? 56.734 41.820  -7.834  1.00 25.32 ? 406  TRP A CZ3   1 
ATOM   3461 C  CH2   . TRP C 3 400 ? 55.921 41.010  -7.020  1.00 24.75 ? 406  TRP A CH2   1 
ATOM   3462 N  N     . LEU C 3 401 ? 63.622 43.375  -6.720  1.00 27.00 ? 407  LEU A N     1 
ATOM   3463 C  CA    . LEU C 3 401 ? 64.744 44.083  -7.327  1.00 28.28 ? 407  LEU A CA    1 
ATOM   3464 C  C     . LEU C 3 401 ? 66.053 43.970  -6.533  1.00 28.56 ? 407  LEU A C     1 
ATOM   3465 O  O     . LEU C 3 401 ? 67.132 44.148  -7.094  1.00 27.84 ? 407  LEU A O     1 
ATOM   3466 C  CB    . LEU C 3 401 ? 64.386 45.558  -7.515  1.00 29.11 ? 407  LEU A CB    1 
ATOM   3467 C  CG    . LEU C 3 401 ? 63.317 45.859  -8.564  1.00 31.22 ? 407  LEU A CG    1 
ATOM   3468 C  CD1   . LEU C 3 401 ? 63.051 47.358  -8.586  1.00 31.75 ? 407  LEU A CD1   1 
ATOM   3469 C  CD2   . LEU C 3 401 ? 63.779 45.370  -9.940  1.00 28.62 ? 407  LEU A CD2   1 
ATOM   3470 N  N     . ARG C 3 402 ? 65.972 43.689  -5.235  1.00 29.33 ? 408  ARG A N     1 
ATOM   3471 C  CA    . ARG C 3 402 ? 67.194 43.544  -4.440  1.00 31.30 ? 408  ARG A CA    1 
ATOM   3472 C  C     . ARG C 3 402 ? 67.688 42.102  -4.487  1.00 31.56 ? 408  ARG A C     1 
ATOM   3473 O  O     . ARG C 3 402 ? 68.854 41.827  -4.210  1.00 31.24 ? 408  ARG A O     1 
ATOM   3474 C  CB    . ARG C 3 402 ? 66.960 43.934  -2.977  1.00 33.03 ? 408  ARG A CB    1 
ATOM   3475 C  CG    . ARG C 3 402 ? 66.636 45.409  -2.744  1.00 35.63 ? 408  ARG A CG    1 
ATOM   3476 C  CD    . ARG C 3 402 ? 66.386 45.676  -1.264  1.00 37.16 ? 408  ARG A CD    1 
ATOM   3477 N  NE    . ARG C 3 402 ? 65.636 46.912  -1.036  1.00 41.60 ? 408  ARG A NE    1 
ATOM   3478 C  CZ    . ARG C 3 402 ? 66.164 48.136  -1.045  1.00 42.60 ? 408  ARG A CZ    1 
ATOM   3479 N  NH1   . ARG C 3 402 ? 67.462 48.303  -1.269  1.00 42.04 ? 408  ARG A NH1   1 
ATOM   3480 N  NH2   . ARG C 3 402 ? 65.390 49.195  -0.831  1.00 40.83 ? 408  ARG A NH2   1 
ATOM   3481 N  N     . TYR C 3 403 ? 66.799 41.183  -4.857  1.00 33.38 ? 409  TYR A N     1 
ATOM   3482 C  CA    . TYR C 3 403 ? 67.145 39.768  -4.910  1.00 31.99 ? 409  TYR A CA    1 
ATOM   3483 C  C     . TYR C 3 403 ? 67.484 39.164  -6.264  1.00 33.44 ? 409  TYR A C     1 
ATOM   3484 O  O     . TYR C 3 403 ? 68.058 38.074  -6.321  1.00 34.60 ? 409  TYR A O     1 
ATOM   3485 C  CB    . TYR C 3 403 ? 66.033 38.950  -4.246  1.00 32.39 ? 409  TYR A CB    1 
ATOM   3486 C  CG    . TYR C 3 403 ? 66.277 38.769  -2.765  1.00 32.33 ? 409  TYR A CG    1 
ATOM   3487 C  CD1   . TYR C 3 403 ? 67.126 37.765  -2.300  1.00 30.92 ? 409  TYR A CD1   1 
ATOM   3488 C  CD2   . TYR C 3 403 ? 65.745 39.661  -1.840  1.00 34.16 ? 409  TYR A CD2   1 
ATOM   3489 C  CE1   . TYR C 3 403 ? 67.444 37.656  -0.953  1.00 33.22 ? 409  TYR A CE1   1 
ATOM   3490 C  CE2   . TYR C 3 403 ? 66.060 39.566  -0.486  1.00 36.19 ? 409  TYR A CE2   1 
ATOM   3491 C  CZ    . TYR C 3 403 ? 66.909 38.563  -0.051  1.00 34.63 ? 409  TYR A CZ    1 
ATOM   3492 O  OH    . TYR C 3 403 ? 67.231 38.479  1.280   1.00 36.86 ? 409  TYR A OH    1 
ATOM   3493 N  N     . VAL C 3 404 ? 67.145 39.841  -7.358  1.00 32.02 ? 410  VAL A N     1 
ATOM   3494 C  CA    . VAL C 3 404 ? 67.459 39.272  -8.660  1.00 31.30 ? 410  VAL A CA    1 
ATOM   3495 C  C     . VAL C 3 404 ? 68.971 39.157  -8.767  1.00 31.57 ? 410  VAL A C     1 
ATOM   3496 O  O     . VAL C 3 404 ? 69.693 40.063  -8.365  1.00 30.48 ? 410  VAL A O     1 
ATOM   3497 C  CB    . VAL C 3 404 ? 66.893 40.132  -9.827  1.00 32.50 ? 410  VAL A CB    1 
ATOM   3498 C  CG1   . VAL C 3 404 ? 67.544 41.501  -9.848  1.00 30.57 ? 410  VAL A CG1   1 
ATOM   3499 C  CG2   . VAL C 3 404 ? 67.107 39.405  -11.149 1.00 30.84 ? 410  VAL A CG2   1 
ATOM   3500 N  N     . ALA C 3 405 ? 69.451 38.036  -9.297  1.00 32.92 ? 411  ALA A N     1 
ATOM   3501 C  CA    . ALA C 3 405 ? 70.888 37.805  -9.421  1.00 33.57 ? 411  ALA A CA    1 
ATOM   3502 C  C     . ALA C 3 405 ? 71.443 38.076  -10.820 1.00 34.70 ? 411  ALA A C     1 
ATOM   3503 O  O     . ALA C 3 405 ? 70.697 38.395  -11.747 1.00 34.27 ? 411  ALA A O     1 
ATOM   3504 C  CB    . ALA C 3 405 ? 71.211 36.374  -8.996  1.00 33.28 ? 411  ALA A CB    1 
ATOM   3505 N  N     . GLU C 3 406 ? 72.762 37.940  -10.959 1.00 37.13 ? 412  GLU A N     1 
ATOM   3506 C  CA    . GLU C 3 406 ? 73.451 38.172  -12.233 1.00 39.35 ? 412  GLU A CA    1 
ATOM   3507 C  C     . GLU C 3 406 ? 72.914 37.326  -13.392 1.00 38.38 ? 412  GLU A C     1 
ATOM   3508 O  O     . GLU C 3 406 ? 72.945 37.762  -14.546 1.00 38.86 ? 412  GLU A O     1 
ATOM   3509 C  CB    . GLU C 3 406 ? 74.953 37.910  -12.077 1.00 42.81 ? 412  GLU A CB    1 
ATOM   3510 C  CG    . GLU C 3 406 ? 75.726 38.994  -11.320 1.00 49.58 ? 412  GLU A CG    1 
ATOM   3511 C  CD    . GLU C 3 406 ? 76.048 40.209  -12.184 1.00 53.24 ? 412  GLU A CD    1 
ATOM   3512 O  OE1   . GLU C 3 406 ? 76.654 40.027  -13.269 1.00 54.73 ? 412  GLU A OE1   1 
ATOM   3513 O  OE2   . GLU C 3 406 ? 75.706 41.346  -11.775 1.00 54.54 ? 412  GLU A OE2   1 
ATOM   3514 N  N     . ASP C 3 407 ? 72.435 36.120  -13.094 1.00 35.77 ? 413  ASP A N     1 
ATOM   3515 C  CA    . ASP C 3 407 ? 71.906 35.251  -14.136 1.00 33.17 ? 413  ASP A CA    1 
ATOM   3516 C  C     . ASP C 3 407 ? 70.470 35.612  -14.511 1.00 31.67 ? 413  ASP A C     1 
ATOM   3517 O  O     . ASP C 3 407 ? 69.808 34.873  -15.244 1.00 30.80 ? 413  ASP A O     1 
ATOM   3518 C  CB    . ASP C 3 407 ? 71.976 33.782  -13.704 1.00 33.82 ? 413  ASP A CB    1 
ATOM   3519 C  CG    . ASP C 3 407 ? 71.278 33.519  -12.373 1.00 37.46 ? 413  ASP A CG    1 
ATOM   3520 O  OD1   . ASP C 3 407 ? 70.485 34.371  -11.913 1.00 37.33 ? 413  ASP A OD1   1 
ATOM   3521 O  OD2   . ASP C 3 407 ? 71.518 32.441  -11.788 1.00 38.74 ? 413  ASP A OD2   1 
ATOM   3522 N  N     . GLY C 3 408 ? 69.996 36.746  -13.999 1.00 29.75 ? 414  GLY A N     1 
ATOM   3523 C  CA    . GLY C 3 408 ? 68.645 37.198  -14.292 1.00 28.27 ? 414  GLY A CA    1 
ATOM   3524 C  C     . GLY C 3 408 ? 67.540 36.427  -13.588 1.00 28.21 ? 414  GLY A C     1 
ATOM   3525 O  O     . GLY C 3 408 ? 66.390 36.434  -14.029 1.00 27.36 ? 414  GLY A O     1 
ATOM   3526 N  N     . LYS C 3 409 ? 67.870 35.769  -12.482 1.00 27.23 ? 415  LYS A N     1 
ATOM   3527 C  CA    . LYS C 3 409 ? 66.868 34.988  -11.768 1.00 25.37 ? 415  LYS A CA    1 
ATOM   3528 C  C     . LYS C 3 409 ? 66.803 35.287  -10.278 1.00 24.83 ? 415  LYS A C     1 
ATOM   3529 O  O     . LYS C 3 409 ? 67.788 35.698  -9.668  1.00 24.97 ? 415  LYS A O     1 
ATOM   3530 C  CB    . LYS C 3 409 ? 67.146 33.488  -11.965 1.00 26.49 ? 415  LYS A CB    1 
ATOM   3531 C  CG    . LYS C 3 409 ? 67.138 33.034  -13.428 1.00 25.63 ? 415  LYS A CG    1 
ATOM   3532 C  CD    . LYS C 3 409 ? 67.889 31.730  -13.610 1.00 28.02 ? 415  LYS A CD    1 
ATOM   3533 C  CE    . LYS C 3 409 ? 67.924 31.297  -15.078 1.00 31.90 ? 415  LYS A CE    1 
ATOM   3534 N  NZ    . LYS C 3 409 ? 68.497 32.361  -15.972 1.00 35.01 ? 415  LYS A NZ    1 
ATOM   3535 N  N     . ILE C 3 410 ? 65.622 35.092  -9.702  1.00 23.23 ? 416  ILE A N     1 
ATOM   3536 C  CA    . ILE C 3 410 ? 65.445 35.271  -8.272  1.00 22.30 ? 416  ILE A CA    1 
ATOM   3537 C  C     . ILE C 3 410 ? 65.486 33.862  -7.681  1.00 22.80 ? 416  ILE A C     1 
ATOM   3538 O  O     . ILE C 3 410 ? 64.669 33.007  -8.024  1.00 22.35 ? 416  ILE A O     1 
ATOM   3539 C  CB    . ILE C 3 410 ? 64.101 35.964  -7.945  1.00 20.98 ? 416  ILE A CB    1 
ATOM   3540 C  CG1   . ILE C 3 410 ? 64.195 37.445  -8.323  1.00 19.27 ? 416  ILE A CG1   1 
ATOM   3541 C  CG2   . ILE C 3 410 ? 63.775 35.801  -6.455  1.00 19.32 ? 416  ILE A CG2   1 
ATOM   3542 C  CD1   . ILE C 3 410 ? 62.887 38.194  -8.248  1.00 22.93 ? 416  ILE A CD1   1 
ATOM   3543 N  N     . HIS C 3 411 ? 66.469 33.619  -6.824  1.00 23.33 ? 417  HIS A N     1 
ATOM   3544 C  CA    . HIS C 3 411 ? 66.642 32.317  -6.204  1.00 23.78 ? 417  HIS A CA    1 
ATOM   3545 C  C     . HIS C 3 411 ? 66.052 32.337  -4.805  1.00 24.94 ? 417  HIS A C     1 
ATOM   3546 O  O     . HIS C 3 411 ? 66.773 32.475  -3.828  1.00 26.50 ? 417  HIS A O     1 
ATOM   3547 C  CB    . HIS C 3 411 ? 68.135 31.970  -6.149  1.00 24.16 ? 417  HIS A CB    1 
ATOM   3548 C  CG    . HIS C 3 411 ? 68.788 31.890  -7.497  1.00 25.02 ? 417  HIS A CG    1 
ATOM   3549 N  ND1   . HIS C 3 411 ? 68.972 30.700  -8.171  1.00 25.37 ? 417  HIS A ND1   1 
ATOM   3550 C  CD2   . HIS C 3 411 ? 69.293 32.858  -8.303  1.00 24.45 ? 417  HIS A CD2   1 
ATOM   3551 C  CE1   . HIS C 3 411 ? 69.563 30.937  -9.330  1.00 22.96 ? 417  HIS A CE1   1 
ATOM   3552 N  NE2   . HIS C 3 411 ? 69.769 32.239  -9.435  1.00 25.50 ? 417  HIS A NE2   1 
ATOM   3553 N  N     . GLY C 3 412 ? 64.732 32.208  -4.721  1.00 26.36 ? 418  GLY A N     1 
ATOM   3554 C  CA    . GLY C 3 412 ? 64.063 32.224  -3.433  1.00 26.43 ? 418  GLY A CA    1 
ATOM   3555 C  C     . GLY C 3 412 ? 64.394 30.994  -2.608  1.00 26.55 ? 418  GLY A C     1 
ATOM   3556 O  O     . GLY C 3 412 ? 64.583 29.897  -3.136  1.00 26.66 ? 418  GLY A O     1 
ATOM   3557 N  N     . SER C 3 413 ? 64.474 31.168  -1.299  1.00 26.37 ? 419  SER A N     1 
ATOM   3558 C  CA    . SER C 3 413 ? 64.785 30.041  -0.443  1.00 26.03 ? 419  SER A CA    1 
ATOM   3559 C  C     . SER C 3 413 ? 63.525 29.268  -0.112  1.00 24.94 ? 419  SER A C     1 
ATOM   3560 O  O     . SER C 3 413 ? 62.421 29.800  -0.145  1.00 25.11 ? 419  SER A O     1 
ATOM   3561 C  CB    . SER C 3 413 ? 65.455 30.514  0.841   1.00 26.23 ? 419  SER A CB    1 
ATOM   3562 O  OG    . SER C 3 413 ? 65.678 29.410  1.697   1.00 29.73 ? 419  SER A OG    1 
ATOM   3563 N  N     . VAL C 3 414 ? 63.693 27.991  0.177   1.00 24.70 ? 420  VAL A N     1 
ATOM   3564 C  CA    . VAL C 3 414 ? 62.562 27.152  0.535   1.00 23.54 ? 420  VAL A CA    1 
ATOM   3565 C  C     . VAL C 3 414 ? 62.948 26.213  1.664   1.00 24.48 ? 420  VAL A C     1 
ATOM   3566 O  O     . VAL C 3 414 ? 63.978 25.546  1.588   1.00 24.85 ? 420  VAL A O     1 
ATOM   3567 C  CB    . VAL C 3 414 ? 62.085 26.265  -0.649  1.00 23.38 ? 420  VAL A CB    1 
ATOM   3568 C  CG1   . VAL C 3 414 ? 61.003 25.305  -0.161  1.00 20.86 ? 420  VAL A CG1   1 
ATOM   3569 C  CG2   . VAL C 3 414 ? 61.540 27.130  -1.797  1.00 22.93 ? 420  VAL A CG2   1 
ATOM   3570 N  N     . ASN C 3 415 ? 62.135 26.184  2.715   1.00 23.41 ? 421  ASN A N     1 
ATOM   3571 C  CA    . ASN C 3 415 ? 62.350 25.257  3.822   1.00 23.04 ? 421  ASN A CA    1 
ATOM   3572 C  C     . ASN C 3 415 ? 61.313 24.180  3.479   1.00 23.70 ? 421  ASN A C     1 
ATOM   3573 O  O     . ASN C 3 415 ? 60.123 24.349  3.754   1.00 24.61 ? 421  ASN A O     1 
ATOM   3574 C  CB    . ASN C 3 415 ? 62.007 25.905  5.157   1.00 22.94 ? 421  ASN A CB    1 
ATOM   3575 C  CG    . ASN C 3 415 ? 62.204 24.961  6.337   1.00 24.95 ? 421  ASN A CG    1 
ATOM   3576 O  OD1   . ASN C 3 415 ? 62.061 23.741  6.208   1.00 24.00 ? 421  ASN A OD1   1 
ATOM   3577 N  ND2   . ASN C 3 415 ? 62.509 25.528  7.504   1.00 25.01 ? 421  ASN A ND2   1 
ATOM   3578 N  N     . PRO C 3 416 ? 61.760 23.063  2.878   1.00 23.78 ? 422  PRO A N     1 
ATOM   3579 C  CA    . PRO C 3 416 ? 60.950 21.915  2.447   1.00 23.97 ? 422  PRO A CA    1 
ATOM   3580 C  C     . PRO C 3 416 ? 59.929 21.395  3.442   1.00 25.08 ? 422  PRO A C     1 
ATOM   3581 O  O     . PRO C 3 416 ? 58.943 20.763  3.053   1.00 26.28 ? 422  PRO A O     1 
ATOM   3582 C  CB    . PRO C 3 416 ? 61.996 20.851  2.112   1.00 23.17 ? 422  PRO A CB    1 
ATOM   3583 C  CG    . PRO C 3 416 ? 63.192 21.647  1.759   1.00 24.62 ? 422  PRO A CG    1 
ATOM   3584 C  CD    . PRO C 3 416 ? 63.189 22.723  2.808   1.00 23.01 ? 422  PRO A CD    1 
ATOM   3585 N  N     . ASN C 3 417 ? 60.152 21.668  4.721   1.00 24.63 ? 423  ASN A N     1 
ATOM   3586 C  CA    . ASN C 3 417 ? 59.245 21.185  5.746   1.00 26.28 ? 423  ASN A CA    1 
ATOM   3587 C  C     . ASN C 3 417 ? 59.136 22.192  6.880   1.00 26.35 ? 423  ASN A C     1 
ATOM   3588 O  O     . ASN C 3 417 ? 59.104 21.816  8.047   1.00 27.00 ? 423  ASN A O     1 
ATOM   3589 C  CB    . ASN C 3 417 ? 59.759 19.841  6.277   1.00 27.78 ? 423  ASN A CB    1 
ATOM   3590 C  CG    . ASN C 3 417 ? 58.698 19.065  7.016   1.00 29.01 ? 423  ASN A CG    1 
ATOM   3591 O  OD1   . ASN C 3 417 ? 57.623 18.797  6.483   1.00 30.77 ? 423  ASN A OD1   1 
ATOM   3592 N  ND2   . ASN C 3 417 ? 58.990 18.701  8.249   1.00 31.12 ? 423  ASN A ND2   1 
ATOM   3593 N  N     . GLY C 3 418 ? 59.069 23.471  6.521   1.00 26.25 ? 424  GLY A N     1 
ATOM   3594 C  CA    . GLY C 3 418 ? 58.991 24.531  7.508   1.00 24.76 ? 424  GLY A CA    1 
ATOM   3595 C  C     . GLY C 3 418 ? 57.719 24.644  8.329   1.00 25.05 ? 424  GLY A C     1 
ATOM   3596 O  O     . GLY C 3 418 ? 57.753 25.204  9.413   1.00 24.95 ? 424  GLY A O     1 
ATOM   3597 N  N     . ALA C 3 419 ? 56.597 24.142  7.827   1.00 25.72 ? 425  ALA A N     1 
ATOM   3598 C  CA    . ALA C 3 419 ? 55.340 24.226  8.568   1.00 26.05 ? 425  ALA A CA    1 
ATOM   3599 C  C     . ALA C 3 419 ? 55.047 22.925  9.318   1.00 27.83 ? 425  ALA A C     1 
ATOM   3600 O  O     . ALA C 3 419 ? 55.413 21.844  8.857   1.00 26.38 ? 425  ALA A O     1 
ATOM   3601 C  CB    . ALA C 3 419 ? 54.185 24.560  7.616   1.00 22.97 ? 425  ALA A CB    1 
ATOM   3602 N  N     . VAL C 3 420 ? 54.398 23.048  10.477  1.00 29.68 ? 426  VAL A N     1 
ATOM   3603 C  CA    . VAL C 3 420 ? 54.028 21.899  11.314  1.00 31.38 ? 426  VAL A CA    1 
ATOM   3604 C  C     . VAL C 3 420 ? 53.292 20.796  10.549  1.00 29.70 ? 426  VAL A C     1 
ATOM   3605 O  O     . VAL C 3 420 ? 53.483 19.615  10.814  1.00 31.71 ? 426  VAL A O     1 
ATOM   3606 C  CB    . VAL C 3 420 ? 53.117 22.336  12.513  1.00 34.33 ? 426  VAL A CB    1 
ATOM   3607 C  CG1   . VAL C 3 420 ? 53.920 23.126  13.531  1.00 36.54 ? 426  VAL A CG1   1 
ATOM   3608 C  CG2   . VAL C 3 420 ? 51.950 23.191  12.007  1.00 33.78 ? 426  VAL A CG2   1 
ATOM   3609 N  N     . THR C 3 421 ? 52.460 21.198  9.598   1.00 28.70 ? 427  THR A N     1 
ATOM   3610 C  CA    . THR C 3 421 ? 51.656 20.286  8.779   1.00 26.40 ? 427  THR A CA    1 
ATOM   3611 C  C     . THR C 3 421 ? 52.416 19.542  7.678   1.00 26.51 ? 427  THR A C     1 
ATOM   3612 O  O     . THR C 3 421 ? 51.878 18.630  7.039   1.00 25.46 ? 427  THR A O     1 
ATOM   3613 C  CB    . THR C 3 421 ? 50.523 21.062  8.092   1.00 26.34 ? 427  THR A CB    1 
ATOM   3614 O  OG1   . THR C 3 421 ? 51.093 22.156  7.365   1.00 25.90 ? 427  THR A OG1   1 
ATOM   3615 C  CG2   . THR C 3 421 ? 49.530 21.605  9.121   1.00 24.86 ? 427  THR A CG2   1 
ATOM   3616 N  N     . GLY C 3 422 ? 53.656 19.939  7.434   1.00 25.62 ? 428  GLY A N     1 
ATOM   3617 C  CA    . GLY C 3 422 ? 54.414 19.280  6.390   1.00 25.03 ? 428  GLY A CA    1 
ATOM   3618 C  C     . GLY C 3 422 ? 54.550 20.174  5.178   1.00 24.62 ? 428  GLY A C     1 
ATOM   3619 O  O     . GLY C 3 422 ? 55.233 19.834  4.212   1.00 26.56 ? 428  GLY A O     1 
ATOM   3620 N  N     . ARG C 3 423 ? 53.881 21.317  5.221   1.00 22.76 ? 429  ARG A N     1 
ATOM   3621 C  CA    . ARG C 3 423 ? 53.971 22.270  4.131   1.00 23.09 ? 429  ARG A CA    1 
ATOM   3622 C  C     . ARG C 3 423 ? 55.350 22.896  4.159   1.00 22.41 ? 429  ARG A C     1 
ATOM   3623 O  O     . ARG C 3 423 ? 56.008 22.911  5.197   1.00 21.90 ? 429  ARG A O     1 
ATOM   3624 C  CB    . ARG C 3 423 ? 52.951 23.388  4.299   1.00 23.78 ? 429  ARG A CB    1 
ATOM   3625 C  CG    . ARG C 3 423 ? 51.655 23.184  3.565   1.00 25.65 ? 429  ARG A CG    1 
ATOM   3626 C  CD    . ARG C 3 423 ? 50.804 24.436  3.688   1.00 25.35 ? 429  ARG A CD    1 
ATOM   3627 N  NE    . ARG C 3 423 ? 49.653 24.405  2.790   1.00 25.70 ? 429  ARG A NE    1 
ATOM   3628 C  CZ    . ARG C 3 423 ? 48.818 25.421  2.618   1.00 23.63 ? 429  ARG A CZ    1 
ATOM   3629 N  NH1   . ARG C 3 423 ? 49.006 26.547  3.286   1.00 25.88 ? 429  ARG A NH1   1 
ATOM   3630 N  NH2   . ARG C 3 423 ? 47.799 25.310  1.779   1.00 23.37 ? 429  ARG A NH2   1 
ATOM   3631 N  N     . ALA C 3 424 ? 55.787 23.406  3.018   1.00 21.56 ? 430  ALA A N     1 
ATOM   3632 C  CA    . ALA C 3 424 ? 57.069 24.085  2.940   1.00 21.84 ? 430  ALA A CA    1 
ATOM   3633 C  C     . ALA C 3 424 ? 56.833 25.560  3.261   1.00 23.07 ? 430  ALA A C     1 
ATOM   3634 O  O     . ALA C 3 424 ? 55.688 26.030  3.236   1.00 22.89 ? 430  ALA A O     1 
ATOM   3635 C  CB    . ALA C 3 424 ? 57.645 23.958  1.541   1.00 23.95 ? 430  ALA A CB    1 
ATOM   3636 N  N     . THR C 3 425 ? 57.912 26.269  3.598   1.00 22.07 ? 431  THR A N     1 
ATOM   3637 C  CA    . THR C 3 425 ? 57.859 27.702  3.861   1.00 20.64 ? 431  THR A CA    1 
ATOM   3638 C  C     . THR C 3 425 ? 58.801 28.323  2.839   1.00 20.89 ? 431  THR A C     1 
ATOM   3639 O  O     . THR C 3 425 ? 59.792 27.702  2.456   1.00 20.35 ? 431  THR A O     1 
ATOM   3640 C  CB    . THR C 3 425 ? 58.325 28.066  5.296   1.00 21.87 ? 431  THR A CB    1 
ATOM   3641 O  OG1   . THR C 3 425 ? 59.686 27.658  5.500   1.00 22.58 ? 431  THR A OG1   1 
ATOM   3642 C  CG2   . THR C 3 425 ? 57.423 27.394  6.329   1.00 23.33 ? 431  THR A CG2   1 
ATOM   3643 N  N     . HIS C 3 426 ? 58.495 29.536  2.388   1.00 21.91 ? 432  HIS A N     1 
ATOM   3644 C  CA    . HIS C 3 426 ? 59.319 30.208  1.384   1.00 23.45 ? 432  HIS A CA    1 
ATOM   3645 C  C     . HIS C 3 426 ? 59.743 31.595  1.862   1.00 24.08 ? 432  HIS A C     1 
ATOM   3646 O  O     . HIS C 3 426 ? 58.949 32.326  2.463   1.00 23.92 ? 432  HIS A O     1 
ATOM   3647 C  CB    . HIS C 3 426 ? 58.538 30.334  0.073   1.00 22.85 ? 432  HIS A CB    1 
ATOM   3648 C  CG    . HIS C 3 426 ? 57.729 29.123  -0.260  1.00 24.73 ? 432  HIS A CG    1 
ATOM   3649 N  ND1   . HIS C 3 426 ? 56.675 28.696  0.524   1.00 25.59 ? 432  HIS A ND1   1 
ATOM   3650 C  CD2   . HIS C 3 426 ? 57.835 28.227  -1.269  1.00 23.13 ? 432  HIS A CD2   1 
ATOM   3651 C  CE1   . HIS C 3 426 ? 56.170 27.588  0.011   1.00 25.12 ? 432  HIS A CE1   1 
ATOM   3652 N  NE2   . HIS C 3 426 ? 56.855 27.281  -1.077  1.00 24.30 ? 432  HIS A NE2   1 
ATOM   3653 N  N     . ALA C 3 427 ? 60.988 31.967  1.584   1.00 22.29 ? 433  ALA A N     1 
ATOM   3654 C  CA    . ALA C 3 427 ? 61.480 33.261  2.026   1.00 22.55 ? 433  ALA A CA    1 
ATOM   3655 C  C     . ALA C 3 427 ? 62.733 33.700  1.287   1.00 23.06 ? 433  ALA A C     1 
ATOM   3656 O  O     . ALA C 3 427 ? 63.391 32.903  0.624   1.00 22.95 ? 433  ALA A O     1 
ATOM   3657 C  CB    . ALA C 3 427 ? 61.759 33.217  3.539   1.00 20.19 ? 433  ALA A CB    1 
ATOM   3658 N  N     . PHE C 3 428 ? 63.037 34.987  1.410   1.00 23.19 ? 434  PHE A N     1 
ATOM   3659 C  CA    . PHE C 3 428 ? 64.222 35.587  0.816   1.00 23.25 ? 434  PHE A CA    1 
ATOM   3660 C  C     . PHE C 3 428 ? 64.312 35.565  -0.701  1.00 21.92 ? 434  PHE A C     1 
ATOM   3661 O  O     . PHE C 3 428 ? 65.311 35.102  -1.249  1.00 23.99 ? 434  PHE A O     1 
ATOM   3662 C  CB    . PHE C 3 428 ? 65.480 34.928  1.397   1.00 24.55 ? 434  PHE A CB    1 
ATOM   3663 C  CG    . PHE C 3 428 ? 65.469 34.810  2.894   1.00 27.97 ? 434  PHE A CG    1 
ATOM   3664 C  CD1   . PHE C 3 428 ? 65.150 35.900  3.691   1.00 30.36 ? 434  PHE A CD1   1 
ATOM   3665 C  CD2   . PHE C 3 428 ? 65.770 33.599  3.511   1.00 31.18 ? 434  PHE A CD2   1 
ATOM   3666 C  CE1   . PHE C 3 428 ? 65.125 35.788  5.091   1.00 32.26 ? 434  PHE A CE1   1 
ATOM   3667 C  CE2   . PHE C 3 428 ? 65.749 33.475  4.904   1.00 31.23 ? 434  PHE A CE2   1 
ATOM   3668 C  CZ    . PHE C 3 428 ? 65.425 34.572  5.694   1.00 31.44 ? 434  PHE A CZ    1 
ATOM   3669 N  N     . PRO C 3 429 ? 63.267 36.030  -1.404  1.00 20.67 ? 435  PRO A N     1 
ATOM   3670 C  CA    . PRO C 3 429 ? 62.014 36.559  -0.857  1.00 20.33 ? 435  PRO A CA    1 
ATOM   3671 C  C     . PRO C 3 429 ? 60.996 35.428  -0.910  1.00 19.55 ? 435  PRO A C     1 
ATOM   3672 O  O     . PRO C 3 429 ? 61.283 34.374  -1.465  1.00 17.99 ? 435  PRO A O     1 
ATOM   3673 C  CB    . PRO C 3 429 ? 61.669 37.684  -1.821  1.00 19.91 ? 435  PRO A CB    1 
ATOM   3674 C  CG    . PRO C 3 429 ? 62.104 37.128  -3.118  1.00 18.39 ? 435  PRO A CG    1 
ATOM   3675 C  CD    . PRO C 3 429 ? 63.430 36.451  -2.807  1.00 19.51 ? 435  PRO A CD    1 
ATOM   3676 N  N     . ASN C 3 430 ? 59.815 35.650  -0.345  1.00 18.42 ? 436  ASN A N     1 
ATOM   3677 C  CA    . ASN C 3 430 ? 58.768 34.636  -0.335  1.00 19.08 ? 436  ASN A CA    1 
ATOM   3678 C  C     . ASN C 3 430 ? 58.054 34.593  -1.695  1.00 21.55 ? 436  ASN A C     1 
ATOM   3679 O  O     . ASN C 3 430 ? 57.153 35.390  -1.960  1.00 22.86 ? 436  ASN A O     1 
ATOM   3680 C  CB    . ASN C 3 430 ? 57.767 34.949  0.778   1.00 18.22 ? 436  ASN A CB    1 
ATOM   3681 C  CG    . ASN C 3 430 ? 56.634 33.945  0.851   1.00 17.84 ? 436  ASN A CG    1 
ATOM   3682 O  OD1   . ASN C 3 430 ? 56.454 33.119  -0.051  1.00 17.60 ? 436  ASN A OD1   1 
ATOM   3683 N  ND2   . ASN C 3 430 ? 55.851 34.015  1.929   1.00 16.23 ? 436  ASN A ND2   1 
ATOM   3684 N  N     . LEU C 3 431 ? 58.452 33.654  -2.548  1.00 22.41 ? 437  LEU A N     1 
ATOM   3685 C  CA    . LEU C 3 431 ? 57.846 33.529  -3.871  1.00 24.05 ? 437  LEU A CA    1 
ATOM   3686 C  C     . LEU C 3 431 ? 56.458 32.896  -3.850  1.00 23.80 ? 437  LEU A C     1 
ATOM   3687 O  O     . LEU C 3 431 ? 55.830 32.736  -4.891  1.00 23.99 ? 437  LEU A O     1 
ATOM   3688 C  CB    . LEU C 3 431 ? 58.773 32.742  -4.793  1.00 24.16 ? 437  LEU A CB    1 
ATOM   3689 C  CG    . LEU C 3 431 ? 60.146 33.403  -4.941  1.00 25.53 ? 437  LEU A CG    1 
ATOM   3690 C  CD1   . LEU C 3 431 ? 60.989 32.598  -5.907  1.00 29.53 ? 437  LEU A CD1   1 
ATOM   3691 C  CD2   . LEU C 3 431 ? 59.984 34.838  -5.440  1.00 26.69 ? 437  LEU A CD2   1 
ATOM   3692 N  N     . ALA C 3 432 ? 55.992 32.529  -2.660  1.00 23.83 ? 438  ALA A N     1 
ATOM   3693 C  CA    . ALA C 3 432 ? 54.666 31.954  -2.495  1.00 21.81 ? 438  ALA A CA    1 
ATOM   3694 C  C     . ALA C 3 432 ? 53.691 33.028  -2.012  1.00 22.49 ? 438  ALA A C     1 
ATOM   3695 O  O     . ALA C 3 432 ? 52.622 32.700  -1.504  1.00 23.24 ? 438  ALA A O     1 
ATOM   3696 C  CB    . ALA C 3 432 ? 54.698 30.804  -1.497  1.00 23.47 ? 438  ALA A CB    1 
ATOM   3697 N  N     . GLN C 3 433 ? 54.068 34.301  -2.140  1.00 23.01 ? 439  GLN A N     1 
ATOM   3698 C  CA    . GLN C 3 433 ? 53.184 35.406  -1.748  1.00 24.45 ? 439  GLN A CA    1 
ATOM   3699 C  C     . GLN C 3 433 ? 53.186 36.526  -2.793  1.00 24.33 ? 439  GLN A C     1 
ATOM   3700 O  O     . GLN C 3 433 ? 52.962 37.701  -2.473  1.00 25.13 ? 439  GLN A O     1 
ATOM   3701 C  CB    . GLN C 3 433 ? 53.526 35.970  -0.344  1.00 22.74 ? 439  GLN A CB    1 
ATOM   3702 C  CG    . GLN C 3 433 ? 54.827 36.747  -0.210  1.00 24.46 ? 439  GLN A CG    1 
ATOM   3703 C  CD    . GLN C 3 433 ? 55.098 37.261  1.227   1.00 25.67 ? 439  GLN A CD    1 
ATOM   3704 O  OE1   . GLN C 3 433 ? 56.215 37.675  1.547   1.00 24.22 ? 439  GLN A OE1   1 
ATOM   3705 N  NE2   . GLN C 3 433 ? 54.077 37.235  2.080   1.00 24.66 ? 439  GLN A NE2   1 
ATOM   3706 N  N     . ILE C 3 434 ? 53.447 36.152  -4.044  1.00 23.83 ? 440  ILE A N     1 
ATOM   3707 C  CA    . ILE C 3 434 ? 53.432 37.106  -5.159  1.00 23.49 ? 440  ILE A CA    1 
ATOM   3708 C  C     . ILE C 3 434 ? 51.960 37.420  -5.403  1.00 24.50 ? 440  ILE A C     1 
ATOM   3709 O  O     . ILE C 3 434 ? 51.137 36.512  -5.426  1.00 22.89 ? 440  ILE A O     1 
ATOM   3710 C  CB    . ILE C 3 434 ? 53.941 36.498  -6.483  1.00 23.04 ? 440  ILE A CB    1 
ATOM   3711 C  CG1   . ILE C 3 434 ? 55.303 35.827  -6.283  1.00 23.54 ? 440  ILE A CG1   1 
ATOM   3712 C  CG2   . ILE C 3 434 ? 53.984 37.583  -7.553  1.00 21.57 ? 440  ILE A CG2   1 
ATOM   3713 C  CD1   . ILE C 3 434 ? 56.353 36.718  -5.696  1.00 22.32 ? 440  ILE A CD1   1 
ATOM   3714 N  N     . PRO C 3 435 ? 51.611 38.702  -5.590  1.00 24.36 ? 441  PRO A N     1 
ATOM   3715 C  CA    . PRO C 3 435 ? 50.207 39.055  -5.830  1.00 24.71 ? 441  PRO A CA    1 
ATOM   3716 C  C     . PRO C 3 435 ? 49.624 38.260  -6.993  1.00 25.35 ? 441  PRO A C     1 
ATOM   3717 O  O     . PRO C 3 435 ? 50.264 38.117  -8.023  1.00 24.23 ? 441  PRO A O     1 
ATOM   3718 C  CB    . PRO C 3 435 ? 50.277 40.552  -6.132  1.00 24.77 ? 441  PRO A CB    1 
ATOM   3719 C  CG    . PRO C 3 435 ? 51.446 41.006  -5.282  1.00 25.06 ? 441  PRO A CG    1 
ATOM   3720 C  CD    . PRO C 3 435 ? 52.462 39.905  -5.543  1.00 24.67 ? 441  PRO A CD    1 
ATOM   3721 N  N     . GLY C 3 436 ? 48.409 37.744  -6.815  1.00 27.75 ? 442  GLY A N     1 
ATOM   3722 C  CA    . GLY C 3 436 ? 47.761 36.974  -7.859  1.00 27.62 ? 442  GLY A CA    1 
ATOM   3723 C  C     . GLY C 3 436 ? 47.197 37.883  -8.934  1.00 28.87 ? 442  GLY A C     1 
ATOM   3724 O  O     . GLY C 3 436 ? 47.037 39.085  -8.704  1.00 28.90 ? 442  GLY A O     1 
ATOM   3725 N  N     . VAL C 3 437 ? 46.882 37.319  -10.099 1.00 29.18 ? 443  VAL A N     1 
ATOM   3726 C  CA    . VAL C 3 437 ? 46.354 38.108  -11.210 1.00 30.82 ? 443  VAL A CA    1 
ATOM   3727 C  C     . VAL C 3 437 ? 45.043 38.819  -10.906 1.00 32.66 ? 443  VAL A C     1 
ATOM   3728 O  O     . VAL C 3 437 ? 44.715 39.819  -11.551 1.00 33.98 ? 443  VAL A O     1 
ATOM   3729 C  CB    . VAL C 3 437 ? 46.172 37.246  -12.486 1.00 30.78 ? 443  VAL A CB    1 
ATOM   3730 C  CG1   . VAL C 3 437 ? 47.524 36.730  -12.951 1.00 28.73 ? 443  VAL A CG1   1 
ATOM   3731 C  CG2   . VAL C 3 437 ? 45.215 36.091  -12.223 1.00 29.19 ? 443  VAL A CG2   1 
ATOM   3732 N  N     . ARG C 3 438 ? 44.298 38.319  -9.924  1.00 34.09 ? 444  ARG A N     1 
ATOM   3733 C  CA    . ARG C 3 438 ? 43.023 38.931  -9.557  1.00 36.47 ? 444  ARG A CA    1 
ATOM   3734 C  C     . ARG C 3 438 ? 43.169 40.219  -8.730  1.00 37.40 ? 444  ARG A C     1 
ATOM   3735 O  O     . ARG C 3 438 ? 42.239 41.025  -8.663  1.00 38.87 ? 444  ARG A O     1 
ATOM   3736 C  CB    . ARG C 3 438 ? 42.156 37.932  -8.786  1.00 37.48 ? 444  ARG A CB    1 
ATOM   3737 N  N     . SER C 3 439 ? 44.325 40.428  -8.110  1.00 36.54 ? 445  SER A N     1 
ATOM   3738 C  CA    . SER C 3 439 ? 44.513 41.633  -7.307  1.00 36.33 ? 445  SER A CA    1 
ATOM   3739 C  C     . SER C 3 439 ? 45.207 42.735  -8.109  1.00 35.94 ? 445  SER A C     1 
ATOM   3740 O  O     . SER C 3 439 ? 45.841 42.465  -9.124  1.00 36.97 ? 445  SER A O     1 
ATOM   3741 C  CB    . SER C 3 439 ? 45.310 41.303  -6.042  1.00 36.43 ? 445  SER A CB    1 
ATOM   3742 O  OG    . SER C 3 439 ? 46.656 41.019  -6.346  1.00 38.06 ? 445  SER A OG    1 
ATOM   3743 N  N     . PRO C 3 440 ? 45.078 43.998  -7.671  1.00 35.91 ? 446  PRO A N     1 
ATOM   3744 C  CA    . PRO C 3 440 ? 45.696 45.138  -8.357  1.00 34.54 ? 446  PRO A CA    1 
ATOM   3745 C  C     . PRO C 3 440 ? 47.178 44.940  -8.654  1.00 34.39 ? 446  PRO A C     1 
ATOM   3746 O  O     . PRO C 3 440 ? 47.964 44.635  -7.753  1.00 34.44 ? 446  PRO A O     1 
ATOM   3747 C  CB    . PRO C 3 440 ? 45.443 46.293  -7.392  1.00 34.74 ? 446  PRO A CB    1 
ATOM   3748 C  CG    . PRO C 3 440 ? 44.098 45.952  -6.842  1.00 35.29 ? 446  PRO A CG    1 
ATOM   3749 C  CD    . PRO C 3 440 ? 44.234 44.463  -6.552  1.00 36.54 ? 446  PRO A CD    1 
ATOM   3750 N  N     . TYR C 3 441 ? 47.539 45.130  -9.922  1.00 32.44 ? 447  TYR A N     1 
ATOM   3751 C  CA    . TYR C 3 441 ? 48.904 44.979  -10.408 1.00 32.21 ? 447  TYR A CA    1 
ATOM   3752 C  C     . TYR C 3 441 ? 49.381 43.524  -10.418 1.00 31.82 ? 447  TYR A C     1 
ATOM   3753 O  O     . TYR C 3 441 ? 50.508 43.237  -10.821 1.00 29.91 ? 447  TYR A O     1 
ATOM   3754 C  CB    . TYR C 3 441 ? 49.858 45.847  -9.585  1.00 33.31 ? 447  TYR A CB    1 
ATOM   3755 C  CG    . TYR C 3 441 ? 49.499 47.312  -9.636  1.00 35.02 ? 447  TYR A CG    1 
ATOM   3756 C  CD1   . TYR C 3 441 ? 49.640 48.048  -10.815 1.00 35.32 ? 447  TYR A CD1   1 
ATOM   3757 C  CD2   . TYR C 3 441 ? 48.963 47.955  -8.517  1.00 35.48 ? 447  TYR A CD2   1 
ATOM   3758 C  CE1   . TYR C 3 441 ? 49.250 49.386  -10.877 1.00 34.95 ? 447  TYR A CE1   1 
ATOM   3759 C  CE2   . TYR C 3 441 ? 48.573 49.285  -8.569  1.00 35.03 ? 447  TYR A CE2   1 
ATOM   3760 C  CZ    . TYR C 3 441 ? 48.713 49.994  -9.748  1.00 36.24 ? 447  TYR A CZ    1 
ATOM   3761 O  OH    . TYR C 3 441 ? 48.276 51.298  -9.796  1.00 37.60 ? 447  TYR A OH    1 
ATOM   3762 N  N     . GLY C 3 442 ? 48.514 42.611  -9.991  1.00 31.53 ? 448  GLY A N     1 
ATOM   3763 C  CA    . GLY C 3 442 ? 48.874 41.206  -9.973  1.00 32.16 ? 448  GLY A CA    1 
ATOM   3764 C  C     . GLY C 3 442 ? 49.332 40.713  -11.332 1.00 33.50 ? 448  GLY A C     1 
ATOM   3765 O  O     . GLY C 3 442 ? 50.264 39.915  -11.435 1.00 34.19 ? 448  GLY A O     1 
ATOM   3766 N  N     . GLU C 3 443 ? 48.677 41.190  -12.384 1.00 35.42 ? 449  GLU A N     1 
ATOM   3767 C  CA    . GLU C 3 443 ? 49.021 40.786  -13.743 1.00 36.53 ? 449  GLU A CA    1 
ATOM   3768 C  C     . GLU C 3 443 ? 50.468 41.106  -14.085 1.00 34.14 ? 449  GLU A C     1 
ATOM   3769 O  O     . GLU C 3 443 ? 51.180 40.273  -14.633 1.00 33.65 ? 449  GLU A O     1 
ATOM   3770 C  CB    . GLU C 3 443 ? 48.100 41.476  -14.747 1.00 39.07 ? 449  GLU A CB    1 
ATOM   3771 C  CG    . GLU C 3 443 ? 46.722 40.846  -14.858 1.00 45.01 ? 449  GLU A CG    1 
ATOM   3772 C  CD    . GLU C 3 443 ? 46.632 39.849  -16.002 1.00 48.65 ? 449  GLU A CD    1 
ATOM   3773 O  OE1   . GLU C 3 443 ? 47.300 38.792  -15.934 1.00 49.19 ? 449  GLU A OE1   1 
ATOM   3774 O  OE2   . GLU C 3 443 ? 45.894 40.135  -16.976 1.00 49.93 ? 449  GLU A OE2   1 
ATOM   3775 N  N     . GLN C 3 444 ? 50.903 42.312  -13.744 1.00 32.98 ? 450  GLN A N     1 
ATOM   3776 C  CA    . GLN C 3 444 ? 52.265 42.723  -14.041 1.00 32.06 ? 450  GLN A CA    1 
ATOM   3777 C  C     . GLN C 3 444 ? 53.306 42.064  -13.145 1.00 29.88 ? 450  GLN A C     1 
ATOM   3778 O  O     . GLN C 3 444 ? 54.390 41.713  -13.612 1.00 29.34 ? 450  GLN A O     1 
ATOM   3779 C  CB    . GLN C 3 444 ? 52.374 44.247  -13.962 1.00 32.28 ? 450  GLN A CB    1 
ATOM   3780 C  CG    . GLN C 3 444 ? 51.686 44.950  -15.119 1.00 35.12 ? 450  GLN A CG    1 
ATOM   3781 C  CD    . GLN C 3 444 ? 51.392 46.409  -14.821 1.00 38.38 ? 450  GLN A CD    1 
ATOM   3782 O  OE1   . GLN C 3 444 ? 50.458 46.729  -14.077 1.00 38.05 ? 450  GLN A OE1   1 
ATOM   3783 N  NE2   . GLN C 3 444 ? 52.196 47.303  -15.393 1.00 38.30 ? 450  GLN A NE2   1 
ATOM   3784 N  N     . CYS C 3 445 ? 52.985 41.898  -11.866 1.00 28.51 ? 451  CYS A N     1 
ATOM   3785 C  CA    . CYS C 3 445 ? 53.910 41.259  -10.930 1.00 29.75 ? 451  CYS A CA    1 
ATOM   3786 C  C     . CYS C 3 445 ? 54.135 39.823  -11.391 1.00 28.98 ? 451  CYS A C     1 
ATOM   3787 O  O     . CYS C 3 445 ? 55.258 39.355  -11.532 1.00 30.24 ? 451  CYS A O     1 
ATOM   3788 C  CB    . CYS C 3 445 ? 53.313 41.222  -9.522  1.00 29.52 ? 451  CYS A CB    1 
ATOM   3789 S  SG    . CYS C 3 445 ? 53.008 42.820  -8.786  1.00 31.88 ? 451  CYS A SG    1 
ATOM   3790 N  N     . ARG C 3 446 ? 53.026 39.148  -11.642 1.00 29.75 ? 452  ARG A N     1 
ATOM   3791 C  CA    . ARG C 3 446 ? 53.024 37.767  -12.072 1.00 30.17 ? 452  ARG A CA    1 
ATOM   3792 C  C     . ARG C 3 446 ? 53.726 37.547  -13.411 1.00 30.29 ? 452  ARG A C     1 
ATOM   3793 O  O     . ARG C 3 446 ? 54.531 36.630  -13.546 1.00 31.15 ? 452  ARG A O     1 
ATOM   3794 C  CB    . ARG C 3 446 ? 51.583 37.285  -12.150 1.00 30.88 ? 452  ARG A CB    1 
ATOM   3795 C  CG    . ARG C 3 446 ? 51.358 35.933  -11.547 1.00 34.39 ? 452  ARG A CG    1 
ATOM   3796 C  CD    . ARG C 3 446 ? 51.365 35.907  -10.019 1.00 32.33 ? 452  ARG A CD    1 
ATOM   3797 N  NE    . ARG C 3 446 ? 51.209 34.509  -9.653  1.00 34.08 ? 452  ARG A NE    1 
ATOM   3798 C  CZ    . ARG C 3 446 ? 50.840 34.029  -8.473  1.00 32.42 ? 452  ARG A CZ    1 
ATOM   3799 N  NH1   . ARG C 3 446 ? 50.567 34.820  -7.448  1.00 29.11 ? 452  ARG A NH1   1 
ATOM   3800 N  NH2   . ARG C 3 446 ? 50.716 32.718  -8.349  1.00 32.45 ? 452  ARG A NH2   1 
ATOM   3801 N  N     . ALA C 3 447 ? 53.436 38.394  -14.394 1.00 28.76 ? 453  ALA A N     1 
ATOM   3802 C  CA    . ALA C 3 447 ? 54.044 38.251  -15.711 1.00 29.08 ? 453  ALA A CA    1 
ATOM   3803 C  C     . ALA C 3 447 ? 55.558 38.422  -15.664 1.00 27.76 ? 453  ALA A C     1 
ATOM   3804 O  O     . ALA C 3 447 ? 56.271 37.961  -16.555 1.00 27.46 ? 453  ALA A O     1 
ATOM   3805 C  CB    . ALA C 3 447 ? 53.424 39.263  -16.700 1.00 29.96 ? 453  ALA A CB    1 
ATOM   3806 N  N     . ALA C 3 448 ? 56.046 39.083  -14.620 1.00 27.58 ? 454  ALA A N     1 
ATOM   3807 C  CA    . ALA C 3 448 ? 57.479 39.313  -14.465 1.00 25.68 ? 454  ALA A CA    1 
ATOM   3808 C  C     . ALA C 3 448 ? 58.245 38.038  -14.089 1.00 24.68 ? 454  ALA A C     1 
ATOM   3809 O  O     . ALA C 3 448 ? 59.463 37.977  -14.236 1.00 26.94 ? 454  ALA A O     1 
ATOM   3810 C  CB    . ALA C 3 448 ? 57.720 40.401  -13.431 1.00 26.90 ? 454  ALA A CB    1 
ATOM   3811 N  N     . PHE C 3 449 ? 57.539 37.032  -13.588 1.00 25.26 ? 455  PHE A N     1 
ATOM   3812 C  CA    . PHE C 3 449 ? 58.159 35.756  -13.242 1.00 23.96 ? 455  PHE A CA    1 
ATOM   3813 C  C     . PHE C 3 449 ? 57.724 34.749  -14.312 1.00 25.08 ? 455  PHE A C     1 
ATOM   3814 O  O     . PHE C 3 449 ? 56.548 34.410  -14.404 1.00 26.32 ? 455  PHE A O     1 
ATOM   3815 C  CB    . PHE C 3 449 ? 57.690 35.259  -11.865 1.00 23.51 ? 455  PHE A CB    1 
ATOM   3816 C  CG    . PHE C 3 449 ? 58.167 36.106  -10.706 1.00 22.33 ? 455  PHE A CG    1 
ATOM   3817 C  CD1   . PHE C 3 449 ? 57.476 37.259  -10.332 1.00 19.59 ? 455  PHE A CD1   1 
ATOM   3818 C  CD2   . PHE C 3 449 ? 59.312 35.743  -9.990  1.00 20.64 ? 455  PHE A CD2   1 
ATOM   3819 C  CE1   . PHE C 3 449 ? 57.916 38.043  -9.253  1.00 20.50 ? 455  PHE A CE1   1 
ATOM   3820 C  CE2   . PHE C 3 449 ? 59.771 36.515  -8.906  1.00 20.02 ? 455  PHE A CE2   1 
ATOM   3821 C  CZ    . PHE C 3 449 ? 59.072 37.669  -8.534  1.00 20.37 ? 455  PHE A CZ    1 
ATOM   3822 N  N     . GLY C 3 450 ? 58.659 34.273  -15.125 1.00 25.39 ? 456  GLY A N     1 
ATOM   3823 C  CA    . GLY C 3 450 ? 58.283 33.326  -16.161 1.00 25.71 ? 456  GLY A CA    1 
ATOM   3824 C  C     . GLY C 3 450 ? 59.434 32.799  -16.996 1.00 26.95 ? 456  GLY A C     1 
ATOM   3825 O  O     . GLY C 3 450 ? 60.471 33.458  -17.152 1.00 27.23 ? 456  GLY A O     1 
ATOM   3826 N  N     . ALA C 3 451 ? 59.246 31.600  -17.539 1.00 27.02 ? 457  ALA A N     1 
ATOM   3827 C  CA    . ALA C 3 451 ? 60.261 30.956  -18.364 1.00 27.61 ? 457  ALA A CA    1 
ATOM   3828 C  C     . ALA C 3 451 ? 60.669 31.809  -19.556 1.00 28.02 ? 457  ALA A C     1 
ATOM   3829 O  O     . ALA C 3 451 ? 61.812 31.750  -20.001 1.00 29.09 ? 457  ALA A O     1 
ATOM   3830 C  CB    . ALA C 3 451 ? 59.751 29.608  -18.849 1.00 28.78 ? 457  ALA A CB    1 
ATOM   3831 N  N     . GLU C 3 452 ? 59.738 32.603  -20.071 1.00 28.97 ? 458  GLU A N     1 
ATOM   3832 C  CA    . GLU C 3 452 ? 60.028 33.450  -21.223 1.00 30.32 ? 458  GLU A CA    1 
ATOM   3833 C  C     . GLU C 3 452 ? 61.213 34.380  -20.970 1.00 30.47 ? 458  GLU A C     1 
ATOM   3834 O  O     . GLU C 3 452 ? 61.906 34.772  -21.909 1.00 31.12 ? 458  GLU A O     1 
ATOM   3835 C  CB    . GLU C 3 452 ? 58.791 34.281  -21.613 1.00 31.73 ? 458  GLU A CB    1 
ATOM   3836 C  CG    . GLU C 3 452 ? 58.545 35.524  -20.760 1.00 33.25 ? 458  GLU A CG    1 
ATOM   3837 C  CD    . GLU C 3 452 ? 57.380 36.372  -21.261 1.00 36.32 ? 458  GLU A CD    1 
ATOM   3838 O  OE1   . GLU C 3 452 ? 57.266 36.555  -22.494 1.00 37.51 ? 458  GLU A OE1   1 
ATOM   3839 O  OE2   . GLU C 3 452 ? 56.585 36.871  -20.428 1.00 36.43 ? 458  GLU A OE2   1 
ATOM   3840 N  N     . HIS C 3 453 ? 61.457 34.719  -19.704 1.00 30.47 ? 459  HIS A N     1 
ATOM   3841 C  CA    . HIS C 3 453 ? 62.553 35.622  -19.354 1.00 28.72 ? 459  HIS A CA    1 
ATOM   3842 C  C     . HIS C 3 453 ? 63.917 34.944  -19.329 1.00 28.71 ? 459  HIS A C     1 
ATOM   3843 O  O     . HIS C 3 453 ? 64.940 35.586  -19.066 1.00 30.01 ? 459  HIS A O     1 
ATOM   3844 C  CB    . HIS C 3 453 ? 62.266 36.295  -18.012 1.00 28.21 ? 459  HIS A CB    1 
ATOM   3845 C  CG    . HIS C 3 453 ? 60.897 36.895  -17.933 1.00 28.63 ? 459  HIS A CG    1 
ATOM   3846 N  ND1   . HIS C 3 453 ? 60.401 37.738  -18.902 1.00 27.99 ? 459  HIS A ND1   1 
ATOM   3847 C  CD2   . HIS C 3 453 ? 59.916 36.767  -17.006 1.00 30.10 ? 459  HIS A CD2   1 
ATOM   3848 C  CE1   . HIS C 3 453 ? 59.175 38.107  -18.577 1.00 29.36 ? 459  HIS A CE1   1 
ATOM   3849 N  NE2   . HIS C 3 453 ? 58.857 37.533  -17.430 1.00 29.90 ? 459  HIS A NE2   1 
ATOM   3850 N  N     . HIS C 3 454 ? 63.935 33.640  -19.576 1.00 27.54 ? 460  HIS A N     1 
ATOM   3851 C  CA    . HIS C 3 454 ? 65.196 32.920  -19.645 1.00 26.31 ? 460  HIS A CA    1 
ATOM   3852 C  C     . HIS C 3 454 ? 65.426 32.552  -21.117 1.00 26.47 ? 460  HIS A C     1 
ATOM   3853 O  O     . HIS C 3 454 ? 64.556 31.961  -21.752 1.00 26.88 ? 460  HIS A O     1 
ATOM   3854 C  CB    . HIS C 3 454 ? 65.157 31.638  -18.822 1.00 26.90 ? 460  HIS A CB    1 
ATOM   3855 C  CG    . HIS C 3 454 ? 66.320 30.738  -19.088 1.00 26.65 ? 460  HIS A CG    1 
ATOM   3856 N  ND1   . HIS C 3 454 ? 67.577 30.982  -18.580 1.00 28.04 ? 460  HIS A ND1   1 
ATOM   3857 C  CD2   . HIS C 3 454 ? 66.441 29.654  -19.891 1.00 27.45 ? 460  HIS A CD2   1 
ATOM   3858 C  CE1   . HIS C 3 454 ? 68.424 30.090  -19.060 1.00 27.64 ? 460  HIS A CE1   1 
ATOM   3859 N  NE2   . HIS C 3 454 ? 67.761 29.274  -19.859 1.00 28.68 ? 460  HIS A NE2   1 
ATOM   3860 N  N     . LEU C 3 455 ? 66.588 32.899  -21.658 1.00 27.46 ? 461  LEU A N     1 
ATOM   3861 C  CA    . LEU C 3 455 ? 66.898 32.585  -23.056 1.00 29.29 ? 461  LEU A CA    1 
ATOM   3862 C  C     . LEU C 3 455 ? 67.790 31.349  -23.069 1.00 29.49 ? 461  LEU A C     1 
ATOM   3863 O  O     . LEU C 3 455 ? 68.755 31.278  -22.303 1.00 30.06 ? 461  LEU A O     1 
ATOM   3864 C  CB    . LEU C 3 455 ? 67.621 33.764  -23.718 1.00 30.09 ? 461  LEU A CB    1 
ATOM   3865 C  CG    . LEU C 3 455 ? 66.938 35.134  -23.607 1.00 32.01 ? 461  LEU A CG    1 
ATOM   3866 C  CD1   . LEU C 3 455 ? 67.793 36.186  -24.294 1.00 33.38 ? 461  LEU A CD1   1 
ATOM   3867 C  CD2   . LEU C 3 455 ? 65.551 35.091  -24.226 1.00 32.05 ? 461  LEU A CD2   1 
ATOM   3868 N  N     . ASP C 3 456 ? 67.470 30.375  -23.924 1.00 28.49 ? 462  ASP A N     1 
ATOM   3869 C  CA    . ASP C 3 456 ? 68.264 29.153  -23.977 1.00 28.66 ? 462  ASP A CA    1 
ATOM   3870 C  C     . ASP C 3 456 ? 69.746 29.430  -24.149 1.00 28.70 ? 462  ASP A C     1 
ATOM   3871 O  O     . ASP C 3 456 ? 70.144 30.236  -24.991 1.00 28.77 ? 462  ASP A O     1 
ATOM   3872 C  CB    . ASP C 3 456 ? 67.814 28.229  -25.103 1.00 29.72 ? 462  ASP A CB    1 
ATOM   3873 C  CG    . ASP C 3 456 ? 68.416 26.844  -24.969 1.00 32.40 ? 462  ASP A CG    1 
ATOM   3874 O  OD1   . ASP C 3 456 ? 67.991 26.116  -24.038 1.00 29.00 ? 462  ASP A OD1   1 
ATOM   3875 O  OD2   . ASP C 3 456 ? 69.323 26.493  -25.769 1.00 32.55 ? 462  ASP A OD2   1 
ATOM   3876 N  N     . GLY C 3 457 ? 70.557 28.746  -23.348 1.00 28.96 ? 463  GLY A N     1 
ATOM   3877 C  CA    . GLY C 3 457 ? 71.992 28.931  -23.404 1.00 30.37 ? 463  GLY A CA    1 
ATOM   3878 C  C     . GLY C 3 457 ? 72.588 28.646  -24.769 1.00 32.23 ? 463  GLY A C     1 
ATOM   3879 O  O     . GLY C 3 457 ? 73.578 29.267  -25.143 1.00 32.72 ? 463  GLY A O     1 
ATOM   3880 N  N     . ILE C 3 458 ? 71.994 27.716  -25.516 1.00 33.11 ? 464  ILE A N     1 
ATOM   3881 C  CA    . ILE C 3 458 ? 72.500 27.374  -26.846 1.00 33.28 ? 464  ILE A CA    1 
ATOM   3882 C  C     . ILE C 3 458 ? 71.863 28.193  -27.969 1.00 33.26 ? 464  ILE A C     1 
ATOM   3883 O  O     . ILE C 3 458 ? 72.558 28.866  -28.724 1.00 34.98 ? 464  ILE A O     1 
ATOM   3884 C  CB    . ILE C 3 458 ? 72.270 25.874  -27.197 1.00 33.89 ? 464  ILE A CB    1 
ATOM   3885 C  CG1   . ILE C 3 458 ? 72.930 24.959  -26.160 1.00 34.03 ? 464  ILE A CG1   1 
ATOM   3886 C  CG2   . ILE C 3 458 ? 72.824 25.578  -28.594 1.00 33.73 ? 464  ILE A CG2   1 
ATOM   3887 C  CD1   . ILE C 3 458 ? 74.417 25.167  -25.993 1.00 34.88 ? 464  ILE A CD1   1 
ATOM   3888 N  N     . THR C 3 459 ? 70.540 28.128  -28.074 1.00 33.01 ? 465  THR A N     1 
ATOM   3889 C  CA    . THR C 3 459 ? 69.810 28.816  -29.134 1.00 32.32 ? 465  THR A CA    1 
ATOM   3890 C  C     . THR C 3 459 ? 69.373 30.254  -28.874 1.00 33.60 ? 465  THR A C     1 
ATOM   3891 O  O     . THR C 3 459 ? 68.933 30.934  -29.798 1.00 34.61 ? 465  THR A O     1 
ATOM   3892 C  CB    . THR C 3 459 ? 68.536 28.052  -29.501 1.00 31.70 ? 465  THR A CB    1 
ATOM   3893 O  OG1   . THR C 3 459 ? 67.584 28.201  -28.444 1.00 31.20 ? 465  THR A OG1   1 
ATOM   3894 C  CG2   . THR C 3 459 ? 68.832 26.577  -29.712 1.00 31.33 ? 465  THR A CG2   1 
ATOM   3895 N  N     . GLY C 3 460 ? 69.452 30.713  -27.629 1.00 33.81 ? 466  GLY A N     1 
ATOM   3896 C  CA    . GLY C 3 460 ? 69.026 32.072  -27.333 1.00 33.05 ? 466  GLY A CA    1 
ATOM   3897 C  C     . GLY C 3 460 ? 67.509 32.216  -27.360 1.00 33.62 ? 466  GLY A C     1 
ATOM   3898 O  O     . GLY C 3 460 ? 66.980 33.298  -27.123 1.00 34.70 ? 466  GLY A O     1 
ATOM   3899 N  N     . LYS C 3 461 ? 66.798 31.127  -27.645 1.00 33.31 ? 467  LYS A N     1 
ATOM   3900 C  CA    . LYS C 3 461 ? 65.336 31.173  -27.690 1.00 31.79 ? 467  LYS A CA    1 
ATOM   3901 C  C     . LYS C 3 461 ? 64.722 31.132  -26.286 1.00 30.97 ? 467  LYS A C     1 
ATOM   3902 O  O     . LYS C 3 461 ? 65.194 30.408  -25.410 1.00 30.87 ? 467  LYS A O     1 
ATOM   3903 C  CB    . LYS C 3 461 ? 64.793 30.001  -28.514 1.00 31.36 ? 467  LYS A CB    1 
ATOM   3904 C  CG    . LYS C 3 461 ? 65.314 29.951  -29.952 1.00 35.49 ? 467  LYS A CG    1 
ATOM   3905 C  CD    . LYS C 3 461 ? 65.112 31.292  -30.670 1.00 34.84 ? 467  LYS A CD    1 
ATOM   3906 C  CE    . LYS C 3 461 ? 63.644 31.665  -30.757 1.00 35.39 ? 467  LYS A CE    1 
ATOM   3907 N  NZ    . LYS C 3 461 ? 63.467 33.053  -31.253 1.00 36.76 ? 467  LYS A NZ    1 
ATOM   3908 N  N     . PRO C 3 462 ? 63.649 31.903  -26.063 1.00 29.42 ? 468  PRO A N     1 
ATOM   3909 C  CA    . PRO C 3 462 ? 63.006 31.918  -24.750 1.00 28.57 ? 468  PRO A CA    1 
ATOM   3910 C  C     . PRO C 3 462 ? 62.452 30.540  -24.425 1.00 29.06 ? 468  PRO A C     1 
ATOM   3911 O  O     . PRO C 3 462 ? 62.117 29.778  -25.328 1.00 29.00 ? 468  PRO A O     1 
ATOM   3912 C  CB    . PRO C 3 462 ? 61.886 32.945  -24.916 1.00 29.78 ? 468  PRO A CB    1 
ATOM   3913 C  CG    . PRO C 3 462 ? 62.380 33.840  -26.039 1.00 30.47 ? 468  PRO A CG    1 
ATOM   3914 C  CD    . PRO C 3 462 ? 62.968 32.824  -26.991 1.00 30.50 ? 468  PRO A CD    1 
ATOM   3915 N  N     . TRP C 3 463 ? 62.369 30.223  -23.137 1.00 26.71 ? 469  TRP A N     1 
ATOM   3916 C  CA    . TRP C 3 463 ? 61.820 28.950  -22.705 1.00 26.11 ? 469  TRP A CA    1 
ATOM   3917 C  C     . TRP C 3 463 ? 60.324 29.111  -22.504 1.00 26.38 ? 469  TRP A C     1 
ATOM   3918 O  O     . TRP C 3 463 ? 59.802 30.229  -22.496 1.00 26.17 ? 469  TRP A O     1 
ATOM   3919 C  CB    . TRP C 3 463 ? 62.482 28.481  -21.398 1.00 25.21 ? 469  TRP A CB    1 
ATOM   3920 C  CG    . TRP C 3 463 ? 63.740 27.703  -21.623 1.00 23.60 ? 469  TRP A CG    1 
ATOM   3921 C  CD1   . TRP C 3 463 ? 64.695 27.941  -22.582 1.00 22.45 ? 469  TRP A CD1   1 
ATOM   3922 C  CD2   . TRP C 3 463 ? 64.203 26.576  -20.868 1.00 24.21 ? 469  TRP A CD2   1 
ATOM   3923 N  NE1   . TRP C 3 463 ? 65.718 27.034  -22.466 1.00 22.81 ? 469  TRP A NE1   1 
ATOM   3924 C  CE2   . TRP C 3 463 ? 65.447 26.185  -21.424 1.00 22.92 ? 469  TRP A CE2   1 
ATOM   3925 C  CE3   . TRP C 3 463 ? 63.690 25.858  -19.776 1.00 24.06 ? 469  TRP A CE3   1 
ATOM   3926 C  CZ2   . TRP C 3 463 ? 66.186 25.109  -20.923 1.00 23.99 ? 469  TRP A CZ2   1 
