data_1SL0
# 
_entry.id   1SL0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SL0         
NDB   PD0525       
RCSB  RCSB021802   
WWPDB D_1000021802 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1T7P 'T7 DNA POLYMERASE COMPLEXED TO DNA PRIMER/TEMPLATE, A NUCLEOSIDE TRIPHOSPHATE, AND ITS PROCESSIVITY FACTOR THIOREDOXIN' 
unspecified 
PDB 1SKR 'T7 DNA polymerase complexed primer/template DNA containing a cis-syn thymine dimer on the template' unspecified 
PDB 1SKS 
;Binary 3' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn thymine dimer on the template
;
unspecified 
PDB 1SKW 
;Binary 3' complex of T7 DNA polymerase with a DNA primer/template containing a disordered cis-syn thymine dimer on the template
;
unspecified 
PDB 1SL1 
;Binary 5' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn thymine dimer on the template
;
unspecified 
PDB 1SL2 
;Ternary 5' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn thymine dimer on the template and an incoming nucleotide
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SL0 
_pdbx_database_status.recvd_initial_deposition_date   2004-03-05 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, Y.'          1 
'Dutta, S.'       2 
'Doublie, S.'     3 
'Bdour, H.M.'     4 
'Taylor, J.S.'    5 
'Ellenberger, T.' 6 
# 
_citation.id                        primary 
_citation.title                     
'Nucleotide insertion opposite a cis-syn thymine dimer by a replicative DNA polymerase from bacteriophage T7.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            11 
_citation.page_first                784 
_citation.page_last                 790 
_citation.year                      2004 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15235589 
_citation.pdbx_database_id_DOI      10.1038/nsmb792 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, Y.'          1 
primary 'Dutta, S.'       2 
primary 'Doublie, S.'     3 
primary 'Bdour, H.M.'     4 
primary 'Taylor, J.S.'    5 
primary 'Ellenberger, T.' 6 
# 
_cell.entry_id           1SL0 
_cell.length_a           54.266 
_cell.length_b           105.466 
_cell.length_c           213.931 
_cell.angle_alpha        90.00 
_cell.angle_beta         91.57 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SL0 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*CP*GP*AP*AP*AP*AP*CP*GP*AP*CP*GP*GP*CP*CP*AP*GP*TP*GP*CP*CP*(2DT))-3'"             6426.177  2 ?       ? 
? 'DNA primer'   
2 polymer     syn "5'-D(*CP*CP*CP*(TTD)P*AP*GP*GP*CP*AP*CP*TP*GP*GP*CP*CP*GP*TP*CP*GP*TP*TP*TP*TP*CP*G)-3'" 7922.077  2 ?       ? 
? 'DNA template' 
3 polymer     man 'DNA polymerase'                                                                          79089.789 2 2.7.7.7 
'DEL(118-123)' ? ?              
4 polymer     man 'Thioredoxin 1'                                                                           11687.388 2 ?       ? 
? ?              
5 non-polymer syn 'MAGNESIUM ION'                                                                           24.305    2 ?       ? 
? ?              
6 non-polymer syn "2',3'-DIDEOXYADENOSINE-5'-TRIPHOSPHATE"                                                  475.182   2 ?       ? 
? ?              
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 'T7 DNA polymerase' 
4 'TRX1, TRX'         
# 
_entity_name_sys.entity_id   3 
_entity_name_sys.name        2.7.7.7 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes 
;(DC)(DG)(DA)(DA)(DA)(DA)(DC)(DG)(DA)(DC)(DG)(DG)(DC)(DC)(DA)(DG)(DT)(DG)(DC)(DC)
(2DT)
;
CGAAAACGACGGCCAGTGCCT P,Q ? 
2 polydeoxyribonucleotide no yes 
;(DC)(DC)(DC)(TTD)(DA)(DG)(DG)(DC)(DA)(DC)(DT)(DG)(DG)(DC)(DC)(DG)(DT)(DC)(DG)
(DT)(DT)(DT)(DT)(DC)(DG)
;
CCCTAGGCACTGGCCGTCGTTTTCG T,U ? 
3 'polypeptide(L)'        no no  
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFNEE
MMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIEELYVEL
AARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREYVAGAPY
TPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSAEGDKAW
LRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAH
FMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTPAIAALR
ESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKHGWDGDF
AYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFNEE
MMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIEELYVEL
AARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREYVAGAPY
TPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSAEGDKAW
LRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAH
FMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTPAIAALR
ESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKHGWDGDF
AYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
A,C ? 
4 'polypeptide(L)'        no no  
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DG  n 
1 3   DA  n 
1 4   DA  n 
1 5   DA  n 
1 6   DA  n 
1 7   DC  n 
1 8   DG  n 
1 9   DA  n 
1 10  DC  n 
1 11  DG  n 
1 12  DG  n 
1 13  DC  n 
1 14  DC  n 
1 15  DA  n 
1 16  DG  n 
1 17  DT  n 
1 18  DG  n 
1 19  DC  n 
1 20  DC  n 
1 21  2DT n 
2 1   DC  n 
2 2   DC  n 
2 3   DC  n 
2 4   TTD n 
2 5   DA  n 
2 6   DG  n 
2 7   DG  n 
2 8   DC  n 
2 9   DA  n 
2 10  DC  n 
2 11  DT  n 
2 12  DG  n 
2 13  DG  n 
2 14  DC  n 
2 15  DC  n 
2 16  DG  n 
2 17  DT  n 
2 18  DC  n 
2 19  DG  n 
2 20  DT  n 
2 21  DT  n 
2 22  DT  n 
2 23  DT  n 
2 24  DC  n 
2 25  DG  n 
3 1   MET n 
3 2   ILE n 
3 3   VAL n 
3 4   SER n 
3 5   ASP n 
3 6   ILE n 
3 7   GLU n 
3 8   ALA n 
3 9   ASN n 
3 10  ALA n 
3 11  LEU n 
3 12  LEU n 
3 13  GLU n 
3 14  SER n 
3 15  VAL n 
3 16  THR n 
3 17  LYS n 
3 18  PHE n 
3 19  HIS n 
3 20  CYS n 
3 21  GLY n 
3 22  VAL n 
3 23  ILE n 
3 24  TYR n 
3 25  ASP n 
3 26  TYR n 
3 27  SER n 
3 28  THR n 
3 29  ALA n 
3 30  GLU n 
3 31  TYR n 
3 32  VAL n 
3 33  SER n 
3 34  TYR n 
3 35  ARG n 
3 36  PRO n 
3 37  SER n 
3 38  ASP n 
3 39  PHE n 
3 40  GLY n 
3 41  ALA n 
3 42  TYR n 
3 43  LEU n 
3 44  ASP n 
3 45  ALA n 
3 46  LEU n 
3 47  GLU n 
3 48  ALA n 
3 49  GLU n 
3 50  VAL n 
3 51  ALA n 
3 52  ARG n 
3 53  GLY n 
3 54  GLY n 
3 55  LEU n 
3 56  ILE n 
3 57  VAL n 
3 58  PHE n 
3 59  HIS n 
3 60  ASN n 
3 61  GLY n 
3 62  HIS n 
3 63  LYS n 
3 64  TYR n 
3 65  ASP n 
3 66  VAL n 
3 67  PRO n 
3 68  ALA n 
3 69  LEU n 
3 70  THR n 
3 71  LYS n 
3 72  LEU n 
3 73  ALA n 
3 74  LYS n 
3 75  LEU n 
3 76  GLN n 
3 77  LEU n 
3 78  ASN n 
3 79  ARG n 
3 80  GLU n 
3 81  PHE n 
3 82  HIS n 
3 83  LEU n 
3 84  PRO n 
3 85  ARG n 
3 86  GLU n 
3 87  ASN n 
3 88  CYS n 
3 89  ILE n 
3 90  ASP n 
3 91  THR n 
3 92  LEU n 
3 93  VAL n 
3 94  LEU n 
3 95  SER n 
3 96  ARG n 
3 97  LEU n 
3 98  ILE n 
3 99  HIS n 
3 100 SER n 
3 101 ASN n 
3 102 LEU n 
3 103 LYS n 
3 104 ASP n 
3 105 THR n 
3 106 ASP n 
3 107 MET n 
3 108 GLY n 
3 109 LEU n 
3 110 LEU n 
3 111 ARG n 
3 112 SER n 
3 113 GLY n 
3 114 LYS n 
3 115 LEU n 
3 116 PRO n 
3 117 GLY n 
3 118 ALA n 
3 119 LEU n 
3 120 GLU n 
3 121 ALA n 
3 122 TRP n 
3 123 GLY n 
3 124 TYR n 
3 125 ARG n 
3 126 LEU n 
3 127 GLY n 
3 128 GLU n 
3 129 MET n 
3 130 LYS n 
3 131 GLY n 
3 132 GLU n 
3 133 TYR n 
3 134 LYS n 
3 135 ASP n 
3 136 ASP n 
3 137 PHE n 
3 138 LYS n 
3 139 ARG n 
3 140 MET n 
3 141 LEU n 
3 142 GLU n 
3 143 GLU n 
3 144 GLN n 
3 145 GLY n 
3 146 GLU n 
3 147 GLU n 
3 148 TYR n 
3 149 VAL n 
3 150 ASP n 
3 151 GLY n 
3 152 MET n 
3 153 GLU n 
3 154 TRP n 
3 155 TRP n 
3 156 ASN n 
3 157 PHE n 
3 158 ASN n 
3 159 GLU n 
3 160 GLU n 
3 161 MET n 
3 162 MET n 
3 163 ASP n 
3 164 TYR n 
3 165 ASN n 
3 166 VAL n 
3 167 GLN n 
3 168 ASP n 
3 169 VAL n 
3 170 VAL n 
3 171 VAL n 
3 172 THR n 
3 173 LYS n 
3 174 ALA n 
3 175 LEU n 
3 176 LEU n 
3 177 GLU n 
3 178 LYS n 
3 179 LEU n 
3 180 LEU n 
3 181 SER n 
3 182 ASP n 
3 183 LYS n 
3 184 HIS n 
3 185 TYR n 
3 186 PHE n 
3 187 PRO n 
3 188 PRO n 
3 189 GLU n 
3 190 ILE n 
3 191 ASP n 
3 192 PHE n 
3 193 THR n 
3 194 ASP n 
3 195 VAL n 
3 196 GLY n 
3 197 TYR n 
3 198 THR n 
3 199 THR n 
3 200 PHE n 
3 201 TRP n 
3 202 SER n 
3 203 GLU n 
3 204 SER n 
3 205 LEU n 
3 206 GLU n 
3 207 ALA n 
3 208 VAL n 
3 209 ASP n 
3 210 ILE n 
3 211 GLU n 
3 212 HIS n 
3 213 ARG n 
3 214 ALA n 
3 215 ALA n 
3 216 TRP n 
3 217 LEU n 
3 218 LEU n 
3 219 ALA n 
3 220 LYS n 
3 221 GLN n 
3 222 GLU n 
3 223 ARG n 
3 224 ASN n 
3 225 GLY n 
3 226 PHE n 
3 227 PRO n 
3 228 PHE n 
3 229 ASP n 
3 230 THR n 
3 231 LYS n 
3 232 ALA n 
3 233 ILE n 
3 234 GLU n 
3 235 GLU n 
3 236 LEU n 
3 237 TYR n 
3 238 VAL n 
3 239 GLU n 
3 240 LEU n 
3 241 ALA n 
3 242 ALA n 
3 243 ARG n 
3 244 ARG n 
3 245 SER n 
3 246 GLU n 
3 247 LEU n 
3 248 LEU n 
3 249 ARG n 
3 250 LYS n 
3 251 LEU n 
3 252 THR n 
3 253 GLU n 
3 254 THR n 
3 255 PHE n 
3 256 GLY n 
3 257 SER n 
3 258 TRP n 
3 259 TYR n 
3 260 GLN n 
3 261 PRO n 
3 262 LYS n 
3 263 GLY n 
3 264 GLY n 
3 265 THR n 
3 266 GLU n 
3 267 MET n 
3 268 PHE n 
3 269 CYS n 
3 270 HIS n 
3 271 PRO n 
3 272 ARG n 
3 273 THR n 
3 274 GLY n 
3 275 LYS n 
3 276 PRO n 
3 277 LEU n 
3 278 PRO n 
3 279 LYS n 
3 280 TYR n 
3 281 PRO n 
3 282 ARG n 
3 283 ILE n 
3 284 LYS n 
3 285 THR n 
3 286 PRO n 
3 287 LYS n 
3 288 VAL n 
3 289 GLY n 
3 290 GLY n 
3 291 ILE n 
3 292 PHE n 
3 293 LYS n 
3 294 LYS n 
3 295 PRO n 
3 296 LYS n 
3 297 ASN n 
3 298 LYS n 
3 299 ALA n 
3 300 GLN n 
3 301 ARG n 
3 302 GLU n 
3 303 GLY n 
3 304 ARG n 
3 305 GLU n 
3 306 PRO n 
3 307 CYS n 
3 308 GLU n 
3 309 LEU n 
3 310 ASP n 
3 311 THR n 
3 312 ARG n 
3 313 GLU n 
3 314 TYR n 
3 315 VAL n 
3 316 ALA n 
3 317 GLY n 
3 318 ALA n 
3 319 PRO n 
3 320 TYR n 
3 321 THR n 
3 322 PRO n 
3 323 VAL n 
3 324 GLU n 
3 325 HIS n 
3 326 VAL n 
3 327 VAL n 
3 328 PHE n 
3 329 ASN n 
3 330 PRO n 
3 331 SER n 
3 332 SER n 
3 333 ARG n 
3 334 ASP n 
3 335 HIS n 
3 336 ILE n 
3 337 GLN n 
3 338 LYS n 
3 339 LYS n 
3 340 LEU n 
3 341 GLN n 
3 342 GLU n 
3 343 ALA n 
3 344 GLY n 
3 345 TRP n 
3 346 VAL n 
3 347 PRO n 
3 348 THR n 
3 349 LYS n 
3 350 TYR n 
3 351 THR n 
3 352 ASP n 
3 353 LYS n 
3 354 GLY n 
3 355 ALA n 
3 356 PRO n 
3 357 VAL n 
3 358 VAL n 
3 359 ASP n 
3 360 ASP n 
3 361 GLU n 
3 362 VAL n 
3 363 LEU n 
3 364 GLU n 
3 365 GLY n 
3 366 VAL n 
3 367 ARG n 
3 368 VAL n 
3 369 ASP n 
3 370 ASP n 
3 371 PRO n 
3 372 GLU n 
3 373 LYS n 
3 374 GLN n 
3 375 ALA n 
3 376 ALA n 
3 377 ILE n 
3 378 ASP n 
3 379 LEU n 
3 380 ILE n 
3 381 LYS n 
3 382 GLU n 
3 383 TYR n 
3 384 LEU n 
3 385 MET n 
3 386 ILE n 
3 387 GLN n 
3 388 LYS n 
3 389 ARG n 
3 390 ILE n 
3 391 GLY n 
3 392 GLN n 
3 393 SER n 
3 394 ALA n 
3 395 GLU n 
3 396 GLY n 
3 397 ASP n 
3 398 LYS n 
3 399 ALA n 
3 400 TRP n 
3 401 LEU n 
3 402 ARG n 
3 403 TYR n 
3 404 VAL n 
3 405 ALA n 
3 406 GLU n 
3 407 ASP n 
3 408 GLY n 
3 409 LYS n 
3 410 ILE n 
3 411 HIS n 
3 412 GLY n 
3 413 SER n 
3 414 VAL n 
3 415 ASN n 
3 416 PRO n 
3 417 ASN n 
3 418 GLY n 
3 419 ALA n 
3 420 VAL n 
3 421 THR n 
3 422 GLY n 
3 423 ARG n 
3 424 ALA n 
3 425 THR n 
3 426 HIS n 
3 427 ALA n 
3 428 PHE n 
3 429 PRO n 
3 430 ASN n 
3 431 LEU n 
3 432 ALA n 
3 433 GLN n 
3 434 ILE n 
3 435 PRO n 
3 436 GLY n 
3 437 VAL n 
3 438 ARG n 
3 439 SER n 
3 440 PRO n 
3 441 TYR n 
3 442 GLY n 
3 443 GLU n 
3 444 GLN n 
3 445 CYS n 
3 446 ARG n 
3 447 ALA n 
3 448 ALA n 
3 449 PHE n 
3 450 GLY n 
3 451 ALA n 
3 452 GLU n 
3 453 HIS n 
3 454 HIS n 
3 455 LEU n 
3 456 ASP n 
3 457 GLY n 
3 458 ILE n 
3 459 THR n 
3 460 GLY n 
3 461 LYS n 
3 462 PRO n 
3 463 TRP n 
3 464 VAL n 
3 465 GLN n 
3 466 ALA n 
3 467 GLY n 
3 468 ILE n 
3 469 ASP n 
3 470 ALA n 
3 471 SER n 
3 472 GLY n 
3 473 LEU n 
3 474 GLU n 
3 475 LEU n 
3 476 ARG n 
3 477 CYS n 
3 478 LEU n 
3 479 ALA n 
3 480 HIS n 
3 481 PHE n 
3 482 MET n 
3 483 ALA n 
3 484 ARG n 
3 485 PHE n 
3 486 ASP n 
3 487 ASN n 
3 488 GLY n 
3 489 GLU n 
3 490 TYR n 
3 491 ALA n 
3 492 HIS n 
3 493 GLU n 
3 494 ILE n 
3 495 LEU n 
3 496 ASN n 
3 497 GLY n 
3 498 ASP n 
3 499 ILE n 
3 500 HIS n 
3 501 THR n 
3 502 LYS n 
3 503 ASN n 
3 504 GLN n 
3 505 ILE n 
3 506 ALA n 
3 507 ALA n 
3 508 GLU n 
3 509 LEU n 
3 510 PRO n 
3 511 THR n 
3 512 ARG n 
3 513 ASP n 
3 514 ASN n 
3 515 ALA n 
3 516 LYS n 
3 517 THR n 
3 518 PHE n 
3 519 ILE n 
3 520 TYR n 
3 521 GLY n 
3 522 PHE n 
3 523 LEU n 
3 524 TYR n 
3 525 GLY n 
3 526 ALA n 
3 527 GLY n 
3 528 ASP n 
3 529 GLU n 
3 530 LYS n 
3 531 ILE n 
3 532 GLY n 
3 533 GLN n 
3 534 ILE n 
3 535 VAL n 
3 536 GLY n 
3 537 ALA n 
3 538 GLY n 
3 539 LYS n 
3 540 GLU n 
3 541 ARG n 
3 542 GLY n 
3 543 LYS n 
3 544 GLU n 
3 545 LEU n 
3 546 LYS n 
3 547 LYS n 
3 548 LYS n 
3 549 PHE n 
3 550 LEU n 
3 551 GLU n 
3 552 ASN n 
3 553 THR n 
3 554 PRO n 
3 555 ALA n 
3 556 ILE n 
3 557 ALA n 
3 558 ALA n 
3 559 LEU n 
3 560 ARG n 
3 561 GLU n 
3 562 SER n 
3 563 ILE n 
3 564 GLN n 
3 565 GLN n 
3 566 THR n 
3 567 LEU n 
3 568 VAL n 
3 569 GLU n 
3 570 SER n 
3 571 SER n 
3 572 GLN n 
3 573 TRP n 
3 574 VAL n 
3 575 ALA n 
3 576 GLY n 
3 577 GLU n 
3 578 GLN n 
3 579 GLN n 
3 580 VAL n 
3 581 LYS n 
3 582 TRP n 
3 583 LYS n 
3 584 ARG n 
3 585 ARG n 
3 586 TRP n 
3 587 ILE n 
3 588 LYS n 
3 589 GLY n 
3 590 LEU n 
3 591 ASP n 
3 592 GLY n 
3 593 ARG n 
3 594 LYS n 
3 595 VAL n 
3 596 HIS n 
3 597 VAL n 
3 598 ARG n 
3 599 SER n 
3 600 PRO n 
3 601 HIS n 
3 602 ALA n 
3 603 ALA n 
3 604 LEU n 
3 605 ASN n 
3 606 THR n 
3 607 LEU n 
3 608 LEU n 
3 609 GLN n 
3 610 SER n 
3 611 ALA n 
3 612 GLY n 
3 613 ALA n 
3 614 LEU n 
3 615 ILE n 
3 616 CYS n 
3 617 LYS n 
3 618 LEU n 
3 619 TRP n 
3 620 ILE n 
3 621 ILE n 
3 622 LYS n 
3 623 THR n 
3 624 GLU n 
3 625 GLU n 
3 626 MET n 
3 627 LEU n 
3 628 VAL n 
3 629 GLU n 
3 630 LYS n 
3 631 GLY n 
3 632 LEU n 
3 633 LYS n 
3 634 HIS n 
3 635 GLY n 
3 636 TRP n 
3 637 ASP n 
3 638 GLY n 
3 639 ASP n 
3 640 PHE n 
3 641 ALA n 
3 642 TYR n 
3 643 MET n 
3 644 ALA n 
3 645 TRP n 
3 646 VAL n 
3 647 HIS n 
3 648 ASP n 
3 649 GLU n 
3 650 ILE n 
3 651 GLN n 
3 652 VAL n 
3 653 GLY n 
3 654 CYS n 
3 655 ARG n 
3 656 THR n 
3 657 GLU n 
3 658 GLU n 
3 659 ILE n 
3 660 ALA n 
3 661 GLN n 
3 662 VAL n 
3 663 VAL n 
3 664 ILE n 
3 665 GLU n 
3 666 THR n 
3 667 ALA n 
3 668 GLN n 
3 669 GLU n 
3 670 ALA n 
3 671 MET n 
3 672 ARG n 
3 673 TRP n 
3 674 VAL n 
3 675 GLY n 
3 676 ASP n 
3 677 HIS n 
3 678 TRP n 
3 679 ASN n 
3 680 PHE n 
3 681 ARG n 
3 682 CYS n 
3 683 LEU n 
3 684 LEU n 
3 685 ASP n 
3 686 THR n 
3 687 GLU n 
3 688 GLY n 
3 689 LYS n 
3 690 MET n 
3 691 GLY n 
3 692 PRO n 
3 693 ASN n 
3 694 TRP n 
3 695 ALA n 
3 696 ILE n 
3 697 CYS n 
3 698 HIS n 
4 1   SER n 
4 2   ASP n 
4 3   LYS n 
4 4   ILE n 
4 5   ILE n 
4 6   HIS n 
4 7   LEU n 
4 8   THR n 
4 9   ASP n 
4 10  ASP n 
4 11  SER n 
4 12  PHE n 
4 13  ASP n 
4 14  THR n 
4 15  ASP n 
4 16  VAL n 
4 17  LEU n 
4 18  LYS n 
4 19  ALA n 
4 20  ASP n 
4 21  GLY n 
4 22  ALA n 
4 23  ILE n 
4 24  LEU n 
4 25  VAL n 
4 26  ASP n 
4 27  PHE n 
4 28  TRP n 
4 29  ALA n 
4 30  GLU n 
4 31  TRP n 
4 32  CYS n 
4 33  GLY n 
4 34  PRO n 
4 35  CYS n 
4 36  LYS n 
4 37  MET n 
4 38  ILE n 
4 39  ALA n 
4 40  PRO n 
4 41  ILE n 
4 42  LEU n 
4 43  ASP n 
4 44  GLU n 
4 45  ILE n 
4 46  ALA n 
4 47  ASP n 
4 48  GLU n 
4 49  TYR n 
4 50  GLN n 
4 51  GLY n 
4 52  LYS n 
4 53  LEU n 
4 54  THR n 
4 55  VAL n 
4 56  ALA n 
4 57  LYS n 
4 58  LEU n 
4 59  ASN n 
4 60  ILE n 
4 61  ASP n 
4 62  GLN n 
4 63  ASN n 
4 64  PRO n 
4 65  GLY n 
4 66  THR n 
4 67  ALA n 
4 68  PRO n 
4 69  LYS n 
4 70  TYR n 
4 71  GLY n 
4 72  ILE n 
4 73  ARG n 
4 74  GLY n 
4 75  ILE n 
4 76  PRO n 
4 77  THR n 
4 78  LEU n 
4 79  LEU n 
4 80  LEU n 
4 81  PHE n 
4 82  LYS n 
4 83  ASN n 
4 84  GLY n 
4 85  GLU n 
4 86  VAL n 
4 87  ALA n 
4 88  ALA n 
4 89  THR n 
4 90  LYS n 
4 91  VAL n 
4 92  GLY n 
4 93  ALA n 
4 94  LEU n 
4 95  SER n 
4 96  LYS n 
4 97  GLY n 
4 98  GLN n 
4 99  LEU n 
4 100 LYS n 
4 101 GLU n 
4 102 PHE n 
4 103 LEU n 
4 104 ASP n 
4 105 ALA n 
4 106 ASN n 
4 107 LEU n 
4 108 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample ? ? ? ? 'T7-like viruses' 5 ? ? ? ? ? ? 'Enterobacteria phage T7' 10760 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? ? Escherichia       
'TRXA, TSNC, FIPA, B3781, C4701, Z5291, ECS4714, STM3915, STMD1.75, STY3639, T3381, SF3854, S3905' ? ? ? ? ? ? 'Escherichia coli' 
562   ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP DPOL_BPT7  P00581 3 1 ? ? 
2 UNP THIO_ECOLI P0AA25 4 1 ? ? 
3 PDB 1SL0       1SL0   1 ? ? ? 
4 PDB 1SL0       1SL0   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1SL0 A 1 ? 698 ? P00581 1 ? 704 ? 1 704 
2 2 1SL0 B 1 ? 108 ? P0AA25 1 ? 108 ? 1 108 
3 1 1SL0 C 1 ? 698 ? P00581 1 ? 704 ? 1 704 
4 2 1SL0 D 1 ? 108 ? P0AA25 1 ? 108 ? 1 108 
5 3 1SL0 P 1 ? 21  ? 1SL0   1 ? 21  ? 1 21  
6 4 1SL0 T 1 ? 25  ? 1SL0   2 ? 26  ? 2 26  
7 3 1SL0 Q 1 ? 21  ? 1SL0   1 ? 21  ? 1 21  
8 4 1SL0 U 1 ? 25  ? 1SL0   2 ? 26  ? 2 26  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1SL0 ? A ? ? UNP P00581 LYS 118 DELETION ? 1  
1 1SL0 ? A ? ? UNP P00581 ARG 119 DELETION ? 2  
1 1SL0 ? A ? ? UNP P00581 PHE 120 DELETION ? 3  
1 1SL0 ? A ? ? UNP P00581 GLY 121 DELETION ? 4  
1 1SL0 ? A ? ? UNP P00581 SER 122 DELETION ? 5  
1 1SL0 ? A ? ? UNP P00581 HIS 123 DELETION ? 6  
3 1SL0 ? C ? ? UNP P00581 LYS 118 DELETION ? 7  
3 1SL0 ? C ? ? UNP P00581 ARG 119 DELETION ? 8  
3 1SL0 ? C ? ? UNP P00581 PHE 120 DELETION ? 9  
3 1SL0 ? C ? ? UNP P00581 GLY 121 DELETION ? 10 
3 1SL0 ? C ? ? UNP P00581 SER 122 DELETION ? 11 
3 1SL0 ? C ? ? UNP P00581 HIS 123 DELETION ? 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2DT 'DNA linking'       n "3'-DEOXYTHYMIDINE-5'-MONOPHOSPHATE"     "2',3'-DIDEOXYTHYMIDINE-5'-MONOPHOSPHATE" 'C10 H15 N2 O7 P'   
306.209 
ALA 'L-peptide linking' y ALANINE                                  ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                 ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                 ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"     ? 'C10 H14 N5 O6 P'   331.222 
DAD non-polymer         . "2',3'-DIDEOXYADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O11 P3' 475.182 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"      ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"     ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"             ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                                ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                  ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                               ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                  ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                   ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                               ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                          ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                            ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                  ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                   ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ? 'C11 H12 N2 O2'     204.225 
TTD 'DNA linking'       n 'CIS-SYN CYCLOBUTANE THYMINE DIMER'      
;[(3S,4S,9S,10R,12R,15AR,18BS,18CS)-3,7-DIHYDROXY-15A,15B-DIMETHYL-7-OXIDO-13,15,16,18-TETRAOXOHEXADECAHYDRO-1H-1,4-EPOXY-9,12-METHANO-6,8,11-TRIOXA-12A,14,17,18A-TETRAAZA-7-PHOSPHACYCLOHEXADECA[1,2,3,4-DEF]BIPHENYLEN-10-YL]METHYL DIHYDROGEN PHOSPHATE
;
'C20 H28 N4 O15 P2' 626.402 
TYR 'L-peptide linking' y TYROSINE                                 ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                   ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1SL0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   57.49 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      2.89 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'pH 7.5, VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2003-07-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0055 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             1.0055 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1SL0 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            3.200 
_reflns.number_obs                   39978 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.069 
_reflns.pdbx_netI_over_sigmaI        35.2000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              34.600 
_reflns.R_free_details               ? 
_reflns.limit_k_min                  ? 
_reflns.observed_criterion_F_min     ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.20 
_reflns_shell.d_res_low              3.31 
_reflns_shell.percent_possible_all   96.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.313 
_reflns_shell.meanI_over_sigI_obs    5.67 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1SL0 
_refine.ls_number_reflns_obs                     39656 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.0 
_refine.ls_d_res_high                            3.20 
_refine.ls_percent_reflns_obs                    99.3 
_refine.ls_R_factor_obs                          0.282 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.282 
_refine.ls_R_factor_R_free                       0.351 
_refine.ls_R_factor_R_free_error                 0.008 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1987 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               77.4 
_refine.aniso_B[1][1]                            54.63 
_refine.aniso_B[2][2]                            -23.23 
_refine.aniso_B[3][3]                            -31.40 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -3.05 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.213547 
_refine.solvent_model_param_bsol                 68.4057 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             GROUP 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1SL0 
_refine_analyze.Luzzati_coordinate_error_obs    0.44 
_refine_analyze.Luzzati_sigma_a_obs             0.65 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.61 
_refine_analyze.Luzzati_sigma_a_free            0.72 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10982 
_refine_hist.pdbx_number_atoms_nucleic_acid   862 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               11904 
_refine_hist.d_res_high                       3.20 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.4   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.7  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.96  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   CONSTR 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.20 
_refine_ls_shell.d_res_low                        3.40 
_refine_ls_shell.number_reflns_R_work             6101 
_refine_ls_shell.R_factor_R_work                  0.355 
_refine_ls_shell.percent_reflns_obs               96.9 
_refine_ls_shell.R_factor_R_free                  0.397 
_refine_ls_shell.R_factor_R_free_error            0.022 
_refine_ls_shell.percent_reflns_R_free            5.0 
_refine_ls_shell.number_reflns_R_free             318 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.details       ? 
_struct_ncs_dom.pdbx_ens_id   1 
# 
_struct_ncs_ens.id            1 
_struct_ncs_ens.details       ? 
_struct_ncs_ens.point_group   ? 
# 
_struct.entry_id                  1SL0 
_struct.title                     
;Ternary 3' complex of T7 DNA polymerase with a DNA primer/template containing a disordered cis-syn thymine dimer on the template and an incoming nucleotide
;
_struct.pdbx_descriptor           'DNA POLYMERASE(E.C.2.7.7.7)/THIOREDOXIN 1/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SL0 
_struct_keywords.pdbx_keywords   'TRANSFERASE/ELECTRON TRANSPORT/DNA' 
_struct_keywords.text            
'DNA polymerase, fidelity, lesion bypass, thymine dimer, open, close, TRANSFERASE-ELECTRON TRANSPORT-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 5 ? 
L N N 6 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU E 11  ? VAL E 15  ? LEU A 11  VAL A 15  5 ? 5  
HELX_P HELX_P2  2  ASP E 38  ? GLY E 53  ? ASP A 38  GLY A 53  1 ? 16 
HELX_P HELX_P3  3  TYR E 64  ? ASN E 78  ? TYR A 64  ASN A 78  1 ? 15 
HELX_P HELX_P4  4  PRO E 84  ? GLU E 86  ? PRO A 84  GLU A 86  5 ? 3  
HELX_P HELX_P5  5  THR E 91  ? HIS E 99  ? THR A 91  HIS A 99  1 ? 9  
HELX_P HELX_P6  6  GLY E 123 ? GLU E 128 ? GLY A 129 GLU A 134 1 ? 6  
HELX_P HELX_P7  7  GLU E 128 ? GLU E 143 ? GLU A 134 GLU A 149 1 ? 16 
HELX_P HELX_P8  8  GLY E 151 ? TRP E 155 ? GLY A 157 TRP A 161 5 ? 5  
HELX_P HELX_P9  9  ASN E 158 ? SER E 181 ? ASN A 164 SER A 187 1 ? 24 
HELX_P HELX_P10 10 ASP E 191 ? VAL E 195 ? ASP A 197 VAL A 201 5 ? 5  
HELX_P HELX_P11 11 GLY E 196 ? GLU E 203 ? GLY A 202 GLU A 209 1 ? 8  
HELX_P HELX_P12 12 LEU E 205 ? GLY E 225 ? LEU A 211 GLY A 231 1 ? 21 
HELX_P HELX_P13 13 ASP E 229 ? PHE E 255 ? ASP A 235 PHE A 261 1 ? 27 
HELX_P HELX_P14 14 SER E 332 ? ALA E 343 ? SER A 338 ALA A 349 1 ? 12 
HELX_P HELX_P15 15 ASP E 359 ? VAL E 366 ? ASP A 365 VAL A 372 1 ? 8  
HELX_P HELX_P16 16 ASP E 370 ? ALA E 394 ? ASP A 376 ALA A 400 1 ? 25 
HELX_P HELX_P17 17 ALA E 399 ? VAL E 404 ? ALA A 405 VAL A 410 1 ? 6  
HELX_P HELX_P18 18 CYS E 445 ? PHE E 449 ? CYS A 451 PHE A 455 5 ? 5  
HELX_P HELX_P19 19 GLY E 450 ? HIS E 454 ? GLY A 456 HIS A 460 5 ? 5  
HELX_P HELX_P20 20 GLY E 472 ? MET E 482 ? GLY A 478 MET A 488 1 ? 11 
HELX_P HELX_P21 21 MET E 482 ? ASN E 487 ? MET A 488 ASN A 493 1 ? 6  
HELX_P HELX_P22 22 GLY E 488 ? GLY E 497 ? GLY A 494 GLY A 503 1 ? 10 
HELX_P HELX_P23 23 ILE E 499 ? ALA E 507 ? ILE A 505 ALA A 513 1 ? 9  
HELX_P HELX_P24 24 THR E 511 ? GLY E 521 ? THR A 517 GLY A 527 1 ? 11 
HELX_P HELX_P25 25 LYS E 530 ? GLY E 536 ? LYS A 536 GLY A 542 1 ? 7  
HELX_P HELX_P26 26 ARG E 541 ? THR E 553 ? ARG A 547 THR A 559 1 ? 13 
HELX_P HELX_P27 27 THR E 553 ? THR E 566 ? THR A 559 THR A 572 1 ? 14 
HELX_P HELX_P28 28 ALA E 602 ? GLU E 629 ? ALA A 608 GLU A 635 1 ? 28 
HELX_P HELX_P29 29 THR E 656 ? TRP E 678 ? THR A 662 TRP A 684 1 ? 23 
HELX_P HELX_P30 30 SER F 11  ? LEU F 17  ? SER B 11  LEU B 17  1 ? 7  
HELX_P HELX_P31 31 CYS F 32  ? GLU F 48  ? CYS B 32  GLU B 48  1 ? 17 
HELX_P HELX_P32 32 GLY F 97  ? ALA F 105 ? GLY B 97  ALA B 105 1 ? 9  
HELX_P HELX_P33 33 LEU G 11  ? VAL G 15  ? LEU C 11  VAL C 15  5 ? 5  
HELX_P HELX_P34 34 ASP G 38  ? GLY G 53  ? ASP C 38  GLY C 53  1 ? 16 
HELX_P HELX_P35 35 TYR G 64  ? ASN G 78  ? TYR C 64  ASN C 78  1 ? 15 
HELX_P HELX_P36 36 PRO G 84  ? GLU G 86  ? PRO C 84  GLU C 86  5 ? 3  
HELX_P HELX_P37 37 THR G 91  ? HIS G 99  ? THR C 91  HIS C 99  1 ? 9  
HELX_P HELX_P38 38 GLY G 123 ? GLU G 128 ? GLY C 129 GLU C 134 1 ? 6  
HELX_P HELX_P39 39 GLU G 128 ? GLU G 143 ? GLU C 134 GLU C 149 1 ? 16 
HELX_P HELX_P40 40 GLY G 151 ? TRP G 155 ? GLY C 157 TRP C 161 5 ? 5  
HELX_P HELX_P41 41 ASN G 158 ? SER G 181 ? ASN C 164 SER C 187 1 ? 24 
HELX_P HELX_P42 42 ASP G 191 ? VAL G 195 ? ASP C 197 VAL C 201 5 ? 5  
HELX_P HELX_P43 43 GLY G 196 ? GLU G 203 ? GLY C 202 GLU C 209 1 ? 8  
HELX_P HELX_P44 44 LEU G 205 ? GLY G 225 ? LEU C 211 GLY C 231 1 ? 21 
HELX_P HELX_P45 45 ASP G 229 ? PHE G 255 ? ASP C 235 PHE C 261 1 ? 27 
HELX_P HELX_P46 46 SER G 332 ? ALA G 343 ? SER C 338 ALA C 349 1 ? 12 
HELX_P HELX_P47 47 ASP G 359 ? VAL G 366 ? ASP C 365 VAL C 372 1 ? 8  
HELX_P HELX_P48 48 ASP G 370 ? ALA G 394 ? ASP C 376 ALA C 400 1 ? 25 
HELX_P HELX_P49 49 ALA G 399 ? VAL G 404 ? ALA C 405 VAL C 410 1 ? 6  
HELX_P HELX_P50 50 CYS G 445 ? PHE G 449 ? CYS C 451 PHE C 455 5 ? 5  
HELX_P HELX_P51 51 GLY G 450 ? HIS G 454 ? GLY C 456 HIS C 460 5 ? 5  
HELX_P HELX_P52 52 GLY G 472 ? MET G 482 ? GLY C 478 MET C 488 1 ? 11 
HELX_P HELX_P53 53 MET G 482 ? ASN G 487 ? MET C 488 ASN C 493 1 ? 6  
HELX_P HELX_P54 54 GLY G 488 ? GLY G 497 ? GLY C 494 GLY C 503 1 ? 10 
HELX_P HELX_P55 55 ILE G 499 ? ALA G 507 ? ILE C 505 ALA C 513 1 ? 9  
HELX_P HELX_P56 56 ARG G 512 ? GLY G 521 ? ARG C 518 GLY C 527 1 ? 10 
HELX_P HELX_P57 57 LYS G 530 ? GLY G 536 ? LYS C 536 GLY C 542 1 ? 7  
HELX_P HELX_P58 58 ARG G 541 ? THR G 553 ? ARG C 547 THR C 559 1 ? 13 
HELX_P HELX_P59 59 THR G 553 ? GLN G 565 ? THR C 559 GLN C 571 1 ? 13 
HELX_P HELX_P60 60 ALA G 602 ? GLU G 629 ? ALA C 608 GLU C 635 1 ? 28 
HELX_P HELX_P61 61 THR G 656 ? TRP G 678 ? THR C 662 TRP C 684 1 ? 23 
HELX_P HELX_P62 62 SER H 11  ? LEU H 17  ? SER D 11  LEU D 17  1 ? 7  
HELX_P HELX_P63 63 CYS H 32  ? GLU H 48  ? CYS D 32  GLU D 48  1 ? 17 
HELX_P HELX_P64 64 GLY H 97  ? ALA H 105 ? GLY D 97  ALA D 105 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? I MG  .  MG    ? ? ? 1_555 E ASP 5  OD1 ? ? A MG  4003 A ASP 5  1_555 ? ? ? ? ? ? ?               2.864 ? 
metalc2  metalc ? ? K MG  .  MG    ? ? ? 1_555 G ASP 65 OD2 ? ? C MG  4004 C ASP 65 1_555 ? ? ? ? ? ? ?               2.979 ? 
metalc3  metalc ? ? K MG  .  MG    ? ? ? 1_555 G ASP 5  OD1 ? ? C MG  4004 C ASP 5  1_555 ? ? ? ? ? ? ?               3.013 ? 
metalc4  metalc ? ? K MG  .  MG    ? ? ? 1_555 G ASP 65 OD1 ? ? C MG  4004 C ASP 65 1_555 ? ? ? ? ? ? ?               2.929 ? 
covale1  covale ? ? A DC  20 "O3'" ? ? ? 1_555 A 2DT 21 P   ? ? P DC  20   P 2DT 21 1_555 ? ? ? ? ? ? ?               1.593 ? 
covale2  covale ? ? C DC  20 "O3'" ? ? ? 1_555 C 2DT 21 P   ? ? Q DC  20   Q 2DT 21 1_555 ? ? ? ? ? ? ?               1.600 ? 
hydrog1  hydrog ? ? A DC  13 N3    ? ? ? 1_555 B DG  13 N1  ? ? P DC  13   T DG  14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2  hydrog ? ? A DC  13 N4    ? ? ? 1_555 B DG  13 O6  ? ? P DC  13   T DG  14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3  hydrog ? ? A DC  13 O2    ? ? ? 1_555 B DG  13 N2  ? ? P DC  13   T DG  14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4  hydrog ? ? A DC  14 N3    ? ? ? 1_555 B DG  12 N2  ? ? P DC  14   T DG  13 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog5  hydrog ? ? A DA  15 N1    ? ? ? 1_555 B DT  11 N3  ? ? P DA  15   T DT  12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6  hydrog ? ? A DA  15 N6    ? ? ? 1_555 B DT  11 O4  ? ? P DA  15   T DT  12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7  hydrog ? ? A DG  16 N1    ? ? ? 1_555 B DC  10 N3  ? ? P DG  16   T DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8  hydrog ? ? A DG  16 N2    ? ? ? 1_555 B DC  10 O2  ? ? P DG  16   T DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9  hydrog ? ? A DG  16 O6    ? ? ? 1_555 B DC  10 N4  ? ? P DG  16   T DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10 hydrog ? ? A DT  17 N3    ? ? ? 1_555 B DA  9  N1  ? ? P DT  17   T DA  10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11 hydrog ? ? A DT  17 O4    ? ? ? 1_555 B DA  9  N6  ? ? P DT  17   T DA  10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12 hydrog ? ? A DG  18 N1    ? ? ? 1_555 B DC  8  N3  ? ? P DG  18   T DC  9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13 hydrog ? ? A DG  18 N2    ? ? ? 1_555 B DC  8  O2  ? ? P DG  18   T DC  9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14 hydrog ? ? A DG  18 O6    ? ? ? 1_555 B DC  8  N4  ? ? P DG  18   T DC  9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15 hydrog ? ? A DC  19 N3    ? ? ? 1_555 B DG  7  N1  ? ? P DC  19   T DG  8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16 hydrog ? ? A DC  19 N4    ? ? ? 1_555 B DG  7  O6  ? ? P DC  19   T DG  8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17 hydrog ? ? A DC  19 O2    ? ? ? 1_555 B DG  7  N2  ? ? P DC  19   T DG  8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18 hydrog ? ? A DC  20 N3    ? ? ? 1_555 B DG  6  N1  ? ? P DC  20   T DG  7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19 hydrog ? ? A DC  20 N4    ? ? ? 1_555 B DG  6  O6  ? ? P DC  20   T DG  7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20 hydrog ? ? A DC  20 O2    ? ? ? 1_555 B DG  6  N2  ? ? P DC  20   T DG  7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21 hydrog ? ? A 2DT 21 N3    ? ? ? 1_555 B DA  5  N1  ? ? P 2DT 21   T DA  6  1_555 ? ? ? ? ? ? '2DT-DA PAIR'   ?     ? 
hydrog22 hydrog ? ? C DC  13 N4    ? ? ? 1_555 D DG  12 O6  ? ? Q DC  13   U DG  13 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog23 hydrog ? ? C DC  13 N3    ? ? ? 1_555 D DG  13 N1  ? ? Q DC  13   U DG  14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24 hydrog ? ? C DC  13 N4    ? ? ? 1_555 D DG  13 O6  ? ? Q DC  13   U DG  14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25 hydrog ? ? C DC  13 O2    ? ? ? 1_555 D DG  13 N2  ? ? Q DC  13   U DG  14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26 hydrog ? ? C DA  15 N1    ? ? ? 1_555 D DT  11 N3  ? ? Q DA  15   U DT  12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27 hydrog ? ? C DA  15 N6    ? ? ? 1_555 D DT  11 O4  ? ? Q DA  15   U DT  12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28 hydrog ? ? C DG  16 N1    ? ? ? 1_555 D DC  10 N3  ? ? Q DG  16   U DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29 hydrog ? ? C DG  16 N2    ? ? ? 1_555 D DC  10 O2  ? ? Q DG  16   U DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30 hydrog ? ? C DG  16 O6    ? ? ? 1_555 D DC  10 N4  ? ? Q DG  16   U DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31 hydrog ? ? C DG  16 N2    ? ? ? 1_555 D DT  11 O2  ? ? Q DG  16   U DT  12 1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ?     ? 
hydrog32 hydrog ? ? C DT  17 N3    ? ? ? 1_555 D DA  9  N1  ? ? Q DT  17   U DA  10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33 hydrog ? ? C DT  17 O4    ? ? ? 1_555 D DA  9  N6  ? ? Q DT  17   U DA  10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34 hydrog ? ? C DG  18 N1    ? ? ? 1_555 D DC  8  N3  ? ? Q DG  18   U DC  9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35 hydrog ? ? C DG  18 N2    ? ? ? 1_555 D DC  8  O2  ? ? Q DG  18   U DC  9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36 hydrog ? ? C DG  18 O6    ? ? ? 1_555 D DC  8  N4  ? ? Q DG  18   U DC  9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37 hydrog ? ? C DC  19 N3    ? ? ? 1_555 D DG  7  N1  ? ? Q DC  19   U DG  8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38 hydrog ? ? C DC  19 N4    ? ? ? 1_555 D DG  7  O6  ? ? Q DC  19   U DG  8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39 hydrog ? ? C DC  19 O2    ? ? ? 1_555 D DG  7  N2  ? ? Q DC  19   U DG  8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40 hydrog ? ? C DC  20 O2    ? ? ? 1_555 D DG  6  N2  ? ? Q DC  20   U DG  7  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog41 hydrog ? ? C 2DT 21 N3    ? ? ? 1_555 D DA  5  N1  ? ? Q 2DT 21   U DA  6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42 hydrog ? ? C 2DT 21 O4    ? ? ? 1_555 D DA  5  N6  ? ? Q 2DT 21   U DA  6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 428 E . ? PHE 434 A PRO 429 E ? PRO 435 A 1 -0.43 
2 ILE 75  F . ? ILE 75  B PRO 76  F ? PRO 76  B 1 0.23  
3 PHE 428 G . ? PHE 434 C PRO 429 G ? PRO 435 C 1 -0.55 
4 ILE 75  H . ? ILE 75  D PRO 76  H ? PRO 76  D 1 0.29  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 2 ? 
D ? 3 ? 