ATOM   3927 C  CZ3   . TRP C 3 463 ? 64.426 24.785  -19.277 1.00 24.35 ? 469  TRP A CZ3   1 
ATOM   3928 C  CH2   . TRP C 3 463 ? 65.662 24.421  -19.851 1.00 25.56 ? 469  TRP A CH2   1 
ATOM   3929 N  N     . VAL C 3 464 ? 59.648 27.980  -22.350 1.00 26.22 ? 470  VAL A N     1 
ATOM   3930 C  CA    . VAL C 3 464 ? 58.211 27.927  -22.162 1.00 27.55 ? 470  VAL A CA    1 
ATOM   3931 C  C     . VAL C 3 464 ? 57.900 27.425  -20.752 1.00 28.14 ? 470  VAL A C     1 
ATOM   3932 O  O     . VAL C 3 464 ? 58.646 26.621  -20.179 1.00 27.42 ? 470  VAL A O     1 
ATOM   3933 C  CB    . VAL C 3 464 ? 57.578 26.973  -23.199 1.00 31.26 ? 470  VAL A CB    1 
ATOM   3934 C  CG1   . VAL C 3 464 ? 56.102 26.782  -22.912 1.00 32.86 ? 470  VAL A CG1   1 
ATOM   3935 C  CG2   . VAL C 3 464 ? 57.788 27.538  -24.607 1.00 31.42 ? 470  VAL A CG2   1 
ATOM   3936 N  N     . GLN C 3 465 ? 56.775 27.876  -20.213 1.00 27.19 ? 471  GLN A N     1 
ATOM   3937 C  CA    . GLN C 3 465 ? 56.382 27.507  -18.867 1.00 27.00 ? 471  GLN A CA    1 
ATOM   3938 C  C     . GLN C 3 465 ? 55.186 26.573  -18.767 1.00 26.80 ? 471  GLN A C     1 
ATOM   3939 O  O     . GLN C 3 465 ? 54.187 26.734  -19.466 1.00 26.77 ? 471  GLN A O     1 
ATOM   3940 C  CB    . GLN C 3 465 ? 56.098 28.787  -18.077 1.00 28.62 ? 471  GLN A CB    1 
ATOM   3941 C  CG    . GLN C 3 465 ? 55.927 28.609  -16.582 1.00 26.54 ? 471  GLN A CG    1 
ATOM   3942 C  CD    . GLN C 3 465 ? 55.956 29.944  -15.861 1.00 26.78 ? 471  GLN A CD    1 
ATOM   3943 O  OE1   . GLN C 3 465 ? 56.738 30.824  -16.211 1.00 27.82 ? 471  GLN A OE1   1 
ATOM   3944 N  NE2   . GLN C 3 465 ? 55.118 30.094  -14.842 1.00 27.40 ? 471  GLN A NE2   1 
ATOM   3945 N  N     . ALA C 3 466 ? 55.297 25.595  -17.882 1.00 26.18 ? 472  ALA A N     1 
ATOM   3946 C  CA    . ALA C 3 466 ? 54.212 24.657  -17.639 1.00 27.14 ? 472  ALA A CA    1 
ATOM   3947 C  C     . ALA C 3 466 ? 53.760 24.884  -16.199 1.00 29.22 ? 472  ALA A C     1 
ATOM   3948 O  O     . ALA C 3 466 ? 54.533 24.673  -15.261 1.00 30.14 ? 472  ALA A O     1 
ATOM   3949 C  CB    . ALA C 3 466 ? 54.692 23.224  -17.814 1.00 26.16 ? 472  ALA A CB    1 
ATOM   3950 N  N     . GLY C 3 467 ? 52.526 25.347  -16.024 1.00 28.42 ? 473  GLY A N     1 
ATOM   3951 C  CA    . GLY C 3 467 ? 52.009 25.569  -14.688 1.00 28.11 ? 473  GLY A CA    1 
ATOM   3952 C  C     . GLY C 3 467 ? 50.999 24.490  -14.369 1.00 29.14 ? 473  GLY A C     1 
ATOM   3953 O  O     . GLY C 3 467 ? 50.026 24.330  -15.104 1.00 30.24 ? 473  GLY A O     1 
ATOM   3954 N  N     . ILE C 3 468 ? 51.218 23.747  -13.283 1.00 29.71 ? 474  ILE A N     1 
ATOM   3955 C  CA    . ILE C 3 468 ? 50.309 22.664  -12.909 1.00 28.66 ? 474  ILE A CA    1 
ATOM   3956 C  C     . ILE C 3 468 ? 49.872 22.723  -11.450 1.00 29.52 ? 474  ILE A C     1 
ATOM   3957 O  O     . ILE C 3 468 ? 50.689 22.940  -10.557 1.00 28.30 ? 474  ILE A O     1 
ATOM   3958 C  CB    . ILE C 3 468 ? 50.951 21.271  -13.130 1.00 28.36 ? 474  ILE A CB    1 
ATOM   3959 C  CG1   . ILE C 3 468 ? 51.524 21.147  -14.541 1.00 28.61 ? 474  ILE A CG1   1 
ATOM   3960 C  CG2   . ILE C 3 468 ? 49.914 20.190  -12.904 1.00 27.65 ? 474  ILE A CG2   1 
ATOM   3961 C  CD1   . ILE C 3 468 ? 52.880 21.803  -14.717 1.00 29.56 ? 474  ILE A CD1   1 
ATOM   3962 N  N     . ASP C 3 469 ? 48.582 22.519  -11.204 1.00 31.41 ? 475  ASP A N     1 
ATOM   3963 C  CA    . ASP C 3 469 ? 48.076 22.530  -9.839  1.00 33.73 ? 475  ASP A CA    1 
ATOM   3964 C  C     . ASP C 3 469 ? 47.162 21.344  -9.566  1.00 34.09 ? 475  ASP A C     1 
ATOM   3965 O  O     . ASP C 3 469 ? 46.546 20.791  -10.481 1.00 34.01 ? 475  ASP A O     1 
ATOM   3966 C  CB    . ASP C 3 469 ? 47.341 23.843  -9.538  1.00 37.96 ? 475  ASP A CB    1 
ATOM   3967 C  CG    . ASP C 3 469 ? 46.195 24.106  -10.493 1.00 42.84 ? 475  ASP A CG    1 
ATOM   3968 O  OD1   . ASP C 3 469 ? 46.458 24.365  -11.689 1.00 47.98 ? 475  ASP A OD1   1 
ATOM   3969 O  OD2   . ASP C 3 469 ? 45.026 24.055  -10.053 1.00 47.34 ? 475  ASP A OD2   1 
ATOM   3970 N  N     . ALA C 3 470 ? 47.108 20.941  -8.300  1.00 33.46 ? 476  ALA A N     1 
ATOM   3971 C  CA    . ALA C 3 470 ? 46.273 19.834  -7.862  1.00 33.09 ? 476  ALA A CA    1 
ATOM   3972 C  C     . ALA C 3 470 ? 44.854 20.371  -7.751  1.00 33.59 ? 476  ALA A C     1 
ATOM   3973 O  O     . ALA C 3 470 ? 44.599 21.294  -6.984  1.00 37.46 ? 476  ALA A O     1 
ATOM   3974 C  CB    . ALA C 3 470 ? 46.752 19.336  -6.509  1.00 33.89 ? 476  ALA A CB    1 
ATOM   3975 N  N     . SER C 3 471 ? 43.935 19.792  -8.513  1.00 33.41 ? 477  SER A N     1 
ATOM   3976 C  CA    . SER C 3 471 ? 42.542 20.229  -8.528  1.00 34.02 ? 477  SER A CA    1 
ATOM   3977 C  C     . SER C 3 471 ? 41.775 20.008  -7.223  1.00 33.98 ? 477  SER A C     1 
ATOM   3978 O  O     . SER C 3 471 ? 41.714 18.885  -6.715  1.00 35.55 ? 477  SER A O     1 
ATOM   3979 C  CB    . SER C 3 471 ? 41.797 19.528  -9.665  1.00 33.28 ? 477  SER A CB    1 
ATOM   3980 O  OG    . SER C 3 471 ? 42.449 19.731  -10.901 1.00 32.67 ? 477  SER A OG    1 
ATOM   3981 N  N     . GLY C 3 472 ? 41.181 21.086  -6.707  1.00 33.01 ? 478  GLY A N     1 
ATOM   3982 C  CA    . GLY C 3 472 ? 40.401 21.031  -5.479  1.00 32.68 ? 478  GLY A CA    1 
ATOM   3983 C  C     . GLY C 3 472 ? 40.954 20.042  -4.477  1.00 33.47 ? 478  GLY A C     1 
ATOM   3984 O  O     . GLY C 3 472 ? 40.219 19.242  -3.890  1.00 32.69 ? 478  GLY A O     1 
ATOM   3985 N  N     . LEU C 3 473 ? 42.264 20.111  -4.278  1.00 33.02 ? 479  LEU A N     1 
ATOM   3986 C  CA    . LEU C 3 473 ? 42.952 19.201  -3.383  1.00 34.05 ? 479  LEU A CA    1 
ATOM   3987 C  C     . LEU C 3 473 ? 42.341 19.077  -1.985  1.00 34.29 ? 479  LEU A C     1 
ATOM   3988 O  O     . LEU C 3 473 ? 42.122 17.967  -1.504  1.00 34.09 ? 479  LEU A O     1 
ATOM   3989 C  CB    . LEU C 3 473 ? 44.423 19.604  -3.291  1.00 32.56 ? 479  LEU A CB    1 
ATOM   3990 C  CG    . LEU C 3 473 ? 45.331 18.723  -2.437  1.00 35.67 ? 479  LEU A CG    1 
ATOM   3991 C  CD1   . LEU C 3 473 ? 45.328 17.287  -2.958  1.00 32.26 ? 479  LEU A CD1   1 
ATOM   3992 C  CD2   . LEU C 3 473 ? 46.738 19.308  -2.451  1.00 34.60 ? 479  LEU A CD2   1 
ATOM   3993 N  N     . GLU C 3 474 ? 42.056 20.205  -1.342  1.00 35.28 ? 480  GLU A N     1 
ATOM   3994 C  CA    . GLU C 3 474 ? 41.495 20.190  0.007   1.00 37.54 ? 480  GLU A CA    1 
ATOM   3995 C  C     . GLU C 3 474 ? 40.178 19.434  0.117   1.00 36.44 ? 480  GLU A C     1 
ATOM   3996 O  O     . GLU C 3 474 ? 39.996 18.634  1.035   1.00 36.87 ? 480  GLU A O     1 
ATOM   3997 C  CB    . GLU C 3 474 ? 41.314 21.619  0.539   1.00 40.16 ? 480  GLU A CB    1 
ATOM   3998 C  CG    . GLU C 3 474 ? 42.616 22.343  0.893   1.00 47.42 ? 480  GLU A CG    1 
ATOM   3999 C  CD    . GLU C 3 474 ? 42.930 22.340  2.394   1.00 52.86 ? 480  GLU A CD    1 
ATOM   4000 O  OE1   . GLU C 3 474 ? 42.041 22.715  3.195   1.00 54.51 ? 480  GLU A OE1   1 
ATOM   4001 O  OE2   . GLU C 3 474 ? 44.072 21.981  2.776   1.00 54.82 ? 480  GLU A OE2   1 
ATOM   4002 N  N     . LEU C 3 475 ? 39.255 19.691  -0.802  1.00 34.81 ? 481  LEU A N     1 
ATOM   4003 C  CA    . LEU C 3 475 ? 37.971 19.009  -0.775  1.00 33.98 ? 481  LEU A CA    1 
ATOM   4004 C  C     . LEU C 3 475 ? 38.155 17.510  -0.983  1.00 32.48 ? 481  LEU A C     1 
ATOM   4005 O  O     . LEU C 3 475 ? 37.479 16.700  -0.350  1.00 31.78 ? 481  LEU A O     1 
ATOM   4006 C  CB    . LEU C 3 475 ? 37.033 19.581  -1.843  1.00 35.45 ? 481  LEU A CB    1 
ATOM   4007 C  CG    . LEU C 3 475 ? 36.189 20.746  -1.315  1.00 39.01 ? 481  LEU A CG    1 
ATOM   4008 C  CD1   . LEU C 3 475 ? 35.366 21.390  -2.430  1.00 38.30 ? 481  LEU A CD1   1 
ATOM   4009 C  CD2   . LEU C 3 475 ? 35.284 20.214  -0.209  1.00 39.19 ? 481  LEU A CD2   1 
ATOM   4010 N  N     . ARG C 3 476 ? 39.076 17.146  -1.865  1.00 29.39 ? 482  ARG A N     1 
ATOM   4011 C  CA    . ARG C 3 476 ? 39.329 15.742  -2.128  1.00 28.79 ? 482  ARG A CA    1 
ATOM   4012 C  C     . ARG C 3 476 ? 39.922 15.081  -0.896  1.00 28.67 ? 482  ARG A C     1 
ATOM   4013 O  O     . ARG C 3 476 ? 39.572 13.948  -0.579  1.00 29.46 ? 482  ARG A O     1 
ATOM   4014 C  CB    . ARG C 3 476 ? 40.244 15.590  -3.341  1.00 28.34 ? 482  ARG A CB    1 
ATOM   4015 C  CG    . ARG C 3 476 ? 39.710 16.357  -4.542  1.00 29.31 ? 482  ARG A CG    1 
ATOM   4016 C  CD    . ARG C 3 476 ? 40.148 15.772  -5.876  1.00 31.71 ? 482  ARG A CD    1 
ATOM   4017 N  NE    . ARG C 3 476 ? 39.651 16.579  -6.993  1.00 31.24 ? 482  ARG A NE    1 
ATOM   4018 C  CZ    . ARG C 3 476 ? 39.548 16.141  -8.244  1.00 31.89 ? 482  ARG A CZ    1 
ATOM   4019 N  NH1   . ARG C 3 476 ? 39.902 14.897  -8.550  1.00 30.56 ? 482  ARG A NH1   1 
ATOM   4020 N  NH2   . ARG C 3 476 ? 39.097 16.950  -9.192  1.00 30.92 ? 482  ARG A NH2   1 
ATOM   4021 N  N     . CYS C 3 477 ? 40.801 15.787  -0.183  1.00 26.95 ? 483  CYS A N     1 
ATOM   4022 C  CA    . CYS C 3 477 ? 41.381 15.221  1.025   1.00 25.86 ? 483  CYS A CA    1 
ATOM   4023 C  C     . CYS C 3 477 ? 40.266 15.017  2.037   1.00 26.25 ? 483  CYS A C     1 
ATOM   4024 O  O     . CYS C 3 477 ? 40.243 14.014  2.757   1.00 26.65 ? 483  CYS A O     1 
ATOM   4025 C  CB    . CYS C 3 477 ? 42.447 16.143  1.614   1.00 24.71 ? 483  CYS A CB    1 
ATOM   4026 S  SG    . CYS C 3 477 ? 43.999 16.144  0.702   1.00 27.34 ? 483  CYS A SG    1 
ATOM   4027 N  N     . LEU C 3 478 ? 39.345 15.979  2.088   1.00 25.96 ? 484  LEU A N     1 
ATOM   4028 C  CA    . LEU C 3 478 ? 38.208 15.905  2.996   1.00 25.08 ? 484  LEU A CA    1 
ATOM   4029 C  C     . LEU C 3 478 ? 37.345 14.712  2.613   1.00 24.41 ? 484  LEU A C     1 
ATOM   4030 O  O     . LEU C 3 478 ? 36.923 13.945  3.468   1.00 24.81 ? 484  LEU A O     1 
ATOM   4031 C  CB    . LEU C 3 478 ? 37.365 17.186  2.916   1.00 25.08 ? 484  LEU A CB    1 
ATOM   4032 C  CG    . LEU C 3 478 ? 35.987 17.130  3.593   1.00 22.90 ? 484  LEU A CG    1 
ATOM   4033 C  CD1   . LEU C 3 478 ? 36.140 16.740  5.057   1.00 22.95 ? 484  LEU A CD1   1 
ATOM   4034 C  CD2   . LEU C 3 478 ? 35.307 18.482  3.472   1.00 24.15 ? 484  LEU A CD2   1 
ATOM   4035 N  N     . ALA C 3 479 ? 37.095 14.562  1.317   1.00 24.12 ? 485  ALA A N     1 
ATOM   4036 C  CA    . ALA C 3 479 ? 36.281 13.464  0.825   1.00 25.30 ? 485  ALA A CA    1 
ATOM   4037 C  C     . ALA C 3 479 ? 36.888 12.127  1.260   1.00 26.92 ? 485  ALA A C     1 
ATOM   4038 O  O     . ALA C 3 479 ? 36.185 11.252  1.770   1.00 28.67 ? 485  ALA A O     1 
ATOM   4039 C  CB    . ALA C 3 479 ? 36.176 13.534  -0.696  1.00 22.60 ? 485  ALA A CB    1 
ATOM   4040 N  N     . HIS C 3 480 ? 38.197 11.990  1.064   1.00 26.54 ? 486  HIS A N     1 
ATOM   4041 C  CA    . HIS C 3 480 ? 38.926 10.779  1.430   1.00 26.81 ? 486  HIS A CA    1 
ATOM   4042 C  C     . HIS C 3 480 ? 38.737 10.391  2.900   1.00 27.27 ? 486  HIS A C     1 
ATOM   4043 O  O     . HIS C 3 480 ? 38.455 9.234   3.210   1.00 25.81 ? 486  HIS A O     1 
ATOM   4044 C  CB    . HIS C 3 480 ? 40.421 10.968  1.145   1.00 26.24 ? 486  HIS A CB    1 
ATOM   4045 C  CG    . HIS C 3 480 ? 41.297 9.944   1.797   1.00 26.19 ? 486  HIS A CG    1 
ATOM   4046 N  ND1   . HIS C 3 480 ? 41.450 8.664   1.303   1.00 26.75 ? 486  HIS A ND1   1 
ATOM   4047 C  CD2   . HIS C 3 480 ? 42.044 10.003  2.925   1.00 26.25 ? 486  HIS A CD2   1 
ATOM   4048 C  CE1   . HIS C 3 480 ? 42.252 7.981   2.099   1.00 26.87 ? 486  HIS A CE1   1 
ATOM   4049 N  NE2   . HIS C 3 480 ? 42.627 8.770   3.090   1.00 26.59 ? 486  HIS A NE2   1 
ATOM   4050 N  N     . PHE C 3 481 ? 38.887 11.353  3.806   1.00 27.26 ? 487  PHE A N     1 
ATOM   4051 C  CA    . PHE C 3 481 ? 38.742 11.041  5.220   1.00 29.04 ? 487  PHE A CA    1 
ATOM   4052 C  C     . PHE C 3 481 ? 37.302 10.752  5.649   1.00 30.62 ? 487  PHE A C     1 
ATOM   4053 O  O     . PHE C 3 481 ? 37.078 10.040  6.624   1.00 29.92 ? 487  PHE A O     1 
ATOM   4054 C  CB    . PHE C 3 481 ? 39.366 12.150  6.072   1.00 26.99 ? 487  PHE A CB    1 
ATOM   4055 C  CG    . PHE C 3 481 ? 40.879 12.134  6.065   1.00 27.34 ? 487  PHE A CG    1 
ATOM   4056 C  CD1   . PHE C 3 481 ? 41.580 11.100  6.689   1.00 27.38 ? 487  PHE A CD1   1 
ATOM   4057 C  CD2   . PHE C 3 481 ? 41.603 13.137  5.418   1.00 28.41 ? 487  PHE A CD2   1 
ATOM   4058 C  CE1   . PHE C 3 481 ? 42.978 11.060  6.672   1.00 26.71 ? 487  PHE A CE1   1 
ATOM   4059 C  CE2   . PHE C 3 481 ? 43.009 13.112  5.391   1.00 26.78 ? 487  PHE A CE2   1 
ATOM   4060 C  CZ    . PHE C 3 481 ? 43.698 12.071  6.020   1.00 26.26 ? 487  PHE A CZ    1 
ATOM   4061 N  N     . MET C 3 482 ? 36.318 11.273  4.924   1.00 32.87 ? 488  MET A N     1 
ATOM   4062 C  CA    . MET C 3 482 ? 34.949 10.983  5.314   1.00 34.81 ? 488  MET A CA    1 
ATOM   4063 C  C     . MET C 3 482 ? 34.437 9.710   4.651   1.00 34.03 ? 488  MET A C     1 
ATOM   4064 O  O     . MET C 3 482 ? 33.359 9.221   4.981   1.00 34.53 ? 488  MET A O     1 
ATOM   4065 C  CB    . MET C 3 482 ? 34.014 12.183  5.045   1.00 35.16 ? 488  MET A CB    1 
ATOM   4066 C  CG    . MET C 3 482 ? 34.137 12.886  3.719   1.00 37.56 ? 488  MET A CG    1 
ATOM   4067 S  SD    . MET C 3 482 ? 33.411 14.583  3.815   1.00 38.88 ? 488  MET A SD    1 
ATOM   4068 C  CE    . MET C 3 482 ? 31.663 14.213  3.648   1.00 39.16 ? 488  MET A CE    1 
ATOM   4069 N  N     . ALA C 3 483 ? 35.238 9.156   3.748   1.00 32.52 ? 489  ALA A N     1 
ATOM   4070 C  CA    . ALA C 3 483 ? 34.869 7.932   3.046   1.00 34.47 ? 489  ALA A CA    1 
ATOM   4071 C  C     . ALA C 3 483 ? 34.585 6.763   3.982   1.00 35.54 ? 489  ALA A C     1 
ATOM   4072 O  O     . ALA C 3 483 ? 33.767 5.902   3.665   1.00 36.61 ? 489  ALA A O     1 
ATOM   4073 C  CB    . ALA C 3 483 ? 35.968 7.538   2.058   1.00 33.99 ? 489  ALA A CB    1 
ATOM   4074 N  N     . ARG C 3 484 ? 35.251 6.713   5.130   1.00 35.98 ? 490  ARG A N     1 
ATOM   4075 C  CA    . ARG C 3 484 ? 35.011 5.603   6.033   1.00 37.98 ? 490  ARG A CA    1 
ATOM   4076 C  C     . ARG C 3 484 ? 33.703 5.797   6.797   1.00 39.18 ? 490  ARG A C     1 
ATOM   4077 O  O     . ARG C 3 484 ? 33.287 4.929   7.569   1.00 40.02 ? 490  ARG A O     1 
ATOM   4078 C  CB    . ARG C 3 484 ? 36.191 5.420   7.007   1.00 39.03 ? 490  ARG A CB    1 
ATOM   4079 C  CG    . ARG C 3 484 ? 36.165 6.275   8.257   1.00 41.09 ? 490  ARG A CG    1 
ATOM   4080 C  CD    . ARG C 3 484 ? 36.443 5.413   9.483   1.00 42.85 ? 490  ARG A CD    1 
ATOM   4081 N  NE    . ARG C 3 484 ? 37.736 5.674   10.125  1.00 46.29 ? 490  ARG A NE    1 
ATOM   4082 C  CZ    . ARG C 3 484 ? 38.924 5.504   9.550   1.00 45.52 ? 490  ARG A CZ    1 
ATOM   4083 N  NH1   . ARG C 3 484 ? 39.008 5.071   8.299   1.00 47.64 ? 490  ARG A NH1   1 
ATOM   4084 N  NH2   . ARG C 3 484 ? 40.035 5.747   10.234  1.00 45.80 ? 490  ARG A NH2   1 
ATOM   4085 N  N     . PHE C 3 485 ? 33.048 6.929   6.561   1.00 39.06 ? 491  PHE A N     1 
ATOM   4086 C  CA    . PHE C 3 485 ? 31.790 7.236   7.234   1.00 38.59 ? 491  PHE A CA    1 
ATOM   4087 C  C     . PHE C 3 485 ? 30.632 7.364   6.253   1.00 38.57 ? 491  PHE A C     1 
ATOM   4088 O  O     . PHE C 3 485 ? 29.478 7.213   6.640   1.00 39.65 ? 491  PHE A O     1 
ATOM   4089 C  CB    . PHE C 3 485 ? 31.918 8.536   8.024   1.00 36.91 ? 491  PHE A CB    1 
ATOM   4090 C  CG    . PHE C 3 485 ? 32.995 8.509   9.063   1.00 36.10 ? 491  PHE A CG    1 
ATOM   4091 C  CD1   . PHE C 3 485 ? 32.861 7.722   10.202  1.00 36.44 ? 491  PHE A CD1   1 
ATOM   4092 C  CD2   . PHE C 3 485 ? 34.135 9.292   8.918   1.00 35.90 ? 491  PHE A CD2   1 
ATOM   4093 C  CE1   . PHE C 3 485 ? 33.850 7.720   11.190  1.00 35.44 ? 491  PHE A CE1   1 
ATOM   4094 C  CE2   . PHE C 3 485 ? 35.126 9.299   9.893   1.00 36.20 ? 491  PHE A CE2   1 
ATOM   4095 C  CZ    . PHE C 3 485 ? 34.983 8.511   11.033  1.00 36.33 ? 491  PHE A CZ    1 
ATOM   4096 N  N     . ASP C 3 486 ? 30.939 7.636   4.987   1.00 38.51 ? 492  ASP A N     1 
ATOM   4097 C  CA    . ASP C 3 486 ? 29.901 7.788   3.969   1.00 38.23 ? 492  ASP A CA    1 
ATOM   4098 C  C     . ASP C 3 486 ? 30.146 6.894   2.751   1.00 37.81 ? 492  ASP A C     1 
ATOM   4099 O  O     . ASP C 3 486 ? 29.457 7.002   1.744   1.00 38.73 ? 492  ASP A O     1 
ATOM   4100 C  CB    . ASP C 3 486 ? 29.808 9.260   3.535   1.00 38.86 ? 492  ASP A CB    1 
ATOM   4101 C  CG    . ASP C 3 486 ? 30.956 9.683   2.630   1.00 39.18 ? 492  ASP A CG    1 
ATOM   4102 O  OD1   . ASP C 3 486 ? 32.053 9.097   2.752   1.00 36.07 ? 492  ASP A OD1   1 
ATOM   4103 O  OD2   . ASP C 3 486 ? 30.759 10.609  1.805   1.00 39.62 ? 492  ASP A OD2   1 
ATOM   4104 N  N     . ASN C 3 487 ? 31.142 6.024   2.849   1.00 38.26 ? 493  ASN A N     1 
ATOM   4105 C  CA    . ASN C 3 487 ? 31.480 5.089   1.774   1.00 37.59 ? 493  ASN A CA    1 
ATOM   4106 C  C     . ASN C 3 487 ? 31.850 5.696   0.422   1.00 36.72 ? 493  ASN A C     1 
ATOM   4107 O  O     . ASN C 3 487 ? 31.564 5.106   -0.619  1.00 38.51 ? 493  ASN A O     1 
ATOM   4108 C  CB    . ASN C 3 487 ? 30.331 4.097   1.577   1.00 37.57 ? 493  ASN A CB    1 
ATOM   4109 C  CG    . ASN C 3 487 ? 29.974 3.373   2.850   1.00 38.58 ? 493  ASN A CG    1 
ATOM   4110 O  OD1   . ASN C 3 487 ? 30.829 2.748   3.477   1.00 42.11 ? 493  ASN A OD1   1 
ATOM   4111 N  ND2   . ASN C 3 487 ? 28.711 3.454   3.246   1.00 39.85 ? 493  ASN A ND2   1 
ATOM   4112 N  N     . GLY C 3 488 ? 32.487 6.861   0.428   1.00 35.53 ? 494  GLY A N     1 
ATOM   4113 C  CA    . GLY C 3 488 ? 32.881 7.479   -0.826  1.00 33.63 ? 494  GLY A CA    1 
ATOM   4114 C  C     . GLY C 3 488 ? 31.825 8.348   -1.483  1.00 33.46 ? 494  GLY A C     1 
ATOM   4115 O  O     . GLY C 3 488 ? 32.012 8.824   -2.604  1.00 32.50 ? 494  GLY A O     1 
ATOM   4116 N  N     . GLU C 3 489 ? 30.714 8.563   -0.787  1.00 33.72 ? 495  GLU A N     1 
ATOM   4117 C  CA    . GLU C 3 489 ? 29.631 9.375   -1.326  1.00 34.57 ? 495  GLU A CA    1 
ATOM   4118 C  C     . GLU C 3 489 ? 30.116 10.769  -1.726  1.00 34.96 ? 495  GLU A C     1 
ATOM   4119 O  O     . GLU C 3 489 ? 29.869 11.222  -2.844  1.00 34.69 ? 495  GLU A O     1 
ATOM   4120 C  CB    . GLU C 3 489 ? 28.497 9.487   -0.298  1.00 35.39 ? 495  GLU A CB    1 
ATOM   4121 N  N     . TYR C 3 490 ? 30.810 11.442  -0.812  1.00 35.57 ? 496  TYR A N     1 
ATOM   4122 C  CA    . TYR C 3 490 ? 31.326 12.783  -1.071  1.00 37.47 ? 496  TYR A CA    1 
ATOM   4123 C  C     . TYR C 3 490 ? 32.338 12.760  -2.225  1.00 38.03 ? 496  TYR A C     1 
ATOM   4124 O  O     . TYR C 3 490 ? 32.330 13.635  -3.092  1.00 38.88 ? 496  TYR A O     1 
ATOM   4125 C  CB    . TYR C 3 490 ? 31.992 13.325  0.194   1.00 39.69 ? 496  TYR A CB    1 
ATOM   4126 C  CG    . TYR C 3 490 ? 31.940 14.829  0.348   1.00 41.20 ? 496  TYR A CG    1 
ATOM   4127 C  CD1   . TYR C 3 490 ? 30.774 15.465  0.775   1.00 41.70 ? 496  TYR A CD1   1 
ATOM   4128 C  CD2   . TYR C 3 490 ? 33.069 15.612  0.114   1.00 41.00 ? 496  TYR A CD2   1 
ATOM   4129 C  CE1   . TYR C 3 490 ? 30.737 16.846  0.975   1.00 42.25 ? 496  TYR A CE1   1 
ATOM   4130 C  CE2   . TYR C 3 490 ? 33.043 16.987  0.307   1.00 42.67 ? 496  TYR A CE2   1 
ATOM   4131 C  CZ    . TYR C 3 490 ? 31.875 17.599  0.741   1.00 43.56 ? 496  TYR A CZ    1 
ATOM   4132 O  OH    . TYR C 3 490 ? 31.858 18.962  0.956   1.00 44.41 ? 496  TYR A OH    1 
ATOM   4133 N  N     . ALA C 3 491 ? 33.210 11.757  -2.230  1.00 38.79 ? 497  ALA A N     1 
ATOM   4134 C  CA    . ALA C 3 491 ? 34.212 11.618  -3.282  1.00 40.15 ? 497  ALA A CA    1 
ATOM   4135 C  C     . ALA C 3 491 ? 33.518 11.410  -4.629  1.00 41.94 ? 497  ALA A C     1 
ATOM   4136 O  O     . ALA C 3 491 ? 33.952 11.929  -5.661  1.00 41.83 ? 497  ALA A O     1 
ATOM   4137 C  CB    . ALA C 3 491 ? 35.128 10.430  -2.978  1.00 38.44 ? 497  ALA A CB    1 
ATOM   4138 N  N     . HIS C 3 492 ? 32.432 10.647  -4.611  1.00 44.21 ? 498  HIS A N     1 
ATOM   4139 C  CA    . HIS C 3 492 ? 31.685 10.374  -5.831  1.00 46.08 ? 498  HIS A CA    1 
ATOM   4140 C  C     . HIS C 3 492 ? 31.005 11.636  -6.358  1.00 44.61 ? 498  HIS A C     1 
ATOM   4141 O  O     . HIS C 3 492 ? 30.925 11.844  -7.568  1.00 44.02 ? 498  HIS A O     1 
ATOM   4142 C  CB    . HIS C 3 492 ? 30.650 9.273   -5.578  1.00 49.42 ? 498  HIS A CB    1 
ATOM   4143 C  CG    . HIS C 3 492 ? 29.892 8.870   -6.803  1.00 52.97 ? 498  HIS A CG    1 
ATOM   4144 N  ND1   . HIS C 3 492 ? 28.880 9.638   -7.339  1.00 55.07 ? 498  HIS A ND1   1 
ATOM   4145 C  CD2   . HIS C 3 492 ? 30.030 7.802   -7.625  1.00 54.49 ? 498  HIS A CD2   1 
ATOM   4146 C  CE1   . HIS C 3 492 ? 28.429 9.062   -8.440  1.00 55.69 ? 498  HIS A CE1   1 
ATOM   4147 N  NE2   . HIS C 3 492 ? 29.111 7.947   -8.636  1.00 55.60 ? 498  HIS A NE2   1 
ATOM   4148 N  N     . GLU C 3 493 ? 30.533 12.486  -5.451  1.00 44.38 ? 499  GLU A N     1 
ATOM   4149 C  CA    . GLU C 3 493 ? 29.865 13.721  -5.850  1.00 44.73 ? 499  GLU A CA    1 
ATOM   4150 C  C     . GLU C 3 493 ? 30.831 14.742  -6.462  1.00 44.49 ? 499  GLU A C     1 
ATOM   4151 O  O     . GLU C 3 493 ? 30.480 15.470  -7.395  1.00 43.12 ? 499  GLU A O     1 
ATOM   4152 C  CB    . GLU C 3 493 ? 29.162 14.349  -4.649  1.00 46.74 ? 499  GLU A CB    1 
ATOM   4153 C  CG    . GLU C 3 493 ? 28.266 15.517  -5.027  1.00 50.88 ? 499  GLU A CG    1 
ATOM   4154 C  CD    . GLU C 3 493 ? 27.036 15.082  -5.811  1.00 52.36 ? 499  GLU A CD    1 
ATOM   4155 O  OE1   . GLU C 3 493 ? 26.739 15.718  -6.845  1.00 54.13 ? 499  GLU A OE1   1 
ATOM   4156 O  OE2   . GLU C 3 493 ? 26.360 14.114  -5.391  1.00 52.68 ? 499  GLU A OE2   1 
ATOM   4157 N  N     . ILE C 3 494 ? 32.046 14.799  -5.924  1.00 44.38 ? 500  ILE A N     1 
ATOM   4158 C  CA    . ILE C 3 494 ? 33.063 15.720  -6.416  1.00 44.61 ? 500  ILE A CA    1 
ATOM   4159 C  C     . ILE C 3 494 ? 33.452 15.358  -7.849  1.00 45.83 ? 500  ILE A C     1 
ATOM   4160 O  O     . ILE C 3 494 ? 33.537 16.220  -8.725  1.00 44.93 ? 500  ILE A O     1 
ATOM   4161 C  CB    . ILE C 3 494 ? 34.336 15.662  -5.533  1.00 43.65 ? 500  ILE A CB    1 
ATOM   4162 C  CG1   . ILE C 3 494 ? 33.994 16.078  -4.100  1.00 44.23 ? 500  ILE A CG1   1 
ATOM   4163 C  CG2   . ILE C 3 494 ? 35.421 16.554  -6.119  1.00 42.03 ? 500  ILE A CG2   1 
ATOM   4164 C  CD1   . ILE C 3 494 ? 35.152 15.972  -3.118  1.00 42.47 ? 500  ILE A CD1   1 
ATOM   4165 N  N     . LEU C 3 495 ? 33.679 14.069  -8.071  1.00 47.58 ? 501  LEU A N     1 
ATOM   4166 C  CA    . LEU C 3 495 ? 34.086 13.553  -9.371  1.00 50.36 ? 501  LEU A CA    1 
ATOM   4167 C  C     . LEU C 3 495 ? 33.008 13.532  -10.460 1.00 52.11 ? 501  LEU A C     1 
ATOM   4168 O  O     . LEU C 3 495 ? 33.326 13.652  -11.647 1.00 51.22 ? 501  LEU A O     1 
ATOM   4169 C  CB    . LEU C 3 495 ? 34.657 12.142  -9.195  1.00 50.45 ? 501  LEU A CB    1 
ATOM   4170 C  CG    . LEU C 3 495 ? 36.091 12.017  -8.660  1.00 52.19 ? 501  LEU A CG    1 
ATOM   4171 C  CD1   . LEU C 3 495 ? 36.355 13.025  -7.543  1.00 51.29 ? 501  LEU A CD1   1 
ATOM   4172 C  CD2   . LEU C 3 495 ? 36.309 10.587  -8.173  1.00 52.65 ? 501  LEU A CD2   1 
ATOM   4173 N  N     . ASN C 3 496 ? 31.742 13.387  -10.071 1.00 53.63 ? 502  ASN A N     1 
ATOM   4174 C  CA    . ASN C 3 496 ? 30.668 13.328  -11.061 1.00 54.65 ? 502  ASN A CA    1 
ATOM   4175 C  C     . ASN C 3 496 ? 29.580 14.384  -10.891 1.00 54.97 ? 502  ASN A C     1 
ATOM   4176 O  O     . ASN C 3 496 ? 29.216 15.067  -11.851 1.00 55.77 ? 502  ASN A O     1 
ATOM   4177 C  CB    . ASN C 3 496 ? 30.044 11.933  -11.046 1.00 54.29 ? 502  ASN A CB    1 
ATOM   4178 C  CG    . ASN C 3 496 ? 31.088 10.836  -11.099 1.00 54.95 ? 502  ASN A CG    1 
ATOM   4179 O  OD1   . ASN C 3 496 ? 31.866 10.745  -12.051 1.00 54.85 ? 502  ASN A OD1   1 
ATOM   4180 N  ND2   . ASN C 3 496 ? 31.116 9.998   -10.067 1.00 55.49 ? 502  ASN A ND2   1 
ATOM   4181 N  N     . GLY C 3 497 ? 29.057 14.518  -9.677  1.00 54.53 ? 503  GLY A N     1 
ATOM   4182 C  CA    . GLY C 3 497 ? 28.019 15.505  -9.438  1.00 53.80 ? 503  GLY A CA    1 
ATOM   4183 C  C     . GLY C 3 497 ? 28.582 16.905  -9.270  1.00 53.65 ? 503  GLY A C     1 
ATOM   4184 O  O     . GLY C 3 497 ? 29.543 17.282  -9.943  1.00 53.08 ? 503  GLY A O     1 
ATOM   4185 N  N     . ASP C 3 498 ? 27.973 17.685  -8.382  1.00 54.01 ? 504  ASP A N     1 
ATOM   4186 C  CA    . ASP C 3 498 ? 28.439 19.040  -8.111  1.00 54.52 ? 504  ASP A CA    1 
ATOM   4187 C  C     . ASP C 3 498 ? 28.508 19.265  -6.607  1.00 54.08 ? 504  ASP A C     1 
ATOM   4188 O  O     . ASP C 3 498 ? 27.563 19.764  -5.995  1.00 53.33 ? 504  ASP A O     1 
ATOM   4189 C  CB    . ASP C 3 498 ? 27.516 20.084  -8.739  1.00 55.26 ? 504  ASP A CB    1 
ATOM   4190 C  CG    . ASP C 3 498 ? 28.020 21.498  -8.516  1.00 56.93 ? 504  ASP A CG    1 
ATOM   4191 O  OD1   . ASP C 3 498 ? 29.162 21.792  -8.942  1.00 57.34 ? 504  ASP A OD1   1 
ATOM   4192 O  OD2   . ASP C 3 498 ? 27.287 22.312  -7.911  1.00 56.74 ? 504  ASP A OD2   1 
ATOM   4193 N  N     . ILE C 3 499 ? 29.642 18.890  -6.028  1.00 54.12 ? 505  ILE A N     1 
ATOM   4194 C  CA    . ILE C 3 499 ? 29.879 19.015  -4.596  1.00 54.54 ? 505  ILE A CA    1 
ATOM   4195 C  C     . ILE C 3 499 ? 29.476 20.394  -4.050  1.00 54.88 ? 505  ILE A C     1 
ATOM   4196 O  O     . ILE C 3 499 ? 28.999 20.507  -2.917  1.00 54.19 ? 505  ILE A O     1 
ATOM   4197 C  CB    . ILE C 3 499 ? 31.378 18.727  -4.273  1.00 53.71 ? 505  ILE A CB    1 
ATOM   4198 C  CG1   . ILE C 3 499 ? 31.552 18.439  -2.781  1.00 54.15 ? 505  ILE A CG1   1 
ATOM   4199 C  CG2   . ILE C 3 499 ? 32.244 19.898  -4.704  1.00 52.91 ? 505  ILE A CG2   1 
ATOM   4200 C  CD1   . ILE C 3 499 ? 30.964 17.109  -2.347  1.00 54.96 ? 505  ILE A CD1   1 
ATOM   4201 N  N     . HIS C 3 500 ? 29.656 21.438  -4.855  1.00 55.37 ? 506  HIS A N     1 
ATOM   4202 C  CA    . HIS C 3 500 ? 29.304 22.787  -4.420  1.00 57.12 ? 506  HIS A CA    1 
ATOM   4203 C  C     . HIS C 3 500 ? 27.796 22.974  -4.265  1.00 57.41 ? 506  HIS A C     1 
ATOM   4204 O  O     . HIS C 3 500 ? 27.332 23.499  -3.250  1.00 57.95 ? 506  HIS A O     1 
ATOM   4205 C  CB    . HIS C 3 500 ? 29.871 23.824  -5.393  1.00 57.53 ? 506  HIS A CB    1 
ATOM   4206 C  CG    . HIS C 3 500 ? 31.366 23.892  -5.389  1.00 57.91 ? 506  HIS A CG    1 
ATOM   4207 N  ND1   . HIS C 3 500 ? 32.098 24.077  -4.234  1.00 58.09 ? 506  HIS A ND1   1 
ATOM   4208 C  CD2   . HIS C 3 500 ? 32.269 23.790  -6.394  1.00 58.15 ? 506  HIS A CD2   1 
ATOM   4209 C  CE1   . HIS C 3 500 ? 33.386 24.085  -4.529  1.00 58.44 ? 506  HIS A CE1   1 
ATOM   4210 N  NE2   . HIS C 3 500 ? 33.518 23.914  -5.832  1.00 58.53 ? 506  HIS A NE2   1 
ATOM   4211 N  N     . THR C 3 501 ? 27.029 22.545  -5.262  1.00 57.53 ? 507  THR A N     1 
ATOM   4212 C  CA    . THR C 3 501 ? 25.579 22.670  -5.182  1.00 57.62 ? 507  THR A CA    1 
ATOM   4213 C  C     . THR C 3 501 ? 25.113 21.887  -3.963  1.00 57.03 ? 507  THR A C     1 
ATOM   4214 O  O     . THR C 3 501 ? 24.340 22.395  -3.144  1.00 57.96 ? 507  THR A O     1 
ATOM   4215 C  CB    . THR C 3 501 ? 24.882 22.103  -6.438  1.00 57.77 ? 507  THR A CB    1 
ATOM   4216 N  N     . LYS C 3 502 ? 25.598 20.653  -3.843  1.00 56.52 ? 508  LYS A N     1 
ATOM   4217 C  CA    . LYS C 3 502 ? 25.240 19.792  -2.720  1.00 56.14 ? 508  LYS A CA    1 
ATOM   4218 C  C     . LYS C 3 502 ? 25.487 20.513  -1.402  1.00 56.14 ? 508  LYS A C     1 
ATOM   4219 O  O     . LYS C 3 502 ? 24.649 20.476  -0.501  1.00 55.17 ? 508  LYS A O     1 
ATOM   4220 C  CB    . LYS C 3 502 ? 26.044 18.487  -2.763  1.00 55.73 ? 508  LYS A CB    1 
ATOM   4221 C  CG    . LYS C 3 502 ? 25.891 17.625  -1.512  1.00 56.25 ? 508  LYS A CG    1 
ATOM   4222 C  CD    . LYS C 3 502 ? 26.556 16.259  -1.662  1.00 57.15 ? 508  LYS A CD    1 
ATOM   4223 C  CE    . LYS C 3 502 ? 25.828 15.401  -2.693  1.00 59.24 ? 508  LYS A CE    1 
ATOM   4224 N  NZ    . LYS C 3 502 ? 26.312 13.985  -2.724  1.00 59.59 ? 508  LYS A NZ    1 
ATOM   4225 N  N     . ASN C 3 503 ? 26.639 21.168  -1.287  1.00 56.20 ? 509  ASN A N     1 
ATOM   4226 C  CA    . ASN C 3 503 ? 26.946 21.900  -0.067  1.00 57.20 ? 509  ASN A CA    1 
ATOM   4227 C  C     . ASN C 3 503 ? 26.016 23.106  0.077   1.00 57.88 ? 509  ASN A C     1 
ATOM   4228 O  O     . ASN C 3 503 ? 25.733 23.551  1.190   1.00 57.73 ? 509  ASN A O     1 
ATOM   4229 C  CB    . ASN C 3 503 ? 28.412 22.355  -0.056  1.00 57.72 ? 509  ASN A CB    1 
ATOM   4230 C  CG    . ASN C 3 503 ? 29.383 21.193  0.109   1.00 57.97 ? 509  ASN A CG    1 
ATOM   4231 O  OD1   . ASN C 3 503 ? 29.175 20.305  0.941   1.00 57.27 ? 509  ASN A OD1   1 
ATOM   4232 N  ND2   . ASN C 3 503 ? 30.456 21.201  -0.677  1.00 57.30 ? 509  ASN A ND2   1 
ATOM   4233 N  N     . GLN C 3 504 ? 25.538 23.630  -1.050  1.00 58.50 ? 510  GLN A N     1 
ATOM   4234 C  CA    . GLN C 3 504 ? 24.628 24.773  -1.022  1.00 58.86 ? 510  GLN A CA    1 
ATOM   4235 C  C     . GLN C 3 504 ? 23.281 24.319  -0.468  1.00 58.62 ? 510  GLN A C     1 
ATOM   4236 O  O     . GLN C 3 504 ? 22.549 25.105  0.131   1.00 59.68 ? 510  GLN A O     1 
ATOM   4237 C  CB    . GLN C 3 504 ? 24.442 25.352  -2.428  1.00 59.20 ? 510  GLN A CB    1 
ATOM   4238 N  N     . ILE C 3 505 ? 22.960 23.046  -0.671  1.00 57.54 ? 511  ILE A N     1 
ATOM   4239 C  CA    . ILE C 3 505 ? 21.705 22.491  -0.182  1.00 56.86 ? 511  ILE A CA    1 
ATOM   4240 C  C     . ILE C 3 505 ? 21.842 22.070  1.279   1.00 57.21 ? 511  ILE A C     1 
ATOM   4241 O  O     . ILE C 3 505 ? 20.937 22.300  2.085   1.00 57.23 ? 511  ILE A O     1 
ATOM   4242 C  CB    . ILE C 3 505 ? 21.275 21.266  -1.016  1.00 55.53 ? 511  ILE A CB    1 
ATOM   4243 C  CG1   . ILE C 3 505 ? 21.084 21.680  -2.477  1.00 55.65 ? 511  ILE A CG1   1 
ATOM   4244 C  CG2   . ILE C 3 505 ? 19.988 20.682  -0.463  1.00 55.09 ? 511  ILE A CG2   1 
ATOM   4245 C  CD1   . ILE C 3 505 ? 20.777 20.529  -3.415  1.00 52.58 ? 511  ILE A CD1   1 
ATOM   4246 N  N     . ALA C 3 506 ? 22.974 21.455  1.616   1.00 56.83 ? 512  ALA A N     1 
ATOM   4247 C  CA    . ALA C 3 506 ? 23.223 21.005  2.983   1.00 57.23 ? 512  ALA A CA    1 
ATOM   4248 C  C     . ALA C 3 506 ? 23.204 22.218  3.899   1.00 57.84 ? 512  ALA A C     1 
ATOM   4249 O  O     . ALA C 3 506 ? 22.623 22.192  4.987   1.00 58.10 ? 512  ALA A O     1 
ATOM   4250 C  CB    . ALA C 3 506 ? 24.570 20.305  3.069   1.00 56.99 ? 512  ALA A CB    1 
ATOM   4251 N  N     . ALA C 3 507 ? 23.861 23.279  3.448   1.00 58.07 ? 513  ALA A N     1 
ATOM   4252 C  CA    . ALA C 3 507 ? 23.908 24.525  4.193   1.00 58.42 ? 513  ALA A CA    1 
ATOM   4253 C  C     . ALA C 3 507 ? 22.855 25.416  3.545   1.00 59.06 ? 513  ALA A C     1 
ATOM   4254 O  O     . ALA C 3 507 ? 23.006 25.807  2.389   1.00 58.70 ? 513  ALA A O     1 
ATOM   4255 C  CB    . ALA C 3 507 ? 25.291 25.156  4.069   1.00 57.35 ? 513  ALA A CB    1 
ATOM   4256 N  N     . GLU C 3 508 ? 21.780 25.716  4.272   1.00 59.67 ? 514  GLU A N     1 
ATOM   4257 C  CA    . GLU C 3 508 ? 20.720 26.556  3.723   1.00 60.76 ? 514  GLU A CA    1 
ATOM   4258 C  C     . GLU C 3 508 ? 21.280 27.922  3.340   1.00 60.77 ? 514  GLU A C     1 
ATOM   4259 O  O     . GLU C 3 508 ? 21.124 28.904  4.071   1.00 61.37 ? 514  GLU A O     1 
ATOM   4260 C  CB    . GLU C 3 508 ? 19.572 26.716  4.729   1.00 60.92 ? 514  GLU A CB    1 
ATOM   4261 C  CG    . GLU C 3 508 ? 18.354 25.827  4.449   1.00 62.51 ? 514  GLU A CG    1 
ATOM   4262 C  CD    . GLU C 3 508 ? 18.526 24.384  4.916   1.00 63.62 ? 514  GLU A CD    1 
ATOM   4263 O  OE1   . GLU C 3 508 ? 17.635 23.554  4.623   1.00 63.50 ? 514  GLU A OE1   1 
ATOM   4264 O  OE2   . GLU C 3 508 ? 19.541 24.077  5.581   1.00 64.27 ? 514  GLU A OE2   1 
ATOM   4265 N  N     . LEU C 3 509 ? 21.948 27.965  2.191   1.00 60.63 ? 515  LEU A N     1 
ATOM   4266 C  CA    . LEU C 3 509 ? 22.545 29.190  1.681   1.00 61.33 ? 515  LEU A CA    1 
ATOM   4267 C  C     . LEU C 3 509 ? 21.937 29.488  0.311   1.00 62.00 ? 515  LEU A C     1 
ATOM   4268 O  O     . LEU C 3 509 ? 21.577 28.567  -0.434  1.00 61.83 ? 515  LEU A O     1 
ATOM   4269 C  CB    . LEU C 3 509 ? 24.067 29.034  1.564   1.00 60.68 ? 515  LEU A CB    1 
ATOM   4270 N  N     . PRO C 3 510 ? 21.820 30.782  -0.040  1.00 62.01 ? 516  PRO A N     1 
ATOM   4271 C  CA    . PRO C 3 510 ? 21.254 31.244  -1.313  1.00 62.35 ? 516  PRO A CA    1 
ATOM   4272 C  C     . PRO C 3 510 ? 21.981 30.775  -2.572  1.00 62.64 ? 516  PRO A C     1 
ATOM   4273 O  O     . PRO C 3 510 ? 21.656 29.726  -3.132  1.00 63.01 ? 516  PRO A O     1 
ATOM   4274 C  CB    . PRO C 3 510 ? 21.275 32.763  -1.162  1.00 61.73 ? 516  PRO A CB    1 
ATOM   4275 C  CG    . PRO C 3 510 ? 22.491 32.990  -0.318  1.00 61.68 ? 516  PRO A CG    1 
ATOM   4276 C  CD    . PRO C 3 510 ? 22.335 31.922  0.741   1.00 61.96 ? 516  PRO A CD    1 
ATOM   4277 N  N     . THR C 3 511 ? 22.961 31.557  -3.014  1.00 63.48 ? 517  THR A N     1 
ATOM   4278 C  CA    . THR C 3 511 ? 23.715 31.234  -4.221  1.00 63.43 ? 517  THR A CA    1 
ATOM   4279 C  C     . THR C 3 511 ? 24.609 30.008  -4.086  1.00 63.36 ? 517  THR A C     1 
ATOM   4280 O  O     . THR C 3 511 ? 24.935 29.568  -2.983  1.00 63.15 ? 517  THR A O     1 
ATOM   4281 C  CB    . THR C 3 511 ? 24.596 32.419  -4.661  1.00 62.83 ? 517  THR A CB    1 
ATOM   4282 N  N     . ARG C 3 512 ? 24.997 29.461  -5.232  1.00 64.00 ? 518  ARG A N     1 
ATOM   4283 C  CA    . ARG C 3 512 ? 25.867 28.295  -5.280  1.00 64.11 ? 518  ARG A CA    1 
ATOM   4284 C  C     . ARG C 3 512 ? 27.300 28.736  -4.983  1.00 64.42 ? 518  ARG A C     1 
ATOM   4285 O  O     . ARG C 3 512 ? 28.107 27.961  -4.460  1.00 64.83 ? 518  ARG A O     1 
ATOM   4286 C  CB    . ARG C 3 512 ? 25.782 27.641  -6.666  1.00 63.98 ? 518  ARG A CB    1 
ATOM   4287 C  CG    . ARG C 3 512 ? 26.789 26.525  -6.924  1.00 64.08 ? 518  ARG A CG    1 
ATOM   4288 C  CD    . ARG C 3 512 ? 26.550 25.889  -8.293  1.00 63.86 ? 518  ARG A CD    1 
ATOM   4289 N  NE    . ARG C 3 512 ? 27.659 25.043  -8.731  1.00 64.16 ? 518  ARG A NE    1 
ATOM   4290 C  CZ    . ARG C 3 512 ? 28.895 25.483  -8.956  1.00 65.16 ? 518  ARG A CZ    1 
ATOM   4291 N  NH1   . ARG C 3 512 ? 29.193 26.765  -8.784  1.00 65.77 ? 518  ARG A NH1   1 
ATOM   4292 N  NH2   . ARG C 3 512 ? 29.838 24.642  -9.361  1.00 65.51 ? 518  ARG A NH2   1 
ATOM   4293 N  N     . ASP C 3 513 ? 27.612 29.987  -5.310  1.00 63.85 ? 519  ASP A N     1 
ATOM   4294 C  CA    . ASP C 3 513 ? 28.949 30.514  -5.065  1.00 64.21 ? 519  ASP A CA    1 
ATOM   4295 C  C     . ASP C 3 513 ? 29.182 30.742  -3.577  1.00 63.23 ? 519  ASP A C     1 
ATOM   4296 O  O     . ASP C 3 513 ? 30.308 30.621  -3.090  1.00 62.97 ? 519  ASP A O     1 
ATOM   4297 C  CB    . ASP C 3 513 ? 29.167 31.818  -5.840  1.00 65.58 ? 519  ASP A CB    1 
ATOM   4298 C  CG    . ASP C 3 513 ? 29.204 31.600  -7.342  1.00 67.16 ? 519  ASP A CG    1 
ATOM   4299 O  OD1   . ASP C 3 513 ? 29.526 32.557  -8.082  1.00 67.47 ? 519  ASP A OD1   1 
ATOM   4300 O  OD2   . ASP C 3 513 ? 28.907 30.467  -7.781  1.00 67.23 ? 519  ASP A OD2   1 
ATOM   4301 N  N     . ASN C 3 514 ? 28.115 31.074  -2.857  1.00 62.08 ? 520  ASN A N     1 
ATOM   4302 C  CA    . ASN C 3 514 ? 28.225 31.295  -1.423  1.00 61.51 ? 520  ASN A CA    1 
ATOM   4303 C  C     . ASN C 3 514 ? 28.852 30.055  -0.795  1.00 60.39 ? 520  ASN A C     1 
ATOM   4304 O  O     . ASN C 3 514 ? 29.814 30.154  -0.029  1.00 59.29 ? 520  ASN A O     1 
ATOM   4305 C  CB    . ASN C 3 514 ? 26.844 31.550  -0.812  1.00 61.63 ? 520  ASN A CB    1 
ATOM   4306 C  CG    . ASN C 3 514 ? 26.291 32.913  -1.176  1.00 61.70 ? 520  ASN A CG    1 
ATOM   4307 O  OD1   . ASN C 3 514 ? 26.076 33.218  -2.350  1.00 61.04 ? 520  ASN A OD1   1 
ATOM   4308 N  ND2   . ASN C 3 514 ? 26.062 33.744  -0.165  1.00 61.90 ? 520  ASN A ND2   1 
ATOM   4309 N  N     . ALA C 3 515 ? 28.303 28.891  -1.135  1.00 59.39 ? 521  ALA A N     1 
ATOM   4310 C  CA    . ALA C 3 515 ? 28.807 27.620  -0.626  1.00 58.65 ? 521  ALA A CA    1 
ATOM   4311 C  C     . ALA C 3 515 ? 30.247 27.428  -1.098  1.00 58.15 ? 521  ALA A C     1 
ATOM   4312 O  O     . ALA C 3 515 ? 31.117 27.006  -0.332  1.00 57.73 ? 521  ALA A O     1 
ATOM   4313 C  CB    . ALA C 3 515 ? 27.936 26.478  -1.130  1.00 58.17 ? 521  ALA A CB    1 
ATOM   4314 N  N     . LYS C 3 516 ? 30.485 27.758  -2.366  1.00 57.62 ? 522  LYS A N     1 
ATOM   4315 C  CA    . LYS C 3 516 ? 31.803 27.634  -2.979  1.00 56.42 ? 522  LYS A CA    1 
ATOM   4316 C  C     . LYS C 3 516 ? 32.819 28.493  -2.239  1.00 55.95 ? 522  LYS A C     1 
ATOM   4317 O  O     . LYS C 3 516 ? 34.028 28.327  -2.404  1.00 56.26 ? 522  LYS A O     1 
ATOM   4318 C  CB    . LYS C 3 516 ? 31.729 28.056  -4.452  1.00 56.59 ? 522  LYS A CB    1 
ATOM   4319 C  CG    . LYS C 3 516 ? 32.996 27.804  -5.250  1.00 55.82 ? 522  LYS A CG    1 
ATOM   4320 C  CD    . LYS C 3 516 ? 32.728 27.912  -6.746  1.00 56.06 ? 522  LYS A CD    1 
ATOM   4321 C  CE    . LYS C 3 516 ? 33.949 27.497  -7.565  1.00 57.53 ? 522  LYS A CE    1 
ATOM   4322 N  NZ    . LYS C 3 516 ? 33.662 27.403  -9.027  1.00 56.93 ? 522  LYS A NZ    1 
ATOM   4323 N  N     . THR C 3 517 ? 32.314 29.415  -1.426  1.00 55.06 ? 523  THR A N     1 
ATOM   4324 C  CA    . THR C 3 517 ? 33.165 30.302  -0.645  1.00 53.78 ? 523  THR A CA    1 
ATOM   4325 C  C     . THR C 3 517 ? 33.114 29.843  0.808   1.00 52.95 ? 523  THR A C     1 
ATOM   4326 O  O     . THR C 3 517 ? 34.059 30.038  1.575   1.00 51.83 ? 523  THR A O     1 
ATOM   4327 C  CB    . THR C 3 517 ? 32.675 31.765  -0.730  1.00 53.73 ? 523  THR A CB    1 
ATOM   4328 N  N     . PHE C 3 518 ? 31.995 29.228  1.172   1.00 53.03 ? 524  PHE A N     1 
ATOM   4329 C  CA    . PHE C 3 518 ? 31.779 28.719  2.521   1.00 52.62 ? 524  PHE A CA    1 
ATOM   4330 C  C     . PHE C 3 518 ? 32.710 27.545  2.816   1.00 52.15 ? 524  PHE A C     1 
ATOM   4331 O  O     . PHE C 3 518 ? 33.472 27.569  3.785   1.00 52.01 ? 524  PHE A O     1 
ATOM   4332 C  CB    . PHE C 3 518 ? 30.327 28.261  2.674   1.00 53.17 ? 524  PHE A CB    1 
ATOM   4333 C  CG    . PHE C 3 518 ? 30.053 27.521  3.953   1.00 54.47 ? 524  PHE A CG    1 
ATOM   4334 C  CD1   . PHE C 3 518 ? 30.014 28.194  5.170   1.00 54.40 ? 524  PHE A CD1   1 
ATOM   4335 C  CD2   . PHE C 3 518 ? 29.844 26.141  3.941   1.00 55.07 ? 524  PHE A CD2   1 
ATOM   4336 C  CE1   . PHE C 3 518 ? 29.769 27.503  6.361   1.00 55.42 ? 524  PHE A CE1   1 
ATOM   4337 C  CE2   . PHE C 3 518 ? 29.599 25.437  5.123   1.00 54.96 ? 524  PHE A CE2   1 
ATOM   4338 C  CZ    . PHE C 3 518 ? 29.562 26.119  6.337   1.00 55.55 ? 524  PHE A CZ    1 
ATOM   4339 N  N     . ILE C 3 519 ? 32.649 26.523  1.968   1.00 51.19 ? 525  ILE A N     1 
ATOM   4340 C  CA    . ILE C 3 519 ? 33.468 25.334  2.157   1.00 51.09 ? 525  ILE A CA    1 
ATOM   4341 C  C     . ILE C 3 519 ? 34.945 25.669  2.362   1.00 51.97 ? 525  ILE A C     1 
ATOM   4342 O  O     . ILE C 3 519 ? 35.554 25.221  3.335   1.00 51.58 ? 525  ILE A O     1 
ATOM   4343 C  CB    . ILE C 3 519 ? 33.297 24.337  0.970   1.00 49.64 ? 525  ILE A CB    1 
ATOM   4344 C  CG1   . ILE C 3 519 ? 33.850 22.967  1.368   1.00 48.37 ? 525  ILE A CG1   1 
ATOM   4345 C  CG2   . ILE C 3 519 ? 33.997 24.854  -0.282  1.00 48.65 ? 525  ILE A CG2   1 
ATOM   4346 C  CD1   . ILE C 3 519 ? 33.169 22.367  2.585   1.00 47.11 ? 525  ILE A CD1   1 
ATOM   4347 N  N     . TYR C 3 520 ? 35.518 26.463  1.461   1.00 53.07 ? 526  TYR A N     1 
ATOM   4348 C  CA    . TYR C 3 520 ? 36.919 26.843  1.581   1.00 54.00 ? 526  TYR A CA    1 
ATOM   4349 C  C     . TYR C 3 520 ? 37.137 27.616  2.865   1.00 54.19 ? 526  TYR A C     1 
ATOM   4350 O  O     . TYR C 3 520 ? 38.227 27.603  3.434   1.00 54.79 ? 526  TYR A O     1 
ATOM   4351 C  CB    . TYR C 3 520 ? 37.353 27.674  0.371   1.00 55.63 ? 526  TYR A CB    1 
ATOM   4352 C  CG    . TYR C 3 520 ? 37.529 26.836  -0.875  1.00 58.47 ? 526  TYR A CG    1 
ATOM   4353 C  CD1   . TYR C 3 520 ? 37.465 27.409  -2.145  1.00 59.46 ? 526  TYR A CD1   1 
ATOM   4354 C  CD2   . TYR C 3 520 ? 37.731 25.456  -0.783  1.00 58.62 ? 526  TYR A CD2   1 
ATOM   4355 C  CE1   . TYR C 3 520 ? 37.587 26.623  -3.294  1.00 60.40 ? 526  TYR A CE1   1 
ATOM   4356 C  CE2   . TYR C 3 520 ? 37.854 24.669  -1.915  1.00 59.58 ? 526  TYR A CE2   1 
ATOM   4357 C  CZ    . TYR C 3 520 ? 37.778 25.253  -3.168  1.00 60.81 ? 526  TYR A CZ    1 
ATOM   4358 O  OH    . TYR C 3 520 ? 37.865 24.459  -4.292  1.00 62.95 ? 526  TYR A OH    1 
ATOM   4359 N  N     . GLY C 3 521 ? 36.093 28.292  3.326   1.00 54.54 ? 527  GLY A N     1 
ATOM   4360 C  CA    . GLY C 3 521 ? 36.215 29.034  4.563   1.00 55.37 ? 527  GLY A CA    1 
ATOM   4361 C  C     . GLY C 3 521 ? 36.230 28.017  5.681   1.00 55.99 ? 527  GLY A C     1 
ATOM   4362 O  O     . GLY C 3 521 ? 36.896 28.194  6.701   1.00 55.82 ? 527  GLY A O     1 
ATOM   4363 N  N     . PHE C 3 522 ? 35.493 26.932  5.464   1.00 57.80 ? 528  PHE A N     1 
ATOM   4364 C  CA    . PHE C 3 522 ? 35.381 25.845  6.433   1.00 58.61 ? 528  PHE A CA    1 
ATOM   4365 C  C     . PHE C 3 522 ? 36.696 25.082  6.567   1.00 58.51 ? 528  PHE A C     1 
ATOM   4366 O  O     . PHE C 3 522 ? 37.185 24.851  7.672   1.00 58.32 ? 528  PHE A O     1 
ATOM   4367 C  CB    . PHE C 3 522 ? 34.279 24.879  5.998   1.00 58.89 ? 528  PHE A CB    1 
ATOM   4368 C  CG    . PHE C 3 522 ? 33.939 23.842  7.030   1.00 60.27 ? 528  PHE A CG    1 
ATOM   4369 C  CD1   . PHE C 3 522 ? 33.212 24.184  8.166   1.00 60.37 ? 528  PHE A CD1   1 
ATOM   4370 C  CD2   . PHE C 3 522 ? 34.344 22.521  6.866   1.00 60.09 ? 528  PHE A CD2   1 
ATOM   4371 C  CE1   . PHE C 3 522 ? 32.890 23.223  9.127   1.00 61.50 ? 528  PHE A CE1   1 
ATOM   4372 C  CE2   . PHE C 3 522 ? 34.028 21.553  7.821   1.00 60.98 ? 528  PHE A CE2   1 
ATOM   4373 C  CZ    . PHE C 3 522 ? 33.300 21.904  8.953   1.00 60.66 ? 528  PHE A CZ    1 
ATOM   4374 N  N     . LEU C 3 523 ? 37.260 24.690  5.431   1.00 59.98 ? 529  LEU A N     1 
ATOM   4375 C  CA    . LEU C 3 523 ? 38.515 23.946  5.413   1.00 61.21 ? 529  LEU A CA    1 
ATOM   4376 C  C     . LEU C 3 523 ? 39.689 24.797  5.897   1.00 62.31 ? 529  LEU A C     1 
ATOM   4377 O  O     . LEU C 3 523 ? 40.402 24.407  6.824   1.00 63.13 ? 529  LEU A O     1 
ATOM   4378 C  CB    . LEU C 3 523 ? 38.796 23.433  3.998   1.00 60.44 ? 529  LEU A CB    1 
ATOM   4379 C  CG    . LEU C 3 523 ? 37.698 22.553  3.392   1.00 60.53 ? 529  LEU A CG    1 
ATOM   4380 C  CD1   . LEU C 3 523 ? 38.046 22.197  1.956   1.00 60.26 ? 529  LEU A CD1   1 
ATOM   4381 C  CD2   . LEU C 3 523 ? 37.532 21.301  4.234   1.00 59.75 ? 529  LEU A CD2   1 
ATOM   4382 N  N     . TYR C 3 524 ? 39.881 25.956  5.272   1.00 62.83 ? 530  TYR A N     1 
ATOM   4383 C  CA    . TYR C 3 524 ? 40.972 26.859  5.631   1.00 63.47 ? 530  TYR A CA    1 
ATOM   4384 C  C     . TYR C 3 524 ? 40.733 27.619  6.930   1.00 63.19 ? 530  TYR A C     1 
ATOM   4385 O  O     . TYR C 3 524 ? 41.380 28.635  7.182   1.00 63.30 ? 530  TYR A O     1 
ATOM   4386 C  CB    . TYR C 3 524 ? 41.227 27.855  4.495   1.00 64.59 ? 530  TYR A CB    1 
ATOM   4387 C  CG    . TYR C 3 524 ? 42.028 27.276  3.352   1.00 65.96 ? 530  TYR A CG    1 
ATOM   4388 C  CD1   . TYR C 3 524 ? 43.383 26.976  3.510   1.00 66.25 ? 530  TYR A CD1   1 
ATOM   4389 C  CD2   . TYR C 3 524 ? 41.431 27.006  2.120   1.00 65.97 ? 530  TYR A CD2   1 
ATOM   4390 C  CE1   . TYR C 3 524 ? 44.124 26.421  2.471   1.00 66.92 ? 530  TYR A CE1   1 
ATOM   4391 C  CE2   . TYR C 3 524 ? 42.165 26.448  1.071   1.00 66.92 ? 530  TYR A CE2   1 
ATOM   4392 C  CZ    . TYR C 3 524 ? 43.512 26.159  1.256   1.00 67.46 ? 530  TYR A CZ    1 
ATOM   4393 O  OH    . TYR C 3 524 ? 44.244 25.609  0.228   1.00 67.55 ? 530  TYR A OH    1 
ATOM   4394 N  N     . GLY C 3 525 ? 39.809 27.125  7.750   1.00 63.18 ? 531  GLY A N     1 
ATOM   4395 C  CA    . GLY C 3 525 ? 39.515 27.777  9.017   1.00 62.62 ? 531  GLY A CA    1 
ATOM   4396 C  C     . GLY C 3 525 ? 39.040 29.211  8.862   1.00 62.08 ? 531  GLY A C     1 
ATOM   4397 O  O     . GLY C 3 525 ? 39.605 29.983  8.089   1.00 61.41 ? 531  GLY A O     1 
ATOM   4398 N  N     . ALA C 3 526 ? 37.996 29.571  9.599   1.00 62.14 ? 532  ALA A N     1 
ATOM   4399 C  CA    . ALA C 3 526 ? 37.447 30.922  9.540   1.00 62.10 ? 532  ALA A CA    1 
ATOM   4400 C  C     . ALA C 3 526 ? 36.298 31.059  10.531  1.00 62.70 ? 532  ALA A C     1 
ATOM   4401 O  O     . ALA C 3 526 ? 35.338 30.286  10.490  1.00 62.60 ? 532  ALA A O     1 
ATOM   4402 C  CB    . ALA C 3 526 ? 36.961 31.230  8.128   1.00 61.29 ? 532  ALA A CB    1 
ATOM   4403 N  N     . GLY C 3 527 ? 36.403 32.043  11.422  1.00 63.53 ? 533  GLY A N     1 
ATOM   4404 C  CA    . GLY C 3 527 ? 35.366 32.265  12.416  1.00 64.34 ? 533  GLY A CA    1 
ATOM   4405 C  C     . GLY C 3 527 ? 33.994 32.477  11.803  1.00 65.19 ? 533  GLY A C     1 
ATOM   4406 O  O     . GLY C 3 527 ? 33.867 32.675  10.590  1.00 65.01 ? 533  GLY A O     1 
ATOM   4407 N  N     . ASP C 3 528 ? 32.961 32.437  12.640  1.00 65.73 ? 534  ASP A N     1 
ATOM   4408 C  CA    . ASP C 3 528 ? 31.594 32.623  12.168  1.00 66.30 ? 534  ASP A CA    1 
ATOM   4409 C  C     . ASP C 3 528 ? 31.427 34.009  11.548  1.00 67.15 ? 534  ASP A C     1 
ATOM   4410 C  CB    . ASP C 3 528 ? 30.606 32.446  13.325  1.00 66.58 ? 534  ASP A CB    1 
ATOM   4411 N  N     . GLU C 3 529 ? 32.370 34.902  11.840  1.00 67.35 ? 535  GLU A N     1 
ATOM   4412 C  CA    . GLU C 3 529 ? 32.331 36.260  11.306  1.00 67.42 ? 535  GLU A CA    1 
ATOM   4413 C  C     . GLU C 3 529 ? 32.356 36.224  9.780   1.00 66.93 ? 535  GLU A C     1 
ATOM   4414 O  O     . GLU C 3 529 ? 31.321 36.396  9.128   1.00 66.28 ? 535  GLU A O     1 
ATOM   4415 C  CB    . GLU C 3 529 ? 33.525 37.069  11.826  1.00 67.60 ? 535  GLU A CB    1 
ATOM   4416 N  N     . LYS C 3 530 ? 33.543 35.999  9.219   1.00 66.58 ? 536  LYS A N     1 
ATOM   4417 C  CA    . LYS C 3 530 ? 33.706 35.926  7.769   1.00 66.49 ? 536  LYS A CA    1 
ATOM   4418 C  C     . LYS C 3 530 ? 32.714 34.914  7.190   1.00 66.08 ? 536  LYS A C     1 
ATOM   4419 O  O     . LYS C 3 530 ? 32.273 35.046  6.045   1.00 65.70 ? 536  LYS A O     1 
ATOM   4420 C  CB    . LYS C 3 530 ? 35.141 35.513  7.416   1.00 66.05 ? 536  LYS A CB    1 
ATOM   4421 N  N     . ILE C 3 531 ? 32.368 33.907  7.991   1.00 65.80 ? 537  ILE A N     1 
ATOM   4422 C  CA    . ILE C 3 531 ? 31.420 32.879  7.570   1.00 65.58 ? 537  ILE A CA    1 
ATOM   4423 C  C     . ILE C 3 531 ? 30.073 33.533  7.281   1.00 64.75 ? 537  ILE A C     1 
ATOM   4424 O  O     . ILE C 3 531 ? 29.605 33.546  6.140   1.00 64.00 ? 537  ILE A O     1 
ATOM   4425 C  CB    . ILE C 3 531 ? 31.227 31.809  8.666   1.00 65.59 ? 537  ILE A CB    1 
ATOM   4426 N  N     . GLY C 3 532 ? 29.456 34.082  8.323   1.00 64.16 ? 538  GLY A N     1 
ATOM   4427 C  CA    . GLY C 3 532 ? 28.175 34.739  8.149   1.00 64.03 ? 538  GLY A CA    1 
ATOM   4428 C  C     . GLY C 3 532 ? 28.284 35.950  7.238   1.00 63.28 ? 538  GLY A C     1 
ATOM   4429 O  O     . GLY C 3 532 ? 27.284 36.412  6.686   1.00 63.07 ? 538  GLY A O     1 
ATOM   4430 N  N     . GLN C 3 533 ? 29.504 36.458  7.075   1.00 62.42 ? 539  GLN A N     1 
ATOM   4431 C  CA    . GLN C 3 533 ? 29.747 37.624  6.233   1.00 61.78 ? 539  GLN A CA    1 
ATOM   4432 C  C     . GLN C 3 533 ? 29.413 37.358  4.764   1.00 61.10 ? 539  GLN A C     1 
ATOM   4433 O  O     . GLN C 3 533 ? 29.550 38.245  3.919   1.00 61.57 ? 539  GLN A O     1 
ATOM   4434 C  CB    . GLN C 3 533 ? 31.206 38.081  6.362   1.00 61.46 ? 539  GLN A CB    1 
ATOM   4435 N  N     . ILE C 3 534 ? 28.981 36.136  4.464   1.00 60.01 ? 540  ILE A N     1 
ATOM   4436 C  CA    . ILE C 3 534 ? 28.603 35.770  3.100   1.00 59.45 ? 540  ILE A CA    1 
ATOM   4437 C  C     . ILE C 3 534 ? 27.080 35.830  3.020   1.00 59.32 ? 540  ILE A C     1 
ATOM   4438 O  O     . ILE C 3 534 ? 26.504 36.070  1.956   1.00 58.63 ? 540  ILE A O     1 
ATOM   4439 C  CB    . ILE C 3 534 ? 29.074 34.339  2.742   1.00 58.94 ? 540  ILE A CB    1 
ATOM   4440 N  N     . VAL C 3 535 ? 26.438 35.613  4.165   1.00 59.72 ? 541  VAL A N     1 
ATOM   4441 C  CA    . VAL C 3 535 ? 24.983 35.647  4.264   1.00 60.39 ? 541  VAL A CA    1 
ATOM   4442 C  C     . VAL C 3 535 ? 24.528 36.974  4.872   1.00 61.00 ? 541  VAL A C     1 
ATOM   4443 O  O     . VAL C 3 535 ? 23.575 37.018  5.653   1.00 61.54 ? 541  VAL A O     1 
ATOM   4444 C  CB    . VAL C 3 535 ? 24.455 34.500  5.152   1.00 59.25 ? 541  VAL A CB    1 
ATOM   4445 N  N     . GLY C 3 536 ? 25.220 38.054  4.517   1.00 61.23 ? 542  GLY A N     1 
ATOM   4446 C  CA    . GLY C 3 536 ? 24.869 39.362  5.036   1.00 61.27 ? 542  GLY A CA    1 
ATOM   4447 C  C     . GLY C 3 536 ? 25.175 39.542  6.511   1.00 61.54 ? 542  GLY A C     1 
ATOM   4448 O  O     . GLY C 3 536 ? 25.814 40.520  6.903   1.00 61.84 ? 542  GLY A O     1 
ATOM   4449 N  N     . ALA C 3 537 ? 24.721 38.601  7.333   1.00 61.74 ? 543  ALA A N     1 
ATOM   4450 C  CA    . ALA C 3 537 ? 24.943 38.664  8.774   1.00 61.81 ? 543  ALA A CA    1 
ATOM   4451 C  C     . ALA C 3 537 ? 26.429 38.656  9.138   1.00 62.01 ? 543  ALA A C     1 
ATOM   4452 O  O     . ALA C 3 537 ? 27.293 39.007  8.325   1.00 60.65 ? 543  ALA A O     1 
ATOM   4453 C  CB    . ALA C 3 537 ? 24.231 37.495  9.460   1.00 60.94 ? 543  ALA A CB    1 
ATOM   4454 N  N     . GLY C 3 538 ? 26.709 38.262  10.377  1.00 62.55 ? 544  GLY A N     1 
ATOM   4455 C  CA    . GLY C 3 538 ? 28.077 38.191  10.851  1.00 63.99 ? 544  GLY A CA    1 
ATOM   4456 C  C     . GLY C 3 538 ? 28.301 36.832  11.479  1.00 65.04 ? 544  GLY A C     1 
ATOM   4457 O  O     . GLY C 3 538 ? 27.898 35.810  10.917  1.00 65.48 ? 544  GLY A O     1 
ATOM   4458 N  N     . LYS C 3 539 ? 28.942 36.811  12.643  1.00 65.40 ? 545  LYS A N     1 
ATOM   4459 C  CA    . LYS C 3 539 ? 29.184 35.559  13.342  1.00 65.79 ? 545  LYS A CA    1 
ATOM   4460 C  C     . LYS C 3 539 ? 27.837 35.051  13.864  1.00 66.62 ? 545  LYS A C     1 
ATOM   4461 O  O     . LYS C 3 539 ? 27.748 33.976  14.463  1.00 66.65 ? 545  LYS A O     1 
ATOM   4462 C  CB    . LYS C 3 539 ? 30.155 35.780  14.505  1.00 66.00 ? 545  LYS A CB    1 
ATOM   4463 N  N     . GLU C 3 540 ? 26.792 35.840  13.623  1.00 66.42 ? 546  GLU A N     1 
ATOM   4464 C  CA    . GLU C 3 540 ? 25.439 35.499  14.050  1.00 66.73 ? 546  GLU A CA    1 
ATOM   4465 C  C     . GLU C 3 540 ? 24.926 34.289  13.273  1.00 66.87 ? 546  GLU A C     1 
ATOM   4466 O  O     . GLU C 3 540 ? 25.026 33.153  13.742  1.00 66.53 ? 546  GLU A O     1 
ATOM   4467 C  CB    . GLU C 3 540 ? 24.503 36.691  13.828  1.00 66.83 ? 546  GLU A CB    1 
ATOM   4468 N  N     . ARG C 3 541 ? 24.376 34.540  12.087  1.00 67.16 ? 547  ARG A N     1 
ATOM   4469 C  CA    . ARG C 3 541 ? 23.865 33.465  11.241  1.00 67.70 ? 547  ARG A CA    1 
ATOM   4470 C  C     . ARG C 3 541 ? 25.013 32.507  10.913  1.00 67.52 ? 547  ARG A C     1 
ATOM   4471 O  O     . ARG C 3 541 ? 24.787 31.368  10.504  1.00 67.49 ? 547  ARG A O     1 
ATOM   4472 C  CB    . ARG C 3 541 ? 23.273 34.035  9.944   1.00 66.85 ? 547  ARG A CB    1 
ATOM   4473 N  N     . GLY C 3 542 ? 26.244 32.983  11.099  1.00 67.37 ? 548  GLY A N     1 
ATOM   4474 C  CA    . GLY C 3 542 ? 27.410 32.159  10.832  1.00 67.52 ? 548  GLY A CA    1 
ATOM   4475 C  C     . GLY C 3 542 ? 27.357 30.880  11.645  1.00 67.45 ? 548  GLY A C     1 
ATOM   4476 O  O     . GLY C 3 542 ? 27.497 29.781  11.104  1.00 67.43 ? 548  GLY A O     1 
ATOM   4477 N  N     . LYS C 3 543 ? 27.155 31.024  12.952  1.00 66.90 ? 549  LYS A N     1 
ATOM   4478 C  CA    . LYS C 3 543 ? 27.065 29.874  13.844  1.00 66.10 ? 549  LYS A CA    1 
ATOM   4479 C  C     . LYS C 3 543 ? 25.940 28.961  13.365  1.00 65.62 ? 549  LYS A C     1 
ATOM   4480 O  O     . LYS C 3 543 ? 26.063 27.735  13.393  1.00 65.28 ? 549  LYS A O     1 
ATOM   4481 C  CB    . LYS C 3 543 ? 26.779 30.335  15.278  1.00 65.64 ? 549  LYS A CB    1 
ATOM   4482 N  N     . GLU C 3 544 ? 24.844 29.572  12.924  1.00 65.19 ? 550  GLU A N     1 
ATOM   4483 C  CA    . GLU C 3 544 ? 23.693 28.823  12.434  1.00 65.09 ? 550  GLU A CA    1 
ATOM   4484 C  C     . GLU C 3 544 ? 24.033 28.067  11.153  1.00 65.05 ? 550  GLU A C     1 
ATOM   4485 O  O     . GLU C 3 544 ? 23.663 26.902  10.993  1.00 65.56 ? 550  GLU A O     1 
ATOM   4486 C  CB    . GLU C 3 544 ? 22.521 29.772  12.167  1.00 64.71 ? 550  GLU A CB    1 
ATOM   4487 N  N     . LEU C 3 545 ? 24.747 28.738  10.251  1.00 64.85 ? 551  LEU A N     1 
ATOM   4488 C  CA    . LEU C 3 545 ? 25.136 28.168  8.964   1.00 64.06 ? 551  LEU A CA    1 
ATOM   4489 C  C     . LEU C 3 545 ? 26.055 26.951  9.070   1.00 63.81 ? 551  LEU A C     1 
ATOM   4490 O  O     . LEU C 3 545 ? 25.759 25.894  8.507   1.00 63.70 ? 551  LEU A O     1 
ATOM   4491 C  CB    . LEU C 3 545 ? 25.809 29.244  8.107   1.00 64.48 ? 551  LEU A CB    1 
ATOM   4492 N  N     . LYS C 3 546 ? 27.171 27.108  9.782   1.00 63.10 ? 552  LYS A N     1 
ATOM   4493 C  CA    . LYS C 3 546 ? 28.140 26.027  9.955   1.00 61.72 ? 552  LYS A CA    1 
ATOM   4494 C  C     . LYS C 3 546 ? 27.542 24.849  10.720  1.00 61.57 ? 552  LYS A C     1 
ATOM   4495 O  O     . LYS C 3 546 ? 28.129 23.766  10.768  1.00 61.36 ? 552  LYS A O     1 
ATOM   4496 C  CB    . LYS C 3 546 ? 29.382 26.538  10.690  1.00 61.26 ? 552  LYS A CB    1 
ATOM   4497 N  N     . LYS C 3 547 ? 26.374 25.063  11.318  1.00 60.90 ? 553  LYS A N     1 
ATOM   4498 C  CA    . LYS C 3 547 ? 25.704 24.010  12.068  1.00 60.30 ? 553  LYS A CA    1 
ATOM   4499 C  C     . LYS C 3 547 ? 24.714 23.266  11.171  1.00 59.75 ? 553  LYS A C     1 
ATOM   4500 O  O     . LYS C 3 547 ? 24.643 22.037  11.198  1.00 59.65 ? 553  LYS A O     1 
ATOM   4501 C  CB    . LYS C 3 547 ? 24.976 24.604  13.276  1.00 60.67 ? 553  LYS A CB    1 
ATOM   4502 N  N     . LYS C 3 548 ? 23.951 24.016  10.379  1.00 59.55 ? 554  LYS A N     1 
ATOM   4503 C  CA    . LYS C 3 548 ? 22.976 23.419  9.469   1.00 58.78 ? 554  LYS A CA    1 
ATOM   4504 C  C     . LYS C 3 548 ? 23.710 22.575  8.431   1.00 58.16 ? 554  LYS A C     1 
ATOM   4505 O  O     . LYS C 3 548 ? 23.178 21.582  7.925   1.00 57.92 ? 554  LYS A O     1 
ATOM   4506 C  CB    . LYS C 3 548 ? 22.160 24.510  8.766   1.00 58.15 ? 554  LYS A CB    1 
ATOM   4507 N  N     . PHE C 3 549 ? 24.936 22.982  8.116   1.00 57.17 ? 555  PHE A N     1 
ATOM   4508 C  CA    . PHE C 3 549 ? 25.756 22.263  7.150   1.00 56.44 ? 555  PHE A CA    1 
ATOM   4509 C  C     . PHE C 3 549 ? 26.077 20.887  7.729   1.00 56.22 ? 555  PHE A C     1 
ATOM   4510 O  O     . PHE C 3 549 ? 25.662 19.856  7.192   1.00 55.98 ? 555  PHE A O     1 
ATOM   4511 C  CB    . PHE C 3 549 ? 27.050 23.037  6.887   1.00 55.52 ? 555  PHE A CB    1 
ATOM   4512 C  CG    . PHE C 3 549 ? 27.973 22.370  5.906   1.00 53.95 ? 555  PHE A CG    1 
ATOM   4513 C  CD1   . PHE C 3 549 ? 27.559 22.115  4.604   1.00 52.43 ? 555  PHE A CD1   1 
ATOM   4514 C  CD2   . PHE C 3 549 ? 29.266 22.008  6.282   1.00 52.78 ? 555  PHE A CD2   1 
ATOM   4515 C  CE1   . PHE C 3 549 ? 28.420 21.511  3.686   1.00 52.35 ? 555  PHE A CE1   1 
ATOM   4516 C  CE2   . PHE C 3 549 ? 30.132 21.404  5.373   1.00 51.58 ? 555  PHE A CE2   1 
ATOM   4517 C  CZ    . PHE C 3 549 ? 29.708 21.156  4.072   1.00 51.17 ? 555  PHE A CZ    1 
ATOM   4518 N  N     . LEU C 3 550 ? 26.811 20.889  8.838   1.00 55.66 ? 556  LEU A N     1 
ATOM   4519 C  CA    . LEU C 3 550 ? 27.193 19.663  9.516   1.00 55.38 ? 556  LEU A CA    1 
ATOM   4520 C  C     . LEU C 3 550 ? 25.971 18.776  9.702   1.00 55.62 ? 556  LEU A C     1 
ATOM   4521 O  O     . LEU C 3 550 ? 26.033 17.563  9.501   1.00 56.04 ? 556  LEU A O     1 
ATOM   4522 C  CB    . LEU C 3 550 ? 27.811 19.989  10.876  1.00 55.41 ? 556  LEU A CB    1 
ATOM   4523 N  N     . GLU C 3 551 ? 24.856 19.392  10.076  1.00 55.62 ? 557  GLU A N     1 
ATOM   4524 C  CA    . GLU C 3 551 ? 23.615 18.660  10.294  1.00 55.27 ? 557  GLU A CA    1 
ATOM   4525 C  C     . GLU C 3 551 ? 23.220 17.851  9.061   1.00 54.65 ? 557  GLU A C     1 
ATOM   4526 O  O     . GLU C 3 551 ? 22.737 16.722  9.178   1.00 53.77 ? 557  GLU A O     1 
ATOM   4527 C  CB    . GLU C 3 551 ? 22.490 19.635  10.653  1.00 55.60 ? 557  GLU A CB    1 
ATOM   4528 N  N     . ASN C 3 552 ? 23.436 18.429  7.882   1.00 53.79 ? 558  ASN A N     1 
ATOM   4529 C  CA    . ASN C 3 552 ? 23.090 17.768  6.626   1.00 52.71 ? 558  ASN A CA    1 
ATOM   4530 C  C     . ASN C 3 552 ? 24.258 16.998  6.009   1.00 51.84 ? 558  ASN A C     1 
ATOM   4531 O  O     . ASN C 3 552 ? 24.152 16.486  4.894   1.00 51.80 ? 558  ASN A O     1 
ATOM   4532 C  CB    . ASN C 3 552 ? 22.566 18.799  5.621   1.00 52.26 ? 558  ASN A CB    1 
ATOM   4533 N  N     . THR C 3 553 ? 25.373 16.928  6.731   1.00 50.46 ? 559  THR A N     1 
ATOM   4534 C  CA    . THR C 3 553 ? 26.556 16.208  6.255   1.00 49.51 ? 559  THR A CA    1 
ATOM   4535 C  C     . THR C 3 553 ? 27.176 15.509  7.458   1.00 47.84 ? 559  THR A C     1 
ATOM   4536 O  O     . THR C 3 553 ? 28.278 15.848  7.888   1.00 47.92 ? 559  THR A O     1 
ATOM   4537 C  CB    . THR C 3 553 ? 27.594 17.172  5.640   1.00 50.44 ? 559  THR A CB    1 
ATOM   4538 O  OG1   . THR C 3 553 ? 26.969 17.970  4.625   1.00 51.07 ? 559  THR A OG1   1 
ATOM   4539 C  CG2   . THR C 3 553 ? 28.734 16.390  5.011   1.00 51.15 ? 559  THR A CG2   1 
ATOM   4540 N  N     . PRO C 3 554 ? 26.463 14.519  8.022   1.00 46.29 ? 560  PRO A N     1 
ATOM   4541 C  CA    . PRO C 3 554 ? 26.918 13.758  9.191   1.00 43.64 ? 560  PRO A CA    1 
ATOM   4542 C  C     . PRO C 3 554 ? 28.298 13.102  9.101   1.00 42.26 ? 560  PRO A C     1 
ATOM   4543 O  O     . PRO C 3 554 ? 28.968 12.942  10.123  1.00 42.48 ? 560  PRO A O     1 
ATOM   4544 C  CB    . PRO C 3 554 ? 25.789 12.747  9.405   1.00 43.60 ? 560  PRO A CB    1 
ATOM   4545 C  CG    . PRO C 3 554 ? 25.245 12.550  8.029   1.00 44.57 ? 560  PRO A CG    1 
ATOM   4546 C  CD    . PRO C 3 554 ? 25.214 13.952  7.484   1.00 44.61 ? 560  PRO A CD    1 
ATOM   4547 N  N     . ALA C 3 555 ? 28.734 12.728  7.899   1.00 39.33 ? 561  ALA A N     1 
ATOM   4548 C  CA    . ALA C 3 555 ? 30.049 12.098  7.756   1.00 38.30 ? 561  ALA A CA    1 
ATOM   4549 C  C     . ALA C 3 555 ? 31.156 13.008  8.289   1.00 36.74 ? 561  ALA A C     1 
ATOM   4550 O  O     . ALA C 3 555 ? 32.111 12.539  8.904   1.00 36.41 ? 561  ALA A O     1 
ATOM   4551 C  CB    . ALA C 3 555 ? 30.319 11.735  6.289   1.00 38.29 ? 561  ALA A CB    1 
ATOM   4552 N  N     . ILE C 3 556 ? 31.023 14.308  8.052   1.00 36.18 ? 562  ILE A N     1 
ATOM   4553 C  CA    . ILE C 3 556 ? 32.004 15.272  8.526   1.00 35.23 ? 562  ILE A CA    1 
ATOM   4554 C  C     . ILE C 3 556 ? 31.970 15.349  10.053  1.00 36.70 ? 562  ILE A C     1 
ATOM   4555 O  O     . ILE C 3 556 ? 33.011 15.511  10.707  1.00 36.45 ? 562  ILE A O     1 
ATOM   4556 C  CB    . ILE C 3 556 ? 31.725 16.663  7.936   1.00 34.90 ? 562  ILE A CB    1 
ATOM   4557 C  CG1   . ILE C 3 556 ? 31.982 16.642  6.429   1.00 32.99 ? 562  ILE A CG1   1 
ATOM   4558 C  CG2   . ILE C 3 556 ? 32.590 17.704  8.616   1.00 35.67 ? 562  ILE A CG2   1 
ATOM   4559 C  CD1   . ILE C 3 556 ? 31.718 17.957  5.742   1.00 31.46 ? 562  ILE A CD1   1 
ATOM   4560 N  N     . ALA C 3 557 ? 30.770 15.224  10.622  1.00 36.38 ? 563  ALA A N     1 
ATOM   4561 C  CA    . ALA C 3 557 ? 30.609 15.275  12.073  1.00 35.09 ? 563  ALA A CA    1 
ATOM   4562 C  C     . ALA C 3 557 ? 31.238 14.031  12.685  1.00 34.18 ? 563  ALA A C     1 
ATOM   4563 O  O     . ALA C 3 557 ? 31.907 14.106  13.706  1.00 34.89 ? 563  ALA A O     1 
ATOM   4564 C  CB    . ALA C 3 557 ? 29.124 15.363  12.443  1.00 35.31 ? 563  ALA A CB    1 
ATOM   4565 N  N     . ALA C 3 558 ? 31.021 12.884  12.051  1.00 34.74 ? 564  ALA A N     1 
ATOM   4566 C  CA    . ALA C 3 558 ? 31.593 11.630  12.528  1.00 34.79 ? 564  ALA A CA    1 
ATOM   4567 C  C     . ALA C 3 558 ? 33.114 11.762  12.521  1.00 35.36 ? 564  ALA A C     1 
ATOM   4568 O  O     . ALA C 3 558 ? 33.788 11.441  13.507  1.00 36.17 ? 564  ALA A O     1 
ATOM   4569 C  CB    . ALA C 3 558 ? 31.165 10.487  11.625  1.00 34.19 ? 564  ALA A CB    1 
ATOM   4570 N  N     . LEU C 3 559 ? 33.644 12.239  11.397  1.00 35.34 ? 565  LEU A N     1 
ATOM   4571 C  CA    . LEU C 3 559 ? 35.080 12.442  11.237  1.00 35.42 ? 565  LEU A CA    1 
ATOM   4572 C  C     . LEU C 3 559 ? 35.635 13.301  12.370  1.00 37.39 ? 565  LEU A C     1 
ATOM   4573 O  O     . LEU C 3 559 ? 36.565 12.898  13.066  1.00 38.08 ? 565  LEU A O     1 
ATOM   4574 C  CB    . LEU C 3 559 ? 35.366 13.115  9.890   1.00 31.54 ? 565  LEU A CB    1 
ATOM   4575 C  CG    . LEU C 3 559 ? 36.818 13.512  9.575   1.00 30.03 ? 565  LEU A CG    1 
ATOM   4576 C  CD1   . LEU C 3 559 ? 37.736 12.279  9.577   1.00 25.28 ? 565  LEU A CD1   1 
ATOM   4577 C  CD2   . LEU C 3 559 ? 36.847 14.202  8.208   1.00 25.97 ? 565  LEU A CD2   1 
ATOM   4578 N  N     . ARG C 3 560 ? 35.067 14.488  12.548  1.00 40.69 ? 566  ARG A N     1 
ATOM   4579 C  CA    . ARG C 3 560 ? 35.516 15.393  13.604  1.00 44.28 ? 566  ARG A CA    1 
ATOM   4580 C  C     . ARG C 3 560 ? 35.517 14.668  14.949  1.00 44.62 ? 566  ARG A C     1 
ATOM   4581 O  O     . ARG C 3 560 ? 36.483 14.744  15.707  1.00 44.92 ? 566  ARG A O     1 
ATOM   4582 C  CB    . ARG C 3 560 ? 34.599 16.623  13.680  1.00 45.66 ? 566  ARG A CB    1 
ATOM   4583 C  CG    . ARG C 3 560 ? 34.948 17.599  14.806  1.00 50.02 ? 566  ARG A CG    1 
ATOM   4584 C  CD    . ARG C 3 560 ? 33.757 18.498  15.189  1.00 52.73 ? 566  ARG A CD    1 
ATOM   4585 N  NE    . ARG C 3 560 ? 33.777 19.830  14.578  1.00 54.12 ? 566  ARG A NE    1 
ATOM   4586 C  CZ    . ARG C 3 560 ? 33.796 20.067  13.268  1.00 54.36 ? 566  ARG A CZ    1 
ATOM   4587 N  NH1   . ARG C 3 560 ? 33.805 19.062  12.400  1.00 54.33 ? 566  ARG A NH1   1 
ATOM   4588 N  NH2   . ARG C 3 560 ? 33.790 21.317  12.824  1.00 53.95 ? 566  ARG A NH2   1 
ATOM   4589 N  N     . GLU C 3 561 ? 34.434 13.956  15.237  1.00 46.17 ? 567  GLU A N     1 
ATOM   4590 C  CA    . GLU C 3 561 ? 34.322 13.224  16.494  1.00 47.17 ? 567  GLU A CA    1 
ATOM   4591 C  C     . GLU C 3 561 ? 35.385 12.127  16.641  1.00 46.46 ? 567  GLU A C     1 
ATOM   4592 O  O     . GLU C 3 561 ? 35.914 11.918  17.735  1.00 46.00 ? 567  GLU A O     1 
ATOM   4593 C  CB    . GLU C 3 561 ? 32.920 12.613  16.630  1.00 48.61 ? 567  GLU A CB    1 
ATOM   4594 C  CG    . GLU C 3 561 ? 31.779 13.634  16.679  1.00 52.42 ? 567  GLU A CG    1 
ATOM   4595 C  CD    . GLU C 3 561 ? 30.398 12.980  16.797  1.00 55.27 ? 567  GLU A CD    1 
ATOM   4596 O  OE1   . GLU C 3 561 ? 30.152 12.268  17.799  1.00 57.35 ? 567  GLU A OE1   1 
ATOM   4597 O  OE2   . GLU C 3 561 ? 29.558 13.176  15.888  1.00 55.09 ? 567  GLU A OE2   1 
ATOM   4598 N  N     . SER C 3 562 ? 35.697 11.421  15.557  1.00 45.27 ? 568  SER A N     1 
ATOM   4599 C  CA    . SER C 3 562 ? 36.706 10.369  15.640  1.00 46.17 ? 568  SER A CA    1 
ATOM   4600 C  C     . SER C 3 562 ? 38.090 10.967  15.915  1.00 46.22 ? 568  SER A C     1 
ATOM   4601 O  O     . SER C 3 562 ? 38.905 10.366  16.613  1.00 46.44 ? 568  SER A O     1 
ATOM   4602 C  CB    . SER C 3 562 ? 36.721 9.523   14.358  1.00 46.83 ? 568  SER A CB    1 
ATOM   4603 O  OG    . SER C 3 562 ? 36.815 10.327  13.196  1.00 49.67 ? 568  SER A OG    1 
ATOM   4604 N  N     . ILE C 3 563 ? 38.348 12.154  15.371  1.00 46.76 ? 569  ILE A N     1 
ATOM   4605 C  CA    . ILE C 3 563 ? 39.619 12.843  15.591  1.00 46.68 ? 569  ILE A CA    1 
ATOM   4606 C  C     . ILE C 3 563 ? 39.733 13.223  17.075  1.00 46.97 ? 569  ILE A C     1 
ATOM   4607 O  O     . ILE C 3 563 ? 40.774 13.025  17.699  1.00 46.07 ? 569  ILE A O     1 
ATOM   4608 C  CB    . ILE C 3 563 ? 39.713 14.119  14.723  1.00 46.04 ? 569  ILE A CB    1 
ATOM   4609 C  CG1   . ILE C 3 563 ? 39.788 13.731  13.246  1.00 45.39 ? 569  ILE A CG1   1 
ATOM   4610 C  CG2   . ILE C 3 563 ? 40.928 14.943  15.123  1.00 45.98 ? 569  ILE A CG2   1 
ATOM   4611 C  CD1   . ILE C 3 563 ? 39.766 14.911  12.296  1.00 43.45 ? 569  ILE A CD1   1 
ATOM   4612 N  N     . GLN C 3 564 ? 38.653 13.773  17.624  1.00 47.05 ? 570  GLN A N     1 
ATOM   4613 C  CA    . GLN C 3 564 ? 38.600 14.161  19.033  1.00 48.01 ? 570  GLN A CA    1 
ATOM   4614 C  C     . GLN C 3 564 ? 38.914 12.975  19.942  1.00 47.37 ? 570  GLN A C     1 
ATOM   4615 O  O     . GLN C 3 564 ? 39.793 13.049  20.795  1.00 47.24 ? 570  GLN A O     1 
ATOM   4616 C  CB    . GLN C 3 564 ? 37.203 14.686  19.383  1.00 49.10 ? 570  GLN A CB    1 
ATOM   4617 C  CG    . GLN C 3 564 ? 36.971 16.156  19.089  1.00 51.23 ? 570  GLN A CG    1 
ATOM   4618 C  CD    . GLN C 3 564 ? 37.605 17.060  20.131  1.00 53.67 ? 570  GLN A CD    1 
ATOM   4619 O  OE1   . GLN C 3 564 ? 37.414 16.873  21.338  1.00 53.13 ? 570  GLN A OE1   1 
ATOM   4620 N  NE2   . GLN C 3 564 ? 38.356 18.054  19.670  1.00 55.01 ? 570  GLN A NE2   1 
ATOM   4621 N  N     . GLN C 3 565 ? 38.175 11.886  19.757  1.00 47.85 ? 571  GLN A N     1 
ATOM   4622 C  CA    . GLN C 3 565 ? 38.350 10.675  20.554  1.00 48.27 ? 571  GLN A CA    1 
ATOM   4623 C  C     . GLN C 3 565 ? 39.802 10.228  20.599  1.00 48.03 ? 571  GLN A C     1 
ATOM   4624 O  O     . GLN C 3 565 ? 40.302 9.806   21.643  1.00 49.01 ? 571  GLN A O     1 
ATOM   4625 C  CB    . GLN C 3 565 ? 37.488 9.540   19.989  1.00 48.01 ? 571  GLN A CB    1 
ATOM   4626 N  N     . THR C 3 566 ? 40.481 10.323  19.464  1.00 47.65 ? 572  THR A N     1 
ATOM   4627 C  CA    . THR C 3 566 ? 41.876 9.921   19.386  1.00 48.24 ? 572  THR A CA    1 
ATOM   4628 C  C     . THR C 3 566 ? 42.827 10.844  20.151  1.00 48.04 ? 572  THR A C     1 
ATOM   4629 O  O     . THR C 3 566 ? 43.792 10.375  20.750  1.00 48.99 ? 572  THR A O     1 
ATOM   4630 C  CB    . THR C 3 566 ? 42.341 9.848   17.919  1.00 49.06 ? 572  THR A CB    1 
ATOM   4631 O  OG1   . THR C 3 566 ? 41.529 8.906   17.209  1.00 51.04 ? 572  THR A OG1   1 
ATOM   4632 C  CG2   . THR C 3 566 ? 43.794 9.405   17.838  1.00 49.28 ? 572  THR A CG2   1 
ATOM   4633 N  N     . LEU C 3 567 ? 42.552 12.147  20.140  1.00 47.24 ? 573  LEU A N     1 
ATOM   4634 C  CA    . LEU C 3 567 ? 43.416 13.120  20.811  1.00 48.19 ? 573  LEU A CA    1 
ATOM   4635 C  C     . LEU C 3 567 ? 43.065 13.460  22.258  1.00 50.87 ? 573  LEU A C     1 
ATOM   4636 O  O     . LEU C 3 567 ? 43.946 13.488  23.123  1.00 51.22 ? 573  LEU A O     1 
ATOM   4637 C  CB    . LEU C 3 567 ? 43.447 14.420  20.014  1.00 45.15 ? 573  LEU A CB    1 
ATOM   4638 C  CG    . LEU C 3 567 ? 43.869 14.330  18.551  1.00 44.53 ? 573  LEU A CG    1 
ATOM   4639 C  CD1   . LEU C 3 567 ? 43.767 15.712  17.931  1.00 45.32 ? 573  LEU A CD1   1 
ATOM   4640 C  CD2   . LEU C 3 567 ? 45.288 13.788  18.445  1.00 44.52 ? 573  LEU A CD2   1 
ATOM   4641 N  N     . VAL C 3 568 ? 41.784 13.733  22.509  1.00 53.05 ? 574  VAL A N     1 
ATOM   4642 C  CA    . VAL C 3 568 ? 41.305 14.104  23.843  1.00 55.49 ? 574  VAL A CA    1 
ATOM   4643 C  C     . VAL C 3 568 ? 40.569 12.975  24.565  1.00 56.41 ? 574  VAL A C     1 
ATOM   4644 O  O     . VAL C 3 568 ? 39.534 12.494  24.097  1.00 56.43 ? 574  VAL A O     1 
ATOM   4645 C  CB    . VAL C 3 568 ? 40.358 15.325  23.760  1.00 55.97 ? 574  VAL A CB    1 
ATOM   4646 C  CG1   . VAL C 3 568 ? 39.949 15.764  25.157  1.00 56.32 ? 574  VAL A CG1   1 
ATOM   4647 C  CG2   . VAL C 3 568 ? 41.038 16.464  23.011  1.00 55.58 ? 574  VAL A CG2   1 
ATOM   4648 N  N     . GLU C 3 569 ? 41.097 12.571  25.717  1.00 58.20 ? 575  GLU A N     1 
ATOM   4649 C  CA    . GLU C 3 569 ? 40.496 11.493  26.505  1.00 60.28 ? 575  GLU A CA    1 
ATOM   4650 C  C     . GLU C 3 569 ? 39.442 12.017  27.483  1.00 60.19 ? 575  GLU A C     1 
ATOM   4651 O  O     . GLU C 3 569 ? 39.569 13.191  27.898  1.00 61.30 ? 575  GLU A O     1 
ATOM   4652 C  CB    . GLU C 3 569 ? 41.586 10.742  27.278  1.00 62.26 ? 575  GLU A CB    1 
ATOM   4653 C  CG    . GLU C 3 569 ? 42.160 11.512  28.463  1.00 63.45 ? 575  GLU A CG    1 
ATOM   4654 C  CD    . GLU C 3 569 ? 43.562 11.058  28.839  1.00 65.32 ? 575  GLU A CD    1 
ATOM   4655 O  OE1   . GLU C 3 569 ? 43.788 9.831   28.956  1.00 64.83 ? 575  GLU A OE1   1 
ATOM   4656 O  OE2   . GLU C 3 569 ? 44.439 11.933  29.022  1.00 65.75 ? 575  GLU A OE2   1 
ATOM   4657 N  N     . LYS C 3 581 ? 44.731 16.821  29.521  1.00 52.80 ? 587  LYS A N     1 
ATOM   4658 C  CA    . LYS C 3 581 ? 43.605 16.994  28.558  1.00 52.19 ? 587  LYS A CA    1 
ATOM   4659 C  C     . LYS C 3 581 ? 43.828 16.174  27.280  1.00 52.26 ? 587  LYS A C     1 
ATOM   4660 O  O     . LYS C 3 581 ? 42.873 15.851  26.563  1.00 52.34 ? 587  LYS A O     1 
ATOM   4661 C  CB    . LYS C 3 581 ? 43.439 18.480  28.211  1.00 50.60 ? 587  LYS A CB    1 
ATOM   4662 N  N     . TRP C 3 582 ? 45.085 15.828  27.002  1.00 51.60 ? 588  TRP A N     1 
ATOM   4663 C  CA    . TRP C 3 582 ? 45.407 15.052  25.804  1.00 50.79 ? 588  TRP A CA    1 
ATOM   4664 C  C     . TRP C 3 582 ? 45.750 13.591  26.089  1.00 50.53 ? 588  TRP A C     1 
ATOM   4665 O  O     . TRP C 3 582 ? 46.193 13.236  27.179  1.00 50.59 ? 588  TRP A O     1 
ATOM   4666 C  CB    . TRP C 3 582 ? 46.602 15.663  25.059  1.00 50.16 ? 588  TRP A CB    1 
ATOM   4667 C  CG    . TRP C 3 582 ? 46.493 17.113  24.724  1.00 50.32 ? 588  TRP A CG    1 
ATOM   4668 C  CD1   . TRP C 3 582 ? 46.817 18.167  25.528  1.00 51.50 ? 588  TRP A CD1   1 
ATOM   4669 C  CD2   . TRP C 3 582 ? 46.045 17.676  23.484  1.00 51.25 ? 588  TRP A CD2   1 
ATOM   4670 N  NE1   . TRP C 3 582 ? 46.603 19.354  24.866  1.00 51.74 ? 588  TRP A NE1   1 
ATOM   4671 C  CE2   . TRP C 3 582 ? 46.127 19.082  23.609  1.00 51.62 ? 588  TRP A CE2   1 
ATOM   4672 C  CE3   . TRP C 3 582 ? 45.580 17.130  22.278  1.00 50.68 ? 588  TRP A CE3   1 
ATOM   4673 C  CZ2   . TRP C 3 582 ? 45.762 19.952  22.571  1.00 51.30 ? 588  TRP A CZ2   1 
ATOM   4674 C  CZ3   . TRP C 3 582 ? 45.217 17.995  21.248  1.00 50.84 ? 588  TRP A CZ3   1 
ATOM   4675 C  CH2   . TRP C 3 582 ? 45.311 19.391  21.403  1.00 50.95 ? 588  TRP A CH2   1 
ATOM   4676 N  N     . LYS C 3 583 ? 45.536 12.746  25.088  1.00 50.09 ? 589  LYS A N     1 
ATOM   4677 C  CA    . LYS C 3 583 ? 45.883 11.335  25.184  1.00 49.55 ? 589  LYS A CA    1 
ATOM   4678 C  C     . LYS C 3 583 ? 47.086 11.213  24.243  1.00 49.03 ? 589  LYS A C     1 
ATOM   4679 O  O     . LYS C 3 583 ? 47.916 10.309  24.365  1.00 49.44 ? 589  LYS A O     1 
ATOM   4680 C  CB    . LYS C 3 583 ? 44.730 10.456  24.689  1.00 49.47 ? 589  LYS A CB    1 
ATOM   4681 N  N     . ARG C 3 584 ? 47.168 12.169  23.319  1.00 47.99 ? 590  ARG A N     1 
ATOM   4682 C  CA    . ARG C 3 584 ? 48.231 12.240  22.324  1.00 46.92 ? 590  ARG A CA    1 
ATOM   4683 C  C     . ARG C 3 584 ? 48.098 13.598  21.632  1.00 46.11 ? 590  ARG A C     1 
ATOM   4684 O  O     . ARG C 3 584 ? 47.035 13.914  21.099  1.00 46.17 ? 590  ARG A O     1 
ATOM   4685 C  CB    . ARG C 3 584 ? 48.054 11.133  21.293  1.00 46.04 ? 590  ARG A CB    1 
ATOM   4686 C  CG    . ARG C 3 584 ? 49.341 10.690  20.641  1.00 47.31 ? 590  ARG A CG    1 
ATOM   4687 C  CD    . ARG C 3 584 ? 49.045 10.005  19.332  1.00 47.29 ? 590  ARG A CD    1 
ATOM   4688 N  NE    . ARG C 3 584 ? 47.966 9.038   19.462  1.00 49.20 ? 590  ARG A NE    1 
ATOM   4689 C  CZ    . ARG C 3 584 ? 47.263 8.570   18.438  1.00 50.47 ? 590  ARG A CZ    1 
ATOM   4690 N  NH1   . ARG C 3 584 ? 47.533 8.985   17.206  1.00 52.06 ? 590  ARG A NH1   1 
ATOM   4691 N  NH2   . ARG C 3 584 ? 46.281 7.702   18.648  1.00 51.00 ? 590  ARG A NH2   1 
ATOM   4692 N  N     . ARG C 3 585 ? 49.163 14.398  21.629  1.00 45.32 ? 591  ARG A N     1 
ATOM   4693 C  CA    . ARG C 3 585 ? 49.093 15.717  21.004  1.00 43.77 ? 591  ARG A CA    1 
ATOM   4694 C  C     . ARG C 3 585 ? 49.494 15.739  19.528  1.00 41.18 ? 591  ARG A C     1 
ATOM   4695 O  O     . ARG C 3 585 ? 49.778 16.796  18.964  1.00 40.10 ? 591  ARG A O     1 
ATOM   4696 C  CB    . ARG C 3 585 ? 49.931 16.730  21.797  1.00 46.76 ? 591  ARG A CB    1 
ATOM   4697 C  CG    . ARG C 3 585 ? 49.664 18.184  21.398  1.00 50.50 ? 591  ARG A CG    1 
ATOM   4698 C  CD    . ARG C 3 585 ? 49.809 19.153  22.570  1.00 53.65 ? 591  ARG A CD    1 
ATOM   4699 N  NE    . ARG C 3 585 ? 49.404 20.508  22.194  1.00 55.53 ? 591  ARG A NE    1 
ATOM   4700 C  CZ    . ARG C 3 585 ? 49.271 21.522  23.044  1.00 56.55 ? 591  ARG A CZ    1 
ATOM   4701 N  NH1   . ARG C 3 585 ? 49.509 21.351  24.338  1.00 57.65 ? 591  ARG A NH1   1 
ATOM   4702 N  NH2   . ARG C 3 585 ? 48.893 22.713  22.599  1.00 56.94 ? 591  ARG A NH2   1 
ATOM   4703 N  N     . TRP C 3 586 ? 49.516 14.571  18.897  1.00 38.37 ? 592  TRP A N     1 
ATOM   4704 C  CA    . TRP C 3 586 ? 49.854 14.511  17.485  1.00 36.15 ? 592  TRP A CA    1 
ATOM   4705 C  C     . TRP C 3 586 ? 48.922 13.592  16.730  1.00 35.32 ? 592  TRP A C     1 
ATOM   4706 O  O     . TRP C 3 586 ? 48.219 12.778  17.319  1.00 35.79 ? 592  TRP A O     1 
ATOM   4707 C  CB    . TRP C 3 586 ? 51.299 14.056  17.267  1.00 33.00 ? 592  TRP A CB    1 
ATOM   4708 C  CG    . TRP C 3 586 ? 51.675 12.782  17.951  1.00 31.73 ? 592  TRP A CG    1 
ATOM   4709 C  CD1   . TRP C 3 586 ? 52.199 12.653  19.202  1.00 30.72 ? 592  TRP A CD1   1 
ATOM   4710 C  CD2   . TRP C 3 586 ? 51.610 11.456  17.402  1.00 30.10 ? 592  TRP A CD2   1 
ATOM   4711 N  NE1   . TRP C 3 586 ? 52.473 11.333  19.466  1.00 32.06 ? 592  TRP A NE1   1 
ATOM   4712 C  CE2   . TRP C 3 586 ? 52.122 10.576  18.379  1.00 30.90 ? 592  TRP A CE2   1 
ATOM   4713 C  CE3   . TRP C 3 586 ? 51.170 10.929  16.178  1.00 29.72 ? 592  TRP A CE3   1 
ATOM   4714 C  CZ2   . TRP C 3 586 ? 52.210 9.190   18.174  1.00 30.49 ? 592  TRP A CZ2   1 
ATOM   4715 C  CZ3   . TRP C 3 586 ? 51.254 9.551   15.972  1.00 30.56 ? 592  TRP A CZ3   1 
ATOM   4716 C  CH2   . TRP C 3 586 ? 51.771 8.698   16.968  1.00 31.00 ? 592  TRP A CH2   1 
ATOM   4717 N  N     . ILE C 3 587 ? 48.929 13.740  15.413  1.00 34.30 ? 593  ILE A N     1 
ATOM   4718 C  CA    . ILE C 3 587 ? 48.103 12.942  14.537  1.00 33.52 ? 593  ILE A CA    1 
ATOM   4719 C  C     . ILE C 3 587 ? 49.044 12.347  13.480  1.00 33.12 ? 593  ILE A C     1 
ATOM   4720 O  O     . ILE C 3 587 ? 50.017 12.984  13.066  1.00 32.15 ? 593  ILE A O     1 
ATOM   4721 C  CB    . ILE C 3 587 ? 46.989 13.834  13.907  1.00 36.78 ? 593  ILE A CB    1 
ATOM   4722 C  CG1   . ILE C 3 587 ? 45.676 13.051  13.822  1.00 40.17 ? 593  ILE A CG1   1 
ATOM   4723 C  CG2   . ILE C 3 587 ? 47.425 14.372  12.552  1.00 37.30 ? 593  ILE A CG2   1 
ATOM   4724 C  CD1   . ILE C 3 587 ? 45.777 11.699  13.114  1.00 43.24 ? 593  ILE A CD1   1 
ATOM   4725 N  N     . LYS C 3 588 ? 48.767 11.116  13.066  1.00 32.71 ? 594  LYS A N     1 
ATOM   4726 C  CA    . LYS C 3 588 ? 49.592 10.422  12.088  1.00 31.78 ? 594  LYS A CA    1 
ATOM   4727 C  C     . LYS C 3 588 ? 49.359 10.914  10.665  1.00 30.74 ? 594  LYS A C     1 
ATOM   4728 O  O     . LYS C 3 588 ? 48.232 10.937  10.189  1.00 31.56 ? 594  LYS A O     1 
ATOM   4729 C  CB    . LYS C 3 588 ? 49.328 8.911   12.181  1.00 33.45 ? 594  LYS A CB    1 
ATOM   4730 C  CG    . LYS C 3 588 ? 50.162 8.048   11.230  1.00 36.78 ? 594  LYS A CG    1 
ATOM   4731 C  CD    . LYS C 3 588 ? 50.148 6.568   11.643  1.00 38.32 ? 594  LYS A CD    1 
ATOM   4732 C  CE    . LYS C 3 588 ? 50.809 6.388   13.017  1.00 42.00 ? 594  LYS A CE    1 
ATOM   4733 N  NZ    . LYS C 3 588 ? 51.099 4.963   13.387  1.00 43.69 ? 594  LYS A NZ    1 
ATOM   4734 N  N     . GLY C 3 589 ? 50.436 11.304  9.988   1.00 29.31 ? 595  GLY A N     1 
ATOM   4735 C  CA    . GLY C 3 589 ? 50.322 11.793  8.626   1.00 26.35 ? 595  GLY A CA    1 
ATOM   4736 C  C     . GLY C 3 589 ? 50.271 10.660  7.621   1.00 27.30 ? 595  GLY A C     1 
ATOM   4737 O  O     . GLY C 3 589 ? 50.462 9.497   7.976   1.00 28.13 ? 595  GLY A O     1 
ATOM   4738 N  N     . LEU C 3 590 ? 50.027 10.994  6.359   1.00 26.86 ? 596  LEU A N     1 
ATOM   4739 C  CA    . LEU C 3 590 ? 49.946 9.984   5.313   1.00 27.24 ? 596  LEU A CA    1 
ATOM   4740 C  C     . LEU C 3 590 ? 51.183 9.103   5.204   1.00 26.96 ? 596  LEU A C     1 
ATOM   4741 O  O     . LEU C 3 590 ? 51.081 7.925   4.879   1.00 26.31 ? 596  LEU A O     1 
ATOM   4742 C  CB    . LEU C 3 590 ? 49.658 10.644  3.960   1.00 25.73 ? 596  LEU A CB    1 
ATOM   4743 C  CG    . LEU C 3 590 ? 48.249 11.238  3.867   1.00 24.95 ? 596  LEU A CG    1 
ATOM   4744 C  CD1   . LEU C 3 590 ? 48.034 11.915  2.500   1.00 22.24 ? 596  LEU A CD1   1 
ATOM   4745 C  CD2   . LEU C 3 590 ? 47.232 10.111  4.097   1.00 20.36 ? 596  LEU A CD2   1 
ATOM   4746 N  N     . ASP C 3 591 ? 52.356 9.662   5.474   1.00 27.95 ? 597  ASP A N     1 
ATOM   4747 C  CA    . ASP C 3 591 ? 53.566 8.859   5.376   1.00 27.53 ? 597  ASP A CA    1 
ATOM   4748 C  C     . ASP C 3 591 ? 54.033 8.360   6.736   1.00 26.43 ? 597  ASP A C     1 
ATOM   4749 O  O     . ASP C 3 591 ? 55.189 7.972   6.901   1.00 25.44 ? 597  ASP A O     1 
ATOM   4750 C  CB    . ASP C 3 591 ? 54.681 9.642   4.679   1.00 28.34 ? 597  ASP A CB    1 
ATOM   4751 C  CG    . ASP C 3 591 ? 55.050 10.915  5.406   1.00 29.30 ? 597  ASP A CG    1 
ATOM   4752 O  OD1   . ASP C 3 591 ? 54.560 11.129  6.532   1.00 31.84 ? 597  ASP A OD1   1 
ATOM   4753 O  OD2   . ASP C 3 591 ? 55.838 11.702  4.846   1.00 31.41 ? 597  ASP A OD2   1 
ATOM   4754 N  N     . GLY C 3 592 ? 53.126 8.381   7.708   1.00 26.82 ? 598  GLY A N     1 
ATOM   4755 C  CA    . GLY C 3 592 ? 53.450 7.894   9.037   1.00 27.68 ? 598  GLY A CA    1 
ATOM   4756 C  C     . GLY C 3 592 ? 54.027 8.870   10.046  1.00 28.55 ? 598  GLY A C     1 
ATOM   4757 O  O     . GLY C 3 592 ? 54.070 8.562   11.237  1.00 30.04 ? 598  GLY A O     1 
ATOM   4758 N  N     . ARG C 3 593 ? 54.460 10.045  9.603   1.00 28.15 ? 599  ARG A N     1 
ATOM   4759 C  CA    . ARG C 3 593 ? 55.056 11.004  10.530  1.00 28.80 ? 599  ARG A CA    1 
ATOM   4760 C  C     . ARG C 3 593 ? 54.071 11.505  11.572  1.00 29.19 ? 599  ARG A C     1 
ATOM   4761 O  O     . ARG C 3 593 ? 52.854 11.370  11.419  1.00 28.44 ? 599  ARG A O     1 
ATOM   4762 C  CB    . ARG C 3 593 ? 55.621 12.212  9.775   1.00 28.17 ? 599  ARG A CB    1 
ATOM   4763 C  CG    . ARG C 3 593 ? 54.557 13.150  9.240   1.00 28.92 ? 599  ARG A CG    1 
ATOM   4764 C  CD    . ARG C 3 593 ? 54.853 13.520  7.795   1.00 30.02 ? 599  ARG A CD    1 
ATOM   4765 N  NE    . ARG C 3 593 ? 55.566 14.777  7.691   1.00 29.45 ? 599  ARG A NE    1 
ATOM   4766 C  CZ    . ARG C 3 593 ? 56.438 15.072  6.732   1.00 28.34 ? 599  ARG A CZ    1 
ATOM   4767 N  NH1   . ARG C 3 593 ? 56.722 14.193  5.779   1.00 27.28 ? 599  ARG A NH1   1 
ATOM   4768 N  NH2   . ARG C 3 593 ? 57.021 16.259  6.732   1.00 27.15 ? 599  ARG A NH2   1 
ATOM   4769 N  N     . LYS C 3 594 ? 54.616 12.083  12.638  1.00 29.07 ? 600  LYS A N     1 
ATOM   4770 C  CA    . LYS C 3 594 ? 53.797 12.649  13.695  1.00 28.43 ? 600  LYS A CA    1 
ATOM   4771 C  C     . LYS C 3 594 ? 53.499 14.082  13.295  1.00 28.22 ? 600  LYS A C     1 
ATOM   4772 O  O     . LYS C 3 594 ? 54.398 14.820  12.922  1.00 27.51 ? 600  LYS A O     1 
ATOM   4773 C  CB    . LYS C 3 594 ? 54.550 12.678  15.024  1.00 28.21 ? 600  LYS A CB    1 
ATOM   4774 C  CG    . LYS C 3 594 ? 54.798 11.342  15.674  1.00 28.72 ? 600  LYS A CG    1 
ATOM   4775 C  CD    . LYS C 3 594 ? 55.511 11.562  16.993  1.00 30.49 ? 600  LYS A CD    1 
ATOM   4776 C  CE    . LYS C 3 594 ? 55.731 10.270  17.749  1.00 34.64 ? 600  LYS A CE    1 
ATOM   4777 N  NZ    . LYS C 3 594 ? 56.595 10.503  18.948  1.00 36.72 ? 600  LYS A NZ    1 
ATOM   4778 N  N     . VAL C 3 595 ? 52.236 14.475  13.362  1.00 28.20 ? 601  VAL A N     1 
ATOM   4779 C  CA    . VAL C 3 595 ? 51.875 15.838  13.037  1.00 27.23 ? 601  VAL A CA    1 
ATOM   4780 C  C     . VAL C 3 595 ? 51.302 16.488  14.285  1.00 28.01 ? 601  VAL A C     1 
ATOM   4781 O  O     . VAL C 3 595 ? 50.145 16.259  14.647  1.00 28.20 ? 601  VAL A O     1 
ATOM   4782 C  CB    . VAL C 3 595 ? 50.835 15.898  11.920  1.00 27.56 ? 601  VAL A CB    1 
ATOM   4783 C  CG1   . VAL C 3 595 ? 50.500 17.346  11.622  1.00 26.28 ? 601  VAL A CG1   1 
ATOM   4784 C  CG2   . VAL C 3 595 ? 51.367 15.200  10.673  1.00 28.37 ? 601  VAL A CG2   1 
ATOM   4785 N  N     . HIS C 3 596 ? 52.124 17.289  14.946  1.00 28.73 ? 602  HIS A N     1 
ATOM   4786 C  CA    . HIS C 3 596 ? 51.720 17.987  16.157  1.00 31.05 ? 602  HIS A CA    1 
ATOM   4787 C  C     . HIS C 3 596 ? 50.413 18.759  15.974  1.00 31.77 ? 602  HIS A C     1 
ATOM   4788 O  O     . HIS C 3 596 ? 50.205 19.428  14.965  1.00 32.84 ? 602  HIS A O     1 
ATOM   4789 C  CB    . HIS C 3 596 ? 52.825 18.948  16.585  1.00 32.32 ? 602  HIS A CB    1 
ATOM   4790 C  CG    . HIS C 3 596 ? 52.501 19.738  17.811  1.00 33.57 ? 602  HIS A CG    1 
ATOM   4791 N  ND1   . HIS C 3 596 ? 52.354 19.159  19.053  1.00 34.29 ? 602  HIS A ND1   1 
ATOM   4792 C  CD2   . HIS C 3 596 ? 52.301 21.065  17.986  1.00 34.11 ? 602  HIS A CD2   1 
ATOM   4793 C  CE1   . HIS C 3 596 ? 52.075 20.097  19.941  1.00 34.50 ? 602  HIS A CE1   1 
ATOM   4794 N  NE2   . HIS C 3 596 ? 52.037 21.262  19.320  1.00 34.56 ? 602  HIS A NE2   1 
ATOM   4795 N  N     . VAL C 3 597 ? 49.532 18.650  16.960  1.00 33.02 ? 603  VAL A N     1 
ATOM   4796 C  CA    . VAL C 3 597 ? 48.248 19.336  16.933  1.00 35.19 ? 603  VAL A CA    1 
ATOM   4797 C  C     . VAL C 3 597 ? 48.289 20.453  17.966  1.00 38.30 ? 603  VAL A C     1 
ATOM   4798 O  O     . VAL C 3 597 ? 48.422 20.198  19.161  1.00 39.80 ? 603  VAL A O     1 
ATOM   4799 C  CB    . VAL C 3 597 ? 47.105 18.364  17.274  1.00 35.11 ? 603  VAL A CB    1 
ATOM   4800 C  CG1   . VAL C 3 597 ? 45.783 19.107  17.331  1.00 33.02 ? 603  VAL A CG1   1 
ATOM   4801 C  CG2   . VAL C 3 597 ? 47.054 17.247  16.232  1.00 32.18 ? 603  VAL A CG2   1 
ATOM   4802 N  N     . ARG C 3 598 ? 48.183 21.691  17.499  1.00 41.39 ? 604  ARG A N     1 
ATOM   4803 C  CA    . ARG C 3 598 ? 48.231 22.850  18.378  1.00 44.47 ? 604  ARG A CA    1 
ATOM   4804 C  C     . ARG C 3 598 ? 46.980 22.997  19.242  1.00 46.62 ? 604  ARG A C     1 
ATOM   4805 O  O     . ARG C 3 598 ? 47.082 23.317  20.425  1.00 47.28 ? 604  ARG A O     1 
ATOM   4806 C  CB    . ARG C 3 598 ? 48.495 24.111  17.543  1.00 43.58 ? 604  ARG A CB    1 
ATOM   4807 C  CG    . ARG C 3 598 ? 49.899 24.101  16.916  1.00 45.37 ? 604  ARG A CG    1 
ATOM   4808 C  CD    . ARG C 3 598 ? 50.151 25.216  15.894  1.00 43.61 ? 604  ARG A CD    1 
ATOM   4809 N  NE    . ARG C 3 598 ? 51.570 25.280  15.531  1.00 42.80 ? 604  ARG A NE    1 
ATOM   4810 C  CZ    . ARG C 3 598 ? 52.084 26.085  14.597  1.00 42.21 ? 604  ARG A CZ    1 
ATOM   4811 N  NH1   . ARG C 3 598 ? 51.302 26.907  13.906  1.00 40.31 ? 604  ARG A NH1   1 
ATOM   4812 N  NH2   . ARG C 3 598 ? 53.389 26.078  14.359  1.00 39.65 ? 604  ARG A NH2   1 
ATOM   4813 N  N     . SER C 3 599 ? 45.806 22.754  18.662  1.00 48.48 ? 605  SER A N     1 
ATOM   4814 C  CA    . SER C 3 599 ? 44.556 22.846  19.418  1.00 50.01 ? 605  SER A CA    1 
ATOM   4815 C  C     . SER C 3 599 ? 43.510 21.851  18.915  1.00 50.13 ? 605  SER A C     1 
ATOM   4816 O  O     . SER C 3 599 ? 43.476 21.506  17.736  1.00 49.75 ? 605  SER A O     1 
ATOM   4817 C  CB    . SER C 3 599 ? 43.983 24.266  19.352  1.00 50.58 ? 605  SER A CB    1 
ATOM   4818 O  OG    . SER C 3 599 ? 43.509 24.563  18.054  1.00 51.54 ? 605  SER A OG    1 
ATOM   4819 N  N     . PRO C 3 600 ? 42.639 21.378  19.816  1.00 50.92 ? 606  PRO A N     1 
ATOM   4820 C  CA    . PRO C 3 600 ? 41.582 20.419  19.485  1.00 50.78 ? 606  PRO A CA    1 
ATOM   4821 C  C     . PRO C 3 600 ? 40.624 20.873  18.385  1.00 51.00 ? 606  PRO A C     1 
ATOM   4822 O  O     . PRO C 3 600 ? 40.166 20.060  17.582  1.00 50.56 ? 606  PRO A O     1 
ATOM   4823 C  CB    . PRO C 3 600 ? 40.866 20.224  20.821  1.00 51.32 ? 606  PRO A CB    1 
ATOM   4824 C  CG    . PRO C 3 600 ? 41.968 20.400  21.815  1.00 51.94 ? 606  PRO A CG    1 
ATOM   4825 C  CD    . PRO C 3 600 ? 42.688 21.617  21.269  1.00 51.43 ? 606  PRO A CD    1 
ATOM   4826 N  N     . HIS C 3 601 ? 40.312 22.165  18.347  1.00 50.75 ? 607  HIS A N     1 
ATOM   4827 C  CA    . HIS C 3 601 ? 39.389 22.665  17.338  1.00 51.61 ? 607  HIS A CA    1 
ATOM   4828 C  C     . HIS C 3 601 ? 40.039 22.763  15.959  1.00 50.41 ? 607  HIS A C     1 
ATOM   4829 O  O     . HIS C 3 601 ? 39.350 22.765  14.941  1.00 49.81 ? 607  HIS A O     1 
ATOM   4830 C  CB    . HIS C 3 601 ? 38.821 24.032  17.753  1.00 54.44 ? 607  HIS A CB    1 
ATOM   4831 C  CG    . HIS C 3 601 ? 39.582 25.202  17.209  1.00 57.81 ? 607  HIS A CG    1 
ATOM   4832 N  ND1   . HIS C 3 601 ? 40.863 25.514  17.611  1.00 59.21 ? 607  HIS A ND1   1 
ATOM   4833 C  CD2   . HIS C 3 601 ? 39.240 26.133  16.285  1.00 59.09 ? 607  HIS A CD2   1 
ATOM   4834 C  CE1   . HIS C 3 601 ? 41.279 26.588  16.961  1.00 59.62 ? 607  HIS A CE1   1 
ATOM   4835 N  NE2   . HIS C 3 601 ? 40.313 26.983  16.150  1.00 61.18 ? 607  HIS A NE2   1 
ATOM   4836 N  N     . ALA C 3 602 ? 41.364 22.840  15.922  1.00 48.79 ? 608  ALA A N     1 
ATOM   4837 C  CA    . ALA C 3 602 ? 42.068 22.934  14.646  1.00 47.82 ? 608  ALA A CA    1 
ATOM   4838 C  C     . ALA C 3 602 ? 42.552 21.561  14.165  1.00 45.11 ? 608  ALA A C     1 
ATOM   4839 O  O     . ALA C 3 602 ? 43.250 21.459  13.160  1.00 44.51 ? 608  ALA A O     1 
ATOM   4840 C  CB    . ALA C 3 602 ? 43.250 23.897  14.775  1.00 48.64 ? 608  ALA A CB    1 
ATOM   4841 N  N     . ALA C 3 603 ? 42.159 20.514  14.884  1.00 42.20 ? 609  ALA A N     1 
ATOM   4842 C  CA    . ALA C 3 603 ? 42.555 19.145  14.565  1.00 40.34 ? 609  ALA A CA    1 
ATOM   4843 C  C     . ALA C 3 603 ? 42.182 18.661  13.159  1.00 39.45 ? 609  ALA A C     1 
ATOM   4844 O  O     . ALA C 3 603 ? 43.015 18.088  12.456  1.00 39.06 ? 609  ALA A O     1 
ATOM   4845 C  CB    . ALA C 3 603 ? 41.986 18.194  15.606  1.00 38.23 ? 609  ALA A CB    1 
ATOM   4846 N  N     . LEU C 3 604 ? 40.935 18.872  12.751  1.00 39.12 ? 610  LEU A N     1 
ATOM   4847 C  CA    . LEU C 3 604 ? 40.511 18.433  11.429  1.00 38.81 ? 610  LEU A CA    1 
ATOM   4848 C  C     . LEU C 3 604 ? 41.307 19.161  10.358  1.00 39.00 ? 610  LEU A C     1 
ATOM   4849 O  O     . LEU C 3 604 ? 41.734 18.550  9.379   1.00 37.90 ? 610  LEU A O     1 
ATOM   4850 C  CB    . LEU C 3 604 ? 39.016 18.693  11.218  1.00 39.82 ? 610  LEU A CB    1 
ATOM   4851 C  CG    . LEU C 3 604 ? 38.490 18.529  9.781   1.00 41.13 ? 610  LEU A CG    1 
ATOM   4852 C  CD1   . LEU C 3 604 ? 38.773 17.130  9.263   1.00 39.76 ? 610  LEU A CD1   1 
ATOM   4853 C  CD2   . LEU C 3 604 ? 36.999 18.804  9.757   1.00 42.34 ? 610  LEU A CD2   1 
ATOM   4854 N  N     . ASN C 3 605 ? 41.500 20.464  10.554  1.00 38.38 ? 611  ASN A N     1 
ATOM   4855 C  CA    . ASN C 3 605 ? 42.239 21.278  9.601   1.00 38.59 ? 611  ASN A CA    1 
ATOM   4856 C  C     . ASN C 3 605 ? 43.688 20.844  9.489   1.00 37.80 ? 611  ASN A C     1 
ATOM   4857 O  O     . ASN C 3 605 ? 44.233 20.792  8.393   1.00 38.14 ? 611  ASN A O     1 
ATOM   4858 C  CB    . ASN C 3 605 ? 42.180 22.760  9.980   1.00 41.16 ? 611  ASN A CB    1 
ATOM   4859 C  CG    . ASN C 3 605 ? 43.108 23.612  9.120   1.00 44.55 ? 611  ASN A CG    1 
ATOM   4860 O  OD1   . ASN C 3 605 ? 44.314 23.696  9.375   1.00 45.77 ? 611  ASN A OD1   1 