E ? 2 ? 
F ? 4 ? 
G ? 2 ? 
H ? 5 ? 
I ? 3 ? 
J ? 2 ? 
K ? 2 ? 
L ? 3 ? 
M ? 2 ? 
N ? 4 ? 
O ? 2 ? 
P ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? parallel      
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? anti-parallel 
P 1 2 ? parallel      
P 2 3 ? parallel      
P 3 4 ? anti-parallel 
P 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE E 2   ? VAL E 3   ? ILE A 2   VAL A 3   
A 2 ILE E 56  ? PHE E 58  ? ILE A 56  PHE A 58  
A 3 CYS E 88  ? ASP E 90  ? CYS A 88  ASP A 90  
B 1 ASP E 5   ? ALA E 8   ? ASP A 5   ALA A 8   
B 2 PHE E 18  ? VAL E 22  ? PHE A 18  VAL A 22  
C 1 TYR E 24  ? ASP E 25  ? TYR A 24  ASP A 25  
C 2 GLU E 30  ? TYR E 31  ? GLU A 30  TYR A 31  
D 1 TRP E 258 ? PRO E 261 ? TRP A 264 PRO A 267 
D 2 THR E 321 ? VAL E 326 ? THR A 327 VAL A 332 
D 3 GLY F 74  ? ILE F 75  ? GLY B 74  ILE B 75  
E 1 SER E 413 ? ASN E 415 ? SER A 419 ASN A 421 
E 2 THR E 425 ? ALA E 427 ? THR A 431 ALA A 433 
F 1 PHE E 640 ? TRP E 645 ? PHE A 646 TRP A 651 
F 2 GLU E 649 ? CYS E 654 ? GLU A 655 CYS A 660 
F 3 VAL E 464 ? ALA E 470 ? VAL A 470 ALA A 476 
F 4 THR E 686 ? GLY E 691 ? THR A 692 GLY A 697 
G 1 TRP E 586 ? LYS E 588 ? TRP A 592 LYS A 594 
G 2 LYS E 594 ? HIS E 596 ? LYS A 600 HIS A 602 
H 1 ILE F 5   ? HIS F 6   ? ILE B 5   HIS B 6   
H 2 THR F 54  ? ASN F 59  ? THR B 54  ASN B 59  
H 3 ALA F 22  ? TRP F 28  ? ALA B 22  TRP B 28  
H 4 THR F 77  ? LYS F 82  ? THR B 77  LYS B 82  
H 5 VAL F 86  ? VAL F 91  ? VAL B 86  VAL B 91  
I 1 ILE G 2   ? VAL G 3   ? ILE C 2   VAL C 3   
I 2 ILE G 56  ? PHE G 58  ? ILE C 56  PHE C 58  
I 3 CYS G 88  ? ASP G 90  ? CYS C 88  ASP C 90  
J 1 ASP G 5   ? ALA G 8   ? ASP C 5   ALA C 8   
J 2 PHE G 18  ? VAL G 22  ? PHE C 18  VAL C 22  
K 1 TYR G 24  ? ASP G 25  ? TYR C 24  ASP C 25  
K 2 GLU G 30  ? TYR G 31  ? GLU C 30  TYR C 31  
L 1 TRP G 258 ? PRO G 261 ? TRP C 264 PRO C 267 
L 2 THR G 321 ? VAL G 326 ? THR C 327 VAL C 332 
L 3 GLY H 74  ? ILE H 75  ? GLY D 74  ILE D 75  
M 1 SER G 413 ? ASN G 415 ? SER C 419 ASN C 421 
M 2 THR G 425 ? ALA G 427 ? THR C 431 ALA C 433 
N 1 PHE G 640 ? TRP G 645 ? PHE C 646 TRP C 651 
N 2 GLU G 649 ? CYS G 654 ? GLU C 655 CYS C 660 
N 3 VAL G 464 ? ALA G 470 ? VAL C 470 ALA C 476 
N 4 THR G 686 ? GLY G 691 ? THR C 692 GLY C 697 
O 1 TRP G 586 ? LYS G 588 ? TRP C 592 LYS C 594 
O 2 LYS G 594 ? HIS G 596 ? LYS C 600 HIS C 602 
P 1 ILE H 5   ? HIS H 6   ? ILE D 5   HIS D 6   
P 2 THR H 54  ? ASN H 59  ? THR D 54  ASN D 59  
P 3 ALA H 22  ? TRP H 28  ? ALA D 22  TRP D 28  
P 4 THR H 77  ? LYS H 82  ? THR D 77  LYS D 82  
P 5 VAL H 86  ? VAL H 91  ? VAL D 86  VAL D 91  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE E 2   ? N ILE A 2   O VAL E 57  ? O VAL A 57  
A 2 3 N ILE E 56  ? N ILE A 56  O ILE E 89  ? O ILE A 89  
B 1 2 N GLU E 7   ? N GLU A 7   O HIS E 19  ? O HIS A 19  
C 1 2 N ASP E 25  ? N ASP A 25  O GLU E 30  ? O GLU A 30  
D 1 2 N TRP E 258 ? N TRP A 264 O VAL E 326 ? O VAL A 332 
D 2 3 N THR E 321 ? N THR A 327 O ILE F 75  ? O ILE B 75  
E 1 2 N SER E 413 ? N SER A 419 O ALA E 427 ? O ALA A 433 
F 1 2 N ALA E 641 ? N ALA A 647 O GLY E 653 ? O GLY A 659 
F 2 3 O CYS E 654 ? O CYS A 660 N VAL E 464 ? N VAL A 470 
F 3 4 N GLN E 465 ? N GLN A 471 O GLY E 691 ? O GLY A 697 
G 1 2 N ILE E 587 ? N ILE A 593 O VAL E 595 ? O VAL A 601 
H 1 2 N ILE F 5   ? N ILE B 5   O LYS F 57  ? O LYS B 57  
H 2 3 O THR F 54  ? O THR B 54  N ALA F 22  ? N ALA B 22  
H 3 4 N ILE F 23  ? N ILE B 23  O PHE F 81  ? O PHE B 81  
H 4 5 N LEU F 78  ? N LEU B 78  O LYS F 90  ? O LYS B 90  
I 1 2 N ILE G 2   ? N ILE C 2   O VAL G 57  ? O VAL C 57  
I 2 3 N ILE G 56  ? N ILE C 56  O ILE G 89  ? O ILE C 89  
J 1 2 N GLU G 7   ? N GLU C 7   O HIS G 19  ? O HIS C 19  
K 1 2 N ASP G 25  ? N ASP C 25  O GLU G 30  ? O GLU C 30  
L 1 2 N TRP G 258 ? N TRP C 264 O VAL G 326 ? O VAL C 332 
L 2 3 N THR G 321 ? N THR C 327 O ILE H 75  ? O ILE D 75  
M 1 2 N SER G 413 ? N SER C 419 O ALA G 427 ? O ALA C 433 
N 1 2 N ALA G 641 ? N ALA C 647 O GLY G 653 ? O GLY C 659 
N 2 3 O CYS G 654 ? O CYS C 660 N VAL G 464 ? N VAL C 470 
N 3 4 N GLN G 465 ? N GLN C 471 O GLY G 691 ? O GLY C 697 
O 1 2 N ILE G 587 ? N ILE C 593 O VAL G 595 ? O VAL C 601 
P 1 2 N ILE H 5   ? N ILE D 5   O LYS H 57  ? O LYS D 57  
P 2 3 O THR H 54  ? O THR D 54  N ALA H 22  ? N ALA D 22  
P 3 4 N ILE H 23  ? N ILE D 23  O PHE H 81  ? O PHE D 81  
P 4 5 N LEU H 78  ? N LEU D 78  O LYS H 90  ? O LYS D 90  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MG A 4003'  
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG C 4004'  
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE DAD C 4005' 
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE DAD A 4004' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 ASP E 5   ? ASP A 5   . ? 1_555 ? 
2  AC1 2 ASP E 65  ? ASP A 65  . ? 1_555 ? 
3  AC2 3 ASP G 5   ? ASP C 5   . ? 1_555 ? 
4  AC2 3 HIS G 59  ? HIS C 59  . ? 1_555 ? 
5  AC2 3 ASP G 65  ? ASP C 65  . ? 1_555 ? 
6  AC3 2 HIS G 500 ? HIS C 506 . ? 1_555 ? 
7  AC3 2 ARG G 512 ? ARG C 518 . ? 1_555 ? 
8  AC4 3 HIS E 500 ? HIS A 506 . ? 1_555 ? 
9  AC4 3 ARG E 512 ? ARG A 518 . ? 1_555 ? 
10 AC4 3 TYR E 520 ? TYR A 526 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1SL0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SL0 
_atom_sites.fract_transf_matrix[1][1]   0.018428 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000504 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009482 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004676 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     P  P     . DG  A 1 11  ? 10.054  48.693  2.490   1.00 164.96 ? 11   DG  P P     1 
ATOM   2     O  OP1   . DG  A 1 11  ? 9.185   47.471  2.736   1.00 122.08 ? 11   DG  P OP1   1 
ATOM   3     O  OP2   . DG  A 1 11  ? 10.666  48.708  1.096   1.00 122.08 ? 11   DG  P OP2   1 
ATOM   4     O  "O5'" . DG  A 1 11  ? 11.294  48.580  3.545   1.00 164.96 ? 11   DG  P "O5'" 1 
ATOM   5     C  "C5'" . DG  A 1 11  ? 11.287  49.327  4.780   1.00 164.96 ? 11   DG  P "C5'" 1 
ATOM   6     C  "C4'" . DG  A 1 11  ? 12.580  49.113  5.537   1.00 164.96 ? 11   DG  P "C4'" 1 
ATOM   7     O  "O4'" . DG  A 1 11  ? 13.703  49.403  4.665   1.00 164.96 ? 11   DG  P "O4'" 1 
ATOM   8     C  "C3'" . DG  A 1 11  ? 12.744  50.028  6.754   1.00 164.96 ? 11   DG  P "C3'" 1 
ATOM   9     O  "O3'" . DG  A 1 11  ? 13.399  49.347  7.838   1.00 164.96 ? 11   DG  P "O3'" 1 
ATOM   10    C  "C2'" . DG  A 1 11  ? 13.601  51.159  6.222   1.00 164.96 ? 11   DG  P "C2'" 1 
ATOM   11    C  "C1'" . DG  A 1 11  ? 14.484  50.463  5.204   1.00 164.96 ? 11   DG  P "C1'" 1 
ATOM   12    N  N9    . DG  A 1 11  ? 14.911  51.332  4.109   1.00 122.08 ? 11   DG  P N9    1 
ATOM   13    C  C8    . DG  A 1 11  ? 14.215  51.634  2.960   1.00 122.08 ? 11   DG  P C8    1 
ATOM   14    N  N7    . DG  A 1 11  ? 14.847  52.469  2.178   1.00 122.08 ? 11   DG  P N7    1 
ATOM   15    C  C5    . DG  A 1 11  ? 16.037  52.732  2.845   1.00 122.08 ? 11   DG  P C5    1 
ATOM   16    C  C6    . DG  A 1 11  ? 17.131  53.574  2.486   1.00 122.08 ? 11   DG  P C6    1 
ATOM   17    O  O6    . DG  A 1 11  ? 17.267  54.277  1.474   1.00 122.08 ? 11   DG  P O6    1 
ATOM   18    N  N1    . DG  A 1 11  ? 18.135  53.549  3.450   1.00 122.08 ? 11   DG  P N1    1 
ATOM   19    C  C2    . DG  A 1 11  ? 18.099  52.813  4.612   1.00 122.08 ? 11   DG  P C2    1 
ATOM   20    N  N2    . DG  A 1 11  ? 19.168  52.931  5.416   1.00 122.08 ? 11   DG  P N2    1 
ATOM   21    N  N3    . DG  A 1 11  ? 17.089  52.024  4.960   1.00 122.08 ? 11   DG  P N3    1 
ATOM   22    C  C4    . DG  A 1 11  ? 16.098  52.033  4.037   1.00 122.08 ? 11   DG  P C4    1 
ATOM   23    P  P     . DG  A 1 12  ? 13.542  50.071  9.275   1.00 133.79 ? 12   DG  P P     1 
ATOM   24    O  OP1   . DG  A 1 12  ? 13.852  49.039  10.303  1.00 106.80 ? 12   DG  P OP1   1 
ATOM   25    O  OP2   . DG  A 1 12  ? 12.365  50.958  9.470   1.00 106.80 ? 12   DG  P OP2   1 
ATOM   26    O  "O5'" . DG  A 1 12  ? 14.821  51.011  9.097   1.00 133.79 ? 12   DG  P "O5'" 1 
ATOM   27    C  "C5'" . DG  A 1 12  ? 16.153  50.488  9.199   1.00 133.79 ? 12   DG  P "C5'" 1 
ATOM   28    C  "C4'" . DG  A 1 12  ? 17.149  51.614  9.378   1.00 133.79 ? 12   DG  P "C4'" 1 
ATOM   29    O  "O4'" . DG  A 1 12  ? 17.282  52.362  8.142   1.00 133.79 ? 12   DG  P "O4'" 1 
ATOM   30    C  "C3'" . DG  A 1 12  ? 16.753  52.631  10.447  1.00 133.79 ? 12   DG  P "C3'" 1 
ATOM   31    O  "O3'" . DG  A 1 12  ? 17.890  53.075  11.189  1.00 133.79 ? 12   DG  P "O3'" 1 
ATOM   32    C  "C2'" . DG  A 1 12  ? 16.163  53.774  9.646   1.00 133.79 ? 12   DG  P "C2'" 1 
ATOM   33    C  "C1'" . DG  A 1 12  ? 16.945  53.732  8.347   1.00 133.79 ? 12   DG  P "C1'" 1 
ATOM   34    N  N9    . DG  A 1 12  ? 16.119  54.174  7.222   1.00 106.80 ? 12   DG  P N9    1 
ATOM   35    C  C8    . DG  A 1 12  ? 14.841  53.745  6.943   1.00 106.80 ? 12   DG  P C8    1 
ATOM   36    N  N7    . DG  A 1 12  ? 14.323  54.311  5.888   1.00 106.80 ? 12   DG  P N7    1 
ATOM   37    C  C5    . DG  A 1 12  ? 15.315  55.170  5.430   1.00 106.80 ? 12   DG  P C5    1 
ATOM   38    C  C6    . DG  A 1 12  ? 15.324  56.040  4.311   1.00 106.80 ? 12   DG  P C6    1 
ATOM   39    O  O6    . DG  A 1 12  ? 14.439  56.216  3.472   1.00 106.80 ? 12   DG  P O6    1 
ATOM   40    N  N1    . DG  A 1 12  ? 16.519  56.738  4.211   1.00 106.80 ? 12   DG  P N1    1 
ATOM   41    C  C2    . DG  A 1 12  ? 17.583  56.610  5.067   1.00 106.80 ? 12   DG  P C2    1 
ATOM   42    N  N2    . DG  A 1 12  ? 18.650  57.376  4.787   1.00 106.80 ? 12   DG  P N2    1 
ATOM   43    N  N3    . DG  A 1 12  ? 17.599  55.790  6.117   1.00 106.80 ? 12   DG  P N3    1 
ATOM   44    C  C4    . DG  A 1 12  ? 16.435  55.104  6.239   1.00 106.80 ? 12   DG  P C4    1 
ATOM   45    P  P     . DC  A 1 13  ? 17.782  54.405  12.092  1.00 124.97 ? 13   DC  P P     1 
ATOM   46    O  OP1   . DC  A 1 13  ? 18.973  54.457  12.993  1.00 80.69  ? 13   DC  P OP1   1 
ATOM   47    O  OP2   . DC  A 1 13  ? 16.409  54.456  12.683  1.00 80.69  ? 13   DC  P OP2   1 
ATOM   48    O  "O5'" . DC  A 1 13  ? 17.906  55.574  11.011  1.00 124.97 ? 13   DC  P "O5'" 1 
ATOM   49    C  "C5'" . DC  A 1 13  ? 19.070  55.678  10.179  1.00 124.97 ? 13   DC  P "C5'" 1 
ATOM   50    C  "C4'" . DC  A 1 13  ? 19.327  57.119  9.796   1.00 124.97 ? 13   DC  P "C4'" 1 
ATOM   51    O  "O4'" . DC  A 1 13  ? 18.623  57.482  8.584   1.00 124.97 ? 13   DC  P "O4'" 1 
ATOM   52    C  "C3'" . DC  A 1 13  ? 18.914  58.141  10.852  1.00 124.97 ? 13   DC  P "C3'" 1 
ATOM   53    O  "O3'" . DC  A 1 13  ? 19.879  59.178  10.954  1.00 124.97 ? 13   DC  P "O3'" 1 
ATOM   54    C  "C2'" . DC  A 1 13  ? 17.627  58.717  10.298  1.00 124.97 ? 13   DC  P "C2'" 1 
ATOM   55    C  "C1'" . DC  A 1 13  ? 17.873  58.669  8.802   1.00 124.97 ? 13   DC  P "C1'" 1 
ATOM   56    N  N1    . DC  A 1 13  ? 16.639  58.598  7.985   1.00 80.69  ? 13   DC  P N1    1 
ATOM   57    C  C2    . DC  A 1 13  ? 16.523  59.415  6.852   1.00 80.69  ? 13   DC  P C2    1 
ATOM   58    O  O2    . DC  A 1 13  ? 17.441  60.195  6.569   1.00 80.69  ? 13   DC  P O2    1 
ATOM   59    N  N3    . DC  A 1 13  ? 15.406  59.336  6.099   1.00 80.69  ? 13   DC  P N3    1 
ATOM   60    C  C4    . DC  A 1 13  ? 14.423  58.497  6.443   1.00 80.69  ? 13   DC  P C4    1 
ATOM   61    N  N4    . DC  A 1 13  ? 13.340  58.449  5.665   1.00 80.69  ? 13   DC  P N4    1 
ATOM   62    C  C5    . DC  A 1 13  ? 14.506  57.669  7.595   1.00 80.69  ? 13   DC  P C5    1 
ATOM   63    C  C6    . DC  A 1 13  ? 15.619  57.746  8.327   1.00 80.69  ? 13   DC  P C6    1 
ATOM   64    P  P     . DC  A 1 14  ? 19.752  60.260  12.137  1.00 104.93 ? 14   DC  P P     1 
ATOM   65    O  OP1   . DC  A 1 14  ? 20.641  59.867  13.269  1.00 89.59  ? 14   DC  P OP1   1 
ATOM   66    O  OP2   . DC  A 1 14  ? 18.299  60.503  12.400  1.00 89.59  ? 14   DC  P OP2   1 
ATOM   67    O  "O5'" . DC  A 1 14  ? 20.370  61.567  11.481  1.00 104.93 ? 14   DC  P "O5'" 1 
ATOM   68    C  "C5'" . DC  A 1 14  ? 19.841  62.841  11.788  1.00 104.93 ? 14   DC  P "C5'" 1 
ATOM   69    C  "C4'" . DC  A 1 14  ? 19.876  63.728  10.568  1.00 104.93 ? 14   DC  P "C4'" 1 
ATOM   70    O  "O4'" . DC  A 1 14  ? 19.096  63.167  9.480   1.00 104.93 ? 14   DC  P "O4'" 1 
ATOM   71    C  "C3'" . DC  A 1 14  ? 19.267  65.085  10.863  1.00 104.93 ? 14   DC  P "C3'" 1 
ATOM   72    O  "O3'" . DC  A 1 14  ? 20.031  66.115  10.273  1.00 104.93 ? 14   DC  P "O3'" 1 
ATOM   73    C  "C2'" . DC  A 1 14  ? 17.884  65.013  10.251  1.00 104.93 ? 14   DC  P "C2'" 1 
ATOM   74    C  "C1'" . DC  A 1 14  ? 18.064  64.062  9.088   1.00 104.93 ? 14   DC  P "C1'" 1 
ATOM   75    N  N1    . DC  A 1 14  ? 16.832  63.275  8.841   1.00 89.59  ? 14   DC  P N1    1 
ATOM   76    C  C2    . DC  A 1 14  ? 16.149  63.425  7.619   1.00 89.59  ? 14   DC  P C2    1 
ATOM   77    O  O2    . DC  A 1 14  ? 16.614  64.181  6.753   1.00 89.59  ? 14   DC  P O2    1 
ATOM   78    N  N3    . DC  A 1 14  ? 14.999  62.737  7.414   1.00 89.59  ? 14   DC  P N3    1 
ATOM   79    C  C4    . DC  A 1 14  ? 14.534  61.922  8.359   1.00 89.59  ? 14   DC  P C4    1 
ATOM   80    N  N4    . DC  A 1 14  ? 13.402  61.261  8.116   1.00 89.59  ? 14   DC  P N4    1 
ATOM   81    C  C5    . DC  A 1 14  ? 15.209  61.744  9.599   1.00 89.59  ? 14   DC  P C5    1 
ATOM   82    C  C6    . DC  A 1 14  ? 16.344  62.428  9.796   1.00 89.59  ? 14   DC  P C6    1 
ATOM   83    P  P     . DA  A 1 15  ? 19.521  67.622  10.411  1.00 81.36  ? 15   DA  P P     1 
ATOM   84    O  OP1   . DA  A 1 15  ? 20.648  68.559  10.146  1.00 66.81  ? 15   DA  P OP1   1 
ATOM   85    O  OP2   . DA  A 1 15  ? 18.724  67.775  11.660  1.00 66.81  ? 15   DA  P OP2   1 
ATOM   86    O  "O5'" . DA  A 1 15  ? 18.483  67.697  9.220   1.00 81.36  ? 15   DA  P "O5'" 1 
ATOM   87    C  "C5'" . DA  A 1 15  ? 18.919  67.581  7.876   1.00 81.36  ? 15   DA  P "C5'" 1 
ATOM   88    C  "C4'" . DA  A 1 15  ? 17.992  68.372  6.989   1.00 81.36  ? 15   DA  P "C4'" 1 
ATOM   89    O  "O4'" . DA  A 1 15  ? 16.769  67.632  6.808   1.00 81.36  ? 15   DA  P "O4'" 1 
ATOM   90    C  "C3'" . DA  A 1 15  ? 17.593  69.708  7.605   1.00 81.36  ? 15   DA  P "C3'" 1 
ATOM   91    O  "O3'" . DA  A 1 15  ? 17.472  70.661  6.561   1.00 81.36  ? 15   DA  P "O3'" 1 
ATOM   92    C  "C2'" . DA  A 1 15  ? 16.270  69.399  8.282   1.00 81.36  ? 15   DA  P "C2'" 1 
ATOM   93    C  "C1'" . DA  A 1 15  ? 15.679  68.346  7.365   1.00 81.36  ? 15   DA  P "C1'" 1 
ATOM   94    N  N9    . DA  A 1 15  ? 14.805  67.364  7.991   1.00 66.81  ? 15   DA  P N9    1 
ATOM   95    C  C8    . DA  A 1 15  ? 14.997  66.651  9.141   1.00 66.81  ? 15   DA  P C8    1 
ATOM   96    N  N7    . DA  A 1 15  ? 14.063  65.765  9.373   1.00 66.81  ? 15   DA  P N7    1 
ATOM   97    C  C5    . DA  A 1 15  ? 13.184  65.927  8.316   1.00 66.81  ? 15   DA  P C5    1 
ATOM   98    C  C6    . DA  A 1 15  ? 12.001  65.279  7.973   1.00 66.81  ? 15   DA  P C6    1 
ATOM   99    N  N6    . DA  A 1 15  ? 11.467  64.283  8.674   1.00 66.81  ? 15   DA  P N6    1 
ATOM   100   N  N1    . DA  A 1 15  ? 11.371  65.685  6.859   1.00 66.81  ? 15   DA  P N1    1 
ATOM   101   C  C2    . DA  A 1 15  ? 11.911  66.674  6.144   1.00 66.81  ? 15   DA  P C2    1 
ATOM   102   N  N3    . DA  A 1 15  ? 13.019  67.354  6.358   1.00 66.81  ? 15   DA  P N3    1 
ATOM   103   C  C4    . DA  A 1 15  ? 13.617  66.926  7.474   1.00 66.81  ? 15   DA  P C4    1 
ATOM   104   P  P     . DG  A 1 16  ? 17.142  72.186  6.905   1.00 71.70  ? 16   DG  P P     1 
ATOM   105   O  OP1   . DG  A 1 16  ? 17.782  73.016  5.844   1.00 52.61  ? 16   DG  P OP1   1 
ATOM   106   O  OP2   . DG  A 1 16  ? 17.392  72.470  8.346   1.00 52.61  ? 16   DG  P OP2   1 
ATOM   107   O  "O5'" . DG  A 1 16  ? 15.572  72.276  6.699   1.00 71.70  ? 16   DG  P "O5'" 1 
ATOM   108   C  "C5'" . DG  A 1 16  ? 14.982  71.933  5.448   1.00 71.70  ? 16   DG  P "C5'" 1 
ATOM   109   C  "C4'" . DG  A 1 16  ? 13.481  72.037  5.546   1.00 71.70  ? 16   DG  P "C4'" 1 
ATOM   110   O  "O4'" . DG  A 1 16  ? 12.927  70.898  6.248   1.00 71.70  ? 16   DG  P "O4'" 1 
ATOM   111   C  "C3'" . DG  A 1 16  ? 12.992  73.276  6.296   1.00 71.70  ? 16   DG  P "C3'" 1 
ATOM   112   O  "O3'" . DG  A 1 16  ? 11.863  73.793  5.602   1.00 71.70  ? 16   DG  P "O3'" 1 
ATOM   113   C  "C2'" . DG  A 1 16  ? 12.585  72.720  7.648   1.00 71.70  ? 16   DG  P "C2'" 1 
ATOM   114   C  "C1'" . DG  A 1 16  ? 12.023  71.380  7.222   1.00 71.70  ? 16   DG  P "C1'" 1 
ATOM   115   N  N9    . DG  A 1 16  ? 11.832  70.348  8.239   1.00 52.61  ? 16   DG  P N9    1 
ATOM   116   C  C8    . DG  A 1 16  ? 12.593  70.117  9.347   1.00 52.61  ? 16   DG  P C8    1 
ATOM   117   N  N7    . DG  A 1 16  ? 12.168  69.112  10.062  1.00 52.61  ? 16   DG  P N7    1 
ATOM   118   C  C5    . DG  A 1 16  ? 11.057  68.648  9.381   1.00 52.61  ? 16   DG  P C5    1 
ATOM   119   C  C6    . DG  A 1 16  ? 10.180  67.558  9.671   1.00 52.61  ? 16   DG  P C6    1 
ATOM   120   O  O6    . DG  A 1 16  ? 10.204  66.769  10.631  1.00 52.61  ? 16   DG  P O6    1 
ATOM   121   N  N1    . DG  A 1 16  ? 9.193   67.433  8.702   1.00 52.61  ? 16   DG  P N1    1 
ATOM   122   C  C2    . DG  A 1 16  ? 9.059   68.245  7.606   1.00 52.61  ? 16   DG  P C2    1 
ATOM   123   N  N2    . DG  A 1 16  ? 8.070   67.942  6.776   1.00 52.61  ? 16   DG  P N2    1 
ATOM   124   N  N3    . DG  A 1 16  ? 9.847   69.268  7.338   1.00 52.61  ? 16   DG  P N3    1 
ATOM   125   C  C4    . DG  A 1 16  ? 10.826  69.405  8.258   1.00 52.61  ? 16   DG  P C4    1 
ATOM   126   P  P     . DT  A 1 17  ? 11.300  75.251  5.955   1.00 52.74  ? 17   DT  P P     1 
ATOM   127   O  OP1   . DT  A 1 17  ? 11.023  75.914  4.654   1.00 72.77  ? 17   DT  P OP1   1 
ATOM   128   O  OP2   . DT  A 1 17  ? 12.174  75.914  6.968   1.00 72.77  ? 17   DT  P OP2   1 
ATOM   129   O  "O5'" . DT  A 1 17  ? 9.918   74.954  6.670   1.00 52.74  ? 17   DT  P "O5'" 1 
ATOM   130   C  "C5'" . DT  A 1 17  ? 9.708   73.709  7.305   1.00 52.74  ? 17   DT  P "C5'" 1 
ATOM   131   C  "C4'" . DT  A 1 17  ? 8.267   73.300  7.174   1.00 52.74  ? 17   DT  P "C4'" 1 
ATOM   132   O  "O4'" . DT  A 1 17  ? 8.157   71.950  7.666   1.00 52.74  ? 17   DT  P "O4'" 1 
ATOM   133   C  "C3'" . DT  A 1 17  ? 7.349   74.156  8.030   1.00 52.74  ? 17   DT  P "C3'" 1 
ATOM   134   O  "O3'" . DT  A 1 17  ? 6.140   74.457  7.351   1.00 52.74  ? 17   DT  P "O3'" 1 
ATOM   135   C  "C2'" . DT  A 1 17  ? 7.119   73.319  9.271   1.00 52.74  ? 17   DT  P "C2'" 1 
ATOM   136   C  "C1'" . DT  A 1 17  ? 7.336   71.889  8.807   1.00 52.74  ? 17   DT  P "C1'" 1 
ATOM   137   N  N1    . DT  A 1 17  ? 8.031   71.073  9.809   1.00 72.77  ? 17   DT  P N1    1 
ATOM   138   C  C2    . DT  A 1 17  ? 7.461   69.892  10.211  1.00 72.77  ? 17   DT  P C2    1 
ATOM   139   O  O2    . DT  A 1 17  ? 6.473   69.411  9.683   1.00 72.77  ? 17   DT  P O2    1 
ATOM   140   N  N3    . DT  A 1 17  ? 8.105   69.278  11.255  1.00 72.77  ? 17   DT  P N3    1 
ATOM   141   C  C4    . DT  A 1 17  ? 9.249   69.706  11.899  1.00 72.77  ? 17   DT  P C4    1 
ATOM   142   O  O4    . DT  A 1 17  ? 9.676   69.081  12.863  1.00 72.77  ? 17   DT  P O4    1 
ATOM   143   C  C5    . DT  A 1 17  ? 9.841   70.907  11.361  1.00 72.77  ? 17   DT  P C5    1 
ATOM   144   C  C7    . DT  A 1 17  ? 11.121  71.415  11.940  1.00 72.77  ? 17   DT  P C7    1 
ATOM   145   C  C6    . DT  A 1 17  ? 9.211   71.520  10.358  1.00 72.77  ? 17   DT  P C6    1 
ATOM   146   P  P     . DG  A 1 18  ? 5.075   75.447  8.031   1.00 52.74  ? 18   DG  P P     1 
ATOM   147   O  OP1   . DG  A 1 18  ? 4.425   76.245  6.957   1.00 53.24  ? 18   DG  P OP1   1 
ATOM   148   O  OP2   . DG  A 1 18  ? 5.699   76.150  9.178   1.00 53.24  ? 18   DG  P OP2   1 
ATOM   149   O  "O5'" . DG  A 1 18  ? 4.024   74.431  8.639   1.00 52.74  ? 18   DG  P "O5'" 1 
ATOM   150   C  "C5'" . DG  A 1 18  ? 3.389   73.483  7.803   1.00 52.74  ? 18   DG  P "C5'" 1 
ATOM   151   C  "C4'" . DG  A 1 18  ? 2.377   72.702  8.599   1.00 52.74  ? 18   DG  P "C4'" 1 
ATOM   152   O  "O4'" . DG  A 1 18  ? 3.051   71.754  9.455   1.00 52.74  ? 18   DG  P "O4'" 1 
ATOM   153   C  "C3'" . DG  A 1 18  ? 1.508   73.570  9.508   1.00 52.74  ? 18   DG  P "C3'" 1 
ATOM   154   O  "O3'" . DG  A 1 18  ? 0.191   73.011  9.518   1.00 52.74  ? 18   DG  P "O3'" 1 
ATOM   155   C  "C2'" . DG  A 1 18  ? 2.195   73.440  10.853  1.00 52.74  ? 18   DG  P "C2'" 1 
ATOM   156   C  "C1'" . DG  A 1 18  ? 2.724   72.015  10.808  1.00 52.74  ? 18   DG  P "C1'" 1 
ATOM   157   N  N9    . DG  A 1 18  ? 3.917   71.789  11.625  1.00 53.24  ? 18   DG  P N9    1 
ATOM   158   C  C8    . DG  A 1 18  ? 4.995   72.630  11.774  1.00 53.24  ? 18   DG  P C8    1 
ATOM   159   N  N7    . DG  A 1 18  ? 5.886   72.176  12.609  1.00 53.24  ? 18   DG  P N7    1 
ATOM   160   C  C5    . DG  A 1 18  ? 5.372   70.960  13.030  1.00 53.24  ? 18   DG  P C5    1 
ATOM   161   C  C6    . DG  A 1 18  ? 5.885   70.026  13.953  1.00 53.24  ? 18   DG  P C6    1 
ATOM   162   O  O6    . DG  A 1 18  ? 6.944   70.091  14.611  1.00 53.24  ? 18   DG  P O6    1 
ATOM   163   N  N1    . DG  A 1 18  ? 5.036   68.931  14.094  1.00 53.24  ? 18   DG  P N1    1 
ATOM   164   C  C2    . DG  A 1 18  ? 3.850   68.769  13.436  1.00 53.24  ? 18   DG  P C2    1 
ATOM   165   N  N2    . DG  A 1 18  ? 3.168   67.663  13.717  1.00 53.24  ? 18   DG  P N2    1 
ATOM   166   N  N3    . DG  A 1 18  ? 3.365   69.628  12.574  1.00 53.24  ? 18   DG  P N3    1 
ATOM   167   C  C4    . DG  A 1 18  ? 4.168   70.697  12.421  1.00 53.24  ? 18   DG  P C4    1 
ATOM   168   P  P     . DC  A 1 19  ? -1.046  73.822  10.156  1.00 58.73  ? 19   DC  P P     1 
ATOM   169   O  OP1   . DC  A 1 19  ? -1.836  74.323  8.997   1.00 56.73  ? 19   DC  P OP1   1 
ATOM   170   O  OP2   . DC  A 1 19  ? -0.592  74.768  11.219  1.00 56.73  ? 19   DC  P OP2   1 
ATOM   171   O  "O5'" . DC  A 1 19  ? -1.872  72.657  10.859  1.00 58.73  ? 19   DC  P "O5'" 1 
ATOM   172   C  "C5'" . DC  A 1 19  ? -1.194  71.496  11.330  1.00 58.73  ? 19   DC  P "C5'" 1 
ATOM   173   C  "C4'" . DC  A 1 19  ? -2.056  70.754  12.315  1.00 58.73  ? 19   DC  P "C4'" 1 
ATOM   174   O  "O4'" . DC  A 1 19  ? -1.193  69.794  12.967  1.00 58.73  ? 19   DC  P "O4'" 1 
ATOM   175   C  "C3'" . DC  A 1 19  ? -2.584  71.684  13.397  1.00 58.73  ? 19   DC  P "C3'" 1 
ATOM   176   O  "O3'" . DC  A 1 19  ? -3.977  71.621  13.540  1.00 58.73  ? 19   DC  P "O3'" 1 
ATOM   177   C  "C2'" . DC  A 1 19  ? -1.948  71.228  14.688  1.00 58.73  ? 19   DC  P "C2'" 1 
ATOM   178   C  "C1'" . DC  A 1 19  ? -1.064  70.055  14.352  1.00 58.73  ? 19   DC  P "C1'" 1 
ATOM   179   N  N1    . DC  A 1 19  ? 0.310   70.508  14.628  1.00 56.73  ? 19   DC  P N1    1 
ATOM   180   C  C2    . DC  A 1 19  ? 0.975   69.995  15.727  1.00 56.73  ? 19   DC  P C2    1 
ATOM   181   O  O2    . DC  A 1 19  ? 0.480   69.042  16.335  1.00 56.73  ? 19   DC  P O2    1 
ATOM   182   N  N3    . DC  A 1 19  ? 2.144   70.538  16.097  1.00 56.73  ? 19   DC  P N3    1 
ATOM   183   C  C4    . DC  A 1 19  ? 2.672   71.529  15.385  1.00 56.73  ? 19   DC  P C4    1 
ATOM   184   N  N4    . DC  A 1 19  ? 3.812   72.063  15.810  1.00 56.73  ? 19   DC  P N4    1 
ATOM   185   C  C5    . DC  A 1 19  ? 2.054   72.020  14.214  1.00 56.73  ? 19   DC  P C5    1 
ATOM   186   C  C6    . DC  A 1 19  ? 0.892   71.481  13.867  1.00 56.73  ? 19   DC  P C6    1 
ATOM   187   P  P     . DC  A 1 20  ? -4.677  72.519  14.661  1.00 64.30  ? 20   DC  P P     1 
ATOM   188   O  OP1   . DC  A 1 20  ? -5.978  72.967  14.121  1.00 43.28  ? 20   DC  P OP1   1 
ATOM   189   O  OP2   . DC  A 1 20  ? -3.739  73.527  15.181  1.00 43.28  ? 20   DC  P OP2   1 
ATOM   190   O  "O5'" . DC  A 1 20  ? -4.909  71.459  15.812  1.00 64.30  ? 20   DC  P "O5'" 1 
ATOM   191   C  "C5'" . DC  A 1 20  ? -5.109  71.879  17.132  1.00 64.30  ? 20   DC  P "C5'" 1 
ATOM   192   C  "C4'" . DC  A 1 20  ? -4.573  70.850  18.066  1.00 64.30  ? 20   DC  P "C4'" 1 
ATOM   193   O  "O4'" . DC  A 1 20  ? -3.228  70.525  17.670  1.00 64.30  ? 20   DC  P "O4'" 1 
ATOM   194   C  "C3'" . DC  A 1 20  ? -4.461  71.330  19.497  1.00 64.30  ? 20   DC  P "C3'" 1 
ATOM   195   O  "O3'" . DC  A 1 20  ? -5.695  71.092  20.149  1.00 64.30  ? 20   DC  P "O3'" 1 
ATOM   196   C  "C2'" . DC  A 1 20  ? -3.342  70.461  20.052  1.00 64.30  ? 20   DC  P "C2'" 1 
ATOM   197   C  "C1'" . DC  A 1 20  ? -2.445  70.296  18.823  1.00 64.30  ? 20   DC  P "C1'" 1 
ATOM   198   N  N1    . DC  A 1 20  ? -1.266  71.172  18.768  1.00 43.28  ? 20   DC  P N1    1 
ATOM   199   C  C2    . DC  A 1 20  ? -0.311  71.052  19.749  1.00 43.28  ? 20   DC  P C2    1 
ATOM   200   O  O2    . DC  A 1 20  ? -0.522  70.270  20.683  1.00 43.28  ? 20   DC  P O2    1 
ATOM   201   N  N3    . DC  A 1 20  ? 0.818   71.789  19.669  1.00 43.28  ? 20   DC  P N3    1 
ATOM   202   C  C4    . DC  A 1 20  ? 0.988   72.630  18.653  1.00 43.28  ? 20   DC  P C4    1 
ATOM   203   N  N4    . DC  A 1 20  ? 2.123   73.318  18.588  1.00 43.28  ? 20   DC  P N4    1 
ATOM   204   C  C5    . DC  A 1 20  ? 0.005   72.800  17.653  1.00 43.28  ? 20   DC  P C5    1 
ATOM   205   C  C6    . DC  A 1 20  ? -1.098  72.062  17.750  1.00 43.28  ? 20   DC  P C6    1 
HETATM 206   P  P     . 2DT A 1 21  ? -6.472  72.304  20.831  1.00 70.87  ? 21   2DT P P     1 
HETATM 207   O  OP1   . 2DT A 1 21  ? -7.836  72.327  20.247  1.00 70.87  ? 21   2DT P OP1   1 
HETATM 208   O  OP2   . 2DT A 1 21  ? -5.641  73.530  20.768  1.00 70.87  ? 21   2DT P OP2   1 
HETATM 209   O  "O5'" . 2DT A 1 21  ? -6.541  71.811  22.339  1.00 70.87  ? 21   2DT P "O5'" 1 
HETATM 210   N  N1    . 2DT A 1 21  ? -2.264  72.978  23.034  1.00 70.87  ? 21   2DT P N1    1 
HETATM 211   C  C6    . 2DT A 1 21  ? -2.990  73.495  21.981  1.00 70.87  ? 21   2DT P C6    1 
HETATM 212   C  C2    . 2DT A 1 21  ? -0.928  73.227  23.157  1.00 70.87  ? 21   2DT P C2    1 
HETATM 213   O  O2    . 2DT A 1 21  ? -0.262  72.831  24.097  1.00 70.87  ? 21   2DT P O2    1 
HETATM 214   N  N3    . 2DT A 1 21  ? -0.396  73.975  22.136  1.00 70.87  ? 21   2DT P N3    1 
HETATM 215   C  C4    . 2DT A 1 21  ? -1.060  74.501  21.046  1.00 70.87  ? 21   2DT P C4    1 
HETATM 216   O  O4    . 2DT A 1 21  ? -0.446  75.143  20.203  1.00 70.87  ? 21   2DT P O4    1 
HETATM 217   C  C5    . 2DT A 1 21  ? -2.461  74.232  21.002  1.00 70.87  ? 21   2DT P C5    1 
HETATM 218   C  C5M   . 2DT A 1 21  ? -3.267  74.782  19.870  1.00 70.87  ? 21   2DT P C5M   1 
HETATM 219   C  "C2'" . 2DT A 1 21  ? -3.187  72.788  25.398  1.00 70.87  ? 21   2DT P "C2'" 1 
HETATM 220   C  "C5'" . 2DT A 1 21  ? -6.322  72.721  23.411  1.00 70.87  ? 21   2DT P "C5'" 1 
HETATM 221   C  "C4'" . 2DT A 1 21  ? -5.234  72.205  24.326  1.00 70.87  ? 21   2DT P "C4'" 1 
HETATM 222   O  "O4'" . 2DT A 1 21  ? -4.146  71.672  23.527  1.00 70.87  ? 21   2DT P "O4'" 1 
HETATM 223   C  "C1'" . 2DT A 1 21  ? -2.910  72.118  24.049  1.00 70.87  ? 21   2DT P "C1'" 1 
HETATM 224   C  "C3'" . 2DT A 1 21  ? -4.618  73.279  25.218  1.00 70.87  ? 21   2DT P "C3'" 1 
ATOM   225   P  P     . DA  B 2 5   ? 10.348  78.440  22.194  1.00 85.16  ? 6    DA  T P     1 
ATOM   226   O  OP1   . DA  B 2 5   ? 9.285   79.521  22.285  1.00 111.84 ? 6    DA  T OP1   1 
ATOM   227   O  OP2   . DA  B 2 5   ? 10.425  77.782  20.823  1.00 111.84 ? 6    DA  T OP2   1 
ATOM   228   O  "O5'" . DA  B 2 5   ? 9.914   77.257  23.235  1.00 85.16  ? 6    DA  T "O5'" 1 
ATOM   229   C  "C5'" . DA  B 2 5   ? 10.266  77.331  24.638  1.00 85.16  ? 6    DA  T "C5'" 1 
ATOM   230   C  "C4'" . DA  B 2 5   ? 9.112   76.867  25.514  1.00 85.16  ? 6    DA  T "C4'" 1 
ATOM   231   O  "O4'" . DA  B 2 5   ? 7.866   77.409  25.008  1.00 85.16  ? 6    DA  T "O4'" 1 
ATOM   232   C  "C3'" . DA  B 2 5   ? 8.860   75.372  25.562  1.00 85.16  ? 6    DA  T "C3'" 1 
ATOM   233   O  "O3'" . DA  B 2 5   ? 9.685   74.751  26.527  1.00 85.16  ? 6    DA  T "O3'" 1 
ATOM   234   C  "C2'" . DA  B 2 5   ? 7.407   75.309  26.000  1.00 85.16  ? 6    DA  T "C2'" 1 
ATOM   235   C  "C1'" . DA  B 2 5   ? 6.816   76.484  25.230  1.00 85.16  ? 6    DA  T "C1'" 1 
ATOM   236   N  N9    . DA  B 2 5   ? 6.247   76.101  23.935  1.00 111.84 ? 6    DA  T N9    1 
ATOM   237   C  C8    . DA  B 2 5   ? 6.751   76.318  22.672  1.00 111.84 ? 6    DA  T C8    1 
ATOM   238   N  N7    . DA  B 2 5   ? 5.966   75.895  21.710  1.00 111.84 ? 6    DA  T N7    1 
ATOM   239   C  C5    . DA  B 2 5   ? 4.878   75.356  22.384  1.00 111.84 ? 6    DA  T C5    1 
ATOM   240   C  C6    . DA  B 2 5   ? 3.687   74.763  21.935  1.00 111.84 ? 6    DA  T C6    1 
ATOM   241   N  N6    . DA  B 2 5   ? 3.372   74.632  20.648  1.00 111.84 ? 6    DA  T N6    1 
ATOM   242   N  N1    . DA  B 2 5   ? 2.816   74.313  22.865  1.00 111.84 ? 6    DA  T N1    1 
ATOM   243   C  C2    . DA  B 2 5   ? 3.121   74.468  24.156  1.00 111.84 ? 6    DA  T C2    1 
ATOM   244   N  N3    . DA  B 2 5   ? 4.198   75.024  24.704  1.00 111.84 ? 6    DA  T N3    1 