ATOM   4861 N  ND2   . ASN C 3 605 ? 42.552 24.230  8.083   1.00 45.13 ? 611  ASN A ND2   1 
ATOM   4862 N  N     . THR C 3 606 ? 44.314 20.549  10.623  1.00 36.47 ? 612  THR A N     1 
ATOM   4863 C  CA    . THR C 3 606 ? 45.698 20.096  10.634  1.00 35.70 ? 612  THR A CA    1 
ATOM   4864 C  C     . THR C 3 606 ? 45.796 18.806  9.827   1.00 35.10 ? 612  THR A C     1 
ATOM   4865 O  O     . THR C 3 606 ? 46.743 18.599  9.075   1.00 35.72 ? 612  THR A O     1 
ATOM   4866 C  CB    . THR C 3 606 ? 46.175 19.820  12.072  1.00 35.87 ? 612  THR A CB    1 
ATOM   4867 O  OG1   . THR C 3 606 ? 46.258 21.058  12.787  1.00 38.04 ? 612  THR A OG1   1 
ATOM   4868 C  CG2   . THR C 3 606 ? 47.531 19.144  12.075  1.00 34.83 ? 612  THR A CG2   1 
ATOM   4869 N  N     . LEU C 3 607 ? 44.804 17.942  9.991   1.00 34.86 ? 613  LEU A N     1 
ATOM   4870 C  CA    . LEU C 3 607 ? 44.771 16.670  9.281   1.00 34.91 ? 613  LEU A CA    1 
ATOM   4871 C  C     . LEU C 3 607 ? 44.648 16.868  7.768   1.00 33.04 ? 613  LEU A C     1 
ATOM   4872 O  O     . LEU C 3 607 ? 45.387 16.260  6.989   1.00 32.52 ? 613  LEU A O     1 
ATOM   4873 C  CB    . LEU C 3 607 ? 43.596 15.827  9.782   1.00 36.44 ? 613  LEU A CB    1 
ATOM   4874 C  CG    . LEU C 3 607 ? 43.367 14.472  9.111   1.00 37.90 ? 613  LEU A CG    1 
ATOM   4875 C  CD1   . LEU C 3 607 ? 44.456 13.498  9.532   1.00 38.50 ? 613  LEU A CD1   1 
ATOM   4876 C  CD2   . LEU C 3 607 ? 41.997 13.938  9.520   1.00 40.70 ? 613  LEU A CD2   1 
ATOM   4877 N  N     . LEU C 3 608 ? 43.725 17.733  7.363   1.00 30.94 ? 614  LEU A N     1 
ATOM   4878 C  CA    . LEU C 3 608 ? 43.487 17.992  5.950   1.00 30.74 ? 614  LEU A CA    1 
ATOM   4879 C  C     . LEU C 3 608 ? 44.637 18.727  5.272   1.00 30.45 ? 614  LEU A C     1 
ATOM   4880 O  O     . LEU C 3 608 ? 45.026 18.380  4.150   1.00 30.48 ? 614  LEU A O     1 
ATOM   4881 C  CB    . LEU C 3 608 ? 42.187 18.787  5.767   1.00 31.43 ? 614  LEU A CB    1 
ATOM   4882 C  CG    . LEU C 3 608 ? 40.898 18.207  6.375   1.00 31.20 ? 614  LEU A CG    1 
ATOM   4883 C  CD1   . LEU C 3 608 ? 39.707 19.039  5.905   1.00 31.62 ? 614  LEU A CD1   1 
ATOM   4884 C  CD2   . LEU C 3 608 ? 40.721 16.751  5.963   1.00 29.71 ? 614  LEU A CD2   1 
ATOM   4885 N  N     . GLN C 3 609 ? 45.182 19.737  5.947   1.00 30.54 ? 615  GLN A N     1 
ATOM   4886 C  CA    . GLN C 3 609 ? 46.286 20.511  5.387   1.00 29.57 ? 615  GLN A CA    1 
ATOM   4887 C  C     . GLN C 3 609 ? 47.516 19.621  5.264   1.00 27.80 ? 615  GLN A C     1 
ATOM   4888 O  O     . GLN C 3 609 ? 48.284 19.738  4.316   1.00 27.66 ? 615  GLN A O     1 
ATOM   4889 C  CB    . GLN C 3 609 ? 46.611 21.741  6.266   1.00 29.62 ? 615  GLN A CB    1 
ATOM   4890 C  CG    . GLN C 3 609 ? 47.643 22.689  5.625   1.00 32.97 ? 615  GLN A CG    1 
ATOM   4891 C  CD    . GLN C 3 609 ? 48.040 23.874  6.509   1.00 36.01 ? 615  GLN A CD    1 
ATOM   4892 O  OE1   . GLN C 3 609 ? 49.203 24.001  6.929   1.00 34.82 ? 615  GLN A OE1   1 
ATOM   4893 N  NE2   . GLN C 3 609 ? 47.074 24.748  6.794   1.00 36.87 ? 615  GLN A NE2   1 
ATOM   4894 N  N     . SER C 3 610 ? 47.694 18.719  6.220   1.00 27.58 ? 616  SER A N     1 
ATOM   4895 C  CA    . SER C 3 610 ? 48.843 17.827  6.199   1.00 28.28 ? 616  SER A CA    1 
ATOM   4896 C  C     . SER C 3 610 ? 48.769 16.815  5.055   1.00 29.00 ? 616  SER A C     1 
ATOM   4897 O  O     . SER C 3 610 ? 49.785 16.500  4.430   1.00 29.09 ? 616  SER A O     1 
ATOM   4898 C  CB    . SER C 3 610 ? 48.965 17.085  7.524   1.00 27.84 ? 616  SER A CB    1 
ATOM   4899 O  OG    . SER C 3 610 ? 50.113 16.259  7.521   1.00 29.35 ? 616  SER A OG    1 
ATOM   4900 N  N     . ALA C 3 611 ? 47.571 16.304  4.789   1.00 28.25 ? 617  ALA A N     1 
ATOM   4901 C  CA    . ALA C 3 611 ? 47.395 15.335  3.714   1.00 28.01 ? 617  ALA A CA    1 
ATOM   4902 C  C     . ALA C 3 611 ? 47.685 16.029  2.396   1.00 27.86 ? 617  ALA A C     1 
ATOM   4903 O  O     . ALA C 3 611 ? 48.420 15.503  1.560   1.00 29.40 ? 617  ALA A O     1 
ATOM   4904 C  CB    . ALA C 3 611 ? 45.980 14.773  3.720   1.00 27.65 ? 617  ALA A CB    1 
ATOM   4905 N  N     . GLY C 3 612 ? 47.112 17.216  2.213   1.00 27.80 ? 618  GLY A N     1 
ATOM   4906 C  CA    . GLY C 3 612 ? 47.364 17.957  0.993   1.00 26.62 ? 618  GLY A CA    1 
ATOM   4907 C  C     . GLY C 3 612 ? 48.855 18.241  0.857   1.00 26.39 ? 618  GLY A C     1 
ATOM   4908 O  O     . GLY C 3 612 ? 49.446 18.048  -0.203  1.00 27.99 ? 618  GLY A O     1 
ATOM   4909 N  N     . ALA C 3 613 ? 49.476 18.683  1.942   1.00 25.48 ? 619  ALA A N     1 
ATOM   4910 C  CA    . ALA C 3 613 ? 50.899 18.990  1.916   1.00 25.46 ? 619  ALA A CA    1 
ATOM   4911 C  C     . ALA C 3 613 ? 51.744 17.778  1.529   1.00 26.04 ? 619  ALA A C     1 
ATOM   4912 O  O     . ALA C 3 613 ? 52.594 17.869  0.642   1.00 25.59 ? 619  ALA A O     1 
ATOM   4913 C  CB    . ALA C 3 613 ? 51.347 19.521  3.270   1.00 24.07 ? 619  ALA A CB    1 
ATOM   4914 N  N     . LEU C 3 614 ? 51.513 16.647  2.194   1.00 24.79 ? 620  LEU A N     1 
ATOM   4915 C  CA    . LEU C 3 614 ? 52.278 15.439  1.903   1.00 24.65 ? 620  LEU A CA    1 
ATOM   4916 C  C     . LEU C 3 614 ? 51.980 14.874  0.518   1.00 24.76 ? 620  LEU A C     1 
ATOM   4917 O  O     . LEU C 3 614 ? 52.861 14.317  -0.128  1.00 23.95 ? 620  LEU A O     1 
ATOM   4918 C  CB    . LEU C 3 614 ? 52.023 14.374  2.968   1.00 24.84 ? 620  LEU A CB    1 
ATOM   4919 C  CG    . LEU C 3 614 ? 52.340 14.792  4.408   1.00 27.12 ? 620  LEU A CG    1 
ATOM   4920 C  CD1   . LEU C 3 614 ? 52.445 13.541  5.272   1.00 25.47 ? 620  LEU A CD1   1 
ATOM   4921 C  CD2   . LEU C 3 614 ? 53.646 15.575  4.463   1.00 23.98 ? 620  LEU A CD2   1 
ATOM   4922 N  N     . ILE C 3 615 ? 50.735 15.010  0.069   1.00 26.15 ? 621  ILE A N     1 
ATOM   4923 C  CA    . ILE C 3 615 ? 50.355 14.540  -1.250  1.00 24.87 ? 621  ILE A CA    1 
ATOM   4924 C  C     . ILE C 3 615 ? 51.106 15.388  -2.275  1.00 26.81 ? 621  ILE A C     1 
ATOM   4925 O  O     . ILE C 3 615 ? 51.696 14.862  -3.215  1.00 26.19 ? 621  ILE A O     1 
ATOM   4926 C  CB    . ILE C 3 615 ? 48.812 14.661  -1.469  1.00 25.33 ? 621  ILE A CB    1 
ATOM   4927 C  CG1   . ILE C 3 615 ? 48.113 13.418  -0.898  1.00 25.67 ? 621  ILE A CG1   1 
ATOM   4928 C  CG2   . ILE C 3 615 ? 48.482 14.817  -2.960  1.00 21.37 ? 621  ILE A CG2   1 
ATOM   4929 C  CD1   . ILE C 3 615 ? 46.602 13.556  -0.763  1.00 22.08 ? 621  ILE A CD1   1 
ATOM   4930 N  N     . CYS C 3 616 ? 51.103 16.703  -2.080  1.00 27.08 ? 622  CYS A N     1 
ATOM   4931 C  CA    . CYS C 3 616 ? 51.793 17.591  -3.013  1.00 27.19 ? 622  CYS A CA    1 
ATOM   4932 C  C     . CYS C 3 616 ? 53.307 17.410  -3.013  1.00 26.42 ? 622  CYS A C     1 
ATOM   4933 O  O     . CYS C 3 616 ? 53.961 17.558  -4.049  1.00 25.50 ? 622  CYS A O     1 
ATOM   4934 C  CB    . CYS C 3 616 ? 51.431 19.050  -2.721  1.00 26.82 ? 622  CYS A CB    1 
ATOM   4935 S  SG    . CYS C 3 616 ? 49.776 19.461  -3.326  1.00 35.13 ? 622  CYS A SG    1 
ATOM   4936 N  N     . LYS C 3 617 ? 53.862 17.072  -1.856  1.00 25.70 ? 623  LYS A N     1 
ATOM   4937 C  CA    . LYS C 3 617 ? 55.295 16.870  -1.752  1.00 25.40 ? 623  LYS A CA    1 
ATOM   4938 C  C     . LYS C 3 617 ? 55.707 15.616  -2.525  1.00 25.22 ? 623  LYS A C     1 
ATOM   4939 O  O     . LYS C 3 617 ? 56.620 15.666  -3.344  1.00 25.87 ? 623  LYS A O     1 
ATOM   4940 C  CB    . LYS C 3 617 ? 55.696 16.768  -0.281  1.00 26.22 ? 623  LYS A CB    1 
ATOM   4941 C  CG    . LYS C 3 617 ? 57.185 16.798  -0.024  1.00 27.71 ? 623  LYS A CG    1 
ATOM   4942 C  CD    . LYS C 3 617 ? 57.471 16.905  1.470   1.00 27.09 ? 623  LYS A CD    1 
ATOM   4943 C  CE    . LYS C 3 617 ? 57.149 18.294  1.994   1.00 28.84 ? 623  LYS A CE    1 
ATOM   4944 N  NZ    . LYS C 3 617 ? 57.412 18.425  3.461   1.00 30.14 ? 623  LYS A NZ    1 
ATOM   4945 N  N     . LEU C 3 618 ? 55.028 14.498  -2.287  1.00 25.36 ? 624  LEU A N     1 
ATOM   4946 C  CA    . LEU C 3 618 ? 55.355 13.260  -2.995  1.00 24.60 ? 624  LEU A CA    1 
ATOM   4947 C  C     . LEU C 3 618 ? 55.087 13.456  -4.488  1.00 24.89 ? 624  LEU A C     1 
ATOM   4948 O  O     . LEU C 3 618 ? 55.805 12.932  -5.341  1.00 26.98 ? 624  LEU A O     1 
ATOM   4949 C  CB    . LEU C 3 618 ? 54.499 12.099  -2.486  1.00 24.57 ? 624  LEU A CB    1 
ATOM   4950 C  CG    . LEU C 3 618 ? 55.157 10.737  -2.196  1.00 27.89 ? 624  LEU A CG    1 
ATOM   4951 C  CD1   . LEU C 3 618 ? 54.087 9.657   -2.320  1.00 24.50 ? 624  LEU A CD1   1 
ATOM   4952 C  CD2   . LEU C 3 618 ? 56.318 10.442  -3.133  1.00 26.53 ? 624  LEU A CD2   1 
ATOM   4953 N  N     . TRP C 3 619 ? 54.045 14.210  -4.802  1.00 23.72 ? 625  TRP A N     1 
ATOM   4954 C  CA    . TRP C 3 619 ? 53.688 14.476  -6.192  1.00 25.11 ? 625  TRP A CA    1 
ATOM   4955 C  C     . TRP C 3 619 ? 54.788 15.166  -7.001  1.00 25.07 ? 625  TRP A C     1 
ATOM   4956 O  O     . TRP C 3 619 ? 55.122 14.724  -8.099  1.00 25.58 ? 625  TRP A O     1 
ATOM   4957 C  CB    . TRP C 3 619 ? 52.413 15.315  -6.250  1.00 24.92 ? 625  TRP A CB    1 
ATOM   4958 C  CG    . TRP C 3 619 ? 52.113 15.881  -7.603  1.00 26.27 ? 625  TRP A CG    1 
ATOM   4959 C  CD1   . TRP C 3 619 ? 52.025 15.196  -8.783  1.00 26.54 ? 625  TRP A CD1   1 
ATOM   4960 C  CD2   . TRP C 3 619 ? 51.783 17.241  -7.901  1.00 25.62 ? 625  TRP A CD2   1 
ATOM   4961 N  NE1   . TRP C 3 619 ? 51.650 16.047  -9.795  1.00 26.47 ? 625  TRP A NE1   1 
ATOM   4962 C  CE2   . TRP C 3 619 ? 51.494 17.308  -9.282  1.00 25.94 ? 625  TRP A CE2   1 
ATOM   4963 C  CE3   . TRP C 3 619 ? 51.697 18.409  -7.133  1.00 24.03 ? 625  TRP A CE3   1 
ATOM   4964 C  CZ2   . TRP C 3 619 ? 51.125 18.501  -9.916  1.00 26.71 ? 625  TRP A CZ2   1 
ATOM   4965 C  CZ3   . TRP C 3 619 ? 51.329 19.597  -7.762  1.00 26.90 ? 625  TRP A CZ3   1 
ATOM   4966 C  CH2   . TRP C 3 619 ? 51.047 19.632  -9.142  1.00 26.47 ? 625  TRP A CH2   1 
ATOM   4967 N  N     . ILE C 3 620 ? 55.347 16.252  -6.479  1.00 26.93 ? 626  ILE A N     1 
ATOM   4968 C  CA    . ILE C 3 620 ? 56.394 16.944  -7.222  1.00 27.09 ? 626  ILE A CA    1 
ATOM   4969 C  C     . ILE C 3 620 ? 57.649 16.083  -7.280  1.00 28.08 ? 626  ILE A C     1 
ATOM   4970 O  O     . ILE C 3 620 ? 58.417 16.163  -8.232  1.00 29.15 ? 626  ILE A O     1 
ATOM   4971 C  CB    . ILE C 3 620 ? 56.721 18.316  -6.615  1.00 28.04 ? 626  ILE A CB    1 
ATOM   4972 C  CG1   . ILE C 3 620 ? 57.318 18.160  -5.216  1.00 29.70 ? 626  ILE A CG1   1 
ATOM   4973 C  CG2   . ILE C 3 620 ? 55.461 19.156  -6.567  1.00 25.51 ? 626  ILE A CG2   1 
ATOM   4974 C  CD1   . ILE C 3 620 ? 57.786 19.482  -4.615  1.00 31.20 ? 626  ILE A CD1   1 
ATOM   4975 N  N     . ILE C 3 621 ? 57.849 15.242  -6.270  1.00 27.50 ? 627  ILE A N     1 
ATOM   4976 C  CA    . ILE C 3 621 ? 59.002 14.355  -6.267  1.00 27.25 ? 627  ILE A CA    1 
ATOM   4977 C  C     . ILE C 3 621 ? 58.837 13.305  -7.365  1.00 27.99 ? 627  ILE A C     1 
ATOM   4978 O  O     . ILE C 3 621 ? 59.742 13.078  -8.172  1.00 26.94 ? 627  ILE A O     1 
ATOM   4979 C  CB    . ILE C 3 621 ? 59.158 13.626  -4.917  1.00 26.21 ? 627  ILE A CB    1 
ATOM   4980 C  CG1   . ILE C 3 621 ? 59.626 14.609  -3.837  1.00 25.35 ? 627  ILE A CG1   1 
ATOM   4981 C  CG2   . ILE C 3 621 ? 60.164 12.483  -5.058  1.00 24.89 ? 627  ILE A CG2   1 
ATOM   4982 C  CD1   . ILE C 3 621 ? 59.502 14.060  -2.425  1.00 25.22 ? 627  ILE A CD1   1 
ATOM   4983 N  N     . LYS C 3 622 ? 57.671 12.670  -7.392  1.00 28.45 ? 628  LYS A N     1 
ATOM   4984 C  CA    . LYS C 3 622 ? 57.396 11.635  -8.381  1.00 28.29 ? 628  LYS A CA    1 
ATOM   4985 C  C     . LYS C 3 622 ? 57.340 12.200  -9.795  1.00 26.64 ? 628  LYS A C     1 
ATOM   4986 O  O     . LYS C 3 622 ? 57.667 11.508  -10.753 1.00 26.72 ? 628  LYS A O     1 
ATOM   4987 C  CB    . LYS C 3 622 ? 56.079 10.920  -8.052  1.00 29.32 ? 628  LYS A CB    1 
ATOM   4988 C  CG    . LYS C 3 622 ? 55.808 9.679   -8.909  1.00 34.00 ? 628  LYS A CG    1 
ATOM   4989 C  CD    . LYS C 3 622 ? 56.824 8.565   -8.634  1.00 33.90 ? 628  LYS A CD    1 
ATOM   4990 C  CE    . LYS C 3 622 ? 56.550 7.336   -9.494  1.00 35.97 ? 628  LYS A CE    1 
ATOM   4991 N  NZ    . LYS C 3 622 ? 57.603 6.284   -9.321  1.00 38.68 ? 628  LYS A NZ    1 
ATOM   4992 N  N     . THR C 3 623 ? 56.932 13.459  -9.929  1.00 26.98 ? 629  THR A N     1 
ATOM   4993 C  CA    . THR C 3 623 ? 56.855 14.071  -11.251 1.00 27.50 ? 629  THR A CA    1 
ATOM   4994 C  C     . THR C 3 623 ? 58.267 14.223  -11.825 1.00 27.15 ? 629  THR A C     1 
ATOM   4995 O  O     . THR C 3 623 ? 58.533 13.813  -12.958 1.00 27.77 ? 629  THR A O     1 
ATOM   4996 C  CB    . THR C 3 623 ? 56.155 15.461  -11.202 1.00 27.88 ? 629  THR A CB    1 
ATOM   4997 O  OG1   . THR C 3 623 ? 54.803 15.306  -10.761 1.00 29.20 ? 629  THR A OG1   1 
ATOM   4998 C  CG2   . THR C 3 623 ? 56.145 16.110  -12.576 1.00 26.28 ? 629  THR A CG2   1 
ATOM   4999 N  N     . GLU C 3 624 ? 59.171 14.801  -11.039 1.00 27.16 ? 630  GLU A N     1 
ATOM   5000 C  CA    . GLU C 3 624 ? 60.538 14.986  -11.495 1.00 29.05 ? 630  GLU A CA    1 
ATOM   5001 C  C     . GLU C 3 624 ? 61.169 13.626  -11.789 1.00 30.13 ? 630  GLU A C     1 
ATOM   5002 O  O     . GLU C 3 624 ? 61.840 13.470  -12.801 1.00 31.08 ? 630  GLU A O     1 
ATOM   5003 C  CB    . GLU C 3 624 ? 61.376 15.736  -10.448 1.00 27.02 ? 630  GLU A CB    1 
ATOM   5004 C  CG    . GLU C 3 624 ? 62.709 16.278  -10.996 1.00 28.69 ? 630  GLU A CG    1 
ATOM   5005 C  CD    . GLU C 3 624 ? 63.950 15.639  -10.369 1.00 30.08 ? 630  GLU A CD    1 
ATOM   5006 O  OE1   . GLU C 3 624 ? 63.816 14.720  -9.532  1.00 31.33 ? 630  GLU A OE1   1 
ATOM   5007 O  OE2   . GLU C 3 624 ? 65.073 16.062  -10.713 1.00 28.23 ? 630  GLU A OE2   1 
ATOM   5008 N  N     . GLU C 3 625 ? 60.942 12.642  -10.920 1.00 31.73 ? 631  GLU A N     1 
ATOM   5009 C  CA    . GLU C 3 625 ? 61.509 11.309  -11.128 1.00 34.45 ? 631  GLU A CA    1 
ATOM   5010 C  C     . GLU C 3 625 ? 61.024 10.674  -12.434 1.00 33.61 ? 631  GLU A C     1 
ATOM   5011 O  O     . GLU C 3 625 ? 61.807 10.056  -13.157 1.00 33.00 ? 631  GLU A O     1 
ATOM   5012 C  CB    . GLU C 3 625 ? 61.181 10.378  -9.947  1.00 37.86 ? 631  GLU A CB    1 
ATOM   5013 C  CG    . GLU C 3 625 ? 61.745 8.959   -10.109 1.00 44.80 ? 631  GLU A CG    1 
ATOM   5014 C  CD    . GLU C 3 625 ? 61.540 8.062   -8.880  1.00 48.53 ? 631  GLU A CD    1 
ATOM   5015 O  OE1   . GLU C 3 625 ? 60.381 7.883   -8.429  1.00 49.65 ? 631  GLU A OE1   1 
ATOM   5016 O  OE2   . GLU C 3 625 ? 62.549 7.521   -8.370  1.00 49.92 ? 631  GLU A OE2   1 
ATOM   5017 N  N     . MET C 3 626 ? 59.741 10.829  -12.744 1.00 33.00 ? 632  MET A N     1 
ATOM   5018 C  CA    . MET C 3 626 ? 59.210 10.262  -13.979 1.00 33.90 ? 632  MET A CA    1 
ATOM   5019 C  C     . MET C 3 626 ? 59.799 10.971  -15.202 1.00 33.63 ? 632  MET A C     1 
ATOM   5020 O  O     . MET C 3 626 ? 60.038 10.341  -16.234 1.00 33.42 ? 632  MET A O     1 
ATOM   5021 C  CB    . MET C 3 626 ? 57.682 10.357  -14.009 1.00 34.01 ? 632  MET A CB    1 
ATOM   5022 C  CG    . MET C 3 626 ? 56.979 9.345   -13.116 1.00 35.08 ? 632  MET A CG    1 
ATOM   5023 S  SD    . MET C 3 626 ? 55.184 9.579   -13.096 1.00 39.23 ? 632  MET A SD    1 
ATOM   5024 C  CE    . MET C 3 626 ? 54.744 8.837   -14.688 1.00 40.06 ? 632  MET A CE    1 
ATOM   5025 N  N     . LEU C 3 627 ? 60.032 12.277  -15.082 1.00 31.98 ? 633  LEU A N     1 
ATOM   5026 C  CA    . LEU C 3 627 ? 60.599 13.049  -16.181 1.00 31.46 ? 633  LEU A CA    1 
ATOM   5027 C  C     . LEU C 3 627 ? 62.013 12.567  -16.489 1.00 32.91 ? 633  LEU A C     1 
ATOM   5028 O  O     . LEU C 3 627 ? 62.376 12.378  -17.652 1.00 31.94 ? 633  LEU A O     1 
ATOM   5029 C  CB    . LEU C 3 627 ? 60.644 14.540  -15.834 1.00 28.58 ? 633  LEU A CB    1 
ATOM   5030 C  CG    . LEU C 3 627 ? 59.310 15.278  -15.721 1.00 26.91 ? 633  LEU A CG    1 
ATOM   5031 C  CD1   . LEU C 3 627 ? 59.577 16.726  -15.345 1.00 25.22 ? 633  LEU A CD1   1 
ATOM   5032 C  CD2   . LEU C 3 627 ? 58.543 15.187  -17.043 1.00 25.50 ? 633  LEU A CD2   1 
ATOM   5033 N  N     . VAL C 3 628 ? 62.805 12.381  -15.436 1.00 34.44 ? 634  VAL A N     1 
ATOM   5034 C  CA    . VAL C 3 628 ? 64.177 11.921  -15.578 1.00 36.59 ? 634  VAL A CA    1 
ATOM   5035 C  C     . VAL C 3 628 ? 64.244 10.485  -16.090 1.00 38.95 ? 634  VAL A C     1 
ATOM   5036 O  O     . VAL C 3 628 ? 65.192 10.126  -16.793 1.00 40.18 ? 634  VAL A O     1 
ATOM   5037 C  CB    . VAL C 3 628 ? 64.945 12.027  -14.237 1.00 36.78 ? 634  VAL A CB    1 
ATOM   5038 C  CG1   . VAL C 3 628 ? 66.243 11.233  -14.300 1.00 34.76 ? 634  VAL A CG1   1 
ATOM   5039 C  CG2   . VAL C 3 628 ? 65.251 13.484  -13.939 1.00 35.49 ? 634  VAL A CG2   1 
ATOM   5040 N  N     . GLU C 3 629 ? 63.251 9.663   -15.749 1.00 40.28 ? 635  GLU A N     1 
ATOM   5041 C  CA    . GLU C 3 629 ? 63.255 8.282   -16.217 1.00 41.34 ? 635  GLU A CA    1 
ATOM   5042 C  C     . GLU C 3 629 ? 62.869 8.280   -17.694 1.00 41.06 ? 635  GLU A C     1 
ATOM   5043 O  O     . GLU C 3 629 ? 63.225 7.364   -18.434 1.00 41.20 ? 635  GLU A O     1 
ATOM   5044 C  CB    . GLU C 3 629 ? 62.286 7.408   -15.399 1.00 45.09 ? 635  GLU A CB    1 
ATOM   5045 C  CG    . GLU C 3 629 ? 60.825 7.455   -15.841 1.00 50.44 ? 635  GLU A CG    1 
ATOM   5046 C  CD    . GLU C 3 629 ? 59.890 6.750   -14.861 1.00 54.66 ? 635  GLU A CD    1 
ATOM   5047 O  OE1   . GLU C 3 629 ? 58.681 6.615   -15.176 1.00 55.25 ? 635  GLU A OE1   1 
ATOM   5048 O  OE2   . GLU C 3 629 ? 60.363 6.338   -13.773 1.00 55.98 ? 635  GLU A OE2   1 
ATOM   5049 N  N     . LYS C 3 630 ? 62.148 9.311   -18.127 1.00 39.10 ? 636  LYS A N     1 
ATOM   5050 C  CA    . LYS C 3 630 ? 61.758 9.411   -19.530 1.00 38.33 ? 636  LYS A CA    1 
ATOM   5051 C  C     . LYS C 3 630 ? 62.897 9.999   -20.355 1.00 37.40 ? 636  LYS A C     1 
ATOM   5052 O  O     . LYS C 3 630 ? 62.735 10.264  -21.539 1.00 38.32 ? 636  LYS A O     1 
ATOM   5053 C  CB    . LYS C 3 630 ? 60.513 10.283  -19.697 1.00 38.44 ? 636  LYS A CB    1 
ATOM   5054 C  CG    . LYS C 3 630 ? 59.228 9.628   -19.216 1.00 39.08 ? 636  LYS A CG    1 
ATOM   5055 C  CD    . LYS C 3 630 ? 58.048 10.548  -19.447 1.00 39.97 ? 636  LYS A CD    1 
ATOM   5056 C  CE    . LYS C 3 630 ? 56.770 9.957   -18.904 1.00 39.84 ? 636  LYS A CE    1 
ATOM   5057 N  NZ    . LYS C 3 630 ? 55.625 10.901  -19.112 1.00 42.61 ? 636  LYS A NZ    1 
ATOM   5058 N  N     . GLY C 3 631 ? 64.048 10.211  -19.722 1.00 36.14 ? 637  GLY A N     1 
ATOM   5059 C  CA    . GLY C 3 631 ? 65.189 10.754  -20.439 1.00 34.79 ? 637  GLY A CA    1 
ATOM   5060 C  C     . GLY C 3 631 ? 65.406 12.261  -20.409 1.00 33.60 ? 637  GLY A C     1 
ATOM   5061 O  O     . GLY C 3 631 ? 66.427 12.727  -20.896 1.00 35.16 ? 637  GLY A O     1 
ATOM   5062 N  N     . LEU C 3 632 ? 64.470 13.025  -19.852 1.00 32.00 ? 638  LEU A N     1 
ATOM   5063 C  CA    . LEU C 3 632 ? 64.613 14.483  -19.789 1.00 31.39 ? 638  LEU A CA    1 
ATOM   5064 C  C     . LEU C 3 632 ? 65.625 14.896  -18.723 1.00 31.36 ? 638  LEU A C     1 
ATOM   5065 O  O     . LEU C 3 632 ? 65.748 14.250  -17.682 1.00 30.31 ? 638  LEU A O     1 
ATOM   5066 C  CB    . LEU C 3 632 ? 63.264 15.137  -19.501 1.00 32.11 ? 638  LEU A CB    1 
ATOM   5067 C  CG    . LEU C 3 632 ? 62.228 15.133  -20.628 1.00 32.83 ? 638  LEU A CG    1 
ATOM   5068 C  CD1   . LEU C 3 632 ? 62.112 13.750  -21.247 1.00 34.91 ? 638  LEU A CD1   1 
ATOM   5069 C  CD2   . LEU C 3 632 ? 60.897 15.574  -20.066 1.00 32.75 ? 638  LEU A CD2   1 
ATOM   5070 N  N     . LYS C 3 633 ? 66.339 15.983  -18.987 1.00 30.83 ? 639  LYS A N     1 
ATOM   5071 C  CA    . LYS C 3 633 ? 67.364 16.467  -18.070 1.00 30.14 ? 639  LYS A CA    1 
ATOM   5072 C  C     . LYS C 3 633 ? 66.910 17.686  -17.274 1.00 27.95 ? 639  LYS A C     1 
ATOM   5073 O  O     . LYS C 3 633 ? 66.409 18.655  -17.837 1.00 26.30 ? 639  LYS A O     1 
ATOM   5074 C  CB    . LYS C 3 633 ? 68.631 16.823  -18.855 1.00 32.75 ? 639  LYS A CB    1 
ATOM   5075 C  CG    . LYS C 3 633 ? 69.846 17.070  -17.990 1.00 37.15 ? 639  LYS A CG    1 
ATOM   5076 C  CD    . LYS C 3 633 ? 70.975 17.739  -18.771 1.00 38.94 ? 639  LYS A CD    1 
ATOM   5077 C  CE    . LYS C 3 633 ? 72.240 17.805  -17.931 1.00 39.86 ? 639  LYS A CE    1 
ATOM   5078 N  NZ    . LYS C 3 633 ? 71.943 18.251  -16.524 1.00 42.37 ? 639  LYS A NZ    1 
ATOM   5079 N  N     . HIS C 3 634 ? 67.120 17.638  -15.964 1.00 27.17 ? 640  HIS A N     1 
ATOM   5080 C  CA    . HIS C 3 634 ? 66.734 18.737  -15.083 1.00 25.72 ? 640  HIS A CA    1 
ATOM   5081 C  C     . HIS C 3 634 ? 67.821 19.798  -15.005 1.00 25.12 ? 640  HIS A C     1 
ATOM   5082 O  O     . HIS C 3 634 ? 68.869 19.576  -14.404 1.00 24.49 ? 640  HIS A O     1 
ATOM   5083 C  CB    . HIS C 3 634 ? 66.447 18.217  -13.674 1.00 23.48 ? 640  HIS A CB    1 
ATOM   5084 C  CG    . HIS C 3 634 ? 65.724 19.201  -12.811 1.00 23.68 ? 640  HIS A CG    1 
ATOM   5085 N  ND1   . HIS C 3 634 ? 65.218 18.872  -11.574 1.00 23.27 ? 640  HIS A ND1   1 
ATOM   5086 C  CD2   . HIS C 3 634 ? 65.357 20.484  -13.038 1.00 24.49 ? 640  HIS A CD2   1 
ATOM   5087 C  CE1   . HIS C 3 634 ? 64.561 19.906  -11.081 1.00 23.26 ? 640  HIS A CE1   1 
ATOM   5088 N  NE2   . HIS C 3 634 ? 64.629 20.897  -11.951 1.00 25.05 ? 640  HIS A NE2   1 
ATOM   5089 N  N     . GLY C 3 635 ? 67.557 20.954  -15.605 1.00 24.99 ? 641  GLY A N     1 
ATOM   5090 C  CA    . GLY C 3 635 ? 68.522 22.042  -15.582 1.00 25.63 ? 641  GLY A CA    1 
ATOM   5091 C  C     . GLY C 3 635 ? 68.376 22.997  -16.757 1.00 25.71 ? 641  GLY A C     1 
ATOM   5092 O  O     . GLY C 3 635 ? 67.760 22.661  -17.769 1.00 26.48 ? 641  GLY A O     1 
ATOM   5093 N  N     . TRP C 3 636 ? 68.929 24.195  -16.627 1.00 25.09 ? 642  TRP A N     1 
ATOM   5094 C  CA    . TRP C 3 636 ? 68.861 25.168  -17.708 1.00 25.82 ? 642  TRP A CA    1 
ATOM   5095 C  C     . TRP C 3 636 ? 69.693 24.655  -18.885 1.00 26.70 ? 642  TRP A C     1 
ATOM   5096 O  O     . TRP C 3 636 ? 69.495 25.058  -20.027 1.00 25.38 ? 642  TRP A O     1 
ATOM   5097 C  CB    . TRP C 3 636 ? 69.389 26.523  -17.239 1.00 23.38 ? 642  TRP A CB    1 
ATOM   5098 C  CG    . TRP C 3 636 ? 68.556 27.130  -16.152 1.00 26.11 ? 642  TRP A CG    1 
ATOM   5099 C  CD1   . TRP C 3 636 ? 68.960 27.429  -14.887 1.00 25.03 ? 642  TRP A CD1   1 
ATOM   5100 C  CD2   . TRP C 3 636 ? 67.167 27.500  -16.229 1.00 23.93 ? 642  TRP A CD2   1 
ATOM   5101 N  NE1   . TRP C 3 636 ? 67.911 27.958  -14.167 1.00 26.66 ? 642  TRP A NE1   1 
ATOM   5102 C  CE2   . TRP C 3 636 ? 66.801 28.014  -14.966 1.00 24.33 ? 642  TRP A CE2   1 
ATOM   5103 C  CE3   . TRP C 3 636 ? 66.202 27.447  -17.242 1.00 22.56 ? 642  TRP A CE3   1 
ATOM   5104 C  CZ2   . TRP C 3 636 ? 65.509 28.472  -14.685 1.00 24.16 ? 642  TRP A CZ2   1 
ATOM   5105 C  CZ3   . TRP C 3 636 ? 64.919 27.902  -16.965 1.00 24.40 ? 642  TRP A CZ3   1 
ATOM   5106 C  CH2   . TRP C 3 636 ? 64.584 28.409  -15.693 1.00 22.68 ? 642  TRP A CH2   1 
ATOM   5107 N  N     . ASP C 3 637 ? 70.628 23.762  -18.588 1.00 27.37 ? 643  ASP A N     1 
ATOM   5108 C  CA    . ASP C 3 637 ? 71.478 23.169  -19.612 1.00 30.36 ? 643  ASP A CA    1 
ATOM   5109 C  C     . ASP C 3 637 ? 70.842 21.853  -20.060 1.00 30.89 ? 643  ASP A C     1 
ATOM   5110 O  O     . ASP C 3 637 ? 71.490 21.016  -20.692 1.00 31.98 ? 643  ASP A O     1 
ATOM   5111 C  CB    . ASP C 3 637 ? 72.877 22.910  -19.041 1.00 29.27 ? 643  ASP A CB    1 
ATOM   5112 C  CG    . ASP C 3 637 ? 72.862 21.933  -17.875 1.00 32.51 ? 643  ASP A CG    1 
ATOM   5113 O  OD1   . ASP C 3 637 ? 71.833 21.841  -17.163 1.00 31.72 ? 643  ASP A OD1   1 
ATOM   5114 O  OD2   . ASP C 3 637 ? 73.890 21.261  -17.658 1.00 33.76 ? 643  ASP A OD2   1 
ATOM   5115 N  N     . GLY C 3 638 ? 69.562 21.682  -19.737 1.00 30.56 ? 644  GLY A N     1 
ATOM   5116 C  CA    . GLY C 3 638 ? 68.874 20.456  -20.103 1.00 29.98 ? 644  GLY A CA    1 
ATOM   5117 C  C     . GLY C 3 638 ? 67.559 20.656  -20.824 1.00 30.20 ? 644  GLY A C     1 
ATOM   5118 O  O     . GLY C 3 638 ? 67.495 21.390  -21.811 1.00 31.40 ? 644  GLY A O     1 
ATOM   5119 N  N     . ASP C 3 639 ? 66.507 20.012  -20.322 1.00 30.66 ? 645  ASP A N     1 
ATOM   5120 C  CA    . ASP C 3 639 ? 65.180 20.093  -20.927 1.00 29.87 ? 645  ASP A CA    1 
ATOM   5121 C  C     . ASP C 3 639 ? 64.132 20.826  -20.076 1.00 30.01 ? 645  ASP A C     1 
ATOM   5122 O  O     . ASP C 3 639 ? 63.234 21.484  -20.625 1.00 27.79 ? 645  ASP A O     1 
ATOM   5123 C  CB    . ASP C 3 639 ? 64.698 18.678  -21.255 1.00 30.87 ? 645  ASP A CB    1 
ATOM   5124 C  CG    . ASP C 3 639 ? 65.728 17.894  -22.065 1.00 31.78 ? 645  ASP A CG    1 
ATOM   5125 O  OD1   . ASP C 3 639 ? 66.021 18.295  -23.214 1.00 31.92 ? 645  ASP A OD1   1 
ATOM   5126 O  OD2   . ASP C 3 639 ? 66.257 16.888  -21.546 1.00 32.99 ? 645  ASP A OD2   1 
ATOM   5127 N  N     . PHE C 3 640 ? 64.234 20.710  -18.748 1.00 27.71 ? 646  PHE A N     1 
ATOM   5128 C  CA    . PHE C 3 640 ? 63.283 21.389  -17.866 1.00 25.72 ? 646  PHE A CA    1 
ATOM   5129 C  C     . PHE C 3 640 ? 63.924 21.883  -16.570 1.00 24.24 ? 646  PHE A C     1 
ATOM   5130 O  O     . PHE C 3 640 ? 65.016 21.448  -16.194 1.00 22.46 ? 646  PHE A O     1 
ATOM   5131 C  CB    . PHE C 3 640 ? 62.096 20.476  -17.523 1.00 26.42 ? 646  PHE A CB    1 
ATOM   5132 C  CG    . PHE C 3 640 ? 62.435 19.368  -16.560 1.00 28.29 ? 646  PHE A CG    1 
ATOM   5133 C  CD1   . PHE C 3 640 ? 63.034 18.192  -17.011 1.00 26.22 ? 646  PHE A CD1   1 
ATOM   5134 C  CD2   . PHE C 3 640 ? 62.165 19.509  -15.194 1.00 27.77 ? 646  PHE A CD2   1 
ATOM   5135 C  CE1   . PHE C 3 640 ? 63.363 17.170  -16.122 1.00 26.07 ? 646  PHE A CE1   1 
ATOM   5136 C  CE2   . PHE C 3 640 ? 62.489 18.494  -14.291 1.00 28.37 ? 646  PHE A CE2   1 
ATOM   5137 C  CZ    . PHE C 3 640 ? 63.091 17.318  -14.755 1.00 28.34 ? 646  PHE A CZ    1 
ATOM   5138 N  N     . ALA C 3 641 ? 63.237 22.800  -15.895 1.00 22.30 ? 647  ALA A N     1 
ATOM   5139 C  CA    . ALA C 3 641 ? 63.728 23.348  -14.637 1.00 20.95 ? 647  ALA A CA    1 
ATOM   5140 C  C     . ALA C 3 641 ? 62.592 23.779  -13.713 1.00 20.63 ? 647  ALA A C     1 
ATOM   5141 O  O     . ALA C 3 641 ? 61.751 24.601  -14.086 1.00 21.22 ? 647  ALA A O     1 
ATOM   5142 C  CB    . ALA C 3 641 ? 64.667 24.542  -14.903 1.00 17.88 ? 647  ALA A CB    1 
ATOM   5143 N  N     . TYR C 3 642 ? 62.569 23.206  -12.513 1.00 21.55 ? 648  TYR A N     1 
ATOM   5144 C  CA    . TYR C 3 642 ? 61.568 23.554  -11.507 1.00 21.30 ? 648  TYR A CA    1 
ATOM   5145 C  C     . TYR C 3 642 ? 61.892 24.994  -11.090 1.00 20.85 ? 648  TYR A C     1 
ATOM   5146 O  O     . TYR C 3 642 ? 63.028 25.305  -10.745 1.00 21.83 ? 648  TYR A O     1 
ATOM   5147 C  CB    . TYR C 3 642 ? 61.697 22.628  -10.295 1.00 22.43 ? 648  TYR A CB    1 
ATOM   5148 C  CG    . TYR C 3 642 ? 60.890 21.353  -10.358 1.00 23.87 ? 648  TYR A CG    1 
ATOM   5149 C  CD1   . TYR C 3 642 ? 60.792 20.612  -11.536 1.00 23.47 ? 648  TYR A CD1   1 
ATOM   5150 C  CD2   . TYR C 3 642 ? 60.228 20.878  -9.226  1.00 24.97 ? 648  TYR A CD2   1 
ATOM   5151 C  CE1   . TYR C 3 642 ? 60.051 19.434  -11.584 1.00 21.72 ? 648  TYR A CE1   1 
ATOM   5152 C  CE2   . TYR C 3 642 ? 59.487 19.702  -9.265  1.00 24.46 ? 648  TYR A CE2   1 
ATOM   5153 C  CZ    . TYR C 3 642 ? 59.399 18.988  -10.443 1.00 23.70 ? 648  TYR A CZ    1 
ATOM   5154 O  OH    . TYR C 3 642 ? 58.631 17.848  -10.478 1.00 23.31 ? 648  TYR A OH    1 
ATOM   5155 N  N     . MET C 3 643 ? 60.909 25.875  -11.129 1.00 20.75 ? 649  MET A N     1 
ATOM   5156 C  CA    . MET C 3 643 ? 61.162 27.260  -10.762 1.00 21.18 ? 649  MET A CA    1 
ATOM   5157 C  C     . MET C 3 643 ? 60.477 27.601  -9.452  1.00 22.22 ? 649  MET A C     1 
ATOM   5158 O  O     . MET C 3 643 ? 60.997 28.378  -8.655  1.00 23.87 ? 649  MET A O     1 
ATOM   5159 C  CB    . MET C 3 643 ? 60.676 28.193  -11.883 1.00 21.02 ? 649  MET A CB    1 
ATOM   5160 C  CG    . MET C 3 643 ? 61.193 27.777  -13.275 1.00 19.66 ? 649  MET A CG    1 
ATOM   5161 S  SD    . MET C 3 643 ? 60.738 28.923  -14.599 1.00 22.10 ? 649  MET A SD    1 
ATOM   5162 C  CE    . MET C 3 643 ? 58.980 28.578  -14.709 1.00 16.24 ? 649  MET A CE    1 
ATOM   5163 N  N     . ALA C 3 644 ? 59.317 27.001  -9.216  1.00 21.27 ? 650  ALA A N     1 
ATOM   5164 C  CA    . ALA C 3 644 ? 58.599 27.283  -7.993  1.00 23.61 ? 650  ALA A CA    1 
ATOM   5165 C  C     . ALA C 3 644 ? 57.579 26.225  -7.609  1.00 23.87 ? 650  ALA A C     1 
ATOM   5166 O  O     . ALA C 3 644 ? 56.945 25.597  -8.456  1.00 26.03 ? 650  ALA A O     1 
ATOM   5167 C  CB    . ALA C 3 644 ? 57.910 28.648  -8.105  1.00 23.17 ? 650  ALA A CB    1 
ATOM   5168 N  N     . TRP C 3 645 ? 57.432 26.045  -6.307  1.00 23.90 ? 651  TRP A N     1 
ATOM   5169 C  CA    . TRP C 3 645 ? 56.474 25.116  -5.753  1.00 24.36 ? 651  TRP A CA    1 
ATOM   5170 C  C     . TRP C 3 645 ? 55.710 25.898  -4.689  1.00 25.18 ? 651  TRP A C     1 
ATOM   5171 O  O     . TRP C 3 645 ? 56.237 26.194  -3.614  1.00 26.20 ? 651  TRP A O     1 
ATOM   5172 C  CB    . TRP C 3 645 ? 57.182 23.917  -5.129  1.00 23.75 ? 651  TRP A CB    1 
ATOM   5173 C  CG    . TRP C 3 645 ? 56.243 23.043  -4.372  1.00 22.80 ? 651  TRP A CG    1 
ATOM   5174 C  CD1   . TRP C 3 645 ? 54.970 22.726  -4.716  1.00 22.62 ? 651  TRP A CD1   1 
ATOM   5175 C  CD2   . TRP C 3 645 ? 56.497 22.395  -3.127  1.00 23.40 ? 651  TRP A CD2   1 
ATOM   5176 N  NE1   . TRP C 3 645 ? 54.402 21.924  -3.760  1.00 26.60 ? 651  TRP A NE1   1 
ATOM   5177 C  CE2   . TRP C 3 645 ? 55.323 21.703  -2.771  1.00 25.35 ? 651  TRP A CE2   1 
ATOM   5178 C  CE3   . TRP C 3 645 ? 57.602 22.334  -2.275  1.00 21.56 ? 651  TRP A CE3   1 
ATOM   5179 C  CZ2   . TRP C 3 645 ? 55.221 20.959  -1.597  1.00 26.80 ? 651  TRP A CZ2   1 
ATOM   5180 C  CZ3   . TRP C 3 645 ? 57.500 21.595  -1.108  1.00 24.16 ? 651  TRP A CZ3   1 
ATOM   5181 C  CH2   . TRP C 3 645 ? 56.322 20.920  -0.780  1.00 24.24 ? 651  TRP A CH2   1 
ATOM   5182 N  N     . VAL C 3 646 ? 54.472 26.248  -5.000  1.00 25.63 ? 652  VAL A N     1 
ATOM   5183 C  CA    . VAL C 3 646 ? 53.654 27.024  -4.085  1.00 26.04 ? 652  VAL A CA    1 
ATOM   5184 C  C     . VAL C 3 646 ? 52.479 26.231  -3.544  1.00 27.18 ? 652  VAL A C     1 
ATOM   5185 O  O     . VAL C 3 646 ? 51.339 26.421  -3.968  1.00 27.25 ? 652  VAL A O     1 
ATOM   5186 C  CB    . VAL C 3 646 ? 53.165 28.327  -4.778  1.00 24.77 ? 652  VAL A CB    1 
ATOM   5187 C  CG1   . VAL C 3 646 ? 52.307 29.164  -3.829  1.00 24.01 ? 652  VAL A CG1   1 
ATOM   5188 C  CG2   . VAL C 3 646 ? 54.377 29.134  -5.223  1.00 22.86 ? 652  VAL A CG2   1 
ATOM   5189 N  N     . HIS C 3 647 ? 52.797 25.326  -2.616  1.00 28.34 ? 653  HIS A N     1 
ATOM   5190 C  CA    . HIS C 3 647 ? 51.834 24.468  -1.933  1.00 29.92 ? 653  HIS A CA    1 
ATOM   5191 C  C     . HIS C 3 647 ? 51.162 23.368  -2.745  1.00 31.35 ? 653  HIS A C     1 
ATOM   5192 O  O     . HIS C 3 647 ? 51.481 22.197  -2.573  1.00 35.55 ? 653  HIS A O     1 
ATOM   5193 C  CB    . HIS C 3 647 ? 50.784 25.341  -1.245  1.00 28.63 ? 653  HIS A CB    1 
ATOM   5194 C  CG    . HIS C 3 647 ? 51.382 26.357  -0.322  1.00 28.03 ? 653  HIS A CG    1 
ATOM   5195 N  ND1   . HIS C 3 647 ? 52.207 26.009  0.727   1.00 26.37 ? 653  HIS A ND1   1 
ATOM   5196 C  CD2   . HIS C 3 647 ? 51.335 27.709  -0.332  1.00 26.69 ? 653  HIS A CD2   1 
ATOM   5197 C  CE1   . HIS C 3 647 ? 52.645 27.104  1.321   1.00 25.92 ? 653  HIS A CE1   1 
ATOM   5198 N  NE2   . HIS C 3 647 ? 52.131 28.150  0.698   1.00 25.57 ? 653  HIS A NE2   1 
ATOM   5199 N  N     . ASP C 3 648 ? 50.241 23.729  -3.627  1.00 31.24 ? 654  ASP A N     1 
ATOM   5200 C  CA    . ASP C 3 648 ? 49.530 22.738  -4.429  1.00 31.32 ? 654  ASP A CA    1 
ATOM   5201 C  C     . ASP C 3 648 ? 49.700 23.020  -5.926  1.00 30.99 ? 654  ASP A C     1 
ATOM   5202 O  O     . ASP C 3 648 ? 48.894 22.583  -6.756  1.00 29.70 ? 654  ASP A O     1 
ATOM   5203 C  CB    . ASP C 3 648 ? 48.049 22.788  -4.066  1.00 33.62 ? 654  ASP A CB    1 
ATOM   5204 C  CG    . ASP C 3 648 ? 47.400 24.121  -4.447  1.00 35.74 ? 654  ASP A CG    1 
ATOM   5205 O  OD1   . ASP C 3 648 ? 48.111 25.142  -4.567  1.00 36.49 ? 654  ASP A OD1   1 
ATOM   5206 O  OD2   . ASP C 3 648 ? 46.167 24.151  -4.619  1.00 41.75 ? 654  ASP A OD2   1 
ATOM   5207 N  N     . GLU C 3 649 ? 50.757 23.746  -6.260  1.00 29.71 ? 655  GLU A N     1 
ATOM   5208 C  CA    . GLU C 3 649 ? 51.018 24.129  -7.636  1.00 30.29 ? 655  GLU A CA    1 
ATOM   5209 C  C     . GLU C 3 649 ? 52.517 24.208  -7.924  1.00 29.67 ? 655  GLU A C     1 
ATOM   5210 O  O     . GLU C 3 649 ? 53.316 24.544  -7.044  1.00 28.16 ? 655  GLU A O     1 
ATOM   5211 C  CB    . GLU C 3 649 ? 50.360 25.497  -7.883  1.00 32.19 ? 655  GLU A CB    1 
ATOM   5212 C  CG    . GLU C 3 649 ? 50.888 26.299  -9.066  1.00 38.31 ? 655  GLU A CG    1 
ATOM   5213 C  CD    . GLU C 3 649 ? 50.665 27.796  -8.879  1.00 39.82 ? 655  GLU A CD    1 
ATOM   5214 O  OE1   . GLU C 3 649 ? 51.079 28.312  -7.829  1.00 43.49 ? 655  GLU A OE1   1 
ATOM   5215 O  OE2   . GLU C 3 649 ? 50.084 28.458  -9.764  1.00 40.83 ? 655  GLU A OE2   1 
ATOM   5216 N  N     . ILE C 3 650 ? 52.896 23.893  -9.156  1.00 28.66 ? 656  ILE A N     1 
ATOM   5217 C  CA    . ILE C 3 650 ? 54.293 23.977  -9.553  1.00 29.15 ? 656  ILE A CA    1 
ATOM   5218 C  C     . ILE C 3 650 ? 54.426 24.710  -10.876 1.00 28.21 ? 656  ILE A C     1 
ATOM   5219 O  O     . ILE C 3 650 ? 53.573 24.586  -11.757 1.00 27.91 ? 656  ILE A O     1 
ATOM   5220 C  CB    . ILE C 3 650 ? 54.951 22.600  -9.720  1.00 30.37 ? 656  ILE A CB    1 
ATOM   5221 C  CG1   . ILE C 3 650 ? 54.120 21.727  -10.658 1.00 30.48 ? 656  ILE A CG1   1 
ATOM   5222 C  CG2   . ILE C 3 650 ? 55.150 21.961  -8.370  1.00 32.39 ? 656  ILE A CG2   1 
ATOM   5223 C  CD1   . ILE C 3 650 ? 54.767 20.401  -10.951 1.00 33.50 ? 656  ILE A CD1   1 
ATOM   5224 N  N     . GLN C 3 651 ? 55.493 25.488  -10.992 1.00 26.95 ? 657  GLN A N     1 
ATOM   5225 C  CA    . GLN C 3 651 ? 55.773 26.235  -12.205 1.00 26.67 ? 657  GLN A CA    1 
ATOM   5226 C  C     . GLN C 3 651 ? 57.096 25.684  -12.714 1.00 26.38 ? 657  GLN A C     1 
ATOM   5227 O  O     . GLN C 3 651 ? 58.125 25.782  -12.042 1.00 25.97 ? 657  GLN A O     1 
ATOM   5228 C  CB    . GLN C 3 651 ? 55.885 27.729  -11.903 1.00 26.27 ? 657  GLN A CB    1 
ATOM   5229 C  CG    . GLN C 3 651 ? 54.596 28.360  -11.383 1.00 27.72 ? 657  GLN A CG    1 
ATOM   5230 C  CD    . GLN C 3 651 ? 53.433 28.238  -12.368 1.00 30.39 ? 657  GLN A CD    1 
ATOM   5231 O  OE1   . GLN C 3 651 ? 53.581 28.490  -13.562 1.00 32.26 ? 657  GLN A OE1   1 
ATOM   5232 N  NE2   . GLN C 3 651 ? 52.271 27.863  -11.862 1.00 29.97 ? 657  GLN A NE2   1 
ATOM   5233 N  N     . VAL C 3 652 ? 57.057 25.085  -13.897 1.00 25.95 ? 658  VAL A N     1 
ATOM   5234 C  CA    . VAL C 3 652 ? 58.242 24.478  -14.479 1.00 27.62 ? 658  VAL A CA    1 
ATOM   5235 C  C     . VAL C 3 652 ? 58.644 25.084  -15.814 1.00 27.22 ? 658  VAL A C     1 
ATOM   5236 O  O     . VAL C 3 652 ? 57.821 25.231  -16.716 1.00 28.56 ? 658  VAL A O     1 
ATOM   5237 C  CB    . VAL C 3 652 ? 58.030 22.954  -14.676 1.00 29.87 ? 658  VAL A CB    1 
ATOM   5238 C  CG1   . VAL C 3 652 ? 59.261 22.325  -15.333 1.00 27.94 ? 658  VAL A CG1   1 
ATOM   5239 C  CG2   . VAL C 3 652 ? 57.743 22.291  -13.328 1.00 27.77 ? 658  VAL A CG2   1 
ATOM   5240 N  N     . GLY C 3 653 ? 59.917 25.441  -15.931 1.00 27.22 ? 659  GLY A N     1 
ATOM   5241 C  CA    . GLY C 3 653 ? 60.403 25.989  -17.184 1.00 26.19 ? 659  GLY A CA    1 
ATOM   5242 C  C     . GLY C 3 653 ? 60.734 24.831  -18.116 1.00 25.57 ? 659  GLY A C     1 
ATOM   5243 O  O     . GLY C 3 653 ? 61.265 23.812  -17.672 1.00 25.10 ? 659  GLY A O     1 
ATOM   5244 N  N     . CYS C 3 654 ? 60.419 24.977  -19.398 1.00 25.41 ? 660  CYS A N     1 
ATOM   5245 C  CA    . CYS C 3 654 ? 60.687 23.924  -20.380 1.00 26.42 ? 660  CYS A CA    1 
ATOM   5246 C  C     . CYS C 3 654 ? 61.409 24.498  -21.616 1.00 26.23 ? 660  CYS A C     1 
ATOM   5247 O  O     . CYS C 3 654 ? 61.101 25.598  -22.074 1.00 26.21 ? 660  CYS A O     1 
ATOM   5248 C  CB    . CYS C 3 654 ? 59.367 23.266  -20.796 1.00 27.90 ? 660  CYS A CB    1 
ATOM   5249 S  SG    . CYS C 3 654 ? 58.369 22.644  -19.411 1.00 32.22 ? 660  CYS A SG    1 
ATOM   5250 N  N     . ARG C 3 655 ? 62.377 23.764  -22.149 1.00 25.62 ? 661  ARG A N     1 
ATOM   5251 C  CA    . ARG C 3 655 ? 63.118 24.243  -23.315 1.00 26.59 ? 661  ARG A CA    1 
ATOM   5252 C  C     . ARG C 3 655 ? 62.216 24.364  -24.544 1.00 27.55 ? 661  ARG A C     1 
ATOM   5253 O  O     . ARG C 3 655 ? 62.425 25.227  -25.400 1.00 28.82 ? 661  ARG A O     1 
ATOM   5254 C  CB    . ARG C 3 655 ? 64.293 23.303  -23.613 1.00 26.29 ? 661  ARG A CB    1 
ATOM   5255 C  CG    . ARG C 3 655 ? 65.256 23.792  -24.692 1.00 26.14 ? 661  ARG A CG    1 
ATOM   5256 C  CD    . ARG C 3 655 ? 66.548 22.981  -24.667 1.00 24.91 ? 661  ARG A CD    1 
ATOM   5257 N  NE    . ARG C 3 655 ? 66.299 21.543  -24.758 1.00 25.33 ? 661  ARG A NE    1 
ATOM   5258 C  CZ    . ARG C 3 655 ? 65.771 20.936  -25.820 1.00 26.85 ? 661  ARG A CZ    1 
ATOM   5259 N  NH1   . ARG C 3 655 ? 65.436 21.638  -26.893 1.00 22.35 ? 661  ARG A NH1   1 
ATOM   5260 N  NH2   . ARG C 3 655 ? 65.568 19.623  -25.807 1.00 27.57 ? 661  ARG A NH2   1 
ATOM   5261 N  N     . THR C 3 656 ? 61.202 23.510  -24.626 1.00 28.03 ? 662  THR A N     1 
ATOM   5262 C  CA    . THR C 3 656 ? 60.289 23.542  -25.765 1.00 28.13 ? 662  THR A CA    1 
ATOM   5263 C  C     . THR C 3 656 ? 58.838 23.308  -25.361 1.00 29.02 ? 662  THR A C     1 
ATOM   5264 O  O     . THR C 3 656 ? 58.543 22.841  -24.256 1.00 29.22 ? 662  THR A O     1 
ATOM   5265 C  CB    . THR C 3 656 ? 60.637 22.456  -26.805 1.00 26.63 ? 662  THR A CB    1 
ATOM   5266 O  OG1   . THR C 3 656 ? 60.266 21.175  -26.285 1.00 27.09 ? 662  THR A OG1   1 
ATOM   5267 C  CG2   . THR C 3 656 ? 62.132 22.450  -27.108 1.00 25.94 ? 662  THR A CG2   1 
ATOM   5268 N  N     . GLU C 3 657 ? 57.949 23.629  -26.295 1.00 30.45 ? 663  GLU A N     1 
ATOM   5269 C  CA    . GLU C 3 657 ? 56.511 23.471  -26.144 1.00 31.48 ? 663  GLU A CA    1 
ATOM   5270 C  C     . GLU C 3 657 ? 56.189 21.995  -25.961 1.00 31.39 ? 663  GLU A C     1 
ATOM   5271 O  O     . GLU C 3 657 ? 55.372 21.620  -25.114 1.00 31.26 ? 663  GLU A O     1 
ATOM   5272 C  CB    . GLU C 3 657 ? 55.818 24.009  -27.399 1.00 36.06 ? 663  GLU A CB    1 
ATOM   5273 C  CG    . GLU C 3 657 ? 54.331 24.251  -27.251 1.00 44.03 ? 663  GLU A CG    1 
ATOM   5274 C  CD    . GLU C 3 657 ? 53.745 25.030  -28.416 1.00 46.89 ? 663  GLU A CD    1 
ATOM   5275 O  OE1   . GLU C 3 657 ? 53.739 24.498  -29.546 1.00 48.55 ? 663  GLU A OE1   1 
ATOM   5276 O  OE2   . GLU C 3 657 ? 53.294 26.177  -28.199 1.00 49.61 ? 663  GLU A OE2   1 
ATOM   5277 N  N     . GLU C 3 658 ? 56.847 21.156  -26.757 1.00 31.69 ? 664  GLU A N     1 
ATOM   5278 C  CA    . GLU C 3 658 ? 56.629 19.722  -26.679 1.00 32.50 ? 664  GLU A CA    1 
ATOM   5279 C  C     . GLU C 3 658 ? 57.010 19.218  -25.291 1.00 31.40 ? 664  GLU A C     1 
ATOM   5280 O  O     . GLU C 3 658 ? 56.313 18.388  -24.711 1.00 31.21 ? 664  GLU A O     1 
ATOM   5281 C  CB    . GLU C 3 658 ? 57.454 18.983  -27.745 1.00 34.38 ? 664  GLU A CB    1 
ATOM   5282 C  CG    . GLU C 3 658 ? 57.302 17.465  -27.670 1.00 39.05 ? 664  GLU A CG    1 
ATOM   5283 C  CD    . GLU C 3 658 ? 58.224 16.708  -28.618 1.00 44.58 ? 664  GLU A CD    1 
ATOM   5284 O  OE1   . GLU C 3 658 ? 58.327 15.464  -28.469 1.00 46.65 ? 664  GLU A OE1   1 
ATOM   5285 O  OE2   . GLU C 3 658 ? 58.839 17.341  -29.512 1.00 45.07 ? 664  GLU A OE2   1 
ATOM   5286 N  N     . ILE C 3 659 ? 58.123 19.714  -24.760 1.00 30.05 ? 665  ILE A N     1 
ATOM   5287 C  CA    . ILE C 3 659 ? 58.556 19.290  -23.435 1.00 30.54 ? 665  ILE A CA    1 
ATOM   5288 C  C     . ILE C 3 659 ? 57.530 19.725  -22.386 1.00 29.41 ? 665  ILE A C     1 
ATOM   5289 O  O     . ILE C 3 659 ? 57.213 18.970  -21.475 1.00 29.86 ? 665  ILE A O     1 
ATOM   5290 C  CB    . ILE C 3 659 ? 59.957 19.863  -23.087 1.00 29.84 ? 665  ILE A CB    1 
ATOM   5291 C  CG1   . ILE C 3 659 ? 61.035 19.068  -23.837 1.00 29.57 ? 665  ILE A CG1   1 
ATOM   5292 C  CG2   . ILE C 3 659 ? 60.185 19.811  -21.582 1.00 30.27 ? 665  ILE A CG2   1 
ATOM   5293 C  CD1   . ILE C 3 659 ? 62.441 19.648  -23.753 1.00 26.97 ? 665  ILE A CD1   1 
ATOM   5294 N  N     . ALA C 3 660 ? 57.002 20.932  -22.532 1.00 28.56 ? 666  ALA A N     1 
ATOM   5295 C  CA    . ALA C 3 660 ? 56.013 21.424  -21.587 1.00 30.02 ? 666  ALA A CA    1 
ATOM   5296 C  C     . ALA C 3 660 ? 54.797 20.501  -21.600 1.00 30.83 ? 666  ALA A C     1 
ATOM   5297 O  O     . ALA C 3 660 ? 54.201 20.230  -20.552 1.00 30.11 ? 666  ALA A O     1 
ATOM   5298 C  CB    . ALA C 3 660 ? 55.609 22.850  -21.940 1.00 29.41 ? 666  ALA A CB    1 
ATOM   5299 N  N     . GLN C 3 661 ? 54.436 20.011  -22.787 1.00 32.44 ? 667  GLN A N     1 
ATOM   5300 C  CA    . GLN C 3 661 ? 53.299 19.104  -22.911 1.00 32.60 ? 667  GLN A CA    1 
ATOM   5301 C  C     . GLN C 3 661 ? 53.587 17.838  -22.120 1.00 31.88 ? 667  GLN A C     1 
ATOM   5302 O  O     . GLN C 3 661 ? 52.725 17.340  -21.393 1.00 31.47 ? 667  GLN A O     1 
ATOM   5303 C  CB    . GLN C 3 661 ? 53.038 18.748  -24.380 1.00 35.78 ? 667  GLN A CB    1 
ATOM   5304 C  CG    . GLN C 3 661 ? 52.530 19.916  -25.225 1.00 41.21 ? 667  GLN A CG    1 
ATOM   5305 C  CD    . GLN C 3 661 ? 51.119 20.346  -24.842 1.00 44.06 ? 667  GLN A CD    1 
ATOM   5306 O  OE1   . GLN C 3 661 ? 50.635 21.395  -25.274 1.00 47.04 ? 667  GLN A OE1   1 
ATOM   5307 N  NE2   . GLN C 3 661 ? 50.448 19.529  -24.035 1.00 46.02 ? 667  GLN A NE2   1 
ATOM   5308 N  N     . VAL C 3 662 ? 54.806 17.328  -22.258 1.00 29.78 ? 668  VAL A N     1 
ATOM   5309 C  CA    . VAL C 3 662 ? 55.205 16.120  -21.554 1.00 30.39 ? 668  VAL A CA    1 
ATOM   5310 C  C     . VAL C 3 662 ? 55.207 16.314  -20.033 1.00 30.06 ? 668  VAL A C     1 
ATOM   5311 O  O     . VAL C 3 662 ? 54.796 15.421  -19.290 1.00 29.24 ? 668  VAL A O     1 
ATOM   5312 C  CB    . VAL C 3 662 ? 56.604 15.635  -22.019 1.00 31.47 ? 668  VAL A CB    1 
ATOM   5313 C  CG1   . VAL C 3 662 ? 57.038 14.411  -21.202 1.00 29.53 ? 668  VAL A CG1   1 
ATOM   5314 C  CG2   . VAL C 3 662 ? 56.559 15.282  -23.521 1.00 27.84 ? 668  VAL A CG2   1 
ATOM   5315 N  N     . VAL C 3 663 ? 55.661 17.481  -19.576 1.00 29.47 ? 669  VAL A N     1 
ATOM   5316 C  CA    . VAL C 3 663 ? 55.700 17.779  -18.143 1.00 28.47 ? 669  VAL A CA    1 
ATOM   5317 C  C     . VAL C 3 663 ? 54.284 17.785  -17.570 1.00 28.77 ? 669  VAL A C     1 
ATOM   5318 O  O     . VAL C 3 663 ? 54.032 17.247  -16.495 1.00 27.64 ? 669  VAL A O     1 
ATOM   5319 C  CB    . VAL C 3 663 ? 56.369 19.158  -17.880 1.00 28.33 ? 669  VAL A CB    1 
ATOM   5320 C  CG1   . VAL C 3 663 ? 56.166 19.589  -16.435 1.00 27.30 ? 669  VAL A CG1   1 
ATOM   5321 C  CG2   . VAL C 3 663 ? 57.855 19.070  -18.182 1.00 28.23 ? 669  VAL A CG2   1 
ATOM   5322 N  N     . ILE C 3 664 ? 53.362 18.391  -18.310 1.00 28.85 ? 670  ILE A N     1 
ATOM   5323 C  CA    . ILE C 3 664 ? 51.969 18.481  -17.896 1.00 29.11 ? 670  ILE A CA    1 
ATOM   5324 C  C     . ILE C 3 664 ? 51.306 17.107  -17.799 1.00 30.98 ? 670  ILE A C     1 
ATOM   5325 O  O     . ILE C 3 664 ? 50.614 16.808  -16.816 1.00 30.97 ? 670  ILE A O     1 
ATOM   5326 C  CB    . ILE C 3 664 ? 51.173 19.369  -18.875 1.00 28.15 ? 670  ILE A CB    1 
ATOM   5327 C  CG1   . ILE C 3 664 ? 51.667 20.815  -18.762 1.00 26.52 ? 670  ILE A CG1   1 
ATOM   5328 C  CG2   . ILE C 3 664 ? 49.669 19.262  -18.603 1.00 27.84 ? 670  ILE A CG2   1 
ATOM   5329 C  CD1   . ILE C 3 664 ? 51.018 21.768  -19.758 1.00 25.70 ? 670  ILE A CD1   1 
ATOM   5330 N  N     . GLU C 3 665 ? 51.530 16.267  -18.807 1.00 31.03 ? 671  GLU A N     1 
ATOM   5331 C  CA    . GLU C 3 665 ? 50.933 14.937  -18.818 1.00 32.51 ? 671  GLU A CA    1 
ATOM   5332 C  C     . GLU C 3 665 ? 51.580 14.053  -17.770 1.00 30.74 ? 671  GLU A C     1 
ATOM   5333 O  O     . GLU C 3 665 ? 50.912 13.227  -17.155 1.00 31.18 ? 671  GLU A O     1 
ATOM   5334 C  CB    . GLU C 3 665 ? 51.074 14.294  -20.202 1.00 34.40 ? 671  GLU A CB    1 
ATOM   5335 C  CG    . GLU C 3 665 ? 50.672 15.225  -21.339 1.00 38.76 ? 671  GLU A CG    1 
ATOM   5336 C  CD    . GLU C 3 665 ? 50.873 14.614  -22.721 1.00 41.83 ? 671  GLU A CD    1 
ATOM   5337 O  OE1   . GLU C 3 665 ? 51.861 13.864  -22.914 1.00 41.72 ? 671  GLU A OE1   1 
ATOM   5338 O  OE2   . GLU C 3 665 ? 50.047 14.903  -23.615 1.00 42.89 ? 671  GLU A OE2   1 
ATOM   5339 N  N     . THR C 3 666 ? 52.879 14.242  -17.562 1.00 29.76 ? 672  THR A N     1 
ATOM   5340 C  CA    . THR C 3 666 ? 53.625 13.456  -16.588 1.00 28.96 ? 672  THR A CA    1 
ATOM   5341 C  C     . THR C 3 666 ? 53.204 13.822  -15.166 1.00 29.78 ? 672  THR A C     1 
ATOM   5342 O  O     . THR C 3 666 ? 53.123 12.962  -14.296 1.00 28.89 ? 672  THR A O     1 
ATOM   5343 C  CB    . THR C 3 666 ? 55.144 13.682  -16.736 1.00 28.37 ? 672  THR A CB    1 
ATOM   5344 O  OG1   . THR C 3 666 ? 55.533 13.430  -18.088 1.00 28.64 ? 672  THR A OG1   1 
ATOM   5345 C  CG2   . THR C 3 666 ? 55.917 12.753  -15.814 1.00 26.37 ? 672  THR A CG2   1 
ATOM   5346 N  N     . ALA C 3 667 ? 52.937 15.101  -14.938 1.00 30.63 ? 673  ALA A N     1 
ATOM   5347 C  CA    . ALA C 3 667 ? 52.509 15.555  -13.624 1.00 31.84 ? 673  ALA A CA    1 
ATOM   5348 C  C     . ALA C 3 667 ? 51.163 14.897  -13.295 1.00 32.55 ? 673  ALA A C     1 
ATOM   5349 O  O     . ALA C 3 667 ? 50.928 14.464  -12.165 1.00 33.31 ? 673  ALA A O     1 
ATOM   5350 C  CB    . ALA C 3 667 ? 52.385 17.081  -13.616 1.00 30.05 ? 673  ALA A CB    1 
ATOM   5351 N  N     . GLN C 3 668 ? 50.281 14.827  -14.290 1.00 32.94 ? 674  GLN A N     1 
ATOM   5352 C  CA    . GLN C 3 668 ? 48.977 14.200  -14.108 1.00 33.01 ? 674  GLN A CA    1 
ATOM   5353 C  C     . GLN C 3 668 ? 49.188 12.733  -13.749 1.00 33.13 ? 674  GLN A C     1 
ATOM   5354 O  O     . GLN C 3 668 ? 48.553 12.209  -12.826 1.00 33.70 ? 674  GLN A O     1 
ATOM   5355 C  CB    . GLN C 3 668 ? 48.139 14.324  -15.393 1.00 32.37 ? 674  GLN A CB    1 
ATOM   5356 C  CG    . GLN C 3 668 ? 46.830 13.512  -15.416 1.00 29.66 ? 674  GLN A CG    1 
ATOM   5357 C  CD    . GLN C 3 668 ? 45.874 13.840  -14.271 1.00 31.08 ? 674  GLN A CD    1 
ATOM   5358 O  OE1   . GLN C 3 668 ? 45.888 14.941  -13.719 1.00 30.69 ? 674  GLN A OE1   1 
ATOM   5359 N  NE2   . GLN C 3 668 ? 45.021 12.883  -13.927 1.00 30.73 ? 674  GLN A NE2   1 
ATOM   5360 N  N     . GLU C 3 669 ? 50.086 12.072  -14.475 1.00 33.18 ? 675  GLU A N     1 
ATOM   5361 C  CA    . GLU C 3 669 ? 50.380 10.666  -14.212 1.00 33.79 ? 675  GLU A CA    1 
ATOM   5362 C  C     . GLU C 3 669 ? 50.927 10.479  -12.795 1.00 32.75 ? 675  GLU A C     1 
ATOM   5363 O  O     . GLU C 3 669 ? 50.553 9.540   -12.098 1.00 32.94 ? 675  GLU A O     1 
ATOM   5364 C  CB    . GLU C 3 669 ? 51.414 10.131  -15.202 1.00 36.95 ? 675  GLU A CB    1 
ATOM   5365 C  CG    . GLU C 3 669 ? 50.964 10.027  -16.653 1.00 42.33 ? 675  GLU A CG    1 
ATOM   5366 C  CD    . GLU C 3 669 ? 52.123 9.657   -17.580 1.00 45.24 ? 675  GLU A CD    1 
ATOM   5367 O  OE1   . GLU C 3 669 ? 52.826 8.661   -17.294 1.00 46.24 ? 675  GLU A OE1   1 
ATOM   5368 O  OE2   . GLU C 3 669 ? 52.335 10.361  -18.592 1.00 47.06 ? 675  GLU A OE2   1 
ATOM   5369 N  N     . ALA C 3 670 ? 51.816 11.375  -12.377 1.00 29.87 ? 676  ALA A N     1 
ATOM   5370 C  CA    . ALA C 3 670 ? 52.420 11.280  -11.051 1.00 30.37 ? 676  ALA A CA    1 
ATOM   5371 C  C     . ALA C 3 670 ? 51.387 11.437  -9.933  1.00 28.84 ? 676  ALA A C     1 
ATOM   5372 O  O     . ALA C 3 670 ? 51.466 10.758  -8.905  1.00 26.70 ? 676  ALA A O     1 
ATOM   5373 C  CB    . ALA C 3 670 ? 53.532 12.323  -10.902 1.00 28.92 ? 676  ALA A CB    1 
ATOM   5374 N  N     . MET C 3 671 ? 50.421 12.328  -10.143 1.00 28.41 ? 677  MET A N     1 
ATOM   5375 C  CA    . MET C 3 671 ? 49.375 12.562  -9.156  1.00 29.51 ? 677  MET A CA    1 
ATOM   5376 C  C     . MET C 3 671 ? 48.547 11.289  -8.983  1.00 30.50 ? 677  MET A C     1 
ATOM   5377 O  O     . MET C 3 671 ? 48.239 10.889  -7.858  1.00 30.80 ? 677  MET A O     1 
ATOM   5378 C  CB    . MET C 3 671 ? 48.484 13.730  -9.596  1.00 29.57 ? 677  MET A CB    1 
ATOM   5379 C  CG    . MET C 3 671 ? 47.445 14.163  -8.563  1.00 31.90 ? 677  MET A CG    1 
ATOM   5380 S  SD    . MET C 3 671 ? 48.128 14.641  -6.939  1.00 34.67 ? 677  MET A SD    1 
ATOM   5381 C  CE    . MET C 3 671 ? 48.594 16.352  -7.271  1.00 31.37 ? 677  MET A CE    1 
ATOM   5382 N  N     . ARG C 3 672 ? 48.201 10.641  -10.093 1.00 30.60 ? 678  ARG A N     1 
ATOM   5383 C  CA    . ARG C 3 672 ? 47.420 9.411   -10.020 1.00 30.64 ? 678  ARG A CA    1 
ATOM   5384 C  C     . ARG C 3 672 ? 48.221 8.386   -9.236  1.00 28.78 ? 678  ARG A C     1 
ATOM   5385 O  O     . ARG C 3 672 ? 47.684 7.705   -8.366  1.00 29.70 ? 678  ARG A O     1 
ATOM   5386 C  CB    . ARG C 3 672 ? 47.106 8.883   -11.424 1.00 32.22 ? 678  ARG A CB    1 
ATOM   5387 C  CG    . ARG C 3 672 ? 46.406 9.905   -12.318 1.00 35.24 ? 678  ARG A CG    1 
ATOM   5388 C  CD    . ARG C 3 672 ? 45.075 10.374  -11.737 1.00 37.54 ? 678  ARG A CD    1 
ATOM   5389 N  NE    . ARG C 3 672 ? 44.027 9.380   -11.924 1.00 43.17 ? 678  ARG A NE    1 
ATOM   5390 C  CZ    . ARG C 3 672 ? 42.886 9.588   -12.581 1.00 43.14 ? 678  ARG A CZ    1 
ATOM   5391 N  NH1   . ARG C 3 672 ? 42.612 10.770  -13.127 1.00 39.91 ? 678  ARG A NH1   1 
ATOM   5392 N  NH2   . ARG C 3 672 ? 42.021 8.592   -12.709 1.00 43.01 ? 678  ARG A NH2   1 
ATOM   5393 N  N     . TRP C 3 673 ? 49.514 8.298   -9.537  1.00 27.74 ? 679  TRP A N     1 
ATOM   5394 C  CA    . TRP C 3 673 ? 50.418 7.373   -8.852  1.00 26.92 ? 679  TRP A CA    1 
ATOM   5395 C  C     . TRP C 3 673 ? 50.394 7.616   -7.335  1.00 25.91 ? 679  TRP A C     1 
ATOM   5396 O  O     . TRP C 3 673 ? 50.338 6.678   -6.544  1.00 26.70 ? 679  TRP A O     1 
ATOM   5397 C  CB    . TRP C 3 673 ? 51.850 7.556   -9.367  1.00 26.79 ? 679  TRP A CB    1 
ATOM   5398 C  CG    . TRP C 3 673 ? 52.830 6.575   -8.784  1.00 26.91 ? 679  TRP A CG    1 
ATOM   5399 C  CD1   . TRP C 3 673 ? 53.135 5.336   -9.272  1.00 26.26 ? 679  TRP A CD1   1 
ATOM   5400 C  CD2   . TRP C 3 673 ? 53.579 6.722   -7.567  1.00 25.59 ? 679  TRP A CD2   1 
ATOM   5401 N  NE1   . TRP C 3 673 ? 54.020 4.702   -8.435  1.00 25.53 ? 679  TRP A NE1   1 
ATOM   5402 C  CE2   . TRP C 3 673 ? 54.309 5.528   -7.381  1.00 25.56 ? 679  TRP A CE2   1 
ATOM   5403 C  CE3   . TRP C 3 673 ? 53.700 7.745   -6.613  1.00 26.50 ? 679  TRP A CE3   1 
ATOM   5404 C  CZ2   . TRP C 3 673 ? 55.151 5.325   -6.278  1.00 25.29 ? 679  TRP A CZ2   1 
ATOM   5405 C  CZ3   . TRP C 3 673 ? 54.535 7.544   -5.516  1.00 23.94 ? 679  TRP A CZ3   1 
ATOM   5406 C  CH2   . TRP C 3 673 ? 55.248 6.340   -5.361  1.00 27.15 ? 679  TRP A CH2   1 
ATOM   5407 N  N     . VAL C 3 674 ? 50.443 8.881   -6.932  1.00 26.02 ? 680  VAL A N     1 
ATOM   5408 C  CA    . VAL C 3 674 ? 50.422 9.210   -5.514  1.00 26.96 ? 680  VAL A CA    1 
ATOM   5409 C  C     . VAL C 3 674 ? 49.099 8.769   -4.878  1.00 27.11 ? 680  VAL A C     1 
ATOM   5410 O  O     . VAL C 3 674 ? 49.087 8.203   -3.787  1.00 26.99 ? 680  VAL A O     1 
ATOM   5411 C  CB    . VAL C 3 674 ? 50.627 10.728  -5.297  1.00 26.92 ? 680  VAL A CB    1 
ATOM   5412 C  CG1   . VAL C 3 674 ? 50.227 11.120  -3.884  1.00 26.56 ? 680  VAL A CG1   1 
ATOM   5413 C  CG2   . VAL C 3 674 ? 52.081 11.080  -5.530  1.00 25.44 ? 680  VAL A CG2   1 
ATOM   5414 N  N     . GLY C 3 675 ? 47.991 9.029   -5.566  1.00 26.67 ? 681  GLY A N     1 
ATOM   5415 C  CA    . GLY C 3 675 ? 46.694 8.633   -5.049  1.00 28.36 ? 681  GLY A CA    1 
ATOM   5416 C  C     . GLY C 3 675 ? 46.602 7.127   -4.864  1.00 29.49 ? 681  GLY A C     1 
ATOM   5417 O  O     . GLY C 3 675 ? 46.065 6.632   -3.867  1.00 28.51 ? 681  GLY A O     1 
ATOM   5418 N  N     . ASP C 3 676 ? 47.124 6.387   -5.833  1.00 30.99 ? 682  ASP A N     1 
ATOM   5419 C  CA    . ASP C 3 676 ? 47.101 4.940   -5.740  1.00 31.91 ? 682  ASP A CA    1 
ATOM   5420 C  C     . ASP C 3 676 ? 48.047 4.474   -4.642  1.00 30.58 ? 682  ASP A C     1 
ATOM   5421 O  O     . ASP C 3 676 ? 47.727 3.559   -3.889  1.00 30.72 ? 682  ASP A O     1 
ATOM   5422 C  CB    . ASP C 3 676 ? 47.512 4.316   -7.068  1.00 34.33 ? 682  ASP A CB    1 
ATOM   5423 C  CG    . ASP C 3 676 ? 47.705 2.820   -6.968  1.00 39.12 ? 682  ASP A CG    1 
ATOM   5424 O  OD1   . ASP C 3 676 ? 46.693 2.080   -6.905  1.00 40.36 ? 682  ASP A OD1   1 
ATOM   5425 O  OD2   . ASP C 3 676 ? 48.878 2.384   -6.941  1.00 41.93 ? 682  ASP A OD2   1 
ATOM   5426 N  N     . HIS C 3 677 ? 49.205 5.123   -4.550  1.00 30.97 ? 683  HIS A N     1 
ATOM   5427 C  CA    . HIS C 3 677 ? 50.231 4.779   -3.560  1.00 28.80 ? 683  HIS A CA    1 
ATOM   5428 C  C     . HIS C 3 677 ? 49.742 4.832   -2.105  1.00 29.09 ? 683  HIS A C     1 
ATOM   5429 O  O     . HIS C 3 677 ? 50.146 4.023   -1.271  1.00 29.49 ? 683  HIS A O     1 
ATOM   5430 C  CB    . HIS C 3 677 ? 51.435 5.717   -3.733  1.00 28.53 ? 683  HIS A CB    1 
ATOM   5431 C  CG    . HIS C 3 677 ? 52.506 5.531   -2.701  1.00 28.26 ? 683  HIS A CG    1 
ATOM   5432 N  ND1   . HIS C 3 677 ? 53.429 4.507   -2.756  1.00 27.96 ? 683  HIS A ND1   1 
ATOM   5433 C  CD2   . HIS C 3 677 ? 52.783 6.226   -1.573  1.00 28.71 ? 683  HIS A CD2   1 
ATOM   5434 C  CE1   . HIS C 3 677 ? 54.228 4.579   -1.706  1.00 28.53 ? 683  HIS A CE1   1 
ATOM   5435 N  NE2   . HIS C 3 677 ? 53.858 5.614   -0.971  1.00 30.92 ? 683  HIS A NE2   1 
ATOM   5436 N  N     . TRP C 3 678 ? 48.888 5.793   -1.788  1.00 28.96 ? 684  TRP A N     1 
ATOM   5437 C  CA    . TRP C 3 678 ? 48.391 5.895   -0.429  1.00 29.52 ? 684  TRP A CA    1 
ATOM   5438 C  C     . TRP C 3 678 ? 46.942 5.458   -0.310  1.00 29.74 ? 684  TRP A C     1 
ATOM   5439 O  O     . TRP C 3 678 ? 46.247 5.843   0.626   1.00 29.86 ? 684  TRP A O     1 
ATOM   5440 C  CB    . TRP C 3 678 ? 48.571 7.322   0.114   1.00 27.58 ? 684  TRP A CB    1 
ATOM   5441 C  CG    . TRP C 3 678 ? 49.968 7.587   0.608   1.00 27.41 ? 684  TRP A CG    1 
ATOM   5442 C  CD1   . TRP C 3 678 ? 50.805 6.692   1.210   1.00 26.89 ? 684  TRP A CD1   1 
ATOM   5443 C  CD2   . TRP C 3 678 ? 50.681 8.839   0.575   1.00 26.43 ? 684  TRP A CD2   1 
ATOM   5444 N  NE1   . TRP C 3 678 ? 51.994 7.305   1.553   1.00 26.60 ? 684  TRP A NE1   1 
ATOM   5445 C  CE2   . TRP C 3 678 ? 51.942 8.620   1.176   1.00 25.35 ? 684  TRP A CE2   1 
ATOM   5446 C  CE3   . TRP C 3 678 ? 50.373 10.121  0.100   1.00 26.27 ? 684  TRP A CE3   1 
ATOM   5447 C  CZ2   . TRP C 3 678 ? 52.896 9.636   1.312   1.00 24.84 ? 684  TRP A CZ2   1 
ATOM   5448 C  CZ3   . TRP C 3 678 ? 51.324 11.133  0.239   1.00 24.54 ? 684  TRP A CZ3   1 
ATOM   5449 C  CH2   . TRP C 3 678 ? 52.567 10.881  0.838   1.00 24.50 ? 684  TRP A CH2   1 
ATOM   5450 N  N     . ASN C 3 679 ? 46.504 4.640   -1.263  1.00 30.42 ? 685  ASN A N     1 
ATOM   5451 C  CA    . ASN C 3 679 ? 45.143 4.114   -1.283  1.00 31.22 ? 685  ASN A CA    1 
ATOM   5452 C  C     . ASN C 3 679 ? 44.111 5.188   -0.950  1.00 30.58 ? 685  ASN A C     1 
ATOM   5453 O  O     . ASN C 3 679 ? 43.254 4.988   -0.096  1.00 28.68 ? 685  ASN A O     1 
ATOM   5454 C  CB    . ASN C 3 679 ? 45.023 2.956   -0.286  1.00 30.27 ? 685  ASN A CB    1 
ATOM   5455 C  CG    . ASN C 3 679 ? 46.152 1.940   -0.430  1.00 33.51 ? 685  ASN A CG    1 
ATOM   5456 O  OD1   . ASN C 3 679 ? 46.330 1.321   -1.489  1.00 33.49 ? 685  ASN A OD1   1 
ATOM   5457 N  ND2   . ASN C 3 679 ? 46.923 1.765   0.639   1.00 33.07 ? 685  ASN A ND2   1 
ATOM   5458 N  N     . PHE C 3 680 ? 44.186 6.316   -1.645  1.00 30.46 ? 686  PHE A N     1 
ATOM   5459 C  CA    . PHE C 3 680 ? 43.268 7.421   -1.402  1.00 30.50 ? 686  PHE A CA    1 
ATOM   5460 C  C     . PHE C 3 680 ? 41.847 7.116   -1.883  1.00 31.00 ? 686  PHE A C     1 
ATOM   5461 O  O     . PHE C 3 680 ? 41.651 6.676   -3.014  1.00 31.32 ? 686  PHE A O     1 
ATOM   5462 C  CB    . PHE C 3 680 ? 43.802 8.695   -2.071  1.00 28.45 ? 686  PHE A CB    1 
ATOM   5463 C  CG    . PHE C 3 680 ? 43.891 9.871   -1.135  1.00 27.76 ? 686  PHE A CG    1 
ATOM   5464 C  CD1   . PHE C 3 680 ? 44.638 9.788   0.030   1.00 27.37 ? 686  PHE A CD1   1 
ATOM   5465 C  CD2   . PHE C 3 680 ? 43.209 11.050  -1.409  1.00 26.49 ? 686  PHE A CD2   1 
ATOM   5466 C  CE1   . PHE C 3 680 ? 44.701 10.867  0.917   1.00 27.69 ? 686  PHE A CE1   1 
ATOM   5467 C  CE2   . PHE C 3 680 ? 43.266 12.131  -0.532  1.00 27.29 ? 686  PHE A CE2   1 
ATOM   5468 C  CZ    . PHE C 3 680 ? 44.010 12.041  0.634   1.00 26.17 ? 686  PHE A CZ    1 
ATOM   5469 N  N     . ARG C 3 681 ? 40.862 7.368   -1.018  1.00 31.86 ? 687  ARG A N     1 
ATOM   5470 C  CA    . ARG C 3 681 ? 39.456 7.096   -1.325  1.00 32.90 ? 687  ARG A CA    1 
ATOM   5471 C  C     . ARG C 3 681 ? 38.818 8.114   -2.270  1.00 33.11 ? 687  ARG A C     1 
ATOM   5472 O  O     . ARG C 3 681 ? 37.652 7.984   -2.634  1.00 34.76 ? 687  ARG A O     1 
ATOM   5473 C  CB    . ARG C 3 681 ? 38.643 7.016   -0.030  1.00 35.12 ? 687  ARG A CB    1 
ATOM   5474 C  CG    . ARG C 3 681 ? 39.339 6.245   1.087   1.00 36.43 ? 687  ARG A CG    1 
ATOM   5475 C  CD    . ARG C 3 681 ? 39.210 4.740   0.955   1.00 37.53 ? 687  ARG A CD    1 
ATOM   5476 N  NE    . ARG C 3 681 ? 37.968 4.253   1.554   1.00 39.41 ? 687  ARG A NE    1 
ATOM   5477 C  CZ    . ARG C 3 681 ? 36.820 4.136   0.899   1.00 38.91 ? 687  ARG A CZ    1 
ATOM   5478 N  NH1   . ARG C 3 681 ? 36.756 4.468   -0.386  1.00 40.13 ? 687  ARG A NH1   1 
ATOM   5479 N  NH2   . ARG C 3 681 ? 35.741 3.695   1.528   1.00 37.46 ? 687  ARG A NH2   1 
ATOM   5480 N  N     . CYS C 3 682 ? 39.568 9.138   -2.652  1.00 31.72 ? 688  CYS A N     1 
ATOM   5481 C  CA    . CYS C 3 682 ? 39.057 10.110  -3.605  1.00 31.38 ? 688  CYS A CA    1 
ATOM   5482 C  C     . CYS C 3 682 ? 40.079 10.238  -4.728  1.00 31.40 ? 688  CYS A C     1 
ATOM   5483 O  O     . CYS C 3 682 ? 41.266 10.383  -4.474  1.00 32.90 ? 688  CYS A O     1 
ATOM   5484 C  CB    . CYS C 3 682 ? 38.832 11.474  -2.950  1.00 29.46 ? 688  CYS A CB    1 
ATOM   5485 S  SG    . CYS C 3 682 ? 38.126 12.687  -4.093  1.00 35.41 ? 688  CYS A SG    1 
ATOM   5486 N  N     . LEU C 3 683 ? 39.618 10.165  -5.968  1.00 31.58 ? 689  LEU A N     1 
ATOM   5487 C  CA    . LEU C 3 683 ? 40.504 10.275  -7.118  1.00 32.34 ? 689  LEU A CA    1 
ATOM   5488 C  C     . LEU C 3 683 ? 41.147 11.662  -7.154  1.00 32.56 ? 689  LEU A C     1 
ATOM   5489 O  O     . LEU C 3 683 ? 40.466 12.680  -7.012  1.00 32.57 ? 689  LEU A O     1 
ATOM   5490 C  CB    . LEU C 3 683 ? 39.713 10.041  -8.404  1.00 32.12 ? 689  LEU A CB    1 
ATOM   5491 C  CG    . LEU C 3 683 ? 40.507 9.865   -9.698  1.00 33.92 ? 689  LEU A CG    1 
ATOM   5492 C  CD1   . LEU C 3 683 ? 41.289 8.548   -9.640  1.00 33.86 ? 689  LEU A CD1   1 
ATOM   5493 C  CD2   . LEU C 3 683 ? 39.543 9.864   -10.887 1.00 34.33 ? 689  LEU A CD2   1 
ATOM   5494 N  N     . LEU C 3 684 ? 42.461 11.692  -7.353  1.00 32.70 ? 690  LEU A N     1 
ATOM   5495 C  CA    . LEU C 3 684 ? 43.209 12.947  -7.401  1.00 31.85 ? 690  LEU A CA    1 
ATOM   5496 C  C     . LEU C 3 684 ? 43.522 13.346  -8.833  1.00 32.17 ? 690  LEU A C     1 
ATOM   5497 O  O     . LEU C 3 684 ? 43.801 12.492  -9.671  1.00 32.72 ? 690  LEU A O     1 
ATOM   5498 C  CB    . LEU C 3 684 ? 44.514 12.805  -6.616  1.00 30.97 ? 690  LEU A CB    1 
ATOM   5499 C  CG    . LEU C 3 684 ? 44.379 12.415  -5.141  1.00 30.07 ? 690  LEU A CG    1 
ATOM   5500 C  CD1   . LEU C 3 684 ? 45.771 12.236  -4.528  1.00 26.66 ? 690  LEU A CD1   1 
ATOM   5501 C  CD2   . LEU C 3 684 ? 43.596 13.496  -4.399  1.00 29.03 ? 690  LEU A CD2   1 
ATOM   5502 N  N     . ASP C 3 685 ? 43.482 14.646  -9.110  1.00 31.41 ? 691  ASP A N     1 
ATOM   5503 C  CA    . ASP C 3 685 ? 43.766 15.138  -10.448 1.00 32.19 ? 691  ASP A CA    1 
ATOM   5504 C  C     . ASP C 3 685 ? 44.576 16.422  -10.463 1.00 31.74 ? 691  ASP A C     1 
ATOM   5505 O  O     . ASP C 3 685 ? 44.783 17.056  -9.431  1.00 29.31 ? 691  ASP A O     1 
ATOM   5506 C  CB    . ASP C 3 685 ? 42.464 15.375  -11.214 1.00 34.13 ? 691  ASP A CB    1 
ATOM   5507 C  CG    . ASP C 3 685 ? 41.776 14.086  -11.599 1.00 37.29 ? 691  ASP A CG    1 
ATOM   5508 O  OD1   . ASP C 3 685 ? 42.411 13.271  -12.304 1.00 38.94 ? 691  ASP A OD1   1 
ATOM   5509 O  OD2   . ASP C 3 685 ? 40.606 13.889  -11.198 1.00 38.72 ? 691  ASP A OD2   1 
ATOM   5510 N  N     . THR C 3 686 ? 45.021 16.793  -11.659 1.00 31.99 ? 692  THR A N     1 
ATOM   5511 C  CA    . THR C 3 686 ? 45.789 18.012  -11.872 1.00 33.12 ? 692  THR A CA    1 
ATOM   5512 C  C     . THR C 3 686 ? 45.345 18.669  -13.175 1.00 33.70 ? 692  THR A C     1 
ATOM   5513 O  O     . THR C 3 686 ? 44.881 17.999  -14.095 1.00 33.33 ? 692  THR A O     1 
ATOM   5514 C  CB    . THR C 3 686 ? 47.289 17.738  -12.025 1.00 33.02 ? 692  THR A CB    1 
ATOM   5515 O  OG1   . THR C 3 686 ? 47.502 16.982  -13.221 1.00 32.83 ? 692  THR A OG1   1 
ATOM   5516 C  CG2   . THR C 3 686 ? 47.831 16.980  -10.823 1.00 33.65 ? 692  THR A CG2   1 
ATOM   5517 N  N     . GLU C 3 687 ? 45.498 19.987  -13.243 1.00 33.84 ? 693  GLU A N     1 
ATOM   5518 C  CA    . GLU C 3 687 ? 45.157 20.742  -14.433 1.00 33.70 ? 693  GLU A CA    1 
ATOM   5519 C  C     . GLU C 3 687 ? 46.435 21.493  -14.771 1.00 34.24 ? 693  GLU A C     1 
ATOM   5520 O  O     . GLU C 3 687 ? 47.066 22.076  -13.892 1.00 33.38 ? 693  GLU A O     1 
ATOM   5521 C  CB    . GLU C 3 687 ? 44.017 21.727  -14.144 1.00 33.78 ? 693  GLU A CB    1 
ATOM   5522 N  N     . GLY C 3 688 ? 46.834 21.457  -16.037 1.00 35.40 ? 694  GLY A N     1 
ATOM   5523 C  CA    . GLY C 3 688 ? 48.048 22.143  -16.429 1.00 33.82 ? 694  GLY A CA    1 
ATOM   5524 C  C     . GLY C 3 688 ? 47.776 23.164  -17.505 1.00 33.68 ? 694  GLY A C     1 
ATOM   5525 O  O     . GLY C 3 688 ? 46.786 23.058  -18.223 1.00 34.74 ? 694  GLY A O     1 
ATOM   5526 N  N     . LYS C 3 689 ? 48.653 24.156  -17.608 1.00 32.73 ? 695  LYS A N     1 
ATOM   5527 C  CA    . LYS C 3 689 ? 48.527 25.201  -18.610 1.00 31.68 ? 695  LYS A CA    1 
ATOM   5528 C  C     . LYS C 3 689 ? 49.925 25.617  -19.062 1.00 32.59 ? 695  LYS A C     1 
ATOM   5529 O  O     . LYS C 3 689 ? 50.845 25.753  -18.254 1.00 30.80 ? 695  LYS A O     1 
ATOM   5530 C  CB    . LYS C 3 689 ? 47.781 26.408  -18.036 1.00 33.79 ? 695  LYS A CB    1 
ATOM   5531 N  N     . MET C 3 690 ? 50.075 25.806  -20.365 1.00 32.03 ? 696  MET A N     1 
ATOM   5532 C  CA    . MET C 3 690 ? 51.342 26.194  -20.952 1.00 34.02 ? 696  MET A CA    1 
ATOM   5533 C  C     . MET C 3 690 ? 51.311 27.670  -21.350 1.00 33.32 ? 696  MET A C     1 
ATOM   5534 O  O     . MET C 3 690 ? 50.286 28.179  -21.800 1.00 34.07 ? 696  MET A O     1 
ATOM   5535 C  CB    . MET C 3 690 ? 51.612 25.321  -22.177 1.00 36.31 ? 696  MET A CB    1 
ATOM   5536 C  CG    . MET C 3 690 ? 52.849 25.693  -22.961 1.00 40.02 ? 696  MET A CG    1 
ATOM   5537 S  SD    . MET C 3 690 ? 52.927 24.744  -24.499 1.00 45.42 ? 696  MET A SD    1 
ATOM   5538 C  CE    . MET C 3 690 ? 53.067 23.078  -23.866 1.00 42.42 ? 696  MET A CE    1 
ATOM   5539 N  N     . GLY C 3 691 ? 52.437 28.352  -21.183 1.00 32.85 ? 697  GLY A N     1 
ATOM   5540 C  CA    . GLY C 3 691 ? 52.500 29.760  -21.528 1.00 31.04 ? 697  GLY A CA    1 
ATOM   5541 C  C     . GLY C 3 691 ? 53.883 30.314  -21.298 1.00 28.89 ? 697  GLY A C     1 
ATOM   5542 O  O     . GLY C 3 691 ? 54.791 29.560  -20.972 1.00 31.35 ? 697  GLY A O     1 
ATOM   5543 N  N     . PRO C 3 692 ? 54.084 31.628  -21.464 1.00 27.90 ? 698  PRO A N     1 
ATOM   5544 C  CA    . PRO C 3 692 ? 55.402 32.238  -21.257 1.00 27.14 ? 698  PRO A CA    1 
ATOM   5545 C  C     . PRO C 3 692 ? 55.723 32.647  -19.819 1.00 27.11 ? 698  PRO A C     1 
ATOM   5546 O  O     . PRO C 3 692 ? 56.898 32.755  -19.460 1.00 28.41 ? 698  PRO A O     1 
ATOM   5547 C  CB    . PRO C 3 692 ? 55.361 33.452  -22.183 1.00 26.76 ? 698  PRO A CB    1 
ATOM   5548 C  CG    . PRO C 3 692 ? 53.942 33.897  -22.031 1.00 26.07 ? 698  PRO A CG    1 
ATOM   5549 C  CD    . PRO C 3 692 ? 53.175 32.578  -22.131 1.00 25.42 ? 698  PRO A CD    1 
ATOM   5550 N  N     . ASN C 3 693 ? 54.700 32.882  -18.999 1.00 26.27 ? 699  ASN A N     1 
ATOM   5551 C  CA    . ASN C 3 693 ? 54.948 33.316  -17.626 1.00 26.72 ? 699  ASN A CA    1 
ATOM   5552 C  C     . ASN C 3 693 ? 53.889 32.913  -16.604 1.00 27.01 ? 699  ASN A C     1 
ATOM   5553 O  O     . ASN C 3 693 ? 52.897 32.268  -16.941 1.00 28.54 ? 699  ASN A O     1 
ATOM   5554 C  CB    . ASN C 3 693 ? 55.139 34.835  -17.592 1.00 25.44 ? 699  ASN A CB    1 
ATOM   5555 C  CG    . ASN C 3 693 ? 53.940 35.588  -18.138 1.00 25.18 ? 699  ASN A CG    1 
ATOM   5556 O  OD1   . ASN C 3 693 ? 52.806 35.349  -17.733 1.00 24.81 ? 699  ASN A OD1   1 
ATOM   5557 N  ND2   . ASN C 3 693 ? 54.191 36.512  -19.059 1.00 26.67 ? 699  ASN A ND2   1 
ATOM   5558 N  N     . TRP C 3 694 ? 54.097 33.326  -15.355 1.00 26.91 ? 700  TRP A N     1 
ATOM   5559 C  CA    . TRP C 3 694 ? 53.185 32.978  -14.266 1.00 26.86 ? 700  TRP A CA    1 
ATOM   5560 C  C     . TRP C 3 694 ? 51.806 33.612  -14.390 1.00 26.83 ? 700  TRP A C     1 
ATOM   5561 O  O     . TRP C 3 694 ? 50.820 33.052  -13.924 1.00 27.22 ? 700  TRP A O     1 
ATOM   5562 C  CB    . TRP C 3 694 ? 53.797 33.345  -12.910 1.00 25.76 ? 700  TRP A CB    1 
ATOM   5563 C  CG    . TRP C 3 694 ? 53.404 32.409  -11.789 1.00 24.20 ? 700  TRP A CG    1 
ATOM   5564 C  CD1   . TRP C 3 694 ? 52.434 31.445  -11.818 1.00 25.10 ? 700  TRP A CD1   1 
ATOM   5565 C  CD2   . TRP C 3 694 ? 54.025 32.308  -10.505 1.00 23.89 ? 700  TRP A CD2   1 
ATOM   5566 N  NE1   . TRP C 3 694 ? 52.422 30.742  -10.637 1.00 23.57 ? 700  TRP A NE1   1 
ATOM   5567 C  CE2   . TRP C 3 694 ? 53.390 31.251  -9.813  1.00 24.38 ? 700  TRP A CE2   1 
ATOM   5568 C  CE3   . TRP C 3 694 ? 55.062 33.003  -9.873  1.00 23.80 ? 700  TRP A CE3   1 
ATOM   5569 C  CZ2   . TRP C 3 694 ? 53.762 30.871  -8.519  1.00 24.45 ? 700  TRP A CZ2   1 
ATOM   5570 C  CZ3   . TRP C 3 694 ? 55.434 32.622  -8.586  1.00 26.15 ? 700  TRP A CZ3   1 
ATOM   5571 C  CH2   . TRP C 3 694 ? 54.785 31.565  -7.926  1.00 25.82 ? 700  TRP A CH2   1 
ATOM   5572 N  N     . ALA C 3 695 ? 51.726 34.778  -15.013 1.00 27.93 ? 701  ALA A N     1 
ATOM   5573 C  CA    . ALA C 3 695 ? 50.430 35.422  -15.189 1.00 30.42 ? 701  ALA A CA    1 
ATOM   5574 C  C     . ALA C 3 695 ? 49.532 34.537  -16.062 1.00 32.08 ? 701  ALA A C     1 
ATOM   5575 O  O     . ALA C 3 695 ? 48.380 34.253  -15.724 1.00 31.81 ? 701  ALA A O     1 
ATOM   5576 C  CB    . ALA C 3 695 ? 50.609 36.794  -15.844 1.00 30.39 ? 701  ALA A CB    1 
ATOM   5577 N  N     . ILE C 3 696 ? 50.077 34.088  -17.184 1.00 33.11 ? 702  ILE A N     1 
ATOM   5578 C  CA    . ILE C 3 696 ? 49.321 33.265  -18.107 1.00 34.55 ? 702  ILE A CA    1 
ATOM   5579 C  C     . ILE C 3 696 ? 49.127 31.832  -17.625 1.00 37.34 ? 702  ILE A C     1 
ATOM   5580 O  O     . ILE C 3 696 ? 48.118 31.206  -17.933 1.00 38.67 ? 702  ILE A O     1 
ATOM   5581 C  CB    . ILE C 3 696 ? 50.001 33.263  -19.484 1.00 35.11 ? 702  ILE A CB    1 
ATOM   5582 C  CG1   . ILE C 3 696 ? 50.157 34.714  -19.961 1.00 35.04 ? 702  ILE A CG1   1 
ATOM   5583 C  CG2   . ILE C 3 696 ? 49.182 32.428  -20.478 1.00 31.55 ? 702  ILE A CG2   1 
ATOM   5584 C  CD1   . ILE C 3 696 ? 50.944 34.867  -21.221 1.00 39.26 ? 702  ILE A CD1   1 
ATOM   5585 N  N     . CYS C 3 697 ? 50.077 31.315  -16.856 1.00 37.92 ? 703  CYS A N     1 
ATOM   5586 C  CA    . CYS C 3 697 ? 49.967 29.947  -16.368 1.00 40.28 ? 703  CYS A CA    1 
ATOM   5587 C  C     . CYS C 3 697 ? 49.258 29.813  -15.021 1.00 42.40 ? 703  CYS A C     1 
ATOM   5588 O  O     . CYS C 3 697 ? 49.683 29.031  -14.169 1.00 43.71 ? 703  CYS A O     1 
ATOM   5589 C  CB    . CYS C 3 697 ? 51.355 29.311  -16.295 1.00 39.07 ? 703  CYS A CB    1 
ATOM   5590 S  SG    . CYS C 3 697 ? 52.130 29.132  -17.918 1.00 37.66 ? 703  CYS A SG    1 
ATOM   5591 N  N     . HIS C 3 698 ? 48.177 30.570  -14.842 1.00 43.56 ? 704  HIS A N     1 
ATOM   5592 C  CA    . HIS C 3 698 ? 47.388 30.541  -13.611 1.00 45.18 ? 704  HIS A CA    1 
ATOM   5593 C  C     . HIS C 3 698 ? 46.430 31.727  -13.557 1.00 46.75 ? 704  HIS A C     1 
ATOM   5594 O  O     . HIS C 3 698 ? 46.849 32.814  -14.007 1.00 46.26 ? 704  HIS A O     1 
ATOM   5595 C  CB    . HIS C 3 698 ? 48.297 30.572  -12.379 1.00 46.30 ? 704  HIS A CB    1 
ATOM   5596 N  N     . LYS D 4 3   ? 39.694 91.947  25.120  1.00 47.22 ? 3    LYS B N     1 
ATOM   5597 C  CA    . LYS D 4 3   ? 40.569 92.878  24.346  1.00 48.52 ? 3    LYS B CA    1 
ATOM   5598 C  C     . LYS D 4 3   ? 41.629 92.156  23.517  1.00 47.81 ? 3    LYS B C     1 
ATOM   5599 O  O     . LYS D 4 3   ? 42.418 92.793  22.814  1.00 47.54 ? 3    LYS B O     1 
ATOM   5600 C  CB    . LYS D 4 3   ? 41.254 93.856  25.296  1.00 50.23 ? 3    LYS B CB    1 
ATOM   5601 C  CG    . LYS D 4 3   ? 40.278 94.670  26.127  1.00 53.04 ? 3    LYS B CG    1 
ATOM   5602 C  CD    . LYS D 4 3   ? 40.990 95.563  27.131  1.00 53.35 ? 3    LYS B CD    1 
ATOM   5603 C  CE    . LYS D 4 3   ? 39.972 96.261  28.024  1.00 55.45 ? 3    LYS B CE    1 
ATOM   5604 N  NZ    . LYS D 4 3   ? 39.046 95.265  28.658  1.00 55.34 ? 3    LYS B NZ    1 
ATOM   5605 N  N     . ILE D 4 4   ? 41.650 90.828  23.591  1.00 46.30 ? 4    ILE B N     1 
ATOM   5606 C  CA    . ILE D 4 4   ? 42.627 90.062  22.826  1.00 45.14 ? 4    ILE B CA    1 
ATOM   5607 C  C     . ILE D 4 4   ? 42.099 89.696  21.443  1.00 44.23 ? 4    ILE B C     1 
ATOM   5608 O  O     . ILE D 4 4   ? 40.943 89.297  21.287  1.00 45.01 ? 4    ILE B O     1 
ATOM   5609 C  CB    . ILE D 4 4   ? 43.023 88.768  23.552  1.00 45.23 ? 4    ILE B CB    1 
ATOM   5610 C  CG1   . ILE D 4 4   ? 43.620 89.106  24.920  1.00 45.20 ? 4    ILE B CG1   1 
ATOM   5611 C  CG2   . ILE D 4 4   ? 44.023 87.986  22.704  1.00 44.20 ? 4    ILE B CG2   1 
ATOM   5612 C  CD1   . ILE D 4 4   ? 44.056 87.899  25.716  1.00 46.14 ? 4    ILE B CD1   1 
ATOM   5613 N  N     . ILE D 4 5   ? 42.954 89.837  20.440  1.00 42.19 ? 5    ILE B N     1 
ATOM   5614 C  CA    . ILE D 4 5   ? 42.577 89.512  19.072  1.00 41.96 ? 5    ILE B CA    1 
ATOM   5615 C  C     . ILE D 4 5   ? 42.840 88.042  18.771  1.00 39.89 ? 5    ILE B C     1 
ATOM   5616 O  O     . ILE D 4 5   ? 43.981 87.584  18.815  1.00 39.25 ? 5    ILE B O     1 
ATOM   5617 C  CB    . ILE D 4 5   ? 43.362 90.372  18.064  1.00 42.87 ? 5    ILE B CB    1 
ATOM   5618 C  CG1   . ILE D 4 5   ? 42.925 91.832  18.181  1.00 43.68 ? 5    ILE B CG1   1 
ATOM   5619 C  CG2   . ILE D 4 5   ? 43.144 89.857  16.656  1.00 43.89 ? 5    ILE B CG2   1 
ATOM   5620 C  CD1   . ILE D 4 5   ? 43.613 92.748  17.185  1.00 47.72 ? 5    ILE B CD1   1 
ATOM   5621 N  N     . HIS D 4 6   ? 41.773 87.311  18.475  1.00 38.65 ? 6    HIS B N     1 
ATOM   5622 C  CA    . HIS D 4 6   ? 41.870 85.895  18.146  1.00 37.46 ? 6    HIS B CA    1 
ATOM   5623 C  C     . HIS D 4 6   ? 42.033 85.767  16.635  1.00 35.59 ? 6    HIS B C     1 
ATOM   5624 O  O     . HIS D 4 6   ? 41.108 86.042  15.879  1.00 34.65 ? 6    HIS B O     1 
ATOM   5625 C  CB    . HIS D 4 6   ? 40.611 85.180  18.620  1.00 39.63 ? 6    HIS B CB    1 
ATOM   5626 C  CG    . HIS D 4 6   ? 40.378 85.310  20.091  1.00 43.69 ? 6    HIS B CG    1 
ATOM   5627 N  ND1   . HIS D 4 6   ? 41.156 84.662  21.028  1.00 45.23 ? 6    HIS B ND1   1 
ATOM   5628 C  CD2   . HIS D 4 6   ? 39.490 86.058  20.789  1.00 44.95 ? 6    HIS B CD2   1 
ATOM   5629 C  CE1   . HIS D 4 6   ? 40.757 85.005  22.240  1.00 46.12 ? 6    HIS B CE1   1 
ATOM   5630 N  NE2   . HIS D 4 6   ? 39.748 85.851  22.124  1.00 46.29 ? 6    HIS B NE2   1 
ATOM   5631 N  N     . LEU D 4 7   ? 43.220 85.347  16.210  1.00 34.57 ? 7    LEU B N     1 
ATOM   5632 C  CA    . LEU D 4 7   ? 43.553 85.215  14.793  1.00 33.87 ? 7    LEU B CA    1 
ATOM   5633 C  C     . LEU D 4 7   ? 43.141 83.887  14.159  1.00 33.67 ? 7    LEU B C     1 
ATOM   5634 O  O     . LEU D 4 7   ? 42.762 82.943  14.847  1.00 33.25 ? 7    LEU B O     1 
ATOM   5635 C  CB    . LEU D 4 7   ? 45.064 85.381  14.607  1.00 33.57 ? 7    LEU B CB    1 
ATOM   5636 C  CG    . LEU D 4 7   ? 45.766 86.589  15.228  1.00 35.31 ? 7    LEU B CG    1 
ATOM   5637 C  CD1   . LEU D 4 7   ? 47.278 86.339  15.273  1.00 34.52 ? 7    LEU B CD1   1 
ATOM   5638 C  CD2   . LEU D 4 7   ? 45.438 87.838  14.433  1.00 34.36 ? 7    LEU B CD2   1 
ATOM   5639 N  N     . THR D 4 8   ? 43.227 83.839  12.832  1.00 32.82 ? 8    THR B N     1 
ATOM   5640 C  CA    . THR D 4 8   ? 42.933 82.634  12.057  1.00 32.60 ? 8    THR B CA    1 
ATOM   5641 C  C     . THR D 4 8   ? 44.020 82.625  10.993  1.00 31.77 ? 8    THR B C     1 
ATOM   5642 O  O     . THR D 4 8   ? 44.668 83.652  10.768  1.00 32.87 ? 8    THR B O     1 
ATOM   5643 C  CB    . THR D 4 8   ? 41.571 82.706  11.329  1.00 32.13 ? 8    THR B CB    1 
ATOM   5644 O  OG1   . THR D 4 8   ? 41.602 83.775  10.376  1.00 32.36 ? 8    THR B OG1   1 
ATOM   5645 C  CG2   . THR D 4 8   ? 40.437 82.943  12.313  1.00 32.84 ? 8    THR B CG2   1 
ATOM   5646 N  N     . ASP D 4 9   ? 44.227 81.487  10.340  1.00 30.99 ? 9    ASP B N     1 
ATOM   5647 C  CA    . ASP D 4 9   ? 45.238 81.417  9.291   1.00 31.95 ? 9    ASP B CA    1 
ATOM   5648 C  C     . ASP D 4 9   ? 44.978 82.436  8.185   1.00 32.00 ? 9    ASP B C     1 
ATOM   5649 O  O     . ASP D 4 9   ? 45.904 83.086  7.703   1.00 30.50 ? 9    ASP B O     1 
ATOM   5650 C  CB    . ASP D 4 9   ? 45.289 80.019  8.656   1.00 33.93 ? 9    ASP B CB    1 
ATOM   5651 C  CG    . ASP D 4 9   ? 46.154 79.044  9.441   1.00 36.48 ? 9    ASP B CG    1 
ATOM   5652 O  OD1   . ASP D 4 9   ? 47.209 79.466  9.967   1.00 38.32 ? 9    ASP B OD1   1 
ATOM   5653 O  OD2   . ASP D 4 9   ? 45.785 77.851  9.513   1.00 37.09 ? 9    ASP B OD2   1 
ATOM   5654 N  N     . ASP D 4 10  ? 43.714 82.573  7.786   1.00 32.76 ? 10   ASP B N     1 
ATOM   5655 C  CA    . ASP D 4 10  ? 43.358 83.489  6.708   1.00 33.23 ? 10   ASP B CA    1 
ATOM   5656 C  C     . ASP D 4 10  ? 43.326 84.962  7.082   1.00 33.27 ? 10   ASP B C     1 
ATOM   5657 O  O     . ASP D 4 10  ? 43.378 85.817  6.204   1.00 32.60 ? 10   ASP B O     1 
ATOM   5658 C  CB    . ASP D 4 10  ? 42.015 83.093  6.096   1.00 34.73 ? 10   ASP B CB    1 
ATOM   5659 C  CG    . ASP D 4 10  ? 42.043 81.707  5.473   1.00 36.92 ? 10   ASP B CG    1 
ATOM   5660 O  OD1   . ASP D 4 10  ? 43.120 81.290  4.985   1.00 37.99 ? 10   ASP B OD1   1 
ATOM   5661 O  OD2   . ASP D 4 10  ? 40.985 81.041  5.461   1.00 36.68 ? 10   ASP B OD2   1 
ATOM   5662 N  N     . SER D 4 11  ? 43.242 85.273  8.372   1.00 33.18 ? 11   SER B N     1 
ATOM   5663 C  CA    . SER D 4 11  ? 43.217 86.671  8.770   1.00 34.19 ? 11   SER B CA    1 
ATOM   5664 C  C     . SER D 4 11  ? 44.591 87.149  9.227   1.00 34.68 ? 11   SER B C     1 
ATOM   5665 O  O     . SER D 4 11  ? 44.803 88.346  9.433   1.00 34.81 ? 11   SER B O     1 
ATOM   5666 C  CB    . SER D 4 11  ? 42.206 86.896  9.896   1.00 32.38 ? 11   SER B CB    1 
ATOM   5667 O  OG    . SER D 4 11  ? 42.781 86.643  11.167  1.00 35.23 ? 11   SER B OG    1 
ATOM   5668 N  N     . PHE D 4 12  ? 45.528 86.216  9.364   1.00 35.60 ? 12   PHE B N     1 
ATOM   5669 C  CA    . PHE D 4 12  ? 46.864 86.555  9.846   1.00 36.17 ? 12   PHE B CA    1 
ATOM   5670 C  C     . PHE D 4 12  ? 47.564 87.685  9.103   1.00 36.80 ? 12   PHE B C     1 
ATOM   5671 O  O     . PHE D 4 12  ? 48.003 88.657  9.717   1.00 36.59 ? 12   PHE B O     1 
ATOM   5672 C  CB    . PHE D 4 12  ? 47.763 85.314  9.850   1.00 33.69 ? 12   PHE B CB    1 
ATOM   5673 C  CG    . PHE D 4 12  ? 49.041 85.495  10.630  1.00 32.69 ? 12   PHE B CG    1 
ATOM   5674 C  CD1   . PHE D 4 12  ? 50.190 85.985  10.014  1.00 31.69 ? 12   PHE B CD1   1 
ATOM   5675 C  CD2   . PHE D 4 12  ? 49.086 85.193  11.991  1.00 31.96 ? 12   PHE B CD2   1 
ATOM   5676 C  CE1   . PHE D 4 12  ? 51.364 86.171  10.743  1.00 32.66 ? 12   PHE B CE1   1 
ATOM   5677 C  CE2   . PHE D 4 12  ? 50.254 85.375  12.730  1.00 30.19 ? 12   PHE B CE2   1 
ATOM   5678 C  CZ    . PHE D 4 12  ? 51.395 85.864  12.105  1.00 30.88 ? 12   PHE B CZ    1 
ATOM   5679 N  N     . ASP D 4 13  ? 47.663 87.562  7.788   1.00 38.47 ? 13   ASP B N     1 
ATOM   5680 C  CA    . ASP D 4 13  ? 48.343 88.569  6.986   1.00 40.63 ? 13   ASP B CA    1 
ATOM   5681 C  C     . ASP D 4 13  ? 47.900 90.012  7.249   1.00 41.83 ? 13   ASP B C     1 
ATOM   5682 O  O     . ASP D 4 13  ? 48.739 90.875  7.523   1.00 42.38 ? 13   ASP B O     1 
ATOM   5683 C  CB    . ASP D 4 13  ? 48.190 88.246  5.495   1.00 42.50 ? 13   ASP B CB    1 
ATOM   5684 C  CG    . ASP D 4 13  ? 49.115 89.076  4.621   1.00 44.72 ? 13   ASP B CG    1 
ATOM   5685 O  OD1   . ASP D 4 13  ? 48.974 90.316  4.604   1.00 44.48 ? 13   ASP B OD1   1 
ATOM   5686 O  OD2   . ASP D 4 13  ? 49.990 88.486  3.951   1.00 46.88 ? 13   ASP B OD2   1 
ATOM   5687 N  N     . THR D 4 14  ? 46.597 90.280  7.182   1.00 41.82 ? 14   THR B N     1 
ATOM   5688 C  CA    . THR D 4 14  ? 46.113 91.639  7.393   1.00 42.94 ? 14   THR B CA    1 
ATOM   5689 C  C     . THR D 4 14  ? 46.113 92.089  8.850   1.00 42.58 ? 14   THR B C     1 
ATOM   5690 O  O     . THR D 4 14  ? 46.485 93.230  9.138   1.00 43.38 ? 14   THR B O     1 
ATOM   5691 C  CB    . THR D 4 14  ? 44.687 91.853  6.787   1.00 44.27 ? 14   THR B CB    1 
ATOM   5692 O  OG1   . THR D 4 14  ? 43.714 91.132  7.551   1.00 46.70 ? 14   THR B OG1   1 
ATOM   5693 C  CG2   . THR D 4 14  ? 44.648 91.365  5.345   1.00 44.31 ? 14   THR B CG2   1 
ATOM   5694 N  N     . ASP D 4 15  ? 45.710 91.211  9.768   1.00 42.37 ? 15   ASP B N     1 
ATOM   5695 C  CA    . ASP D 4 15  ? 45.681 91.562  11.192  1.00 41.48 ? 15   ASP B CA    1 
ATOM   5696 C  C     . ASP D 4 15  ? 47.060 91.755  11.814  1.00 40.71 ? 15   ASP B C     1 
ATOM   5697 O  O     . ASP D 4 15  ? 47.230 92.583  12.706  1.00 40.60 ? 15   ASP B O     1 
ATOM   5698 C  CB    . ASP D 4 15  ? 44.940 90.499  12.013  1.00 42.99 ? 15   ASP B CB    1 
ATOM   5699 C  CG    . ASP D 4 15  ? 43.438 90.527  11.794  1.00 45.89 ? 15   ASP B CG    1 
ATOM   5700 O  OD1   . ASP D 4 15  ? 42.870 91.639  11.751  1.00 45.89 ? 15   ASP B OD1   1 
ATOM   5701 O  OD2   . ASP D 4 15  ? 42.823 89.440  11.681  1.00 45.84 ? 15   ASP B OD2   1 
ATOM   5702 N  N     . VAL D 4 16  ? 48.045 90.997  11.342  1.00 39.86 ? 16   VAL B N     1 
ATOM   5703 C  CA    . VAL D 4 16  ? 49.388 91.078  11.898  1.00 36.90 ? 16   VAL B CA    1 
ATOM   5704 C  C     . VAL D 4 16  ? 50.433 91.761  11.028  1.00 37.98 ? 16   VAL B C     1 
ATOM   5705 O  O     . VAL D 4 16  ? 50.998 92.784  11.417  1.00 37.72 ? 16   VAL B O     1 
ATOM   5706 C  CB    . VAL D 4 16  ? 49.917 89.667  12.254  1.00 35.26 ? 16   VAL B CB    1 
ATOM   5707 C  CG1   . VAL D 4 16  ? 51.318 89.759  12.838  1.00 34.41 ? 16   VAL B CG1   1 
ATOM   5708 C  CG2   . VAL D 4 16  ? 48.981 88.999  13.245  1.00 33.50 ? 16   VAL B CG2   1 
ATOM   5709 N  N     . LEU D 4 17  ? 50.690 91.188  9.855   1.00 38.39 ? 17   LEU B N     1 
ATOM   5710 C  CA    . LEU D 4 17  ? 51.711 91.701  8.949   1.00 40.60 ? 17   LEU B CA    1 
ATOM   5711 C  C     . LEU D 4 17  ? 51.452 93.068  8.315   1.00 43.88 ? 17   LEU B C     1 
ATOM   5712 O  O     . LEU D 4 17  ? 52.396 93.811  8.045   1.00 45.33 ? 17   LEU B O     1 
ATOM   5713 C  CB    . LEU D 4 17  ? 51.986 90.663  7.854   1.00 39.14 ? 17   LEU B CB    1 
ATOM   5714 C  CG    . LEU D 4 17  ? 52.227 89.244  8.397   1.00 38.77 ? 17   LEU B CG    1 
ATOM   5715 C  CD1   . LEU D 4 17  ? 52.527 88.289  7.249   1.00 35.00 ? 17   LEU B CD1   1 
ATOM   5716 C  CD2   . LEU D 4 17  ? 53.385 89.262  9.417   1.00 36.30 ? 17   LEU B CD2   1 
ATOM   5717 N  N     . LYS D 4 18  ? 50.191 93.408  8.074   1.00 45.72 ? 18   LYS B N     1 
ATOM   5718 C  CA    . LYS D 4 18  ? 49.883 94.697  7.468   1.00 48.15 ? 18   LYS B CA    1 
ATOM   5719 C  C     . LYS D 4 18  ? 49.379 95.688  8.509   1.00 48.93 ? 18   LYS B C     1 
ATOM   5720 O  O     . LYS D 4 18  ? 49.016 96.814  8.179   1.00 50.06 ? 18   LYS B O     1 
ATOM   5721 C  CB    . LYS D 4 18  ? 48.830 94.530  6.363   1.00 47.88 ? 18   LYS B CB    1 
ATOM   5722 C  CG    . LYS D 4 18  ? 49.256 93.620  5.224   1.00 50.04 ? 18   LYS B CG    1 
ATOM   5723 C  CD    . LYS D 4 18  ? 48.102 93.347  4.265   1.00 49.94 ? 18   LYS B CD    1 
ATOM   5724 N  N     . ALA D 4 19  ? 49.361 95.273  9.769   1.00 50.27 ? 19   ALA B N     1 
ATOM   5725 C  CA    . ALA D 4 19  ? 48.885 96.145  10.834  1.00 51.05 ? 19   ALA B CA    1 
ATOM   5726 C  C     . ALA D 4 19  ? 49.863 97.265  11.198  1.00 52.00 ? 19   ALA B C     1 
ATOM   5727 O  O     . ALA D 4 19  ? 51.064 97.192  10.912  1.00 51.69 ? 19   ALA B O     1 
ATOM   5728 C  CB    . ALA D 4 19  ? 48.561 95.323  12.074  1.00 50.87 ? 19   ALA B CB    1 
ATOM   5729 N  N     . ASP D 4 20  ? 49.323 98.307  11.824  1.00 52.59 ? 20   ASP B N     1 
ATOM   5730 C  CA    . ASP D 4 20  ? 50.115 99.445  12.264  1.00 53.72 ? 20   ASP B CA    1 
ATOM   5731 C  C     . ASP D 4 20  ? 50.307 99.259  13.759  1.00 53.59 ? 20   ASP B C     1 
ATOM   5732 O  O     . ASP D 4 20  ? 49.358 98.922  14.469  1.00 54.19 ? 20   ASP B O     1 
ATOM   5733 C  CB    . ASP D 4 20  ? 49.371 100.760 11.999  1.00 54.06 ? 20   ASP B CB    1 
ATOM   5734 N  N     . GLY D 4 21  ? 51.530 99.461  14.237  1.00 52.81 ? 21   GLY B N     1 
ATOM   5735 C  CA    . GLY D 4 21  ? 51.786 99.299  15.656  1.00 51.77 ? 21   GLY B CA    1 
ATOM   5736 C  C     . GLY D 4 21  ? 52.341 97.933  16.026  1.00 50.95 ? 21   GLY B C     1 
ATOM   5737 O  O     . GLY D 4 21  ? 52.414 97.017  15.194  1.00 52.46 ? 21   GLY B O     1 
ATOM   5738 N  N     . ALA D 4 22  ? 52.730 97.804  17.291  1.00 48.48 ? 22   ALA B N     1 
ATOM   5739 C  CA    . ALA D 4 22  ? 53.300 96.574  17.815  1.00 45.40 ? 22   ALA B CA    1 
ATOM   5740 C  C     . ALA D 4 22  ? 52.227 95.534  18.097  1.00 43.69 ? 22   ALA B C     1 
ATOM   5741 O  O     . ALA D 4 22  ? 51.203 95.832  18.719  1.00 43.96 ? 22   ALA B O     1 
ATOM   5742 C  CB    . ALA D 4 22  ? 54.083 96.874  19.089  1.00 45.67 ? 22   ALA B CB    1 
ATOM   5743 N  N     . ILE D 4 23  ? 52.472 94.309  17.641  1.00 41.43 ? 23   ILE B N     1 
ATOM   5744 C  CA    . ILE D 4 23  ? 51.528 93.216  17.848  1.00 39.50 ? 23   ILE B CA    1 
ATOM   5745 C  C     . ILE D 4 23  ? 52.217 92.006  18.474  1.00 36.66 ? 23   ILE B C     1 
ATOM   5746 O  O     . ILE D 4 23  ? 53.186 91.479  17.929  1.00 35.44 ? 23   ILE B O     1 
ATOM   5747 C  CB    . ILE D 4 23  ? 50.890 92.760  16.514  1.00 40.35 ? 23   ILE B CB    1 
ATOM   5748 C  CG1   . ILE D 4 23  ? 50.333 93.966  15.755  1.00 41.25 ? 23   ILE B CG1   1 
ATOM   5749 C  CG2   . ILE D 4 23  ? 49.778 91.754  16.789  1.00 41.52 ? 23   ILE B CG2   1 
ATOM   5750 C  CD1   . ILE D 4 23  ? 49.234 94.707  16.500  1.00 43.23 ? 23   ILE B CD1   1 
ATOM   5751 N  N     . LEU D 4 24  ? 51.723 91.571  19.624  1.00 35.67 ? 24   LEU B N     1 
ATOM   5752 C  CA    . LEU D 4 24  ? 52.297 90.401  20.273  1.00 35.00 ? 24   LEU B CA    1 
ATOM   5753 C  C     . LEU D 4 24  ? 51.415 89.191  19.975  1.00 34.67 ? 24   LEU B C     1 
ATOM   5754 O  O     . LEU D 4 24  ? 50.263 89.132  20.417  1.00 34.41 ? 24   LEU B O     1 
ATOM   5755 C  CB    . LEU D 4 24  ? 52.386 90.602  21.785  1.00 34.69 ? 24   LEU B CB    1 
ATOM   5756 C  CG    . LEU D 4 24  ? 53.030 89.419  22.519  1.00 35.52 ? 24   LEU B CG    1 
ATOM   5757 C  CD1   . LEU D 4 24  ? 54.479 89.298  22.093  1.00 35.91 ? 24   LEU B CD1   1 
ATOM   5758 C  CD2   . LEU D 4 24  ? 52.935 89.607  24.025  1.00 35.71 ? 24   LEU B CD2   1 
ATOM   5759 N  N     . VAL D 4 25  ? 51.956 88.236  19.219  1.00 32.96 ? 25   VAL B N     1 
ATOM   5760 C  CA    . VAL D 4 25  ? 51.220 87.025  18.861  1.00 31.34 ? 25   VAL B CA    1 
ATOM   5761 C  C     . VAL D 4 25  ? 51.619 85.833  19.725  1.00 31.28 ? 25   VAL B C     1 
ATOM   5762 O  O     . VAL D 4 25  ? 52.802 85.544  19.889  1.00 30.36 ? 25   VAL B O     1 
ATOM   5763 C  CB    . VAL D 4 25  ? 51.454 86.615  17.385  1.00 30.50 ? 25   VAL B CB    1 
ATOM   5764 C  CG1   . VAL D 4 25  ? 50.713 85.290  17.083  1.00 27.35 ? 25   VAL B CG1   1 
ATOM   5765 C  CG2   . VAL D 4 25  ? 50.977 87.714  16.457  1.00 29.57 ? 25   VAL B CG2   1 
ATOM   5766 N  N     . ASP D 4 26  ? 50.618 85.142  20.262  1.00 29.92 ? 26   ASP B N     1 
ATOM   5767 C  CA    . ASP D 4 26  ? 50.850 83.966  21.084  1.00 29.18 ? 26   ASP B CA    1 
ATOM   5768 C  C     . ASP D 4 26  ? 50.414 82.673  20.368  1.00 28.24 ? 26   ASP B C     1 
ATOM   5769 O  O     . ASP D 4 26  ? 49.225 82.419  20.201  1.00 28.82 ? 26   ASP B O     1 
ATOM   5770 C  CB    . ASP D 4 26  ? 50.100 84.114  22.409  1.00 28.60 ? 26   ASP B CB    1 
ATOM   5771 C  CG    . ASP D 4 26  ? 49.967 82.805  23.154  1.00 30.09 ? 26   ASP B CG    1 
ATOM   5772 O  OD1   . ASP D 4 26  ? 50.967 82.074  23.256  1.00 31.76 ? 26   ASP B OD1   1 
ATOM   5773 O  OD2   . ASP D 4 26  ? 48.860 82.508  23.650  1.00 33.49 ? 26   ASP B OD2   1 
ATOM   5774 N  N     . PHE D 4 27  ? 51.381 81.873  19.929  1.00 28.09 ? 27   PHE B N     1 
ATOM   5775 C  CA    . PHE D 4 27  ? 51.080 80.608  19.271  1.00 29.02 ? 27   PHE B CA    1 
ATOM   5776 C  C     . PHE D 4 27  ? 50.860 79.601  20.393  1.00 29.42 ? 27   PHE B C     1 
ATOM   5777 O  O     . PHE D 4 27  ? 51.764 79.342  21.194  1.00 30.15 ? 27   PHE B O     1 
ATOM   5778 C  CB    . PHE D 4 27  ? 52.236 80.181  18.370  1.00 28.17 ? 27   PHE B CB    1 
ATOM   5779 C  CG    . PHE D 4 27  ? 52.424 81.071  17.177  1.00 30.07 ? 27   PHE B CG    1 
ATOM   5780 C  CD1   . PHE D 4 27  ? 53.265 82.177  17.239  1.00 31.36 ? 27   PHE B CD1   1 
ATOM   5781 C  CD2   . PHE D 4 27  ? 51.740 80.817  15.991  1.00 31.47 ? 27   PHE B CD2   1 
ATOM   5782 C  CE1   . PHE D 4 27  ? 53.426 83.019  16.140  1.00 32.56 ? 27   PHE B CE1   1 
ATOM   5783 C  CE2   . PHE D 4 27  ? 51.890 81.652  14.881  1.00 33.02 ? 27   PHE B CE2   1 
ATOM   5784 C  CZ    . PHE D 4 27  ? 52.736 82.758  14.953  1.00 34.29 ? 27   PHE B CZ    1 
ATOM   5785 N  N     . TRP D 4 28  ? 49.658 79.039  20.450  1.00 28.43 ? 28   TRP B N     1 
ATOM   5786 C  CA    . TRP D 4 28  ? 49.301 78.122  21.524  1.00 29.49 ? 28   TRP B CA    1 
ATOM   5787 C  C     . TRP D 4 28  ? 48.425 76.940  21.114  1.00 30.16 ? 28   TRP B C     1 
ATOM   5788 O  O     . TRP D 4 28  ? 47.866 76.904  20.009  1.00 29.74 ? 28   TRP B O     1 
ATOM   5789 C  CB    . TRP D 4 28  ? 48.560 78.896  22.618  1.00 27.78 ? 28   TRP B CB    1 
ATOM   5790 C  CG    . TRP D 4 28  ? 47.195 79.365  22.183  1.00 26.97 ? 28   TRP B CG    1 
ATOM   5791 C  CD1   . TRP D 4 28  ? 46.915 80.353  21.286  1.00 27.83 ? 28   TRP B CD1   1 
ATOM   5792 C  CD2   . TRP D 4 28  ? 45.927 78.844  22.611  1.00 26.54 ? 28   TRP B CD2   1 
ATOM   5793 N  NE1   . TRP D 4 28  ? 45.555 80.484  21.127  1.00 25.90 ? 28   TRP B NE1   1 