ATOM   245   C  C4    . DA  B 2 5   ? 5.048   75.456  23.752  1.00 111.84 ? 6    DA  T C4    1 
ATOM   246   P  P     . DG  B 2 6   ? 10.249  73.278  26.252  1.00 125.63 ? 7    DG  T P     1 
ATOM   247   O  OP1   . DG  B 2 6   ? 11.051  72.934  27.446  1.00 67.21  ? 7    DG  T OP1   1 
ATOM   248   O  OP2   . DG  B 2 6   ? 10.873  73.251  24.909  1.00 67.21  ? 7    DG  T OP2   1 
ATOM   249   O  "O5'" . DG  B 2 6   ? 8.953   72.351  26.201  1.00 125.63 ? 7    DG  T "O5'" 1 
ATOM   250   C  "C5'" . DG  B 2 6   ? 8.382   71.822  27.394  1.00 125.63 ? 7    DG  T "C5'" 1 
ATOM   251   C  "C4'" . DG  B 2 6   ? 7.283   70.841  27.064  1.00 125.63 ? 7    DG  T "C4'" 1 
ATOM   252   O  "O4'" . DG  B 2 6   ? 6.242   71.534  26.327  1.00 125.63 ? 7    DG  T "O4'" 1 
ATOM   253   C  "C3'" . DG  B 2 6   ? 7.647   69.685  26.146  1.00 125.63 ? 7    DG  T "C3'" 1 
ATOM   254   O  "O3'" . DG  B 2 6   ? 8.269   68.610  26.832  1.00 125.63 ? 7    DG  T "O3'" 1 
ATOM   255   C  "C2'" . DG  B 2 6   ? 6.284   69.271  25.619  1.00 125.63 ? 7    DG  T "C2'" 1 
ATOM   256   C  "C1'" . DG  B 2 6   ? 5.629   70.634  25.416  1.00 125.63 ? 7    DG  T "C1'" 1 
ATOM   257   N  N9    . DG  B 2 6   ? 5.804   71.130  24.051  1.00 67.21  ? 7    DG  T N9    1 
ATOM   258   C  C8    . DG  B 2 6   ? 6.932   71.670  23.478  1.00 67.21  ? 7    DG  T C8    1 
ATOM   259   N  N7    . DG  B 2 6   ? 6.750   72.026  22.233  1.00 67.21  ? 7    DG  T N7    1 
ATOM   260   C  C5    . DG  B 2 6   ? 5.424   71.701  21.971  1.00 67.21  ? 7    DG  T C5    1 
ATOM   261   C  C6    . DG  B 2 6   ? 4.643   71.865  20.790  1.00 67.21  ? 7    DG  T C6    1 
ATOM   262   O  O6    . DG  B 2 6   ? 4.975   72.377  19.708  1.00 67.21  ? 7    DG  T O6    1 
ATOM   263   N  N1    . DG  B 2 6   ? 3.351   71.367  20.960  1.00 67.21  ? 7    DG  T N1    1 
ATOM   264   C  C2    . DG  B 2 6   ? 2.868   70.798  22.119  1.00 67.21  ? 7    DG  T C2    1 
ATOM   265   N  N2    . DG  B 2 6   ? 1.613   70.345  22.096  1.00 67.21  ? 7    DG  T N2    1 
ATOM   266   N  N3    . DG  B 2 6   ? 3.571   70.673  23.225  1.00 67.21  ? 7    DG  T N3    1 
ATOM   267   C  C4    . DG  B 2 6   ? 4.832   71.136  23.080  1.00 67.21  ? 7    DG  T C4    1 
ATOM   268   P  P     . DG  B 2 7   ? 8.837   67.364  25.993  1.00 53.36  ? 8    DG  T P     1 
ATOM   269   O  OP1   . DG  B 2 7   ? 9.610   66.496  26.920  1.00 70.01  ? 8    DG  T OP1   1 
ATOM   270   O  OP2   . DG  B 2 7   ? 9.483   67.894  24.752  1.00 70.01  ? 8    DG  T OP2   1 
ATOM   271   O  "O5'" . DG  B 2 7   ? 7.531   66.571  25.546  1.00 53.36  ? 8    DG  T "O5'" 1 
ATOM   272   C  "C5'" . DG  B 2 7   ? 7.532   65.778  24.358  1.00 53.36  ? 8    DG  T "C5'" 1 
ATOM   273   C  "C4'" . DG  B 2 7   ? 6.127   65.626  23.826  1.00 53.36  ? 8    DG  T "C4'" 1 
ATOM   274   O  "O4'" . DG  B 2 7   ? 5.567   66.936  23.558  1.00 53.36  ? 8    DG  T "O4'" 1 
ATOM   275   C  "C3'" . DG  B 2 7   ? 6.041   64.910  22.495  1.00 53.36  ? 8    DG  T "C3'" 1 
ATOM   276   O  "O3'" . DG  B 2 7   ? 6.035   63.510  22.706  1.00 53.36  ? 8    DG  T "O3'" 1 
ATOM   277   C  "C2'" . DG  B 2 7   ? 4.723   65.421  21.938  1.00 53.36  ? 8    DG  T "C2'" 1 
ATOM   278   C  "C1'" . DG  B 2 7   ? 4.730   66.871  22.424  1.00 53.36  ? 8    DG  T "C1'" 1 
ATOM   279   N  N9    . DG  B 2 7   ? 5.199   67.824  21.422  1.00 70.01  ? 8    DG  T N9    1 
ATOM   280   C  C8    . DG  B 2 7   ? 6.421   68.444  21.335  1.00 70.01  ? 8    DG  T C8    1 
ATOM   281   N  N7    . DG  B 2 7   ? 6.540   69.195  20.273  1.00 70.01  ? 8    DG  T N7    1 
ATOM   282   C  C5    . DG  B 2 7   ? 5.316   69.074  19.634  1.00 70.01  ? 8    DG  T C5    1 
ATOM   283   C  C6    . DG  B 2 7   ? 4.844   69.653  18.429  1.00 70.01  ? 8    DG  T C6    1 
ATOM   284   O  O6    . DG  B 2 7   ? 5.440   70.394  17.643  1.00 70.01  ? 8    DG  T O6    1 
ATOM   285   N  N1    . DG  B 2 7   ? 3.533   69.276  18.166  1.00 70.01  ? 8    DG  T N1    1 
ATOM   286   C  C2    . DG  B 2 7   ? 2.781   68.431  18.947  1.00 70.01  ? 8    DG  T C2    1 
ATOM   287   N  N2    . DG  B 2 7   ? 1.551   68.153  18.522  1.00 70.01  ? 8    DG  T N2    1 
ATOM   288   N  N3    . DG  B 2 7   ? 3.209   67.887  20.061  1.00 70.01  ? 8    DG  T N3    1 
ATOM   289   C  C4    . DG  B 2 7   ? 4.475   68.248  20.344  1.00 70.01  ? 8    DG  T C4    1 
ATOM   290   P  P     . DC  B 2 8   ? 6.495   62.539  21.523  1.00 35.72  ? 9    DC  T P     1 
ATOM   291   O  OP1   . DC  B 2 8   ? 6.468   61.137  22.006  1.00 54.30  ? 9    DC  T OP1   1 
ATOM   292   O  OP2   . DC  B 2 8   ? 7.746   63.100  20.924  1.00 54.30  ? 9    DC  T OP2   1 
ATOM   293   O  "O5'" . DC  B 2 8   ? 5.360   62.722  20.425  1.00 35.72  ? 9    DC  T "O5'" 1 
ATOM   294   C  "C5'" . DC  B 2 8   ? 4.051   62.228  20.641  1.00 35.72  ? 9    DC  T "C5'" 1 
ATOM   295   C  "C4'" . DC  B 2 8   ? 3.267   62.263  19.356  1.00 35.72  ? 9    DC  T "C4'" 1 
ATOM   296   O  "O4'" . DC  B 2 8   ? 3.360   63.601  18.835  1.00 35.72  ? 9    DC  T "O4'" 1 
ATOM   297   C  "C3'" . DC  B 2 8   ? 3.766   61.341  18.248  1.00 35.72  ? 9    DC  T "C3'" 1 
ATOM   298   O  "O3'" . DC  B 2 8   ? 2.640   60.750  17.589  1.00 35.72  ? 9    DC  T "O3'" 1 
ATOM   299   C  "C2'" . DC  B 2 8   ? 4.549   62.261  17.327  1.00 35.72  ? 9    DC  T "C2'" 1 
ATOM   300   C  "C1'" . DC  B 2 8   ? 3.874   63.601  17.523  1.00 35.72  ? 9    DC  T "C1'" 1 
ATOM   301   N  N1    . DC  B 2 8   ? 4.753   64.770  17.402  1.00 54.30  ? 9    DC  T N1    1 
ATOM   302   C  C2    . DC  B 2 8   ? 4.604   65.629  16.310  1.00 54.30  ? 9    DC  T C2    1 
ATOM   303   O  O2    . DC  B 2 8   ? 3.730   65.385  15.461  1.00 54.30  ? 9    DC  T O2    1 
ATOM   304   N  N3    . DC  B 2 8   ? 5.408   66.715  16.209  1.00 54.30  ? 9    DC  T N3    1 
ATOM   305   C  C4    . DC  B 2 8   ? 6.309   66.965  17.155  1.00 54.30  ? 9    DC  T C4    1 
ATOM   306   N  N4    . DC  B 2 8   ? 7.037   68.066  17.048  1.00 54.30  ? 9    DC  T N4    1 
ATOM   307   C  C5    . DC  B 2 8   ? 6.491   66.102  18.265  1.00 54.30  ? 9    DC  T C5    1 
ATOM   308   C  C6    . DC  B 2 8   ? 5.701   65.026  18.348  1.00 54.30  ? 9    DC  T C6    1 
ATOM   309   P  P     . DA  B 2 9   ? 2.854   59.569  16.513  1.00 35.00  ? 10   DA  T P     1 
ATOM   310   O  OP1   . DA  B 2 9   ? 1.610   58.788  16.385  1.00 48.79  ? 10   DA  T OP1   1 
ATOM   311   O  OP2   . DA  B 2 9   ? 4.116   58.873  16.843  1.00 48.79  ? 10   DA  T OP2   1 
ATOM   312   O  "O5'" . DA  B 2 9   ? 3.057   60.374  15.163  1.00 35.00  ? 10   DA  T "O5'" 1 
ATOM   313   C  "C5'" . DA  B 2 9   ? 2.017   61.176  14.641  1.00 35.00  ? 10   DA  T "C5'" 1 
ATOM   314   C  "C4'" . DA  B 2 9   ? 2.451   61.791  13.332  1.00 35.00  ? 10   DA  T "C4'" 1 
ATOM   315   O  "O4'" . DA  B 2 9   ? 3.285   62.961  13.561  1.00 35.00  ? 10   DA  T "O4'" 1 
ATOM   316   C  "C3'" . DA  B 2 9   ? 3.249   60.858  12.410  1.00 35.00  ? 10   DA  T "C3'" 1 
ATOM   317   O  "O3'" . DA  B 2 9   ? 2.881   61.094  11.043  1.00 35.00  ? 10   DA  T "O3'" 1 
ATOM   318   C  "C2'" . DA  B 2 9   ? 4.660   61.375  12.594  1.00 35.00  ? 10   DA  T "C2'" 1 
ATOM   319   C  "C1'" . DA  B 2 9   ? 4.398   62.865  12.708  1.00 35.00  ? 10   DA  T "C1'" 1 
ATOM   320   N  N9    . DA  B 2 9   ? 5.495   63.662  13.251  1.00 48.79  ? 10   DA  T N9    1 
ATOM   321   C  C8    . DA  B 2 9   ? 6.386   63.338  14.235  1.00 48.79  ? 10   DA  T C8    1 
ATOM   322   N  N7    . DA  B 2 9   ? 7.310   64.246  14.429  1.00 48.79  ? 10   DA  T N7    1 
ATOM   323   C  C5    . DA  B 2 9   ? 6.994   65.237  13.520  1.00 48.79  ? 10   DA  T C5    1 
ATOM   324   C  C6    . DA  B 2 9   ? 7.597   66.453  13.218  1.00 48.79  ? 10   DA  T C6    1 
ATOM   325   N  N6    . DA  B 2 9   ? 8.697   66.894  13.807  1.00 48.79  ? 10   DA  T N6    1 
ATOM   326   N  N1    . DA  B 2 9   ? 7.034   67.214  12.274  1.00 48.79  ? 10   DA  T N1    1 
ATOM   327   C  C2    . DA  B 2 9   ? 5.940   66.773  11.678  1.00 48.79  ? 10   DA  T C2    1 
ATOM   328   N  N3    . DA  B 2 9   ? 5.277   65.639  11.866  1.00 48.79  ? 10   DA  T N3    1 
ATOM   329   C  C4    . DA  B 2 9   ? 5.867   64.904  12.810  1.00 48.79  ? 10   DA  T C4    1 
ATOM   330   P  P     . DC  B 2 10  ? 2.462   59.878  10.079  1.00 46.32  ? 11   DC  T P     1 
ATOM   331   O  OP1   . DC  B 2 10  ? 1.214   59.291  10.621  1.00 61.93  ? 11   DC  T OP1   1 
ATOM   332   O  OP2   . DC  B 2 10  ? 3.622   59.013  9.794   1.00 61.93  ? 11   DC  T OP2   1 
ATOM   333   O  "O5'" . DC  B 2 10  ? 2.133   60.623  8.724   1.00 46.32  ? 11   DC  T "O5'" 1 
ATOM   334   C  "C5'" . DC  B 2 10  ? 1.375   61.833  8.722   1.00 46.32  ? 11   DC  T "C5'" 1 
ATOM   335   C  "C4'" . DC  B 2 10  ? 1.898   62.770  7.658   1.00 46.32  ? 11   DC  T "C4'" 1 
ATOM   336   O  "O4'" . DC  B 2 10  ? 2.901   63.675  8.195   1.00 46.32  ? 11   DC  T "O4'" 1 
ATOM   337   C  "C3'" . DC  B 2 10  ? 2.561   62.014  6.506   1.00 46.32  ? 11   DC  T "C3'" 1 
ATOM   338   O  "O3'" . DC  B 2 10  ? 2.178   62.487  5.231   1.00 46.32  ? 11   DC  T "O3'" 1 
ATOM   339   C  "C2'" . DC  B 2 10  ? 4.038   62.264  6.706   1.00 46.32  ? 11   DC  T "C2'" 1 
ATOM   340   C  "C1'" . DC  B 2 10  ? 4.062   63.624  7.378   1.00 46.32  ? 11   DC  T "C1'" 1 
ATOM   341   N  N1    . DC  B 2 10  ? 5.259   63.826  8.223   1.00 61.93  ? 11   DC  T N1    1 
ATOM   342   C  C2    . DC  B 2 10  ? 6.094   64.923  7.959   1.00 61.93  ? 11   DC  T C2    1 
ATOM   343   O  O2    . DC  B 2 10  ? 5.811   65.694  7.025   1.00 61.93  ? 11   DC  T O2    1 
ATOM   344   N  N3    . DC  B 2 10  ? 7.188   65.117  8.718   1.00 61.93  ? 11   DC  T N3    1 
ATOM   345   C  C4    . DC  B 2 10  ? 7.467   64.276  9.708   1.00 61.93  ? 11   DC  T C4    1 
ATOM   346   N  N4    . DC  B 2 10  ? 8.537   64.543  10.462  1.00 61.93  ? 11   DC  T N4    1 
ATOM   347   C  C5    . DC  B 2 10  ? 6.654   63.137  9.984   1.00 61.93  ? 11   DC  T C5    1 
ATOM   348   C  C6    . DC  B 2 10  ? 5.567   62.958  9.232   1.00 61.93  ? 11   DC  T C6    1 
ATOM   349   P  P     . DT  B 2 11  ? 2.567   61.630  3.940   1.00 57.55  ? 12   DT  T P     1 
ATOM   350   O  OP1   . DT  B 2 11  ? 1.399   61.685  3.035   1.00 53.19  ? 12   DT  T OP1   1 
ATOM   351   O  OP2   . DT  B 2 11  ? 3.136   60.320  4.335   1.00 53.19  ? 12   DT  T OP2   1 
ATOM   352   O  "O5'" . DT  B 2 11  ? 3.713   62.506  3.288   1.00 57.55  ? 12   DT  T "O5'" 1 
ATOM   353   C  "C5'" . DT  B 2 11  ? 3.437   63.837  2.860   1.00 57.55  ? 12   DT  T "C5'" 1 
ATOM   354   C  "C4'" . DT  B 2 11  ? 4.653   64.441  2.198   1.00 57.55  ? 12   DT  T "C4'" 1 
ATOM   355   O  "O4'" . DT  B 2 11  ? 5.657   64.776  3.184   1.00 57.55  ? 12   DT  T "O4'" 1 
ATOM   356   C  "C3'" . DT  B 2 11  ? 5.336   63.545  1.169   1.00 57.55  ? 12   DT  T "C3'" 1 
ATOM   357   O  "O3'" . DT  B 2 11  ? 5.670   64.322  0.026   1.00 57.55  ? 12   DT  T "O3'" 1 
ATOM   358   C  "C2'" . DT  B 2 11  ? 6.573   63.039  1.892   1.00 57.55  ? 12   DT  T "C2'" 1 
ATOM   359   C  "C1'" . DT  B 2 11  ? 6.896   64.175  2.851   1.00 57.55  ? 12   DT  T "C1'" 1 
ATOM   360   N  N1    . DT  B 2 11  ? 7.549   63.763  4.119   1.00 53.19  ? 12   DT  T N1    1 
ATOM   361   C  C2    . DT  B 2 11  ? 8.434   64.638  4.734   1.00 53.19  ? 12   DT  T C2    1 
ATOM   362   O  O2    . DT  B 2 11  ? 8.695   65.759  4.309   1.00 53.19  ? 12   DT  T O2    1 
ATOM   363   N  N3    . DT  B 2 11  ? 9.005   64.148  5.880   1.00 53.19  ? 12   DT  T N3    1 
ATOM   364   C  C4    . DT  B 2 11  ? 8.792   62.919  6.461   1.00 53.19  ? 12   DT  T C4    1 
ATOM   365   O  O4    . DT  B 2 11  ? 9.390   62.623  7.488   1.00 53.19  ? 12   DT  T O4    1 
ATOM   366   C  C5    . DT  B 2 11  ? 7.850   62.068  5.773   1.00 53.19  ? 12   DT  T C5    1 
ATOM   367   C  C7    . DT  B 2 11  ? 7.555   60.714  6.324   1.00 53.19  ? 12   DT  T C7    1 
ATOM   368   C  C6    . DT  B 2 11  ? 7.282   62.525  4.662   1.00 53.19  ? 12   DT  T C6    1 
ATOM   369   P  P     . DG  B 2 12  ? 6.355   63.628  -1.250  1.00 49.03  ? 13   DG  T P     1 
ATOM   370   O  OP1   . DG  B 2 12  ? 5.564   64.050  -2.426  1.00 61.41  ? 13   DG  T OP1   1 
ATOM   371   O  OP2   . DG  B 2 12  ? 6.612   62.180  -1.021  1.00 61.41  ? 13   DG  T OP2   1 
ATOM   372   O  "O5'" . DG  B 2 12  ? 7.761   64.375  -1.308  1.00 49.03  ? 13   DG  T "O5'" 1 
ATOM   373   C  "C5'" . DG  B 2 12  ? 7.876   65.770  -0.969  1.00 49.03  ? 13   DG  T "C5'" 1 
ATOM   374   C  "C4'" . DG  B 2 12  ? 9.328   66.150  -0.781  1.00 49.03  ? 13   DG  T "C4'" 1 
ATOM   375   O  "O4'" . DG  B 2 12  ? 9.821   65.678  0.494   1.00 49.03  ? 13   DG  T "O4'" 1 
ATOM   376   C  "C3'" . DG  B 2 12  ? 10.280  65.596  -1.838  1.00 49.03  ? 13   DG  T "C3'" 1 
ATOM   377   O  "O3'" . DG  B 2 12  ? 11.224  66.596  -2.212  1.00 49.03  ? 13   DG  T "O3'" 1 
ATOM   378   C  "C2'" . DG  B 2 12  ? 10.947  64.425  -1.143  1.00 49.03  ? 13   DG  T "C2'" 1 
ATOM   379   C  "C1'" . DG  B 2 12  ? 10.943  64.830  0.326   1.00 49.03  ? 13   DG  T "C1'" 1 
ATOM   380   N  N9    . DG  B 2 12  ? 10.790  63.726  1.276   1.00 61.41  ? 13   DG  T N9    1 
ATOM   381   C  C8    . DG  B 2 12  ? 9.971   62.633  1.129   1.00 61.41  ? 13   DG  T C8    1 
ATOM   382   N  N7    . DG  B 2 12  ? 10.023  61.809  2.138   1.00 61.41  ? 13   DG  T N7    1 
ATOM   383   C  C5    . DG  B 2 12  ? 10.931  62.388  3.012   1.00 61.41  ? 13   DG  T C5    1 
ATOM   384   C  C6    . DG  B 2 12  ? 11.395  61.939  4.279   1.00 61.41  ? 13   DG  T C6    1 
ATOM   385   O  O6    . DG  B 2 12  ? 11.081  60.906  4.895   1.00 61.41  ? 13   DG  T O6    1 
ATOM   386   N  N1    . DG  B 2 12  ? 12.323  62.820  4.824   1.00 61.41  ? 13   DG  T N1    1 
ATOM   387   C  C2    . DG  B 2 12  ? 12.759  63.976  4.226   1.00 61.41  ? 13   DG  T C2    1 
ATOM   388   N  N2    . DG  B 2 12  ? 13.679  64.677  4.905   1.00 61.41  ? 13   DG  T N2    1 
ATOM   389   N  N3    . DG  B 2 12  ? 12.330  64.410  3.044   1.00 61.41  ? 13   DG  T N3    1 
ATOM   390   C  C4    . DG  B 2 12  ? 11.422  63.571  2.497   1.00 61.41  ? 13   DG  T C4    1 
ATOM   391   P  P     . DG  B 2 13  ? 12.139  66.386  -3.506  1.00 64.10  ? 14   DG  T P     1 
ATOM   392   O  OP1   . DG  B 2 13  ? 12.433  67.733  -4.055  1.00 62.67  ? 14   DG  T OP1   1 
ATOM   393   O  OP2   . DG  B 2 13  ? 11.537  65.345  -4.377  1.00 62.67  ? 14   DG  T OP2   1 
ATOM   394   O  "O5'" . DG  B 2 13  ? 13.476  65.812  -2.877  1.00 64.10  ? 14   DG  T "O5'" 1 
ATOM   395   C  "C5'" . DG  B 2 13  ? 14.199  66.588  -1.919  1.00 64.10  ? 14   DG  T "C5'" 1 
ATOM   396   C  "C4'" . DG  B 2 13  ? 15.403  65.831  -1.409  1.00 64.10  ? 14   DG  T "C4'" 1 
ATOM   397   O  "O4'" . DG  B 2 13  ? 15.040  64.918  -0.348  1.00 64.10  ? 14   DG  T "O4'" 1 
ATOM   398   C  "C3'" . DG  B 2 13  ? 16.149  65.006  -2.460  1.00 64.10  ? 14   DG  T "C3'" 1 
ATOM   399   O  "O3'" . DG  B 2 13  ? 17.554  65.208  -2.309  1.00 64.10  ? 14   DG  T "O3'" 1 
ATOM   400   C  "C2'" . DG  B 2 13  ? 15.766  63.576  -2.118  1.00 64.10  ? 14   DG  T "C2'" 1 
ATOM   401   C  "C1'" . DG  B 2 13  ? 15.621  63.661  -0.609  1.00 64.10  ? 14   DG  T "C1'" 1 
ATOM   402   N  N9    . DG  B 2 13  ? 14.802  62.646  0.036   1.00 62.67  ? 14   DG  T N9    1 
ATOM   403   C  C8    . DG  B 2 13  ? 13.769  61.925  -0.513  1.00 62.67  ? 14   DG  T C8    1 
ATOM   404   N  N7    . DG  B 2 13  ? 13.258  61.052  0.315   1.00 62.67  ? 14   DG  T N7    1 
ATOM   405   C  C5    . DG  B 2 13  ? 13.994  61.213  1.481   1.00 62.67  ? 14   DG  T C5    1 
ATOM   406   C  C6    . DG  B 2 13  ? 13.907  60.532  2.713   1.00 62.67  ? 14   DG  T C6    1 
ATOM   407   O  O6    . DG  B 2 13  ? 13.133  59.626  3.035   1.00 62.67  ? 14   DG  T O6    1 
ATOM   408   N  N1    . DG  B 2 13  ? 14.841  61.006  3.623   1.00 62.67  ? 14   DG  T N1    1 
ATOM   409   C  C2    . DG  B 2 13  ? 15.737  62.018  3.379   1.00 62.67  ? 14   DG  T C2    1 
ATOM   410   N  N2    . DG  B 2 13  ? 16.538  62.353  4.394   1.00 62.67  ? 14   DG  T N2    1 
ATOM   411   N  N3    . DG  B 2 13  ? 15.835  62.659  2.229   1.00 62.67  ? 14   DG  T N3    1 
ATOM   412   C  C4    . DG  B 2 13  ? 14.939  62.205  1.330   1.00 62.67  ? 14   DG  T C4    1 
ATOM   413   P  P     . DC  B 2 14  ? 18.578  64.539  -3.342  1.00 84.36  ? 15   DC  T P     1 
ATOM   414   O  OP1   . DC  B 2 14  ? 19.421  65.661  -3.820  1.00 71.09  ? 15   DC  T OP1   1 
ATOM   415   O  OP2   . DC  B 2 14  ? 17.835  63.707  -4.321  1.00 71.09  ? 15   DC  T OP2   1 
ATOM   416   O  "O5'" . DC  B 2 14  ? 19.452  63.580  -2.419  1.00 84.36  ? 15   DC  T "O5'" 1 
ATOM   417   C  "C5'" . DC  B 2 14  ? 20.224  64.121  -1.346  1.00 84.36  ? 15   DC  T "C5'" 1 
ATOM   418   C  "C4'" . DC  B 2 14  ? 20.797  63.014  -0.493  1.00 84.36  ? 15   DC  T "C4'" 1 
ATOM   419   O  "O4'" . DC  B 2 14  ? 19.685  62.306  0.113   1.00 84.36  ? 15   DC  T "O4'" 1 
ATOM   420   C  "C3'" . DC  B 2 14  ? 21.626  61.963  -1.253  1.00 84.36  ? 15   DC  T "C3'" 1 
ATOM   421   O  "O3'" . DC  B 2 14  ? 22.825  61.593  -0.542  1.00 84.36  ? 15   DC  T "O3'" 1 
ATOM   422   C  "C2'" . DC  B 2 14  ? 20.681  60.776  -1.361  1.00 84.36  ? 15   DC  T "C2'" 1 
ATOM   423   C  "C1'" . DC  B 2 14  ? 19.857  60.911  -0.084  1.00 84.36  ? 15   DC  T "C1'" 1 
ATOM   424   N  N1    . DC  B 2 14  ? 18.527  60.247  -0.033  1.00 71.09  ? 15   DC  T N1    1 
ATOM   425   C  C2    . DC  B 2 14  ? 17.965  59.943  1.232   1.00 71.09  ? 15   DC  T C2    1 
ATOM   426   O  O2    . DC  B 2 14  ? 18.566  60.288  2.261   1.00 71.09  ? 15   DC  T O2    1 
ATOM   427   N  N3    . DC  B 2 14  ? 16.786  59.283  1.295   1.00 71.09  ? 15   DC  T N3    1 
ATOM   428   C  C4    . DC  B 2 14  ? 16.163  58.926  0.175   1.00 71.09  ? 15   DC  T C4    1 
ATOM   429   N  N4    . DC  B 2 14  ? 15.023  58.235  0.287   1.00 71.09  ? 15   DC  T N4    1 
ATOM   430   C  C5    . DC  B 2 14  ? 16.686  59.249  -1.116  1.00 71.09  ? 15   DC  T C5    1 
ATOM   431   C  C6    . DC  B 2 14  ? 17.856  59.906  -1.174  1.00 71.09  ? 15   DC  T C6    1 
ATOM   432   P  P     . DG  C 1 11  ? 7.517   86.950  104.948 1.00 160.12 ? 11   DG  Q P     1 
ATOM   433   O  OP1   . DG  C 1 11  ? 6.633   88.157  104.663 1.00 147.56 ? 11   DG  Q OP1   1 
ATOM   434   O  OP2   . DG  C 1 11  ? 8.079   86.941  106.362 1.00 147.56 ? 11   DG  Q OP2   1 
ATOM   435   O  "O5'" . DG  C 1 11  ? 8.795   87.083  103.942 1.00 160.12 ? 11   DG  Q "O5'" 1 
ATOM   436   C  "C5'" . DG  C 1 11  ? 8.845   86.340  102.706 1.00 160.12 ? 11   DG  Q "C5'" 1 
ATOM   437   C  "C4'" . DG  C 1 11  ? 10.160  86.580  101.996 1.00 160.12 ? 11   DG  Q "C4'" 1 
ATOM   438   O  "O4'" . DG  C 1 11  ? 11.256  86.336  102.909 1.00 160.12 ? 11   DG  Q "O4'" 1 
ATOM   439   C  "C3'" . DG  C 1 11  ? 10.402  85.664  100.797 1.00 160.12 ? 11   DG  Q "C3'" 1 
ATOM   440   O  "O3'" . DG  C 1 11  ? 11.093  86.360  99.750  1.00 160.12 ? 11   DG  Q "O3'" 1 
ATOM   441   C  "C2'" . DG  C 1 11  ? 11.251  84.544  101.373 1.00 160.12 ? 11   DG  Q "C2'" 1 
ATOM   442   C  "C1'" . DG  C 1 11  ? 12.040  85.227  102.480 1.00 160.12 ? 11   DG  Q "C1'" 1 
ATOM   443   N  N9    . DG  C 1 11  ? 12.266  84.376  103.649 1.00 147.56 ? 11   DG  Q N9    1 
ATOM   444   C  C8    . DG  C 1 11  ? 11.362  84.086  104.648 1.00 147.56 ? 11   DG  Q C8    1 
ATOM   445   N  N7    . DG  C 1 11  ? 11.851  83.305  105.573 1.00 147.56 ? 11   DG  Q N7    1 
ATOM   446   C  C5    . DG  C 1 11  ? 13.155  83.059  105.164 1.00 147.56 ? 11   DG  Q C5    1 
ATOM   447   C  C6    . DG  C 1 11  ? 14.178  82.276  105.770 1.00 147.56 ? 11   DG  Q C6    1 
ATOM   448   O  O6    . DG  C 1 11  ? 14.132  81.622  106.822 1.00 147.56 ? 11   DG  Q O6    1 
ATOM   449   N  N1    . DG  C 1 11  ? 15.352  82.300  105.019 1.00 147.56 ? 11   DG  Q N1    1 
ATOM   450   C  C2    . DG  C 1 11  ? 15.523  82.985  103.839 1.00 147.56 ? 11   DG  Q C2    1 
ATOM   451   N  N2    . DG  C 1 11  ? 16.731  82.880  103.263 1.00 147.56 ? 11   DG  Q N2    1 
ATOM   452   N  N3    . DG  C 1 11  ? 14.579  83.717  103.264 1.00 147.56 ? 11   DG  Q N3    1 
ATOM   453   C  C4    . DG  C 1 11  ? 13.428  83.711  103.976 1.00 147.56 ? 11   DG  Q C4    1 
ATOM   454   P  P     . DG  C 1 12  ? 11.303  85.652  98.316  1.00 148.84 ? 12   DG  Q P     1 
ATOM   455   O  OP1   . DG  C 1 12  ? 11.641  86.699  97.312  1.00 185.93 ? 12   DG  Q OP1   1 
ATOM   456   O  OP2   . DG  C 1 12  ? 10.142  84.751  98.069  1.00 185.93 ? 12   DG  Q OP2   1 
ATOM   457   O  "O5'" . DG  C 1 12  ? 12.591  84.735  98.540  1.00 148.84 ? 12   DG  Q "O5'" 1 
ATOM   458   C  "C5'" . DG  C 1 12  ? 13.913  85.284  98.484  1.00 148.84 ? 12   DG  Q "C5'" 1 
ATOM   459   C  "C4'" . DG  C 1 12  ? 14.935  84.179  98.335  1.00 148.84 ? 12   DG  Q "C4'" 1 
ATOM   460   O  "O4'" . DG  C 1 12  ? 15.045  83.437  99.575  1.00 148.84 ? 12   DG  Q "O4'" 1 
ATOM   461   C  "C3'" . DG  C 1 12  ? 14.586  83.150  97.260  1.00 148.84 ? 12   DG  Q "C3'" 1 
ATOM   462   O  "O3'" . DG  C 1 12  ? 15.760  82.743  96.550  1.00 148.84 ? 12   DG  Q "O3'" 1 
ATOM   463   C  "C2'" . DG  C 1 12  ? 13.985  82.003  98.055  1.00 148.84 ? 12   DG  Q "C2'" 1 
ATOM   464   C  "C1'" . DG  C 1 12  ? 14.777  82.061  99.347  1.00 148.84 ? 12   DG  Q "C1'" 1 
ATOM   465   N  N9    . DG  C 1 12  ? 14.102  81.531  100.530 1.00 185.93 ? 12   DG  Q N9    1 
ATOM   466   C  C8    . DG  C 1 12  ? 12.813  81.780  100.941 1.00 185.93 ? 12   DG  Q C8    1 
ATOM   467   N  N7    . DG  C 1 12  ? 12.497  81.160  102.046 1.00 185.93 ? 12   DG  Q N7    1 
ATOM   468   C  C5    . DG  C 1 12  ? 13.645  80.456  102.386 1.00 185.93 ? 12   DG  Q C5    1 
ATOM   469   C  C6    . DG  C 1 12  ? 13.907  79.597  103.488 1.00 185.93 ? 12   DG  Q C6    1 
ATOM   470   O  O6    . DG  C 1 12  ? 13.150  79.272  104.410 1.00 185.93 ? 12   DG  Q O6    1 
ATOM   471   N  N1    . DG  C 1 12  ? 15.204  79.097  103.448 1.00 185.93 ? 12   DG  Q N1    1 
ATOM   472   C  C2    . DG  C 1 12  ? 16.132  79.381  102.474 1.00 185.93 ? 12   DG  Q C2    1 
ATOM   473   N  N2    . DG  C 1 12  ? 17.333  78.803  102.614 1.00 185.93 ? 12   DG  Q N2    1 
ATOM   474   N  N3    . DG  C 1 12  ? 15.900  80.174  101.441 1.00 185.93 ? 12   DG  Q N3    1 
ATOM   475   C  C4    . DG  C 1 12  ? 14.646  80.675  101.460 1.00 185.93 ? 12   DG  Q C4    1 
ATOM   476   P  P     . DC  C 1 13  ? 15.723  81.408  95.651  1.00 129.11 ? 13   DC  Q P     1 
ATOM   477   O  OP1   . DC  C 1 13  ? 16.942  81.379  94.803  1.00 146.38 ? 13   DC  Q OP1   1 
ATOM   478   O  OP2   . DC  C 1 13  ? 14.383  81.316  95.009  1.00 146.38 ? 13   DC  Q OP2   1 
ATOM   479   O  "O5'" . DC  C 1 13  ? 15.823  80.240  96.739  1.00 129.11 ? 13   DC  Q "O5'" 1 
ATOM   480   C  "C5'" . DC  C 1 13  ? 16.954  80.147  97.620  1.00 129.11 ? 13   DC  Q "C5'" 1 
ATOM   481   C  "C4'" . DC  C 1 13  ? 17.210  78.708  98.010  1.00 129.11 ? 13   DC  Q "C4'" 1 
ATOM   482   O  "O4'" . DC  C 1 13  ? 16.459  78.338  99.193  1.00 129.11 ? 13   DC  Q "O4'" 1 
ATOM   483   C  "C3'" . DC  C 1 13  ? 16.855  77.678  96.934  1.00 129.11 ? 13   DC  Q "C3'" 1 
ATOM   484   O  "O3'" . DC  C 1 13  ? 17.848  76.656  96.869  1.00 129.11 ? 13   DC  Q "O3'" 1 
ATOM   485   C  "C2'" . DC  C 1 13  ? 15.554  77.086  97.441  1.00 129.11 ? 13   DC  Q "C2'" 1 
ATOM   486   C  "C1'" . DC  C 1 13  ? 15.779  77.117  98.941  1.00 129.11 ? 13   DC  Q "C1'" 1 
ATOM   487   N  N1    . DC  C 1 13  ? 14.560  77.070  99.775  1.00 146.38 ? 13   DC  Q N1    1 
ATOM   488   C  C2    . DC  C 1 13  ? 14.428  76.039  100.726 1.00 146.38 ? 13   DC  Q C2    1 
ATOM   489   O  O2    . DC  C 1 13  ? 15.336  75.194  100.841 1.00 146.38 ? 13   DC  Q O2    1 
ATOM   490   N  N3    . DC  C 1 13  ? 13.312  75.987  101.490 1.00 146.38 ? 13   DC  Q N3    1 
ATOM   491   C  C4    . DC  C 1 13  ? 12.355  76.903  101.338 1.00 146.38 ? 13   DC  Q C4    1 
ATOM   492   N  N4    . DC  C 1 13  ? 11.276  76.811  102.114 1.00 146.38 ? 13   DC  Q N4    1 
ATOM   493   C  C5    . DC  C 1 13  ? 12.461  77.955  100.383 1.00 146.38 ? 13   DC  Q C5    1 
ATOM   494   C  C6    . DC  C 1 13  ? 13.569  78.003  99.632  1.00 146.38 ? 13   DC  Q C6    1 
ATOM   495   P  P     . DC  C 1 14  ? 17.805  75.580  95.674  1.00 143.39 ? 14   DC  Q P     1 
ATOM   496   O  OP1   . DC  C 1 14  ? 18.737  75.979  94.587  1.00 118.11 ? 14   DC  Q OP1   1 
ATOM   497   O  OP2   . DC  C 1 14  ? 16.378  75.309  95.350  1.00 118.11 ? 14   DC  Q OP2   1 
ATOM   498   O  "O5'" . DC  C 1 14  ? 18.412  74.280  96.353  1.00 143.39 ? 14   DC  Q "O5'" 1 
ATOM   499   C  "C5'" . DC  C 1 14  ? 17.915  73.001  96.014  1.00 143.39 ? 14   DC  Q "C5'" 1 
ATOM   500   C  "C4'" . DC  C 1 14  ? 17.905  72.103  97.227  1.00 143.39 ? 14   DC  Q "C4'" 1 
ATOM   501   O  "O4'" . DC  C 1 14  ? 17.077  72.651  98.291  1.00 143.39 ? 14   DC  Q "O4'" 1 
ATOM   502   C  "C3'" . DC  C 1 14  ? 17.317  70.741  96.894  1.00 143.39 ? 14   DC  Q "C3'" 1 
ATOM   503   O  "O3'" . DC  C 1 14  ? 18.096  69.717  97.491  1.00 143.39 ? 14   DC  Q "O3'" 1 
ATOM   504   C  "C2'" . DC  C 1 14  ? 15.916  70.795  97.474  1.00 143.39 ? 14   DC  Q "C2'" 1 
ATOM   505   C  "C1'" . DC  C 1 14  ? 16.103  71.691  98.682  1.00 143.39 ? 14   DC  Q "C1'" 1 
ATOM   506   N  N1    . DC  C 1 14  ? 14.868  72.389  99.098  1.00 118.11 ? 14   DC  Q N1    1 
ATOM   507   C  C2    . DC  C 1 14  ? 14.457  73.542  98.418  1.00 118.11 ? 14   DC  Q C2    1 
ATOM   508   O  O2    . DC  C 1 14  ? 15.187  74.016  97.536  1.00 118.11 ? 14   DC  Q O2    1 
ATOM   509   N  N3    . DC  C 1 14  ? 13.275  74.114  98.747  1.00 118.11 ? 14   DC  Q N3    1 
ATOM   510   C  C4    . DC  C 1 14  ? 12.530  73.596  99.722  1.00 118.11 ? 14   DC  Q C4    1 
ATOM   511   N  N4    . DC  C 1 14  ? 11.361  74.180  99.989  1.00 118.11 ? 14   DC  Q N4    1 
ATOM   512   C  C5    . DC  C 1 14  ? 12.947  72.453  100.462 1.00 118.11 ? 14   DC  Q C5    1 
ATOM   513   C  C6    . DC  C 1 14  ? 14.111  71.889  100.122 1.00 118.11 ? 14   DC  Q C6    1 
ATOM   514   P  P     . DA  C 1 15  ? 17.608  68.201  97.371  1.00 98.59  ? 15   DA  Q P     1 
ATOM   515   O  OP1   . DA  C 1 15  ? 18.742  67.286  97.694  1.00 102.14 ? 15   DA  Q OP1   1 
ATOM   516   O  OP2   . DA  C 1 15  ? 16.888  68.057  96.074  1.00 102.14 ? 15   DA  Q OP2   1 
ATOM   517   O  "O5'" . DA  C 1 15  ? 16.522  68.117  98.522  1.00 98.59  ? 15   DA  Q "O5'" 1 
ATOM   518   C  "C5'" . DA  C 1 15  ? 16.906  68.224  99.885  1.00 98.59  ? 15   DA  Q "C5'" 1 
ATOM   519   C  "C4'" . DA  C 1 15  ? 15.950  67.424  100.730 1.00 98.59  ? 15   DA  Q "C4'" 1 
ATOM   520   O  "O4'" . DA  C 1 15  ? 14.714  68.153  100.879 1.00 98.59  ? 15   DA  Q "O4'" 1 
ATOM   521   C  "C3'" . DA  C 1 15  ? 15.580  66.088  100.091 1.00 98.59  ? 15   DA  Q "C3'" 1 
ATOM   522   O  "O3'" . DA  C 1 15  ? 15.421  65.125  101.125 1.00 98.59  ? 15   DA  Q "O3'" 1 
ATOM   523   C  "C2'" . DA  C 1 15  ? 14.279  66.395  99.368  1.00 98.59  ? 15   DA  Q "C2'" 1 
ATOM   524   C  "C1'" . DA  C 1 15  ? 13.645  67.434  100.286 1.00 98.59  ? 15   DA  Q "C1'" 1 
ATOM   525   N  N9    . DA  C 1 15  ? 12.751  68.417  99.672  1.00 102.14 ? 15   DA  Q N9    1 
ATOM   526   C  C8    . DA  C 1 15  ? 12.886  69.071  98.475  1.00 102.14 ? 15   DA  Q C8    1 
ATOM   527   N  N7    . DA  C 1 15  ? 11.923  69.922  98.226  1.00 102.14 ? 15   DA  Q N7    1 
ATOM   528   C  C5    . DA  C 1 15  ? 11.090  69.816  99.330  1.00 102.14 ? 15   DA  Q C5    1 
ATOM   529   C  C6    . DA  C 1 15  ? 9.882   70.455  99.673  1.00 102.14 ? 15   DA  Q C6    1 
ATOM   530   N  N6    . DA  C 1 15  ? 9.280   71.368  98.908  1.00 102.14 ? 15   DA  Q N6    1 
ATOM   531   N  N1    . DA  C 1 15  ? 9.305   70.118  100.847 1.00 102.14 ? 15   DA  Q N1    1 
ATOM   532   C  C2    . DA  C 1 15  ? 9.906   69.203  101.616 1.00 102.14 ? 15   DA  Q C2    1 
ATOM   533   N  N3    . DA  C 1 15  ? 11.037  68.536  101.403 1.00 102.14 ? 15   DA  Q N3    1 
ATOM   534   C  C4    . DA  C 1 15  ? 11.586  68.892  100.227 1.00 102.14 ? 15   DA  Q C4    1 
ATOM   535   P  P     . DG  C 1 16  ? 15.162  63.594  100.754 1.00 97.57  ? 16   DG  Q P     1 
ATOM   536   O  OP1   . DG  C 1 16  ? 15.781  62.774  101.835 1.00 92.71  ? 16   DG  Q OP1   1 
ATOM   537   O  OP2   . DG  C 1 16  ? 15.511  63.340  99.328  1.00 92.71  ? 16   DG  Q OP2   1 
ATOM   538   O  "O5'" . DG  C 1 16  ? 13.586  63.471  100.889 1.00 97.57  ? 16   DG  Q "O5'" 1 
ATOM   539   C  "C5'" . DG  C 1 16  ? 12.941  63.787  102.118 1.00 97.57  ? 16   DG  Q "C5'" 1 
ATOM   540   C  "C4'" . DG  C 1 16  ? 11.447  63.650  101.960 1.00 97.57  ? 16   DG  Q "C4'" 1 
ATOM   541   O  "O4'" . DG  C 1 16  ? 10.896  64.784  101.249 1.00 97.57  ? 16   DG  Q "O4'" 1 
ATOM   542   C  "C3'" . DG  C 1 16  ? 11.014  62.409  101.179 1.00 97.57  ? 16   DG  Q "C3'" 1 
ATOM   543   O  "O3'" . DG  C 1 16  ? 9.866   61.863  101.829 1.00 97.57  ? 16   DG  Q "O3'" 1 
ATOM   544   C  "C2'" . DG  C 1 16  ? 10.659  62.972  99.812  1.00 97.57  ? 16   DG  Q "C2'" 1 
ATOM   545   C  "C1'" . DG  C 1 16  ? 10.060  64.305  100.213 1.00 97.57  ? 16   DG  Q "C1'" 1 
ATOM   546   N  N9    . DG  C 1 16  ? 9.951   65.347  99.196  1.00 92.71  ? 16   DG  Q N9    1 