ATOM   5794 C  CE2   . TRP D 4 28  ? 44.925 79.569  21.928  1.00 27.12 ? 28   TRP B CE2   1 
ATOM   5795 C  CE3   . TRP D 4 28  ? 45.542 77.833  23.507  1.00 25.82 ? 28   TRP B CE3   1 
ATOM   5796 C  CZ2   . TRP D 4 28  ? 43.553 79.319  22.111  1.00 28.38 ? 28   TRP B CZ2   1 
ATOM   5797 C  CZ3   . TRP D 4 28  ? 44.184 77.583  23.690  1.00 28.86 ? 28   TRP B CZ3   1 
ATOM   5798 C  CH2   . TRP D 4 28  ? 43.204 78.328  22.991  1.00 28.57 ? 28   TRP B CH2   1 
ATOM   5799 N  N     . ALA D 4 29  ? 48.298 75.991  22.038  1.00 30.38 ? 29   ALA B N     1 
ATOM   5800 C  CA    . ALA D 4 29  ? 47.479 74.797  21.840  1.00 33.44 ? 29   ALA B CA    1 
ATOM   5801 C  C     . ALA D 4 29  ? 46.805 74.472  23.165  1.00 34.00 ? 29   ALA B C     1 
ATOM   5802 O  O     . ALA D 4 29  ? 47.388 74.662  24.232  1.00 36.30 ? 29   ALA B O     1 
ATOM   5803 C  CB    . ALA D 4 29  ? 48.336 73.616  21.369  1.00 31.06 ? 29   ALA B CB    1 
ATOM   5804 N  N     . GLU D 4 30  ? 45.571 73.994  23.091  1.00 35.19 ? 30   GLU B N     1 
ATOM   5805 C  CA    . GLU D 4 30  ? 44.797 73.665  24.279  1.00 35.63 ? 30   GLU B CA    1 
ATOM   5806 C  C     . GLU D 4 30  ? 45.421 72.577  25.145  1.00 36.51 ? 30   GLU B C     1 
ATOM   5807 O  O     . GLU D 4 30  ? 45.199 72.548  26.355  1.00 38.01 ? 30   GLU B O     1 
ATOM   5808 C  CB    . GLU D 4 30  ? 43.382 73.240  23.872  1.00 35.46 ? 30   GLU B CB    1 
ATOM   5809 N  N     . TRP D 4 31  ? 46.204 71.690  24.536  1.00 36.28 ? 31   TRP B N     1 
ATOM   5810 C  CA    . TRP D 4 31  ? 46.823 70.585  25.276  1.00 36.49 ? 31   TRP B CA    1 
ATOM   5811 C  C     . TRP D 4 31  ? 48.186 70.878  25.903  1.00 36.67 ? 31   TRP B C     1 
ATOM   5812 O  O     . TRP D 4 31  ? 48.853 69.972  26.397  1.00 36.76 ? 31   TRP B O     1 
ATOM   5813 C  CB    . TRP D 4 31  ? 46.951 69.361  24.367  1.00 35.81 ? 31   TRP B CB    1 
ATOM   5814 C  CG    . TRP D 4 31  ? 47.376 69.698  22.964  1.00 36.11 ? 31   TRP B CG    1 
ATOM   5815 C  CD1   . TRP D 4 31  ? 46.561 69.852  21.876  1.00 34.41 ? 31   TRP B CD1   1 
ATOM   5816 C  CD2   . TRP D 4 31  ? 48.714 69.923  22.496  1.00 34.53 ? 31   TRP B CD2   1 
ATOM   5817 N  NE1   . TRP D 4 31  ? 47.310 70.154  20.762  1.00 34.93 ? 31   TRP B NE1   1 
ATOM   5818 C  CE2   . TRP D 4 31  ? 48.632 70.203  21.112  1.00 33.56 ? 31   TRP B CE2   1 
ATOM   5819 C  CE3   . TRP D 4 31  ? 49.971 69.915  23.111  1.00 33.86 ? 31   TRP B CE3   1 
ATOM   5820 C  CZ2   . TRP D 4 31  ? 49.759 70.469  20.331  1.00 34.02 ? 31   TRP B CZ2   1 
ATOM   5821 C  CZ3   . TRP D 4 31  ? 51.096 70.182  22.333  1.00 34.37 ? 31   TRP B CZ3   1 
ATOM   5822 C  CH2   . TRP D 4 31  ? 50.980 70.453  20.957  1.00 35.33 ? 31   TRP B CH2   1 
ATOM   5823 N  N     . CYS D 4 32  ? 48.595 72.140  25.888  1.00 36.31 ? 32   CYS B N     1 
ATOM   5824 C  CA    . CYS D 4 32  ? 49.875 72.529  26.449  1.00 34.21 ? 32   CYS B CA    1 
ATOM   5825 C  C     . CYS D 4 32  ? 49.690 73.185  27.819  1.00 35.05 ? 32   CYS B C     1 
ATOM   5826 O  O     . CYS D 4 32  ? 48.969 74.174  27.955  1.00 35.49 ? 32   CYS B O     1 
ATOM   5827 C  CB    . CYS D 4 32  ? 50.574 73.490  25.486  1.00 34.00 ? 32   CYS B CB    1 
ATOM   5828 S  SG    . CYS D 4 32  ? 52.080 74.259  26.115  1.00 32.49 ? 32   CYS B SG    1 
ATOM   5829 N  N     . GLY D 4 33  ? 50.345 72.631  28.835  1.00 36.42 ? 33   GLY B N     1 
ATOM   5830 C  CA    . GLY D 4 33  ? 50.239 73.183  30.177  1.00 36.11 ? 33   GLY B CA    1 
ATOM   5831 C  C     . GLY D 4 33  ? 50.778 74.603  30.271  1.00 36.11 ? 33   GLY B C     1 
ATOM   5832 O  O     . GLY D 4 33  ? 50.099 75.499  30.779  1.00 36.31 ? 33   GLY B O     1 
ATOM   5833 N  N     . PRO D 4 34  ? 52.008 74.841  29.797  1.00 36.72 ? 34   PRO B N     1 
ATOM   5834 C  CA    . PRO D 4 34  ? 52.600 76.183  29.849  1.00 36.47 ? 34   PRO B CA    1 
ATOM   5835 C  C     . PRO D 4 34  ? 51.721 77.249  29.169  1.00 37.51 ? 34   PRO B C     1 
ATOM   5836 O  O     . PRO D 4 34  ? 51.626 78.386  29.646  1.00 38.00 ? 34   PRO B O     1 
ATOM   5837 C  CB    . PRO D 4 34  ? 53.945 75.990  29.148  1.00 36.41 ? 34   PRO B CB    1 
ATOM   5838 C  CG    . PRO D 4 34  ? 54.296 74.565  29.488  1.00 35.19 ? 34   PRO B CG    1 
ATOM   5839 C  CD    . PRO D 4 34  ? 52.978 73.848  29.297  1.00 36.05 ? 34   PRO B CD    1 
ATOM   5840 N  N     . CYS D 4 35  ? 51.084 76.883  28.061  1.00 37.50 ? 35   CYS B N     1 
ATOM   5841 C  CA    . CYS D 4 35  ? 50.207 77.812  27.346  1.00 37.70 ? 35   CYS B CA    1 
ATOM   5842 C  C     . CYS D 4 35  ? 49.066 78.256  28.250  1.00 39.34 ? 35   CYS B C     1 
ATOM   5843 O  O     . CYS D 4 35  ? 48.684 79.427  28.254  1.00 39.93 ? 35   CYS B O     1 
ATOM   5844 C  CB    . CYS D 4 35  ? 49.614 77.154  26.095  1.00 37.39 ? 35   CYS B CB    1 
ATOM   5845 S  SG    . CYS D 4 35  ? 50.747 76.950  24.711  1.00 35.35 ? 35   CYS B SG    1 
ATOM   5846 N  N     . LYS D 4 36  ? 48.515 77.316  29.014  1.00 40.63 ? 36   LYS B N     1 
ATOM   5847 C  CA    . LYS D 4 36  ? 47.419 77.638  29.915  1.00 42.07 ? 36   LYS B CA    1 
ATOM   5848 C  C     . LYS D 4 36  ? 47.918 78.513  31.055  1.00 42.30 ? 36   LYS B C     1 
ATOM   5849 O  O     . LYS D 4 36  ? 47.150 79.272  31.648  1.00 41.52 ? 36   LYS B O     1 
ATOM   5850 C  CB    . LYS D 4 36  ? 46.781 76.360  30.464  1.00 43.80 ? 36   LYS B CB    1 
ATOM   5851 C  CG    . LYS D 4 36  ? 46.125 75.507  29.391  1.00 46.15 ? 36   LYS B CG    1 
ATOM   5852 C  CD    . LYS D 4 36  ? 45.435 74.281  29.977  1.00 48.58 ? 36   LYS B CD    1 
ATOM   5853 N  N     . MET D 4 37  ? 49.212 78.420  31.344  1.00 43.22 ? 37   MET B N     1 
ATOM   5854 C  CA    . MET D 4 37  ? 49.812 79.219  32.404  1.00 43.36 ? 37   MET B CA    1 
ATOM   5855 C  C     . MET D 4 37  ? 49.949 80.690  32.015  1.00 43.38 ? 37   MET B C     1 
ATOM   5856 O  O     . MET D 4 37  ? 49.661 81.578  32.819  1.00 43.47 ? 37   MET B O     1 
ATOM   5857 C  CB    . MET D 4 37  ? 51.196 78.686  32.764  1.00 44.15 ? 37   MET B CB    1 
ATOM   5858 C  CG    . MET D 4 37  ? 51.211 77.396  33.551  1.00 44.82 ? 37   MET B CG    1 
ATOM   5859 S  SD    . MET D 4 37  ? 52.924 76.881  33.798  1.00 47.48 ? 37   MET B SD    1 
ATOM   5860 C  CE    . MET D 4 37  ? 53.457 78.048  35.067  1.00 47.83 ? 37   MET B CE    1 
ATOM   5861 N  N     . ILE D 4 38  ? 50.393 80.954  30.790  1.00 42.77 ? 38   ILE B N     1 
ATOM   5862 C  CA    . ILE D 4 38  ? 50.571 82.334  30.360  1.00 43.05 ? 38   ILE B CA    1 
ATOM   5863 C  C     . ILE D 4 38  ? 49.277 83.004  29.896  1.00 42.81 ? 38   ILE B C     1 
ATOM   5864 O  O     . ILE D 4 38  ? 49.195 84.229  29.843  1.00 43.33 ? 38   ILE B O     1 
ATOM   5865 C  CB    . ILE D 4 38  ? 51.621 82.441  29.232  1.00 43.29 ? 38   ILE B CB    1 
ATOM   5866 C  CG1   . ILE D 4 38  ? 52.057 83.900  29.077  1.00 43.09 ? 38   ILE B CG1   1 
ATOM   5867 C  CG2   . ILE D 4 38  ? 51.038 81.934  27.912  1.00 43.91 ? 38   ILE B CG2   1 
ATOM   5868 C  CD1   . ILE D 4 38  ? 53.214 84.098  28.119  1.00 43.35 ? 38   ILE B CD1   1 
ATOM   5869 N  N     . ALA D 4 39  ? 48.267 82.204  29.571  1.00 42.87 ? 39   ALA B N     1 
ATOM   5870 C  CA    . ALA D 4 39  ? 46.987 82.736  29.103  1.00 42.77 ? 39   ALA B CA    1 
ATOM   5871 C  C     . ALA D 4 39  ? 46.453 83.871  29.986  1.00 42.80 ? 39   ALA B C     1 
ATOM   5872 O  O     . ALA D 4 39  ? 46.171 84.968  29.491  1.00 41.66 ? 39   ALA B O     1 
ATOM   5873 C  CB    . ALA D 4 39  ? 45.951 81.607  29.002  1.00 41.47 ? 39   ALA B CB    1 
ATOM   5874 N  N     . PRO D 4 40  ? 46.291 83.619  31.300  1.00 43.71 ? 40   PRO B N     1 
ATOM   5875 C  CA    . PRO D 4 40  ? 45.787 84.667  32.198  1.00 43.89 ? 40   PRO B CA    1 
ATOM   5876 C  C     . PRO D 4 40  ? 46.675 85.905  32.151  1.00 43.97 ? 40   PRO B C     1 
ATOM   5877 O  O     . PRO D 4 40  ? 46.189 87.035  32.125  1.00 44.69 ? 40   PRO B O     1 
ATOM   5878 C  CB    . PRO D 4 40  ? 45.814 83.989  33.567  1.00 44.39 ? 40   PRO B CB    1 
ATOM   5879 C  CG    . PRO D 4 40  ? 45.536 82.550  33.226  1.00 45.13 ? 40   PRO B CG    1 
ATOM   5880 C  CD    . PRO D 4 40  ? 46.428 82.338  32.021  1.00 43.55 ? 40   PRO B CD    1 
ATOM   5881 N  N     . ILE D 4 41  ? 47.984 85.678  32.130  1.00 44.20 ? 41   ILE B N     1 
ATOM   5882 C  CA    . ILE D 4 41  ? 48.951 86.762  32.086  1.00 43.93 ? 41   ILE B CA    1 
ATOM   5883 C  C     . ILE D 4 41  ? 48.686 87.657  30.879  1.00 44.87 ? 41   ILE B C     1 
ATOM   5884 O  O     . ILE D 4 41  ? 48.701 88.883  30.993  1.00 45.38 ? 41   ILE B O     1 
ATOM   5885 C  CB    . ILE D 4 41  ? 50.403 86.210  32.033  1.00 43.51 ? 41   ILE B CB    1 
ATOM   5886 C  CG1   . ILE D 4 41  ? 50.814 85.654  33.401  1.00 44.50 ? 41   ILE B CG1   1 
ATOM   5887 C  CG2   . ILE D 4 41  ? 51.373 87.307  31.660  1.00 45.27 ? 41   ILE B CG2   1 
ATOM   5888 C  CD1   . ILE D 4 41  ? 49.990 84.479  33.885  1.00 44.73 ? 41   ILE B CD1   1 
ATOM   5889 N  N     . LEU D 4 42  ? 48.429 87.047  29.726  1.00 45.55 ? 42   LEU B N     1 
ATOM   5890 C  CA    . LEU D 4 42  ? 48.165 87.815  28.515  1.00 46.29 ? 42   LEU B CA    1 
ATOM   5891 C  C     . LEU D 4 42  ? 46.910 88.674  28.622  1.00 46.52 ? 42   LEU B C     1 
ATOM   5892 O  O     . LEU D 4 42  ? 46.885 89.791  28.116  1.00 45.99 ? 42   LEU B O     1 
ATOM   5893 C  CB    . LEU D 4 42  ? 48.059 86.887  27.302  1.00 44.80 ? 42   LEU B CB    1 
ATOM   5894 C  CG    . LEU D 4 42  ? 49.389 86.365  26.752  1.00 43.79 ? 42   LEU B CG    1 
ATOM   5895 C  CD1   . LEU D 4 42  ? 49.125 85.487  25.538  1.00 42.58 ? 42   LEU B CD1   1 
ATOM   5896 C  CD2   . LEU D 4 42  ? 50.290 87.536  26.374  1.00 41.90 ? 42   LEU B CD2   1 
ATOM   5897 N  N     . ASP D 4 43  ? 45.872 88.154  29.275  1.00 48.53 ? 43   ASP B N     1 
ATOM   5898 C  CA    . ASP D 4 43  ? 44.634 88.913  29.446  1.00 50.38 ? 43   ASP B CA    1 
ATOM   5899 C  C     . ASP D 4 43  ? 44.947 90.234  30.144  1.00 51.67 ? 43   ASP B C     1 
ATOM   5900 O  O     . ASP D 4 43  ? 44.511 91.297  29.697  1.00 52.23 ? 43   ASP B O     1 
ATOM   5901 C  CB    . ASP D 4 43  ? 43.612 88.136  30.290  1.00 50.98 ? 43   ASP B CB    1 
ATOM   5902 C  CG    . ASP D 4 43  ? 43.031 86.936  29.563  1.00 51.86 ? 43   ASP B CG    1 
ATOM   5903 O  OD1   . ASP D 4 43  ? 42.595 87.091  28.400  1.00 53.18 ? 43   ASP B OD1   1 
ATOM   5904 O  OD2   . ASP D 4 43  ? 42.993 85.837  30.159  1.00 53.50 ? 43   ASP B OD2   1 
ATOM   5905 N  N     . GLU D 4 44  ? 45.704 90.157  31.239  1.00 52.00 ? 44   GLU B N     1 
ATOM   5906 C  CA    . GLU D 4 44  ? 46.083 91.339  32.007  1.00 52.91 ? 44   GLU B CA    1 
ATOM   5907 C  C     . GLU D 4 44  ? 47.007 92.255  31.218  1.00 52.75 ? 44   GLU B C     1 
ATOM   5908 O  O     . GLU D 4 44  ? 46.993 93.467  31.402  1.00 53.39 ? 44   GLU B O     1 
ATOM   5909 C  CB    . GLU D 4 44  ? 46.761 90.928  33.322  1.00 54.34 ? 44   GLU B CB    1 
ATOM   5910 C  CG    . GLU D 4 44  ? 45.812 90.320  34.349  1.00 56.31 ? 44   GLU B CG    1 
ATOM   5911 C  CD    . GLU D 4 44  ? 46.524 89.829  35.603  1.00 58.53 ? 44   GLU B CD    1 
ATOM   5912 O  OE1   . GLU D 4 44  ? 47.274 88.831  35.516  1.00 58.75 ? 44   GLU B OE1   1 
ATOM   5913 O  OE2   . GLU D 4 44  ? 46.336 90.444  36.677  1.00 59.79 ? 44   GLU B OE2   1 
ATOM   5914 N  N     . ILE D 4 45  ? 47.819 91.678  30.341  1.00 53.02 ? 45   ILE B N     1 
ATOM   5915 C  CA    . ILE D 4 45  ? 48.728 92.481  29.536  1.00 52.82 ? 45   ILE B CA    1 
ATOM   5916 C  C     . ILE D 4 45  ? 47.961 93.274  28.488  1.00 53.28 ? 45   ILE B C     1 
ATOM   5917 O  O     . ILE D 4 45  ? 48.340 94.396  28.157  1.00 53.35 ? 45   ILE B O     1 
ATOM   5918 C  CB    . ILE D 4 45  ? 49.787 91.601  28.840  1.00 52.69 ? 45   ILE B CB    1 
ATOM   5919 C  CG1   . ILE D 4 45  ? 50.784 91.086  29.881  1.00 53.33 ? 45   ILE B CG1   1 
ATOM   5920 C  CG2   . ILE D 4 45  ? 50.507 92.389  27.755  1.00 51.68 ? 45   ILE B CG2   1 
ATOM   5921 C  CD1   . ILE D 4 45  ? 51.545 92.189  30.605  1.00 52.33 ? 45   ILE B CD1   1 
ATOM   5922 N  N     . ALA D 4 46  ? 46.883 92.692  27.968  1.00 53.65 ? 46   ALA B N     1 
ATOM   5923 C  CA    . ALA D 4 46  ? 46.067 93.368  26.964  1.00 54.40 ? 46   ALA B CA    1 
ATOM   5924 C  C     . ALA D 4 46  ? 45.340 94.558  27.594  1.00 54.74 ? 46   ALA B C     1 
ATOM   5925 O  O     . ALA D 4 46  ? 45.162 95.592  26.951  1.00 54.64 ? 46   ALA B O     1 
ATOM   5926 C  CB    . ALA D 4 46  ? 45.061 92.396  26.356  1.00 54.26 ? 46   ALA B CB    1 
ATOM   5927 N  N     . ASP D 4 47  ? 44.923 94.404  28.849  1.00 55.09 ? 47   ASP B N     1 
ATOM   5928 C  CA    . ASP D 4 47  ? 44.230 95.474  29.568  1.00 56.43 ? 47   ASP B CA    1 
ATOM   5929 C  C     . ASP D 4 47  ? 45.168 96.614  29.956  1.00 56.69 ? 47   ASP B C     1 
ATOM   5930 O  O     . ASP D 4 47  ? 44.728 97.748  30.139  1.00 57.66 ? 47   ASP B O     1 
ATOM   5931 C  CB    . ASP D 4 47  ? 43.574 94.940  30.847  1.00 57.72 ? 47   ASP B CB    1 
ATOM   5932 C  CG    . ASP D 4 47  ? 42.303 94.161  30.577  1.00 59.04 ? 47   ASP B CG    1 
ATOM   5933 O  OD1   . ASP D 4 47  ? 41.432 94.683  29.854  1.00 59.98 ? 47   ASP B OD1   1 
ATOM   5934 O  OD2   . ASP D 4 47  ? 42.165 93.032  31.100  1.00 60.69 ? 47   ASP B OD2   1 
ATOM   5935 N  N     . GLU D 4 48  ? 46.456 96.307  30.091  1.00 56.53 ? 48   GLU B N     1 
ATOM   5936 C  CA    . GLU D 4 48  ? 47.452 97.300  30.484  1.00 56.78 ? 48   GLU B CA    1 
ATOM   5937 C  C     . GLU D 4 48  ? 48.121 98.045  29.339  1.00 56.67 ? 48   GLU B C     1 
ATOM   5938 O  O     . GLU D 4 48  ? 48.304 99.261  29.409  1.00 58.52 ? 48   GLU B O     1 
ATOM   5939 C  CB    . GLU D 4 48  ? 48.557 96.652  31.313  1.00 56.70 ? 48   GLU B CB    1 
ATOM   5940 C  CG    . GLU D 4 48  ? 48.159 96.178  32.684  1.00 57.65 ? 48   GLU B CG    1 
ATOM   5941 C  CD    . GLU D 4 48  ? 49.346 95.619  33.441  1.00 59.37 ? 48   GLU B CD    1 
ATOM   5942 O  OE1   . GLU D 4 48  ? 50.375 96.327  33.540  1.00 59.87 ? 48   GLU B OE1   1 
ATOM   5943 O  OE2   . GLU D 4 48  ? 49.255 94.474  33.935  1.00 60.39 ? 48   GLU B OE2   1 
ATOM   5944 N  N     . TYR D 4 49  ? 48.504 97.319  28.294  1.00 55.50 ? 49   TYR B N     1 
ATOM   5945 C  CA    . TYR D 4 49  ? 49.194 97.933  27.168  1.00 54.56 ? 49   TYR B CA    1 
ATOM   5946 C  C     . TYR D 4 49  ? 48.312 98.454  26.038  1.00 54.00 ? 49   TYR B C     1 
ATOM   5947 O  O     . TYR D 4 49  ? 48.776 98.607  24.906  1.00 54.32 ? 49   TYR B O     1 
ATOM   5948 C  CB    . TYR D 4 49  ? 50.244 96.956  26.617  1.00 54.14 ? 49   TYR B CB    1 
ATOM   5949 C  CG    . TYR D 4 49  ? 51.444 96.780  27.534  1.00 53.58 ? 49   TYR B CG    1 
ATOM   5950 C  CD1   . TYR D 4 49  ? 51.296 96.252  28.819  1.00 53.04 ? 49   TYR B CD1   1 
ATOM   5951 C  CD2   . TYR D 4 49  ? 52.721 97.184  27.131  1.00 53.35 ? 49   TYR B CD2   1 
ATOM   5952 C  CE1   . TYR D 4 49  ? 52.389 96.136  29.685  1.00 52.55 ? 49   TYR B CE1   1 
ATOM   5953 C  CE2   . TYR D 4 49  ? 53.821 97.071  27.986  1.00 52.16 ? 49   TYR B CE2   1 
ATOM   5954 C  CZ    . TYR D 4 49  ? 53.646 96.549  29.262  1.00 52.29 ? 49   TYR B CZ    1 
ATOM   5955 O  OH    . TYR D 4 49  ? 54.719 96.459  30.122  1.00 51.97 ? 49   TYR B OH    1 
ATOM   5956 N  N     . GLN D 4 50  ? 47.052 98.746  26.343  1.00 54.04 ? 50   GLN B N     1 
ATOM   5957 C  CA    . GLN D 4 50  ? 46.139 99.266  25.328  1.00 55.70 ? 50   GLN B CA    1 
ATOM   5958 C  C     . GLN D 4 50  ? 46.681 100.592 24.811  1.00 56.44 ? 50   GLN B C     1 
ATOM   5959 O  O     . GLN D 4 50  ? 47.158 101.421 25.588  1.00 57.07 ? 50   GLN B O     1 
ATOM   5960 C  CB    . GLN D 4 50  ? 44.745 99.509  25.910  1.00 56.28 ? 50   GLN B CB    1 
ATOM   5961 C  CG    . GLN D 4 50  ? 44.232 98.407  26.815  1.00 58.55 ? 50   GLN B CG    1 
ATOM   5962 C  CD    . GLN D 4 50  ? 42.799 98.645  27.259  1.00 59.89 ? 50   GLN B CD    1 
ATOM   5963 O  OE1   . GLN D 4 50  ? 41.859 98.466  26.480  1.00 59.71 ? 50   GLN B OE1   1 
ATOM   5964 N  NE2   . GLN D 4 50  ? 42.626 99.061  28.511  1.00 58.96 ? 50   GLN B NE2   1 
ATOM   5965 N  N     . GLY D 4 51  ? 46.608 100.792 23.501  1.00 56.33 ? 51   GLY B N     1 
ATOM   5966 C  CA    . GLY D 4 51  ? 47.084 102.037 22.929  1.00 56.98 ? 51   GLY B CA    1 
ATOM   5967 C  C     . GLY D 4 51  ? 48.567 102.063 22.620  1.00 57.24 ? 51   GLY B C     1 
ATOM   5968 O  O     . GLY D 4 51  ? 49.060 103.026 22.029  1.00 57.60 ? 51   GLY B O     1 
ATOM   5969 N  N     . LYS D 4 52  ? 49.287 101.022 23.026  1.00 56.96 ? 52   LYS B N     1 
ATOM   5970 C  CA    . LYS D 4 52  ? 50.719 100.950 22.760  1.00 56.30 ? 52   LYS B CA    1 
ATOM   5971 C  C     . LYS D 4 52  ? 51.045 99.636  22.067  1.00 54.90 ? 52   LYS B C     1 
ATOM   5972 O  O     . LYS D 4 52  ? 51.979 99.554  21.266  1.00 54.87 ? 52   LYS B O     1 
ATOM   5973 C  CB    . LYS D 4 52  ? 51.514 101.061 24.064  1.00 58.14 ? 52   LYS B CB    1 
ATOM   5974 C  CG    . LYS D 4 52  ? 51.316 102.379 24.802  1.00 60.34 ? 52   LYS B CG    1 
ATOM   5975 C  CD    . LYS D 4 52  ? 52.177 102.446 26.060  1.00 62.99 ? 52   LYS B CD    1 
ATOM   5976 C  CE    . LYS D 4 52  ? 52.005 103.778 26.785  1.00 64.25 ? 52   LYS B CE    1 
ATOM   5977 N  NZ    . LYS D 4 52  ? 52.789 103.830 28.053  1.00 64.62 ? 52   LYS B NZ    1 
ATOM   5978 N  N     . LEU D 4 53  ? 50.258 98.611  22.374  1.00 53.63 ? 53   LEU B N     1 
ATOM   5979 C  CA    . LEU D 4 53  ? 50.461 97.294  21.787  1.00 51.83 ? 53   LEU B CA    1 
ATOM   5980 C  C     . LEU D 4 53  ? 49.193 96.444  21.817  1.00 50.11 ? 53   LEU B C     1 
ATOM   5981 O  O     . LEU D 4 53  ? 48.372 96.551  22.737  1.00 48.98 ? 53   LEU B O     1 
ATOM   5982 C  CB    . LEU D 4 53  ? 51.597 96.572  22.526  1.00 52.01 ? 53   LEU B CB    1 
ATOM   5983 C  CG    . LEU D 4 53  ? 51.832 95.083  22.251  1.00 51.54 ? 53   LEU B CG    1 
ATOM   5984 C  CD1   . LEU D 4 53  ? 53.298 94.746  22.435  1.00 51.86 ? 53   LEU B CD1   1 
ATOM   5985 C  CD2   . LEU D 4 53  ? 50.970 94.253  23.182  1.00 52.05 ? 53   LEU B CD2   1 
ATOM   5986 N  N     . THR D 4 54  ? 49.041 95.599  20.802  1.00 48.16 ? 54   THR B N     1 
ATOM   5987 C  CA    . THR D 4 54  ? 47.887 94.713  20.711  1.00 46.52 ? 54   THR B CA    1 
ATOM   5988 C  C     . THR D 4 54  ? 48.315 93.260  20.898  1.00 44.57 ? 54   THR B C     1 
ATOM   5989 O  O     . THR D 4 54  ? 49.275 92.805  20.282  1.00 43.36 ? 54   THR B O     1 
ATOM   5990 C  CB    . THR D 4 54  ? 47.181 94.846  19.343  1.00 47.05 ? 54   THR B CB    1 
ATOM   5991 O  OG1   . THR D 4 54  ? 46.628 96.163  19.214  1.00 47.77 ? 54   THR B OG1   1 
ATOM   5992 C  CG2   . THR D 4 54  ? 46.064 93.817  19.217  1.00 47.57 ? 54   THR B CG2   1 
ATOM   5993 N  N     . VAL D 4 55  ? 47.597 92.545  21.757  1.00 43.15 ? 55   VAL B N     1 
ATOM   5994 C  CA    . VAL D 4 55  ? 47.884 91.142  22.018  1.00 42.74 ? 55   VAL B CA    1 
ATOM   5995 C  C     . VAL D 4 55  ? 46.966 90.275  21.151  1.00 42.14 ? 55   VAL B C     1 
ATOM   5996 O  O     . VAL D 4 55  ? 45.751 90.465  21.139  1.00 42.87 ? 55   VAL B O     1 
ATOM   5997 C  CB    . VAL D 4 55  ? 47.676 90.809  23.520  1.00 42.65 ? 55   VAL B CB    1 
ATOM   5998 C  CG1   . VAL D 4 55  ? 47.810 89.315  23.761  1.00 41.92 ? 55   VAL B CG1   1 
ATOM   5999 C  CG2   . VAL D 4 55  ? 48.703 91.564  24.356  1.00 42.05 ? 55   VAL B CG2   1 
ATOM   6000 N  N     . ALA D 4 56  ? 47.559 89.336  20.416  1.00 40.78 ? 56   ALA B N     1 
ATOM   6001 C  CA    . ALA D 4 56  ? 46.806 88.444  19.537  1.00 39.41 ? 56   ALA B CA    1 
ATOM   6002 C  C     . ALA D 4 56  ? 47.194 86.986  19.756  1.00 38.77 ? 56   ALA B C     1 
ATOM   6003 O  O     . ALA D 4 56  ? 48.347 86.672  20.056  1.00 39.58 ? 56   ALA B O     1 
ATOM   6004 C  CB    . ALA D 4 56  ? 47.038 88.821  18.087  1.00 37.22 ? 56   ALA B CB    1 
ATOM   6005 N  N     . LYS D 4 57  ? 46.223 86.099  19.589  1.00 36.57 ? 57   LYS B N     1 
ATOM   6006 C  CA    . LYS D 4 57  ? 46.456 84.682  19.778  1.00 35.68 ? 57   LYS B CA    1 
ATOM   6007 C  C     . LYS D 4 57  ? 46.112 83.842  18.559  1.00 35.21 ? 57   LYS B C     1 
ATOM   6008 O  O     . LYS D 4 57  ? 45.127 84.099  17.856  1.00 35.64 ? 57   LYS B O     1 
ATOM   6009 C  CB    . LYS D 4 57  ? 45.658 84.178  20.979  1.00 35.80 ? 57   LYS B CB    1 
ATOM   6010 C  CG    . LYS D 4 57  ? 46.001 84.904  22.261  1.00 38.72 ? 57   LYS B CG    1 
ATOM   6011 C  CD    . LYS D 4 57  ? 45.827 84.019  23.477  1.00 42.09 ? 57   LYS B CD    1 
ATOM   6012 C  CE    . LYS D 4 57  ? 44.399 83.574  23.663  1.00 43.30 ? 57   LYS B CE    1 
ATOM   6013 N  NZ    . LYS D 4 57  ? 44.292 82.760  24.903  1.00 46.04 ? 57   LYS B NZ    1 
ATOM   6014 N  N     . LEU D 4 58  ? 46.939 82.834  18.318  1.00 32.93 ? 58   LEU B N     1 
ATOM   6015 C  CA    . LEU D 4 58  ? 46.724 81.924  17.212  1.00 31.91 ? 58   LEU B CA    1 
ATOM   6016 C  C     . LEU D 4 58  ? 46.850 80.483  17.710  1.00 30.62 ? 58   LEU B C     1 
ATOM   6017 O  O     . LEU D 4 58  ? 47.943 80.024  18.047  1.00 28.62 ? 58   LEU B O     1 
ATOM   6018 C  CB    . LEU D 4 58  ? 47.741 82.180  16.092  1.00 32.00 ? 58   LEU B CB    1 
ATOM   6019 C  CG    . LEU D 4 58  ? 47.461 81.371  14.813  1.00 34.40 ? 58   LEU B CG    1 
ATOM   6020 C  CD1   . LEU D 4 58  ? 46.381 82.075  13.981  1.00 33.66 ? 58   LEU B CD1   1 
ATOM   6021 C  CD2   . LEU D 4 58  ? 48.730 81.224  13.994  1.00 33.72 ? 58   LEU B CD2   1 
ATOM   6022 N  N     . ASN D 4 59  ? 45.721 79.782  17.776  1.00 30.97 ? 59   ASN B N     1 
ATOM   6023 C  CA    . ASN D 4 59  ? 45.710 78.387  18.204  1.00 31.58 ? 59   ASN B CA    1 
ATOM   6024 C  C     . ASN D 4 59  ? 46.215 77.553  17.034  1.00 31.36 ? 59   ASN B C     1 
ATOM   6025 O  O     . ASN D 4 59  ? 45.558 77.487  16.001  1.00 30.97 ? 59   ASN B O     1 
ATOM   6026 C  CB    . ASN D 4 59  ? 44.294 77.958  18.577  1.00 32.17 ? 59   ASN B CB    1 
ATOM   6027 C  CG    . ASN D 4 59  ? 44.197 76.472  18.862  1.00 34.94 ? 59   ASN B CG    1 
ATOM   6028 O  OD1   . ASN D 4 59  ? 44.406 75.639  17.977  1.00 35.09 ? 59   ASN B OD1   1 
ATOM   6029 N  ND2   . ASN D 4 59  ? 43.886 76.131  20.105  1.00 36.91 ? 59   ASN B ND2   1 
ATOM   6030 N  N     . ILE D 4 60  ? 47.375 76.916  17.196  1.00 31.94 ? 60   ILE B N     1 
ATOM   6031 C  CA    . ILE D 4 60  ? 47.970 76.128  16.113  1.00 33.28 ? 60   ILE B CA    1 
ATOM   6032 C  C     . ILE D 4 60  ? 47.250 74.859  15.649  1.00 33.58 ? 60   ILE B C     1 
ATOM   6033 O  O     . ILE D 4 60  ? 47.646 74.256  14.655  1.00 32.38 ? 60   ILE B O     1 
ATOM   6034 C  CB    . ILE D 4 60  ? 49.431 75.761  16.429  1.00 33.12 ? 60   ILE B CB    1 
ATOM   6035 C  CG1   . ILE D 4 60  ? 49.491 74.863  17.666  1.00 34.16 ? 60   ILE B CG1   1 
ATOM   6036 C  CG2   . ILE D 4 60  ? 50.247 77.042  16.613  1.00 32.72 ? 60   ILE B CG2   1 
ATOM   6037 C  CD1   . ILE D 4 60  ? 50.892 74.503  18.082  1.00 34.80 ? 60   ILE B CD1   1 
ATOM   6038 N  N     . ASP D 4 61  ? 46.206 74.440  16.350  1.00 35.07 ? 61   ASP B N     1 
ATOM   6039 C  CA    . ASP D 4 61  ? 45.479 73.262  15.899  1.00 37.18 ? 61   ASP B CA    1 
ATOM   6040 C  C     . ASP D 4 61  ? 44.354 73.673  14.960  1.00 37.60 ? 61   ASP B C     1 
ATOM   6041 O  O     . ASP D 4 61  ? 44.023 72.950  14.019  1.00 38.11 ? 61   ASP B O     1 
ATOM   6042 C  CB    . ASP D 4 61  ? 44.906 72.473  17.076  1.00 37.90 ? 61   ASP B CB    1 
ATOM   6043 C  CG    . ASP D 4 61  ? 45.954 71.639  17.771  1.00 38.95 ? 61   ASP B CG    1 
ATOM   6044 O  OD1   . ASP D 4 61  ? 46.970 71.305  17.119  1.00 40.30 ? 61   ASP B OD1   1 
ATOM   6045 O  OD2   . ASP D 4 61  ? 45.757 71.306  18.958  1.00 38.72 ? 61   ASP B OD2   1 
ATOM   6046 N  N     . GLN D 4 62  ? 43.773 74.841  15.213  1.00 36.64 ? 62   GLN B N     1 
ATOM   6047 C  CA    . GLN D 4 62  ? 42.691 75.323  14.377  1.00 37.45 ? 62   GLN B CA    1 
ATOM   6048 C  C     . GLN D 4 62  ? 43.240 76.053  13.157  1.00 36.04 ? 62   GLN B C     1 
ATOM   6049 O  O     . GLN D 4 62  ? 42.573 76.132  12.130  1.00 34.76 ? 62   GLN B O     1 
ATOM   6050 C  CB    . GLN D 4 62  ? 41.778 76.255  15.180  1.00 39.64 ? 62   GLN B CB    1 
ATOM   6051 C  CG    . GLN D 4 62  ? 41.225 75.622  16.438  1.00 41.98 ? 62   GLN B CG    1 
ATOM   6052 C  CD    . GLN D 4 62  ? 40.360 76.574  17.225  1.00 45.24 ? 62   GLN B CD    1 
ATOM   6053 O  OE1   . GLN D 4 62  ? 40.725 77.736  17.433  1.00 47.98 ? 62   GLN B OE1   1 
ATOM   6054 N  NE2   . GLN D 4 62  ? 39.207 76.090  17.680  1.00 45.65 ? 62   GLN B NE2   1 
ATOM   6055 N  N     . ASN D 4 63  ? 44.461 76.570  13.284  1.00 34.89 ? 63   ASN B N     1 
ATOM   6056 C  CA    . ASN D 4 63  ? 45.130 77.311  12.218  1.00 34.04 ? 63   ASN B CA    1 
ATOM   6057 C  C     . ASN D 4 63  ? 46.535 76.738  12.089  1.00 34.21 ? 63   ASN B C     1 
ATOM   6058 O  O     . ASN D 4 63  ? 47.481 77.280  12.654  1.00 33.09 ? 63   ASN B O     1 
ATOM   6059 C  CB    . ASN D 4 63  ? 45.217 78.786  12.604  1.00 35.64 ? 63   ASN B CB    1 
ATOM   6060 C  CG    . ASN D 4 63  ? 43.880 79.355  13.014  1.00 34.73 ? 63   ASN B CG    1 
ATOM   6061 O  OD1   . ASN D 4 63  ? 42.996 79.544  12.186  1.00 37.60 ? 63   ASN B OD1   1 
ATOM   6062 N  ND2   . ASN D 4 63  ? 43.720 79.618  14.300  1.00 34.42 ? 63   ASN B ND2   1 
ATOM   6063 N  N     . PRO D 4 64  ? 46.690 75.642  11.326  1.00 34.14 ? 64   PRO B N     1 
ATOM   6064 C  CA    . PRO D 4 64  ? 47.987 74.985  11.141  1.00 35.00 ? 64   PRO B CA    1 
ATOM   6065 C  C     . PRO D 4 64  ? 48.939 75.479  10.060  1.00 34.93 ? 64   PRO B C     1 
ATOM   6066 O  O     . PRO D 4 64  ? 50.046 74.967  9.941   1.00 35.54 ? 64   PRO B O     1 
ATOM   6067 C  CB    . PRO D 4 64  ? 47.588 73.530  10.917  1.00 35.31 ? 64   PRO B CB    1 
ATOM   6068 C  CG    . PRO D 4 64  ? 46.349 73.673  10.083  1.00 35.63 ? 64   PRO B CG    1 
ATOM   6069 C  CD    . PRO D 4 64  ? 45.599 74.825  10.756  1.00 35.46 ? 64   PRO B CD    1 
ATOM   6070 N  N     . GLY D 4 65  ? 48.534 76.471  9.281   1.00 35.60 ? 65   GLY B N     1 
ATOM   6071 C  CA    . GLY D 4 65  ? 49.409 76.933  8.219   1.00 35.50 ? 65   GLY B CA    1 
ATOM   6072 C  C     . GLY D 4 65  ? 50.409 78.019  8.558   1.00 36.05 ? 65   GLY B C     1 
ATOM   6073 O  O     . GLY D 4 65  ? 51.437 78.139  7.895   1.00 36.19 ? 65   GLY B O     1 
ATOM   6074 N  N     . THR D 4 66  ? 50.125 78.800  9.596   1.00 36.14 ? 66   THR B N     1 
ATOM   6075 C  CA    . THR D 4 66  ? 50.997 79.904  9.972   1.00 35.97 ? 66   THR B CA    1 
ATOM   6076 C  C     . THR D 4 66  ? 52.250 79.570  10.784  1.00 34.97 ? 66   THR B C     1 
ATOM   6077 O  O     . THR D 4 66  ? 53.347 79.993  10.426  1.00 34.62 ? 66   THR B O     1 
ATOM   6078 C  CB    . THR D 4 66  ? 50.195 80.970  10.717  1.00 37.11 ? 66   THR B CB    1 
ATOM   6079 O  OG1   . THR D 4 66  ? 48.989 81.235  9.995   1.00 37.32 ? 66   THR B OG1   1 
ATOM   6080 C  CG2   . THR D 4 66  ? 51.000 82.258  10.833  1.00 36.80 ? 66   THR B CG2   1 
ATOM   6081 N  N     . ALA D 4 67  ? 52.091 78.829  11.877  1.00 35.09 ? 67   ALA B N     1 
ATOM   6082 C  CA    . ALA D 4 67  ? 53.229 78.468  12.720  1.00 35.87 ? 67   ALA B CA    1 
ATOM   6083 C  C     . ALA D 4 67  ? 54.441 77.936  11.944  1.00 35.90 ? 67   ALA B C     1 
ATOM   6084 O  O     . ALA D 4 67  ? 55.564 78.397  12.146  1.00 35.66 ? 67   ALA B O     1 
ATOM   6085 C  CB    . ALA D 4 67  ? 52.802 77.444  13.781  1.00 33.57 ? 67   ALA B CB    1 
ATOM   6086 N  N     . PRO D 4 68  ? 54.227 76.966  11.040  1.00 36.41 ? 68   PRO B N     1 
ATOM   6087 C  CA    . PRO D 4 68  ? 55.337 76.399  10.265  1.00 37.89 ? 68   PRO B CA    1 
ATOM   6088 C  C     . PRO D 4 68  ? 56.239 77.444  9.622   1.00 39.46 ? 68   PRO B C     1 
ATOM   6089 O  O     . PRO D 4 68  ? 57.462 77.297  9.608   1.00 40.55 ? 68   PRO B O     1 
ATOM   6090 C  CB    . PRO D 4 68  ? 54.625 75.535  9.228   1.00 37.44 ? 68   PRO B CB    1 
ATOM   6091 C  CG    . PRO D 4 68  ? 53.396 75.084  9.962   1.00 36.53 ? 68   PRO B CG    1 
ATOM   6092 C  CD    . PRO D 4 68  ? 52.945 76.355  10.642  1.00 35.95 ? 68   PRO B CD    1 
ATOM   6093 N  N     . LYS D 4 69  ? 55.626 78.497  9.092   1.00 40.52 ? 69   LYS B N     1 
ATOM   6094 C  CA    . LYS D 4 69  ? 56.356 79.574  8.433   1.00 41.31 ? 69   LYS B CA    1 
ATOM   6095 C  C     . LYS D 4 69  ? 57.344 80.307  9.341   1.00 41.60 ? 69   LYS B C     1 
ATOM   6096 O  O     . LYS D 4 69  ? 58.241 80.997  8.852   1.00 42.04 ? 69   LYS B O     1 
ATOM   6097 C  CB    . LYS D 4 69  ? 55.369 80.593  7.854   1.00 42.16 ? 69   LYS B CB    1 
ATOM   6098 C  CG    . LYS D 4 69  ? 54.504 80.074  6.714   1.00 43.55 ? 69   LYS B CG    1 
ATOM   6099 C  CD    . LYS D 4 69  ? 53.504 81.149  6.283   1.00 44.67 ? 69   LYS B CD    1 
ATOM   6100 C  CE    . LYS D 4 69  ? 52.642 80.696  5.119   1.00 43.59 ? 69   LYS B CE    1 
ATOM   6101 N  NZ    . LYS D 4 69  ? 51.704 81.774  4.713   1.00 44.95 ? 69   LYS B NZ    1 
ATOM   6102 N  N     . TYR D 4 70  ? 57.178 80.170  10.654  1.00 41.73 ? 70   TYR B N     1 
ATOM   6103 C  CA    . TYR D 4 70  ? 58.060 80.838  11.609  1.00 41.76 ? 70   TYR B CA    1 
ATOM   6104 C  C     . TYR D 4 70  ? 58.944 79.888  12.410  1.00 41.26 ? 70   TYR B C     1 
ATOM   6105 O  O     . TYR D 4 70  ? 59.560 80.284  13.398  1.00 41.25 ? 70   TYR B O     1 
ATOM   6106 C  CB    . TYR D 4 70  ? 57.229 81.707  12.555  1.00 42.33 ? 70   TYR B CB    1 
ATOM   6107 C  CG    . TYR D 4 70  ? 56.544 82.858  11.851  1.00 43.03 ? 70   TYR B CG    1 
ATOM   6108 C  CD1   . TYR D 4 70  ? 57.255 84.002  11.490  1.00 42.90 ? 70   TYR B CD1   1 
ATOM   6109 C  CD2   . TYR D 4 70  ? 55.196 82.779  11.495  1.00 42.97 ? 70   TYR B CD2   1 
ATOM   6110 C  CE1   . TYR D 4 70  ? 56.637 85.043  10.785  1.00 44.05 ? 70   TYR B CE1   1 
ATOM   6111 C  CE2   . TYR D 4 70  ? 54.570 83.807  10.792  1.00 42.79 ? 70   TYR B CE2   1 
ATOM   6112 C  CZ    . TYR D 4 70  ? 55.293 84.936  10.439  1.00 43.80 ? 70   TYR B CZ    1 
ATOM   6113 O  OH    . TYR D 4 70  ? 54.678 85.946  9.734   1.00 43.22 ? 70   TYR B OH    1 
ATOM   6114 N  N     . GLY D 4 71  ? 58.997 78.632  11.984  1.00 41.25 ? 71   GLY B N     1 
ATOM   6115 C  CA    . GLY D 4 71  ? 59.832 77.649  12.653  1.00 41.77 ? 71   GLY B CA    1 
ATOM   6116 C  C     . GLY D 4 71  ? 59.565 77.356  14.119  1.00 41.93 ? 71   GLY B C     1 
ATOM   6117 O  O     . GLY D 4 71  ? 60.486 77.043  14.875  1.00 42.81 ? 71   GLY B O     1 
ATOM   6118 N  N     . ILE D 4 72  ? 58.312 77.452  14.535  1.00 40.90 ? 72   ILE B N     1 
ATOM   6119 C  CA    . ILE D 4 72  ? 57.966 77.169  15.917  1.00 40.47 ? 72   ILE B CA    1 
ATOM   6120 C  C     . ILE D 4 72  ? 58.410 75.748  16.283  1.00 39.82 ? 72   ILE B C     1 
ATOM   6121 O  O     . ILE D 4 72  ? 58.144 74.798  15.547  1.00 39.04 ? 72   ILE B O     1 
ATOM   6122 C  CB    . ILE D 4 72  ? 56.437 77.350  16.131  1.00 40.14 ? 72   ILE B CB    1 
ATOM   6123 C  CG1   . ILE D 4 72  ? 56.161 78.794  16.553  1.00 40.66 ? 72   ILE B CG1   1 
ATOM   6124 C  CG2   . ILE D 4 72  ? 55.910 76.388  17.173  1.00 41.15 ? 72   ILE B CG2   1 
ATOM   6125 C  CD1   . ILE D 4 72  ? 56.743 79.827  15.606  1.00 38.77 ? 72   ILE B CD1   1 
ATOM   6126 N  N     . ARG D 4 73  ? 59.107 75.620  17.412  1.00 38.28 ? 73   ARG B N     1 
ATOM   6127 C  CA    . ARG D 4 73  ? 59.589 74.322  17.890  1.00 37.46 ? 73   ARG B CA    1 
ATOM   6128 C  C     . ARG D 4 73  ? 59.115 74.085  19.325  1.00 36.62 ? 73   ARG B C     1 
ATOM   6129 O  O     . ARG D 4 73  ? 59.332 73.015  19.901  1.00 36.37 ? 73   ARG B O     1 
ATOM   6130 C  CB    . ARG D 4 73  ? 61.120 74.263  17.823  1.00 36.52 ? 73   ARG B CB    1 
ATOM   6131 N  N     . GLY D 4 74  ? 58.458 75.095  19.892  1.00 37.07 ? 74   GLY B N     1 
ATOM   6132 C  CA    . GLY D 4 74  ? 57.945 74.987  21.248  1.00 35.97 ? 74   GLY B CA    1 
ATOM   6133 C  C     . GLY D 4 74  ? 56.820 75.968  21.513  1.00 35.81 ? 74   GLY B C     1 
ATOM   6134 O  O     . GLY D 4 74  ? 56.699 76.987  20.839  1.00 33.96 ? 74   GLY B O     1 
ATOM   6135 N  N     . ILE D 4 75  ? 55.974 75.661  22.487  1.00 35.79 ? 75   ILE B N     1 
ATOM   6136 C  CA    . ILE D 4 75  ? 54.880 76.557  22.813  1.00 35.32 ? 75   ILE B CA    1 
ATOM   6137 C  C     . ILE D 4 75  ? 54.743 76.668  24.325  1.00 36.22 ? 75   ILE B C     1 
ATOM   6138 O  O     . ILE D 4 75  ? 55.143 75.764  25.059  1.00 36.83 ? 75   ILE B O     1 
ATOM   6139 C  CB    . ILE D 4 75  ? 53.539 76.075  22.212  1.00 35.27 ? 75   ILE B CB    1 
ATOM   6140 C  CG1   . ILE D 4 75  ? 53.223 74.664  22.701  1.00 35.23 ? 75   ILE B CG1   1 
ATOM   6141 C  CG2   . ILE D 4 75  ? 53.591 76.152  20.681  1.00 33.77 ? 75   ILE B CG2   1 
ATOM   6142 C  CD1   . ILE D 4 75  ? 51.913 74.126  22.168  1.00 37.16 ? 75   ILE B CD1   1 
ATOM   6143 N  N     . PRO D 4 76  ? 54.180 77.786  24.808  1.00 35.67 ? 76   PRO B N     1 
ATOM   6144 C  CA    . PRO D 4 76  ? 53.704 78.875  23.950  1.00 36.03 ? 76   PRO B CA    1 
ATOM   6145 C  C     . PRO D 4 76  ? 54.845 79.695  23.370  1.00 36.39 ? 76   PRO B C     1 
ATOM   6146 O  O     . PRO D 4 76  ? 55.865 79.900  24.030  1.00 38.73 ? 76   PRO B O     1 
ATOM   6147 C  CB    . PRO D 4 76  ? 52.836 79.700  24.898  1.00 36.43 ? 76   PRO B CB    1 
ATOM   6148 C  CG    . PRO D 4 76  ? 53.583 79.581  26.188  1.00 34.54 ? 76   PRO B CG    1 
ATOM   6149 C  CD    . PRO D 4 76  ? 53.956 78.104  26.231  1.00 34.94 ? 76   PRO B CD    1 
ATOM   6150 N  N     . THR D 4 77  ? 54.679 80.150  22.132  1.00 35.92 ? 77   THR B N     1 
ATOM   6151 C  CA    . THR D 4 77  ? 55.683 80.989  21.492  1.00 35.13 ? 77   THR B CA    1 
ATOM   6152 C  C     . THR D 4 77  ? 55.113 82.388  21.316  1.00 35.38 ? 77   THR B C     1 
ATOM   6153 O  O     . THR D 4 77  ? 53.998 82.560  20.822  1.00 34.84 ? 77   THR B O     1 
ATOM   6154 C  CB    . THR D 4 77  ? 56.086 80.474  20.110  1.00 36.19 ? 77   THR B CB    1 
ATOM   6155 O  OG1   . THR D 4 77  ? 56.722 79.202  20.238  1.00 37.76 ? 77   THR B OG1   1 
ATOM   6156 C  CG2   . THR D 4 77  ? 57.059 81.445  19.453  1.00 36.04 ? 77   THR B CG2   1 
ATOM   6157 N  N     . LEU D 4 78  ? 55.889 83.387  21.715  1.00 36.26 ? 78   LEU B N     1 
ATOM   6158 C  CA    . LEU D 4 78  ? 55.454 84.766  21.610  1.00 36.48 ? 78   LEU B CA    1 
ATOM   6159 C  C     . LEU D 4 78  ? 56.273 85.517  20.576  1.00 35.58 ? 78   LEU B C     1 
ATOM   6160 O  O     . LEU D 4 78  ? 57.491 85.592  20.675  1.00 35.13 ? 78   LEU B O     1 
ATOM   6161 C  CB    . LEU D 4 78  ? 55.584 85.456  22.967  1.00 37.33 ? 78   LEU B CB    1 
ATOM   6162 C  CG    . LEU D 4 78  ? 54.914 84.770  24.159  1.00 38.97 ? 78   LEU B CG    1 
ATOM   6163 C  CD1   . LEU D 4 78  ? 55.145 85.608  25.413  1.00 39.19 ? 78   LEU B CD1   1 
ATOM   6164 C  CD2   . LEU D 4 78  ? 53.422 84.592  23.898  1.00 39.77 ? 78   LEU B CD2   1 
ATOM   6165 N  N     . LEU D 4 79  ? 55.596 86.060  19.574  1.00 35.97 ? 79   LEU B N     1 
ATOM   6166 C  CA    . LEU D 4 79  ? 56.266 86.829  18.537  1.00 36.74 ? 79   LEU B CA    1 
ATOM   6167 C  C     . LEU D 4 79  ? 55.758 88.268  18.573  1.00 37.85 ? 79   LEU B C     1 
ATOM   6168 O  O     . LEU D 4 79  ? 54.551 88.521  18.512  1.00 36.64 ? 79   LEU B O     1 
ATOM   6169 C  CB    . LEU D 4 79  ? 56.005 86.217  17.158  1.00 36.69 ? 79   LEU B CB    1 
ATOM   6170 C  CG    . LEU D 4 79  ? 57.058 85.246  16.616  1.00 37.99 ? 79   LEU B CG    1 
ATOM   6171 C  CD1   . LEU D 4 79  ? 57.425 84.238  17.678  1.00 38.16 ? 79   LEU B CD1   1 
ATOM   6172 C  CD2   . LEU D 4 79  ? 56.527 84.555  15.371  1.00 36.65 ? 79   LEU B CD2   1 
ATOM   6173 N  N     . LEU D 4 80  ? 56.687 89.208  18.703  1.00 39.67 ? 80   LEU B N     1 
ATOM   6174 C  CA    . LEU D 4 80  ? 56.345 90.624  18.732  1.00 39.94 ? 80   LEU B CA    1 
ATOM   6175 C  C     . LEU D 4 80  ? 56.612 91.128  17.320  1.00 40.44 ? 80   LEU B C     1 
ATOM   6176 O  O     . LEU D 4 80  ? 57.760 91.134  16.876  1.00 40.70 ? 80   LEU B O     1 
ATOM   6177 C  CB    . LEU D 4 80  ? 57.240 91.366  19.726  1.00 39.90 ? 80   LEU B CB    1 
ATOM   6178 C  CG    . LEU D 4 80  ? 56.689 92.629  20.393  1.00 41.02 ? 80   LEU B CG    1 
ATOM   6179 C  CD1   . LEU D 4 80  ? 57.831 93.362  21.080  1.00 41.01 ? 80   LEU B CD1   1 
ATOM   6180 C  CD2   . LEU D 4 80  ? 56.035 93.529  19.375  1.00 42.43 ? 80   LEU B CD2   1 
ATOM   6181 N  N     . PHE D 4 81  ? 55.555 91.526  16.614  1.00 40.40 ? 81   PHE B N     1 
ATOM   6182 C  CA    . PHE D 4 81  ? 55.690 92.018  15.245  1.00 41.71 ? 81   PHE B CA    1 
ATOM   6183 C  C     . PHE D 4 81  ? 55.653 93.540  15.157  1.00 42.63 ? 81   PHE B C     1 
ATOM   6184 O  O     . PHE D 4 81  ? 54.876 94.193  15.850  1.00 44.12 ? 81   PHE B O     1 
ATOM   6185 C  CB    . PHE D 4 81  ? 54.571 91.477  14.345  1.00 39.29 ? 81   PHE B CB    1 
ATOM   6186 C  CG    . PHE D 4 81  ? 54.686 90.016  14.022  1.00 38.22 ? 81   PHE B CG    1 
ATOM   6187 C  CD1   . PHE D 4 81  ? 54.191 89.050  14.894  1.00 37.75 ? 81   PHE B CD1   1 
ATOM   6188 C  CD2   . PHE D 4 81  ? 55.252 89.605  12.821  1.00 36.65 ? 81   PHE B CD2   1 
ATOM   6189 C  CE1   . PHE D 4 81  ? 54.255 87.697  14.567  1.00 36.92 ? 81   PHE B CE1   1 
ATOM   6190 C  CE2   . PHE D 4 81  ? 55.320 88.256  12.490  1.00 37.00 ? 81   PHE B CE2   1 
ATOM   6191 C  CZ    . PHE D 4 81  ? 54.819 87.301  13.364  1.00 35.60 ? 81   PHE B CZ    1 
ATOM   6192 N  N     . LYS D 4 82  ? 56.489 94.092  14.287  1.00 43.19 ? 82   LYS B N     1 
ATOM   6193 C  CA    . LYS D 4 82  ? 56.541 95.530  14.065  1.00 46.44 ? 82   LYS B CA    1 
ATOM   6194 C  C     . LYS D 4 82  ? 56.641 95.720  12.556  1.00 47.72 ? 82   LYS B C     1 
ATOM   6195 O  O     . LYS D 4 82  ? 57.578 95.230  11.919  1.00 48.18 ? 82   LYS B O     1 
ATOM   6196 C  CB    . LYS D 4 82  ? 57.760 96.147  14.764  1.00 46.63 ? 82   LYS B CB    1 
ATOM   6197 N  N     . ASN D 4 83  ? 55.657 96.408  11.986  1.00 50.48 ? 83   ASN B N     1 
ATOM   6198 C  CA    . ASN D 4 83  ? 55.609 96.653  10.545  1.00 51.90 ? 83   ASN B CA    1 
ATOM   6199 C  C     . ASN D 4 83  ? 55.834 95.418  9.673   1.00 52.09 ? 83   ASN B C     1 
ATOM   6200 O  O     . ASN D 4 83  ? 56.682 95.423  8.776   1.00 51.78 ? 83   ASN B O     1 
ATOM   6201 C  CB    . ASN D 4 83  ? 56.605 97.747  10.151  1.00 53.40 ? 83   ASN B CB    1 
ATOM   6202 C  CG    . ASN D 4 83  ? 56.085 99.141  10.460  1.00 56.24 ? 83   ASN B CG    1 
ATOM   6203 O  OD1   . ASN D 4 83  ? 55.963 99.531  11.627  1.00 56.96 ? 83   ASN B OD1   1 
ATOM   6204 N  ND2   . ASN D 4 83  ? 55.761 99.898  9.412   1.00 56.60 ? 83   ASN B ND2   1 
ATOM   6205 N  N     . GLY D 4 84  ? 55.069 94.364  9.949   1.00 52.55 ? 84   GLY B N     1 
ATOM   6206 C  CA    . GLY D 4 84  ? 55.151 93.143  9.166   1.00 52.64 ? 84   GLY B CA    1 
ATOM   6207 C  C     . GLY D 4 84  ? 56.356 92.243  9.346   1.00 53.07 ? 84   GLY B C     1 
ATOM   6208 O  O     . GLY D 4 84  ? 56.580 91.341  8.534   1.00 53.37 ? 84   GLY B O     1 
ATOM   6209 N  N     . GLU D 4 85  ? 57.142 92.471  10.392  1.00 53.59 ? 85   GLU B N     1 
ATOM   6210 C  CA    . GLU D 4 85  ? 58.309 91.632  10.632  1.00 52.88 ? 85   GLU B CA    1 
ATOM   6211 C  C     . GLU D 4 85  ? 58.493 91.315  12.110  1.00 51.23 ? 85   GLU B C     1 
ATOM   6212 O  O     . GLU D 4 85  ? 58.078 92.085  12.980  1.00 49.54 ? 85   GLU B O     1 
ATOM   6213 C  CB    . GLU D 4 85  ? 59.567 92.299  10.074  1.00 55.31 ? 85   GLU B CB    1 
ATOM   6214 C  CG    . GLU D 4 85  ? 59.508 92.521  8.566   1.00 58.77 ? 85   GLU B CG    1 
ATOM   6215 C  CD    . GLU D 4 85  ? 60.880 92.584  7.925   1.00 60.99 ? 85   GLU B CD    1 
ATOM   6216 O  OE1   . GLU D 4 85  ? 61.689 93.455  8.319   1.00 62.17 ? 85   GLU B OE1   1 
ATOM   6217 O  OE2   . GLU D 4 85  ? 61.149 91.757  7.025   1.00 60.98 ? 85   GLU B OE2   1 
ATOM   6218 N  N     . VAL D 4 86  ? 59.099 90.166  12.388  1.00 50.12 ? 86   VAL B N     1 
ATOM   6219 C  CA    . VAL D 4 86  ? 59.332 89.759  13.765  1.00 49.41 ? 86   VAL B CA    1 
ATOM   6220 C  C     . VAL D 4 86  ? 60.473 90.563  14.369  1.00 49.20 ? 86   VAL B C     1 
ATOM   6221 O  O     . VAL D 4 86  ? 61.616 90.468  13.923  1.00 49.17 ? 86   VAL B O     1 
ATOM   6222 C  CB    . VAL D 4 86  ? 59.678 88.263  13.863  1.00 48.42 ? 86   VAL B CB    1 
ATOM   6223 C  CG1   . VAL D 4 86  ? 60.053 87.910  15.297  1.00 47.16 ? 86   VAL B CG1   1 
ATOM   6224 C  CG2   . VAL D 4 86  ? 58.490 87.428  13.414  1.00 47.81 ? 86   VAL B CG2   1 
ATOM   6225 N  N     . ALA D 4 87  ? 60.153 91.361  15.380  1.00 48.65 ? 87   ALA B N     1 
ATOM   6226 C  CA    . ALA D 4 87  ? 61.150 92.181  16.056  1.00 49.29 ? 87   ALA B CA    1 
ATOM   6227 C  C     . ALA D 4 87  ? 61.854 91.368  17.137  1.00 49.44 ? 87   ALA B C     1 
ATOM   6228 O  O     . ALA D 4 87  ? 63.080 91.381  17.237  1.00 49.76 ? 87   ALA B O     1 
ATOM   6229 C  CB    . ALA D 4 87  ? 60.486 93.406  16.676  1.00 47.98 ? 87   ALA B CB    1 
ATOM   6230 N  N     . ALA D 4 88  ? 61.067 90.663  17.946  1.00 49.65 ? 88   ALA B N     1 
ATOM   6231 C  CA    . ALA D 4 88  ? 61.604 89.847  19.027  1.00 48.36 ? 88   ALA B CA    1 
ATOM   6232 C  C     . ALA D 4 88  ? 60.796 88.571  19.199  1.00 47.91 ? 88   ALA B C     1 
ATOM   6233 O  O     . ALA D 4 88  ? 59.639 88.493  18.781  1.00 47.77 ? 88   ALA B O     1 
ATOM   6234 C  CB    . ALA D 4 88  ? 61.601 90.635  20.322  1.00 46.76 ? 88   ALA B CB    1 
ATOM   6235 N  N     . THR D 4 89  ? 61.411 87.576  19.831  1.00 47.75 ? 89   THR B N     1 
ATOM   6236 C  CA    . THR D 4 89  ? 60.759 86.295  20.056  1.00 46.84 ? 89   THR B CA    1 
ATOM   6237 C  C     . THR D 4 89  ? 61.221 85.578  21.321  1.00 46.77 ? 89   THR B C     1 
ATOM   6238 O  O     . THR D 4 89  ? 62.419 85.420  21.566  1.00 46.94 ? 89   THR B O     1 
ATOM   6239 C  CB    . THR D 4 89  ? 60.968 85.352  18.853  1.00 46.67 ? 89   THR B CB    1 
ATOM   6240 O  OG1   . THR D 4 89  ? 60.951 83.991  19.303  1.00 46.92 ? 89   THR B OG1   1 
ATOM   6241 C  CG2   . THR D 4 89  ? 62.289 85.652  18.154  1.00 47.57 ? 89   THR B CG2   1 
ATOM   6242 N  N     . LYS D 4 90  ? 60.248 85.154  22.121  1.00 46.13 ? 90   LYS B N     1 
ATOM   6243 C  CA    . LYS D 4 90  ? 60.501 84.425  23.355  1.00 46.06 ? 90   LYS B CA    1 
ATOM   6244 C  C     . LYS D 4 90  ? 59.581 83.212  23.414  1.00 44.94 ? 90   LYS B C     1 
ATOM   6245 O  O     . LYS D 4 90  ? 58.441 83.260  22.949  1.00 45.43 ? 90   LYS B O     1 
ATOM   6246 C  CB    . LYS D 4 90  ? 60.257 85.316  24.576  1.00 47.54 ? 90   LYS B CB    1 
ATOM   6247 C  CG    . LYS D 4 90  ? 61.479 86.095  25.035  1.00 49.05 ? 90   LYS B CG    1 
ATOM   6248 C  CD    . LYS D 4 90  ? 62.579 85.158  25.510  1.00 50.29 ? 90   LYS B CD    1 
ATOM   6249 C  CE    . LYS D 4 90  ? 63.776 85.933  26.052  1.00 51.78 ? 90   LYS B CE    1 
ATOM   6250 N  NZ    . LYS D 4 90  ? 64.388 86.821  25.027  1.00 52.79 ? 90   LYS B NZ    1 
ATOM   6251 N  N     . VAL D 4 91  ? 60.087 82.126  23.986  1.00 42.83 ? 91   VAL B N     1 
ATOM   6252 C  CA    . VAL D 4 91  ? 59.332 80.889  24.112  1.00 40.93 ? 91   VAL B CA    1 
ATOM   6253 C  C     . VAL D 4 91  ? 59.225 80.532  25.589  1.00 42.23 ? 91   VAL B C     1 
ATOM   6254 O  O     . VAL D 4 91  ? 60.175 80.728  26.344  1.00 43.28 ? 91   VAL B O     1 
ATOM   6255 C  CB    . VAL D 4 91  ? 60.048 79.737  23.372  1.00 38.77 ? 91   VAL B CB    1 
ATOM   6256 C  CG1   . VAL D 4 91  ? 59.243 78.448  23.493  1.00 37.27 ? 91   VAL B CG1   1 
ATOM   6257 C  CG2   . VAL D 4 91  ? 60.257 80.113  21.920  1.00 37.17 ? 91   VAL B CG2   1 
ATOM   6258 N  N     . GLY D 4 92  ? 58.075 80.016  26.005  1.00 42.12 ? 92   GLY B N     1 
ATOM   6259 C  CA    . GLY D 4 92  ? 57.916 79.641  27.395  1.00 42.99 ? 92   GLY B CA    1 
ATOM   6260 C  C     . GLY D 4 92  ? 56.924 80.501  28.147  1.00 43.86 ? 92   GLY B C     1 
ATOM   6261 O  O     . GLY D 4 92  ? 56.649 81.637  27.760  1.00 44.04 ? 92   GLY B O     1 
ATOM   6262 N  N     . ALA D 4 93  ? 56.393 79.954  29.234  1.00 43.29 ? 93   ALA B N     1 
ATOM   6263 C  CA    . ALA D 4 93  ? 55.416 80.662  30.043  1.00 45.09 ? 93   ALA B CA    1 
ATOM   6264 C  C     . ALA D 4 93  ? 56.064 81.729  30.918  1.00 45.26 ? 93   ALA B C     1 
ATOM   6265 O  O     . ALA D 4 93  ? 56.260 81.525  32.117  1.00 44.51 ? 93   ALA B O     1 
ATOM   6266 C  CB    . ALA D 4 93  ? 54.645 79.672  30.908  1.00 45.28 ? 93   ALA B CB    1 
ATOM   6267 N  N     . LEU D 4 94  ? 56.395 82.866  30.312  1.00 45.90 ? 94   LEU B N     1 
ATOM   6268 C  CA    . LEU D 4 94  ? 57.003 83.967  31.048  1.00 46.45 ? 94   LEU B CA    1 
ATOM   6269 C  C     . LEU D 4 94  ? 56.037 84.428  32.134  1.00 48.15 ? 94   LEU B C     1 
ATOM   6270 O  O     . LEU D 4 94  ? 54.820 84.286  32.002  1.00 48.20 ? 94   LEU B O     1 
ATOM   6271 C  CB    . LEU D 4 94  ? 57.287 85.145  30.119  1.00 45.57 ? 94   LEU B CB    1 
ATOM   6272 C  CG    . LEU D 4 94  ? 58.123 84.912  28.862  1.00 46.21 ? 94   LEU B CG    1 
ATOM   6273 C  CD1   . LEU D 4 94  ? 58.216 86.215  28.088  1.00 46.10 ? 94   LEU B CD1   1 
ATOM   6274 C  CD2   . LEU D 4 94  ? 59.508 84.411  29.231  1.00 47.31 ? 94   LEU B CD2   1 
ATOM   6275 N  N     . SER D 4 95  ? 56.585 84.975  33.212  1.00 49.64 ? 95   SER B N     1 
ATOM   6276 C  CA    . SER D 4 95  ? 55.760 85.479  34.298  1.00 50.84 ? 95   SER B CA    1 
ATOM   6277 C  C     . SER D 4 95  ? 55.299 86.856  33.852  1.00 50.59 ? 95   SER B C     1 
ATOM   6278 O  O     . SER D 4 95  ? 55.842 87.417  32.895  1.00 49.25 ? 95   SER B O     1 
ATOM   6279 C  CB    . SER D 4 95  ? 56.579 85.621  35.581  1.00 50.70 ? 95   SER B CB    1 
ATOM   6280 O  OG    . SER D 4 95  ? 57.536 86.659  35.440  1.00 50.53 ? 95   SER B OG    1 
ATOM   6281 N  N     . LYS D 4 96  ? 54.311 87.404  34.547  1.00 50.88 ? 96   LYS B N     1 
ATOM   6282 C  CA    . LYS D 4 96  ? 53.811 88.726  34.202  1.00 51.89 ? 96   LYS B CA    1 
ATOM   6283 C  C     . LYS D 4 96  ? 54.975 89.716  34.243  1.00 51.76 ? 96   LYS B C     1 
ATOM   6284 O  O     . LYS D 4 96  ? 55.149 90.531  33.335  1.00 51.63 ? 96   LYS B O     1 
ATOM   6285 C  CB    . LYS D 4 96  ? 52.713 89.140  35.182  1.00 52.51 ? 96   LYS B CB    1 
ATOM   6286 C  CG    . LYS D 4 96  ? 51.921 90.357  34.747  1.00 53.63 ? 96   LYS B CG    1 
ATOM   6287 C  CD    . LYS D 4 96  ? 50.575 90.393  35.453  1.00 55.58 ? 96   LYS B CD    1 
ATOM   6288 C  CE    . LYS D 4 96  ? 49.791 91.638  35.084  1.00 56.22 ? 96   LYS B CE    1 
ATOM   6289 N  NZ    . LYS D 4 96  ? 50.532 92.865  35.496  1.00 56.75 ? 96   LYS B NZ    1 
ATOM   6290 N  N     . GLY D 4 97  ? 55.790 89.620  35.290  1.00 51.58 ? 97   GLY B N     1 
ATOM   6291 C  CA    . GLY D 4 97  ? 56.927 90.515  35.421  1.00 51.23 ? 97   GLY B CA    1 
ATOM   6292 C  C     . GLY D 4 97  ? 57.900 90.434  34.257  1.00 50.63 ? 97   GLY B C     1 
ATOM   6293 O  O     . GLY D 4 97  ? 58.353 91.458  33.739  1.00 50.42 ? 97   GLY B O     1 
ATOM   6294 N  N     . GLN D 4 98  ? 58.218 89.212  33.839  1.00 50.90 ? 98   GLN B N     1 
ATOM   6295 C  CA    . GLN D 4 98  ? 59.152 88.986  32.737  1.00 49.97 ? 98   GLN B CA    1 
ATOM   6296 C  C     . GLN D 4 98  ? 58.597 89.467  31.396  1.00 48.58 ? 98   GLN B C     1 
ATOM   6297 O  O     . GLN D 4 98  ? 59.357 89.854  30.505  1.00 48.04 ? 98   GLN B O     1 
ATOM   6298 C  CB    . GLN D 4 98  ? 59.496 87.496  32.643  1.00 51.60 ? 98   GLN B CB    1 
ATOM   6299 C  CG    . GLN D 4 98  ? 59.905 86.874  33.968  1.00 52.35 ? 98   GLN B CG    1 
ATOM   6300 C  CD    . GLN D 4 98  ? 60.066 85.370  33.876  1.00 54.87 ? 98   GLN B CD    1 
ATOM   6301 O  OE1   . GLN D 4 98  ? 59.164 84.662  33.420  1.00 54.20 ? 98   GLN B OE1   1 
ATOM   6302 N  NE2   . GLN D 4 98  ? 61.217 84.871  34.314  1.00 55.37 ? 98   GLN B NE2   1 
ATOM   6303 N  N     . LEU D 4 99  ? 57.276 89.437  31.245  1.00 46.98 ? 99   LEU B N     1 
ATOM   6304 C  CA    . LEU D 4 99  ? 56.670 89.886  29.999  1.00 47.33 ? 99   LEU B CA    1 
ATOM   6305 C  C     . LEU D 4 99  ? 56.777 91.404  29.879  1.00 47.86 ? 99   LEU B C     1 
ATOM   6306 O  O     . LEU D 4 99  ? 57.101 91.931  28.808  1.00 47.20 ? 99   LEU B O     1 
ATOM   6307 C  CB    . LEU D 4 99  ? 55.200 89.465  29.931  1.00 46.69 ? 99   LEU B CB    1 
ATOM   6308 C  CG    . LEU D 4 99  ? 54.808 88.467  28.835  1.00 45.63 ? 99   LEU B CG    1 
ATOM   6309 C  CD1   . LEU D 4 99  ? 53.322 88.180  28.925  1.00 44.72 ? 99   LEU B CD1   1 
ATOM   6310 C  CD2   . LEU D 4 99  ? 55.156 89.024  27.464  1.00 43.82 ? 99   LEU B CD2   1 
ATOM   6311 N  N     . LYS D 4 100 ? 56.508 92.105  30.981  1.00 48.84 ? 100  LYS B N     1 
ATOM   6312 C  CA    . LYS D 4 100 ? 56.576 93.564  30.989  1.00 49.57 ? 100  LYS B CA    1 
ATOM   6313 C  C     . LYS D 4 100 ? 57.962 94.039  30.579  1.00 49.60 ? 100  LYS B C     1 
ATOM   6314 O  O     . LYS D 4 100 ? 58.095 94.969  29.784  1.00 49.64 ? 100  LYS B O     1 
ATOM   6315 C  CB    . LYS D 4 100 ? 56.221 94.117  32.374  1.00 50.09 ? 100  LYS B CB    1 
ATOM   6316 C  CG    . LYS D 4 100 ? 54.807 93.777  32.838  1.00 50.91 ? 100  LYS B CG    1 
ATOM   6317 C  CD    . LYS D 4 100 ? 54.451 94.449  34.173  1.00 51.48 ? 100  LYS B CD    1 
ATOM   6318 C  CE    . LYS D 4 100 ? 54.058 95.922  34.009  1.00 51.31 ? 100  LYS B CE    1 
ATOM   6319 N  NZ    . LYS D 4 100 ? 55.165 96.781  33.478  1.00 51.44 ? 100  LYS B NZ    1 
ATOM   6320 N  N     . GLU D 4 101 ? 58.995 93.392  31.112  1.00 50.57 ? 101  GLU B N     1 
ATOM   6321 C  CA    . GLU D 4 101 ? 60.366 93.766  30.784  1.00 50.47 ? 101  GLU B CA    1 
ATOM   6322 C  C     . GLU D 4 101 ? 60.581 93.537  29.299  1.00 49.40 ? 101  GLU B C     1 
ATOM   6323 O  O     . GLU D 4 101 ? 61.163 94.375  28.601  1.00 49.13 ? 101  GLU B O     1 
ATOM   6324 C  CB    . GLU D 4 101 ? 61.370 92.920  31.569  1.00 52.28 ? 101  GLU B CB    1 
ATOM   6325 C  CG    . GLU D 4 101 ? 61.101 92.830  33.056  1.00 55.22 ? 101  GLU B CG    1 
ATOM   6326 C  CD    . GLU D 4 101 ? 62.317 92.340  33.829  1.00 57.13 ? 101  GLU B CD    1 
ATOM   6327 O  OE1   . GLU D 4 101 ? 62.999 91.407  33.349  1.00 57.07 ? 101  GLU B OE1   1 
ATOM   6328 O  OE2   . GLU D 4 101 ? 62.586 92.888  34.922  1.00 58.85 ? 101  GLU B OE2   1 
ATOM   6329 N  N     . PHE D 4 102 ? 60.109 92.390  28.824  1.00 47.79 ? 102  PHE B N     1 
ATOM   6330 C  CA    . PHE D 4 102 ? 60.235 92.037  27.417  1.00 46.82 ? 102  PHE B CA    1 
ATOM   6331 C  C     . PHE D 4 102 ? 59.535 93.091  26.562  1.00 45.79 ? 102  PHE B C     1 
ATOM   6332 O  O     . PHE D 4 102 ? 60.103 93.606  25.603  1.00 44.98 ? 102  PHE B O     1 
ATOM   6333 C  CB    . PHE D 4 102 ? 59.611 90.662  27.165  1.00 46.56 ? 102  PHE B CB    1 
ATOM   6334 C  CG    . PHE D 4 102 ? 59.700 90.208  25.737  1.00 45.31 ? 102  PHE B CG    1 
ATOM   6335 C  CD1   . PHE D 4 102 ? 60.935 89.951  25.152  1.00 45.32 ? 102  PHE B CD1   1 
ATOM   6336 C  CD2   . PHE D 4 102 ? 58.547 90.032  24.977  1.00 45.70 ? 102  PHE B CD2   1 
ATOM   6337 C  CE1   . PHE D 4 102 ? 61.023 89.524  23.830  1.00 44.86 ? 102  PHE B CE1   1 
ATOM   6338 C  CE2   . PHE D 4 102 ? 58.626 89.603  23.649  1.00 45.68 ? 102  PHE B CE2   1 
ATOM   6339 C  CZ    . PHE D 4 102 ? 59.864 89.349  23.077  1.00 44.29 ? 102  PHE B CZ    1 
ATOM   6340 N  N     . LEU D 4 103 ? 58.298 93.408  26.922  1.00 46.39 ? 103  LEU B N     1 
ATOM   6341 C  CA    . LEU D 4 103 ? 57.525 94.404  26.189  1.00 47.82 ? 103  LEU B CA    1 
ATOM   6342 C  C     . LEU D 4 103 ? 58.161 95.788  26.288  1.00 48.39 ? 103  LEU B C     1 
ATOM   6343 O  O     . LEU D 4 103 ? 58.530 96.381  25.275  1.00 47.82 ? 103  LEU B O     1 
ATOM   6344 C  CB    . LEU D 4 103 ? 56.086 94.457  26.718  1.00 48.77 ? 103  LEU B CB    1 
ATOM   6345 C  CG    . LEU D 4 103 ? 55.234 93.193  26.556  1.00 48.47 ? 103  LEU B CG    1 
ATOM   6346 C  CD1   . LEU D 4 103 ? 53.833 93.444  27.081  1.00 49.16 ? 103  LEU B CD1   1 
ATOM   6347 C  CD2   . LEU D 4 103 ? 55.180 92.803  25.087  1.00 50.40 ? 103  LEU B CD2   1 
ATOM   6348 N  N     . ASP D 4 104 ? 58.293 96.298  27.511  1.00 49.39 ? 104  ASP B N     1 
ATOM   6349 C  CA    . ASP D 4 104 ? 58.885 97.615  27.728  1.00 50.20 ? 104  ASP B CA    1 
ATOM   6350 C  C     . ASP D 4 104 ? 60.218 97.781  26.997  1.00 49.95 ? 104  ASP B C     1 
ATOM   6351 O  O     . ASP D 4 104 ? 60.483 98.822  26.401  1.00 49.56 ? 104  ASP B O     1 
ATOM   6352 C  CB    . ASP D 4 104 ? 59.096 97.871  29.226  1.00 50.91 ? 104  ASP B CB    1 
ATOM   6353 C  CG    . ASP D 4 104 ? 57.808 97.761  30.032  1.00 53.14 ? 104  ASP B CG    1 
ATOM   6354 O  OD1   . ASP D 4 104 ? 56.714 97.853  29.434  1.00 53.86 ? 104  ASP B OD1   1 
ATOM   6355 O  OD2   . ASP D 4 104 ? 57.889 97.594  31.269  1.00 54.36 ? 104  ASP B OD2   1 
ATOM   6356 N  N     . ALA D 4 105 ? 61.049 96.746  27.036  1.00 50.25 ? 105  ALA B N     1 
ATOM   6357 C  CA    . ALA D 4 105 ? 62.362 96.792  26.401  1.00 50.32 ? 105  ALA B CA    1 
ATOM   6358 C  C     . ALA D 4 105 ? 62.321 96.805  24.877  1.00 50.98 ? 105  ALA B C     1 
ATOM   6359 O  O     . ALA D 4 105 ? 63.145 97.462  24.234  1.00 51.75 ? 105  ALA B O     1 
ATOM   6360 C  CB    . ALA D 4 105 ? 63.213 95.617  26.888  1.00 50.80 ? 105  ALA B CB    1 
ATOM   6361 N  N     . ASN D 4 106 ? 61.368 96.084  24.296  1.00 50.35 ? 106  ASN B N     1 
ATOM   6362 C  CA    . ASN D 4 106 ? 61.264 96.016  22.843  1.00 49.95 ? 106  ASN B CA    1 
ATOM   6363 C  C     . ASN D 4 106 ? 60.301 97.046  22.256  1.00 50.12 ? 106  ASN B C     1 
ATOM   6364 O  O     . ASN D 4 106 ? 60.391 97.393  21.076  1.00 50.05 ? 106  ASN B O     1 
ATOM   6365 C  CB    . ASN D 4 106 ? 60.863 94.600  22.434  1.00 48.28 ? 106  ASN B CB    1 
ATOM   6366 C  CG    . ASN D 4 106 ? 61.927 93.573  22.786  1.00 47.16 ? 106  ASN B CG    1 
ATOM   6367 O  OD1   . ASN D 4 106 ? 62.944 93.453  22.096  1.00 45.97 ? 106  ASN B OD1   1 
ATOM   6368 N  ND2   . ASN D 4 106 ? 61.707 92.838  23.874  1.00 44.33 ? 106  ASN B ND2   1 
ATOM   6369 N  N     . LEU D 4 107 ? 59.391 97.538  23.089  1.00 50.40 ? 107  LEU B N     1 
ATOM   6370 C  CA    . LEU D 4 107 ? 58.410 98.538  22.673  1.00 51.65 ? 107  LEU B CA    1 
ATOM   6371 C  C     . LEU D 4 107 ? 59.066 99.908  22.491  1.00 52.12 ? 107  LEU B C     1 
ATOM   6372 O  O     . LEU D 4 107 ? 59.709 100.098 21.434  1.00 52.65 ? 107  LEU B O     1 
ATOM   6373 C  CB    . LEU D 4 107 ? 57.286 98.629  23.717  1.00 51.04 ? 107  LEU B CB    1 
ATOM   6374 C  CG    . LEU D 4 107 ? 55.936 97.986  23.369  1.00 51.75 ? 107  LEU B CG    1 
ATOM   6375 C  CD1   . LEU D 4 107 ? 56.151 96.734  22.547  1.00 50.34 ? 107  LEU B CD1   1 
ATOM   6376 C  CD2   . LEU D 4 107 ? 55.163 97.676  24.648  1.00 49.72 ? 107  LEU B CD2   1 
HETATM 6377 MG MG    . MG  E 5 .   ? 78.479 23.388  7.739   1.00 44.68 ? 4003 MG  A MG    1 
HETATM 6378 O  O     . HOH F 6 .   ? 53.142 40.767  1.815   1.00 29.75 ? 5006 HOH P O     1 
HETATM 6379 O  O     . HOH F 6 .   ? 50.985 45.074  5.520   1.00 40.01 ? 5091 HOH P O     1 
HETATM 6380 O  O     . HOH F 6 .   ? 45.598 50.402  13.768  1.00 39.89 ? 5101 HOH P O     1 
HETATM 6381 O  O     . HOH F 6 .   ? 45.350 43.583  -3.071  1.00 42.08 ? 5120 HOH P O     1 
HETATM 6382 O  O     . HOH F 6 .   ? 45.205 38.027  6.362   1.00 42.25 ? 5122 HOH P O     1 
HETATM 6383 O  O     . HOH F 6 .   ? 53.798 40.773  13.376  1.00 34.60 ? 5137 HOH P O     1 
HETATM 6384 O  O     . HOH F 6 .   ? 50.530 48.858  10.663  1.00 37.11 ? 5143 HOH P O     1 
HETATM 6385 O  O     . HOH F 6 .   ? 51.448 40.968  15.203  1.00 50.30 ? 5195 HOH P O     1 
HETATM 6386 O  O     . HOH G 6 .   ? 53.619 32.144  2.733   1.00 24.33 ? 5008 HOH T O     1 
HETATM 6387 O  O     . HOH G 6 .   ? 51.332 27.699  4.298   1.00 31.24 ? 5018 HOH T O     1 
HETATM 6388 O  O     . HOH G 6 .   ? 58.663 41.365  0.513   1.00 26.69 ? 5029 HOH T O     1 
HETATM 6389 O  O     . HOH G 6 .   ? 59.977 28.772  8.054   1.00 31.51 ? 5068 HOH T O     1 
HETATM 6390 O  O     . HOH G 6 .   ? 55.373 59.130  9.604   1.00 36.21 ? 5074 HOH T O     1 
HETATM 6391 O  O     . HOH G 6 .   ? 61.925 34.895  7.434   1.00 30.68 ? 5081 HOH T O     1 
HETATM 6392 O  O     . HOH G 6 .   ? 62.596 41.626  5.989   1.00 48.68 ? 5109 HOH T O     1 
HETATM 6393 O  O     . HOH G 6 .   ? 59.774 50.048  6.133   1.00 42.03 ? 5124 HOH T O     1 
HETATM 6394 O  O     . HOH G 6 .   ? 61.523 31.980  7.382   1.00 39.13 ? 5131 HOH T O     1 
HETATM 6395 O  O     . HOH G 6 .   ? 54.602 42.634  3.768   1.00 34.60 ? 5141 HOH T O     1 
HETATM 6396 O  O     . HOH G 6 .   ? 59.956 53.251  5.854   1.00 55.36 ? 5196 HOH T O     1 
HETATM 6397 O  O     . HOH H 6 .   ? 72.701 19.843  -10.569 1.00 30.90 ? 5001 HOH A O     1 
HETATM 6398 O  O     . HOH H 6 .   ? 54.147 28.046  4.485   1.00 16.31 ? 5002 HOH A O     1 
HETATM 6399 O  O     . HOH H 6 .   ? 55.132 24.667  -1.402  1.00 14.39 ? 5003 HOH A O     1 
HETATM 6400 O  O     . HOH H 6 .   ? 63.465 28.821  -8.001  1.00 19.88 ? 5004 HOH A O     1 
HETATM 6401 O  O     . HOH H 6 .   ? 78.134 16.418  -5.043  1.00 28.04 ? 5005 HOH A O     1 
HETATM 6402 O  O     . HOH H 6 .   ? 66.249 21.760  0.345   1.00 22.90 ? 5007 HOH A O     1 
HETATM 6403 O  O     . HOH H 6 .   ? 57.498 38.076  -2.851  1.00 18.29 ? 5009 HOH A O     1 
HETATM 6404 O  O     . HOH H 6 .   ? 82.343 18.644  -10.220 1.00 21.88 ? 5010 HOH A O     1 
HETATM 6405 O  O     . HOH H 6 .   ? 80.524 31.644  4.296   1.00 32.37 ? 5011 HOH A O     1 
HETATM 6406 O  O     . HOH H 6 .   ? 69.110 12.183  0.380   1.00 21.39 ? 5012 HOH A O     1 
HETATM 6407 O  O     . HOH H 6 .   ? 65.589 26.470  -28.292 1.00 25.67 ? 5013 HOH A O     1 
HETATM 6408 O  O     . HOH H 6 .   ? 60.983 31.696  -1.835  1.00 22.67 ? 5014 HOH A O     1 
HETATM 6409 O  O     . HOH H 6 .   ? 64.086 27.278  -25.901 1.00 28.42 ? 5015 HOH A O     1 
HETATM 6410 O  O     . HOH H 6 .   ? 71.451 24.159  -3.085  1.00 22.70 ? 5016 HOH A O     1 
HETATM 6411 O  O     . HOH H 6 .   ? 66.554 23.746  24.097  1.00 25.07 ? 5017 HOH A O     1 
HETATM 6412 O  O     . HOH H 6 .   ? 69.720 27.552  -20.936 1.00 25.89 ? 5019 HOH A O     1 
HETATM 6413 O  O     . HOH H 6 .   ? 68.201 15.473  -14.442 1.00 29.67 ? 5021 HOH A O     1 
HETATM 6414 O  O     . HOH H 6 .   ? 71.103 28.545  15.681  1.00 30.03 ? 5022 HOH A O     1 
HETATM 6415 O  O     . HOH H 6 .   ? 59.557 40.751  -2.150  1.00 30.82 ? 5023 HOH A O     1 
HETATM 6416 O  O     . HOH H 6 .   ? 49.537 13.845  6.048   1.00 26.87 ? 5024 HOH A O     1 
HETATM 6417 O  O     . HOH H 6 .   ? 58.265 38.472  0.018   1.00 29.88 ? 5025 HOH A O     1 
HETATM 6418 O  O     . HOH H 6 .   ? 69.228 24.054  -26.738 1.00 26.24 ? 5027 HOH A O     1 
HETATM 6419 O  O     . HOH H 6 .   ? 82.430 27.734  5.772   1.00 32.80 ? 5028 HOH A O     1 
HETATM 6420 O  O     . HOH H 6 .   ? 80.628 24.373  8.811   1.00 48.02 ? 5030 HOH A O     1 
HETATM 6421 O  O     . HOH H 6 .   ? 43.546 16.524  -6.899  1.00 26.24 ? 5031 HOH A O     1 
HETATM 6422 O  O     . HOH H 6 .   ? 74.591 3.518   8.451   1.00 30.32 ? 5032 HOH A O     1 
HETATM 6423 O  O     . HOH H 6 .   ? 78.913 34.219  4.744   1.00 46.39 ? 5033 HOH A O     1 
HETATM 6424 O  O     . HOH H 6 .   ? 76.483 3.251   -3.309  1.00 23.25 ? 5034 HOH A O     1 
HETATM 6425 O  O     . HOH H 6 .   ? 70.351 23.808  12.672  1.00 25.58 ? 5035 HOH A O     1 
HETATM 6426 O  O     . HOH H 6 .   ? 80.611 34.382  10.090  1.00 33.43 ? 5036 HOH A O     1 
HETATM 6427 O  O     . HOH H 6 .   ? 51.971 31.099  0.606   1.00 36.36 ? 5037 HOH A O     1 
HETATM 6428 O  O     . HOH H 6 .   ? 44.257 48.982  1.297   1.00 36.54 ? 5038 HOH A O     1 
HETATM 6429 O  O     . HOH H 6 .   ? 69.915 21.249  3.439   1.00 25.13 ? 5039 HOH A O     1 
HETATM 6430 O  O     . HOH H 6 .   ? 49.925 30.821  -7.013  1.00 34.08 ? 5040 HOH A O     1 
HETATM 6431 O  O     . HOH H 6 .   ? 53.335 33.444  -5.139  1.00 28.92 ? 5041 HOH A O     1 
HETATM 6432 O  O     . HOH H 6 .   ? 85.198 12.443  -8.648  1.00 39.18 ? 5042 HOH A O     1 
HETATM 6433 O  O     . HOH H 6 .   ? 73.324 16.255  3.458   1.00 25.22 ? 5043 HOH A O     1 
HETATM 6434 O  O     . HOH H 6 .   ? 87.788 6.879   -3.770  1.00 29.57 ? 5044 HOH A O     1 
HETATM 6435 O  O     . HOH H 6 .   ? 76.445 22.659  -7.739  1.00 33.75 ? 5045 HOH A O     1 
HETATM 6436 O  O     . HOH H 6 .   ? 91.561 23.904  -1.441  1.00 25.89 ? 5046 HOH A O     1 
HETATM 6437 O  O     . HOH H 6 .   ? 61.284 29.685  4.480   1.00 31.82 ? 5047 HOH A O     1 
HETATM 6438 O  O     . HOH H 6 .   ? 47.276 34.583  -10.078 1.00 30.23 ? 5048 HOH A O     1 
HETATM 6439 O  O     . HOH H 6 .   ? 64.121 28.805  3.850   1.00 33.40 ? 5049 HOH A O     1 
HETATM 6440 O  O     . HOH H 6 .   ? 78.415 19.882  10.586  1.00 33.94 ? 5050 HOH A O     1 
HETATM 6441 O  O     . HOH H 6 .   ? 91.398 9.814   3.504   1.00 32.42 ? 5052 HOH A O     1 
HETATM 6442 O  O     . HOH H 6 .   ? 71.472 11.801  -7.312  1.00 35.13 ? 5053 HOH A O     1 
HETATM 6443 O  O     . HOH H 6 .   ? 49.534 33.099  -11.525 1.00 33.06 ? 5054 HOH A O     1 
HETATM 6444 O  O     . HOH H 6 .   ? 70.209 19.091  -5.118  1.00 25.91 ? 5055 HOH A O     1 
HETATM 6445 O  O     . HOH H 6 .   ? 93.939 18.121  -3.306  1.00 35.56 ? 5056 HOH A O     1 
HETATM 6446 O  O     . HOH H 6 .   ? 62.855 28.469  7.972   1.00 33.51 ? 5057 HOH A O     1 
HETATM 6447 O  O     . HOH H 6 .   ? 49.126 6.443   4.478   1.00 38.68 ? 5059 HOH A O     1 
HETATM 6448 O  O     . HOH H 6 .   ? 65.132 24.228  -0.797  1.00 25.74 ? 5060 HOH A O     1 
HETATM 6449 O  O     . HOH H 6 .   ? 67.888 20.285  15.376  1.00 28.70 ? 5061 HOH A O     1 
HETATM 6450 O  O     . HOH H 6 .   ? 58.957 27.299  -4.319  1.00 32.11 ? 5062 HOH A O     1 
HETATM 6451 O  O     . HOH H 6 .   ? 74.741 29.020  0.505   1.00 31.88 ? 5063 HOH A O     1 
HETATM 6452 O  O     . HOH H 6 .   ? 66.315 9.830   -0.070  1.00 32.14 ? 5064 HOH A O     1 
HETATM 6453 O  O     . HOH H 6 .   ? 53.917 23.543  0.997   1.00 37.59 ? 5065 HOH A O     1 
HETATM 6454 O  O     . HOH H 6 .   ? 51.108 56.214  -12.210 1.00 36.47 ? 5066 HOH A O     1 
HETATM 6455 O  O     . HOH H 6 .   ? 33.662 10.318  0.634   1.00 26.32 ? 5067 HOH A O     1 
HETATM 6456 O  O     . HOH H 6 .   ? 44.861 7.068   -9.074  1.00 35.58 ? 5069 HOH A O     1 
HETATM 6457 O  O     . HOH H 6 .   ? 62.454 17.671  6.908   1.00 26.61 ? 5070 HOH A O     1 
HETATM 6458 O  O     . HOH H 6 .   ? 46.997 11.007  8.083   1.00 35.99 ? 5072 HOH A O     1 
HETATM 6459 O  O     . HOH H 6 .   ? 77.894 18.955  7.861   1.00 31.22 ? 5073 HOH A O     1 
HETATM 6460 O  O     . HOH H 6 .   ? 58.072 21.885  -29.390 1.00 33.63 ? 5075 HOH A O     1 
HETATM 6461 O  O     . HOH H 6 .   ? 57.887 13.848  15.368  1.00 28.19 ? 5076 HOH A O     1 
HETATM 6462 O  O     . HOH H 6 .   ? 48.693 44.695  -13.572 1.00 40.01 ? 5077 HOH A O     1 
HETATM 6463 O  O     . HOH H 6 .   ? 68.901 25.225  4.837   1.00 39.70 ? 5079 HOH A O     1 
HETATM 6464 O  O     . HOH H 6 .   ? 52.282 43.789  -2.580  1.00 33.68 ? 5080 HOH A O     1 
HETATM 6465 O  O     . HOH H 6 .   ? 46.622 13.751  7.069   1.00 29.93 ? 5082 HOH A O     1 
HETATM 6466 O  O     . HOH H 6 .   ? 55.770 30.032  2.827   1.00 36.44 ? 5083 HOH A O     1 
HETATM 6467 O  O     . HOH H 6 .   ? 62.792 18.117  3.377   1.00 37.11 ? 5084 HOH A O     1 
HETATM 6468 O  O     . HOH H 6 .   ? 86.088 6.773   3.231   1.00 36.22 ? 5085 HOH A O     1 
HETATM 6469 O  O     . HOH H 6 .   ? 62.437 13.754  -7.574  1.00 34.16 ? 5086 HOH A O     1 
HETATM 6470 O  O     . HOH H 6 .   ? 49.538 67.143  6.306   1.00 34.55 ? 5087 HOH A O     1 
HETATM 6471 O  O     . HOH H 6 .   ? 93.941 13.291  -4.213  1.00 53.33 ? 5088 HOH A O     1 
HETATM 6472 O  O     . HOH H 6 .   ? 43.777 9.340   -7.229  1.00 31.40 ? 5089 HOH A O     1 
HETATM 6473 O  O     . HOH H 6 .   ? 68.447 35.568  -5.741  1.00 30.86 ? 5090 HOH A O     1 
HETATM 6474 O  O     . HOH H 6 .   ? 57.062 40.973  -17.735 1.00 37.87 ? 5092 HOH A O     1 
HETATM 6475 O  O     . HOH H 6 .   ? 79.522 13.268  19.320  1.00 43.96 ? 5093 HOH A O     1 
HETATM 6476 O  O     . HOH H 6 .   ? 65.506 39.734  -17.196 1.00 45.15 ? 5094 HOH A O     1 
HETATM 6477 O  O     . HOH H 6 .   ? 55.960 17.454  9.429   1.00 34.46 ? 5095 HOH A O     1 
HETATM 6478 O  O     . HOH H 6 .   ? 27.327 12.253  14.050  1.00 41.31 ? 5096 HOH A O     1 
HETATM 6479 O  O     . HOH H 6 .   ? 88.596 9.580   6.454   1.00 37.89 ? 5097 HOH A O     1 
HETATM 6480 O  O     . HOH H 6 .   ? 69.521 42.761  -7.283  1.00 44.90 ? 5098 HOH A O     1 
HETATM 6481 O  O     . HOH H 6 .   ? 69.400 26.312  11.681  1.00 31.18 ? 5099 HOH A O     1 
HETATM 6482 O  O     . HOH H 6 .   ? 56.606 15.575  11.691  1.00 31.72 ? 5100 HOH A O     1 
HETATM 6483 O  O     . HOH H 6 .   ? 62.113 24.510  10.498  1.00 39.33 ? 5102 HOH A O     1 
HETATM 6484 O  O     . HOH H 6 .   ? 94.979 15.906  -1.275  1.00 39.70 ? 5104 HOH A O     1 
HETATM 6485 O  O     . HOH H 6 .   ? 68.704 26.761  14.762  1.00 34.57 ? 5105 HOH A O     1 
HETATM 6486 O  O     . HOH H 6 .   ? 56.831 58.176  -4.676  1.00 34.95 ? 5106 HOH A O     1 
HETATM 6487 O  O     . HOH H 6 .   ? 58.979 12.116  18.021  1.00 38.29 ? 5107 HOH A O     1 
HETATM 6488 O  O     . HOH H 6 .   ? 61.990 36.923  -23.519 1.00 37.66 ? 5108 HOH A O     1 
HETATM 6489 O  O     . HOH H 6 .   ? 66.566 34.871  -16.598 1.00 31.98 ? 5110 HOH A O     1 
HETATM 6490 O  O     . HOH H 6 .   ? 60.418 26.981  18.348  1.00 31.25 ? 5111 HOH A O     1 
HETATM 6491 O  O     . HOH H 6 .   ? 75.437 25.020  5.974   1.00 35.32 ? 5112 HOH A O     1 
HETATM 6492 O  O     . HOH H 6 .   ? 75.333 15.736  -6.106  1.00 26.49 ? 5113 HOH A O     1 
HETATM 6493 O  O     . HOH H 6 .   ? 72.092 18.256  -3.084  1.00 37.02 ? 5114 HOH A O     1 
HETATM 6494 O  O     . HOH H 6 .   ? 67.148 2.329   15.907  1.00 48.97 ? 5115 HOH A O     1 
HETATM 6495 O  O     . HOH H 6 .   ? 71.449 27.558  -12.386 1.00 42.36 ? 5117 HOH A O     1 
HETATM 6496 O  O     . HOH H 6 .   ? 60.019 27.374  10.817  1.00 47.07 ? 5118 HOH A O     1 
HETATM 6497 O  O     . HOH H 6 .   ? 59.970 8.575   -1.716  1.00 37.96 ? 5119 HOH A O     1 
HETATM 6498 O  O     . HOH H 6 .   ? 55.405 42.864  -15.921 1.00 43.27 ? 5121 HOH A O     1 
HETATM 6499 O  O     . HOH H 6 .   ? 68.478 34.722  -20.084 1.00 52.52 ? 5123 HOH A O     1 
HETATM 6500 O  O     . HOH H 6 .   ? 67.384 19.777  22.969  1.00 52.71 ? 5125 HOH A O     1 
HETATM 6501 O  O     . HOH H 6 .   ? 33.970 66.238  8.575   1.00 51.82 ? 5126 HOH A O     1 
HETATM 6502 O  O     . HOH H 6 .   ? 93.520 14.082  10.737  1.00 40.96 ? 5127 HOH A O     1 
HETATM 6503 O  O     . HOH H 6 .   ? 75.017 5.190   -5.110  1.00 37.73 ? 5128 HOH A O     1 
HETATM 6504 O  O     . HOH H 6 .   ? 64.464 42.564  -18.069 1.00 41.78 ? 5129 HOH A O     1 
HETATM 6505 O  O     . HOH H 6 .   ? 47.987 68.575  17.458  1.00 36.15 ? 5130 HOH A O     1 
HETATM 6506 O  O     . HOH H 6 .   ? 93.844 22.967  17.847  1.00 43.55 ? 5132 HOH A O     1 
HETATM 6507 O  O     . HOH H 6 .   ? 72.744 26.774  -0.057  1.00 36.07 ? 5133 HOH A O     1 
HETATM 6508 O  O     . HOH H 6 .   ? 87.452 9.365   9.082   1.00 32.28 ? 5134 HOH A O     1 
HETATM 6509 O  O     . HOH H 6 .   ? 52.721 70.564  28.348  1.00 41.25 ? 5136 HOH A O     1 
HETATM 6510 O  O     . HOH H 6 .   ? 46.629 6.536   3.172   1.00 34.28 ? 5138 HOH A O     1 
HETATM 6511 O  O     . HOH H 6 .   ? 45.428 48.414  5.209   1.00 48.22 ? 5139 HOH A O     1 
HETATM 6512 O  O     . HOH H 6 .   ? 79.033 34.701  0.485   1.00 32.44 ? 5140 HOH A O     1 
HETATM 6513 O  O     . HOH H 6 .   ? 62.223 5.930   4.627   1.00 36.33 ? 5142 HOH A O     1 
HETATM 6514 O  O     . HOH H 6 .   ? 53.684 66.388  31.882  1.00 41.70 ? 5144 HOH A O     1 
HETATM 6515 O  O     . HOH H 6 .   ? 31.032 55.526  10.320  1.00 52.44 ? 5145 HOH A O     1 
HETATM 6516 O  O     . HOH H 6 .   ? 66.794 5.103   -3.967  1.00 45.36 ? 5146 HOH A O     1 
HETATM 6517 O  O     . HOH H 6 .   ? 33.045 1.884   2.019   1.00 32.91 ? 5147 HOH A O     1 
HETATM 6518 O  O     . HOH H 6 .   ? 45.730 42.320  -11.897 1.00 46.50 ? 5148 HOH A O     1 
HETATM 6519 O  O     . HOH H 6 .   ? 65.327 23.766  16.603  1.00 36.85 ? 5149 HOH A O     1 
HETATM 6520 O  O     . HOH H 6 .   ? 38.038 59.284  -4.127  1.00 30.67 ? 5150 HOH A O     1 
HETATM 6521 O  O     . HOH H 6 .   ? 61.319 19.109  -27.540 1.00 34.70 ? 5151 HOH A O     1 
HETATM 6522 O  O     . HOH H 6 .   ? 38.695 7.220   5.074   1.00 39.56 ? 5152 HOH A O     1 
HETATM 6523 O  O     . HOH H 6 .   ? 66.643 48.062  -10.014 1.00 40.63 ? 5153 HOH A O     1 
HETATM 6524 O  O     . HOH H 6 .   ? 64.005 30.627  6.300   1.00 41.51 ? 5154 HOH A O     1 
HETATM 6525 O  O     . HOH H 6 .   ? 32.394 61.849  -1.504  1.00 35.96 ? 5156 HOH A O     1 
HETATM 6526 O  O     . HOH H 6 .   ? 80.734 1.334   5.198   1.00 56.33 ? 5157 HOH A O     1 
HETATM 6527 O  O     . HOH H 6 .   ? 44.846 10.833  -16.027 1.00 39.41 ? 5158 HOH A O     1 
HETATM 6528 O  O     . HOH H 6 .   ? 75.583 31.740  12.977  1.00 39.72 ? 5161 HOH A O     1 
HETATM 6529 O  O     . HOH H 6 .   ? 90.575 34.473  7.000   1.00 44.91 ? 5162 HOH A O     1 
HETATM 6530 O  O     . HOH H 6 .   ? 48.880 62.835  39.773  1.00 53.10 ? 5163 HOH A O     1 
HETATM 6531 O  O     . HOH H 6 .   ? 69.862 24.624  -23.164 1.00 38.90 ? 5164 HOH A O     1 
HETATM 6532 O  O     . HOH H 6 .   ? 65.719 21.387  5.455   1.00 30.32 ? 5165 HOH A O     1 
HETATM 6533 O  O     . HOH H 6 .   ? 70.156 26.851  -2.747  1.00 36.78 ? 5166 HOH A O     1 
HETATM 6534 O  O     . HOH H 6 .   ? 67.522 14.967  -11.469 1.00 40.10 ? 5167 HOH A O     1 
HETATM 6535 O  O     . HOH H 6 .   ? 94.069 21.334  -2.825  1.00 35.76 ? 5168 HOH A O     1 
HETATM 6536 O  O     . HOH H 6 .   ? 70.853 41.024  -12.869 1.00 60.11 ? 5169 HOH A O     1 
HETATM 6537 O  O     . HOH H 6 .   ? 44.479 7.481   5.155   1.00 33.96 ? 5170 HOH A O     1 
HETATM 6538 O  O     . HOH H 6 .   ? 67.484 33.260  -1.117  1.00 37.56 ? 5171 HOH A O     1 
HETATM 6539 O  O     . HOH H 6 .   ? 55.868 39.619  -19.993 1.00 38.32 ? 5172 HOH A O     1 
HETATM 6540 O  O     . HOH H 6 .   ? 27.731 13.029  5.425   1.00 44.09 ? 5173 HOH A O     1 
HETATM 6541 O  O     . HOH H 6 .   ? 60.894 30.249  -27.700 1.00 44.02 ? 5174 HOH A O     1 
HETATM 6542 O  O     . HOH H 6 .   ? 52.170 63.932  -8.167  1.00 44.35 ? 5175 HOH A O     1 
HETATM 6543 O  O     . HOH H 6 .   ? 82.162 5.649   -5.968  1.00 43.03 ? 5176 HOH A O     1 
HETATM 6544 O  O     . HOH H 6 .   ? 65.951 14.894  -7.646  1.00 39.80 ? 5177 HOH A O     1 
HETATM 6545 O  O     . HOH H 6 .   ? 48.382 18.092  -15.612 1.00 40.19 ? 5180 HOH A O     1 
HETATM 6546 O  O     . HOH H 6 .   ? 57.866 6.678   -0.480  1.00 41.42 ? 5181 HOH A O     1 
HETATM 6547 O  O     . HOH H 6 .   ? 38.123 19.255  -7.544  1.00 47.82 ? 5183 HOH A O     1 
HETATM 6548 O  O     . HOH H 6 .   ? 91.492 27.116  1.072   1.00 37.62 ? 5184 HOH A O     1 
HETATM 6549 O  O     . HOH H 6 .   ? 48.501 7.177   8.104   1.00 51.27 ? 5185 HOH A O     1 
HETATM 6550 O  O     . HOH H 6 .   ? 72.749 28.547  -9.244  1.00 36.76 ? 5188 HOH A O     1 
HETATM 6551 O  O     . HOH H 6 .   ? 57.762 31.476  -23.858 1.00 32.53 ? 5189 HOH A O     1 
HETATM 6552 O  O     . HOH H 6 .   ? 27.077 18.508  2.008   1.00 41.02 ? 5191 HOH A O     1 
HETATM 6553 O  O     . HOH H 6 .   ? 57.995 57.840  -11.011 1.00 43.28 ? 5192 HOH A O     1 
HETATM 6554 O  O     . HOH H 6 .   ? 50.426 49.106  3.210   1.00 36.75 ? 5193 HOH A O     1 
HETATM 6555 O  O     . HOH H 6 .   ? 88.678 3.916   2.438   1.00 46.36 ? 5194 HOH A O     1 
HETATM 6556 O  O     . HOH H 6 .   ? 86.866 14.197  -13.578 1.00 38.75 ? 5198 HOH A O     1 
HETATM 6557 O  O     . HOH H 6 .   ? 62.876 28.493  -4.997  1.00 39.59 ? 5199 HOH A O     1 
HETATM 6558 O  O     . HOH H 6 .   ? 48.691 26.727  -12.532 1.00 59.41 ? 5201 HOH A O     1 
HETATM 6559 O  O     . HOH H 6 .   ? 77.499 22.536  9.706   1.00 31.78 ? 5202 HOH A O     1 
HETATM 6560 O  O     . HOH H 6 .   ? 77.023 21.774  6.636   1.00 38.16 ? 5203 HOH A O     1 
HETATM 6561 O  O     . HOH H 6 .   ? 79.695 23.070  5.623   1.00 27.52 ? 5204 HOH A O     1 
HETATM 6562 O  O     . HOH H 6 .   ? 93.291 33.837  -0.055  1.00 71.30 ? 5205 HOH A O     1 
HETATM 6563 O  O     . HOH H 6 .   ? 77.891 25.823  7.506   1.00 42.07 ? 5206 HOH A O     1 
HETATM 6564 O  O     . HOH I 6 .   ? 61.710 80.020  28.465  1.00 27.99 ? 5020 HOH B O     1 
HETATM 6565 O  O     . HOH I 6 .   ? 49.892 77.466  12.705  1.00 30.24 ? 5051 HOH B O     1 
HETATM 6566 O  O     . HOH I 6 .   ? 43.261 81.970  19.852  1.00 31.29 ? 5058 HOH B O     1 
HETATM 6567 O  O     . HOH I 6 .   ? 39.829 90.127  11.250  1.00 39.29 ? 5071 HOH B O     1 
HETATM 6568 O  O     . HOH I 6 .   ? 48.006 80.758  25.617  1.00 32.53 ? 5078 HOH B O     1 
HETATM 6569 O  O     . HOH I 6 .   ? 43.136 81.254  16.908  1.00 34.56 ? 5103 HOH B O     1 
HETATM 6570 O  O     . HOH I 6 .   ? 41.562 80.220  8.510   1.00 38.10 ? 5116 HOH B O     1 
HETATM 6571 O  O     . HOH I 6 .   ? 42.127 89.138  5.807   1.00 38.61 ? 5135 HOH B O     1 
HETATM 6572 O  O     . HOH I 6 .   ? 45.710 69.141  15.330  1.00 50.06 ? 5155 HOH B O     1 
HETATM 6573 O  O     . HOH I 6 .   ? 45.093 93.881  22.758  1.00 39.06 ? 5159 HOH B O     1 
HETATM 6574 O  O     . HOH I 6 .   ? 45.137 88.043  5.730   1.00 38.89 ? 5160 HOH B O     1 
HETATM 6575 O  O     . HOH I 6 .   ? 65.265 90.701  18.985  1.00 48.74 ? 5178 HOH B O     1 
HETATM 6576 O  O     . HOH I 6 .   ? 40.526 79.793  15.844  1.00 52.55 ? 5190 HOH B O     1 
HETATM 6577 O  O     . HOH I 6 .   ? 44.504 73.182  20.547  1.00 41.29 ? 5197 HOH B O     1 
HETATM 6578 O  O     . HOH I 6 .   ? 53.385 94.173  12.275  1.00 52.66 ? 5200 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   1   ?   ?   ?   P . n 
A 1 2   DG  2   2   ?   ?   ?   P . n 
A 1 3   DA  3   3   ?   ?   ?   P . n 
A 1 4   DA  4   4   ?   ?   ?   P . n 
A 1 5   DA  5   5   ?   ?   ?   P . n 
A 1 6   DA  6   6   ?   ?   ?   P . n 
A 1 7   DC  7   7   ?   ?   ?   P . n 
A 1 8   DG  8   8   ?   ?   ?   P . n 
A 1 9   DA  9   9   ?   ?   ?   P . n 
A 1 10  DC  10  10  ?   ?   ?   P . n 
A 1 11  DG  11  11  ?   ?   ?   P . n 
A 1 12  DG  12  12  ?   ?   ?   P . n 
A 1 13  DC  13  13  ?   ?   ?   P . n 
A 1 14  DC  14  14  14  DC  CYT P . n 
A 1 15  DA  15  15  15  DA  ADE P . n 
A 1 16  DG  16  16  16  DG  GUA P . n 
A 1 17  DT  17  17  17  DT  THY P . n 
A 1 18  DG  18  18  18  DG  GUA P . n 
A 1 19  DC  19  19  19  DC  CYT P . n 
A 1 20  DC  20  20  20  DC  CYT P . n 
A 1 21  2DT 21  21  21  2DT 2DT P . n 
B 2 1   DC  1   2   ?   ?   ?   T . n 
B 2 2   DC  2   3   ?   ?   ?   T . n 
B 2 3   DC  3   4   ?   ?   ?   T . n 
B 2 4   TTD 4   5   ?   ?   ?   T . n 
B 2 5   DA  5   6   6   DA  ADE T . n 
B 2 6   DG  6   7   7   DG  GUA T . n 
B 2 7   DG  7   8   8   DG  GUA T . n 
B 2 8   DC  8   9   9   DC  CYT T . n 
B 2 9   DA  9   10  10  DA  ADE T . n 
B 2 10  DC  10  11  11  DC  CYT T . n 
B 2 11  DT  11  12  12  DT  THY T . n 
B 2 12  DG  12  13  13  DG  GUA T . n 
B 2 13  DG  13  14  14  DG  GUA T . n 
B 2 14  DC  14  15  15  DC  CYT T . n 
B 2 15  DC  15  16  ?   ?   ?   T . n 
B 2 16  DG  16  17  ?   ?   ?   T . n 
B 2 17  DT  17  18  ?   ?   ?   T . n 
B 2 18  DC  18  19  ?   ?   ?   T . n 
B 2 19  DG  19  20  ?   ?   ?   T . n 
B 2 20  DT  20  21  ?   ?   ?   T . n 
B 2 21  DT  21  22  ?   ?   ?   T . n 
B 2 22  DT  22  23  ?   ?   ?   T . n 
B 2 23  DT  23  24  ?   ?   ?   T . n 
B 2 24  DC  24  25  ?   ?   ?   T . n 
B 2 25  DG  25  26  ?   ?   ?   T . n 
C 3 1   MET 1   1   1   MET MET A . n 
C 3 2   ILE 2   2   2   ILE ILE A . n 
C 3 3   VAL 3   3   3   VAL VAL A . n 
C 3 4   SER 4   4   4   SER SER A . n 
C 3 5   ASP 5   5   5   ASP ASP A . n 
C 3 6   ILE 6   6   6   ILE ILE A . n 
C 3 7   GLU 7   7   7   GLU GLU A . n 
C 3 8   ALA 8   8   8   ALA ALA A . n 
C 3 9   ASN 9   9   9   ASN ASN A . n 
C 3 10  ALA 10  10  10  ALA ALA A . n 
C 3 11  LEU 11  11  11  LEU LEU A . n 
C 3 12  LEU 12  12  12  LEU LEU A . n 
C 3 13  GLU 13  13  13  GLU GLU A . n 
C 3 14  SER 14  14  14  SER SER A . n 
C 3 15  VAL 15  15  15  VAL VAL A . n 
C 3 16  THR 16  16  16  THR THR A . n 
C 3 17  LYS 17  17  17  LYS LYS A . n 
C 3 18  PHE 18  18  18  PHE PHE A . n 
C 3 19  HIS 19  19  19  HIS HIS A . n 
C 3 20  CYS 20  20  20  CYS CYS A . n 
C 3 21  GLY 21  21  21  GLY GLY A . n 
C 3 22  VAL 22  22  22  VAL VAL A . n 
C 3 23  ILE 23  23  23  ILE ILE A . n 
C 3 24  TYR 24  24  24  TYR TYR A . n 
C 3 25  ASP 25  25  25  ASP ASP A . n 
C 3 26  TYR 26  26  26  TYR TYR A . n 
C 3 27  SER 27  27  27  SER SER A . n 
C 3 28  THR 28  28  28  THR THR A . n 
C 3 29  ALA 29  29  29  ALA ALA A . n 
C 3 30  GLU 30  30  30  GLU GLU A . n 
C 3 31  TYR 31  31  31  TYR TYR A . n 
C 3 32  VAL 32  32  32  VAL VAL A . n 
C 3 33  SER 33  33  33  SER SER A . n 
C 3 34  TYR 34  34  34  TYR TYR A . n 
C 3 35  ARG 35  35  35  ARG ARG A . n 
C 3 36  PRO 36  36  36  PRO PRO A . n 
C 3 37  SER 37  37  37  SER SER A . n 
C 3 38  ASP 38  38  38  ASP ASP A . n 
C 3 39  PHE 39  39  39  PHE PHE A . n 
C 3 40  GLY 40  40  40  GLY GLY A . n 
C 3 41  ALA 41  41  41  ALA ALA A . n 
C 3 42  TYR 42  42  42  TYR TYR A . n 
C 3 43  LEU 43  43  43  LEU LEU A . n 
C 3 44  ASP 44  44  44  ASP ASP A . n 
C 3 45  ALA 45  45  45  ALA ALA A . n 
C 3 46  LEU 46  46  46  LEU LEU A . n 
C 3 47  GLU 47  47  47  GLU GLU A . n 
C 3 48  ALA 48  48  48  ALA ALA A . n 
C 3 49  GLU 49  49  49  GLU GLU A . n 
C 3 50  VAL 50  50  50  VAL VAL A . n 
C 3 51  ALA 51  51  51  ALA ALA A . n 
C 3 52  ARG 52  52  52  ARG ARG A . n 
C 3 53  GLY 53  53  53  GLY GLY A . n 
C 3 54  GLY 54  54  54  GLY GLY A . n 
C 3 55  LEU 55  55  55  LEU LEU A . n 
C 3 56  ILE 56  56  56  ILE ILE A . n 
C 3 57  VAL 57  57  57  VAL VAL A . n 
C 3 58  PHE 58  58  58  PHE PHE A . n 
C 3 59  HIS 59  59  59  HIS HIS A . n 
C 3 60  ASN 60  60  60  ASN ASN A . n 
C 3 61  GLY 61  61  61  GLY GLY A . n 
C 3 62  HIS 62  62  62  HIS HIS A . n 
C 3 63  LYS 63  63  63  LYS LYS A . n 
C 3 64  TYR 64  64  64  TYR TYR A . n 
C 3 65  ASP 65  65  65  ASP ASP A . n 
C 3 66  VAL 66  66  66  VAL VAL A . n 
C 3 67  PRO 67  67  67  PRO PRO A . n 
C 3 68  ALA 68  68  68  ALA ALA A . n 
C 3 69  LEU 69  69  69  LEU LEU A . n 
C 3 70  THR 70  70  70  THR THR A . n 
C 3 71  LYS 71  71  71  LYS LYS A . n 
C 3 72  LEU 72  72  72  LEU LEU A . n 
C 3 73  ALA 73  73  73  ALA ALA A . n 
C 3 74  LYS 74  74  74  LYS LYS A . n 
C 3 75  LEU 75  75  75  LEU LEU A . n 
C 3 76  GLN 76  76  76  GLN GLN A . n 
C 3 77  LEU 77  77  77  LEU LEU A . n 
C 3 78  ASN 78  78  78  ASN ASN A . n 
C 3 79  ARG 79  79  79  ARG ARG A . n 
C 3 80  GLU 80  80  80  GLU GLU A . n 
C 3 81  PHE 81  81  81  PHE PHE A . n 
C 3 82  HIS 82  82  82  HIS HIS A . n 
C 3 83  LEU 83  83  83  LEU LEU A . n 
C 3 84  PRO 84  84  84  PRO PRO A . n 
C 3 85  ARG 85  85  85  ARG ARG A . n 
C 3 86  GLU 86  86  86  GLU GLU A . n 
C 3 87  ASN 87  87  87  ASN ASN A . n 
C 3 88  CYS 88  88  88  CYS CYS A . n 
C 3 89  ILE 89  89  89  ILE ILE A . n 
C 3 90  ASP 90  90  90  ASP ASP A . n 
C 3 91  THR 91  91  91  THR THR A . n 
C 3 92  LEU 92  92  92  LEU LEU A . n 
C 3 93  VAL 93  93  93  VAL VAL A . n 
C 3 94  LEU 94  94  94  LEU LEU A . n 
C 3 95  SER 95  95  95  SER SER A . n 
C 3 96  ARG 96  96  96  ARG ARG A . n 
C 3 97  LEU 97  97  97  LEU LEU A . n 
C 3 98  ILE 98  98  98  ILE ILE A . n 
C 3 99  HIS 99  99  99  HIS HIS A . n 
C 3 100 SER 100 100 100 SER SER A . n 
C 3 101 ASN 101 101 101 ASN ASN A . n 
C 3 102 LEU 102 102 102 LEU LEU A . n 
C 3 103 LYS 103 103 103 LYS LYS A . n 
C 3 104 ASP 104 104 104 ASP ASP A . n 
C 3 105 THR 105 105 105 THR THR A . n 
C 3 106 ASP 106 106 106 ASP ASP A . n 
C 3 107 MET 107 107 107 MET MET A . n 
C 3 108 GLY 108 108 108 GLY GLY A . n 
C 3 109 LEU 109 109 109 LEU LEU A . n 
C 3 110 LEU 110 110 110 LEU LEU A . n 
C 3 111 ARG 111 111 111 ARG ARG A . n 
C 3 112 SER 112 112 112 SER SER A . n 
C 3 113 GLY 113 113 113 GLY GLY A . n 
C 3 114 LYS 114 114 114 LYS LYS A . n 
C 3 115 LEU 115 115 115 LEU LEU A . n 
C 3 116 PRO 116 116 116 PRO PRO A . n 
C 3 117 GLY 117 117 117 GLY GLY A . n 
C 3 118 ALA 118 124 124 ALA ALA A . n 
C 3 119 LEU 119 125 125 LEU LEU A . n 
C 3 120 GLU 120 126 126 GLU GLU A . n 
C 3 121 ALA 121 127 127 ALA ALA A . n 
C 3 122 TRP 122 128 128 TRP TRP A . n 
C 3 123 GLY 123 129 129 GLY GLY A . n 
C 3 124 TYR 124 130 130 TYR TYR A . n 
C 3 125 ARG 125 131 131 ARG ARG A . n 
C 3 126 LEU 126 132 132 LEU LEU A . n 
C 3 127 GLY 127 133 133 GLY GLY A . n 
C 3 128 GLU 128 134 134 GLU GLU A . n 
C 3 129 MET 129 135 135 MET MET A . n 
C 3 130 LYS 130 136 136 LYS LYS A . n 
C 3 131 GLY 131 137 137 GLY GLY A . n 
C 3 132 GLU 132 138 138 GLU GLU A . n 
C 3 133 TYR 133 139 139 TYR TYR A . n 
C 3 134 LYS 134 140 140 LYS LYS A . n 
C 3 135 ASP 135 141 141 ASP ASP A . n 
C 3 136 ASP 136 142 142 ASP ASP A . n 
C 3 137 PHE 137 143 143 PHE PHE A . n 
C 3 138 LYS 138 144 144 LYS LYS A . n 
C 3 139 ARG 139 145 145 ARG ARG A . n 
C 3 140 MET 140 146 146 MET MET A . n 
C 3 141 LEU 141 147 147 LEU LEU A . n 
C 3 142 GLU 142 148 148 GLU GLU A . n 
C 3 143 GLU 143 149 149 GLU GLU A . n 
C 3 144 GLN 144 150 150 GLN GLN A . n 
C 3 145 GLY 145 151 151 GLY GLY A . n 
C 3 146 GLU 146 152 152 GLU GLU A . n 
C 3 147 GLU 147 153 153 GLU GLU A . n 
C 3 148 TYR 148 154 154 TYR TYR A . n 
C 3 149 VAL 149 155 155 VAL VAL A . n 
C 3 150 ASP 150 156 156 ASP ASP A . n 
C 3 151 GLY 151 157 157 GLY GLY A . n 
C 3 152 MET 152 158 158 MET MET A . n 
C 3 153 GLU 153 159 159 GLU GLU A . n 
C 3 154 TRP 154 160 160 TRP TRP A . n 
C 3 155 TRP 155 161 161 TRP TRP A . n 
C 3 156 ASN 156 162 162 ASN ASN A . n 
C 3 157 PHE 157 163 163 PHE PHE A . n 
C 3 158 ASN 158 164 164 ASN ASN A . n 
C 3 159 GLU 159 165 165 GLU GLU A . n 
C 3 160 GLU 160 166 166 GLU GLU A . n 
C 3 161 MET 161 167 167 MET MET A . n 
C 3 162 MET 162 168 168 MET MET A . n 
C 3 163 ASP 163 169 169 ASP ASP A . n 
C 3 164 TYR 164 170 170 TYR TYR A . n 
C 3 165 ASN 165 171 171 ASN ASN A . n 
C 3 166 VAL 166 172 172 VAL VAL A . n 
C 3 167 GLN 167 173 173 GLN GLN A . n 
C 3 168 ASP 168 174 174 ASP ASP A . n 
C 3 169 VAL 169 175 175 VAL VAL A . n 
C 3 170 VAL 170 176 176 VAL VAL A . n 
C 3 171 VAL 171 177 177 VAL VAL A . n 
C 3 172 THR 172 178 178 THR THR A . n 
C 3 173 LYS 173 179 179 LYS LYS A . n 
C 3 174 ALA 174 180 180 ALA ALA A . n 
C 3 175 LEU 175 181 181 LEU LEU A . n 
C 3 176 LEU 176 182 182 LEU LEU A . n 
C 3 177 GLU 177 183 183 GLU GLU A . n 
C 3 178 LYS 178 184 184 LYS LYS A . n 
C 3 179 LEU 179 185 185 LEU LEU A . n 
C 3 180 LEU 180 186 186 LEU LEU A . n 
C 3 181 SER 181 187 187 SER SER A . n 
C 3 182 ASP 182 188 188 ASP ASP A . n 
C 3 183 LYS 183 189 189 LYS LYS A . n 
C 3 184 HIS 184 190 190 HIS HIS A . n 
C 3 185 TYR 185 191 191 TYR TYR A . n 
C 3 186 PHE 186 192 192 PHE PHE A . n 
C 3 187 PRO 187 193 193 PRO PRO A . n 
C 3 188 PRO 188 194 194 PRO PRO A . n 
C 3 189 GLU 189 195 195 GLU GLU A . n 
C 3 190 ILE 190 196 196 ILE ILE A . n 
C 3 191 ASP 191 197 197 ASP ASP A . n 
C 3 192 PHE 192 198 198 PHE PHE A . n 
C 3 193 THR 193 199 199 THR THR A . n 
C 3 194 ASP 194 200 200 ASP ASP A . n 
C 3 195 VAL 195 201 201 VAL VAL A . n 
C 3 196 GLY 196 202 202 GLY GLY A . n 
C 3 197 TYR 197 203 203 TYR TYR A . n 
C 3 198 THR 198 204 204 THR THR A . n 
C 3 199 THR 199 205 205 THR THR A . n 
C 3 200 PHE 200 206 206 PHE PHE A . n 
C 3 201 TRP 201 207 207 TRP TRP A . n 
C 3 202 SER 202 208 208 SER SER A . n 
C 3 203 GLU 203 209 209 GLU GLU A . n 
C 3 204 SER 204 210 210 SER SER A . n 
C 3 205 LEU 205 211 211 LEU LEU A . n 
C 3 206 GLU 206 212 212 GLU GLU A . n 
C 3 207 ALA 207 213 213 ALA ALA A . n 
C 3 208 VAL 208 214 214 VAL VAL A . n 
C 3 209 ASP 209 215 215 ASP ASP A . n 
C 3 210 ILE 210 216 216 ILE ILE A . n 
C 3 211 GLU 211 217 217 GLU GLU A . n 
C 3 212 HIS 212 218 218 HIS HIS A . n 
C 3 213 ARG 213 219 219 ARG ARG A . n 
C 3 214 ALA 214 220 220 ALA ALA A . n 
C 3 215 ALA 215 221 221 ALA ALA A . n 
C 3 216 TRP 216 222 222 TRP TRP A . n 
C 3 217 LEU 217 223 223 LEU LEU A . n 
C 3 218 LEU 218 224 224 LEU LEU A . n 
C 3 219 ALA 219 225 225 ALA ALA A . n 
C 3 220 LYS 220 226 226 LYS LYS A . n 
C 3 221 GLN 221 227 227 GLN GLN A . n 
C 3 222 GLU 222 228 228 GLU GLU A . n 
C 3 223 ARG 223 229 229 ARG ARG A . n 
C 3 224 ASN 224 230 230 ASN ASN A . n 
C 3 225 GLY 225 231 231 GLY GLY A . n 
C 3 226 PHE 226 232 232 PHE PHE A . n 
C 3 227 PRO 227 233 233 PRO PRO A . n 
C 3 228 PHE 228 234 234 PHE PHE A . n 
C 3 229 ASP 229 235 235 ASP ASP A . n 
C 3 230 THR 230 236 236 THR THR A . n 
C 3 231 LYS 231 237 237 LYS LYS A . n 
C 3 232 ALA 232 238 238 ALA ALA A . n 
C 3 233 ILE 233 239 239 ILE ILE A . n 
C 3 234 GLU 234 240 240 GLU GLU A . n 
C 3 235 GLU 235 241 241 GLU GLU A . n 
C 3 236 LEU 236 242 242 LEU LEU A . n 
C 3 237 TYR 237 243 243 TYR TYR A . n 
C 3 238 VAL 238 244 244 VAL VAL A . n 
C 3 239 GLU 239 245 245 GLU GLU A . n 
C 3 240 LEU 240 246 246 LEU LEU A . n 
C 3 241 ALA 241 247 247 ALA ALA A . n 
C 3 242 ALA 242 248 248 ALA ALA A . n 
C 3 243 ARG 243 249 249 ARG ARG A . n 
C 3 244 ARG 244 250 250 ARG ARG A . n 
C 3 245 SER 245 251 251 SER SER A . n 
C 3 246 GLU 246 252 252 GLU GLU A . n 
C 3 247 LEU 247 253 253 LEU LEU A . n 
C 3 248 LEU 248 254 254 LEU LEU A . n 
C 3 249 ARG 249 255 255 ARG ARG A . n 
C 3 250 LYS 250 256 256 LYS LYS A . n 
C 3 251 LEU 251 257 257 LEU LEU A . n 
C 3 252 THR 252 258 258 THR THR A . n 
C 3 253 GLU 253 259 259 GLU GLU A . n 
C 3 254 THR 254 260 260 THR THR A . n 
C 3 255 PHE 255 261 261 PHE PHE A . n 
C 3 256 GLY 256 262 262 GLY GLY A . n 
C 3 257 SER 257 263 263 SER SER A . n 
C 3 258 TRP 258 264 264 TRP TRP A . n 
C 3 259 TYR 259 265 265 TYR TYR A . n 
C 3 260 GLN 260 266 266 GLN GLN A . n 
C 3 261 PRO 261 267 267 PRO PRO A . n 
C 3 262 LYS 262 268 268 LYS LYS A . n 
C 3 263 GLY 263 269 269 GLY GLY A . n 
C 3 264 GLY 264 270 270 GLY GLY A . n 
C 3 265 THR 265 271 271 THR THR A . n 
C 3 266 GLU 266 272 272 GLU GLU A . n 
C 3 267 MET 267 273 273 MET MET A . n 
C 3 268 PHE 268 274 274 PHE PHE A . n 
C 3 269 CYS 269 275 275 CYS CYS A . n 
C 3 270 HIS 270 276 276 HIS HIS A . n 
C 3 271 PRO 271 277 277 PRO PRO A . n 
C 3 272 ARG 272 278 278 ARG ARG A . n 
C 3 273 THR 273 279 279 THR THR A . n 
C 3 274 GLY 274 280 280 GLY GLY A . n 
C 3 275 LYS 275 281 281 LYS LYS A . n 
C 3 276 PRO 276 282 282 PRO PRO A . n 
C 3 277 LEU 277 283 283 LEU LEU A . n 
C 3 278 PRO 278 284 284 PRO PRO A . n 
C 3 279 LYS 279 285 285 LYS LYS A . n 
C 3 280 TYR 280 286 286 TYR TYR A . n 
C 3 281 PRO 281 287 287 PRO PRO A . n 
C 3 282 ARG 282 288 288 ARG ARG A . n 
C 3 283 ILE 283 289 289 ILE ILE A . n 
C 3 284 LYS 284 290 290 LYS LYS A . n 
C 3 285 THR 285 291 291 THR THR A . n 
C 3 286 PRO 286 292 292 PRO PRO A . n 
C 3 287 LYS 287 293 293 LYS LYS A . n 
C 3 288 VAL 288 294 294 VAL VAL A . n 
C 3 289 GLY 289 295 295 GLY GLY A . n 
C 3 290 GLY 290 296 296 GLY GLY A . n 
C 3 291 ILE 291 297 297 ILE ILE A . n 
C 3 292 PHE 292 298 298 PHE PHE A . n 
C 3 293 LYS 293 299 299 LYS LYS A . n 
C 3 294 LYS 294 300 300 LYS LYS A . n 
C 3 295 PRO 295 301 301 PRO PRO A . n 
C 3 296 LYS 296 302 302 LYS LYS A . n 
C 3 297 ASN 297 303 303 ASN ASN A . n 
C 3 298 LYS 298 304 ?   ?   ?   A . n 
C 3 299 ALA 299 305 ?   ?   ?   A . n 
C 3 300 GLN 300 306 ?   ?   ?   A . n 
C 3 301 ARG 301 307 ?   ?   ?   A . n 
C 3 302 GLU 302 308 ?   ?   ?   A . n 
C 3 303 GLY 303 309 ?   ?   ?   A . n 
C 3 304 ARG 304 310 ?   ?   ?   A . n 
C 3 305 GLU 305 311 ?   ?   ?   A . n 
C 3 306 PRO 306 312 ?   ?   ?   A . n 
C 3 307 CYS 307 313 313 CYS CYS A . n 
C 3 308 GLU 308 314 314 GLU GLU A . n 