ATOM   547   C  C8    . DG  C 1 16  ? 10.806  65.605  98.153  1.00 92.71  ? 16   DG  Q C8    1 
ATOM   548   N  N7    . DG  C 1 16  ? 10.450  66.641  97.441  1.00 92.71  ? 16   DG  Q N7    1 
ATOM   549   C  C5    . DG  C 1 16  ? 9.283   67.090  98.047  1.00 92.71  ? 16   DG  Q C5    1 
ATOM   550   C  C6    . DG  C 1 16  ? 8.443   68.191  97.728  1.00 92.71  ? 16   DG  Q C6    1 
ATOM   551   O  O6    . DG  C 1 16  ? 8.556   69.006  96.812  1.00 92.71  ? 16   DG  Q O6    1 
ATOM   552   N  N1    . DG  C 1 16  ? 7.375   68.290  98.606  1.00 92.71  ? 16   DG  Q N1    1 
ATOM   553   C  C2    . DG  C 1 16  ? 7.134   67.441  99.653  1.00 92.71  ? 16   DG  Q C2    1 
ATOM   554   N  N2    . DG  C 1 16  ? 6.052   67.713  100.392 1.00 92.71  ? 16   DG  Q N2    1 
ATOM   555   N  N3    . DG  C 1 16  ? 7.899   66.406  99.957  1.00 92.71  ? 16   DG  Q N3    1 
ATOM   556   C  C4    . DG  C 1 16  ? 8.953   66.295  99.121  1.00 92.71  ? 16   DG  Q C4    1 
ATOM   557   P  P     . DT  C 1 17  ? 9.333   60.399  101.442 1.00 69.44  ? 17   DT  Q P     1 
ATOM   558   O  OP1   . DT  C 1 17  ? 9.010   59.742  102.732 1.00 103.99 ? 17   DT  Q OP1   1 
ATOM   559   O  OP2   . DT  C 1 17  ? 10.260  59.749  100.479 1.00 103.99 ? 17   DT  Q OP2   1 
ATOM   560   O  "O5'" . DT  C 1 17  ? 7.969   60.688  100.686 1.00 69.44  ? 17   DT  Q "O5'" 1 
ATOM   561   C  "C5'" . DT  C 1 17  ? 7.773   61.936  100.046 1.00 69.44  ? 17   DT  Q "C5'" 1 
ATOM   562   C  "C4'" . DT  C 1 17  ? 6.323   62.333  100.105 1.00 69.44  ? 17   DT  Q "C4'" 1 
ATOM   563   O  "O4'" . DT  C 1 17  ? 6.222   63.680  99.587  1.00 69.44  ? 17   DT  Q "O4'" 1 
ATOM   564   C  "C3'" . DT  C 1 17  ? 5.451   61.458  99.214  1.00 69.44  ? 17   DT  Q "C3'" 1 
ATOM   565   O  "O3'" . DT  C 1 17  ? 4.218   61.143  99.850  1.00 69.44  ? 17   DT  Q "O3'" 1 
ATOM   566   C  "C2'" . DT  C 1 17  ? 5.265   62.283  97.952  1.00 69.44  ? 17   DT  Q "C2'" 1 
ATOM   567   C  "C1'" . DT  C 1 17  ? 5.409   63.715  98.428  1.00 69.44  ? 17   DT  Q "C1'" 1 
ATOM   568   N  N1    . DT  C 1 17  ? 6.046   64.622  97.458  1.00 103.99 ? 17   DT  Q N1    1 
ATOM   569   C  C2    . DT  C 1 17  ? 5.490   65.867  97.290  1.00 103.99 ? 17   DT  Q C2    1 
ATOM   570   O  O2    . DT  C 1 17  ? 4.509   66.254  97.905  1.00 103.99 ? 17   DT  Q O2    1 
ATOM   571   N  N3    . DT  C 1 17  ? 6.127   66.653  96.372  1.00 103.99 ? 17   DT  Q N3    1 
ATOM   572   C  C4    . DT  C 1 17  ? 7.236   66.335  95.623  1.00 103.99 ? 17   DT  Q C4    1 
ATOM   573   O  O4    . DT  C 1 17  ? 7.697   67.160  94.846  1.00 103.99 ? 17   DT  Q O4    1 
ATOM   574   C  C5    . DT  C 1 17  ? 7.772   65.013  95.846  1.00 103.99 ? 17   DT  Q C5    1 
ATOM   575   C  C7    . DT  C 1 17  ? 8.978   64.576  95.074  1.00 103.99 ? 17   DT  Q C7    1 
ATOM   576   C  C6    . DT  C 1 17  ? 7.158   64.232  96.742  1.00 103.99 ? 17   DT  Q C6    1 
ATOM   577   P  P     . DG  C 1 18  ? 3.194   60.135  99.137  1.00 62.15  ? 18   DG  Q P     1 
ATOM   578   O  OP1   . DG  C 1 18  ? 2.504   59.320  100.178 1.00 78.89  ? 18   DG  Q OP1   1 
ATOM   579   O  OP2   . DG  C 1 18  ? 3.905   59.457  98.020  1.00 78.89  ? 18   DG  Q OP2   1 
ATOM   580   O  "O5'" . DG  C 1 18  ? 2.130   61.116  98.486  1.00 62.15  ? 18   DG  Q "O5'" 1 
ATOM   581   C  "C5'" . DG  C 1 18  ? 1.460   62.060  99.291  1.00 62.15  ? 18   DG  Q "C5'" 1 
ATOM   582   C  "C4'" . DG  C 1 18  ? 0.477   62.830  98.453  1.00 62.15  ? 18   DG  Q "C4'" 1 
ATOM   583   O  "O4'" . DG  C 1 18  ? 1.170   63.801  97.649  1.00 62.15  ? 18   DG  Q "O4'" 1 
ATOM   584   C  "C3'" . DG  C 1 18  ? -0.331  61.973  97.482  1.00 62.15  ? 18   DG  Q "C3'" 1 
ATOM   585   O  "O3'" . DG  C 1 18  ? -1.639  62.543  97.392  1.00 62.15  ? 18   DG  Q "O3'" 1 
ATOM   586   C  "C2'" . DG  C 1 18  ? 0.432   62.124  96.178  1.00 62.15  ? 18   DG  Q "C2'" 1 
ATOM   587   C  "C1'" . DG  C 1 18  ? 0.909   63.561  96.278  1.00 62.15  ? 18   DG  Q "C1'" 1 
ATOM   588   N  N9    . DG  C 1 18  ? 2.106   63.930  95.528  1.00 78.89  ? 18   DG  Q N9    1 
ATOM   589   C  C8    . DG  C 1 18  ? 3.287   63.235  95.410  1.00 78.89  ? 18   DG  Q C8    1 
ATOM   590   N  N7    . DG  C 1 18  ? 4.167   63.849  94.669  1.00 78.89  ? 18   DG  Q N7    1 
ATOM   591   C  C5    . DG  C 1 18  ? 3.525   65.015  94.268  1.00 78.89  ? 18   DG  Q C5    1 
ATOM   592   C  C6    . DG  C 1 18  ? 3.967   66.076  93.431  1.00 78.89  ? 18   DG  Q C6    1 
ATOM   593   O  O6    . DG  C 1 18  ? 5.050   66.198  92.843  1.00 78.89  ? 18   DG  Q O6    1 
ATOM   594   N  N1    . DG  C 1 18  ? 2.992   67.063  93.300  1.00 78.89  ? 18   DG  Q N1    1 
ATOM   595   C  C2    . DG  C 1 18  ? 1.749   67.033  93.884  1.00 78.89  ? 18   DG  Q C2    1 
ATOM   596   N  N2    . DG  C 1 18  ? 0.949   68.084  93.647  1.00 78.89  ? 18   DG  Q N2    1 
ATOM   597   N  N3    . DG  C 1 18  ? 1.324   66.048  94.647  1.00 78.89  ? 18   DG  Q N3    1 
ATOM   598   C  C4    . DG  C 1 18  ? 2.257   65.082  94.799  1.00 78.89  ? 18   DG  Q C4    1 
ATOM   599   P  P     . DC  C 1 19  ? -2.854  61.702  96.769  1.00 77.41  ? 19   DC  Q P     1 
ATOM   600   O  OP1   . DC  C 1 19  ? -3.681  61.187  97.892  1.00 89.83  ? 19   DC  Q OP1   1 
ATOM   601   O  OP2   . DC  C 1 19  ? -2.346  60.761  95.722  1.00 89.83  ? 19   DC  Q OP2   1 
ATOM   602   O  "O5'" . DC  C 1 19  ? -3.665  62.848  96.032  1.00 77.41  ? 19   DC  Q "O5'" 1 
ATOM   603   C  "C5'" . DC  C 1 19  ? -2.976  64.007  95.560  1.00 77.41  ? 19   DC  Q "C5'" 1 
ATOM   604   C  "C4'" . DC  C 1 19  ? -3.814  64.732  94.540  1.00 77.41  ? 19   DC  Q "C4'" 1 
ATOM   605   O  "O4'" . DC  C 1 19  ? -2.951  65.718  93.926  1.00 77.41  ? 19   DC  Q "O4'" 1 
ATOM   606   C  "C3'" . DC  C 1 19  ? -4.287  63.801  93.430  1.00 77.41  ? 19   DC  Q "C3'" 1 
ATOM   607   O  "O3'" . DC  C 1 19  ? -5.685  63.835  93.238  1.00 77.41  ? 19   DC  Q "O3'" 1 
ATOM   608   C  "C2'" . DC  C 1 19  ? -3.571  64.250  92.172  1.00 77.41  ? 19   DC  Q "C2'" 1 
ATOM   609   C  "C1'" . DC  C 1 19  ? -2.728  65.447  92.551  1.00 77.41  ? 19   DC  Q "C1'" 1 
ATOM   610   N  N1    . DC  C 1 19  ? -1.304  65.083  92.371  1.00 89.83  ? 19   DC  Q N1    1 
ATOM   611   C  C2    . DC  C 1 19  ? -0.529  65.773  91.428  1.00 89.83  ? 19   DC  Q C2    1 
ATOM   612   O  O2    . DC  C 1 19  ? -1.018  66.750  90.838  1.00 89.83  ? 19   DC  Q O2    1 
ATOM   613   N  N3    . DC  C 1 19  ? 0.736   65.354  91.183  1.00 89.83  ? 19   DC  Q N3    1 
ATOM   614   C  C4    . DC  C 1 19  ? 1.234   64.307  91.842  1.00 89.83  ? 19   DC  Q C4    1 
ATOM   615   N  N4    . DC  C 1 19  ? 2.468   63.907  91.541  1.00 89.83  ? 19   DC  Q N4    1 
ATOM   616   C  C5    . DC  C 1 19  ? 0.487   63.620  92.835  1.00 89.83  ? 19   DC  Q C5    1 
ATOM   617   C  C6    . DC  C 1 19  ? -0.758  64.043  93.076  1.00 89.83  ? 19   DC  Q C6    1 
ATOM   618   P  P     . DC  C 1 20  ? -6.329  62.925  92.092  1.00 75.49  ? 20   DC  Q P     1 
ATOM   619   O  OP1   . DC  C 1 20  ? -7.653  62.446  92.538  1.00 65.54  ? 20   DC  Q OP1   1 
ATOM   620   O  OP2   . DC  C 1 20  ? -5.318  61.947  91.632  1.00 65.54  ? 20   DC  Q OP2   1 
ATOM   621   O  "O5'" . DC  C 1 20  ? -6.536  63.977  90.931  1.00 75.49  ? 20   DC  Q "O5'" 1 
ATOM   622   C  "C5'" . DC  C 1 20  ? -6.649  63.554  89.598  1.00 75.49  ? 20   DC  Q "C5'" 1 
ATOM   623   C  "C4'" . DC  C 1 20  ? -6.077  64.594  88.691  1.00 75.49  ? 20   DC  Q "C4'" 1 
ATOM   624   O  "O4'" . DC  C 1 20  ? -4.750  64.937  89.132  1.00 75.49  ? 20   DC  Q "O4'" 1 
ATOM   625   C  "C3'" . DC  C 1 20  ? -5.908  64.113  87.271  1.00 75.49  ? 20   DC  Q "C3'" 1 
ATOM   626   O  "O3'" . DC  C 1 20  ? -7.137  64.325  86.603  1.00 75.49  ? 20   DC  Q "O3'" 1 
ATOM   627   C  "C2'" . DC  C 1 20  ? -4.790  65.004  86.752  1.00 75.49  ? 20   DC  Q "C2'" 1 
ATOM   628   C  "C1'" . DC  C 1 20  ? -3.931  65.167  88.004  1.00 75.49  ? 20   DC  Q "C1'" 1 
ATOM   629   N  N1    . DC  C 1 20  ? -2.756  64.284  88.089  1.00 65.54  ? 20   DC  Q N1    1 
ATOM   630   C  C2    . DC  C 1 20  ? -1.638  64.579  87.304  1.00 65.54  ? 20   DC  Q C2    1 
ATOM   631   O  O2    . DC  C 1 20  ? -1.710  65.503  86.461  1.00 65.54  ? 20   DC  Q O2    1 
ATOM   632   N  N3    . DC  C 1 20  ? -0.509  63.859  87.478  1.00 65.54  ? 20   DC  Q N3    1 
ATOM   633   C  C4    . DC  C 1 20  ? -0.476  62.883  88.380  1.00 65.54  ? 20   DC  Q C4    1 
ATOM   634   N  N4    . DC  C 1 20  ? 0.684   62.262  88.578  1.00 65.54  ? 20   DC  Q N4    1 
ATOM   635   C  C5    . DC  C 1 20  ? -1.619  62.515  89.133  1.00 65.54  ? 20   DC  Q C5    1 
ATOM   636   C  C6    . DC  C 1 20  ? -2.728  63.229  88.953  1.00 65.54  ? 20   DC  Q C6    1 
HETATM 637   P  P     . 2DT C 1 21  ? -7.852  63.107  85.852  1.00 70.87  ? 21   2DT Q P     1 
HETATM 638   O  OP1   . 2DT C 1 21  ? -9.243  63.045  86.375  1.00 70.87  ? 21   2DT Q OP1   1 
HETATM 639   O  OP2   . 2DT C 1 21  ? -6.986  61.904  85.945  1.00 70.87  ? 21   2DT Q OP2   1 
HETATM 640   O  "O5'" . 2DT C 1 21  ? -7.871  63.619  84.341  1.00 70.87  ? 21   2DT Q "O5'" 1 
HETATM 641   N  N1    . 2DT C 1 21  ? -3.561  62.411  83.744  1.00 70.87  ? 21   2DT Q N1    1 
HETATM 642   C  C6    . 2DT C 1 21  ? -4.330  61.831  84.733  1.00 70.87  ? 21   2DT Q C6    1 
HETATM 643   C  C2    . 2DT C 1 21  ? -2.209  62.171  83.657  1.00 70.87  ? 21   2DT Q C2    1 
HETATM 644   O  O2    . 2DT C 1 21  ? -1.514  62.577  82.737  1.00 70.87  ? 21   2DT Q O2    1 
HETATM 645   N  N3    . 2DT C 1 21  ? -1.698  61.419  84.680  1.00 70.87  ? 21   2DT Q N3    1 
HETATM 646   C  C4    . 2DT C 1 21  ? -2.392  60.856  85.733  1.00 70.87  ? 21   2DT Q C4    1 
HETATM 647   O  O4    . 2DT C 1 21  ? -1.775  60.249  86.610  1.00 70.87  ? 21   2DT Q O4    1 
HETATM 648   C  C5    . 2DT C 1 21  ? -3.832  61.064  85.706  1.00 70.87  ? 21   2DT Q C5    1 
HETATM 649   C  C5M   . 2DT C 1 21  ? -4.693  60.410  86.747  1.00 70.87  ? 21   2DT Q C5M   1 
HETATM 650   C  "C2'" . 2DT C 1 21  ? -4.383  62.721  81.390  1.00 70.87  ? 21   2DT Q "C2'" 1 
HETATM 651   C  "C5'" . 2DT C 1 21  ? -7.593  62.729  83.267  1.00 70.87  ? 21   2DT Q "C5'" 1 
HETATM 652   C  "C4'" . 2DT C 1 21  ? -6.471  63.270  82.406  1.00 70.87  ? 21   2DT Q "C4'" 1 
HETATM 653   O  "O4'" . 2DT C 1 21  ? -5.410  63.788  83.256  1.00 70.87  ? 21   2DT Q "O4'" 1 
HETATM 654   C  "C1'" . 2DT C 1 21  ? -4.154  63.347  82.764  1.00 70.87  ? 21   2DT Q "C1'" 1 
HETATM 655   C  "C3'" . 2DT C 1 21  ? -5.815  62.213  81.520  1.00 70.87  ? 21   2DT Q "C3'" 1 
ATOM   656   P  P     . DA  D 2 5   ? 9.286   57.553  85.114  1.00 116.23 ? 6    DA  U P     1 
ATOM   657   O  OP1   . DA  D 2 5   ? 8.258   56.438  84.964  1.00 115.34 ? 6    DA  U OP1   1 
ATOM   658   O  OP2   . DA  D 2 5   ? 9.249   58.187  86.496  1.00 115.34 ? 6    DA  U OP2   1 
ATOM   659   O  "O5'" . DA  D 2 5   ? 8.857   58.728  84.063  1.00 116.23 ? 6    DA  U "O5'" 1 
ATOM   660   C  "C5'" . DA  D 2 5   ? 9.256   58.666  82.676  1.00 116.23 ? 6    DA  U "C5'" 1 
ATOM   661   C  "C4'" . DA  D 2 5   ? 8.126   59.117  81.765  1.00 116.23 ? 6    DA  U "C4'" 1 
ATOM   662   O  "O4'" . DA  D 2 5   ? 6.871   58.536  82.207  1.00 116.23 ? 6    DA  U "O4'" 1 
ATOM   663   C  "C3'" . DA  D 2 5   ? 7.833   60.609  81.718  1.00 116.23 ? 6    DA  U "C3'" 1 
ATOM   664   O  "O3'" . DA  D 2 5   ? 8.697   61.265  80.803  1.00 116.23 ? 6    DA  U "O3'" 1 
ATOM   665   C  "C2'" . DA  D 2 5   ? 6.403   60.640  81.198  1.00 116.23 ? 6    DA  U "C2'" 1 
ATOM   666   C  "C1'" . DA  D 2 5   ? 5.802   59.408  81.876  1.00 116.23 ? 6    DA  U "C1'" 1 
ATOM   667   N  N9    . DA  D 2 5   ? 5.037   59.725  83.087  1.00 115.34 ? 6    DA  U N9    1 
ATOM   668   C  C8    . DA  D 2 5   ? 5.480   59.860  84.386  1.00 115.34 ? 6    DA  U C8    1 
ATOM   669   N  N7    . DA  D 2 5   ? 4.532   60.180  85.236  1.00 115.34 ? 6    DA  U N7    1 
ATOM   670   C  C5    . DA  D 2 5   ? 3.388   60.260  84.448  1.00 115.34 ? 6    DA  U C5    1 
ATOM   671   C  C6    . DA  D 2 5   ? 2.045   60.570  84.747  1.00 115.34 ? 6    DA  U C6    1 
ATOM   672   N  N6    . DA  D 2 5   ? 1.608   60.878  85.970  1.00 115.34 ? 6    DA  U N6    1 
ATOM   673   N  N1    . DA  D 2 5   ? 1.154   60.556  83.730  1.00 115.34 ? 6    DA  U N1    1 
ATOM   674   C  C2    . DA  D 2 5   ? 1.588   60.254  82.501  1.00 115.34 ? 6    DA  U C2    1 
ATOM   675   N  N3    . DA  D 2 5   ? 2.817   59.950  82.093  1.00 115.34 ? 6    DA  U N3    1 
ATOM   676   C  C4    . DA  D 2 5   ? 3.682   59.972  83.125  1.00 115.34 ? 6    DA  U C4    1 
ATOM   677   P  P     . DG  D 2 6   ? 9.215   62.750  81.125  1.00 116.16 ? 7    DG  U P     1 
ATOM   678   O  OP1   . DG  D 2 6   ? 10.066  63.135  79.970  1.00 105.17 ? 7    DG  U OP1   1 
ATOM   679   O  OP2   . DG  D 2 6   ? 9.789   62.777  82.499  1.00 105.17 ? 7    DG  U OP2   1 
ATOM   680   O  "O5'" . DG  D 2 6   ? 7.889   63.639  81.114  1.00 116.16 ? 7    DG  U "O5'" 1 
ATOM   681   C  "C5'" . DG  D 2 6   ? 7.370   64.173  79.893  1.00 116.16 ? 7    DG  U "C5'" 1 
ATOM   682   C  "C4'" . DG  D 2 6   ? 6.227   65.129  80.170  1.00 116.16 ? 7    DG  U "C4'" 1 
ATOM   683   O  "O4'" . DG  D 2 6   ? 5.152   64.404  80.822  1.00 116.16 ? 7    DG  U "O4'" 1 
ATOM   684   C  "C3'" . DG  D 2 6   ? 6.499   66.289  81.117  1.00 116.16 ? 7    DG  U "C3'" 1 
ATOM   685   O  "O3'" . DG  D 2 6   ? 7.119   67.398  80.481  1.00 116.16 ? 7    DG  U "O3'" 1 
ATOM   686   C  "C2'" . DG  D 2 6   ? 5.094   66.649  81.566  1.00 116.16 ? 7    DG  U "C2'" 1 
ATOM   687   C  "C1'" . DG  D 2 6   ? 4.484   65.261  81.734  1.00 116.16 ? 7    DG  U "C1'" 1 
ATOM   688   N  N9    . DG  D 2 6   ? 4.698   64.752  83.086  1.00 105.17 ? 7    DG  U N9    1 
ATOM   689   C  C8    . DG  D 2 6   ? 5.903   64.455  83.691  1.00 105.17 ? 7    DG  U C8    1 
ATOM   690   N  N7    . DG  D 2 6   ? 5.769   64.049  84.925  1.00 105.17 ? 7    DG  U N7    1 
ATOM   691   C  C5    . DG  D 2 6   ? 4.397   64.071  85.148  1.00 105.17 ? 7    DG  U C5    1 
ATOM   692   C  C6    . DG  D 2 6   ? 3.649   63.731  86.303  1.00 105.17 ? 7    DG  U C6    1 
ATOM   693   O  O6    . DG  D 2 6   ? 4.067   63.332  87.399  1.00 105.17 ? 7    DG  U O6    1 
ATOM   694   N  N1    . DG  D 2 6   ? 2.278   63.892  86.092  1.00 105.17 ? 7    DG  U N1    1 
ATOM   695   C  C2    . DG  D 2 6   ? 1.704   64.323  84.916  1.00 105.17 ? 7    DG  U C2    1 
ATOM   696   N  N2    . DG  D 2 6   ? 0.372   64.405  84.899  1.00 105.17 ? 7    DG  U N2    1 
ATOM   697   N  N3    . DG  D 2 6   ? 2.390   64.645  83.835  1.00 105.17 ? 7    DG  U N3    1 
ATOM   698   C  C4    . DG  D 2 6   ? 3.721   64.496  84.019  1.00 105.17 ? 7    DG  U C4    1 
ATOM   699   P  P     . DG  D 2 7   ? 7.642   68.632  81.370  1.00 85.58  ? 8    DG  U P     1 
ATOM   700   O  OP1   . DG  D 2 7   ? 8.443   69.521  80.493  1.00 112.02 ? 8    DG  U OP1   1 
ATOM   701   O  OP2   . DG  D 2 7   ? 8.239   68.109  82.634  1.00 112.02 ? 8    DG  U OP2   1 
ATOM   702   O  "O5'" . DG  D 2 7   ? 6.305   69.390  81.774  1.00 85.58  ? 8    DG  U "O5'" 1 
ATOM   703   C  "C5'" . DG  D 2 7   ? 6.233   70.140  82.984  1.00 85.58  ? 8    DG  U "C5'" 1 
ATOM   704   C  "C4'" . DG  D 2 7   ? 4.797   70.269  83.434  1.00 85.58  ? 8    DG  U "C4'" 1 
ATOM   705   O  "O4'" . DG  D 2 7   ? 4.228   68.946  83.632  1.00 85.58  ? 8    DG  U "O4'" 1 
ATOM   706   C  "C3'" . DG  D 2 7   ? 4.606   70.961  84.770  1.00 85.58  ? 8    DG  U "C3'" 1 
ATOM   707   O  "O3'" . DG  D 2 7   ? 4.579   72.370  84.605  1.00 85.58  ? 8    DG  U "O3'" 1 
ATOM   708   C  "C2'" . DG  D 2 7   ? 3.260   70.414  85.220  1.00 85.58  ? 8    DG  U "C2'" 1 
ATOM   709   C  "C1'" . DG  D 2 7   ? 3.350   68.964  84.741  1.00 85.58  ? 8    DG  U "C1'" 1 
ATOM   710   N  N9    . DG  D 2 7   ? 3.892   68.081  85.767  1.00 112.02 ? 8    DG  U N9    1 
ATOM   711   C  C8    . DG  D 2 7   ? 5.195   67.665  85.913  1.00 112.02 ? 8    DG  U C8    1 
ATOM   712   N  N7    . DG  D 2 7   ? 5.374   66.901  86.954  1.00 112.02 ? 8    DG  U N7    1 
ATOM   713   C  C5    . DG  D 2 7   ? 4.114   66.805  87.526  1.00 112.02 ? 8    DG  U C5    1 
ATOM   714   C  C6    . DG  D 2 7   ? 3.687   66.121  88.682  1.00 112.02 ? 8    DG  U C6    1 
ATOM   715   O  O6    . DG  D 2 7   ? 4.364   65.447  89.470  1.00 112.02 ? 8    DG  U O6    1 
ATOM   716   N  N1    . DG  D 2 7   ? 2.323   66.281  88.896  1.00 112.02 ? 8    DG  U N1    1 
ATOM   717   C  C2    . DG  D 2 7   ? 1.479   67.010  88.099  1.00 112.02 ? 8    DG  U C2    1 
ATOM   718   N  N2    . DG  D 2 7   ? 0.196   67.035  88.457  1.00 112.02 ? 8    DG  U N2    1 
ATOM   719   N  N3    . DG  D 2 7   ? 1.867   67.663  87.024  1.00 112.02 ? 8    DG  U N3    1 
ATOM   720   C  C4    . DG  D 2 7   ? 3.189   67.518  86.798  1.00 112.02 ? 8    DG  U C4    1 
ATOM   721   P  P     . DC  D 2 8   ? 4.981   73.317  85.834  1.00 66.96  ? 9    DC  U P     1 
ATOM   722   O  OP1   . DC  D 2 8   ? 4.963   74.732  85.370  1.00 63.72  ? 9    DC  U OP1   1 
ATOM   723   O  OP2   . DC  D 2 8   ? 6.192   72.770  86.490  1.00 63.72  ? 9    DC  U OP2   1 
ATOM   724   O  "O5'" . DC  D 2 8   ? 3.793   73.110  86.859  1.00 66.96  ? 9    DC  U "O5'" 1 
ATOM   725   C  "C5'" . DC  D 2 8   ? 2.475   73.533  86.529  1.00 66.96  ? 9    DC  U "C5'" 1 
ATOM   726   C  "C4'" . DC  D 2 8   ? 1.599   73.486  87.756  1.00 66.96  ? 9    DC  U "C4'" 1 
ATOM   727   O  "O4'" . DC  D 2 8   ? 1.647   72.146  88.288  1.00 66.96  ? 9    DC  U "O4'" 1 
ATOM   728   C  "C3'" . DC  D 2 8   ? 2.027   74.407  88.891  1.00 66.96  ? 9    DC  U "C3'" 1 
ATOM   729   O  "O3'" . DC  D 2 8   ? 0.851   74.936  89.497  1.00 66.96  ? 9    DC  U "O3'" 1 
ATOM   730   C  "C2'" . DC  D 2 8   ? 2.809   73.497  89.821  1.00 66.96  ? 9    DC  U "C2'" 1 
ATOM   731   C  "C1'" . DC  D 2 8   ? 2.144   72.144  89.608  1.00 66.96  ? 9    DC  U "C1'" 1 
ATOM   732   N  N1    . DC  D 2 8   ? 3.022   70.969  89.744  1.00 63.72  ? 9    DC  U N1    1 
ATOM   733   C  C2    . DC  D 2 8   ? 2.658   69.947  90.628  1.00 63.72  ? 9    DC  U C2    1 
ATOM   734   O  O2    . DC  D 2 8   ? 1.585   70.031  91.243  1.00 63.72  ? 9    DC  U O2    1 
ATOM   735   N  N3    . DC  D 2 8   ? 3.479   68.889  90.786  1.00 63.72  ? 9    DC  U N3    1 
ATOM   736   C  C4    . DC  D 2 8   ? 4.613   68.818  90.100  1.00 63.72  ? 9    DC  U C4    1 
ATOM   737   N  N4    . DC  D 2 8   ? 5.405   67.768  90.312  1.00 63.72  ? 9    DC  U N4    1 
ATOM   738   C  C5    . DC  D 2 8   ? 4.992   69.823  89.171  1.00 63.72  ? 9    DC  U C5    1 
ATOM   739   C  C6    . DC  D 2 8   ? 4.177   70.874  89.027  1.00 63.72  ? 9    DC  U C6    1 
ATOM   740   P  P     . DA  D 2 9   ? 0.971   76.112  90.568  1.00 61.65  ? 10   DA  U P     1 
ATOM   741   O  OP1   . DA  D 2 9   ? -0.318  76.845  90.599  1.00 77.74  ? 10   DA  U OP1   1 
ATOM   742   O  OP2   . DA  D 2 9   ? 2.239   76.858  90.321  1.00 77.74  ? 10   DA  U OP2   1 
ATOM   743   O  "O5'" . DA  D 2 9   ? 1.123   75.313  91.938  1.00 61.65  ? 10   DA  U "O5'" 1 
ATOM   744   C  "C5'" . DA  D 2 9   ? 0.064   74.497  92.432  1.00 61.65  ? 10   DA  U "C5'" 1 
ATOM   745   C  "C4'" . DA  D 2 9   ? 0.458   73.880  93.754  1.00 61.65  ? 10   DA  U "C4'" 1 
ATOM   746   O  "O4'" . DA  D 2 9   ? 1.310   72.728  93.559  1.00 61.65  ? 10   DA  U "O4'" 1 
ATOM   747   C  "C3'" . DA  D 2 9   ? 1.206   74.804  94.720  1.00 61.65  ? 10   DA  U "C3'" 1 
ATOM   748   O  "O3'" . DA  D 2 9   ? 0.776   74.545  96.057  1.00 61.65  ? 10   DA  U "O3'" 1 
ATOM   749   C  "C2'" . DA  D 2 9   ? 2.637   74.317  94.598  1.00 61.65  ? 10   DA  U "C2'" 1 
ATOM   750   C  "C1'" . DA  D 2 9   ? 2.409   72.831  94.436  1.00 61.65  ? 10   DA  U "C1'" 1 
ATOM   751   N  N9    . DA  D 2 9   ? 3.512   72.065  93.866  1.00 77.74  ? 10   DA  U N9    1 
ATOM   752   C  C8    . DA  D 2 9   ? 4.237   72.318  92.732  1.00 77.74  ? 10   DA  U C8    1 
ATOM   753   N  N7    . DA  D 2 9   ? 5.140   71.407  92.472  1.00 77.74  ? 10   DA  U N7    1 
ATOM   754   C  C5    . DA  D 2 9   ? 5.006   70.499  93.514  1.00 77.74  ? 10   DA  U C5    1 
ATOM   755   C  C6    . DA  D 2 9   ? 5.675   69.304  93.821  1.00 77.74  ? 10   DA  U C6    1 
ATOM   756   N  N6    . DA  D 2 9   ? 6.644   68.785  93.071  1.00 77.74  ? 10   DA  U N6    1 
ATOM   757   N  N1    . DA  D 2 9   ? 5.309   68.648  94.934  1.00 77.74  ? 10   DA  U N1    1 
ATOM   758   C  C2    . DA  D 2 9   ? 4.335   69.159  95.680  1.00 77.74  ? 10   DA  U C2    1 
ATOM   759   N  N3    . DA  D 2 9   ? 3.627   70.264  95.498  1.00 77.74  ? 10   DA  U N3    1 
ATOM   760   C  C4    . DA  D 2 9   ? 4.017   70.897  94.383  1.00 77.74  ? 10   DA  U C4    1 
ATOM   761   P  P     . DC  D 2 10  ? 0.268   75.745  96.996  1.00 65.56  ? 11   DC  U P     1 
ATOM   762   O  OP1   . DC  D 2 10  ? -0.964  76.304  96.397  1.00 93.97  ? 11   DC  U OP1   1 
ATOM   763   O  OP2   . DC  D 2 10  ? 1.408   76.637  97.319  1.00 93.97  ? 11   DC  U OP2   1 
ATOM   764   O  "O5'" . DC  D 2 10  ? -0.122  74.985  98.333  1.00 65.56  ? 11   DC  U "O5'" 1 
ATOM   765   C  "C5'" . DC  D 2 10  ? -0.836  73.750  98.287  1.00 65.56  ? 11   DC  U "C5'" 1 
ATOM   766   C  "C4'" . DC  D 2 10  ? -0.335  72.827  99.370  1.00 65.56  ? 11   DC  U "C4'" 1 
ATOM   767   O  "O4'" . DC  D 2 10  ? 0.719   71.962  98.870  1.00 65.56  ? 11   DC  U "O4'" 1 
ATOM   768   C  "C3'" . DC  D 2 10  ? 0.248   73.594  100.559 1.00 65.56  ? 11   DC  U "C3'" 1 
ATOM   769   O  "O3'" . DC  D 2 10  ? -0.243  73.127  101.814 1.00 65.56  ? 11   DC  U "O3'" 1 
ATOM   770   C  "C2'" . DC  D 2 10  ? 1.742   73.364  100.448 1.00 65.56  ? 11   DC  U "C2'" 1 
ATOM   771   C  "C1'" . DC  D 2 10  ? 1.830   72.017  99.754  1.00 65.56  ? 11   DC  U "C1'" 1 
ATOM   772   N  N1    . DC  D 2 10  ? 3.074   71.883  98.974  1.00 93.97  ? 11   DC  U N1    1 
ATOM   773   C  C2    . DC  D 2 10  ? 4.075   71.017  99.435  1.00 93.97  ? 11   DC  U C2    1 
ATOM   774   O  O2    . DC  D 2 10  ? 3.857   70.312  100.436 1.00 93.97  ? 11   DC  U O2    1 
ATOM   775   N  N3    . DC  D 2 10  ? 5.252   70.967  98.778  1.00 93.97  ? 11   DC  U N3    1 
ATOM   776   C  C4    . DC  D 2 10  ? 5.447   71.726  97.699  1.00 93.97  ? 11   DC  U C4    1 
ATOM   777   N  N4    . DC  D 2 10  ? 6.641   71.677  97.104  1.00 93.97  ? 11   DC  U N4    1 
ATOM   778   C  C5    . DC  D 2 10  ? 4.435   72.577  97.185  1.00 93.97  ? 11   DC  U C5    1 
ATOM   779   C  C6    . DC  D 2 10  ? 3.273   72.621  97.842  1.00 93.97  ? 11   DC  U C6    1 
ATOM   780   P  P     . DT  D 2 11  ? 0.112   73.941  103.148 1.00 87.66  ? 12   DT  U P     1 
ATOM   781   O  OP1   . DT  D 2 11  ? -1.098  73.865  104.003 1.00 101.12 ? 12   DT  U OP1   1 
ATOM   782   O  OP2   . DT  D 2 11  ? 0.690   75.263  102.794 1.00 101.12 ? 12   DT  U OP2   1 
ATOM   783   O  "O5'" . DT  D 2 11  ? 1.267   73.073  103.811 1.00 87.66  ? 12   DT  U "O5'" 1 
ATOM   784   C  "C5'" . DT  D 2 11  ? 1.006   71.733  104.223 1.00 87.66  ? 12   DT  U "C5'" 1 
ATOM   785   C  "C4'" . DT  D 2 11  ? 2.209   71.155  104.929 1.00 87.66  ? 12   DT  U "C4'" 1 
ATOM   786   O  "O4'" . DT  D 2 11  ? 3.270   70.896  103.975 1.00 87.66  ? 12   DT  U "O4'" 1 
ATOM   787   C  "C3'" . DT  D 2 11  ? 2.807   72.049  106.016 1.00 87.66  ? 12   DT  U "C3'" 1 
ATOM   788   O  "O3'" . DT  D 2 11  ? 3.133   71.254  107.156 1.00 87.66  ? 12   DT  U "O3'" 1 
ATOM   789   C  "C2'" . DT  D 2 11  ? 4.055   72.614  105.359 1.00 87.66  ? 12   DT  U "C2'" 1 
ATOM   790   C  "C1'" . DT  D 2 11  ? 4.474   71.497  104.418 1.00 87.66  ? 12   DT  U "C1'" 1 
ATOM   791   N  N1    . DT  D 2 11  ? 5.252   71.918  103.222 1.00 101.12 ? 12   DT  U N1    1 
ATOM   792   C  C2    . DT  D 2 11  ? 6.041   70.977  102.597 1.00 101.12 ? 12   DT  U C2    1 
ATOM   793   O  O2    . DT  D 2 11  ? 6.129   69.820  102.972 1.00 101.12 ? 12   DT  U O2    1 
ATOM   794   N  N3    . DT  D 2 11  ? 6.727   71.442  101.505 1.00 101.12 ? 12   DT  U N3    1 
ATOM   795   C  C4    . DT  D 2 11  ? 6.706   72.719  100.981 1.00 101.12 ? 12   DT  U C4    1 
ATOM   796   O  O4    . DT  D 2 11  ? 7.359   72.979  99.971  1.00 101.12 ? 12   DT  U O4    1 
ATOM   797   C  C5    . DT  D 2 11  ? 5.877   73.658  101.690 1.00 101.12 ? 12   DT  U C5    1 
ATOM   798   C  C7    . DT  D 2 11  ? 5.821   75.078  101.218 1.00 101.12 ? 12   DT  U C7    1 
ATOM   799   C  C6    . DT  D 2 11  ? 5.193   73.216  102.754 1.00 101.12 ? 12   DT  U C6    1 
ATOM   800   P  P     . DG  D 2 12  ? 3.718   71.941  108.486 1.00 57.52  ? 13   DG  U P     1 
ATOM   801   O  OP1   . DG  D 2 12  ? 2.856   71.494  109.605 1.00 96.87  ? 13   DG  U OP1   1 
ATOM   802   O  OP2   . DG  D 2 12  ? 3.945   73.395  108.278 1.00 96.87  ? 13   DG  U OP2   1 
ATOM   803   O  "O5'" . DG  D 2 12  ? 5.139   71.240  108.615 1.00 57.52  ? 13   DG  U "O5'" 1 
ATOM   804   C  "C5'" . DG  D 2 12  ? 5.292   69.865  108.251 1.00 57.52  ? 13   DG  U "C5'" 1 
ATOM   805   C  "C4'" . DG  D 2 12  ? 6.753   69.503  108.132 1.00 57.52  ? 13   DG  U "C4'" 1 
ATOM   806   O  "O4'" . DG  D 2 12  ? 7.304   70.031  106.903 1.00 57.52  ? 13   DG  U "O4'" 1 
ATOM   807   C  "C3'" . DG  D 2 12  ? 7.621   70.041  109.266 1.00 57.52  ? 13   DG  U "C3'" 1 
ATOM   808   O  "O3'" . DG  D 2 12  ? 8.554   69.041  109.700 1.00 57.52  ? 13   DG  U "O3'" 1 
ATOM   809   C  "C2'" . DG  D 2 12  ? 8.305   71.250  108.650 1.00 57.52  ? 13   DG  U "C2'" 1 
ATOM   810   C  "C1'" . DG  D 2 12  ? 8.416   70.880  107.178 1.00 57.52  ? 13   DG  U "C1'" 1 
ATOM   811   N  N9    . DG  D 2 12  ? 8.335   72.038  106.291 1.00 96.87  ? 13   DG  U N9    1 
ATOM   812   C  C8    . DG  D 2 12  ? 7.464   73.100  106.401 1.00 96.87  ? 13   DG  U C8    1 
ATOM   813   N  N7    . DG  D 2 12  ? 7.603   73.979  105.449 1.00 96.87  ? 13   DG  U N7    1 
ATOM   814   C  C5    . DG  D 2 12  ? 8.628   73.472  104.661 1.00 96.87  ? 13   DG  U C5    1 
ATOM   815   C  C6    . DG  D 2 12  ? 9.205   73.985  103.476 1.00 96.87  ? 13   DG  U C6    1 
ATOM   816   O  O6    . DG  D 2 12  ? 8.909   75.020  102.860 1.00 96.87  ? 13   DG  U O6    1 
ATOM   817   N  N1    . DG  D 2 12  ? 10.221  73.162  103.005 1.00 96.87  ? 13   DG  U N1    1 
ATOM   818   C  C2    . DG  D 2 12  ? 10.625  71.993  103.594 1.00 96.87  ? 13   DG  U C2    1 
ATOM   819   N  N2    . DG  D 2 12  ? 11.624  71.343  102.978 1.00 96.87  ? 13   DG  U N2    1 
ATOM   820   N  N3    . DG  D 2 12  ? 10.089  71.496  104.700 1.00 96.87  ? 13   DG  U N3    1 
ATOM   821   C  C4    . DG  D 2 12  ? 9.101   72.282  105.175 1.00 96.87  ? 13   DG  U C4    1 
ATOM   822   P  P     . DG  D 2 13  ? 9.441   69.291  111.015 1.00 97.06  ? 14   DG  U P     1 
ATOM   823   O  OP1   . DG  D 2 13  ? 9.766   67.962  111.576 1.00 109.56 ? 14   DG  U OP1   1 
ATOM   824   O  OP2   . DG  D 2 13  ? 8.764   70.307  111.863 1.00 109.56 ? 14   DG  U OP2   1 
ATOM   825   O  "O5'" . DG  D 2 13  ? 10.777  69.925  110.434 1.00 97.06  ? 14   DG  U "O5'" 1 
ATOM   826   C  "C5'" . DG  D 2 13  ? 11.580  69.185  109.515 1.00 97.06  ? 14   DG  U "C5'" 1 
ATOM   827   C  "C4'" . DG  D 2 13  ? 12.773  70.000  109.067 1.00 97.06  ? 14   DG  U "C4'" 1 
ATOM   828   O  "O4'" . DG  D 2 13  ? 12.403  70.950  108.035 1.00 97.06  ? 14   DG  U "O4'" 1 
ATOM   829   C  "C3'" . DG  D 2 13  ? 13.471  70.806  110.168 1.00 97.06  ? 14   DG  U "C3'" 1 
ATOM   830   O  "O3'" . DG  D 2 13  ? 14.892  70.674  110.058 1.00 97.06  ? 14   DG  U "O3'" 1 
ATOM   831   C  "C2'" . DG  D 2 13  ? 13.060  72.237  109.875 1.00 97.06  ? 14   DG  U "C2'" 1 
ATOM   832   C  "C1'" . DG  D 2 13  ? 12.943  72.226  108.364 1.00 97.06  ? 14   DG  U "C1'" 1 
ATOM   833   N  N9    . DG  D 2 13  ? 12.064  73.267  107.829 1.00 109.56 ? 14   DG  U N9    1 
ATOM   834   C  C8    . DG  D 2 13  ? 10.939  73.802  108.422 1.00 109.56 ? 14   DG  U C8    1 
ATOM   835   N  N7    . DG  D 2 13  ? 10.387  74.751  107.714 1.00 109.56 ? 14   DG  U N7    1 
ATOM   836   C  C5    . DG  D 2 13  ? 11.188  74.846  106.582 1.00 109.56 ? 14   DG  U C5    1 
ATOM   837   C  C6    . DG  D 2 13  ? 11.096  75.710  105.465 1.00 109.56 ? 14   DG  U C6    1 
ATOM   838   O  O6    . DG  D 2 13  ? 10.263  76.604  105.248 1.00 109.56 ? 14   DG  U O6    1 
ATOM   839   N  N1    . DG  D 2 13  ? 12.111  75.463  104.543 1.00 109.56 ? 14   DG  U N1    1 
ATOM   840   C  C2    . DG  D 2 13  ? 13.094  74.517  104.685 1.00 109.56 ? 14   DG  U C2    1 
ATOM   841   N  N2    . DG  D 2 13  ? 13.982  74.428  103.689 1.00 109.56 ? 14   DG  U N2    1 
ATOM   842   N  N3    . DG  D 2 13  ? 13.201  73.715  105.727 1.00 109.56 ? 14   DG  U N3    1 
ATOM   843   C  C4    . DG  D 2 13  ? 12.221  73.931  106.632 1.00 109.56 ? 14   DG  U C4    1 
ATOM   844   P  P     . DC  D 2 14  ? 15.842  71.311  111.185 1.00 176.83 ? 15   DC  U P     1 
ATOM   845   O  OP1   . DC  D 2 14  ? 16.689  70.209  111.708 1.00 104.07 ? 15   DC  U OP1   1 
ATOM   846   O  OP2   . DC  D 2 14  ? 15.018  72.120  112.128 1.00 104.07 ? 15   DC  U OP2   1 
ATOM   847   O  "O5'" . DC  D 2 14  ? 16.759  72.302  110.343 1.00 176.83 ? 15   DC  U "O5'" 1 
ATOM   848   C  "C5'" . DC  D 2 14  ? 17.563  71.804  109.275 1.00 176.83 ? 15   DC  U "C5'" 1 
ATOM   849   C  "C4'" . DC  D 2 14  ? 18.134  72.943  108.462 1.00 176.83 ? 15   DC  U "C4'" 1 
ATOM   850   O  "O4'" . DC  D 2 14  ? 17.046  73.644  107.807 1.00 176.83 ? 15   DC  U "O4'" 1 
ATOM   851   C  "C3'" . DC  D 2 14  ? 18.917  73.994  109.259 1.00 176.83 ? 15   DC  U "C3'" 1 
ATOM   852   O  "O3'" . DC  D 2 14  ? 20.108  74.377  108.556 1.00 176.83 ? 15   DC  U "O3'" 1 
ATOM   853   C  "C2'" . DC  D 2 14  ? 17.953  75.164  109.347 1.00 176.83 ? 15   DC  U "C2'" 1 
ATOM   854   C  "C1'" . DC  D 2 14  ? 17.165  75.037  108.048 1.00 176.83 ? 15   DC  U "C1'" 1 
ATOM   855   N  N1    . DC  D 2 14  ? 15.807  75.630  108.061 1.00 104.07 ? 15   DC  U N1    1 
ATOM   856   C  C2    . DC  D 2 14  ? 15.266  76.121  106.856 1.00 104.07 ? 15   DC  U C2    1 
ATOM   857   O  O2    . DC  D 2 14  ? 15.903  75.976  105.798 1.00 104.07 ? 15   DC  U O2    1 
ATOM   858   N  N3    . DC  D 2 14  ? 14.058  76.729  106.878 1.00 104.07 ? 15   DC  U N3    1 
ATOM   859   C  C4    . DC  D 2 14  ? 13.383  76.837  108.027 1.00 104.07 ? 15   DC  U C4    1 
ATOM   860   N  N4    . DC  D 2 14  ? 12.199  77.458  108.004 1.00 104.07 ? 15   DC  U N4    1 
ATOM   861   C  C5    . DC  D 2 14  ? 13.889  76.317  109.253 1.00 104.07 ? 15   DC  U C5    1 
ATOM   862   C  C6    . DC  D 2 14  ? 15.090  75.726  109.225 1.00 104.07 ? 15   DC  U C6    1 
ATOM   863   N  N     . MET E 3 1   ? 4.260   41.632  49.634  1.00 66.28  ? 1    MET A N     1 
ATOM   864   C  CA    . MET E 3 1   ? 4.535   42.078  48.238  1.00 66.28  ? 1    MET A CA    1 
ATOM   865   C  C     . MET E 3 1   ? 5.070   40.928  47.383  1.00 66.28  ? 1    MET A C     1 
ATOM   866   O  O     . MET E 3 1   ? 5.595   39.946  47.908  1.00 66.28  ? 1    MET A O     1 
ATOM   867   C  CB    . MET E 3 1   ? 5.557   43.218  48.254  1.00 70.15  ? 1    MET A CB    1 
ATOM   868   C  CG    . MET E 3 1   ? 5.818   43.831  46.886  1.00 70.15  ? 1    MET A CG    1 
ATOM   869   S  SD    . MET E 3 1   ? 6.953   45.234  46.898  1.00 70.15  ? 1    MET A SD    1 
ATOM   870   C  CE    . MET E 3 1   ? 5.864   46.535  47.394  1.00 70.15  ? 1    MET A CE    1 
ATOM   871   N  N     . ILE E 3 2   ? 4.912   41.043  46.067  1.00 60.47  ? 2    ILE A N     1 
ATOM   872   C  CA    . ILE E 3 2   ? 5.399   40.031  45.129  1.00 60.47  ? 2    ILE A CA    1 
ATOM   873   C  C     . ILE E 3 2   ? 5.740   40.721  43.826  1.00 60.47  ? 2    ILE A C     1 
ATOM   874   O  O     . ILE E 3 2   ? 5.231   41.809  43.544  1.00 60.47  ? 2    ILE A O     1 
ATOM   875   C  CB    . ILE E 3 2   ? 4.351   38.910  44.845  1.00 42.70  ? 2    ILE A CB    1 
ATOM   876   C  CG1   . ILE E 3 2   ? 3.068   39.505  44.280  1.00 42.70  ? 2    ILE A CG1   1 
ATOM   877   C  CG2   . ILE E 3 2   ? 4.015   38.162  46.113  1.00 42.70  ? 2    ILE A CG2   1 
ATOM   878   C  CD1   . ILE E 3 2   ? 1.991   38.455  44.013  1.00 42.70  ? 2    ILE A CD1   1 
ATOM   879   N  N     . VAL E 3 3   ? 6.589   40.087  43.027  1.00 48.61  ? 3    VAL A N     1 
ATOM   880   C  CA    . VAL E 3 3   ? 6.998   40.683  41.766  1.00 48.61  ? 3    VAL A CA    1 
ATOM   881   C  C     . VAL E 3 3   ? 6.857   39.735  40.603  1.00 48.61  ? 3    VAL A C     1 
ATOM   882   O  O     . VAL E 3 3   ? 7.806   39.032  40.268  1.00 48.61  ? 3    VAL A O     1 
ATOM   883   C  CB    . VAL E 3 3   ? 8.461   41.135  41.818  1.00 45.08  ? 3    VAL A CB    1 
ATOM   884   C  CG1   . VAL E 3 3   ? 8.878   41.704  40.453  1.00 45.08  ? 3    VAL A CG1   1 
ATOM   885   C  CG2   . VAL E 3 3   ? 8.640   42.161  42.928  1.00 45.08  ? 3    VAL A CG2   1 
ATOM   886   N  N     . SER E 3 4   ? 5.701   39.747  39.953  1.00 35.19  ? 4    SER A N     1 
ATOM   887   C  CA    . SER E 3 4   ? 5.472   38.828  38.846  1.00 35.19  ? 4    SER A CA    1 
ATOM   888   C  C     . SER E 3 4   ? 5.566   39.423  37.435  1.00 35.19  ? 4    SER A C     1 
ATOM   889   O  O     . SER E 3 4   ? 5.699   40.639  37.257  1.00 35.19  ? 4    SER A O     1 
ATOM   890   C  CB    . SER E 3 4   ? 4.121   38.136  39.049  1.00 89.71  ? 4    SER A CB    1 
ATOM   891   O  OG    . SER E 3 4   ? 3.962   37.049  38.162  1.00 89.71  ? 4    SER A OG    1 
ATOM   892   N  N     . ASP E 3 5   ? 5.512   38.537  36.443  1.00 47.13  ? 5    ASP A N     1 
ATOM   893   C  CA    . ASP E 3 5   ? 5.565   38.886  35.023  1.00 47.13  ? 5    ASP A CA    1 
ATOM   894   C  C     . ASP E 3 5   ? 5.013   37.691  34.240  1.00 47.13  ? 5    ASP A C     1 
ATOM   895   O  O     . ASP E 3 5   ? 5.113   36.559  34.694  1.00 47.13  ? 5    ASP A O     1 
ATOM   896   C  CB    . ASP E 3 5   ? 6.994   39.157  34.574  1.00 79.48  ? 5    ASP A CB    1 
ATOM   897   C  CG    . ASP E 3 5   ? 7.107   39.260  33.071  1.00 79.48  ? 5    ASP A CG    1 
ATOM   898   O  OD1   . ASP E 3 5   ? 6.650   40.278  32.505  1.00 79.48  ? 5    ASP A OD1   1 
ATOM   899   O  OD2   . ASP E 3 5   ? 7.632   38.311  32.449  1.00 79.48  ? 5    ASP A OD2   1 
ATOM   900   N  N     . ILE E 3 6   ? 4.431   37.920  33.071  1.00 43.64  ? 6    ILE A N     1 
ATOM   901   C  CA    . ILE E 3 6   ? 3.871   36.813  32.313  1.00 43.64  ? 6    ILE A CA    1 
ATOM   902   C  C     . ILE E 3 6   ? 4.258   36.922  30.859  1.00 43.64  ? 6    ILE A C     1 
ATOM   903   O  O     . ILE E 3 6   ? 4.488   38.026  30.366  1.00 43.64  ? 6    ILE A O     1 
ATOM   904   C  CB    . ILE E 3 6   ? 2.324   36.807  32.372  1.00 58.24  ? 6    ILE A CB    1 
ATOM   905   C  CG1   . ILE E 3 6   ? 1.753   37.853  31.412  1.00 58.24  ? 6    ILE A CG1   1 
ATOM   906   C  CG2   . ILE E 3 6   ? 1.841   37.169  33.767  1.00 58.24  ? 6    ILE A CG2   1 
ATOM   907   C  CD1   . ILE E 3 6   ? 0.292   37.635  31.090  1.00 58.24  ? 6    ILE A CD1   1 
ATOM   908   N  N     . GLU E 3 7   ? 4.311   35.779  30.177  1.00 52.15  ? 7    GLU A N     1 
ATOM   909   C  CA    . GLU E 3 7   ? 4.641   35.708  28.748  1.00 52.15  ? 7    GLU A CA    1 
ATOM   910   C  C     . GLU E 3 7   ? 3.394   35.185  28.030  1.00 52.15  ? 7    GLU A C     1 
ATOM   911   O  O     . GLU E 3 7   ? 2.940   34.074  28.302  1.00 52.15  ? 7    GLU A O     1 
ATOM   912   C  CB    . GLU E 3 7   ? 5.811   34.741  28.501  1.00 59.84  ? 7    GLU A CB    1 
ATOM   913   C  CG    . GLU E 3 7   ? 7.071   35.078  29.259  1.00 59.84  ? 7    GLU A CG    1 
ATOM   914   C  CD    . GLU E 3 7   ? 7.708   36.353  28.764  1.00 59.84  ? 7    GLU A CD    1 
ATOM   915   O  OE1   . GLU E 3 7   ? 6.976   37.349  28.639  1.00 59.84  ? 7    GLU A OE1   1 
ATOM   916   O  OE2   . GLU E 3 7   ? 8.936   36.372  28.497  1.00 59.84  ? 7    GLU A OE2   1 
ATOM   917   N  N     . ALA E 3 8   ? 2.828   35.982  27.131  1.00 52.03  ? 8    ALA A N     1 
ATOM   918   C  CA    . ALA E 3 8   ? 1.634   35.552  26.406  1.00 52.03  ? 8    ALA A CA    1 
ATOM   919   C  C     . ALA E 3 8   ? 2.006   35.268  24.974  1.00 52.03  ? 8    ALA A C     1 
ATOM   920   O  O     . ALA E 3 8   ? 3.165   35.388  24.608  1.00 52.03  ? 8    ALA A O     1 
ATOM   921   C  CB    . ALA E 3 8   ? 0.547   36.620  26.459  1.00 66.72  ? 8    ALA A CB    1 
ATOM   922   N  N     . ASN E 3 9   ? 1.015   34.908  24.165  1.00 53.34  ? 9    ASN A N     1 
ATOM   923   C  CA    . ASN E 3 9   ? 1.242   34.583  22.760  1.00 53.34  ? 9    ASN A CA    1 
ATOM   924   C  C     . ASN E 3 9   ? 1.106   35.768  21.840  1.00 53.34  ? 9    ASN A C     1 
ATOM   925   O  O     . ASN E 3 9   ? 1.353   35.634  20.644  1.00 53.34  ? 9    ASN A O     1 
ATOM   926   C  CB    . ASN E 3 9   ? 0.268   33.520  22.301  1.00 68.50  ? 9    ASN A CB    1 
ATOM   927   C  CG    . ASN E 3 9   ? -1.142  33.933  22.524  1.00 68.50  ? 9    ASN A CG    1 
ATOM   928   O  OD1   . ASN E 3 9   ? -1.516  34.281  23.634  1.00 68.50  ? 9    ASN A OD1   1 
ATOM   929   N  ND2   . ASN E 3 9   ? -1.938  33.914  21.478  1.00 68.50  ? 9    ASN A ND2   1 
ATOM   930   N  N     . ALA E 3 10  ? 0.698   36.914  22.380  1.00 18.42  ? 10   ALA A N     1 
ATOM   931   C  CA    . ALA E 3 10  ? 0.561   38.123  21.574  1.00 18.42  ? 10   ALA A CA    1 
ATOM   932   C  C     . ALA E 3 10  ? 0.310   39.401  22.360  1.00 18.42  ? 10   ALA A C     1 
ATOM   933   O  O     . ALA E 3 10  ? 0.100   39.389  23.587  1.00 18.42  ? 10   ALA A O     1 
ATOM   934   C  CB    . ALA E 3 10  ? -0.521  37.944  20.570  1.00 40.25  ? 10   ALA A CB    1 
ATOM   935   N  N     . LEU E 3 11  ? 0.335   40.516  21.647  1.00 46.79  ? 11   LEU A N     1 
ATOM   936   C  CA    . LEU E 3 11  ? 0.094   41.786  22.292  1.00 46.79  ? 11   LEU A CA    1 
ATOM   937   C  C     . LEU E 3 11  ? -1.309  41.747  22.858  1.00 46.79  ? 11   LEU A C     1 
ATOM   938   O  O     . LEU E 3 11  ? -2.115  40.923  22.463  1.00 46.79  ? 11   LEU A O     1 
ATOM   939   C  CB    . LEU E 3 11  ? 0.213   42.920  21.290  1.00 58.99  ? 11   LEU A CB    1 
ATOM   940   C  CG    . LEU E 3 11  ? 1.611   43.182  20.762  1.00 58.99  ? 11   LEU A CG    1 
ATOM   941   C  CD1   . LEU E 3 11  ? 1.588   44.355  19.788  1.00 58.99  ? 11   LEU A CD1   1 
ATOM   942   C  CD2   . LEU E 3 11  ? 2.504   43.466  21.928  1.00 58.99  ? 11   LEU A CD2   1 
ATOM   943   N  N     . LEU E 3 12  ? -1.611  42.644  23.775  1.00 58.13  ? 12   LEU A N     1 
ATOM   944   C  CA    . LEU E 3 12  ? -2.926  42.636  24.376  1.00 58.13  ? 12   LEU A CA    1 
ATOM   945   C  C     . LEU E 3 12  ? -4.052  42.548  23.380  1.00 58.13  ? 12   LEU A C     1 
ATOM   946   O  O     . LEU E 3 12  ? -4.913  41.674  23.468  1.00 58.13  ? 12   LEU A O     1 
ATOM   947   C  CB    . LEU E 3 12  ? -3.141  43.895  25.176  1.00 22.58  ? 12   LEU A CB    1 
ATOM   948   C  CG    . LEU E 3 12  ? -4.399  43.820  25.988  1.00 22.58  ? 12   LEU A CG    1 
ATOM   949   C  CD1   . LEU E 3 12  ? -4.286  42.589  26.831  1.00 22.58  ? 12   LEU A CD1   1 
ATOM   950   C  CD2   . LEU E 3 12  ? -4.543  45.065  26.839  1.00 22.58  ? 12   LEU A CD2   1 
ATOM   951   N  N     . GLU E 3 13  ? -4.037  43.480  22.434  1.00 58.56  ? 13   GLU A N     1 
ATOM   952   C  CA    . GLU E 3 13  ? -5.072  43.591  21.425  1.00 58.56  ? 13   GLU A CA    1 
ATOM   953   C  C     . GLU E 3 13  ? -5.353  42.321  20.640  1.00 58.56  ? 13   GLU A C     1 
ATOM   954   O  O     . GLU E 3 13  ? -6.330  42.275  19.899  1.00 58.56  ? 13   GLU A O     1 
ATOM   955   C  CB    . GLU E 3 13  ? -4.715  44.729  20.472  1.00 100.37 ? 13   GLU A CB    1 
ATOM   956   C  CG    . GLU E 3 13  ? -4.211  45.994  21.183  1.00 100.37 ? 13   GLU A CG    1 
ATOM   957   C  CD    . GLU E 3 13  ? -2.727  45.935  21.542  1.00 100.37 ? 13   GLU A CD    1 
ATOM   958   O  OE1   . GLU E 3 13  ? -1.898  45.852  20.612  1.00 100.37 ? 13   GLU A OE1   1 
ATOM   959   O  OE2   . GLU E 3 13  ? -2.386  45.978  22.744  1.00 100.37 ? 13   GLU A OE2   1 
ATOM   960   N  N     . SER E 3 14  ? -4.514  41.294  20.805  1.00 31.38  ? 14   SER A N     1 
ATOM   961   C  CA    . SER E 3 14  ? -4.673  40.029  20.077  1.00 31.38  ? 14   SER A CA    1 
ATOM   962   C  C     . SER E 3 14  ? -4.253  38.847  20.889  1.00 31.38  ? 14   SER A C     1 
ATOM   963   O  O     . SER E 3 14  ? -4.193  37.753  20.351  1.00 31.38  ? 14   SER A O     1 
ATOM   964   C  CB    . SER E 3 14  ? -3.810  39.950  18.808  1.00 18.16  ? 14   SER A CB    1 
ATOM   965   O  OG    . SER E 3 14  ? -3.433  41.214  18.252  1.00 18.16  ? 14   SER A OG    1 
ATOM   966   N  N     . VAL E 3 15  ? -3.926  39.046  22.160  1.00 55.09  ? 15   VAL A N     1 
ATOM   967   C  CA    . VAL E 3 15  ? -3.479  37.939  23.007  1.00 55.09  ? 15   VAL A CA    1 
ATOM   968   C  C     . VAL E 3 15  ? -4.589  36.929  23.288  1.00 55.09  ? 15   VAL A C     1 
ATOM   969   O  O     . VAL E 3 15  ? -5.748  37.289  23.449  1.00 55.09  ? 15   VAL A O     1 
ATOM   970   C  CB    . VAL E 3 15  ? -2.913  38.468  24.327  1.00 53.02  ? 15   VAL A CB    1 
ATOM   971   C  CG1   . VAL E 3 15  ? -3.938  39.337  25.017  1.00 53.02  ? 15   VAL A CG1   1 
ATOM   972   C  CG2   . VAL E 3 15  ? -2.498  37.315  25.205  1.00 53.02  ? 15   VAL A CG2   1 
ATOM   973   N  N     . THR E 3 16  ? -4.242  35.653  23.348  1.00 37.51  ? 16   THR A N     1 
ATOM   974   C  CA    . THR E 3 16  ? -5.258  34.637  23.571  1.00 37.51  ? 16   THR A CA    1 
ATOM   975   C  C     . THR E 3 16  ? -4.719  33.397  24.283  1.00 37.51  ? 16   THR A C     1 
ATOM   976   O  O     . THR E 3 16  ? -5.453  32.451  24.518  1.00 37.51  ? 16   THR A O     1 
ATOM   977   C  CB    . THR E 3 16  ? -5.916  34.198  22.202  1.00 35.81  ? 16   THR A CB    1 
ATOM   978   O  OG1   . THR E 3 16  ? -5.113  33.196  21.555  1.00 35.81  ? 16   THR A OG1   1 
ATOM   979   C  CG2   . THR E 3 16  ? -6.055  35.399  21.259  1.00 35.81  ? 16   THR A CG2   1 
ATOM   980   N  N     . LYS E 3 17  ? -3.437  33.386  24.619  1.00 59.51  ? 17   LYS A N     1 
ATOM   981   C  CA    . LYS E 3 17  ? -2.860  32.227  25.303  1.00 59.51  ? 17   LYS A CA    1 
ATOM   982   C  C     . LYS E 3 17  ? -1.749  32.586  26.270  1.00 59.51  ? 17   LYS A C     1 
ATOM   983   O  O     . LYS E 3 17  ? -0.740  33.180  25.902  1.00 59.51  ? 17   LYS A O     1 
ATOM   984   C  CB    . LYS E 3 17  ? -2.323  31.183  24.303  1.00 35.93  ? 17   LYS A CB    1 
ATOM   985   N  N     . PHE E 3 18  ? -1.972  32.218  27.519  1.00 65.60  ? 18   PHE A N     1 
ATOM   986   C  CA    . PHE E 3 18  ? -1.023  32.423  28.588  1.00 65.60  ? 18   PHE A CA    1 
ATOM   987   C  C     . PHE E 3 18  ? 0.062   31.399  28.336  1.00 65.60  ? 18   PHE A C     1 
ATOM   988   O  O     . PHE E 3 18  ? -0.250  30.248  28.047  1.00 65.60  ? 18   PHE A O     1 
ATOM   989   C  CB    . PHE E 3 18  ? -1.701  32.091  29.899  1.00 39.22  ? 18   PHE A CB    1 
ATOM   990   C  CG    . PHE E 3 18  ? -0.791  32.108  31.065  1.00 39.22  ? 18   PHE A CG    1 
ATOM   991   C  CD1   . PHE E 3 18  ? -0.540  33.293  31.747  1.00 39.22  ? 18   PHE A CD1   1 
ATOM   992   C  CD2   . PHE E 3 18  ? -0.205  30.942  31.508  1.00 39.22  ? 18   PHE A CD2   1 
ATOM   993   C  CE1   . PHE E 3 18  ? 0.279   33.305  32.859  1.00 39.22  ? 18   PHE A CE1   1 
ATOM   994   C  CE2   . PHE E 3 18  ? 0.614   30.940  32.615  1.00 39.22  ? 18   PHE A CE2   1 
ATOM   995   C  CZ    . PHE E 3 18  ? 0.858   32.120  33.295  1.00 39.22  ? 18   PHE A CZ    1 
ATOM   996   N  N     . HIS E 3 19  ? 1.327   31.785  28.450  1.00 49.99  ? 19   HIS A N     1 
ATOM   997   C  CA    . HIS E 3 19  ? 2.397   30.829  28.211  1.00 49.99  ? 19   HIS A CA    1 
ATOM   998   C  C     . HIS E 3 19  ? 3.083   30.389  29.490  1.00 49.99  ? 19   HIS A C     1 
ATOM   999   O  O     . HIS E 3 19  ? 3.469   29.233  29.621  1.00 49.99  ? 19   HIS A O     1 
ATOM   1000  C  CB    . HIS E 3 19  ? 3.425   31.420  27.261  1.00 39.34  ? 19   HIS A CB    1 
ATOM   1001  C  CG    . HIS E 3 19  ? 3.030   31.365  25.819  1.00 39.34  ? 19   HIS A CG    1 
ATOM   1002  N  ND1   . HIS E 3 19  ? 2.472   30.244  25.246  1.00 39.34  ? 19   HIS A ND1   1 
ATOM   1003  C  CD2   . HIS E 3 19  ? 3.248   32.236  24.805  1.00 39.34  ? 19   HIS A CD2   1 
ATOM   1004  C  CE1   . HIS E 3 19  ? 2.375   30.423  23.941  1.00 39.34  ? 19   HIS A CE1   1 
ATOM   1005  N  NE2   . HIS E 3 19  ? 2.841   31.623  23.647  1.00 39.34  ? 19   HIS A NE2   1 
ATOM   1006  N  N     . CYS E 3 20  ? 3.223   31.319  30.432  1.00 45.17  ? 20   CYS A N     1 
ATOM   1007  C  CA    . CYS E 3 20  ? 3.878   31.047  31.712  1.00 45.17  ? 20   CYS A CA    1 
ATOM   1008  C  C     . CYS E 3 20  ? 3.959   32.300  32.566  1.00 45.17  ? 20   CYS A C     1 
ATOM   1009  O  O     . CYS E 3 20  ? 3.833   33.418  32.070  1.00 45.17  ? 20   CYS A O     1 
ATOM   1010  C  CB    . CYS E 3 20  ? 5.294   30.474  31.502  1.00 39.89  ? 20   CYS A CB    1 
ATOM   1011  S  SG    . CYS E 3 20  ? 6.404   31.389  30.392  1.00 39.89  ? 20   CYS A SG    1 
ATOM   1012  N  N     . GLY E 3 21  ? 4.161   32.095  33.860  1.00 61.48  ? 21   GLY A N     1 
ATOM   1013  C  CA    . GLY E 3 21  ? 4.250   33.206  34.780  1.00 61.48  ? 21   GLY A CA    1 
ATOM   1014  C  C     . GLY E 3 21  ? 5.197   32.919  35.926  1.00 61.48  ? 21   GLY A C     1 
ATOM   1015  O  O     . GLY E 3 21  ? 5.067   31.901  36.617  1.00 61.48  ? 21   GLY A O     1 
ATOM   1016  N  N     . VAL E 3 22  ? 6.163   33.811  36.120  1.00 47.60  ? 22   VAL A N     1 
ATOM   1017  C  CA    . VAL E 3 22  ? 7.127   33.661  37.197  1.00 47.60  ? 22   VAL A CA    1 
ATOM   1018  C  C     . VAL E 3 22  ? 6.699   34.580  38.325  1.00 47.60  ? 22   VAL A C     1 
ATOM   1019  O  O     . VAL E 3 22  ? 5.920   35.502  38.118  1.00 47.60  ? 22   VAL A O     1 
ATOM   1020  C  CB    . VAL E 3 22  ? 8.546   34.031  36.734  1.00 44.65  ? 22   VAL A CB    1 
ATOM   1021  C  CG1   . VAL E 3 22  ? 9.526   33.810  37.860  1.00 44.65  ? 22   VAL A CG1   1 
ATOM   1022  C  CG2   . VAL E 3 22  ? 8.931   33.191  35.525  1.00 44.65  ? 22   VAL A CG2   1 
ATOM   1023  N  N     . ILE E 3 23  ? 7.184   34.317  39.526  1.00 65.18  ? 23   ILE A N     1 
ATOM   1024  C  CA    . ILE E 3 23  ? 6.848   35.151  40.663  1.00 65.18  ? 23   ILE A CA    1 
ATOM   1025  C  C     . ILE E 3 23  ? 7.923   35.078  41.720  1.00 65.18  ? 23   ILE A C     1 
ATOM   1026  O  O     . ILE E 3 23  ? 8.526   34.031  41.930  1.00 65.18  ? 23   ILE A O     1 
ATOM   1027  C  CB    . ILE E 3 23  ? 5.571   34.719  41.358  1.00 34.33  ? 23   ILE A CB    1 
ATOM   1028  C  CG1   . ILE E 3 23  ? 4.363   34.877  40.448  1.00 34.33  ? 23   ILE A CG1   1 
ATOM   1029  C  CG2   . ILE E 3 23  ? 5.336   35.593  42.557  1.00 34.33  ? 23   ILE A CG2   1 
ATOM   1030  C  CD1   . ILE E 3 23  ? 2.993   34.498  41.143  1.00 34.33  ? 23   ILE A CD1   1 
ATOM   1031  N  N     . TYR E 3 24  ? 8.165   36.200  42.383  1.00 62.31  ? 24   TYR A N     1 
ATOM   1032  C  CA    . TYR E 3 24  ? 9.124   36.238  43.467  1.00 62.31  ? 24   TYR A CA    1 
ATOM   1033  C  C     . TYR E 3 24  ? 8.438   36.825  44.694  1.00 62.31  ? 24   TYR A C     1 
ATOM   1034  O  O     . TYR E 3 24  ? 8.365   38.040  44.844  1.00 62.31  ? 24   TYR A O     1 
ATOM   1035  C  CB    . TYR E 3 24  ? 10.342  37.080  43.114  1.00 57.06  ? 24   TYR A CB    1 
ATOM   1036  C  CG    . TYR E 3 24  ? 11.167  37.364  44.345  1.00 57.06  ? 24   TYR A CG    1 
ATOM   1037  C  CD1   . TYR E 3 24  ? 11.625  36.326  45.147  1.00 57.06  ? 24   TYR A CD1   1 
ATOM   1038  C  CD2   . TYR E 3 24  ? 11.381  38.668  44.778  1.00 57.06  ? 24   TYR A CD2   1 
ATOM   1039  C  CE1   . TYR E 3 24  ? 12.261  36.579  46.352  1.00 57.06  ? 24   TYR A CE1   1 
ATOM   1040  C  CE2   . TYR E 3 24  ? 12.016  38.933  45.984  1.00 57.06  ? 24   TYR A CE2   1 
ATOM   1041  C  CZ    . TYR E 3 24  ? 12.449  37.885  46.769  1.00 57.06  ? 24   TYR A CZ    1 
ATOM   1042  O  OH    . TYR E 3 24  ? 13.046  38.140  47.985  1.00 57.06  ? 24   TYR A OH    1 
ATOM   1043  N  N     . ASP E 3 25  ? 7.915   35.971  45.566  1.00 51.74  ? 25   ASP A N     1 
ATOM   1044  C  CA    . ASP E 3 25  ? 7.252   36.468  46.768  1.00 51.74  ? 25   ASP A CA    1 
ATOM   1045  C  C     . ASP E 3 25  ? 8.306   36.997  47.716  1.00 51.74  ? 25   ASP A C     1 
ATOM   1046  O  O     . ASP E 3 25  ? 9.286   36.325  47.992  1.00 51.74  ? 25   ASP A O     1 
ATOM   1047  C  CB    . ASP E 3 25  ? 6.454   35.367  47.469  1.00 58.92  ? 25   ASP A CB    1 
ATOM   1048  C  CG    . ASP E 3 25  ? 5.591   35.911  48.597  1.00 58.92  ? 25   ASP A CG    1 
ATOM   1049  O  OD1   . ASP E 3 25  ? 5.615   37.152  48.795  1.00 58.92  ? 25   ASP A OD1   1 
ATOM   1050  O  OD2   . ASP E 3 25  ? 4.892   35.111  49.272  1.00 58.92  ? 25   ASP A OD2   1 
ATOM   1051  N  N     . TYR E 3 26  ? 8.116   38.204  48.218  1.00 74.45  ? 26   TYR A N     1 
ATOM   1052  C  CA    . TYR E 3 26  ? 9.098   38.777  49.116  1.00 74.45  ? 26   TYR A CA    1 
ATOM   1053  C  C     . TYR E 3 26  ? 9.125   38.130  50.485  1.00 74.45  ? 26   TYR A C     1 
ATOM   1054  O  O     . TYR E 3 26  ? 10.175  38.087  51.127  1.00 74.45  ? 26   TYR A O     1 
ATOM   1055  C  CB    . TYR E 3 26  ? 8.880   40.281  49.259  1.00 75.17  ? 26   TYR A CB    1 
ATOM   1056  C  CG    . TYR E 3 26  ? 9.743   41.094  48.327  1.00 75.17  ? 26   TYR A CG    1 
ATOM   1057  C  CD1   . TYR E 3 26  ? 11.120  41.176  48.527  1.00 75.17  ? 26   TYR A CD1   1 
ATOM   1058  C  CD2   . TYR E 3 26  ? 9.201   41.745  47.219  1.00 75.17  ? 26   TYR A CD2   1 
ATOM   1059  C  CE1   . TYR E 3 26  ? 11.943  41.882  47.643  1.00 75.17  ? 26   TYR A CE1   1 
ATOM   1060  C  CE2   . TYR E 3 26  ? 10.019  42.457  46.327  1.00 75.17  ? 26   TYR A CE2   1 
ATOM   1061  C  CZ    . TYR E 3 26  ? 11.389  42.513  46.546  1.00 75.17  ? 26   TYR A CZ    1 
ATOM   1062  O  OH    . TYR E 3 26  ? 12.220  43.142  45.648  1.00 75.17  ? 26   TYR A OH    1 
ATOM   1063  N  N     . SER E 3 27  ? 7.992   37.612  50.941  1.00 54.08  ? 27   SER A N     1 
ATOM   1064  C  CA    . SER E 3 27  ? 7.973   37.000  52.253  1.00 54.08  ? 27   SER A CA    1 
ATOM   1065  C  C     . SER E 3 27  ? 8.519   35.573  52.233  1.00 54.08  ? 27   SER A C     1 
ATOM   1066  O  O     . SER E 3 27  ? 8.685   34.959  53.283  1.00 54.08  ? 27   SER A O     1 
ATOM   1067  C  CB    . SER E 3 27  ? 6.562   37.036  52.849  1.00 86.59  ? 27   SER A CB    1 
ATOM   1068  O  OG    . SER E 3 27  ? 5.657   36.238  52.109  1.00 86.59  ? 27   SER A OG    1 
ATOM   1069  N  N     . THR E 3 28  ? 8.840   35.063  51.048  1.00 52.10  ? 28   THR A N     1 
ATOM   1070  C  CA    . THR E 3 28  ? 9.359   33.698  50.897  1.00 52.10  ? 28   THR A CA    1 
ATOM   1071  C  C     . THR E 3 28  ? 10.766  33.640  50.264  1.00 52.10  ? 28   THR A C     1 
ATOM   1072  O  O     . THR E 3 28  ? 11.487  32.652  50.399  1.00 52.10  ? 28   THR A O     1 
ATOM   1073  C  CB    . THR E 3 28  ? 8.372   32.879  50.023  1.00 68.31  ? 28   THR A CB    1 
ATOM   1074  O  OG1   . THR E 3 28  ? 7.222   32.543  50.799  1.00 68.31  ? 28   THR A OG1   1 
ATOM   1075  C  CG2   . THR E 3 28  ? 8.999   31.617  49.502  1.00 68.31  ? 28   THR A CG2   1 
ATOM   1076  N  N     . ALA E 3 29  ? 11.140  34.705  49.567  1.00 73.87  ? 29   ALA A N     1 
ATOM   1077  C  CA    . ALA E 3 29  ? 12.425  34.780  48.895  1.00 73.87  ? 29   ALA A CA    1 
ATOM   1078  C  C     . ALA E 3 29  ? 12.570  33.686  47.849  1.00 73.87  ? 29   ALA A C     1 
ATOM   1079  O  O     . ALA E 3 29  ? 13.677  33.192  47.604  1.00 73.87  ? 29   ALA A O     1 
ATOM   1080  C  CB    . ALA E 3 29  ? 13.543  34.685  49.892  1.00 58.32  ? 29   ALA A CB    1 
ATOM   1081  N  N     . GLU E 3 30  ? 11.456  33.316  47.222  1.00 94.76  ? 30   GLU A N     1 
ATOM   1082  C  CA    . GLU E 3 30  ? 11.479  32.283  46.198  1.00 94.76  ? 30   GLU A CA    1 
ATOM   1083  C  C     . GLU E 3 30  ? 10.898  32.712  44.847  1.00 94.76  ? 30   GLU A C     1 
ATOM   1084  O  O     . GLU E 3 30  ? 10.188  33.712  44.754  1.00 94.76  ? 30   GLU A O     1 
ATOM   1085  C  CB    . GLU E 3 30  ? 10.767  31.038  46.712  1.00 112.08 ? 30   GLU A CB    1 
ATOM   1086  C  CG    . GLU E 3 30  ? 11.617  30.220  47.657  1.00 112.08 ? 30   GLU A CG    1 
ATOM   1087  C  CD    . GLU E 3 30  ? 10.925  28.950  48.091  1.00 112.08 ? 30   GLU A CD    1 
ATOM   1088  O  OE1   . GLU E 3 30  ? 10.334  28.270  47.220  1.00 112.08 ? 30   GLU A OE1   1 
ATOM   1089  O  OE2   . GLU E 3 30  ? 10.977  28.629  49.299  1.00 112.08 ? 30   GLU A OE2   1 
ATOM   1090  N  N     . TYR E 3 31  ? 11.237  31.954  43.803  1.00 45.24  ? 31   TYR A N     1 
ATOM   1091  C  CA    . TYR E 3 31  ? 10.765  32.200  42.446  1.00 45.24  ? 31   TYR A CA    1 
ATOM   1092  C  C     . TYR E 3 31  ? 9.984   30.989  41.973  1.00 45.24  ? 31   TYR A C     1 
ATOM   1093  O  O     . TYR E 3 31  ? 10.554  30.072  41.375  1.00 45.24  ? 31   TYR A O     1 
ATOM   1094  C  CB    . TYR E 3 31  ? 11.936  32.445  41.488  1.00 34.85  ? 31   TYR A CB    1 
ATOM   1095  C  CG    . TYR E 3 31  ? 12.633  33.762  41.692  1.00 34.85  ? 31   TYR A CG    1 
ATOM   1096  C  CD1   . TYR E 3 31  ? 13.158  34.096  42.935  1.00 34.85  ? 31   TYR A CD1   1 
ATOM   1097  C  CD2   . TYR E 3 31  ? 12.719  34.702  40.670  1.00 34.85  ? 31   TYR A CD2   1 
ATOM   1098  C  CE1   . TYR E 3 31  ? 13.745  35.339  43.166  1.00 34.85  ? 31   TYR A CE1   1 
ATOM   1099  C  CE2   . TYR E 3 31  ? 13.309  35.951  40.892  1.00 34.85  ? 31   TYR A CE2   1 
ATOM   1100  C  CZ    . TYR E 3 31  ? 13.815  36.258  42.151  1.00 34.85  ? 31   TYR A CZ    1 
ATOM   1101  O  OH    . TYR E 3 31  ? 14.359  37.488  42.437  1.00 34.85  ? 31   TYR A OH    1 
ATOM   1102  N  N     . VAL E 3 32  ? 8.682   30.987  42.238  1.00 52.51  ? 32   VAL A N     1 
ATOM   1103  C  CA    . VAL E 3 32  ? 7.802   29.892  41.845  1.00 52.51  ? 32   VAL A CA    1 
ATOM   1104  C  C     . VAL E 3 32  ? 7.413   29.996  40.384  1.00 52.51  ? 32   VAL A C     1 
ATOM   1105  O  O     . VAL E 3 32  ? 6.649   30.875  40.039  1.00 52.51  ? 32   VAL A O     1 
ATOM   1106  C  CB    . VAL E 3 32  ? 6.500   29.935  42.621  1.00 53.30  ? 32   VAL A CB    1 
ATOM   1107  C  CG1   . VAL E 3 32  ? 5.673   28.732  42.280  1.00 53.30  ? 32   VAL A CG1   1 
ATOM   1108  C  CG2   . VAL E 3 32  ? 6.773   30.009  44.093  1.00 53.30  ? 32   VAL A CG2   1 
ATOM   1109  N  N     . SER E 3 33  ? 7.900   29.114  39.518  1.00 71.89  ? 33   SER A N     1 
ATOM   1110  C  CA    . SER E 3 33  ? 7.517   29.208  38.105  1.00 71.89  ? 33   SER A CA    1 
ATOM   1111  C  C     . SER E 3 33  ? 6.203   28.501  37.762  1.00 71.89  ? 33   SER A C     1 
ATOM   1112  O  O     . SER E 3 33  ? 6.003   27.338  38.100  1.00 71.89  ? 33   SER A O     1 
ATOM   1113  C  CB    . SER E 3 33  ? 8.621   28.649  37.204  1.00 58.12  ? 33   SER A CB    1 
ATOM   1114  O  OG    . SER E 3 33  ? 9.795   29.427  37.289  1.00 58.12  ? 33   SER A OG    1 
ATOM   1115  N  N     . TYR E 3 34  ? 5.309   29.214  37.091  1.00 51.17  ? 34   TYR A N     1 
ATOM   1116  C  CA    . TYR E 3 34  ? 4.048   28.633  36.689  1.00 51.17  ? 34   TYR A CA    1 
ATOM   1117  C  C     . TYR E 3 34  ? 4.129   28.366  35.201  1.00 51.17  ? 34   TYR A C     1 
ATOM   1118  O  O     . TYR E 3 34  ? 4.597   29.206  34.449  1.00 51.17  ? 34   TYR A O     1 
ATOM   1119  C  CB    . TYR E 3 34  ? 2.906   29.596  36.988  1.00 51.37  ? 34   TYR A CB    1 
ATOM   1120  C  CG    . TYR E 3 34  ? 2.681   29.770  38.469  1.00 51.37  ? 34   TYR A CG    1 
ATOM   1121  C  CD1   . TYR E 3 34  ? 3.452   30.660  39.210  1.00 51.37  ? 34   TYR A CD1   1 
ATOM   1122  C  CD2   . TYR E 3 34  ? 1.769   28.968  39.146  1.00 51.37  ? 34   TYR A CD2   1 
ATOM   1123  C  CE1   . TYR E 3 34  ? 3.327   30.744  40.584  1.00 51.37  ? 34   TYR A CE1   1 
ATOM   1124  C  CE2   . TYR E 3 34  ? 1.640   29.038  40.517  1.00 51.37  ? 34   TYR A CE2   1 
ATOM   1125  C  CZ    . TYR E 3 34  ? 2.424   29.929  41.234  1.00 51.37  ? 34   TYR A CZ    1 
ATOM   1126  O  OH    . TYR E 3 34  ? 2.311   29.981  42.605  1.00 51.37  ? 34   TYR A OH    1 
ATOM   1127  N  N     . ARG E 3 35  ? 3.695   27.189  34.769  1.00 60.49  ? 35   ARG A N     1 
ATOM   1128  C  CA    . ARG E 3 35  ? 3.728   26.856  33.355  1.00 60.49  ? 35   ARG A CA    1 
ATOM   1129  C  C     . ARG E 3 35  ? 2.305   26.895  32.806  1.00 60.49  ? 35   ARG A C     1 
ATOM   1130  O  O     . ARG E 3 35  ? 1.344   26.999  33.571  1.00 60.49  ? 35   ARG A O     1 
ATOM   1131  C  CB    . ARG E 3 35  ? 4.371   25.482  33.162  1.00 63.83  ? 35   ARG A CB    1 
ATOM   1132  C  CG    . ARG E 3 35  ? 5.884   25.506  33.316  1.00 63.83  ? 35   ARG A CG    1 
ATOM   1133  C  CD    . ARG E 3 35  ? 6.546   24.227  32.804  1.00 63.83  ? 35   ARG A CD    1 
ATOM   1134  N  NE    . ARG E 3 35  ? 8.001   24.359  32.720  1.00 63.83  ? 35   ARG A NE    1 
ATOM   1135  C  CZ    . ARG E 3 35  ? 8.807   24.483  33.773  1.00 63.83  ? 35   ARG A CZ    1 
ATOM   1136  N  NH1   . ARG E 3 35  ? 8.303   24.488  35.007  1.00 63.83  ? 35   ARG A NH1   1 
ATOM   1137  N  NH2   . ARG E 3 35  ? 10.119  24.608  33.591  1.00 63.83  ? 35   ARG A NH2   1 
ATOM   1138  N  N     . PRO E 3 36  ? 2.149   26.799  31.477  1.00 62.39  ? 36   PRO A N     1 
ATOM   1139  C  CA    . PRO E 3 36  ? 0.845   26.835  30.817  1.00 62.39  ? 36   PRO A CA    1 
ATOM   1140  C  C     . PRO E 3 36  ? -0.283  26.114  31.547  1.00 62.39  ? 36   PRO A C     1 
ATOM   1141  O  O     . PRO E 3 36  ? -1.439  26.543  31.503  1.00 62.39  ? 36   PRO A O     1 
ATOM   1142  C  CB    . PRO E 3 36  ? 1.148   26.207  29.469  1.00 45.98  ? 36   PRO A CB    1 
ATOM   1143  C  CG    . PRO E 3 36  ? 2.554   26.600  29.217  1.00 45.98  ? 36   PRO A CG    1 
ATOM   1144  C  CD    . PRO E 3 36  ? 3.168   26.299  30.537  1.00 45.98  ? 36   PRO A CD    1 
ATOM   1145  N  N     . SER E 3 37  ? 0.055   25.011  32.205  1.00 70.73  ? 37   SER A N     1 
ATOM   1146  C  CA    . SER E 3 37  ? -0.940  24.231  32.938  1.00 70.73  ? 37   SER A CA    1 
ATOM   1147  C  C     . SER E 3 37  ? -1.199  24.869  34.290  1.00 70.73  ? 37   SER A C     1 
ATOM   1148  O  O     . SER E 3 37  ? -2.285  24.754  34.854  1.00 70.73  ? 37   SER A O     1 
ATOM   1149  C  CB    . SER E 3 37  ? -0.454  22.788  33.138  1.00 75.68  ? 37   SER A CB    1 