C 3 309 LEU 309 315 315 LEU LEU A . n 
C 3 310 ASP 310 316 316 ASP ASP A . n 
C 3 311 THR 311 317 317 THR THR A . n 
C 3 312 ARG 312 318 318 ARG ARG A . n 
C 3 313 GLU 313 319 319 GLU GLU A . n 
C 3 314 TYR 314 320 320 TYR TYR A . n 
C 3 315 VAL 315 321 321 VAL VAL A . n 
C 3 316 ALA 316 322 322 ALA ALA A . n 
C 3 317 GLY 317 323 323 GLY GLY A . n 
C 3 318 ALA 318 324 324 ALA ALA A . n 
C 3 319 PRO 319 325 325 PRO PRO A . n 
C 3 320 TYR 320 326 326 TYR TYR A . n 
C 3 321 THR 321 327 327 THR THR A . n 
C 3 322 PRO 322 328 328 PRO PRO A . n 
C 3 323 VAL 323 329 329 VAL VAL A . n 
C 3 324 GLU 324 330 330 GLU GLU A . n 
C 3 325 HIS 325 331 331 HIS HIS A . n 
C 3 326 VAL 326 332 332 VAL VAL A . n 
C 3 327 VAL 327 333 333 VAL VAL A . n 
C 3 328 PHE 328 334 334 PHE PHE A . n 
C 3 329 ASN 329 335 335 ASN ASN A . n 
C 3 330 PRO 330 336 336 PRO PRO A . n 
C 3 331 SER 331 337 337 SER SER A . n 
C 3 332 SER 332 338 338 SER SER A . n 
C 3 333 ARG 333 339 339 ARG ARG A . n 
C 3 334 ASP 334 340 340 ASP ASP A . n 
C 3 335 HIS 335 341 341 HIS HIS A . n 
C 3 336 ILE 336 342 342 ILE ILE A . n 
C 3 337 GLN 337 343 343 GLN GLN A . n 
C 3 338 LYS 338 344 344 LYS LYS A . n 
C 3 339 LYS 339 345 345 LYS LYS A . n 
C 3 340 LEU 340 346 346 LEU LEU A . n 
C 3 341 GLN 341 347 347 GLN GLN A . n 
C 3 342 GLU 342 348 348 GLU GLU A . n 
C 3 343 ALA 343 349 349 ALA ALA A . n 
C 3 344 GLY 344 350 350 GLY GLY A . n 
C 3 345 TRP 345 351 351 TRP TRP A . n 
C 3 346 VAL 346 352 352 VAL VAL A . n 
C 3 347 PRO 347 353 353 PRO PRO A . n 
C 3 348 THR 348 354 354 THR THR A . n 
C 3 349 LYS 349 355 355 LYS LYS A . n 
C 3 350 TYR 350 356 356 TYR TYR A . n 
C 3 351 THR 351 357 357 THR THR A . n 
C 3 352 ASP 352 358 358 ASP ASP A . n 
C 3 353 LYS 353 359 359 LYS LYS A . n 
C 3 354 GLY 354 360 360 GLY GLY A . n 
C 3 355 ALA 355 361 361 ALA ALA A . n 
C 3 356 PRO 356 362 362 PRO PRO A . n 
C 3 357 VAL 357 363 363 VAL VAL A . n 
C 3 358 VAL 358 364 364 VAL VAL A . n 
C 3 359 ASP 359 365 365 ASP ASP A . n 
C 3 360 ASP 360 366 366 ASP ASP A . n 
C 3 361 GLU 361 367 367 GLU GLU A . n 
C 3 362 VAL 362 368 368 VAL VAL A . n 
C 3 363 LEU 363 369 369 LEU LEU A . n 
C 3 364 GLU 364 370 370 GLU GLU A . n 
C 3 365 GLY 365 371 371 GLY GLY A . n 
C 3 366 VAL 366 372 372 VAL VAL A . n 
C 3 367 ARG 367 373 373 ARG ARG A . n 
C 3 368 VAL 368 374 374 VAL VAL A . n 
C 3 369 ASP 369 375 375 ASP ASP A . n 
C 3 370 ASP 370 376 376 ASP ASP A . n 
C 3 371 PRO 371 377 377 PRO PRO A . n 
C 3 372 GLU 372 378 378 GLU GLU A . n 
C 3 373 LYS 373 379 379 LYS LYS A . n 
C 3 374 GLN 374 380 380 GLN GLN A . n 
C 3 375 ALA 375 381 381 ALA ALA A . n 
C 3 376 ALA 376 382 382 ALA ALA A . n 
C 3 377 ILE 377 383 383 ILE ILE A . n 
C 3 378 ASP 378 384 384 ASP ASP A . n 
C 3 379 LEU 379 385 385 LEU LEU A . n 
C 3 380 ILE 380 386 386 ILE ILE A . n 
C 3 381 LYS 381 387 387 LYS LYS A . n 
C 3 382 GLU 382 388 388 GLU GLU A . n 
C 3 383 TYR 383 389 389 TYR TYR A . n 
C 3 384 LEU 384 390 390 LEU LEU A . n 
C 3 385 MET 385 391 391 MET MET A . n 
C 3 386 ILE 386 392 392 ILE ILE A . n 
C 3 387 GLN 387 393 393 GLN GLN A . n 
C 3 388 LYS 388 394 394 LYS LYS A . n 
C 3 389 ARG 389 395 395 ARG ARG A . n 
C 3 390 ILE 390 396 396 ILE ILE A . n 
C 3 391 GLY 391 397 397 GLY GLY A . n 
C 3 392 GLN 392 398 398 GLN GLN A . n 
C 3 393 SER 393 399 399 SER SER A . n 
C 3 394 ALA 394 400 400 ALA ALA A . n 
C 3 395 GLU 395 401 401 GLU GLU A . n 
C 3 396 GLY 396 402 402 GLY GLY A . n 
C 3 397 ASP 397 403 403 ASP ASP A . n 
C 3 398 LYS 398 404 404 LYS LYS A . n 
C 3 399 ALA 399 405 405 ALA ALA A . n 
C 3 400 TRP 400 406 406 TRP TRP A . n 
C 3 401 LEU 401 407 407 LEU LEU A . n 
C 3 402 ARG 402 408 408 ARG ARG A . n 
C 3 403 TYR 403 409 409 TYR TYR A . n 
C 3 404 VAL 404 410 410 VAL VAL A . n 
C 3 405 ALA 405 411 411 ALA ALA A . n 
C 3 406 GLU 406 412 412 GLU GLU A . n 
C 3 407 ASP 407 413 413 ASP ASP A . n 
C 3 408 GLY 408 414 414 GLY GLY A . n 
C 3 409 LYS 409 415 415 LYS LYS A . n 
C 3 410 ILE 410 416 416 ILE ILE A . n 
C 3 411 HIS 411 417 417 HIS HIS A . n 
C 3 412 GLY 412 418 418 GLY GLY A . n 
C 3 413 SER 413 419 419 SER SER A . n 
C 3 414 VAL 414 420 420 VAL VAL A . n 
C 3 415 ASN 415 421 421 ASN ASN A . n 
C 3 416 PRO 416 422 422 PRO PRO A . n 
C 3 417 ASN 417 423 423 ASN ASN A . n 
C 3 418 GLY 418 424 424 GLY GLY A . n 
C 3 419 ALA 419 425 425 ALA ALA A . n 
C 3 420 VAL 420 426 426 VAL VAL A . n 
C 3 421 THR 421 427 427 THR THR A . n 
C 3 422 GLY 422 428 428 GLY GLY A . n 
C 3 423 ARG 423 429 429 ARG ARG A . n 
C 3 424 ALA 424 430 430 ALA ALA A . n 
C 3 425 THR 425 431 431 THR THR A . n 
C 3 426 HIS 426 432 432 HIS HIS A . n 
C 3 427 ALA 427 433 433 ALA ALA A . n 
C 3 428 PHE 428 434 434 PHE PHE A . n 
C 3 429 PRO 429 435 435 PRO PRO A . n 
C 3 430 ASN 430 436 436 ASN ASN A . n 
C 3 431 LEU 431 437 437 LEU LEU A . n 
C 3 432 ALA 432 438 438 ALA ALA A . n 
C 3 433 GLN 433 439 439 GLN GLN A . n 
C 3 434 ILE 434 440 440 ILE ILE A . n 
C 3 435 PRO 435 441 441 PRO PRO A . n 
C 3 436 GLY 436 442 442 GLY GLY A . n 
C 3 437 VAL 437 443 443 VAL VAL A . n 
C 3 438 ARG 438 444 444 ARG ARG A . n 
C 3 439 SER 439 445 445 SER SER A . n 
C 3 440 PRO 440 446 446 PRO PRO A . n 
C 3 441 TYR 441 447 447 TYR TYR A . n 
C 3 442 GLY 442 448 448 GLY GLY A . n 
C 3 443 GLU 443 449 449 GLU GLU A . n 
C 3 444 GLN 444 450 450 GLN GLN A . n 
C 3 445 CYS 445 451 451 CYS CYS A . n 
C 3 446 ARG 446 452 452 ARG ARG A . n 
C 3 447 ALA 447 453 453 ALA ALA A . n 
C 3 448 ALA 448 454 454 ALA ALA A . n 
C 3 449 PHE 449 455 455 PHE PHE A . n 
C 3 450 GLY 450 456 456 GLY GLY A . n 
C 3 451 ALA 451 457 457 ALA ALA A . n 
C 3 452 GLU 452 458 458 GLU GLU A . n 
C 3 453 HIS 453 459 459 HIS HIS A . n 
C 3 454 HIS 454 460 460 HIS HIS A . n 
C 3 455 LEU 455 461 461 LEU LEU A . n 
C 3 456 ASP 456 462 462 ASP ASP A . n 
C 3 457 GLY 457 463 463 GLY GLY A . n 
C 3 458 ILE 458 464 464 ILE ILE A . n 
C 3 459 THR 459 465 465 THR THR A . n 
C 3 460 GLY 460 466 466 GLY GLY A . n 
C 3 461 LYS 461 467 467 LYS LYS A . n 
C 3 462 PRO 462 468 468 PRO PRO A . n 
C 3 463 TRP 463 469 469 TRP TRP A . n 
C 3 464 VAL 464 470 470 VAL VAL A . n 
C 3 465 GLN 465 471 471 GLN GLN A . n 
C 3 466 ALA 466 472 472 ALA ALA A . n 
C 3 467 GLY 467 473 473 GLY GLY A . n 
C 3 468 ILE 468 474 474 ILE ILE A . n 
C 3 469 ASP 469 475 475 ASP ASP A . n 
C 3 470 ALA 470 476 476 ALA ALA A . n 
C 3 471 SER 471 477 477 SER SER A . n 
C 3 472 GLY 472 478 478 GLY GLY A . n 
C 3 473 LEU 473 479 479 LEU LEU A . n 
C 3 474 GLU 474 480 480 GLU GLU A . n 
C 3 475 LEU 475 481 481 LEU LEU A . n 
C 3 476 ARG 476 482 482 ARG ARG A . n 
C 3 477 CYS 477 483 483 CYS CYS A . n 
C 3 478 LEU 478 484 484 LEU LEU A . n 
C 3 479 ALA 479 485 485 ALA ALA A . n 
C 3 480 HIS 480 486 486 HIS HIS A . n 
C 3 481 PHE 481 487 487 PHE PHE A . n 
C 3 482 MET 482 488 488 MET MET A . n 
C 3 483 ALA 483 489 489 ALA ALA A . n 
C 3 484 ARG 484 490 490 ARG ARG A . n 
C 3 485 PHE 485 491 491 PHE PHE A . n 
C 3 486 ASP 486 492 492 ASP ASP A . n 
C 3 487 ASN 487 493 493 ASN ASN A . n 
C 3 488 GLY 488 494 494 GLY GLY A . n 
C 3 489 GLU 489 495 495 GLU GLU A . n 
C 3 490 TYR 490 496 496 TYR TYR A . n 
C 3 491 ALA 491 497 497 ALA ALA A . n 
C 3 492 HIS 492 498 498 HIS HIS A . n 
C 3 493 GLU 493 499 499 GLU GLU A . n 
C 3 494 ILE 494 500 500 ILE ILE A . n 
C 3 495 LEU 495 501 501 LEU LEU A . n 
C 3 496 ASN 496 502 502 ASN ASN A . n 
C 3 497 GLY 497 503 503 GLY GLY A . n 
C 3 498 ASP 498 504 504 ASP ASP A . n 
C 3 499 ILE 499 505 505 ILE ILE A . n 
C 3 500 HIS 500 506 506 HIS HIS A . n 
C 3 501 THR 501 507 507 THR THR A . n 
C 3 502 LYS 502 508 508 LYS LYS A . n 
C 3 503 ASN 503 509 509 ASN ASN A . n 
C 3 504 GLN 504 510 510 GLN GLN A . n 
C 3 505 ILE 505 511 511 ILE ILE A . n 
C 3 506 ALA 506 512 512 ALA ALA A . n 
C 3 507 ALA 507 513 513 ALA ALA A . n 
C 3 508 GLU 508 514 514 GLU GLU A . n 
C 3 509 LEU 509 515 515 LEU LEU A . n 
C 3 510 PRO 510 516 516 PRO PRO A . n 
C 3 511 THR 511 517 517 THR THR A . n 
C 3 512 ARG 512 518 518 ARG ARG A . n 
C 3 513 ASP 513 519 519 ASP ASP A . n 
C 3 514 ASN 514 520 520 ASN ASN A . n 
C 3 515 ALA 515 521 521 ALA ALA A . n 
C 3 516 LYS 516 522 522 LYS LYS A . n 
C 3 517 THR 517 523 523 THR THR A . n 
C 3 518 PHE 518 524 524 PHE PHE A . n 
C 3 519 ILE 519 525 525 ILE ILE A . n 
C 3 520 TYR 520 526 526 TYR TYR A . n 
C 3 521 GLY 521 527 527 GLY GLY A . n 
C 3 522 PHE 522 528 528 PHE PHE A . n 
C 3 523 LEU 523 529 529 LEU LEU A . n 
C 3 524 TYR 524 530 530 TYR TYR A . n 
C 3 525 GLY 525 531 531 GLY GLY A . n 
C 3 526 ALA 526 532 532 ALA ALA A . n 
C 3 527 GLY 527 533 533 GLY GLY A . n 
C 3 528 ASP 528 534 534 ASP ASP A . n 
C 3 529 GLU 529 535 535 GLU GLU A . n 
C 3 530 LYS 530 536 536 LYS LYS A . n 
C 3 531 ILE 531 537 537 ILE ILE A . n 
C 3 532 GLY 532 538 538 GLY GLY A . n 
C 3 533 GLN 533 539 539 GLN GLN A . n 
C 3 534 ILE 534 540 540 ILE ILE A . n 
C 3 535 VAL 535 541 541 VAL VAL A . n 
C 3 536 GLY 536 542 542 GLY GLY A . n 
C 3 537 ALA 537 543 543 ALA ALA A . n 
C 3 538 GLY 538 544 544 GLY GLY A . n 
C 3 539 LYS 539 545 545 LYS LYS A . n 
C 3 540 GLU 540 546 546 GLU GLU A . n 
C 3 541 ARG 541 547 547 ARG ARG A . n 
C 3 542 GLY 542 548 548 GLY GLY A . n 
C 3 543 LYS 543 549 549 LYS LYS A . n 
C 3 544 GLU 544 550 550 GLU GLU A . n 
C 3 545 LEU 545 551 551 LEU LEU A . n 
C 3 546 LYS 546 552 552 LYS LYS A . n 
C 3 547 LYS 547 553 553 LYS LYS A . n 
C 3 548 LYS 548 554 554 LYS LYS A . n 
C 3 549 PHE 549 555 555 PHE PHE A . n 
C 3 550 LEU 550 556 556 LEU LEU A . n 
C 3 551 GLU 551 557 557 GLU GLU A . n 
C 3 552 ASN 552 558 558 ASN ASN A . n 
C 3 553 THR 553 559 559 THR THR A . n 
C 3 554 PRO 554 560 560 PRO PRO A . n 
C 3 555 ALA 555 561 561 ALA ALA A . n 
C 3 556 ILE 556 562 562 ILE ILE A . n 
C 3 557 ALA 557 563 563 ALA ALA A . n 
C 3 558 ALA 558 564 564 ALA ALA A . n 
C 3 559 LEU 559 565 565 LEU LEU A . n 
C 3 560 ARG 560 566 566 ARG ARG A . n 
C 3 561 GLU 561 567 567 GLU GLU A . n 
C 3 562 SER 562 568 568 SER SER A . n 
C 3 563 ILE 563 569 569 ILE ILE A . n 
C 3 564 GLN 564 570 570 GLN GLN A . n 
C 3 565 GLN 565 571 571 GLN GLN A . n 
C 3 566 THR 566 572 572 THR THR A . n 
C 3 567 LEU 567 573 573 LEU LEU A . n 
C 3 568 VAL 568 574 574 VAL VAL A . n 
C 3 569 GLU 569 575 575 GLU GLU A . n 
C 3 570 SER 570 576 ?   ?   ?   A . n 
C 3 571 SER 571 577 ?   ?   ?   A . n 
C 3 572 GLN 572 578 ?   ?   ?   A . n 
C 3 573 TRP 573 579 ?   ?   ?   A . n 
C 3 574 VAL 574 580 ?   ?   ?   A . n 
C 3 575 ALA 575 581 ?   ?   ?   A . n 
C 3 576 GLY 576 582 ?   ?   ?   A . n 
C 3 577 GLU 577 583 ?   ?   ?   A . n 
C 3 578 GLN 578 584 ?   ?   ?   A . n 
C 3 579 GLN 579 585 ?   ?   ?   A . n 
C 3 580 VAL 580 586 ?   ?   ?   A . n 
C 3 581 LYS 581 587 587 LYS LYS A . n 
C 3 582 TRP 582 588 588 TRP TRP A . n 
C 3 583 LYS 583 589 589 LYS LYS A . n 
C 3 584 ARG 584 590 590 ARG ARG A . n 
C 3 585 ARG 585 591 591 ARG ARG A . n 
C 3 586 TRP 586 592 592 TRP TRP A . n 
C 3 587 ILE 587 593 593 ILE ILE A . n 
C 3 588 LYS 588 594 594 LYS LYS A . n 
C 3 589 GLY 589 595 595 GLY GLY A . n 
C 3 590 LEU 590 596 596 LEU LEU A . n 
C 3 591 ASP 591 597 597 ASP ASP A . n 
C 3 592 GLY 592 598 598 GLY GLY A . n 
C 3 593 ARG 593 599 599 ARG ARG A . n 
C 3 594 LYS 594 600 600 LYS LYS A . n 
C 3 595 VAL 595 601 601 VAL VAL A . n 
C 3 596 HIS 596 602 602 HIS HIS A . n 
C 3 597 VAL 597 603 603 VAL VAL A . n 
C 3 598 ARG 598 604 604 ARG ARG A . n 
C 3 599 SER 599 605 605 SER SER A . n 
C 3 600 PRO 600 606 606 PRO PRO A . n 
C 3 601 HIS 601 607 607 HIS HIS A . n 
C 3 602 ALA 602 608 608 ALA ALA A . n 
C 3 603 ALA 603 609 609 ALA ALA A . n 
C 3 604 LEU 604 610 610 LEU LEU A . n 
C 3 605 ASN 605 611 611 ASN ASN A . n 
C 3 606 THR 606 612 612 THR THR A . n 
C 3 607 LEU 607 613 613 LEU LEU A . n 
C 3 608 LEU 608 614 614 LEU LEU A . n 
C 3 609 GLN 609 615 615 GLN GLN A . n 
C 3 610 SER 610 616 616 SER SER A . n 
C 3 611 ALA 611 617 617 ALA ALA A . n 
C 3 612 GLY 612 618 618 GLY GLY A . n 
C 3 613 ALA 613 619 619 ALA ALA A . n 
C 3 614 LEU 614 620 620 LEU LEU A . n 
C 3 615 ILE 615 621 621 ILE ILE A . n 
C 3 616 CYS 616 622 622 CYS CYS A . n 
C 3 617 LYS 617 623 623 LYS LYS A . n 
C 3 618 LEU 618 624 624 LEU LEU A . n 
C 3 619 TRP 619 625 625 TRP TRP A . n 
C 3 620 ILE 620 626 626 ILE ILE A . n 
C 3 621 ILE 621 627 627 ILE ILE A . n 
C 3 622 LYS 622 628 628 LYS LYS A . n 
C 3 623 THR 623 629 629 THR THR A . n 
C 3 624 GLU 624 630 630 GLU GLU A . n 
C 3 625 GLU 625 631 631 GLU GLU A . n 
C 3 626 MET 626 632 632 MET MET A . n 
C 3 627 LEU 627 633 633 LEU LEU A . n 
C 3 628 VAL 628 634 634 VAL VAL A . n 
C 3 629 GLU 629 635 635 GLU GLU A . n 
C 3 630 LYS 630 636 636 LYS LYS A . n 
C 3 631 GLY 631 637 637 GLY GLY A . n 
C 3 632 LEU 632 638 638 LEU LEU A . n 
C 3 633 LYS 633 639 639 LYS LYS A . n 
C 3 634 HIS 634 640 640 HIS HIS A . n 
C 3 635 GLY 635 641 641 GLY GLY A . n 
C 3 636 TRP 636 642 642 TRP TRP A . n 
C 3 637 ASP 637 643 643 ASP ASP A . n 
C 3 638 GLY 638 644 644 GLY GLY A . n 
C 3 639 ASP 639 645 645 ASP ASP A . n 
C 3 640 PHE 640 646 646 PHE PHE A . n 
C 3 641 ALA 641 647 647 ALA ALA A . n 
C 3 642 TYR 642 648 648 TYR TYR A . n 
C 3 643 MET 643 649 649 MET MET A . n 
C 3 644 ALA 644 650 650 ALA ALA A . n 
C 3 645 TRP 645 651 651 TRP TRP A . n 
C 3 646 VAL 646 652 652 VAL VAL A . n 
C 3 647 HIS 647 653 653 HIS HIS A . n 
C 3 648 ASP 648 654 654 ASP ASP A . n 
C 3 649 GLU 649 655 655 GLU GLU A . n 
C 3 650 ILE 650 656 656 ILE ILE A . n 
C 3 651 GLN 651 657 657 GLN GLN A . n 
C 3 652 VAL 652 658 658 VAL VAL A . n 
C 3 653 GLY 653 659 659 GLY GLY A . n 
C 3 654 CYS 654 660 660 CYS CYS A . n 
C 3 655 ARG 655 661 661 ARG ARG A . n 
C 3 656 THR 656 662 662 THR THR A . n 
C 3 657 GLU 657 663 663 GLU GLU A . n 
C 3 658 GLU 658 664 664 GLU GLU A . n 
C 3 659 ILE 659 665 665 ILE ILE A . n 
C 3 660 ALA 660 666 666 ALA ALA A . n 
C 3 661 GLN 661 667 667 GLN GLN A . n 
C 3 662 VAL 662 668 668 VAL VAL A . n 
C 3 663 VAL 663 669 669 VAL VAL A . n 
C 3 664 ILE 664 670 670 ILE ILE A . n 
C 3 665 GLU 665 671 671 GLU GLU A . n 
C 3 666 THR 666 672 672 THR THR A . n 
C 3 667 ALA 667 673 673 ALA ALA A . n 
C 3 668 GLN 668 674 674 GLN GLN A . n 
C 3 669 GLU 669 675 675 GLU GLU A . n 
C 3 670 ALA 670 676 676 ALA ALA A . n 
C 3 671 MET 671 677 677 MET MET A . n 
C 3 672 ARG 672 678 678 ARG ARG A . n 
C 3 673 TRP 673 679 679 TRP TRP A . n 
C 3 674 VAL 674 680 680 VAL VAL A . n 
C 3 675 GLY 675 681 681 GLY GLY A . n 
C 3 676 ASP 676 682 682 ASP ASP A . n 
C 3 677 HIS 677 683 683 HIS HIS A . n 
C 3 678 TRP 678 684 684 TRP TRP A . n 
C 3 679 ASN 679 685 685 ASN ASN A . n 
C 3 680 PHE 680 686 686 PHE PHE A . n 
C 3 681 ARG 681 687 687 ARG ARG A . n 
C 3 682 CYS 682 688 688 CYS CYS A . n 
C 3 683 LEU 683 689 689 LEU LEU A . n 
C 3 684 LEU 684 690 690 LEU LEU A . n 
C 3 685 ASP 685 691 691 ASP ASP A . n 
C 3 686 THR 686 692 692 THR THR A . n 
C 3 687 GLU 687 693 693 GLU GLU A . n 
C 3 688 GLY 688 694 694 GLY GLY A . n 
C 3 689 LYS 689 695 695 LYS LYS A . n 
C 3 690 MET 690 696 696 MET MET A . n 
C 3 691 GLY 691 697 697 GLY GLY A . n 
C 3 692 PRO 692 698 698 PRO PRO A . n 
C 3 693 ASN 693 699 699 ASN ASN A . n 
C 3 694 TRP 694 700 700 TRP TRP A . n 
C 3 695 ALA 695 701 701 ALA ALA A . n 
C 3 696 ILE 696 702 702 ILE ILE A . n 
C 3 697 CYS 697 703 703 CYS CYS A . n 
C 3 698 HIS 698 704 704 HIS HIS A . n 
D 4 1   SER 1   1   ?   ?   ?   B . n 
D 4 2   ASP 2   2   ?   ?   ?   B . n 
D 4 3   LYS 3   3   3   LYS LYS B . n 
D 4 4   ILE 4   4   4   ILE ILE B . n 
D 4 5   ILE 5   5   5   ILE ILE B . n 
D 4 6   HIS 6   6   6   HIS HIS B . n 
D 4 7   LEU 7   7   7   LEU LEU B . n 
D 4 8   THR 8   8   8   THR THR B . n 
D 4 9   ASP 9   9   9   ASP ASP B . n 
D 4 10  ASP 10  10  10  ASP ASP B . n 
D 4 11  SER 11  11  11  SER SER B . n 
D 4 12  PHE 12  12  12  PHE PHE B . n 
D 4 13  ASP 13  13  13  ASP ASP B . n 
D 4 14  THR 14  14  14  THR THR B . n 
D 4 15  ASP 15  15  15  ASP ASP B . n 
D 4 16  VAL 16  16  16  VAL VAL B . n 
D 4 17  LEU 17  17  17  LEU LEU B . n 
D 4 18  LYS 18  18  18  LYS LYS B . n 
D 4 19  ALA 19  19  19  ALA ALA B . n 
D 4 20  ASP 20  20  20  ASP ASP B . n 
D 4 21  GLY 21  21  21  GLY GLY B . n 
D 4 22  ALA 22  22  22  ALA ALA B . n 
D 4 23  ILE 23  23  23  ILE ILE B . n 
D 4 24  LEU 24  24  24  LEU LEU B . n 
D 4 25  VAL 25  25  25  VAL VAL B . n 
D 4 26  ASP 26  26  26  ASP ASP B . n 
D 4 27  PHE 27  27  27  PHE PHE B . n 
D 4 28  TRP 28  28  28  TRP TRP B . n 
D 4 29  ALA 29  29  29  ALA ALA B . n 
D 4 30  GLU 30  30  30  GLU GLU B . n 
D 4 31  TRP 31  31  31  TRP TRP B . n 
D 4 32  CYS 32  32  32  CYS CYS B . n 
D 4 33  GLY 33  33  33  GLY GLY B . n 
D 4 34  PRO 34  34  34  PRO PRO B . n 
D 4 35  CYS 35  35  35  CYS CYS B . n 
D 4 36  LYS 36  36  36  LYS LYS B . n 
D 4 37  MET 37  37  37  MET MET B . n 
D 4 38  ILE 38  38  38  ILE ILE B . n 
D 4 39  ALA 39  39  39  ALA ALA B . n 
D 4 40  PRO 40  40  40  PRO PRO B . n 
D 4 41  ILE 41  41  41  ILE ILE B . n 
D 4 42  LEU 42  42  42  LEU LEU B . n 
D 4 43  ASP 43  43  43  ASP ASP B . n 
D 4 44  GLU 44  44  44  GLU GLU B . n 
D 4 45  ILE 45  45  45  ILE ILE B . n 
D 4 46  ALA 46  46  46  ALA ALA B . n 
D 4 47  ASP 47  47  47  ASP ASP B . n 
D 4 48  GLU 48  48  48  GLU GLU B . n 
D 4 49  TYR 49  49  49  TYR TYR B . n 
D 4 50  GLN 50  50  50  GLN GLN B . n 
D 4 51  GLY 51  51  51  GLY GLY B . n 
D 4 52  LYS 52  52  52  LYS LYS B . n 
D 4 53  LEU 53  53  53  LEU LEU B . n 
D 4 54  THR 54  54  54  THR THR B . n 
D 4 55  VAL 55  55  55  VAL VAL B . n 
D 4 56  ALA 56  56  56  ALA ALA B . n 
D 4 57  LYS 57  57  57  LYS LYS B . n 
D 4 58  LEU 58  58  58  LEU LEU B . n 
D 4 59  ASN 59  59  59  ASN ASN B . n 
D 4 60  ILE 60  60  60  ILE ILE B . n 
D 4 61  ASP 61  61  61  ASP ASP B . n 
D 4 62  GLN 62  62  62  GLN GLN B . n 
D 4 63  ASN 63  63  63  ASN ASN B . n 
D 4 64  PRO 64  64  64  PRO PRO B . n 
D 4 65  GLY 65  65  65  GLY GLY B . n 
D 4 66  THR 66  66  66  THR THR B . n 
D 4 67  ALA 67  67  67  ALA ALA B . n 
D 4 68  PRO 68  68  68  PRO PRO B . n 
D 4 69  LYS 69  69  69  LYS LYS B . n 
D 4 70  TYR 70  70  70  TYR TYR B . n 
D 4 71  GLY 71  71  71  GLY GLY B . n 
D 4 72  ILE 72  72  72  ILE ILE B . n 
D 4 73  ARG 73  73  73  ARG ARG B . n 
D 4 74  GLY 74  74  74  GLY GLY B . n 
D 4 75  ILE 75  75  75  ILE ILE B . n 
D 4 76  PRO 76  76  76  PRO PRO B . n 
D 4 77  THR 77  77  77  THR THR B . n 
D 4 78  LEU 78  78  78  LEU LEU B . n 
D 4 79  LEU 79  79  79  LEU LEU B . n 
D 4 80  LEU 80  80  80  LEU LEU B . n 
D 4 81  PHE 81  81  81  PHE PHE B . n 
D 4 82  LYS 82  82  82  LYS LYS B . n 
D 4 83  ASN 83  83  83  ASN ASN B . n 
D 4 84  GLY 84  84  84  GLY GLY B . n 
D 4 85  GLU 85  85  85  GLU GLU B . n 
D 4 86  VAL 86  86  86  VAL VAL B . n 
D 4 87  ALA 87  87  87  ALA ALA B . n 
D 4 88  ALA 88  88  88  ALA ALA B . n 
D 4 89  THR 89  89  89  THR THR B . n 
D 4 90  LYS 90  90  90  LYS LYS B . n 
D 4 91  VAL 91  91  91  VAL VAL B . n 
D 4 92  GLY 92  92  92  GLY GLY B . n 
D 4 93  ALA 93  93  93  ALA ALA B . n 
D 4 94  LEU 94  94  94  LEU LEU B . n 
D 4 95  SER 95  95  95  SER SER B . n 
D 4 96  LYS 96  96  96  LYS LYS B . n 
D 4 97  GLY 97  97  97  GLY GLY B . n 
D 4 98  GLN 98  98  98  GLN GLN B . n 
D 4 99  LEU 99  99  99  LEU LEU B . n 
D 4 100 LYS 100 100 100 LYS LYS B . n 
D 4 101 GLU 101 101 101 GLU GLU B . n 
D 4 102 PHE 102 102 102 PHE PHE B . n 
D 4 103 LEU 103 103 103 LEU LEU B . n 
D 4 104 ASP 104 104 104 ASP ASP B . n 
D 4 105 ALA 105 105 105 ALA ALA B . n 
D 4 106 ASN 106 106 106 ASN ASN B . n 
D 4 107 LEU 107 107 107 LEU LEU B . n 
D 4 108 ALA 108 108 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 MG  1   4003 4003 MG  MG  A . 
F 6 HOH 1   5006 5006 HOH HOH P . 
F 6 HOH 2   5091 5091 HOH HOH P . 
F 6 HOH 3   5101 5101 HOH HOH P . 
F 6 HOH 4   5120 5120 HOH HOH P . 
F 6 HOH 5   5122 5122 HOH HOH P . 
F 6 HOH 6   5137 5137 HOH HOH P . 
F 6 HOH 7   5143 5143 HOH HOH P . 
F 6 HOH 8   5195 5195 HOH HOH P . 
G 6 HOH 1   5008 5008 HOH HOH T . 
G 6 HOH 2   5018 5018 HOH HOH T . 
G 6 HOH 3   5029 5029 HOH HOH T . 
G 6 HOH 4   5068 5068 HOH HOH T . 
G 6 HOH 5   5074 5074 HOH HOH T . 
G 6 HOH 6   5081 5081 HOH HOH T . 
G 6 HOH 7   5109 5109 HOH HOH T . 
G 6 HOH 8   5124 5124 HOH HOH T . 
G 6 HOH 9   5131 5131 HOH HOH T . 
G 6 HOH 10  5141 5141 HOH HOH T . 
G 6 HOH 11  5196 5196 HOH HOH T . 
H 6 HOH 1   5001 5001 HOH HOH A . 
H 6 HOH 2   5002 5002 HOH HOH A . 
H 6 HOH 3   5003 5003 HOH HOH A . 
H 6 HOH 4   5004 5004 HOH HOH A . 
H 6 HOH 5   5005 5005 HOH HOH A . 
H 6 HOH 6   5007 5007 HOH HOH A . 
H 6 HOH 7   5009 5009 HOH HOH A . 
H 6 HOH 8   5010 5010 HOH HOH A . 
H 6 HOH 9   5011 5011 HOH HOH A . 
H 6 HOH 10  5012 5012 HOH HOH A . 
H 6 HOH 11  5013 5013 HOH HOH A . 
H 6 HOH 12  5014 5014 HOH HOH A . 
H 6 HOH 13  5015 5015 HOH HOH A . 
H 6 HOH 14  5016 5016 HOH HOH A . 
H 6 HOH 15  5017 5017 HOH HOH A . 
H 6 HOH 16  5019 5019 HOH HOH A . 
H 6 HOH 17  5021 5021 HOH HOH A . 
H 6 HOH 18  5022 5022 HOH HOH A . 
H 6 HOH 19  5023 5023 HOH HOH A . 
H 6 HOH 20  5024 5024 HOH HOH A . 
H 6 HOH 21  5025 5025 HOH HOH A . 
H 6 HOH 22  5027 5027 HOH HOH A . 
H 6 HOH 23  5028 5028 HOH HOH A . 
H 6 HOH 24  5030 5030 HOH HOH A . 
H 6 HOH 25  5031 5031 HOH HOH A . 
H 6 HOH 26  5032 5032 HOH HOH A . 
H 6 HOH 27  5033 5033 HOH HOH A . 
H 6 HOH 28  5034 5034 HOH HOH A . 
H 6 HOH 29  5035 5035 HOH HOH A . 
H 6 HOH 30  5036 5036 HOH HOH A . 
H 6 HOH 31  5037 5037 HOH HOH A . 
H 6 HOH 32  5038 5038 HOH HOH A . 
H 6 HOH 33  5039 5039 HOH HOH A . 
H 6 HOH 34  5040 5040 HOH HOH A . 
H 6 HOH 35  5041 5041 HOH HOH A . 
H 6 HOH 36  5042 5042 HOH HOH A . 
H 6 HOH 37  5043 5043 HOH HOH A . 
H 6 HOH 38  5044 5044 HOH HOH A . 
H 6 HOH 39  5045 5045 HOH HOH A . 
H 6 HOH 40  5046 5046 HOH HOH A . 
H 6 HOH 41  5047 5047 HOH HOH A . 
H 6 HOH 42  5048 5048 HOH HOH A . 
H 6 HOH 43  5049 5049 HOH HOH A . 
H 6 HOH 44  5050 5050 HOH HOH A . 
H 6 HOH 45  5052 5052 HOH HOH A . 
H 6 HOH 46  5053 5053 HOH HOH A . 
H 6 HOH 47  5054 5054 HOH HOH A . 
H 6 HOH 48  5055 5055 HOH HOH A . 
H 6 HOH 49  5056 5056 HOH HOH A . 
H 6 HOH 50  5057 5057 HOH HOH A . 
H 6 HOH 51  5059 5059 HOH HOH A . 
H 6 HOH 52  5060 5060 HOH HOH A . 
H 6 HOH 53  5061 5061 HOH HOH A . 
H 6 HOH 54  5062 5062 HOH HOH A . 
H 6 HOH 55  5063 5063 HOH HOH A . 
H 6 HOH 56  5064 5064 HOH HOH A . 
H 6 HOH 57  5065 5065 HOH HOH A . 
H 6 HOH 58  5066 5066 HOH HOH A . 
H 6 HOH 59  5067 5067 HOH HOH A . 
H 6 HOH 60  5069 5069 HOH HOH A . 
H 6 HOH 61  5070 5070 HOH HOH A . 
H 6 HOH 62  5072 5072 HOH HOH A . 
H 6 HOH 63  5073 5073 HOH HOH A . 
H 6 HOH 64  5075 5075 HOH HOH A . 
H 6 HOH 65  5076 5076 HOH HOH A . 
H 6 HOH 66  5077 5077 HOH HOH A . 
H 6 HOH 67  5079 5079 HOH HOH A . 
H 6 HOH 68  5080 5080 HOH HOH A . 
H 6 HOH 69  5082 5082 HOH HOH A . 
H 6 HOH 70  5083 5083 HOH HOH A . 
H 6 HOH 71  5084 5084 HOH HOH A . 
H 6 HOH 72  5085 5085 HOH HOH A . 
H 6 HOH 73  5086 5086 HOH HOH A . 
H 6 HOH 74  5087 5087 HOH HOH A . 
H 6 HOH 75  5088 5088 HOH HOH A . 
H 6 HOH 76  5089 5089 HOH HOH A . 
H 6 HOH 77  5090 5090 HOH HOH A . 
H 6 HOH 78  5092 5092 HOH HOH A . 
H 6 HOH 79  5093 5093 HOH HOH A . 
H 6 HOH 80  5094 5094 HOH HOH A . 
H 6 HOH 81  5095 5095 HOH HOH A . 
H 6 HOH 82  5096 5096 HOH HOH A . 
H 6 HOH 83  5097 5097 HOH HOH A . 
H 6 HOH 84  5098 5098 HOH HOH A . 
H 6 HOH 85  5099 5099 HOH HOH A . 
H 6 HOH 86  5100 5100 HOH HOH A . 
H 6 HOH 87  5102 5102 HOH HOH A . 
H 6 HOH 88  5104 5104 HOH HOH A . 
H 6 HOH 89  5105 5105 HOH HOH A . 
H 6 HOH 90  5106 5106 HOH HOH A . 
H 6 HOH 91  5107 5107 HOH HOH A . 
H 6 HOH 92  5108 5108 HOH HOH A . 
H 6 HOH 93  5110 5110 HOH HOH A . 
H 6 HOH 94  5111 5111 HOH HOH A . 
H 6 HOH 95  5112 5112 HOH HOH A . 
H 6 HOH 96  5113 5113 HOH HOH A . 
H 6 HOH 97  5114 5114 HOH HOH A . 
H 6 HOH 98  5115 5115 HOH HOH A . 
H 6 HOH 99  5117 5117 HOH HOH A . 
H 6 HOH 100 5118 5118 HOH HOH A . 
H 6 HOH 101 5119 5119 HOH HOH A . 
H 6 HOH 102 5121 5121 HOH HOH A . 
H 6 HOH 103 5123 5123 HOH HOH A . 
H 6 HOH 104 5125 5125 HOH HOH A . 
H 6 HOH 105 5126 5126 HOH HOH A . 
H 6 HOH 106 5127 5127 HOH HOH A . 
H 6 HOH 107 5128 5128 HOH HOH A . 
H 6 HOH 108 5129 5129 HOH HOH A . 
H 6 HOH 109 5130 5130 HOH HOH A . 
H 6 HOH 110 5132 5132 HOH HOH A . 
H 6 HOH 111 5133 5133 HOH HOH A . 
H 6 HOH 112 5134 5134 HOH HOH A . 
H 6 HOH 113 5136 5136 HOH HOH A . 
H 6 HOH 114 5138 5138 HOH HOH A . 
H 6 HOH 115 5139 5139 HOH HOH A . 
H 6 HOH 116 5140 5140 HOH HOH A . 
H 6 HOH 117 5142 5142 HOH HOH A . 
H 6 HOH 118 5144 5144 HOH HOH A . 
H 6 HOH 119 5145 5145 HOH HOH A . 
H 6 HOH 120 5146 5146 HOH HOH A . 
H 6 HOH 121 5147 5147 HOH HOH A . 
H 6 HOH 122 5148 5148 HOH HOH A . 
H 6 HOH 123 5149 5149 HOH HOH A . 
H 6 HOH 124 5150 5150 HOH HOH A . 
H 6 HOH 125 5151 5151 HOH HOH A . 
H 6 HOH 126 5152 5152 HOH HOH A . 
H 6 HOH 127 5153 5153 HOH HOH A . 
H 6 HOH 128 5154 5154 HOH HOH A . 
H 6 HOH 129 5156 5156 HOH HOH A . 
H 6 HOH 130 5157 5157 HOH HOH A . 
H 6 HOH 131 5158 5158 HOH HOH A . 
H 6 HOH 132 5161 5161 HOH HOH A . 
H 6 HOH 133 5162 5162 HOH HOH A . 
H 6 HOH 134 5163 5163 HOH HOH A . 
H 6 HOH 135 5164 5164 HOH HOH A . 
H 6 HOH 136 5165 5165 HOH HOH A . 
H 6 HOH 137 5166 5166 HOH HOH A . 
H 6 HOH 138 5167 5167 HOH HOH A . 
H 6 HOH 139 5168 5168 HOH HOH A . 
H 6 HOH 140 5169 5169 HOH HOH A . 
H 6 HOH 141 5170 5170 HOH HOH A . 
H 6 HOH 142 5171 5171 HOH HOH A . 
H 6 HOH 143 5172 5172 HOH HOH A . 
H 6 HOH 144 5173 5173 HOH HOH A . 
H 6 HOH 145 5174 5174 HOH HOH A . 
H 6 HOH 146 5175 5175 HOH HOH A . 
H 6 HOH 147 5176 5176 HOH HOH A . 
H 6 HOH 148 5177 5177 HOH HOH A . 
H 6 HOH 149 5180 5180 HOH HOH A . 
H 6 HOH 150 5181 5181 HOH HOH A . 
H 6 HOH 151 5183 5183 HOH HOH A . 
H 6 HOH 152 5184 5184 HOH HOH A . 
H 6 HOH 153 5185 5185 HOH HOH A . 
H 6 HOH 154 5188 5188 HOH HOH A . 
H 6 HOH 155 5189 5189 HOH HOH A . 
H 6 HOH 156 5191 5191 HOH HOH A . 
H 6 HOH 157 5192 5192 HOH HOH A . 
H 6 HOH 158 5193 5193 HOH HOH A . 
H 6 HOH 159 5194 5194 HOH HOH A . 
H 6 HOH 160 5198 5198 HOH HOH A . 
H 6 HOH 161 5199 5199 HOH HOH A . 
H 6 HOH 162 5201 5201 HOH HOH A . 
H 6 HOH 163 5202 5202 HOH HOH A . 
H 6 HOH 164 5203 5203 HOH HOH A . 
H 6 HOH 165 5204 5204 HOH HOH A . 
H 6 HOH 166 5205 5205 HOH HOH A . 
H 6 HOH 167 5206 5206 HOH HOH A . 
I 6 HOH 1   5020 5020 HOH HOH B . 
I 6 HOH 2   5051 5051 HOH HOH B . 
I 6 HOH 3   5058 5058 HOH HOH B . 
I 6 HOH 4   5071 5071 HOH HOH B . 
I 6 HOH 5   5078 5078 HOH HOH B . 
I 6 HOH 6   5103 5103 HOH HOH B . 
I 6 HOH 7   5116 5116 HOH HOH B . 
I 6 HOH 8   5135 5135 HOH HOH B . 
I 6 HOH 9   5155 5155 HOH HOH B . 
I 6 HOH 10  5159 5159 HOH HOH B . 
I 6 HOH 11  5160 5160 HOH HOH B . 
I 6 HOH 12  5178 5178 HOH HOH B . 
I 6 HOH 13  5190 5190 HOH HOH B . 
I 6 HOH 14  5197 5197 HOH HOH B . 
I 6 HOH 15  5200 5200 HOH HOH B . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    2DT 
_pdbx_struct_mod_residue.label_seq_id     21 
_pdbx_struct_mod_residue.auth_asym_id     P 
_pdbx_struct_mod_residue.auth_comp_id     2DT 
_pdbx_struct_mod_residue.auth_seq_id      21 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   DT 
_pdbx_struct_mod_residue.details          "3'-DEOXYTHYMIDINE-5'-MONOPHOSPHATE" 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? H HOH . ? A HOH 5203 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 O   ? H HOH . ? A HOH 5030 ? 1_555 158.9 ? 
2  O   ? H HOH . ? A HOH 5203 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 O   ? H HOH . ? A HOH 5202 ? 1_555 83.7  ? 
3  O   ? H HOH . ? A HOH 5030 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 O   ? H HOH . ? A HOH 5202 ? 1_555 97.9  ? 
4  O   ? H HOH . ? A HOH 5203 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 OD1 ? C ASP 5 ? A ASP 5    ? 1_555 75.0  ? 
5  O   ? H HOH . ? A HOH 5030 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 OD1 ? C ASP 5 ? A ASP 5    ? 1_555 84.3  ? 
6  O   ? H HOH . ? A HOH 5202 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 OD1 ? C ASP 5 ? A ASP 5    ? 1_555 82.0  ? 
7  O   ? H HOH . ? A HOH 5203 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 O   ? H HOH . ? A HOH 5204 ? 1_555 79.7  ? 
8  O   ? H HOH . ? A HOH 5030 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 O   ? H HOH . ? A HOH 5204 ? 1_555 89.7  ? 
9  O   ? H HOH . ? A HOH 5202 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 O   ? H HOH . ? A HOH 5204 ? 1_555 151.2 ? 
10 OD1 ? C ASP 5 ? A ASP 5    ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 O   ? H HOH . ? A HOH 5204 ? 1_555 71.1  ? 
11 O   ? H HOH . ? A HOH 5203 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 O   ? H HOH . ? A HOH 5206 ? 1_555 117.3 ? 
12 O   ? H HOH . ? A HOH 5030 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 O   ? H HOH . ? A HOH 5206 ? 1_555 82.2  ? 
13 O   ? H HOH . ? A HOH 5202 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 O   ? H HOH . ? A HOH 5206 ? 1_555 109.3 ? 
14 OD1 ? C ASP 5 ? A ASP 5    ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 O   ? H HOH . ? A HOH 5206 ? 1_555 163.5 ? 
15 O   ? H HOH . ? A HOH 5204 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 O   ? H HOH . ? A HOH 5206 ? 1_555 99.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-07-06 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       . ? 1 
HKL-2000  'data reduction' . ? 2 
SCALEPACK 'data scaling'   . ? 3 
EPMR      phasing          . ? 4 
# 
_pdbx_database_remark.id     600 
_pdbx_database_remark.text   
;HETEROGEN
THERE IS A DD-ATP PRESENT IN THE CRYSTAL BUT
NO DENSITY FOR IT. 
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 10  ? ? -176.66 -179.76 
2  1 TYR A 64  ? ? -120.19 -78.29  
3  1 HIS A 99  ? ? -107.89 45.09   
4  1 GLU A 148 ? ? -66.42  22.66   
5  1 ASP A 156 ? ? 8.58    -84.73  
6  1 ARG A 278 ? ? -77.03  -73.85  
7  1 LYS A 302 ? ? -160.57 66.76   
8  1 ARG A 318 ? ? -43.39  165.87  
9  1 LYS A 359 ? ? -164.11 1.82    
10 1 ALA A 400 ? ? -138.99 -39.64  
11 1 ASN A 423 ? ? -145.52 41.16   
12 1 TYR A 447 ? ? 69.83   -0.15   
13 1 GLU A 514 ? ? -59.75  78.51   
14 1 PRO A 516 ? ? -60.56  -89.73  
15 1 ALA A 532 ? ? -177.64 124.42  
16 1 GLU A 535 ? ? -59.67  -77.83  
17 1 ALA A 543 ? ? -60.80  -158.22 
18 1 GLU A 546 ? ? -67.69  -84.83  
19 1 ARG A 590 ? ? -170.13 124.46  
20 1 VAL A 652 ? ? -112.64 74.96   
21 1 HIS A 653 ? ? 69.92   -72.96  
22 1 CYS A 703 ? ? -90.29  41.45   
23 1 VAL B 16  ? ? -107.30 -62.02  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    DG 
_pdbx_validate_planes.auth_asym_id    T 
_pdbx_validate_planes.auth_seq_id     8 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.053 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LYS 114 ? CG  ? C LYS 114 CG  
2   1 Y 1 A LYS 114 ? CD  ? C LYS 114 CD  
3   1 Y 1 A LYS 114 ? CE  ? C LYS 114 CE  
4   1 Y 1 A LYS 114 ? NZ  ? C LYS 114 NZ  
5   1 Y 1 A ASP 156 ? CG  ? C ASP 150 CG  
6   1 Y 1 A ASP 156 ? OD1 ? C ASP 150 OD1 
7   1 Y 1 A ASP 156 ? OD2 ? C ASP 150 OD2 
8   1 Y 1 A GLU 166 ? CG  ? C GLU 160 CG  
9   1 Y 1 A GLU 166 ? CD  ? C GLU 160 CD  
10  1 Y 1 A GLU 166 ? OE1 ? C GLU 160 OE1 
11  1 Y 1 A GLU 166 ? OE2 ? C GLU 160 OE2 
12  1 Y 1 A LYS 189 ? CG  ? C LYS 183 CG  
13  1 Y 1 A LYS 189 ? CD  ? C LYS 183 CD  
14  1 Y 1 A LYS 189 ? CE  ? C LYS 183 CE  
15  1 Y 1 A LYS 189 ? NZ  ? C LYS 183 NZ  
16  1 Y 1 A GLU 259 ? CG  ? C GLU 253 CG  
17  1 Y 1 A GLU 259 ? CD  ? C GLU 253 CD  
18  1 Y 1 A GLU 259 ? OE1 ? C GLU 253 OE1 
19  1 Y 1 A GLU 259 ? OE2 ? C GLU 253 OE2 
20  1 Y 1 A LYS 268 ? CD  ? C LYS 262 CD  
21  1 Y 1 A LYS 268 ? CE  ? C LYS 262 CE  
22  1 Y 1 A LYS 268 ? NZ  ? C LYS 262 NZ  
23  1 Y 1 A LYS 281 ? CG  ? C LYS 275 CG  
24  1 Y 1 A LYS 281 ? CD  ? C LYS 275 CD  
25  1 Y 1 A LYS 281 ? CE  ? C LYS 275 CE  
26  1 Y 1 A LYS 281 ? NZ  ? C LYS 275 NZ  
27  1 Y 1 A LYS 285 ? CG  ? C LYS 279 CG  
28  1 Y 1 A LYS 285 ? CD  ? C LYS 279 CD  
29  1 Y 1 A LYS 285 ? CE  ? C LYS 279 CE  
30  1 Y 1 A LYS 285 ? NZ  ? C LYS 279 NZ  
31  1 Y 1 A LYS 293 ? CG  ? C LYS 287 CG  
32  1 Y 1 A LYS 293 ? CD  ? C LYS 287 CD  
33  1 Y 1 A LYS 293 ? CE  ? C LYS 287 CE  
34  1 Y 1 A LYS 293 ? NZ  ? C LYS 287 NZ  
35  1 Y 1 A ILE 297 ? CD1 ? C ILE 291 CD1 
36  1 Y 1 A LYS 299 ? CG  ? C LYS 293 CG  
37  1 Y 1 A LYS 299 ? CD  ? C LYS 293 CD  
38  1 Y 1 A LYS 299 ? CE  ? C LYS 293 CE  
39  1 Y 1 A LYS 299 ? NZ  ? C LYS 293 NZ  
40  1 Y 1 A LYS 300 ? CG  ? C LYS 294 CG  
41  1 Y 1 A LYS 300 ? CD  ? C LYS 294 CD  
42  1 Y 1 A LYS 300 ? CE  ? C LYS 294 CE  
43  1 Y 1 A LYS 300 ? NZ  ? C LYS 294 NZ  
44  1 Y 1 A LYS 302 ? CG  ? C LYS 296 CG  
45  1 Y 1 A LYS 302 ? CD  ? C LYS 296 CD  
46  1 Y 1 A LYS 302 ? CE  ? C LYS 296 CE  
47  1 Y 1 A LYS 302 ? NZ  ? C LYS 296 NZ  
48  1 Y 1 A ASN 303 ? CG  ? C ASN 297 CG  
49  1 Y 1 A ASN 303 ? OD1 ? C ASN 297 OD1 
50  1 Y 1 A ASN 303 ? ND2 ? C ASN 297 ND2 
51  1 Y 1 A GLU 314 ? CG  ? C GLU 308 CG  
52  1 Y 1 A GLU 314 ? CD  ? C GLU 308 CD  
53  1 Y 1 A GLU 314 ? OE1 ? C GLU 308 OE1 
54  1 Y 1 A GLU 314 ? OE2 ? C GLU 308 OE2 
55  1 Y 1 A THR 317 ? OG1 ? C THR 311 OG1 
56  1 Y 1 A THR 317 ? CG2 ? C THR 311 CG2 
57  1 Y 1 A ARG 318 ? CG  ? C ARG 312 CG  
58  1 Y 1 A ARG 318 ? CD  ? C ARG 312 CD  
59  1 Y 1 A ARG 318 ? NE  ? C ARG 312 NE  
60  1 Y 1 A ARG 318 ? CZ  ? C ARG 312 CZ  
61  1 Y 1 A ARG 318 ? NH1 ? C ARG 312 NH1 
62  1 Y 1 A ARG 318 ? NH2 ? C ARG 312 NH2 
63  1 Y 1 A LYS 359 ? CD  ? C LYS 353 CD  
64  1 Y 1 A LYS 359 ? CE  ? C LYS 353 CE  
65  1 Y 1 A LYS 359 ? NZ  ? C LYS 353 NZ  
66  1 Y 1 A ARG 444 ? CG  ? C ARG 438 CG  
67  1 Y 1 A ARG 444 ? CD  ? C ARG 438 CD  
68  1 Y 1 A ARG 444 ? NE  ? C ARG 438 NE  
69  1 Y 1 A ARG 444 ? CZ  ? C ARG 438 CZ  
70  1 Y 1 A ARG 444 ? NH1 ? C ARG 438 NH1 
71  1 Y 1 A ARG 444 ? NH2 ? C ARG 438 NH2 
72  1 Y 1 A GLU 495 ? CG  ? C GLU 489 CG  
73  1 Y 1 A GLU 495 ? CD  ? C GLU 489 CD  
74  1 Y 1 A GLU 495 ? OE1 ? C GLU 489 OE1 
75  1 Y 1 A GLU 495 ? OE2 ? C GLU 489 OE2 
76  1 Y 1 A THR 507 ? OG1 ? C THR 501 OG1 
77  1 Y 1 A THR 507 ? CG2 ? C THR 501 CG2 
78  1 Y 1 A GLN 510 ? CG  ? C GLN 504 CG  
79  1 Y 1 A GLN 510 ? CD  ? C GLN 504 CD  
80  1 Y 1 A GLN 510 ? OE1 ? C GLN 504 OE1 
81  1 Y 1 A GLN 510 ? NE2 ? C GLN 504 NE2 
82  1 Y 1 A LEU 515 ? CG  ? C LEU 509 CG  
83  1 Y 1 A LEU 515 ? CD1 ? C LEU 509 CD1 
84  1 Y 1 A LEU 515 ? CD2 ? C LEU 509 CD2 
85  1 Y 1 A THR 517 ? OG1 ? C THR 511 OG1 
86  1 Y 1 A THR 517 ? CG2 ? C THR 511 CG2 
87  1 Y 1 A THR 523 ? OG1 ? C THR 517 OG1 
88  1 Y 1 A THR 523 ? CG2 ? C THR 517 CG2 
89  1 Y 1 A ASP 534 ? O   ? C ASP 528 O   
90  1 Y 1 A ASP 534 ? CG  ? C ASP 528 CG  
91  1 Y 1 A ASP 534 ? OD1 ? C ASP 528 OD1 
92  1 Y 1 A ASP 534 ? OD2 ? C ASP 528 OD2 
93  1 Y 1 A GLU 535 ? CG  ? C GLU 529 CG  
94  1 Y 1 A GLU 535 ? CD  ? C GLU 529 CD  
95  1 Y 1 A GLU 535 ? OE1 ? C GLU 529 OE1 
96  1 Y 1 A GLU 535 ? OE2 ? C GLU 529 OE2 
97  1 Y 1 A LYS 536 ? CG  ? C LYS 530 CG  
98  1 Y 1 A LYS 536 ? CD  ? C LYS 530 CD  
99  1 Y 1 A LYS 536 ? CE  ? C LYS 530 CE  
100 1 Y 1 A LYS 536 ? NZ  ? C LYS 530 NZ  
101 1 Y 1 A ILE 537 ? CG1 ? C ILE 531 CG1 
102 1 Y 1 A ILE 537 ? CG2 ? C ILE 531 CG2 
103 1 Y 1 A ILE 537 ? CD1 ? C ILE 531 CD1 
104 1 Y 1 A GLN 539 ? CG  ? C GLN 533 CG  
105 1 Y 1 A GLN 539 ? CD  ? C GLN 533 CD  
106 1 Y 1 A GLN 539 ? OE1 ? C GLN 533 OE1 
107 1 Y 1 A GLN 539 ? NE2 ? C GLN 533 NE2 
108 1 Y 1 A ILE 540 ? CG1 ? C ILE 534 CG1 
109 1 Y 1 A ILE 540 ? CG2 ? C ILE 534 CG2 
110 1 Y 1 A ILE 540 ? CD1 ? C ILE 534 CD1 
111 1 Y 1 A VAL 541 ? CG1 ? C VAL 535 CG1 
112 1 Y 1 A VAL 541 ? CG2 ? C VAL 535 CG2 
113 1 Y 1 A LYS 545 ? CG  ? C LYS 539 CG  
114 1 Y 1 A LYS 545 ? CD  ? C LYS 539 CD  
115 1 Y 1 A LYS 545 ? CE  ? C LYS 539 CE  
116 1 Y 1 A LYS 545 ? NZ  ? C LYS 539 NZ  
117 1 Y 1 A GLU 546 ? CG  ? C GLU 540 CG  
118 1 Y 1 A GLU 546 ? CD  ? C GLU 540 CD  
119 1 Y 1 A GLU 546 ? OE1 ? C GLU 540 OE1 
120 1 Y 1 A GLU 546 ? OE2 ? C GLU 540 OE2 
121 1 Y 1 A ARG 547 ? CG  ? C ARG 541 CG  
122 1 Y 1 A ARG 547 ? CD  ? C ARG 541 CD  
123 1 Y 1 A ARG 547 ? NE  ? C ARG 541 NE  
124 1 Y 1 A ARG 547 ? CZ  ? C ARG 541 CZ  
125 1 Y 1 A ARG 547 ? NH1 ? C ARG 541 NH1 
126 1 Y 1 A ARG 547 ? NH2 ? C ARG 541 NH2 
127 1 Y 1 A LYS 549 ? CG  ? C LYS 543 CG  
128 1 Y 1 A LYS 549 ? CD  ? C LYS 543 CD  
129 1 Y 1 A LYS 549 ? CE  ? C LYS 543 CE  
130 1 Y 1 A LYS 549 ? NZ  ? C LYS 543 NZ  
131 1 Y 1 A GLU 550 ? CG  ? C GLU 544 CG  
132 1 Y 1 A GLU 550 ? CD  ? C GLU 544 CD  
133 1 Y 1 A GLU 550 ? OE1 ? C GLU 544 OE1 
134 1 Y 1 A GLU 550 ? OE2 ? C GLU 544 OE2 
135 1 Y 1 A LEU 551 ? CG  ? C LEU 545 CG  
136 1 Y 1 A LEU 551 ? CD1 ? C LEU 545 CD1 
137 1 Y 1 A LEU 551 ? CD2 ? C LEU 545 CD2 
138 1 Y 1 A LYS 552 ? CG  ? C LYS 546 CG  
139 1 Y 1 A LYS 552 ? CD  ? C LYS 546 CD  
140 1 Y 1 A LYS 552 ? CE  ? C LYS 546 CE  
141 1 Y 1 A LYS 552 ? NZ  ? C LYS 546 NZ  
142 1 Y 1 A LYS 553 ? CG  ? C LYS 547 CG  
143 1 Y 1 A LYS 553 ? CD  ? C LYS 547 CD  
144 1 Y 1 A LYS 553 ? CE  ? C LYS 547 CE  
145 1 Y 1 A LYS 553 ? NZ  ? C LYS 547 NZ  
146 1 Y 1 A LYS 554 ? CG  ? C LYS 548 CG  
147 1 Y 1 A LYS 554 ? CD  ? C LYS 548 CD  
148 1 Y 1 A LYS 554 ? CE  ? C LYS 548 CE  
149 1 Y 1 A LYS 554 ? NZ  ? C LYS 548 NZ  
150 1 Y 1 A LEU 556 ? CG  ? C LEU 550 CG  
151 1 Y 1 A LEU 556 ? CD1 ? C LEU 550 CD1 
152 1 Y 1 A LEU 556 ? CD2 ? C LEU 550 CD2 
153 1 Y 1 A GLU 557 ? CG  ? C GLU 551 CG  
154 1 Y 1 A GLU 557 ? CD  ? C GLU 551 CD  
155 1 Y 1 A GLU 557 ? OE1 ? C GLU 551 OE1 
156 1 Y 1 A GLU 557 ? OE2 ? C GLU 551 OE2 
157 1 Y 1 A ASN 558 ? CG  ? C ASN 552 CG  
158 1 Y 1 A ASN 558 ? OD1 ? C ASN 552 OD1 
159 1 Y 1 A ASN 558 ? ND2 ? C ASN 552 ND2 
160 1 Y 1 A GLN 571 ? CG  ? C GLN 565 CG  
161 1 Y 1 A GLN 571 ? CD  ? C GLN 565 CD  
162 1 Y 1 A GLN 571 ? OE1 ? C GLN 565 OE1 
163 1 Y 1 A GLN 571 ? NE2 ? C GLN 565 NE2 
164 1 Y 1 A LYS 587 ? CG  ? C LYS 581 CG  
165 1 Y 1 A LYS 587 ? CD  ? C LYS 581 CD  
166 1 Y 1 A LYS 587 ? CE  ? C LYS 581 CE  
167 1 Y 1 A LYS 587 ? NZ  ? C LYS 581 NZ  
168 1 Y 1 A LYS 589 ? CG  ? C LYS 583 CG  
169 1 Y 1 A LYS 589 ? CD  ? C LYS 583 CD  
170 1 Y 1 A LYS 589 ? CE  ? C LYS 583 CE  
171 1 Y 1 A LYS 589 ? NZ  ? C LYS 583 NZ  
172 1 Y 1 A GLU 693 ? CG  ? C GLU 687 CG  
173 1 Y 1 A GLU 693 ? CD  ? C GLU 687 CD  
174 1 Y 1 A GLU 693 ? OE1 ? C GLU 687 OE1 
175 1 Y 1 A GLU 693 ? OE2 ? C GLU 687 OE2 
176 1 Y 1 A LYS 695 ? CG  ? C LYS 689 CG  
177 1 Y 1 A LYS 695 ? CD  ? C LYS 689 CD  
178 1 Y 1 A LYS 695 ? CE  ? C LYS 689 CE  
179 1 Y 1 A LYS 695 ? NZ  ? C LYS 689 NZ  
180 1 Y 1 A HIS 704 ? CG  ? C HIS 698 CG  
181 1 Y 1 A HIS 704 ? ND1 ? C HIS 698 ND1 
182 1 Y 1 A HIS 704 ? CD2 ? C HIS 698 CD2 
183 1 Y 1 A HIS 704 ? CE1 ? C HIS 698 CE1 
184 1 Y 1 A HIS 704 ? NE2 ? C HIS 698 NE2 
185 1 Y 1 B LYS 18  ? CE  ? D LYS 18  CE  
186 1 Y 1 B LYS 18  ? NZ  ? D LYS 18  NZ  
187 1 Y 1 B ASP 20  ? CG  ? D ASP 20  CG  
188 1 Y 1 B ASP 20  ? OD1 ? D ASP 20  OD1 
189 1 Y 1 B ASP 20  ? OD2 ? D ASP 20  OD2 
190 1 Y 1 B GLU 30  ? CG  ? D GLU 30  CG  
191 1 Y 1 B GLU 30  ? CD  ? D GLU 30  CD  
192 1 Y 1 B GLU 30  ? OE1 ? D GLU 30  OE1 
193 1 Y 1 B GLU 30  ? OE2 ? D GLU 30  OE2 
194 1 Y 1 B LYS 36  ? CE  ? D LYS 36  CE  
195 1 Y 1 B LYS 36  ? NZ  ? D LYS 36  NZ  
196 1 Y 1 B ARG 73  ? CG  ? D ARG 73  CG  
197 1 Y 1 B ARG 73  ? CD  ? D ARG 73  CD  
198 1 Y 1 B ARG 73  ? NE  ? D ARG 73  NE  
199 1 Y 1 B ARG 73  ? CZ  ? D ARG 73  CZ  
200 1 Y 1 B ARG 73  ? NH1 ? D ARG 73  NH1 
201 1 Y 1 B ARG 73  ? NH2 ? D ARG 73  NH2 
202 1 Y 1 B LYS 82  ? CG  ? D LYS 82  CG  
203 1 Y 1 B LYS 82  ? CD  ? D LYS 82  CD  
204 1 Y 1 B LYS 82  ? CE  ? D LYS 82  CE  
205 1 Y 1 B LYS 82  ? NZ  ? D LYS 82  NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 P DC  1   ? A DC  1   
2  1 Y 1 P DG  2   ? A DG  2   
3  1 Y 1 P DA  3   ? A DA  3   
4  1 Y 1 P DA  4   ? A DA  4   
5  1 Y 1 P DA  5   ? A DA  5   
6  1 Y 1 P DA  6   ? A DA  6   
7  1 Y 1 P DC  7   ? A DC  7   
8  1 Y 1 P DG  8   ? A DG  8   
9  1 Y 1 P DA  9   ? A DA  9   
10 1 Y 1 P DC  10  ? A DC  10  
11 1 Y 1 P DG  11  ? A DG  11  
12 1 Y 1 P DG  12  ? A DG  12  
13 1 Y 1 P DC  13  ? A DC  13  
14 1 Y 1 T DC  2   ? B DC  1   
15 1 Y 1 T DC  3   ? B DC  2   
16 1 Y 1 T DC  4   ? B DC  3   
17 1 Y 1 T TTD 5   ? B TTD 4   
18 1 Y 1 T DC  16  ? B DC  15  
19 1 Y 1 T DG  17  ? B DG  16  
20 1 Y 1 T DT  18  ? B DT  17  
21 1 Y 1 T DC  19  ? B DC  18  
22 1 Y 1 T DG  20  ? B DG  19  
23 1 Y 1 T DT  21  ? B DT  20  
24 1 Y 1 T DT  22  ? B DT  21  
25 1 Y 1 T DT  23  ? B DT  22  
26 1 Y 1 T DT  24  ? B DT  23  
27 1 Y 1 T DC  25  ? B DC  24  
28 1 Y 1 T DG  26  ? B DG  25  
29 1 Y 1 A LYS 304 ? C LYS 298 
30 1 Y 1 A ALA 305 ? C ALA 299 
31 1 Y 1 A GLN 306 ? C GLN 300 
32 1 Y 1 A ARG 307 ? C ARG 301 
33 1 Y 1 A GLU 308 ? C GLU 302 
34 1 Y 1 A GLY 309 ? C GLY 303 
35 1 Y 1 A ARG 310 ? C ARG 304 
36 1 Y 1 A GLU 311 ? C GLU 305 
37 1 Y 1 A PRO 312 ? C PRO 306 
38 1 Y 1 A SER 576 ? C SER 570 
39 1 Y 1 A SER 577 ? C SER 571 
40 1 Y 1 A GLN 578 ? C GLN 572 
41 1 Y 1 A TRP 579 ? C TRP 573 
42 1 Y 1 A VAL 580 ? C VAL 574 
43 1 Y 1 A ALA 581 ? C ALA 575 
44 1 Y 1 A GLY 582 ? C GLY 576 
45 1 Y 1 A GLU 583 ? C GLU 577 
46 1 Y 1 A GLN 584 ? C GLN 578 
47 1 Y 1 A GLN 585 ? C GLN 579 
48 1 Y 1 A VAL 586 ? C VAL 580 
49 1 Y 1 B SER 1   ? D SER 1   
50 1 Y 1 B ASP 2   ? D ASP 2   
51 1 Y 1 B ALA 108 ? D ALA 108 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1SKW 'double helix'        
1SKW 'a-form double helix' 
1SKW 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC  14 1_555 B DG 12 1_555 0.493  -0.220 0.131  -2.074 -9.415  3.118  1 P_DC14:DG13_T P 14 ? T 13 ? 19 1 
1 A DA  15 1_555 B DT 11 1_555 -0.078 0.083  0.097  -7.141 -14.106 -1.425 2 P_DA15:DT12_T P 15 ? T 12 ? 20 1 
1 A DG  16 1_555 B DC 10 1_555 -0.092 0.050  0.229  3.089  -11.268 -1.106 3 P_DG16:DC11_T P 16 ? T 11 ? 19 1 
1 A DT  17 1_555 B DA 9  1_555 0.109  -0.168 -0.462 1.488  1.337   1.784  4 P_DT17:DA10_T P 17 ? T 10 ? 20 1 
1 A DG  18 1_555 B DC 8  1_555 -0.193 -0.142 -0.216 8.915  8.542   -0.951 5 P_DG18:DC9_T  P 18 ? T 9  ? 19 1 
1 A DC  19 1_555 B DG 7  1_555 0.171  -0.274 -0.256 4.910  -13.394 0.092  6 P_DC19:DG8_T  P 19 ? T 8  ? 19 1 
1 A DC  20 1_555 B DG 6  1_555 0.480  -0.086 0.499  3.876  -15.901 4.816  7 P_DC20:DG7_T  P 20 ? T 7  ? 19 1 
1 A 2DT 21 1_555 B DA 5  1_555 -0.038 0.012  -0.052 16.076 -15.763 6.546  8 P_2DT21:DA6_T P 21 ? T 6  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 14 1_555 B DG 12 1_555 A DA  15 1_555 B DT 11 1_555 -0.434 0.427  3.467 -0.971 3.543  37.099 0.167  0.541  3.501 5.552  
1.521   37.275 1 PP_DC14DA15:DT12DG13_TT P 14 ? T 13 ? P 15 ? T 12 ? 
1 A DA 15 1_555 B DT 11 1_555 A DG  16 1_555 B DC 10 1_555 0.336  -0.101 3.091 -0.336 6.742  30.372 -1.405 -0.687 2.996 12.673 
0.631   31.096 2 PP_DA15DG16:DC11DT12_TT P 15 ? T 12 ? P 16 ? T 11 ? 
1 A DG 16 1_555 B DC 10 1_555 A DT  17 1_555 B DA 9  1_555 1.239  -0.428 3.308 6.518  3.019  34.632 -1.169 -1.038 3.429 5.005  
-10.806 35.347 3 PP_DG16DT17:DA10DC11_TT P 16 ? T 11 ? P 17 ? T 10 ? 
1 A DT 17 1_555 B DA 9  1_555 A DG  18 1_555 B DC 8  1_555 -0.349 -0.461 3.328 -2.433 4.813  25.603 -2.339 0.104  3.207 10.710 
5.413   26.156 4 PP_DT17DG18:DC9DA10_TT  P 17 ? T 10 ? P 18 ? T 9  ? 
1 A DG 18 1_555 B DC 8  1_555 A DC  19 1_555 B DG 7  1_555 -0.546 -0.617 3.575 -6.369 11.024 38.889 -2.199 0.023  3.332 16.043 
9.268   40.843 5 PP_DG18DC19:DG8DC9_TT   P 18 ? T 9  ? P 19 ? T 8  ? 
1 A DC 19 1_555 B DG 7  1_555 A DC  20 1_555 B DG 6  1_555 -0.475 -1.264 3.500 -6.202 8.855  27.414 -4.439 -0.432 2.990 17.830 
12.488  29.430 6 PP_DC19DC20:DG7DG8_TT   P 19 ? T 8  ? P 20 ? T 7  ? 
1 A DC 20 1_555 B DG 6  1_555 A 2DT 21 1_555 B DA 5  1_555 -0.393 -0.524 3.053 3.586  10.305 30.820 -2.547 1.261  2.683 18.671 
-6.497  32.650 7 PP_DC202DT21:DA6DG7_TT  P 20 ? T 7  ? P 21 ? T 6  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'MAGNESIUM ION' MG  
6 water           HOH 
#