ATOM   1150  O  OG    . SER E 3 37  ? 0.685   22.730  33.980  1.00 75.68  ? 37   SER A OG    1 
ATOM   1151  N  N     . ASP E 3 38  ? -0.183  25.558  34.788  1.00 58.49  ? 38   ASP A N     1 
ATOM   1152  C  CA    . ASP E 3 38  ? -0.233  26.213  36.083  1.00 58.49  ? 38   ASP A CA    1 
ATOM   1153  C  C     . ASP E 3 38  ? -0.931  27.567  36.056  1.00 58.49  ? 38   ASP A C     1 
ATOM   1154  O  O     . ASP E 3 38  ? -1.136  28.184  37.101  1.00 58.49  ? 38   ASP A O     1 
ATOM   1155  C  CB    . ASP E 3 38  ? 1.194   26.377  36.599  1.00 68.69  ? 38   ASP A CB    1 
ATOM   1156  C  CG    . ASP E 3 38  ? 1.943   25.072  36.620  1.00 68.69  ? 38   ASP A CG    1 
ATOM   1157  O  OD1   . ASP E 3 38  ? 1.540   24.189  37.402  1.00 68.69  ? 38   ASP A OD1   1 
ATOM   1158  O  OD2   . ASP E 3 38  ? 2.917   24.916  35.853  1.00 68.69  ? 38   ASP A OD2   1 
ATOM   1159  N  N     . PHE E 3 39  ? -1.301  28.026  34.866  1.00 57.51  ? 39   PHE A N     1 
ATOM   1160  C  CA    . PHE E 3 39  ? -1.958  29.321  34.738  1.00 57.51  ? 39   PHE A CA    1 
ATOM   1161  C  C     . PHE E 3 39  ? -2.975  29.534  35.839  1.00 57.51  ? 39   PHE A C     1 
ATOM   1162  O  O     . PHE E 3 39  ? -2.865  30.479  36.618  1.00 57.51  ? 39   PHE A O     1 
ATOM   1163  C  CB    . PHE E 3 39  ? -2.637  29.463  33.369  1.00 67.72  ? 39   PHE A CB    1 
ATOM   1164  C  CG    . PHE E 3 39  ? -3.312  30.799  33.152  1.00 67.72  ? 39   PHE A CG    1 
ATOM   1165  C  CD1   . PHE E 3 39  ? -2.769  31.966  33.666  1.00 67.72  ? 39   PHE A CD1   1 
ATOM   1166  C  CD2   . PHE E 3 39  ? -4.464  30.892  32.389  1.00 67.72  ? 39   PHE A CD2   1 
ATOM   1167  C  CE1   . PHE E 3 39  ? -3.357  33.204  33.420  1.00 67.72  ? 39   PHE A CE1   1 
ATOM   1168  C  CE2   . PHE E 3 39  ? -5.056  32.123  32.138  1.00 67.72  ? 39   PHE A CE2   1 
ATOM   1169  C  CZ    . PHE E 3 39  ? -4.500  33.278  32.654  1.00 67.72  ? 39   PHE A CZ    1 
ATOM   1170  N  N     . GLY E 3 40  ? -3.963  28.654  35.911  1.00 58.04  ? 40   GLY A N     1 
ATOM   1171  C  CA    . GLY E 3 40  ? -4.975  28.791  36.940  1.00 58.04  ? 40   GLY A CA    1 
ATOM   1172  C  C     . GLY E 3 40  ? -4.371  29.018  38.313  1.00 58.04  ? 40   GLY A C     1 
ATOM   1173  O  O     . GLY E 3 40  ? -4.889  29.811  39.097  1.00 58.04  ? 40   GLY A O     1 
ATOM   1174  N  N     . ALA E 3 41  ? -3.273  28.316  38.591  1.00 53.88  ? 41   ALA A N     1 
ATOM   1175  C  CA    . ALA E 3 41  ? -2.562  28.422  39.861  1.00 53.88  ? 41   ALA A CA    1 
ATOM   1176  C  C     . ALA E 3 41  ? -1.909  29.791  39.959  1.00 53.88  ? 41   ALA A C     1 
ATOM   1177  O  O     . ALA E 3 41  ? -1.931  30.427  41.016  1.00 53.88  ? 41   ALA A O     1 
ATOM   1178  C  CB    . ALA E 3 41  ? -1.506  27.340  39.958  1.00 107.71 ? 41   ALA A CB    1 
ATOM   1179  N  N     . TYR E 3 42  ? -1.310  30.230  38.852  1.00 45.54  ? 42   TYR A N     1 
ATOM   1180  C  CA    . TYR E 3 42  ? -0.670  31.533  38.789  1.00 45.54  ? 42   TYR A CA    1 
ATOM   1181  C  C     . TYR E 3 42  ? -1.702  32.537  39.218  1.00 45.54  ? 42   TYR A C     1 
ATOM   1182  O  O     . TYR E 3 42  ? -1.444  33.357  40.083  1.00 45.54  ? 42   TYR A O     1 
ATOM   1183  C  CB    . TYR E 3 42  ? -0.251  31.856  37.375  1.00 40.78  ? 42   TYR A CB    1 
ATOM   1184  C  CG    . TYR E 3 42  ? 0.264   33.263  37.198  1.00 40.78  ? 42   TYR A CG    1 
ATOM   1185  C  CD1   . TYR E 3 42  ? 1.560   33.615  37.595  1.00 40.78  ? 42   TYR A CD1   1 
ATOM   1186  C  CD2   . TYR E 3 42  ? -0.539  34.249  36.627  1.00 40.78  ? 42   TYR A CD2   1 
ATOM   1187  C  CE1   . TYR E 3 42  ? 2.043   34.908  37.427  1.00 40.78  ? 42   TYR A CE1   1 
ATOM   1188  C  CE2   . TYR E 3 42  ? -0.056  35.549  36.457  1.00 40.78  ? 42   TYR A CE2   1 
ATOM   1189  C  CZ    . TYR E 3 42  ? 1.236   35.867  36.862  1.00 40.78  ? 42   TYR A CZ    1 
ATOM   1190  O  OH    . TYR E 3 42  ? 1.693   37.149  36.710  1.00 40.78  ? 42   TYR A OH    1 
ATOM   1191  N  N     . LEU E 3 43  ? -2.879  32.478  38.610  1.00 61.14  ? 43   LEU A N     1 
ATOM   1192  C  CA    . LEU E 3 43  ? -3.942  33.398  38.975  1.00 61.14  ? 43   LEU A CA    1 
ATOM   1193  C  C     . LEU E 3 43  ? -4.255  33.291  40.455  1.00 61.14  ? 43   LEU A C     1 
ATOM   1194  O  O     . LEU E 3 43  ? -4.501  34.301  41.114  1.00 61.14  ? 43   LEU A O     1 
ATOM   1195  C  CB    . LEU E 3 43  ? -5.211  33.110  38.182  1.00 45.02  ? 43   LEU A CB    1 
ATOM   1196  C  CG    . LEU E 3 43  ? -5.229  33.509  36.713  1.00 45.02  ? 43   LEU A CG    1 
ATOM   1197  C  CD1   . LEU E 3 43  ? -6.514  33.044  36.072  1.00 45.02  ? 43   LEU A CD1   1 
ATOM   1198  C  CD2   . LEU E 3 43  ? -5.096  34.991  36.610  1.00 45.02  ? 43   LEU A CD2   1 
ATOM   1199  N  N     . ASP E 3 44  ? -4.255  32.065  40.974  1.00 49.93  ? 44   ASP A N     1 
ATOM   1200  C  CA    . ASP E 3 44  ? -4.540  31.824  42.393  1.00 49.93  ? 44   ASP A CA    1 
ATOM   1201  C  C     . ASP E 3 44  ? -3.527  32.498  43.313  1.00 49.93  ? 44   ASP A C     1 
ATOM   1202  O  O     . ASP E 3 44  ? -3.905  33.110  44.314  1.00 49.93  ? 44   ASP A O     1 
ATOM   1203  C  CB    . ASP E 3 44  ? -4.575  30.321  42.674  1.00 67.75  ? 44   ASP A CB    1 
ATOM   1204  C  CG    . ASP E 3 44  ? -5.898  29.695  42.288  1.00 67.75  ? 44   ASP A CG    1 
ATOM   1205  O  OD1   . ASP E 3 44  ? -6.724  30.414  41.685  1.00 67.75  ? 44   ASP A OD1   1 
ATOM   1206  O  OD2   . ASP E 3 44  ? -6.115  28.498  42.586  1.00 67.75  ? 44   ASP A OD2   1 
ATOM   1207  N  N     . ALA E 3 45  ? -2.247  32.374  42.958  1.00 42.04  ? 45   ALA A N     1 
ATOM   1208  C  CA    . ALA E 3 45  ? -1.129  32.963  43.699  1.00 42.04  ? 45   ALA A CA    1 
ATOM   1209  C  C     . ALA E 3 45  ? -1.288  34.472  43.904  1.00 42.04  ? 45   ALA A C     1 
ATOM   1210  O  O     . ALA E 3 45  ? -1.177  34.972  45.029  1.00 42.04  ? 45   ALA A O     1 
ATOM   1211  C  CB    . ALA E 3 45  ? 0.170   32.693  42.949  1.00 46.29  ? 45   ALA A CB    1 
ATOM   1212  N  N     . LEU E 3 46  ? -1.513  35.184  42.802  1.00 51.51  ? 46   LEU A N     1 
ATOM   1213  C  CA    . LEU E 3 46  ? -1.698  36.630  42.820  1.00 51.51  ? 46   LEU A CA    1 
ATOM   1214  C  C     . LEU E 3 46  ? -2.963  36.983  43.573  1.00 51.51  ? 46   LEU A C     1 
ATOM   1215  O  O     . LEU E 3 46  ? -2.999  37.917  44.358  1.00 51.51  ? 46   LEU A O     1 
ATOM   1216  C  CB    . LEU E 3 46  ? -1.880  37.183  41.416  1.00 40.03  ? 46   LEU A CB    1 
ATOM   1217  C  CG    . LEU E 3 46  ? -0.993  36.755  40.274  1.00 40.03  ? 46   LEU A CG    1 
ATOM   1218  C  CD1   . LEU E 3 46  ? -1.358  37.586  39.072  1.00 40.03  ? 46   LEU A CD1   1 
ATOM   1219  C  CD2   . LEU E 3 46  ? 0.451   36.948  40.641  1.00 40.03  ? 46   LEU A CD2   1 
ATOM   1220  N  N     . GLU E 3 47  ? -4.023  36.252  43.282  1.00 44.08  ? 47   GLU A N     1 
ATOM   1221  C  CA    . GLU E 3 47  ? -5.292  36.497  43.924  1.00 44.08  ? 47   GLU A CA    1 
ATOM   1222  C  C     . GLU E 3 47  ? -5.101  36.305  45.422  1.00 44.08  ? 47   GLU A C     1 
ATOM   1223  O  O     . GLU E 3 47  ? -5.903  36.777  46.221  1.00 44.08  ? 47   GLU A O     1 
ATOM   1224  C  CB    . GLU E 3 47  ? -6.330  35.522  43.374  1.00 85.25  ? 47   GLU A CB    1 
ATOM   1225  C  CG    . GLU E 3 47  ? -7.740  36.065  43.280  1.00 85.25  ? 47   GLU A CG    1 
ATOM   1226  C  CD    . GLU E 3 47  ? -8.679  35.088  42.593  1.00 85.25  ? 47   GLU A CD    1 
ATOM   1227  O  OE1   . GLU E 3 47  ? -8.913  33.986  43.144  1.00 85.25  ? 47   GLU A OE1   1 
ATOM   1228  O  OE2   . GLU E 3 47  ? -9.175  35.424  41.497  1.00 85.25  ? 47   GLU A OE2   1 
ATOM   1229  N  N     . ALA E 3 48  ? -4.030  35.615  45.794  1.00 45.46  ? 48   ALA A N     1 
ATOM   1230  C  CA    . ALA E 3 48  ? -3.716  35.362  47.204  1.00 45.46  ? 48   ALA A CA    1 
ATOM   1231  C  C     . ALA E 3 48  ? -3.177  36.613  47.920  1.00 45.46  ? 48   ALA A C     1 
ATOM   1232  O  O     . ALA E 3 48  ? -3.576  36.919  49.039  1.00 45.46  ? 48   ALA A O     1 
ATOM   1233  C  CB    . ALA E 3 48  ? -2.703  34.233  47.314  1.00 117.92 ? 48   ALA A CB    1 
ATOM   1234  N  N     . GLU E 3 49  ? -2.252  37.316  47.273  1.00 57.93  ? 49   GLU A N     1 
ATOM   1235  C  CA    . GLU E 3 49  ? -1.673  38.537  47.814  1.00 57.93  ? 49   GLU A CA    1 
ATOM   1236  C  C     . GLU E 3 49  ? -2.789  39.520  48.109  1.00 57.93  ? 49   GLU A C     1 
ATOM   1237  O  O     . GLU E 3 49  ? -2.808  40.151  49.154  1.00 57.93  ? 49   GLU A O     1 
ATOM   1238  C  CB    . GLU E 3 49  ? -0.711  39.155  46.789  1.00 70.27  ? 49   GLU A CB    1 
ATOM   1239  C  CG    . GLU E 3 49  ? 0.754   38.889  47.059  1.00 70.27  ? 49   GLU A CG    1 
ATOM   1240  C  CD    . GLU E 3 49  ? 1.291   39.708  48.228  1.00 70.27  ? 49   GLU A CD    1 
ATOM   1241  O  OE1   . GLU E 3 49  ? 1.891   39.113  49.155  1.00 70.27  ? 49   GLU A OE1   1 
ATOM   1242  O  OE2   . GLU E 3 49  ? 1.119   40.951  48.216  1.00 70.27  ? 49   GLU A OE2   1 
ATOM   1243  N  N     . VAL E 3 50  ? -3.717  39.638  47.166  1.00 62.78  ? 50   VAL A N     1 
ATOM   1244  C  CA    . VAL E 3 50  ? -4.833  40.552  47.290  1.00 62.78  ? 50   VAL A CA    1 
ATOM   1245  C  C     . VAL E 3 50  ? -5.621  40.235  48.539  1.00 62.78  ? 50   VAL A C     1 
ATOM   1246  O  O     . VAL E 3 50  ? -6.178  41.128  49.168  1.00 62.78  ? 50   VAL A O     1 
ATOM   1247  C  CB    . VAL E 3 50  ? -5.745  40.468  46.075  1.00 108.80 ? 50   VAL A CB    1 
ATOM   1248  C  CG1   . VAL E 3 50  ? -6.689  41.650  46.064  1.00 108.80 ? 50   VAL A CG1   1 
ATOM   1249  C  CG2   . VAL E 3 50  ? -4.909  40.441  44.810  1.00 108.80 ? 50   VAL A CG2   1 
ATOM   1250  N  N     . ALA E 3 51  ? -5.657  38.962  48.908  1.00 60.27  ? 51   ALA A N     1 
ATOM   1251  C  CA    . ALA E 3 51  ? -6.368  38.540  50.113  1.00 60.27  ? 51   ALA A CA    1 
ATOM   1252  C  C     . ALA E 3 51  ? -5.625  39.061  51.328  1.00 60.27  ? 51   ALA A C     1 
ATOM   1253  O  O     . ALA E 3 51  ? -6.242  39.514  52.290  1.00 60.27  ? 51   ALA A O     1 
ATOM   1254  C  CB    . ALA E 3 51  ? -6.458  37.021  50.176  1.00 96.04  ? 51   ALA A CB    1 
ATOM   1255  N  N     . ARG E 3 52  ? -4.295  38.990  51.275  1.00 51.54  ? 52   ARG A N     1 
ATOM   1256  C  CA    . ARG E 3 52  ? -3.452  39.455  52.369  1.00 51.54  ? 52   ARG A CA    1 
ATOM   1257  C  C     . ARG E 3 52  ? -3.553  40.956  52.432  1.00 51.54  ? 52   ARG A C     1 
ATOM   1258  O  O     . ARG E 3 52  ? -3.305  41.553  53.469  1.00 51.54  ? 52   ARG A O     1 
ATOM   1259  C  CB    . ARG E 3 52  ? -1.982  39.096  52.138  1.00 75.75  ? 52   ARG A CB    1 
ATOM   1260  C  CG    . ARG E 3 52  ? -1.710  37.634  51.913  1.00 75.75  ? 52   ARG A CG    1 
ATOM   1261  C  CD    . ARG E 3 52  ? -0.227  37.328  51.932  1.00 75.75  ? 52   ARG A CD    1 
ATOM   1262  N  NE    . ARG E 3 52  ? 0.021   35.949  51.522  1.00 75.75  ? 52   ARG A NE    1 
ATOM   1263  C  CZ    . ARG E 3 52  ? 0.295   35.567  50.276  1.00 75.75  ? 52   ARG A CZ    1 
ATOM   1264  N  NH1   . ARG E 3 52  ? 0.376   36.460  49.295  1.00 75.75  ? 52   ARG A NH1   1 
ATOM   1265  N  NH2   . ARG E 3 52  ? 0.456   34.279  50.005  1.00 75.75  ? 52   ARG A NH2   1 
ATOM   1266  N  N     . GLY E 3 53  ? -3.937  41.564  51.318  1.00 63.88  ? 53   GLY A N     1 
ATOM   1267  C  CA    . GLY E 3 53  ? -4.005  43.007  51.271  1.00 63.88  ? 53   GLY A CA    1 
ATOM   1268  C  C     . GLY E 3 53  ? -2.563  43.390  51.011  1.00 63.88  ? 53   GLY A C     1 
ATOM   1269  O  O     . GLY E 3 53  ? -2.032  44.332  51.599  1.00 63.88  ? 53   GLY A O     1 
ATOM   1270  N  N     . GLY E 3 54  ? -1.924  42.623  50.128  1.00 59.37  ? 54   GLY A N     1 
ATOM   1271  C  CA    . GLY E 3 54  ? -0.536  42.858  49.775  1.00 59.37  ? 54   GLY A CA    1 
ATOM   1272  C  C     . GLY E 3 54  ? -0.357  43.725  48.544  1.00 59.37  ? 54   GLY A C     1 
ATOM   1273  O  O     . GLY E 3 54  ? -1.261  44.450  48.141  1.00 59.37  ? 54   GLY A O     1 
ATOM   1274  N  N     . LEU E 3 55  ? 0.820   43.649  47.943  1.00 49.63  ? 55   LEU A N     1 
ATOM   1275  C  CA    . LEU E 3 55  ? 1.106   44.438  46.769  1.00 49.63  ? 55   LEU A CA    1 
ATOM   1276  C  C     . LEU E 3 55  ? 1.723   43.582  45.680  1.00 49.63  ? 55   LEU A C     1 
ATOM   1277  O  O     . LEU E 3 55  ? 2.628   42.790  45.964  1.00 49.63  ? 55   LEU A O     1 
ATOM   1278  C  CB    . LEU E 3 55  ? 2.050   45.574  47.143  1.00 22.59  ? 55   LEU A CB    1 
ATOM   1279  C  CG    . LEU E 3 55  ? 1.384   46.807  47.747  1.00 22.59  ? 55   LEU A CG    1 
ATOM   1280  C  CD1   . LEU E 3 55  ? 2.394   47.662  48.435  1.00 22.59  ? 55   LEU A CD1   1 
ATOM   1281  C  CD2   . LEU E 3 55  ? 0.710   47.614  46.632  1.00 22.59  ? 55   LEU A CD2   1 
ATOM   1282  N  N     . ILE E 3 56  ? 1.220   43.723  44.445  1.00 39.83  ? 56   ILE A N     1 
ATOM   1283  C  CA    . ILE E 3 56  ? 1.764   42.972  43.307  1.00 39.83  ? 56   ILE A CA    1 
ATOM   1284  C  C     . ILE E 3 56  ? 2.503   43.934  42.393  1.00 39.83  ? 56   ILE A C     1 
ATOM   1285  O  O     . ILE E 3 56  ? 1.931   44.943  41.969  1.00 39.83  ? 56   ILE A O     1 
ATOM   1286  C  CB    . ILE E 3 56  ? 0.691   42.310  42.480  1.00 46.47  ? 56   ILE A CB    1 
ATOM   1287  C  CG1   . ILE E 3 56  ? -0.289  41.560  43.387  1.00 46.47  ? 56   ILE A CG1   1 
ATOM   1288  C  CG2   . ILE E 3 56  ? 1.355   41.367  41.507  1.00 46.47  ? 56   ILE A CG2   1 
ATOM   1289  C  CD1   . ILE E 3 56  ? -1.508  40.959  42.661  1.00 46.47  ? 56   ILE A CD1   1 
ATOM   1290  N  N     . VAL E 3 57  ? 3.766   43.626  42.088  1.00 27.96  ? 57   VAL A N     1 
ATOM   1291  C  CA    . VAL E 3 57  ? 4.567   44.502  41.243  1.00 27.96  ? 57   VAL A CA    1 
ATOM   1292  C  C     . VAL E 3 57  ? 4.764   43.884  39.891  1.00 27.96  ? 57   VAL A C     1 
ATOM   1293  O  O     . VAL E 3 57  ? 5.091   42.708  39.810  1.00 27.96  ? 57   VAL A O     1 
ATOM   1294  C  CB    . VAL E 3 57  ? 5.933   44.766  41.866  1.00 49.51  ? 57   VAL A CB    1 
ATOM   1295  C  CG1   . VAL E 3 57  ? 6.541   46.033  41.280  1.00 49.51  ? 57   VAL A CG1   1 
ATOM   1296  C  CG2   . VAL E 3 57  ? 5.792   44.877  43.382  1.00 49.51  ? 57   VAL A CG2   1 
ATOM   1297  N  N     . PHE E 3 58  ? 4.550   44.679  38.840  1.00 32.38  ? 58   PHE A N     1 
ATOM   1298  C  CA    . PHE E 3 58  ? 4.672   44.253  37.432  1.00 32.38  ? 58   PHE A CA    1 
ATOM   1299  C  C     . PHE E 3 58  ? 5.448   45.346  36.716  1.00 32.38  ? 58   PHE A C     1 
ATOM   1300  O  O     . PHE E 3 58  ? 5.492   46.482  37.197  1.00 32.38  ? 58   PHE A O     1 
ATOM   1301  C  CB    . PHE E 3 58  ? 3.294   44.200  36.745  1.00 42.27  ? 58   PHE A CB    1 
ATOM   1302  C  CG    . PHE E 3 58  ? 2.578   42.886  36.855  1.00 42.27  ? 58   PHE A CG    1 
ATOM   1303  C  CD1   . PHE E 3 58  ? 3.046   41.768  36.188  1.00 42.27  ? 58   PHE A CD1   1 
ATOM   1304  C  CD2   . PHE E 3 58  ? 1.424   42.774  37.627  1.00 42.27  ? 58   PHE A CD2   1 
ATOM   1305  C  CE1   . PHE E 3 58  ? 2.376   40.556  36.292  1.00 42.27  ? 58   PHE A CE1   1 
ATOM   1306  C  CE2   . PHE E 3 58  ? 0.746   41.563  37.738  1.00 42.27  ? 58   PHE A CE2   1 
ATOM   1307  C  CZ    . PHE E 3 58  ? 1.219   40.454  37.074  1.00 42.27  ? 58   PHE A CZ    1 
ATOM   1308  N  N     . HIS E 3 59  ? 6.052   45.040  35.571  1.00 33.30  ? 59   HIS A N     1 
ATOM   1309  C  CA    . HIS E 3 59  ? 6.748   46.094  34.838  1.00 33.30  ? 59   HIS A CA    1 
ATOM   1310  C  C     . HIS E 3 59  ? 5.851   46.409  33.651  1.00 33.30  ? 59   HIS A C     1 
ATOM   1311  O  O     . HIS E 3 59  ? 5.789   45.627  32.706  1.00 33.30  ? 59   HIS A O     1 
ATOM   1312  C  CB    . HIS E 3 59  ? 8.125   45.637  34.354  1.00 35.84  ? 59   HIS A CB    1 
ATOM   1313  C  CG    . HIS E 3 59  ? 8.901   46.717  33.661  1.00 35.84  ? 59   HIS A CG    1 
ATOM   1314  N  ND1   . HIS E 3 59  ? 9.346   47.851  34.310  1.00 35.84  ? 59   HIS A ND1   1 
ATOM   1315  C  CD2   . HIS E 3 59  ? 9.251   46.868  32.363  1.00 35.84  ? 59   HIS A CD2   1 
ATOM   1316  C  CE1   . HIS E 3 59  ? 9.928   48.656  33.440  1.00 35.84  ? 59   HIS A CE1   1 
ATOM   1317  N  NE2   . HIS E 3 59  ? 9.884   48.083  32.251  1.00 35.84  ? 59   HIS A NE2   1 
ATOM   1318  N  N     . ASN E 3 60  ? 5.148   47.540  33.707  1.00 52.08  ? 60   ASN A N     1 
ATOM   1319  C  CA    . ASN E 3 60  ? 4.198   47.947  32.656  1.00 52.08  ? 60   ASN A CA    1 
ATOM   1320  C  C     . ASN E 3 60  ? 2.975   47.045  32.731  1.00 52.08  ? 60   ASN A C     1 
ATOM   1321  O  O     . ASN E 3 60  ? 2.235   46.906  31.772  1.00 52.08  ? 60   ASN A O     1 
ATOM   1322  C  CB    . ASN E 3 60  ? 4.820   47.832  31.265  1.00 34.93  ? 60   ASN A CB    1 
ATOM   1323  C  CG    . ASN E 3 60  ? 3.843   48.168  30.153  1.00 34.93  ? 60   ASN A CG    1 
ATOM   1324  O  OD1   . ASN E 3 60  ? 3.368   49.294  30.046  1.00 34.93  ? 60   ASN A OD1   1 
ATOM   1325  N  ND2   . ASN E 3 60  ? 3.548   47.184  29.313  1.00 34.93  ? 60   ASN A ND2   1 
ATOM   1326  N  N     . GLY E 3 61  ? 2.780   46.425  33.886  1.00 48.68  ? 61   GLY A N     1 
ATOM   1327  C  CA    . GLY E 3 61  ? 1.654   45.540  34.060  1.00 48.68  ? 61   GLY A CA    1 
ATOM   1328  C  C     . GLY E 3 61  ? 0.352   46.299  34.031  1.00 48.68  ? 61   GLY A C     1 
ATOM   1329  O  O     . GLY E 3 61  ? -0.700  45.724  33.760  1.00 48.68  ? 61   GLY A O     1 
ATOM   1330  N  N     . HIS E 3 62  ? 0.416   47.592  34.319  1.00 52.30  ? 62   HIS A N     1 
ATOM   1331  C  CA    . HIS E 3 62  ? -0.781  48.423  34.307  1.00 52.30  ? 62   HIS A CA    1 
ATOM   1332  C  C     . HIS E 3 62  ? -1.442  48.474  32.949  1.00 52.30  ? 62   HIS A C     1 
ATOM   1333  O  O     . HIS E 3 62  ? -2.664  48.456  32.852  1.00 52.30  ? 62   HIS A O     1 
ATOM   1334  C  CB    . HIS E 3 62  ? -0.462  49.840  34.750  1.00 45.65  ? 62   HIS A CB    1 
ATOM   1335  C  CG    . HIS E 3 62  ? -0.763  50.089  36.191  1.00 45.65  ? 62   HIS A CG    1 
ATOM   1336  N  ND1   . HIS E 3 62  ? -0.397  49.209  37.185  1.00 45.65  ? 62   HIS A ND1   1 
ATOM   1337  C  CD2   . HIS E 3 62  ? -1.429  51.097  36.802  1.00 45.65  ? 62   HIS A CD2   1 
ATOM   1338  C  CE1   . HIS E 3 62  ? -0.830  49.662  38.347  1.00 45.65  ? 62   HIS A CE1   1 
ATOM   1339  N  NE2   . HIS E 3 62  ? -1.459  50.805  38.143  1.00 45.65  ? 62   HIS A NE2   1 
ATOM   1340  N  N     . LYS E 3 63  ? -0.621  48.522  31.905  1.00 32.45  ? 63   LYS A N     1 
ATOM   1341  C  CA    . LYS E 3 63  ? -1.087  48.589  30.543  1.00 32.45  ? 63   LYS A CA    1 
ATOM   1342  C  C     . LYS E 3 63  ? -1.047  47.223  29.883  1.00 32.45  ? 63   LYS A C     1 
ATOM   1343  O  O     . LYS E 3 63  ? -1.369  47.103  28.717  1.00 32.45  ? 63   LYS A O     1 
ATOM   1344  C  CB    . LYS E 3 63  ? -0.219  49.595  29.781  1.00 51.35  ? 63   LYS A CB    1 
ATOM   1345  C  CG    . LYS E 3 63  ? -0.740  50.032  28.433  1.00 51.35  ? 63   LYS A CG    1 
ATOM   1346  C  CD    . LYS E 3 63  ? -0.527  51.539  28.162  1.00 51.35  ? 63   LYS A CD    1 
ATOM   1347  C  CE    . LYS E 3 63  ? 0.962   51.940  27.943  1.00 51.35  ? 63   LYS A CE    1 
ATOM   1348  N  NZ    . LYS E 3 63  ? 1.242   53.433  27.842  1.00 51.35  ? 63   LYS A NZ    1 
ATOM   1349  N  N     . TYR E 3 64  ? -0.671  46.175  30.602  1.00 39.24  ? 64   TYR A N     1 
ATOM   1350  C  CA    . TYR E 3 64  ? -0.619  44.870  29.948  1.00 39.24  ? 64   TYR A CA    1 
ATOM   1351  C  C     . TYR E 3 64  ? -0.831  43.632  30.809  1.00 39.24  ? 64   TYR A C     1 
ATOM   1352  O  O     . TYR E 3 64  ? -1.931  43.081  30.894  1.00 39.24  ? 64   TYR A O     1 
ATOM   1353  C  CB    . TYR E 3 64  ? 0.715   44.715  29.232  1.00 45.29  ? 64   TYR A CB    1 
ATOM   1354  C  CG    . TYR E 3 64  ? 0.877   43.402  28.515  1.00 45.29  ? 64   TYR A CG    1 
ATOM   1355  C  CD1   . TYR E 3 64  ? 0.132   43.124  27.389  1.00 45.29  ? 64   TYR A CD1   1 
ATOM   1356  C  CD2   . TYR E 3 64  ? 1.790   42.445  28.947  1.00 45.29  ? 64   TYR A CD2   1 
ATOM   1357  C  CE1   . TYR E 3 64  ? 0.287   41.927  26.694  1.00 45.29  ? 64   TYR A CE1   1 
ATOM   1358  C  CE2   . TYR E 3 64  ? 1.952   41.235  28.257  1.00 45.29  ? 64   TYR A CE2   1 
ATOM   1359  C  CZ    . TYR E 3 64  ? 1.194   40.992  27.126  1.00 45.29  ? 64   TYR A CZ    1 
ATOM   1360  O  OH    . TYR E 3 64  ? 1.344   39.846  26.383  1.00 45.29  ? 64   TYR A OH    1 
ATOM   1361  N  N     . ASP E 3 65  ? 0.243   43.178  31.439  1.00 52.51  ? 65   ASP A N     1 
ATOM   1362  C  CA    . ASP E 3 65  ? 0.162   41.979  32.243  1.00 52.51  ? 65   ASP A CA    1 
ATOM   1363  C  C     . ASP E 3 65  ? -1.120  41.922  33.042  1.00 52.51  ? 65   ASP A C     1 
ATOM   1364  O  O     . ASP E 3 65  ? -1.747  40.869  33.144  1.00 52.51  ? 65   ASP A O     1 
ATOM   1365  C  CB    . ASP E 3 65  ? 1.397   41.873  33.121  1.00 71.95  ? 65   ASP A CB    1 
ATOM   1366  C  CG    . ASP E 3 65  ? 2.659   41.918  32.304  1.00 71.95  ? 65   ASP A CG    1 
ATOM   1367  O  OD1   . ASP E 3 65  ? 3.079   43.039  31.959  1.00 71.95  ? 65   ASP A OD1   1 
ATOM   1368  O  OD2   . ASP E 3 65  ? 3.211   40.843  31.972  1.00 71.95  ? 65   ASP A OD2   1 
ATOM   1369  N  N     . VAL E 3 66  ? -1.543  43.061  33.568  1.00 42.84  ? 66   VAL A N     1 
ATOM   1370  C  CA    . VAL E 3 66  ? -2.758  43.082  34.345  1.00 42.84  ? 66   VAL A CA    1 
ATOM   1371  C  C     . VAL E 3 66  ? -4.048  42.959  33.544  1.00 42.84  ? 66   VAL A C     1 
ATOM   1372  O  O     . VAL E 3 66  ? -4.888  42.119  33.850  1.00 42.84  ? 66   VAL A O     1 
ATOM   1373  C  CB    . VAL E 3 66  ? -2.841  44.322  35.199  1.00 30.26  ? 66   VAL A CB    1 
ATOM   1374  C  CG1   . VAL E 3 66  ? -4.282  44.711  35.377  1.00 30.26  ? 66   VAL A CG1   1 
ATOM   1375  C  CG2   . VAL E 3 66  ? -2.258  44.035  36.556  1.00 30.26  ? 66   VAL A CG2   1 
ATOM   1376  N  N     . PRO E 3 67  ? -4.248  43.809  32.531  1.00 54.18  ? 67   PRO A N     1 
ATOM   1377  C  CA    . PRO E 3 67  ? -5.491  43.662  31.789  1.00 54.18  ? 67   PRO A CA    1 
ATOM   1378  C  C     . PRO E 3 67  ? -5.467  42.478  30.855  1.00 54.18  ? 67   PRO A C     1 
ATOM   1379  O  O     . PRO E 3 67  ? -6.501  42.097  30.326  1.00 54.18  ? 67   PRO A O     1 
ATOM   1380  C  CB    . PRO E 3 67  ? -5.586  44.969  31.031  1.00 59.97  ? 67   PRO A CB    1 
ATOM   1381  C  CG    . PRO E 3 67  ? -4.190  45.278  30.749  1.00 59.97  ? 67   PRO A CG    1 
ATOM   1382  C  CD    . PRO E 3 67  ? -3.546  45.022  32.091  1.00 59.97  ? 67   PRO A CD    1 
ATOM   1383  N  N     . ALA E 3 68  ? -4.289  41.896  30.647  1.00 48.21  ? 68   ALA A N     1 
ATOM   1384  C  CA    . ALA E 3 68  ? -4.159  40.755  29.744  1.00 48.21  ? 68   ALA A CA    1 
ATOM   1385  C  C     . ALA E 3 68  ? -4.479  39.485  30.476  1.00 48.21  ? 68   ALA A C     1 
ATOM   1386  O  O     . ALA E 3 68  ? -4.721  38.456  29.869  1.00 48.21  ? 68   ALA A O     1 
ATOM   1387  C  CB    . ALA E 3 68  ? -2.757  40.677  29.166  1.00 29.01  ? 68   ALA A CB    1 
ATOM   1388  N  N     . LEU E 3 69  ? -4.463  39.552  31.795  1.00 44.46  ? 69   LEU A N     1 
ATOM   1389  C  CA    . LEU E 3 69  ? -4.787  38.382  32.584  1.00 44.46  ? 69   LEU A CA    1 
ATOM   1390  C  C     . LEU E 3 69  ? -6.291  38.344  32.734  1.00 44.46  ? 69   LEU A C     1 
ATOM   1391  O  O     . LEU E 3 69  ? -6.888  37.275  32.702  1.00 44.46  ? 69   LEU A O     1 
ATOM   1392  C  CB    . LEU E 3 69  ? -4.108  38.452  33.948  1.00 48.68  ? 69   LEU A CB    1 
ATOM   1393  C  CG    . LEU E 3 69  ? -2.614  38.161  33.948  1.00 48.68  ? 69   LEU A CG    1 
ATOM   1394  C  CD1   . LEU E 3 69  ? -2.104  38.145  35.353  1.00 48.68  ? 69   LEU A CD1   1 
ATOM   1395  C  CD2   . LEU E 3 69  ? -2.388  36.819  33.314  1.00 48.68  ? 69   LEU A CD2   1 
ATOM   1396  N  N     . THR E 3 70  ? -6.904  39.515  32.896  1.00 32.65  ? 70   THR A N     1 
ATOM   1397  C  CA    . THR E 3 70  ? -8.360  39.573  33.006  1.00 32.65  ? 70   THR A CA    1 
ATOM   1398  C  C     . THR E 3 70  ? -8.903  38.958  31.725  1.00 32.65  ? 70   THR A C     1 
ATOM   1399  O  O     . THR E 3 70  ? -9.812  38.138  31.749  1.00 32.65  ? 70   THR A O     1 
ATOM   1400  C  CB    . THR E 3 70  ? -8.897  41.008  33.117  1.00 51.54  ? 70   THR A CB    1 
ATOM   1401  O  OG1   . THR E 3 70  ? -8.678  41.520  34.437  1.00 51.54  ? 70   THR A OG1   1 
ATOM   1402  C  CG2   . THR E 3 70  ? -10.361 41.013  32.853  1.00 51.54  ? 70   THR A CG2   1 
ATOM   1403  N  N     . LYS E 3 71  ? -8.306  39.346  30.609  1.00 53.72  ? 71   LYS A N     1 
ATOM   1404  C  CA    . LYS E 3 71  ? -8.700  38.856  29.307  1.00 53.72  ? 71   LYS A CA    1 
ATOM   1405  C  C     . LYS E 3 71  ? -8.502  37.370  29.221  1.00 53.72  ? 71   LYS A C     1 
ATOM   1406  O  O     . LYS E 3 71  ? -9.443  36.630  28.992  1.00 53.72  ? 71   LYS A O     1 
ATOM   1407  C  CB    . LYS E 3 71  ? -7.867  39.538  28.229  1.00 28.55  ? 71   LYS A CB    1 
ATOM   1408  C  CG    . LYS E 3 71  ? -8.089  39.055  26.821  1.00 28.55  ? 71   LYS A CG    1 
ATOM   1409  C  CD    . LYS E 3 71  ? -7.440  40.049  25.925  1.00 28.55  ? 71   LYS A CD    1 
ATOM   1410  C  CE    . LYS E 3 71  ? -7.925  39.964  24.513  1.00 28.55  ? 71   LYS A CE    1 
ATOM   1411  N  NZ    . LYS E 3 71  ? -7.584  38.647  23.959  1.00 28.55  ? 71   LYS A NZ    1 
ATOM   1412  N  N     . LEU E 3 72  ? -7.271  36.926  29.400  1.00 42.13  ? 72   LEU A N     1 
ATOM   1413  C  CA    . LEU E 3 72  ? -6.981  35.502  29.313  1.00 42.13  ? 72   LEU A CA    1 
ATOM   1414  C  C     . LEU E 3 72  ? -7.723  34.664  30.361  1.00 42.13  ? 72   LEU A C     1 
ATOM   1415  O  O     . LEU E 3 72  ? -8.057  33.518  30.105  1.00 42.13  ? 72   LEU A O     1 
ATOM   1416  C  CB    . LEU E 3 72  ? -5.474  35.268  29.417  1.00 31.87  ? 72   LEU A CB    1 
ATOM   1417  C  CG    . LEU E 3 72  ? -4.628  35.934  28.340  1.00 31.87  ? 72   LEU A CG    1 
ATOM   1418  C  CD1   . LEU E 3 72  ? -3.194  35.717  28.668  1.00 31.87  ? 72   LEU A CD1   1 
ATOM   1419  C  CD2   . LEU E 3 72  ? -4.916  35.351  26.995  1.00 31.87  ? 72   LEU A CD2   1 
ATOM   1420  N  N     . ALA E 3 73  ? -7.993  35.236  31.527  1.00 73.97  ? 73   ALA A N     1 
ATOM   1421  C  CA    . ALA E 3 73  ? -8.699  34.500  32.556  1.00 73.97  ? 73   ALA A CA    1 
ATOM   1422  C  C     . ALA E 3 73  ? -10.066 34.042  32.056  1.00 73.97  ? 73   ALA A C     1 
ATOM   1423  O  O     . ALA E 3 73  ? -10.385 32.859  32.156  1.00 73.97  ? 73   ALA A O     1 
ATOM   1424  C  CB    . ALA E 3 73  ? -8.850  35.350  33.794  1.00 75.41  ? 73   ALA A CB    1 
ATOM   1425  N  N     . LYS E 3 74  ? -10.882 34.957  31.526  1.00 47.95  ? 74   LYS A N     1 
ATOM   1426  C  CA    . LYS E 3 74  ? -12.198 34.557  31.021  1.00 47.95  ? 74   LYS A CA    1 
ATOM   1427  C  C     . LYS E 3 74  ? -11.967 33.580  29.872  1.00 47.95  ? 74   LYS A C     1 
ATOM   1428  O  O     . LYS E 3 74  ? -12.470 32.458  29.881  1.00 47.95  ? 74   LYS A O     1 
ATOM   1429  C  CB    . LYS E 3 74  ? -13.002 35.767  30.526  1.00 27.94  ? 74   LYS A CB    1 
ATOM   1430  N  N     . LEU E 3 75  ? -11.180 34.006  28.895  1.00 40.20  ? 75   LEU A N     1 
ATOM   1431  C  CA    . LEU E 3 75  ? -10.846 33.197  27.729  1.00 40.20  ? 75   LEU A CA    1 
ATOM   1432  C  C     . LEU E 3 75  ? -10.516 31.744  28.077  1.00 40.20  ? 75   LEU A C     1 
ATOM   1433  O  O     . LEU E 3 75  ? -11.342 30.841  27.976  1.00 40.20  ? 75   LEU A O     1 
ATOM   1434  C  CB    . LEU E 3 75  ? -9.625  33.810  27.045  1.00 50.80  ? 75   LEU A CB    1 
ATOM   1435  C  CG    . LEU E 3 75  ? -9.419  33.742  25.534  1.00 50.80  ? 75   LEU A CG    1 
ATOM   1436  C  CD1   . LEU E 3 75  ? -9.574  32.308  25.007  1.00 50.80  ? 75   LEU A CD1   1 
ATOM   1437  C  CD2   . LEU E 3 75  ? -10.409 34.693  24.892  1.00 50.80  ? 75   LEU A CD2   1 
ATOM   1438  N  N     . GLN E 3 76  ? -9.282  31.536  28.503  1.00 51.06  ? 76   GLN A N     1 
ATOM   1439  C  CA    . GLN E 3 76  ? -8.795  30.204  28.818  1.00 51.06  ? 76   GLN A CA    1 
ATOM   1440  C  C     . GLN E 3 76  ? -9.439  29.404  29.936  1.00 51.06  ? 76   GLN A C     1 
ATOM   1441  O  O     . GLN E 3 76  ? -9.435  28.175  29.898  1.00 51.06  ? 76   GLN A O     1 
ATOM   1442  C  CB    . GLN E 3 76  ? -7.293  30.261  29.077  1.00 72.39  ? 76   GLN A CB    1 
ATOM   1443  C  CG    . GLN E 3 76  ? -6.512  30.834  27.934  1.00 72.39  ? 76   GLN A CG    1 
ATOM   1444  C  CD    . GLN E 3 76  ? -5.106  30.324  27.920  1.00 72.39  ? 76   GLN A CD    1 
ATOM   1445  O  OE1   . GLN E 3 76  ? -4.304  30.645  28.795  1.00 72.39  ? 76   GLN A OE1   1 
ATOM   1446  N  NE2   . GLN E 3 76  ? -4.793  29.503  26.928  1.00 72.39  ? 76   GLN A NE2   1 
ATOM   1447  N  N     . LEU E 3 77  ? -10.000 30.072  30.926  1.00 48.33  ? 77   LEU A N     1 
ATOM   1448  C  CA    . LEU E 3 77  ? -10.565 29.335  32.035  1.00 48.33  ? 77   LEU A CA    1 
ATOM   1449  C  C     . LEU E 3 77  ? -11.993 29.694  32.355  1.00 48.33  ? 77   LEU A C     1 
ATOM   1450  O  O     . LEU E 3 77  ? -12.564 29.165  33.306  1.00 48.33  ? 77   LEU A O     1 
ATOM   1451  C  CB    . LEU E 3 77  ? -9.719  29.584  33.269  1.00 28.99  ? 77   LEU A CB    1 
ATOM   1452  C  CG    . LEU E 3 77  ? -8.270  29.163  33.092  1.00 28.99  ? 77   LEU A CG    1 
ATOM   1453  C  CD1   . LEU E 3 77  ? -7.386  29.740  34.196  1.00 28.99  ? 77   LEU A CD1   1 
ATOM   1454  C  CD2   . LEU E 3 77  ? -8.233  27.651  33.059  1.00 28.99  ? 77   LEU A CD2   1 
ATOM   1455  N  N     . ASN E 3 78  ? -12.577 30.587  31.570  1.00 75.85  ? 78   ASN A N     1 
ATOM   1456  C  CA    . ASN E 3 78  ? -13.938 31.019  31.830  1.00 75.85  ? 78   ASN A CA    1 
ATOM   1457  C  C     . ASN E 3 78  ? -13.977 31.503  33.278  1.00 75.85  ? 78   ASN A C     1 
ATOM   1458  O  O     . ASN E 3 78  ? -14.916 31.216  34.018  1.00 75.85  ? 78   ASN A O     1 
ATOM   1459  C  CB    . ASN E 3 78  ? -14.911 29.860  31.629  1.00 82.58  ? 78   ASN A CB    1 
ATOM   1460  C  CG    . ASN E 3 78  ? -16.343 30.324  31.557  1.00 82.58  ? 78   ASN A CG    1 
ATOM   1461  O  OD1   . ASN E 3 78  ? -16.664 31.240  30.801  1.00 82.58  ? 78   ASN A OD1   1 
ATOM   1462  N  ND2   . ASN E 3 78  ? -17.216 29.698  32.338  1.00 82.58  ? 78   ASN A ND2   1 
ATOM   1463  N  N     . ARG E 3 79  ? -12.936 32.234  33.670  1.00 44.48  ? 79   ARG A N     1 
ATOM   1464  C  CA    . ARG E 3 79  ? -12.818 32.756  35.029  1.00 44.48  ? 79   ARG A CA    1 
ATOM   1465  C  C     . ARG E 3 79  ? -12.873 34.290  35.102  1.00 44.48  ? 79   ARG A C     1 
ATOM   1466  O  O     . ARG E 3 79  ? -12.394 34.978  34.204  1.00 44.48  ? 79   ARG A O     1 
ATOM   1467  C  CB    . ARG E 3 79  ? -11.509 32.263  35.659  1.00 52.09  ? 79   ARG A CB    1 
ATOM   1468  C  CG    . ARG E 3 79  ? -11.234 32.850  37.038  1.00 52.09  ? 79   ARG A CG    1 
ATOM   1469  C  CD    . ARG E 3 79  ? -9.743  32.927  37.349  1.00 52.09  ? 79   ARG A CD    1 
ATOM   1470  N  NE    . ARG E 3 79  ? -9.213  31.713  37.952  1.00 52.09  ? 79   ARG A NE    1 
ATOM   1471  C  CZ    . ARG E 3 79  ? -8.593  31.692  39.126  1.00 52.09  ? 79   ARG A CZ    1 
ATOM   1472  N  NH1   . ARG E 3 79  ? -8.431  32.809  39.814  1.00 52.09  ? 79   ARG A NH1   1 
ATOM   1473  N  NH2   . ARG E 3 79  ? -8.129  30.557  39.614  1.00 52.09  ? 79   ARG A NH2   1 
ATOM   1474  N  N     . GLU E 3 80  ? -13.475 34.824  36.162  1.00 53.72  ? 80   GLU A N     1 
ATOM   1475  C  CA    . GLU E 3 80  ? -13.542 36.273  36.335  1.00 53.72  ? 80   GLU A CA    1 
ATOM   1476  C  C     . GLU E 3 80  ? -12.404 36.686  37.284  1.00 53.72  ? 80   GLU A C     1 
ATOM   1477  O  O     . GLU E 3 80  ? -12.504 36.558  38.508  1.00 53.72  ? 80   GLU A O     1 
ATOM   1478  C  CB    . GLU E 3 80  ? -14.903 36.704  36.897  1.00 66.32  ? 80   GLU A CB    1 
ATOM   1479  C  CG    . GLU E 3 80  ? -16.019 36.858  35.854  1.00 66.32  ? 80   GLU A CG    1 
ATOM   1480  C  CD    . GLU E 3 80  ? -15.851 38.098  34.970  1.00 66.32  ? 80   GLU A CD    1 
ATOM   1481  O  OE1   . GLU E 3 80  ? -15.239 39.080  35.448  1.00 66.32  ? 80   GLU A OE1   1 
ATOM   1482  O  OE2   . GLU E 3 80  ? -16.342 38.109  33.809  1.00 66.32  ? 80   GLU A OE2   1 
ATOM   1483  N  N     . PHE E 3 81  ? -11.312 37.161  36.690  1.00 73.12  ? 81   PHE A N     1 
ATOM   1484  C  CA    . PHE E 3 81  ? -10.129 37.587  37.424  1.00 73.12  ? 81   PHE A CA    1 
ATOM   1485  C  C     . PHE E 3 81  ? -9.994  39.106  37.329  1.00 73.12  ? 81   PHE A C     1 
ATOM   1486  O  O     . PHE E 3 81  ? -10.004 39.661  36.238  1.00 73.12  ? 81   PHE A O     1 
ATOM   1487  C  CB    . PHE E 3 81  ? -8.906  36.921  36.811  1.00 54.24  ? 81   PHE A CB    1 
ATOM   1488  C  CG    . PHE E 3 81  ? -7.607  37.307  37.464  1.00 54.24  ? 81   PHE A CG    1 
ATOM   1489  C  CD1   . PHE E 3 81  ? -7.167  36.653  38.606  1.00 54.24  ? 81   PHE A CD1   1 
ATOM   1490  C  CD2   . PHE E 3 81  ? -6.814  38.309  36.920  1.00 54.24  ? 81   PHE A CD2   1 
ATOM   1491  C  CE1   . PHE E 3 81  ? -5.965  36.989  39.187  1.00 54.24  ? 81   PHE A CE1   1 
ATOM   1492  C  CE2   . PHE E 3 81  ? -5.610  38.652  37.495  1.00 54.24  ? 81   PHE A CE2   1 
ATOM   1493  C  CZ    . PHE E 3 81  ? -5.184  37.993  38.626  1.00 54.24  ? 81   PHE A CZ    1 
ATOM   1494  N  N     . HIS E 3 82  ? -9.844  39.780  38.461  1.00 69.91  ? 82   HIS A N     1 
ATOM   1495  C  CA    . HIS E 3 82  ? -9.743  41.232  38.445  1.00 69.91  ? 82   HIS A CA    1 
ATOM   1496  C  C     . HIS E 3 82  ? -8.882  41.854  39.537  1.00 69.91  ? 82   HIS A C     1 
ATOM   1497  O  O     . HIS E 3 82  ? -9.380  42.179  40.612  1.00 69.91  ? 82   HIS A O     1 
ATOM   1498  C  CB    . HIS E 3 82  ? -11.140 41.823  38.542  1.00 52.65  ? 82   HIS A CB    1 
ATOM   1499  C  CG    . HIS E 3 82  ? -11.977 41.601  37.327  1.00 52.65  ? 82   HIS A CG    1 
ATOM   1500  N  ND1   . HIS E 3 82  ? -11.816 42.331  36.170  1.00 52.65  ? 82   HIS A ND1   1 
ATOM   1501  C  CD2   . HIS E 3 82  ? -12.996 40.742  37.092  1.00 52.65  ? 82   HIS A CD2   1 
ATOM   1502  C  CE1   . HIS E 3 82  ? -12.704 41.935  35.275  1.00 52.65  ? 82   HIS A CE1   1 
ATOM   1503  N  NE2   . HIS E 3 82  ? -13.433 40.970  35.809  1.00 52.65  ? 82   HIS A NE2   1 
ATOM   1504  N  N     . LEU E 3 83  ? -7.596  42.032  39.270  1.00 63.15  ? 83   LEU A N     1 
ATOM   1505  C  CA    . LEU E 3 83  ? -6.741  42.654  40.257  1.00 63.15  ? 83   LEU A CA    1 
ATOM   1506  C  C     . LEU E 3 83  ? -7.168  44.111  40.393  1.00 63.15  ? 83   LEU A C     1 
ATOM   1507  O  O     . LEU E 3 83  ? -7.300  44.827  39.394  1.00 63.15  ? 83   LEU A O     1 
ATOM   1508  C  CB    . LEU E 3 83  ? -5.292  42.585  39.813  1.00 44.47  ? 83   LEU A CB    1 
ATOM   1509  C  CG    . LEU E 3 83  ? -4.676  41.202  39.880  1.00 44.47  ? 83   LEU A CG    1 
ATOM   1510  C  CD1   . LEU E 3 83  ? -3.228  41.236  39.378  1.00 44.47  ? 83   LEU A CD1   1 
ATOM   1511  C  CD2   . LEU E 3 83  ? -4.728  40.739  41.314  1.00 44.47  ? 83   LEU A CD2   1 
ATOM   1512  N  N     . PRO E 3 84  ? -7.408  44.559  41.632  1.00 57.78  ? 84   PRO A N     1 
ATOM   1513  C  CA    . PRO E 3 84  ? -7.822  45.918  41.966  1.00 57.78  ? 84   PRO A CA    1 
ATOM   1514  C  C     . PRO E 3 84  ? -6.633  46.866  41.947  1.00 57.78  ? 84   PRO A C     1 
ATOM   1515  O  O     . PRO E 3 84  ? -5.564  46.521  42.443  1.00 57.78  ? 84   PRO A O     1 
ATOM   1516  C  CB    . PRO E 3 84  ? -8.384  45.746  43.366  1.00 41.40  ? 84   PRO A CB    1 
ATOM   1517  C  CG    . PRO E 3 84  ? -7.490  44.698  43.930  1.00 41.40  ? 84   PRO A CG    1 
ATOM   1518  C  CD    . PRO E 3 84  ? -7.447  43.703  42.828  1.00 41.40  ? 84   PRO A CD    1 
ATOM   1519  N  N     . ARG E 3 85  ? -6.824  48.059  41.393  1.00 42.91  ? 85   ARG A N     1 
ATOM   1520  C  CA    . ARG E 3 85  ? -5.755  49.044  41.317  1.00 42.91  ? 85   ARG A CA    1 
ATOM   1521  C  C     . ARG E 3 85  ? -4.863  49.083  42.549  1.00 42.91  ? 85   ARG A C     1 
ATOM   1522  O  O     . ARG E 3 85  ? -3.655  48.859  42.459  1.00 42.91  ? 85   ARG A O     1 
ATOM   1523  C  CB    . ARG E 3 85  ? -6.301  50.456  41.125  1.00 61.26  ? 85   ARG A CB    1 
ATOM   1524  C  CG    . ARG E 3 85  ? -5.169  51.497  41.105  1.00 61.26  ? 85   ARG A CG    1 
ATOM   1525  C  CD    . ARG E 3 85  ? -5.585  52.918  41.532  1.00 61.26  ? 85   ARG A CD    1 
ATOM   1526  N  NE    . ARG E 3 85  ? -5.264  53.231  42.931  1.00 61.26  ? 85   ARG A NE    1 
ATOM   1527  C  CZ    . ARG E 3 85  ? -6.149  53.213  43.927  1.00 61.26  ? 85   ARG A CZ    1 
ATOM   1528  N  NH1   . ARG E 3 85  ? -7.419  52.895  43.685  1.00 61.26  ? 85   ARG A NH1   1 
ATOM   1529  N  NH2   . ARG E 3 85  ? -5.770  53.521  45.162  1.00 61.26  ? 85   ARG A NH2   1 
ATOM   1530  N  N     . GLU E 3 86  ? -5.482  49.387  43.690  1.00 36.91  ? 86   GLU A N     1 
ATOM   1531  C  CA    . GLU E 3 86  ? -4.817  49.539  44.990  1.00 36.91  ? 86   GLU A CA    1 
ATOM   1532  C  C     . GLU E 3 86  ? -3.674  48.609  45.349  1.00 36.91  ? 86   GLU A C     1 
ATOM   1533  O  O     . GLU E 3 86  ? -2.775  49.016  46.078  1.00 36.91  ? 86   GLU A O     1 
ATOM   1534  C  CB    . GLU E 3 86  ? -5.867  49.499  46.106  1.00 91.47  ? 86   GLU A CB    1 
ATOM   1535  C  CG    . GLU E 3 86  ? -6.950  48.436  45.920  1.00 91.47  ? 86   GLU A CG    1 
ATOM   1536  C  CD    . GLU E 3 86  ? -7.744  48.187  47.193  1.00 91.47  ? 86   GLU A CD    1 
ATOM   1537  O  OE1   . GLU E 3 86  ? -8.287  49.163  47.749  1.00 91.47  ? 86   GLU A OE1   1 
ATOM   1538  O  OE2   . GLU E 3 86  ? -7.823  47.018  47.641  1.00 91.47  ? 86   GLU A OE2   1 
ATOM   1539  N  N     . ASN E 3 87  ? -3.703  47.374  44.842  1.00 54.39  ? 87   ASN A N     1 
ATOM   1540  C  CA    . ASN E 3 87  ? -2.662  46.378  45.151  1.00 54.39  ? 87   ASN A CA    1 
ATOM   1541  C  C     . ASN E 3 87  ? -1.595  46.229  44.066  1.00 54.39  ? 87   ASN A C     1 
ATOM   1542  O  O     . ASN E 3 87  ? -0.723  45.351  44.160  1.00 54.39  ? 87   ASN A O     1 
ATOM   1543  C  CB    . ASN E 3 87  ? -3.282  44.984  45.379  1.00 63.51  ? 87   ASN A CB    1 
ATOM   1544  C  CG    . ASN E 3 87  ? -4.550  45.023  46.208  1.00 63.51  ? 87   ASN A CG    1 
ATOM   1545  O  OD1   . ASN E 3 87  ? -5.614  45.388  45.717  1.00 63.51  ? 87   ASN A OD1   1 
ATOM   1546  N  ND2   . ASN E 3 87  ? -4.441  44.645  47.474  1.00 63.51  ? 87   ASN A ND2   1 
ATOM   1547  N  N     . CYS E 3 88  ? -1.663  47.080  43.046  1.00 49.89  ? 88   CYS A N     1 
ATOM   1548  C  CA    . CYS E 3 88  ? -0.731  47.008  41.933  1.00 49.89  ? 88   CYS A CA    1 
ATOM   1549  C  C     . CYS E 3 88  ? 0.315   48.092  41.847  1.00 49.89  ? 88   CYS A C     1 
ATOM   1550  O  O     . CYS E 3 88  ? 0.013   49.272  42.017  1.00 49.89  ? 88   CYS A O     1 
ATOM   1551  C  CB    . CYS E 3 88  ? -1.514  47.013  40.637  1.00 47.33  ? 88   CYS A CB    1 
ATOM   1552  S  SG    . CYS E 3 88  ? -2.640  45.680  40.552  1.00 47.33  ? 88   CYS A SG    1 
ATOM   1553  N  N     . ILE E 3 89  ? 1.544   47.680  41.560  1.00 37.82  ? 89   ILE A N     1 
ATOM   1554  C  CA    . ILE E 3 89  ? 2.623   48.625  41.391  1.00 37.82  ? 89   ILE A CA    1 
ATOM   1555  C  C     . ILE E 3 89  ? 3.137   48.402  39.973  1.00 37.82  ? 89   ILE A C     1 
ATOM   1556  O  O     . ILE E 3 89  ? 3.011   47.303  39.428  1.00 37.82  ? 89   ILE A O     1 
ATOM   1557  C  CB    . ILE E 3 89  ? 3.732   48.403  42.440  1.00 64.78  ? 89   ILE A CB    1 
ATOM   1558  C  CG1   . ILE E 3 89  ? 3.235   48.868  43.807  1.00 64.78  ? 89   ILE A CG1   1 
ATOM   1559  C  CG2   . ILE E 3 89  ? 4.975   49.192  42.075  1.00 64.78  ? 89   ILE A CG2   1 
ATOM   1560  C  CD1   . ILE E 3 89  ? 4.235   48.706  44.911  1.00 64.78  ? 89   ILE A CD1   1 
ATOM   1561  N  N     . ASP E 3 90  ? 3.692   49.444  39.368  1.00 56.58  ? 90   ASP A N     1 
ATOM   1562  C  CA    . ASP E 3 90  ? 4.195   49.320  38.021  1.00 56.58  ? 90   ASP A CA    1 
ATOM   1563  C  C     . ASP E 3 90  ? 5.579   49.945  37.913  1.00 56.58  ? 90   ASP A C     1 
ATOM   1564  O  O     . ASP E 3 90  ? 5.702   51.166  37.912  1.00 56.58  ? 90   ASP A O     1 
ATOM   1565  C  CB    . ASP E 3 90  ? 3.229   50.010  37.063  1.00 59.06  ? 90   ASP A CB    1 
ATOM   1566  C  CG    . ASP E 3 90  ? 3.559   49.734  35.619  1.00 59.06  ? 90   ASP A CG    1 
ATOM   1567  O  OD1   . ASP E 3 90  ? 4.703   49.299  35.356  1.00 59.06  ? 90   ASP A OD1   1 
ATOM   1568  O  OD2   . ASP E 3 90  ? 2.693   49.955  34.747  1.00 59.06  ? 90   ASP A OD2   1 
ATOM   1569  N  N     . THR E 3 91  ? 6.628   49.135  37.813  1.00 59.18  ? 91   THR A N     1 
ATOM   1570  C  CA    . THR E 3 91  ? 7.964   49.722  37.709  1.00 59.18  ? 91   THR A CA    1 
ATOM   1571  C  C     . THR E 3 91  ? 8.118   50.695  36.551  1.00 59.18  ? 91   THR A C     1 
ATOM   1572  O  O     . THR E 3 91  ? 8.922   51.615  36.635  1.00 59.18  ? 91   THR A O     1 
ATOM   1573  C  CB    . THR E 3 91  ? 9.085   48.674  37.588  1.00 44.43  ? 91   THR A CB    1 
ATOM   1574  O  OG1   . THR E 3 91  ? 8.670   47.617  36.719  1.00 44.43  ? 91   THR A OG1   1 
ATOM   1575  C  CG2   . THR E 3 91  ? 9.447   48.135  38.949  1.00 44.43  ? 91   THR A CG2   1 
ATOM   1576  N  N     . LEU E 3 92  ? 7.361   50.510  35.473  1.00 36.37  ? 92   LEU A N     1 
ATOM   1577  C  CA    . LEU E 3 92  ? 7.465   51.433  34.344  1.00 36.37  ? 92   LEU A CA    1 
ATOM   1578  C  C     . LEU E 3 92  ? 6.939   52.771  34.786  1.00 36.37  ? 92   LEU A C     1 
ATOM   1579  O  O     . LEU E 3 92  ? 7.602   53.779  34.646  1.00 36.37  ? 92   LEU A O     1 
ATOM   1580  C  CB    . LEU E 3 92  ? 6.640   50.978  33.150  1.00 34.90  ? 92   LEU A CB    1 
ATOM   1581  C  CG    . LEU E 3 92  ? 6.990   51.762  31.886  1.00 34.90  ? 92   LEU A CG    1 
ATOM   1582  C  CD1   . LEU E 3 92  ? 8.311   51.247  31.348  1.00 34.90  ? 92   LEU A CD1   1 
ATOM   1583  C  CD2   . LEU E 3 92  ? 5.948   51.586  30.830  1.00 34.90  ? 92   LEU A CD2   1 
ATOM   1584  N  N     . VAL E 3 93  ? 5.729   52.767  35.321  1.00 41.08  ? 93   VAL A N     1 
ATOM   1585  C  CA    . VAL E 3 93  ? 5.093   53.983  35.808  1.00 41.08  ? 93   VAL A CA    1 
ATOM   1586  C  C     . VAL E 3 93  ? 6.080   54.689  36.690  1.00 41.08  ? 93   VAL A C     1 
ATOM   1587  O  O     . VAL E 3 93  ? 6.381   55.845  36.472  1.00 41.08  ? 93   VAL A O     1 
ATOM   1588  C  CB    . VAL E 3 93  ? 3.828   53.680  36.652  1.00 39.69  ? 93   VAL A CB    1 
ATOM   1589  C  CG1   . VAL E 3 93  ? 3.510   54.852  37.563  1.00 39.69  ? 93   VAL A CG1   1 
ATOM   1590  C  CG2   . VAL E 3 93  ? 2.642   53.386  35.737  1.00 39.69  ? 93   VAL A CG2   1 
ATOM   1591  N  N     . LEU E 3 94  ? 6.584   53.981  37.689  1.00 50.58  ? 94   LEU A N     1 
ATOM   1592  C  CA    . LEU E 3 94  ? 7.546   54.557  38.621  1.00 50.58  ? 94   LEU A CA    1 
ATOM   1593  C  C     . LEU E 3 94  ? 8.825   55.010  37.933  1.00 50.58  ? 94   LEU A C     1 
ATOM   1594  O  O     . LEU E 3 94  ? 9.312   56.102  38.188  1.00 50.58  ? 94   LEU A O     1 
ATOM   1595  C  CB    . LEU E 3 94  ? 7.902   53.558  39.732  1.00 35.94  ? 94   LEU A CB    1 
ATOM   1596  C  CG    . LEU E 3 94  ? 7.117   53.481  41.048  1.00 35.94  ? 94   LEU A CG    1 
ATOM   1597  C  CD1   . LEU E 3 94  ? 7.891   52.571  41.986  1.00 35.94  ? 94   LEU A CD1   1 
ATOM   1598  C  CD2   . LEU E 3 94  ? 6.952   54.848  41.704  1.00 35.94  ? 94   LEU A CD2   1 
ATOM   1599  N  N     . SER E 3 95  ? 9.371   54.172  37.066  1.00 42.26  ? 95   SER A N     1 
ATOM   1600  C  CA    . SER E 3 95  ? 10.589  54.512  36.372  1.00 42.26  ? 95   SER A CA    1 
ATOM   1601  C  C     . SER E 3 95  ? 10.406  55.709  35.435  1.00 42.26  ? 95   SER A C     1 
ATOM   1602  O  O     . SER E 3 95  ? 11.356  56.177  34.807  1.00 42.26  ? 95   SER A O     1 
ATOM   1603  C  CB    . SER E 3 95  ? 11.058  53.310  35.590  1.00 49.61  ? 95   SER A CB    1 
ATOM   1604  O  OG    . SER E 3 95  ? 12.449  53.374  35.446  1.00 49.61  ? 95   SER A OG    1 
ATOM   1605  N  N     . ARG E 3 96  ? 9.177   56.195  35.325  1.00 48.08  ? 96   ARG A N     1 
ATOM   1606  C  CA    . ARG E 3 96  ? 8.904   57.339  34.475  1.00 48.08  ? 96   ARG A CA    1 
ATOM   1607  C  C     . ARG E 3 96  ? 8.715   58.549  35.369  1.00 48.08  ? 96   ARG A C     1 
ATOM   1608  O  O     . ARG E 3 96  ? 8.737   59.677  34.899  1.00 48.08  ? 96   ARG A O     1 
ATOM   1609  C  CB    . ARG E 3 96  ? 7.654   57.104  33.622  1.00 23.19  ? 96   ARG A CB    1 
ATOM   1610  N  N     . LEU E 3 97  ? 8.529   58.308  36.665  1.00 32.66  ? 97   LEU A N     1 
ATOM   1611  C  CA    . LEU E 3 97  ? 8.359   59.381  37.657  1.00 32.66  ? 97   LEU A CA    1 
ATOM   1612  C  C     . LEU E 3 97  ? 9.669   59.592  38.401  1.00 32.66  ? 97   LEU A C     1 
ATOM   1613  O  O     . LEU E 3 97  ? 9.772   60.489  39.188  1.00 32.66  ? 97   LEU A O     1 
ATOM   1614  C  CB    . LEU E 3 97  ? 7.215   59.071  38.654  1.00 27.46  ? 97   LEU A CB    1 
ATOM   1615  C  CG    . LEU E 3 97  ? 7.023   59.912  39.938  1.00 27.46  ? 97   LEU A CG    1 
ATOM   1616  C  CD1   . LEU E 3 97  ? 6.540   61.305  39.588  1.00 27.46  ? 97   LEU A CD1   1 
ATOM   1617  C  CD2   . LEU E 3 97  ? 6.056   59.227  40.906  1.00 27.46  ? 97   LEU A CD2   1 
ATOM   1618  N  N     . ILE E 3 98  ? 10.684  58.776  38.135  1.00 73.65  ? 98   ILE A N     1 
ATOM   1619  C  CA    . ILE E 3 98  ? 11.993  58.944  38.788  1.00 73.65  ? 98   ILE A CA    1 
ATOM   1620  C  C     . ILE E 3 98  ? 13.091  59.329  37.783  1.00 73.65  ? 98   ILE A C     1 
ATOM   1621  O  O     . ILE E 3 98  ? 13.941  60.166  38.074  1.00 73.65  ? 98   ILE A O     1 
ATOM   1622  C  CB    . ILE E 3 98  ? 12.429  57.645  39.552  1.00 54.98  ? 98   ILE A CB    1 
ATOM   1623  C  CG1   . ILE E 3 98  ? 12.079  57.769  41.036  1.00 54.98  ? 98   ILE A CG1   1 
ATOM   1624  C  CG2   . ILE E 3 98  ? 13.916  57.363  39.347  1.00 54.98  ? 98   ILE A CG2   1 
ATOM   1625  C  CD1   . ILE E 3 98  ? 10.602  57.970  41.291  1.00 54.98  ? 98   ILE A CD1   1 
ATOM   1626  N  N     . HIS E 3 99  ? 13.076  58.709  36.609  1.00 111.98 ? 99   HIS A N     1 
ATOM   1627  C  CA    . HIS E 3 99  ? 14.060  59.003  35.566  1.00 111.98 ? 99   HIS A CA    1 
ATOM   1628  C  C     . HIS E 3 99  ? 13.431  59.983  34.570  1.00 111.98 ? 99   HIS A C     1 
ATOM   1629  O  O     . HIS E 3 99  ? 13.591  59.837  33.354  1.00 111.98 ? 99   HIS A O     1 
ATOM   1630  C  CB    . HIS E 3 99  ? 14.438  57.719  34.806  1.00 117.57 ? 99   HIS A CB    1 
ATOM   1631  C  CG    . HIS E 3 99  ? 15.510  56.892  35.455  1.00 117.57 ? 99   HIS A CG    1 
ATOM   1632  N  ND1   . HIS E 3 99  ? 16.834  57.277  35.487  1.00 117.57 ? 99   HIS A ND1   1 
ATOM   1633  C  CD2   . HIS E 3 99  ? 15.466  55.663  36.024  1.00 117.57 ? 99   HIS A CD2   1 
ATOM   1634  C  CE1   . HIS E 3 99  ? 17.558  56.320  36.041  1.00 117.57 ? 99   HIS A CE1   1 
ATOM   1635  N  NE2   . HIS E 3 99  ? 16.752  55.329  36.375  1.00 117.57 ? 99   HIS A NE2   1 
ATOM   1636  N  N     . SER E 3 100 ? 12.718  60.975  35.095  1.00 78.03  ? 100  SER A N     1 
ATOM   1637  C  CA    . SER E 3 100 ? 12.026  61.972  34.285  1.00 78.03  ? 100  SER A CA    1 
ATOM   1638  C  C     . SER E 3 100 ? 12.849  62.654  33.191  1.00 78.03  ? 100  SER A C     1 
ATOM   1639  O  O     . SER E 3 100 ? 12.302  63.073  32.172  1.00 78.03  ? 100  SER A O     1 
ATOM   1640  C  CB    . SER E 3 100 ? 11.461  63.053  35.206  1.00 103.44 ? 100  SER A CB    1 
ATOM   1641  O  OG    . SER E 3 100 ? 12.516  63.755  35.843  1.00 103.44 ? 100  SER A OG    1 
ATOM   1642  N  N     . ASN E 3 101 ? 14.156  62.763  33.397  1.00 139.85 ? 101  ASN A N     1 
ATOM   1643  C  CA    . ASN E 3 101 ? 15.021  63.452  32.444  1.00 139.85 ? 101  ASN A CA    1 
ATOM   1644  C  C     . ASN E 3 101 ? 15.650  62.664  31.287  1.00 139.85 ? 101  ASN A C     1 
ATOM   1645  O  O     . ASN E 3 101 ? 16.031  63.259  30.276  1.00 139.85 ? 101  ASN A O     1 
ATOM   1646  C  CB    . ASN E 3 101 ? 16.129  64.176  33.213  1.00 111.16 ? 101  ASN A CB    1 
ATOM   1647  N  N     . LEU E 3 102 ? 15.776  61.346  31.415  1.00 164.40 ? 102  LEU A N     1 
ATOM   1648  C  CA    . LEU E 3 102 ? 16.387  60.568  30.332  1.00 164.40 ? 102  LEU A CA    1 
ATOM   1649  C  C     . LEU E 3 102 ? 15.436  60.296  29.161  1.00 164.40 ? 102  LEU A C     1 
ATOM   1650  O  O     . LEU E 3 102 ? 14.828  61.227  28.634  1.00 164.40 ? 102  LEU A O     1 
ATOM   1651  C  CB    . LEU E 3 102 ? 16.976  59.252  30.866  1.00 135.10 ? 102  LEU A CB    1 
ATOM   1652  C  CG    . LEU E 3 102 ? 18.335  59.370  31.571  1.00 135.10 ? 102  LEU A CG    1 
ATOM   1653  C  CD1   . LEU E 3 102 ? 18.174  60.147  32.873  1.00 135.10 ? 102  LEU A CD1   1 
ATOM   1654  C  CD2   . LEU E 3 102 ? 18.903  57.987  31.841  1.00 135.10 ? 102  LEU A CD2   1 
ATOM   1655  N  N     . LYS E 3 103 ? 15.320  59.033  28.748  1.00 151.41 ? 103  LYS A N     1 
ATOM   1656  C  CA    . LYS E 3 103 ? 14.450  58.656  27.628  1.00 151.41 ? 103  LYS A CA    1 
ATOM   1657  C  C     . LYS E 3 103 ? 14.383  57.137  27.404  1.00 151.41 ? 103  LYS A C     1 
ATOM   1658  O  O     . LYS E 3 103 ? 15.407  56.447  27.433  1.00 151.41 ? 103  LYS A O     1 
ATOM   1659  C  CB    . LYS E 3 103 ? 14.933  59.329  26.338  1.00 118.38 ? 103  LYS A CB    1 
ATOM   1660  N  N     . ASP E 3 104 ? 13.174  56.628  27.166  1.00 185.89 ? 104  ASP A N     1 
ATOM   1661  C  CA    . ASP E 3 104 ? 12.969  55.197  26.939  1.00 185.89 ? 104  ASP A CA    1 
ATOM   1662  C  C     . ASP E 3 104 ? 12.592  54.851  25.497  1.00 185.89 ? 104  ASP A C     1 
ATOM   1663  O  O     . ASP E 3 104 ? 12.077  55.693  24.755  1.00 185.89 ? 104  ASP A O     1 
ATOM   1664  C  CB    . ASP E 3 104 ? 11.896  54.644  27.901  1.00 125.36 ? 104  ASP A CB    1 
ATOM   1665  C  CG    . ASP E 3 104 ? 10.531  55.319  27.736  1.00 125.36 ? 104  ASP A CG    1 
ATOM   1666  O  OD1   . ASP E 3 104 ? 9.957   55.289  26.623  1.00 125.36 ? 104  ASP A OD1   1 
ATOM   1667  O  OD2   . ASP E 3 104 ? 10.024  55.870  28.735  1.00 125.36 ? 104  ASP A OD2   1 
ATOM   1668  N  N     . THR E 3 105 ? 12.860  53.607  25.107  1.00 138.06 ? 105  THR A N     1 
ATOM   1669  C  CA    . THR E 3 105 ? 12.536  53.143  23.762  1.00 138.06 ? 105  THR A CA    1 
ATOM   1670  C  C     . THR E 3 105 ? 11.088  52.655  23.677  1.00 138.06 ? 105  THR A C     1 
ATOM   1671  O  O     . THR E 3 105 ? 10.669  52.103  22.658  1.00 138.06 ? 105  THR A O     1 
ATOM   1672  C  CB    . THR E 3 105 ? 13.486  52.004  23.301  1.00 126.12 ? 105  THR A CB    1 
ATOM   1673  O  OG1   . THR E 3 105 ? 13.713  51.093  24.385  1.00 126.12 ? 105  THR A OG1   1 
ATOM   1674  C  CG2   . THR E 3 105 ? 14.811  52.574  22.819  1.00 126.12 ? 105  THR A CG2   1 
ATOM   1675  N  N     . ASP E 3 106 ? 10.328  52.875  24.749  1.00 165.57 ? 106  ASP A N     1 
ATOM   1676  C  CA    . ASP E 3 106 ? 8.925   52.469  24.818  1.00 165.57 ? 106  ASP A CA    1 
ATOM   1677  C  C     . ASP E 3 106 ? 8.770   50.953  24.731  1.00 165.57 ? 106  ASP A C     1 
ATOM   1678  O  O     . ASP E 3 106 ? 7.893   50.447  24.028  1.00 165.57 ? 106  ASP A O     1 
ATOM   1679  C  CB    . ASP E 3 106 ? 8.118   53.132  23.695  1.00 98.97  ? 106  ASP A CB    1 
ATOM   1680  N  N     . MET E 3 107 ? 9.632   50.236  25.446  1.00 183.48 ? 107  MET A N     1 
ATOM   1681  C  CA    . MET E 3 107 ? 9.598   48.776  25.471  1.00 183.48 ? 107  MET A CA    1 
ATOM   1682  C  C     . MET E 3 107 ? 9.899   48.120  24.121  1.00 183.48 ? 107  MET A C     1 
ATOM   1683  O  O     . MET E 3 107 ? 9.342   47.068  23.802  1.00 183.48 ? 107  MET A O     1 
ATOM   1684  C  CB    . MET E 3 107 ? 8.233   48.290  25.976  1.00 123.81 ? 107  MET A CB    1 
ATOM   1685  N  N     . GLY E 3 108 ? 10.768  48.743  23.329  1.00 176.19 ? 108  GLY A N     1 
ATOM   1686  C  CA    . GLY E 3 108 ? 11.136  48.180  22.039  1.00 176.19 ? 108  GLY A CA    1 
ATOM   1687  C  C     . GLY E 3 108 ? 10.237  48.475  20.849  1.00 176.19 ? 108  GLY A C     1 
ATOM   1688  O  O     . GLY E 3 108 ? 10.164  47.674  19.915  1.00 176.19 ? 108  GLY A O     1 
ATOM   1689  N  N     . LEU E 3 109 ? 9.555   49.617  20.871  1.00 156.26 ? 109  LEU A N     1 
ATOM   1690  C  CA    . LEU E 3 109 ? 8.675   50.002  19.768  1.00 156.26 ? 109  LEU A CA    1 
ATOM   1691  C  C     . LEU E 3 109 ? 9.228   51.245  19.060  1.00 156.26 ? 109  LEU A C     1 
ATOM   1692  O  O     . LEU E 3 109 ? 8.510   51.942  18.335  1.00 156.26 ? 109  LEU A O     1 
ATOM   1693  C  CB    . LEU E 3 109 ? 7.258   50.272  20.288  1.00 86.23  ? 109  LEU A CB    1 
ATOM   1694  N  N     . LEU E 3 110 ? 10.515  51.505  19.287  1.00 154.09 ? 110  LEU A N     1 
ATOM   1695  C  CA    . LEU E 3 110 ? 11.222  52.637  18.691  1.00 154.09 ? 110  LEU A CA    1 
ATOM   1696  C  C     . LEU E 3 110 ? 12.737  52.396  18.752  1.00 154.09 ? 110  LEU A C     1 
ATOM   1697  O  O     . LEU E 3 110 ? 13.247  51.835  19.728  1.00 154.09 ? 110  LEU A O     1 
ATOM   1698  C  CB    . LEU E 3 110 ? 10.867  53.936  19.424  1.00 100.29 ? 110  LEU A CB    1 
ATOM   1699  N  N     . ARG E 3 111 ? 13.446  52.815  17.704  1.00 89.01  ? 111  ARG A N     1 
ATOM   1700  C  CA    . ARG E 3 111 ? 14.899  52.649  17.619  1.00 89.01  ? 111  ARG A CA    1 
ATOM   1701  C  C     . ARG E 3 111 ? 15.624  53.783  18.339  1.00 89.01  ? 111  ARG A C     1 
ATOM   1702  O  O     . ARG E 3 111 ? 15.426  54.957  18.020  1.00 89.01  ? 111  ARG A O     1 
ATOM   1703  C  CB    . ARG E 3 111 ? 15.354  52.598  16.151  1.00 97.03  ? 111  ARG A CB    1 
ATOM   1704  N  N     . SER E 3 112 ? 16.469  53.414  19.301  1.00 170.76 ? 112  SER A N     1 
ATOM   1705  C  CA    . SER E 3 112 ? 17.238  54.371  20.102  1.00 170.76 ? 112  SER A CA    1 
ATOM   1706  C  C     . SER E 3 112 ? 18.426  54.990  19.361  1.00 170.76 ? 112  SER A C     1 
ATOM   1707  O  O     . SER E 3 112 ? 19.146  55.822  19.920  1.00 170.76 ? 112  SER A O     1 
ATOM   1708  C  CB    . SER E 3 112 ? 17.743  53.697  21.386  1.00 108.08 ? 112  SER A CB    1 
ATOM   1709  N  N     . GLY E 3 113 ? 18.634  54.574  18.114  1.00 182.04 ? 113  GLY A N     1 
ATOM   1710  C  CA    . GLY E 3 113 ? 19.727  55.117  17.326  1.00 182.04 ? 113  GLY A CA    1 
ATOM   1711  C  C     . GLY E 3 113 ? 19.389  56.527  16.874  1.00 182.04 ? 113  GLY A C     1 
ATOM   1712  O  O     . GLY E 3 113 ? 20.264  57.290  16.454  1.00 182.04 ? 113  GLY A O     1 
ATOM   1713  N  N     . LYS E 3 114 ? 18.103  56.865  16.961  1.00 198.06 ? 114  LYS A N     1 
ATOM   1714  C  CA    . LYS E 3 114 ? 17.605  58.184  16.581  1.00 198.06 ? 114  LYS A CA    1 
ATOM   1715  C  C     . LYS E 3 114 ? 17.201  58.978  17.820  1.00 198.06 ? 114  LYS A C     1 
ATOM   1716  O  O     . LYS E 3 114 ? 17.010  60.195  17.751  1.00 198.06 ? 114  LYS A O     1 
ATOM   1717  C  CB    . LYS E 3 114 ? 16.395  58.052  15.657  1.00 72.27  ? 114  LYS A CB    1 
ATOM   1718  N  N     . LEU E 3 115 ? 17.070  58.280  18.948  1.00 145.14 ? 115  LEU A N     1 
ATOM   1719  C  CA    . LEU E 3 115 ? 16.693  58.905  20.214  1.00 145.14 ? 115  LEU A CA    1 
ATOM   1720  C  C     . LEU E 3 115 ? 17.912  59.500  20.923  1.00 145.14 ? 115  LEU A C     1 
ATOM   1721  O  O     . LEU E 3 115 ? 18.891  58.799  21.203  1.00 145.14 ? 115  LEU A O     1 
ATOM   1722  C  CB    . LEU E 3 115 ? 16.010  57.885  21.132  1.00 101.65 ? 115  LEU A CB    1 
ATOM   1723  C  CG    . LEU E 3 115 ? 14.697  57.261  20.651  1.00 101.65 ? 115  LEU A CG    1 
ATOM   1724  C  CD1   . LEU E 3 115 ? 14.228  56.257  21.695  1.00 101.65 ? 115  LEU A CD1   1 
ATOM   1725  C  CD2   . LEU E 3 115 ? 13.636  58.342  20.416  1.00 101.65 ? 115  LEU A CD2   1 
ATOM   1726  N  N     . PRO E 3 116 ? 17.867  60.812  21.211  1.00 194.12 ? 116  PRO A N     1 
ATOM   1727  C  CA    . PRO E 3 116 ? 18.969  61.502  21.888  1.00 194.12 ? 116  PRO A CA    1 
ATOM   1728  C  C     . PRO E 3 116 ? 19.158  61.146  23.364  1.00 194.12 ? 116  PRO A C     1 
ATOM   1729  O  O     . PRO E 3 116 ? 18.432  60.318  23.921  1.00 194.12 ? 116  PRO A O     1 
ATOM   1730  C  CB    . PRO E 3 116 ? 18.640  62.981  21.670  1.00 94.90  ? 116  PRO A CB    1 
ATOM   1731  C  CG    . PRO E 3 116 ? 17.136  62.987  21.527  1.00 94.90  ? 116  PRO A CG    1 
ATOM   1732  C  CD    . PRO E 3 116 ? 16.888  61.779  20.676  1.00 94.90  ? 116  PRO A CD    1 
ATOM   1733  N  N     . GLY E 3 117 ? 20.158  61.770  23.977  1.00 126.16 ? 117  GLY A N     1 
ATOM   1734  C  CA    . GLY E 3 117 ? 20.453  61.536  25.378  1.00 126.16 ? 117  GLY A CA    1 
ATOM   1735  C  C     . GLY E 3 117 ? 21.061  60.185  25.713  1.00 126.16 ? 117  GLY A C     1 
ATOM   1736  O  O     . GLY E 3 117 ? 21.595  59.475  24.852  1.00 126.16 ? 117  GLY A O     1 
ATOM   1737  N  N     . ALA E 3 118 ? 20.967  59.842  26.993  1.00 190.28 ? 124  ALA A N     1 
ATOM   1738  C  CA    . ALA E 3 118 ? 21.491  58.593  27.521  1.00 190.28 ? 124  ALA A CA    1 
ATOM   1739  C  C     . ALA E 3 118 ? 20.356  57.628  27.867  1.00 190.28 ? 124  ALA A C     1 
ATOM   1740  O  O     . ALA E 3 118 ? 19.357  58.013  28.480  1.00 190.28 ? 124  ALA A O     1 
ATOM   1741  C  CB    . ALA E 3 118 ? 22.340  58.882  28.770  1.00 77.64  ? 124  ALA A CB    1 
ATOM   1742  N  N     . LEU E 3 119 ? 20.529  56.375  27.463  1.00 120.73 ? 125  LEU A N     1 
ATOM   1743  C  CA    . LEU E 3 119 ? 19.564  55.317  27.710  1.00 120.73 ? 125  LEU A CA    1 
ATOM   1744  C  C     . LEU E 3 119 ? 19.834  54.733  29.107  1.00 120.73 ? 125  LEU A C     1 
ATOM   1745  O  O     . LEU E 3 119 ? 20.988  54.605  29.519  1.00 120.73 ? 125  LEU A O     1 
ATOM   1746  C  CB    . LEU E 3 119 ? 19.728  54.243  26.622  1.00 44.15  ? 125  LEU A CB    1 
ATOM   1747  N  N     . GLU E 3 120 ? 18.767  54.389  29.824  1.00 118.69 ? 126  GLU A N     1 
ATOM   1748  C  CA    . GLU E 3 120 ? 18.856  53.825  31.171  1.00 118.69 ? 126  GLU A CA    1 
ATOM   1749  C  C     . GLU E 3 120 ? 19.616  52.493  31.183  1.00 118.69 ? 126  GLU A C     1 
ATOM   1750  O  O     . GLU E 3 120 ? 20.212  52.099  30.172  1.00 118.69 ? 126  GLU A O     1 
ATOM   1751  C  CB    . GLU E 3 120 ? 17.441  53.628  31.707  1.00 110.87 ? 126  GLU A CB    1 
ATOM   1752  C  CG    . GLU E 3 120 ? 17.321  53.471  33.201  1.00 110.87 ? 126  GLU A CG    1 
ATOM   1753  C  CD    . GLU E 3 120 ? 15.892  53.166  33.605  1.00 110.87 ? 126  GLU A CD    1 
ATOM   1754  O  OE1   . GLU E 3 120 ? 14.990  53.872  33.105  1.00 110.87 ? 126  GLU A OE1   1 
ATOM   1755  O  OE2   . GLU E 3 120 ? 15.668  52.229  34.411  1.00 110.87 ? 126  GLU A OE2   1 
ATOM   1756  N  N     . ALA E 3 121 ? 19.587  51.807  32.326  1.00 111.48 ? 127  ALA A N     1 
ATOM   1757  C  CA    . ALA E 3 121 ? 20.274  50.524  32.494  1.00 111.48 ? 127  ALA A CA    1 
ATOM   1758  C  C     . ALA E 3 121 ? 19.344  49.333  32.260  1.00 111.48 ? 127  ALA A C     1 
ATOM   1759  O  O     . ALA E 3 121 ? 19.519  48.575  31.300  1.00 111.48 ? 127  ALA A O     1 
ATOM   1760  C  CB    . ALA E 3 121 ? 20.879  50.444  33.894  1.00 135.48 ? 127  ALA A CB    1 
ATOM   1761  N  N     . TRP E 3 122 ? 18.370  49.163  33.153  1.00 122.66 ? 128  TRP A N     1 
ATOM   1762  C  CA    . TRP E 3 122 ? 17.412  48.071  33.026  1.00 122.66 ? 128  TRP A CA    1 
ATOM   1763  C  C     . TRP E 3 122 ? 16.467  48.426  31.891  1.00 122.66 ? 128  TRP A C     1 
ATOM   1764  O  O     . TRP E 3 122 ? 15.924  47.549  31.227  1.00 122.66 ? 128  TRP A O     1 
ATOM   1765  C  CB    . TRP E 3 122 ? 16.554  47.884  34.284  1.00 127.15 ? 128  TRP A CB    1 
ATOM   1766  C  CG    . TRP E 3 122 ? 17.221  48.107  35.597  1.00 127.15 ? 128  TRP A CG    1 
ATOM   1767  C  CD1   . TRP E 3 122 ? 17.020  49.162  36.437  1.00 127.15 ? 128  TRP A CD1   1 
ATOM   1768  C  CD2   . TRP E 3 122 ? 18.159  47.243  36.256  1.00 127.15 ? 128  TRP A CD2   1 
ATOM   1769  N  NE1   . TRP E 3 122 ? 17.770  49.012  37.580  1.00 127.15 ? 128  TRP A NE1   1 
ATOM   1770  C  CE2   . TRP E 3 122 ? 18.480  47.843  37.496  1.00 127.15 ? 128  TRP A CE2   1 
ATOM   1771  C  CE3   . TRP E 3 122 ? 18.761  46.021  35.921  1.00 127.15 ? 128  TRP A CE3   1 
ATOM   1772  C  CZ2   . TRP E 3 122 ? 19.377  47.264  38.403  1.00 127.15 ? 128  TRP A CZ2   1 
ATOM   1773  C  CZ3   . TRP E 3 122 ? 19.656  45.443  36.826  1.00 127.15 ? 128  TRP A CZ3   1 
ATOM   1774  C  CH2   . TRP E 3 122 ? 19.953  46.069  38.052  1.00 127.15 ? 128  TRP A CH2   1 
ATOM   1775  N  N     . GLY E 3 123 ? 16.254  49.723  31.692  1.00 167.06 ? 129  GLY A N     1 
ATOM   1776  C  CA    . GLY E 3 123 ? 15.370  50.172  30.631  1.00 167.06 ? 129  GLY A CA    1 
ATOM   1777  C  C     . GLY E 3 123 ? 15.762  49.529  29.317  1.00 167.06 ? 129  GLY A C     1 
ATOM   1778  O  O     . GLY E 3 123 ? 14.959  48.841  28.683  1.00 167.06 ? 129  GLY A O     1 
ATOM   1779  N  N     . TYR E 3 124 ? 17.003  49.756  28.900  1.00 165.88 ? 130  TYR A N     1 
ATOM   1780  C  CA    . TYR E 3 124 ? 17.497  49.167  27.667  1.00 165.88 ? 130  TYR A CA    1 
ATOM   1781  C  C     . TYR E 3 124 ? 17.662  47.678  27.934  1.00 165.88 ? 130  TYR A C     1 
ATOM   1782  O  O     . TYR E 3 124 ? 17.719  46.877  27.004  1.00 165.88 ? 130  TYR A O     1 
ATOM   1783  C  CB    . TYR E 3 124 ? 18.845  49.774  27.268  1.00 75.21  ? 130  TYR A CB    1 
ATOM   1784  N  N     . ARG E 3 125 ? 17.720  47.314  29.214  1.00 103.43 ? 131  ARG A N     1 
ATOM   1785  C  CA    . ARG E 3 125 ? 17.884  45.920  29.606  1.00 103.43 ? 131  ARG A CA    1 
ATOM   1786  C  C     . ARG E 3 125 ? 16.595  45.156  29.891  1.00 103.43 ? 131  ARG A C     1 
ATOM   1787  O  O     . ARG E 3 125 ? 16.627  44.106  30.528  1.00 103.43 ? 131  ARG A O     1 
ATOM   1788  C  CB    . ARG E 3 125 ? 18.816  45.811  30.815  1.00 91.00  ? 131  ARG A CB    1 
ATOM   1789  C  CG    . ARG E 3 125 ? 20.096  45.063  30.490  1.00 91.00  ? 131  ARG A CG    1 
ATOM   1790  C  CD    . ARG E 3 125 ? 19.791  43.634  30.027  1.00 91.00  ? 131  ARG A CD    1 
ATOM   1791  N  NE    . ARG E 3 125 ? 20.512  43.256  28.808  1.00 91.00  ? 131  ARG A NE    1 
ATOM   1792  C  CZ    . ARG E 3 125 ? 20.166  43.622  27.574  1.00 91.00  ? 131  ARG A CZ    1 
ATOM   1793  N  NH1   . ARG E 3 125 ? 19.098  44.383  27.376  1.00 91.00  ? 131  ARG A NH1   1 
ATOM   1794  N  NH2   . ARG E 3 125 ? 20.889  43.226  26.531  1.00 91.00  ? 131  ARG A NH2   1 
ATOM   1795  N  N     . LEU E 3 126 ? 15.463  45.686  29.438  1.00 110.63 ? 132  LEU A N     1 
ATOM   1796  C  CA    . LEU E 3 126 ? 14.176  45.013  29.613  1.00 110.63 ? 132  LEU A CA    1 
ATOM   1797  C  C     . LEU E 3 126 ? 13.395  45.200  28.330  1.00 110.63 ? 132  LEU A C     1 
ATOM   1798  O  O     . LEU E 3 126 ? 12.531  44.387  28.000  1.00 110.63 ? 132  LEU A O     1 
ATOM   1799  C  CB    . LEU E 3 126 ? 13.354  45.583  30.784  1.00 37.78  ? 132  LEU A CB    1 
ATOM   1800  C  CG    . LEU E 3 126 ? 13.252  44.862  32.138  1.00 37.78  ? 132  LEU A CG    1 
ATOM   1801  C  CD1   . LEU E 3 126 ? 12.257  45.597  32.998  1.00 37.78  ? 132  LEU A CD1   1 
ATOM   1802  C  CD2   . LEU E 3 126 ? 12.850  43.421  31.966  1.00 37.78  ? 132  LEU A CD2   1 
ATOM   1803  N  N     . GLY E 3 127 ? 13.708  46.278  27.613  1.00 78.22  ? 133  GLY A N     1 
ATOM   1804  C  CA    . GLY E 3 127 ? 13.032  46.563  26.361  1.00 78.22  ? 133  GLY A CA    1 
ATOM   1805  C  C     . GLY E 3 127 ? 13.669  45.758  25.249  1.00 78.22  ? 133  GLY A C     1 
ATOM   1806  O  O     . GLY E 3 127 ? 13.006  44.959  24.580  1.00 78.22  ? 133  GLY A O     1 
ATOM   1807  N  N     . GLU E 3 128 ? 14.966  45.971  25.049  1.00 101.92 ? 134  GLU A N     1 
ATOM   1808  C  CA    . GLU E 3 128 ? 15.705  45.251  24.020  1.00 101.92 ? 134  GLU A CA    1 
ATOM   1809  C  C     . GLU E 3 128 ? 15.763  43.793  24.438  1.00 101.92 ? 134  GLU A C     1 
ATOM   1810  O  O     . GLU E 3 128 ? 15.921  42.906  23.608  1.00 101.92 ? 134  GLU A O     1 
ATOM   1811  C  CB    . GLU E 3 128 ? 17.126  45.812  23.886  1.00 85.79  ? 134  GLU A CB    1 
ATOM   1812  N  N     . MET E 3 129 ? 15.625  43.561  25.737  1.00 66.53  ? 135  MET A N     1 
ATOM   1813  C  CA    . MET E 3 129 ? 15.655  42.215  26.294  1.00 66.53  ? 135  MET A CA    1 
ATOM   1814  C  C     . MET E 3 129 ? 14.711  41.252  25.570  1.00 66.53  ? 135  MET A C     1 
ATOM   1815  O  O     . MET E 3 129 ? 14.860  40.033  25.672  1.00 66.53  ? 135  MET A O     1 
ATOM   1816  C  CB    . MET E 3 129 ? 15.293  42.262  27.787  1.00 100.87 ? 135  MET A CB    1 
ATOM   1817  C  CG    . MET E 3 129 ? 14.997  40.897  28.408  1.00 100.87 ? 135  MET A CG    1 
ATOM   1818  S  SD    . MET E 3 129 ? 16.266  40.257  29.517  1.00 100.87 ? 135  MET A SD    1 
ATOM   1819  C  CE    . MET E 3 129 ? 15.348  40.191  31.053  1.00 100.87 ? 135  MET A CE    1 
ATOM   1820  N  N     . LYS E 3 130 ? 13.730  41.787  24.848  1.00 134.80 ? 136  LYS A N     1 
ATOM   1821  C  CA    . LYS E 3 130 ? 12.796  40.924  24.133  1.00 134.80 ? 136  LYS A CA    1 
ATOM   1822  C  C     . LYS E 3 130 ? 13.467  40.324  22.896  1.00 134.80 ? 136  LYS A C     1 
ATOM   1823  O  O     . LYS E 3 130 ? 13.271  39.151  22.587  1.00 134.80 ? 136  LYS A O     1 
ATOM   1824  C  CB    . LYS E 3 130 ? 11.533  41.702  23.738  1.00 86.06  ? 136  LYS A CB    1 
ATOM   1825  N  N     . GLY E 3 131 ? 14.268  41.129  22.202  1.00 115.44 ? 137  GLY A N     1 
ATOM   1826  C  CA    . GLY E 3 131 ? 14.957  40.653  21.014  1.00 115.44 ? 137  GLY A CA    1 
ATOM   1827  C  C     . GLY E 3 131 ? 16.034  39.634  21.342  1.00 115.44 ? 137  GLY A C     1 
ATOM   1828  O  O     . GLY E 3 131 ? 16.433  38.840  20.489  1.00 115.44 ? 137  GLY A O     1 
ATOM   1829  N  N     . GLU E 3 132 ? 16.517  39.659  22.579  1.00 95.57  ? 138  GLU A N     1 
ATOM   1830  C  CA    . GLU E 3 132 ? 17.541  38.718  23.005  1.00 95.57  ? 138  GLU A CA    1 
ATOM   1831  C  C     . GLU E 3 132 ? 16.947  37.316  22.937  1.00 95.57  ? 138  GLU A C     1 
ATOM   1832  O  O     . GLU E 3 132 ? 17.656  36.343  22.679  1.00 95.57  ? 138  GLU A O     1 
ATOM   1833  C  CB    . GLU E 3 132 ? 17.980  39.027  24.439  1.00 74.67  ? 138  GLU A CB    1 
ATOM   1834  N  N     . TYR E 3 133 ? 15.636  37.234  23.168  1.00 63.02  ? 139  TYR A N     1 
ATOM   1835  C  CA    . TYR E 3 133 ? 14.884  35.974  23.143  1.00 63.02  ? 139  TYR A CA    1 
ATOM   1836  C  C     . TYR E 3 133 ? 14.575  35.575  21.704  1.00 63.02  ? 139  TYR A C     1 
ATOM   1837  O  O     . TYR E 3 133 ? 14.424  34.392  21.393  1.00 63.02  ? 139  TYR A O     1 
ATOM   1838  C  CB    . TYR E 3 133 ? 13.552  36.134  23.913  1.00 57.69  ? 139  TYR A CB    1 
ATOM   1839  C  CG    . TYR E 3 133 ? 12.630  34.919  23.861  1.00 57.69  ? 139  TYR A CG    1 
ATOM   1840  C  CD1   . TYR E 3 133 ? 12.871  33.802  24.665  1.00 57.69  ? 139  TYR A CD1   1 
ATOM   1841  C  CD2   . TYR E 3 133 ? 11.567  34.860  22.957  1.00 57.69  ? 139  TYR A CD2   1 
ATOM   1842  C  CE1   . TYR E 3 133 ? 12.085  32.657  24.567  1.00 57.69  ? 139  TYR A CE1   1 
ATOM   1843  C  CE2   . TYR E 3 133 ? 10.780  33.716  22.847  1.00 57.69  ? 139  TYR A CE2   1 
ATOM   1844  C  CZ    . TYR E 3 133 ? 11.044  32.614  23.656  1.00 57.69  ? 139  TYR A CZ    1 
ATOM   1845  O  OH    . TYR E 3 133 ? 10.284  31.468  23.546  1.00 57.69  ? 139  TYR A OH    1 
ATOM   1846  N  N     . LYS E 3 134 ? 14.467  36.571  20.831  1.00 50.07  ? 140  LYS A N     1 
ATOM   1847  C  CA    . LYS E 3 134 ? 14.151  36.291  19.441  1.00 50.07  ? 140  LYS A CA    1 
ATOM   1848  C  C     . LYS E 3 134 ? 15.266  35.540  18.772  1.00 50.07  ? 140  LYS A C     1 
ATOM   1849  O  O     . LYS E 3 134 ? 15.060  34.425  18.300  1.00 50.07  ? 140  LYS A O     1 
ATOM   1850  C  CB    . LYS E 3 134 ? 13.878  37.559  18.632  1.00 59.49  ? 140  LYS A CB    1 
ATOM   1851  C  CG    . LYS E 3 134 ? 13.554  37.224  17.190  1.00 59.49  ? 140  LYS A CG    1 
ATOM   1852  C  CD    . LYS E 3 134 ? 13.309  38.450  16.341  1.00 59.49  ? 140  LYS A CD    1 
ATOM   1853  C  CE    . LYS E 3 134 ? 12.891  38.054  14.917  1.00 59.49  ? 140  LYS A CE    1 
ATOM   1854  N  NZ    . LYS E 3 134 ? 13.051  39.171  13.930  1.00 59.49  ? 140  LYS A NZ    1 
ATOM   1855  N  N     . ASP E 3 135 ? 16.444  36.160  18.739  1.00 78.56  ? 141  ASP A N     1 
ATOM   1856  C  CA    . ASP E 3 135 ? 17.624  35.572  18.118  1.00 78.56  ? 141  ASP A CA    1 
ATOM   1857  C  C     . ASP E 3 135 ? 18.059  34.301  18.835  1.00 78.56  ? 141  ASP A C     1 
ATOM   1858  O  O     . ASP E 3 135 ? 18.580  33.376  18.218  1.00 78.56  ? 141  ASP A O     1 
ATOM   1859  C  CB    . ASP E 3 135 ? 18.760  36.589  18.124  1.00 115.63 ? 141  ASP A CB    1 
ATOM   1860  C  CG    . ASP E 3 135 ? 18.281  37.987  17.798  1.00 115.63 ? 141  ASP A CG    1 
ATOM   1861  O  OD1   . ASP E 3 135 ? 17.597  38.162  16.765  1.00 115.63 ? 141  ASP A OD1   1 
ATOM   1862  O  OD2   . ASP E 3 135 ? 18.586  38.911  18.579  1.00 115.63 ? 141  ASP A OD2   1 
ATOM   1863  N  N     . ASP E 3 136 ? 17.849  34.260  20.144  1.00 59.44  ? 142  ASP A N     1 
ATOM   1864  C  CA    . ASP E 3 136 ? 18.204  33.085  20.938  1.00 59.44  ? 142  ASP A CA    1 
ATOM   1865  C  C     . ASP E 3 136 ? 17.372  31.882  20.451  1.00 59.44  ? 142  ASP A C     1 
ATOM   1866  O  O     . ASP E 3 136 ? 17.826  30.744  20.510  1.00 59.44  ? 142  ASP A O     1 
ATOM   1867  C  CB    . ASP E 3 136 ? 17.918  33.351  22.422  1.00 94.34  ? 142  ASP A CB    1 
ATOM   1868  C  CG    . ASP E 3 136 ? 18.583  32.344  23.340  1.00 94.34  ? 142  ASP A CG    1 
ATOM   1869  O  OD1   . ASP E 3 136 ? 19.730  32.602  23.769  1.00 94.34  ? 142  ASP A OD1   1 
ATOM   1870  O  OD2   . ASP E 3 136 ? 17.961  31.297  23.629  1.00 94.34  ? 142  ASP A OD2   1 
ATOM   1871  N  N     . PHE E 3 137 ? 16.157  32.162  19.970  1.00 51.08  ? 143  PHE A N     1 
ATOM   1872  C  CA    . PHE E 3 137 ? 15.213  31.163  19.468  1.00 51.08  ? 143  PHE A CA    1 
ATOM   1873  C  C     . PHE E 3 137 ? 15.430  31.010  17.985  1.00 51.08  ? 143  PHE A C     1 
ATOM   1874  O  O     . PHE E 3 137 ? 15.469  29.903  17.466  1.00 51.08  ? 143  PHE A O     1 
ATOM   1875  C  CB    . PHE E 3 137 ? 13.773  31.641  19.698  1.00 54.19  ? 143  PHE A CB    1 
ATOM   1876  C  CG    . PHE E 3 137 ? 12.704  30.709  19.133  1.00 54.19  ? 143  PHE A CG    1 
ATOM   1877  C  CD1   . PHE E 3 137 ? 12.306  29.564  19.832  1.00 54.19  ? 143  PHE A CD1   1 
ATOM   1878  C  CD2   . PHE E 3 137 ? 12.087  30.988  17.922  1.00 54.19  ? 143  PHE A CD2   1 
ATOM   1879  C  CE1   . PHE E 3 137 ? 11.314  28.726  19.329  1.00 54.19  ? 143  PHE A CE1   1 
ATOM   1880  C  CE2   . PHE E 3 137 ? 11.107  30.162  17.422  1.00 54.19  ? 143  PHE A CE2   1 
ATOM   1881  C  CZ    . PHE E 3 137 ? 10.721  29.032  18.126  1.00 54.19  ? 143  PHE A CZ    1 
ATOM   1882  N  N     . LYS E 3 138 ? 15.543  32.143  17.305  1.00 65.87  ? 144  LYS A N     1 
ATOM   1883  C  CA    . LYS E 3 138 ? 15.756  32.137  15.868  1.00 65.87  ? 144  LYS A CA    1 
ATOM   1884  C  C     . LYS E 3 138 ? 16.981  31.295  15.591  1.00 65.87  ? 144  LYS A C     1 
ATOM   1885  O  O     . LYS E 3 138 ? 16.905  30.332  14.845  1.00 65.87  ? 144  LYS A O     1 
ATOM   1886  C  CB    . LYS E 3 138 ? 15.964  33.556  15.323  1.00 84.26  ? 144  LYS A CB    1 
ATOM   1887  N  N     . ARG E 3 139 ? 18.107  31.644  16.205  1.00 79.07  ? 145  ARG A N     1 
ATOM   1888  C  CA    . ARG E 3 139 ? 19.338  30.889  16.005  1.00 79.07  ? 145  ARG A CA    1 
ATOM   1889  C  C     . ARG E 3 139 ? 19.115  29.395  16.255  1.00 79.07  ? 145  ARG A C     1 
ATOM   1890  O  O     . ARG E 3 139 ? 19.228  28.578  15.335  1.00 79.07  ? 145  ARG A O     1 
ATOM   1891  C  CB    . ARG E 3 139 ? 20.440  31.406  16.941  1.00 86.41  ? 145  ARG A CB    1 
ATOM   1892  N  N     . MET E 3 140 ? 18.793  29.044  17.499  1.00 63.79  ? 146  MET A N     1 
ATOM   1893  C  CA    . MET E 3 140 ? 18.561  27.650  17.885  1.00 63.79  ? 146  MET A CA    1 
ATOM   1894  C  C     . MET E 3 140 ? 17.613  26.886  16.965  1.00 63.79  ? 146  MET A C     1 
ATOM   1895  O  O     . MET E 3 140 ? 17.318  25.717  17.216  1.00 63.79  ? 146  MET A O     1 
ATOM   1896  C  CB    . MET E 3 140 ? 18.022  27.574  19.318  1.00 45.98  ? 146  MET A CB    1 
ATOM   1897  N  N     . LEU E 3 141 ? 17.126  27.540  15.916  1.00 121.92 ? 147  LEU A N     1 
ATOM   1898  C  CA    . LEU E 3 141 ? 16.217  26.903  14.972  1.00 121.92 ? 147  LEU A CA    1 
ATOM   1899  C  C     . LEU E 3 141 ? 16.506  27.362  13.545  1.00 121.92 ? 147  LEU A C     1 
ATOM   1900  O  O     . LEU E 3 141 ? 16.036  26.752  12.584  1.00 121.92 ? 147  LEU A O     1 
ATOM   1901  C  CB    . LEU E 3 141 ? 14.761  27.219  15.333  1.00 81.79  ? 147  LEU A CB    1 
ATOM   1902  N  N     . GLU E 3 142 ? 17.281  28.439  13.413  1.00 126.98 ? 148  GLU A N     1 
ATOM   1903  C  CA    . GLU E 3 142 ? 17.644  28.984  12.103  1.00 126.98 ? 148  GLU A CA    1 
ATOM   1904  C  C     . GLU E 3 142 ? 18.839  28.215  11.555  1.00 126.98 ? 148  GLU A C     1 
ATOM   1905  O  O     . GLU E 3 142 ? 19.409  28.568  10.521  1.00 126.98 ? 148  GLU A O     1 
ATOM   1906  C  CB    . GLU E 3 142 ? 18.005  30.469  12.219  1.00 115.31 ? 148  GLU A CB    1 
ATOM   1907  N  N     . GLU E 3 143 ? 19.209  27.162  12.274  1.00 141.53 ? 149  GLU A N     1 
ATOM   1908  C  CA    . GLU E 3 143 ? 20.319  26.310  11.892  1.00 141.53 ? 149  GLU A CA    1 
ATOM   1909  C  C     . GLU E 3 143 ? 19.793  24.899  11.620  1.00 141.53 ? 149  GLU A C     1 
ATOM   1910  O  O     . GLU E 3 143 ? 20.365  24.162  10.815  1.00 141.53 ? 149  GLU A O     1 
ATOM   1911  C  CB    . GLU E 3 143 ? 21.361  26.286  13.014  1.00 92.79  ? 149  GLU A CB    1 
ATOM   1912  N  N     . GLN E 3 144 ? 18.691  24.547  12.284  1.00 114.54 ? 150  GLN A N     1 
ATOM   1913  C  CA    . GLN E 3 144 ? 18.057  23.231  12.146  1.00 114.54 ? 150  GLN A CA    1 
ATOM   1914  C  C     . GLN E 3 144 ? 17.107  23.157  10.938  1.00 114.54 ? 150  GLN A C     1 
ATOM   1915  O  O     . GLN E 3 144 ? 16.035  22.545  11.005  1.00 114.54 ? 150  GLN A O     1 
ATOM   1916  C  CB    . GLN E 3 144 ? 17.280  22.897  13.426  1.00 109.00 ? 150  GLN A CB    1 
ATOM   1917  C  CG    . GLN E 3 144 ? 17.923  23.434  14.689  1.00 109.00 ? 150  GLN A CG    1 
ATOM   1918  C  CD    . GLN E 3 144 ? 19.389  23.074  14.787  1.00 109.00 ? 150  GLN A CD    1 
ATOM   1919  O  OE1   . GLN E 3 144 ? 19.745  21.900  14.837  1.00 109.00 ? 150  GLN A OE1   1 
ATOM   1920  N  NE2   . GLN E 3 144 ? 20.248  24.085  14.812  1.00 109.00 ? 150  GLN A NE2   1 
ATOM   1921  N  N     . GLY E 3 145 ? 17.514  23.789  9.841   1.00 174.42 ? 151  GLY A N     1 
ATOM   1922  C  CA    . GLY E 3 145 ? 16.705  23.789  8.636   1.00 174.42 ? 151  GLY A CA    1 
ATOM   1923  C  C     . GLY E 3 145 ? 15.443  24.622  8.746   1.00 174.42 ? 151  GLY A C     1 
ATOM   1924  O  O     . GLY E 3 145 ? 15.071  25.325  7.800   1.00 174.42 ? 151  GLY A O     1 
ATOM   1925  N  N     . GLU E 3 146 ? 14.786  24.551  9.900   1.00 123.57 ? 152  GLU A N     1 
ATOM   1926  C  CA    . GLU E 3 146 ? 13.550  25.292  10.115  1.00 123.57 ? 152  GLU A CA    1 
ATOM   1927  C  C     . GLU E 3 146 ? 13.729  26.795  9.909   1.00 123.57 ? 152  GLU A C     1 
ATOM   1928  O  O     . GLU E 3 146 ? 14.346  27.484  10.723  1.00 123.57 ? 152  GLU A O     1 
ATOM   1929  C  CB    . GLU E 3 146 ? 13.010  24.996  11.512  1.00 75.48  ? 152  GLU A CB    1 
ATOM   1930  C  CG    . GLU E 3 146 ? 12.942  23.501  11.838  1.00 75.48  ? 152  GLU A CG    1 
ATOM   1931  C  CD    . GLU E 3 146 ? 11.983  23.189  12.973  1.00 75.48  ? 152  GLU A CD    1 
ATOM   1932  O  OE1   . GLU E 3 146 ? 12.049  22.063  13.508  1.00 75.48  ? 152  GLU A OE1   1 
ATOM   1933  O  OE2   . GLU E 3 146 ? 11.160  24.064  13.322  1.00 75.48  ? 152  GLU A OE2   1 
ATOM   1934  N  N     . GLU E 3 147 ? 13.195  27.291  8.799   1.00 129.81 ? 153  GLU A N     1 
ATOM   1935  C  CA    . GLU E 3 147 ? 13.290  28.708  8.477   1.00 129.81 ? 153  GLU A CA    1 
ATOM   1936  C  C     . GLU E 3 147 ? 12.449  29.504  9.466   1.00 129.81 ? 153  GLU A C     1 
ATOM   1937  O  O     . GLU E 3 147 ? 11.299  29.153  9.737   1.00 129.81 ? 153  GLU A O     1 
ATOM   1938  C  CB    . GLU E 3 147 ? 12.790  28.970  7.047   1.00 59.27  ? 153  GLU A CB    1 
ATOM   1939  N  N     . TYR E 3 148 ? 13.025  30.568  10.017  1.00 124.58 ? 154  TYR A N     1 
ATOM   1940  C  CA    . TYR E 3 148 ? 12.289  31.395  10.961  1.00 124.58 ? 154  TYR A CA    1 
ATOM   1941  C  C     . TYR E 3 148 ? 11.057  31.898  10.258  1.00 124.58 ? 154  TYR A C     1 
ATOM   1942  O  O     . TYR E 3 148 ? 11.122  32.316  9.097   1.00 124.58 ? 154  TYR A O     1 
ATOM   1943  C  CB    . TYR E 3 148 ? 13.086  32.617  11.407  1.00 69.88  ? 154  TYR A CB    1 
ATOM   1944  C  CG    . TYR E 3 148 ? 12.375  33.425  12.470  1.00 69.88  ? 154  TYR A CG    1 
ATOM   1945  C  CD1   . TYR E 3 148 ? 12.281  32.948  13.782  1.00 69.88  ? 154  TYR A CD1   1 
ATOM   1946  C  CD2   . TYR E 3 148 ? 11.808  34.663  12.175  1.00 69.88  ? 154  TYR A CD2   1 
ATOM   1947  C  CE1   . TYR E 3 148 ? 11.648  33.683  14.782  1.00 69.88  ? 154  TYR A CE1   1 
ATOM   1948  C  CE2   . TYR E 3 148 ? 11.169  35.414  13.167  1.00 69.88  ? 154  TYR A CE2   1 
ATOM   1949  C  CZ    . TYR E 3 148 ? 11.095  34.918  14.476  1.00 69.88  ? 154  TYR A CZ    1 
ATOM   1950  O  OH    . TYR E 3 148 ? 10.500  35.660  15.487  1.00 69.88  ? 154  TYR A OH    1 
ATOM   1951  N  N     . VAL E 3 149 ? 9.937   31.861  10.967  1.00 63.21  ? 155  VAL A N     1 
ATOM   1952  C  CA    . VAL E 3 149 ? 8.678   32.335  10.414  1.00 63.21  ? 155  VAL A CA    1 
ATOM   1953  C  C     . VAL E 3 149 ? 8.298   33.654  11.099  1.00 63.21  ? 155  VAL A C     1 
ATOM   1954  O  O     . VAL E 3 149 ? 8.300   33.736  12.319  1.00 63.21  ? 155  VAL A O     1 
ATOM   1955  C  CB    . VAL E 3 149 ? 7.558   31.265  10.611  1.00 78.47  ? 155  VAL A CB    1 
ATOM   1956  C  CG1   . VAL E 3 149 ? 6.297   31.684  9.887   1.00 78.47  ? 155  VAL A CG1   1 
ATOM   1957  C  CG2   . VAL E 3 149 ? 8.021   29.913  10.079  1.00 78.47  ? 155  VAL A CG2   1 
ATOM   1958  N  N     . ASP E 3 150 ? 8.009   34.675  10.294  1.00 89.36  ? 156  ASP A N     1 
ATOM   1959  C  CA    . ASP E 3 150 ? 7.613   36.001  10.778  1.00 89.36  ? 156  ASP A CA    1 
ATOM   1960  C  C     . ASP E 3 150 ? 7.933   36.266  12.242  1.00 89.36  ? 156  ASP A C     1 
ATOM   1961  O  O     . ASP E 3 150 ? 8.915   36.936  12.556  1.00 89.36  ? 156  ASP A O     1 
ATOM   1962  C  CB    . ASP E 3 150 ? 6.110   36.216  10.555  1.00 105.53 ? 156  ASP A CB    1 
ATOM   1963  N  N     . GLY E 3 151 ? 7.084   35.752  13.130  1.00 76.54  ? 157  GLY A N     1 
ATOM   1964  C  CA    . GLY E 3 151 ? 7.286   35.939  14.557  1.00 76.54  ? 157  GLY A CA    1 
ATOM   1965  C  C     . GLY E 3 151 ? 6.864   34.730  15.374  1.00 76.54  ? 157  GLY A C     1 
ATOM   1966  O  O     . GLY E 3 151 ? 6.255   34.851  16.439  1.00 76.54  ? 157  GLY A O     1 
ATOM   1967  N  N     . MET E 3 152 ? 7.209   33.551  14.875  1.00 65.70  ? 158  MET A N     1 
ATOM   1968  C  CA    . MET E 3 152 ? 6.864   32.306  15.534  1.00 65.70  ? 158  MET A CA    1 
ATOM   1969  C  C     . MET E 3 152 ? 7.532   32.096  16.877  1.00 65.70  ? 158  MET A C     1 
ATOM   1970  O  O     . MET E 3 152 ? 7.298   31.087  17.540  1.00 65.70  ? 158  MET A O     1 
ATOM   1971  C  CB    . MET E 3 152 ? 7.198   31.133  14.622  1.00 72.33  ? 158  MET A CB    1 
ATOM   1972  C  CG    . MET E 3 152 ? 8.647   30.976  14.286  1.00 72.33  ? 158  MET A CG    1 
ATOM   1973  S  SD    . MET E 3 152 ? 8.849   29.382  13.509  1.00 72.33  ? 158  MET A SD    1 
ATOM   1974  C  CE    . MET E 3 152 ? 8.416   28.264  14.886  1.00 72.33  ? 158  MET A CE    1 
ATOM   1975  N  N     . GLU E 3 153 ? 8.365   33.041  17.285  1.00 58.62  ? 159  GLU A N     1 
ATOM   1976  C  CA    . GLU E 3 153 ? 9.044   32.906  18.556  1.00 58.62  ? 159  GLU A CA    1 
ATOM   1977  C  C     . GLU E 3 153 ? 8.077   33.030  19.719  1.00 58.62  ? 159  GLU A C     1 
ATOM   1978  O  O     . GLU E 3 153 ? 8.458   32.820  20.867  1.00 58.62  ? 159  GLU A O     1 
ATOM   1979  C  CB    . GLU E 3 153 ? 10.141  33.954  18.672  1.00 79.30  ? 159  GLU A CB    1 
ATOM   1980  C  CG    . GLU E 3 153 ? 9.781   35.272  18.061  1.00 79.30  ? 159  GLU A CG    1 
ATOM   1981  C  CD    . GLU E 3 153 ? 10.171  36.427  18.950  1.00 79.30  ? 159  GLU A CD    1 
ATOM   1982  O  OE1   . GLU E 3 153 ? 10.179  37.582  18.466  1.00 79.30  ? 159  GLU A OE1   1 
ATOM   1983  O  OE2   . GLU E 3 153 ? 10.459  36.180  20.143  1.00 79.30  ? 159  GLU A OE2   1 
ATOM   1984  N  N     . TRP E 3 154 ? 6.819   33.347  19.420  1.00 62.05  ? 160  TRP A N     1 
ATOM   1985  C  CA    . TRP E 3 154 ? 5.815   33.500  20.465  1.00 62.05  ? 160  TRP A CA    1 
ATOM   1986  C  C     . TRP E 3 154 ? 4.557   32.663  20.310  1.00 62.05  ? 160  TRP A C     1 
ATOM   1987  O  O     . TRP E 3 154 ? 3.680   32.685  21.181  1.00 62.05  ? 160  TRP A O     1 
ATOM   1988  C  CB    . TRP E 3 154 ? 5.418   34.940  20.564  1.00 39.20  ? 160  TRP A CB    1 
ATOM   1989  C  CG    . TRP E 3 154 ? 6.500   35.826  20.951  1.00 39.20  ? 160  TRP A CG    1 
ATOM   1990  C  CD1   . TRP E 3 154 ? 7.159   36.704  20.154  1.00 39.20  ? 160  TRP A CD1   1 
ATOM   1991  C  CD2   . TRP E 3 154 ? 6.975   36.039  22.268  1.00 39.20  ? 160  TRP A CD2   1 
ATOM   1992  N  NE1   . TRP E 3 154 ? 8.015   37.474  20.901  1.00 39.20  ? 160  TRP A NE1   1 
ATOM   1993  C  CE2   . TRP E 3 154 ? 7.921   37.081  22.208  1.00 39.20  ? 160  TRP A CE2   1 
ATOM   1994  C  CE3   . TRP E 3 154 ? 6.691   35.453  23.501  1.00 39.20  ? 160  TRP A CE3   1 
ATOM   1995  C  CZ2   . TRP E 3 154 ? 8.582   37.551  23.333  1.00 39.20  ? 160  TRP A CZ2   1 
ATOM   1996  C  CZ3   . TRP E 3 154 ? 7.346   35.921  24.627  1.00 39.20  ? 160  TRP A CZ3   1 
ATOM   1997  C  CH2   . TRP E 3 154 ? 8.280   36.961  24.535  1.00 39.20  ? 160  TRP A CH2   1 
ATOM   1998  N  N     . TRP E 3 155 ? 4.462   31.939  19.200  1.00 65.27  ? 161  TRP A N     1 
ATOM   1999  C  CA    . TRP E 3 155 ? 3.311   31.089  18.951  1.00 65.27  ? 161  TRP A CA    1 
ATOM   2000  C  C     . TRP E 3 155 ? 3.146   30.086  20.091  1.00 65.27  ? 161  TRP A C     1 
ATOM   2001  O  O     . TRP E 3 155 ? 2.068   29.957  20.666  1.00 65.27  ? 161  TRP A O     1 
ATOM   2002  C  CB    . TRP E 3 155 ? 3.489   30.313  17.649  1.00 35.13  ? 161  TRP A CB    1 
ATOM   2003  C  CG    . TRP E 3 155 ? 3.685   31.137  16.411  1.00 35.13  ? 161  TRP A CG    1 
ATOM   2004  C  CD1   . TRP E 3 155 ? 3.550   32.489  16.289  1.00 35.13  ? 161  TRP A CD1   1 
ATOM   2005  C  CD2   . TRP E 3 155 ? 4.014   30.645  15.093  1.00 35.13  ? 161  TRP A CD2   1 
ATOM   2006  N  NE1   . TRP E 3 155 ? 3.772   32.872  14.974  1.00 35.13  ? 161  TRP A NE1   1 
ATOM   2007  C  CE2   . TRP E 3 155 ? 4.059   31.758  14.226  1.00 35.13  ? 161  TRP A CE2   1 
ATOM   2008  C  CE3   . TRP E 3 155 ? 4.273   29.375  14.569  1.00 35.13  ? 161  TRP A CE3   1 
ATOM   2009  C  CZ2   . TRP E 3 155 ? 4.355   31.638  12.867  1.00 35.13  ? 161  TRP A CZ2   1 
ATOM   2010  C  CZ3   . TRP E 3 155 ? 4.565   29.263  13.211  1.00 35.13  ? 161  TRP A CZ3   1 
ATOM   2011  C  CH2   . TRP E 3 155 ? 4.604   30.389  12.381  1.00 35.13  ? 161  TRP A CH2   1 
ATOM   2012  N  N     . ASN E 3 156 ? 4.223   29.375  20.414  1.00 53.54  ? 162  ASN A N     1 
ATOM   2013  C  CA    . ASN E 3 156 ? 4.173   28.371  21.465  1.00 53.54  ? 162  ASN A CA    1 
ATOM   2014  C  C     . ASN E 3 156 ? 5.212   28.471  22.581  1.00 53.54  ? 162  ASN A C     1 
ATOM   2015  O  O     . ASN E 3 156 ? 6.375   28.800  22.353  1.00 53.54  ? 162  ASN A O     1 
ATOM   2016  C  CB    . ASN E 3 156 ? 4.217   26.978  20.838  1.00 112.41 ? 162  ASN A CB    1 
ATOM   2017  C  CG    . ASN E 3 156 ? 2.884   26.570  20.245  1.00 112.41 ? 162  ASN A CG    1 
ATOM   2018  O  OD1   . ASN E 3 156 ? 1.899   26.392  20.967  1.00 112.41 ? 162  ASN A OD1   1 
ATOM   2019  N  ND2   . ASN E 3 156 ? 2.839   26.429  18.926  1.00 112.41 ? 162  ASN A ND2   1 
ATOM   2020  N  N     . PHE E 3 157 ? 4.742   28.172  23.793  1.00 49.39  ? 163  PHE A N     1 
ATOM   2021  C  CA    . PHE E 3 157 ? 5.530   28.176  25.026  1.00 49.39  ? 163  PHE A CA    1 
ATOM   2022  C  C     . PHE E 3 157 ? 6.668   27.184  24.954  1.00 49.39  ? 163  PHE A C     1 
ATOM   2023  O  O     . PHE E 3 157 ? 6.613   26.206  24.223  1.00 49.39  ? 163  PHE A O     1 
ATOM   2024  C  CB    . PHE E 3 157 ? 4.651   27.778  26.218  1.00 58.61  ? 163  PHE A CB    1 
ATOM   2025  C  CG    . PHE E 3 157 ? 5.430   27.371  27.444  1.00 58.61  ? 163  PHE A CG    1 
ATOM   2026  C  CD1   . PHE E 3 157 ? 5.997   28.326  28.285  1.00 58.61  ? 163  PHE A CD1   1 
ATOM   2027  C  CD2   . PHE E 3 157 ? 5.635   26.032  27.739  1.00 58.61  ? 163  PHE A CD2   1 
ATOM   2028  C  CE1   . PHE E 3 157 ? 6.763   27.939  29.407  1.00 58.61  ? 163  PHE A CE1   1 
ATOM   2029  C  CE2   . PHE E 3 157 ? 6.398   25.646  28.856  1.00 58.61  ? 163  PHE A CE2   1 
ATOM   2030  C  CZ    . PHE E 3 157 ? 6.958   26.596  29.684  1.00 58.61  ? 163  PHE A CZ    1 
ATOM   2031  N  N     . ASN E 3 158 ? 7.701   27.414  25.740  1.00 70.12  ? 164  ASN A N     1 
ATOM   2032  C  CA    . ASN E 3 158 ? 8.819   26.503  25.740  1.00 70.12  ? 164  ASN A CA    1 
ATOM   2033  C  C     . ASN E 3 158 ? 9.734   26.885  26.874  1.00 70.12  ? 164  ASN A C     1 
ATOM   2034  O  O     . ASN E 3 158 ? 9.478   27.871  27.568  1.00 70.12  ? 164  ASN A O     1 
ATOM   2035  C  CB    . ASN E 3 158 ? 9.553   26.571  24.403  1.00 47.79  ? 164  ASN A CB    1 
ATOM   2036  C  CG    . ASN E 3 158 ? 10.225  27.896  24.176  1.00 47.79  ? 164  ASN A CG    1 
ATOM   2037  O  OD1   . ASN E 3 158 ? 10.486  28.284  23.035  1.00 47.79  ? 164  ASN A OD1   1 
ATOM   2038  N  ND2   . ASN E 3 158 ? 10.524  28.599  25.256  1.00 47.79  ? 164  ASN A ND2   1 
ATOM   2039  N  N     . GLU E 3 159 ? 10.809  26.122  27.056  1.00 69.90  ? 165  GLU A N     1 
ATOM   2040  C  CA    . GLU E 3 159 ? 11.736  26.395  28.143  1.00 69.90  ? 165  GLU A CA    1 
ATOM   2041  C  C     . GLU E 3 159 ? 12.506  27.699  27.991  1.00 69.90  ? 165  GLU A C     1 
ATOM   2042  O  O     . GLU E 3 159 ? 12.554  28.490  28.931  1.00 69.90  ? 165  GLU A O     1 
ATOM   2043  C  CB    . GLU E 3 159 ? 12.691  25.223  28.323  1.00 71.87  ? 165  GLU A CB    1 
ATOM   2044  C  CG    . GLU E 3 159 ? 12.016  23.998  28.906  1.00 71.87  ? 165  GLU A CG    1 
ATOM   2045  C  CD    . GLU E 3 159 ? 11.270  24.304  30.201  1.00 71.87  ? 165  GLU A CD    1 
ATOM   2046  O  OE1   . GLU E 3 159 ? 11.722  25.221  30.928  1.00 71.87  ? 165  GLU A OE1   1 
ATOM   2047  O  OE2   . GLU E 3 159 ? 10.249  23.620  30.492  1.00 71.87  ? 165  GLU A OE2   1 
ATOM   2048  N  N     . GLU E 3 160 ? 13.099  27.935  26.820  1.00 36.86  ? 166  GLU A N     1 
ATOM   2049  C  CA    . GLU E 3 160 ? 13.842  29.166  26.615  1.00 36.86  ? 166  GLU A CA    1 
ATOM   2050  C  C     . GLU E 3 160 ? 12.988  30.272  27.152  1.00 36.86  ? 166  GLU A C     1 
ATOM   2051  O  O     . GLU E 3 160 ? 13.429  31.026  28.014  1.00 36.86  ? 166  GLU A O     1 
ATOM   2052  C  CB    . GLU E 3 160 ? 14.122  29.408  25.144  1.00 26.74  ? 166  GLU A CB    1 
ATOM   2053  N  N     . MET E 3 161 ? 11.753  30.335  26.653  1.00 62.55  ? 167  MET A N     1 
ATOM   2054  C  CA    . MET E 3 161 ? 10.760  31.329  27.063  1.00 62.55  ? 167  MET A CA    1 
ATOM   2055  C  C     . MET E 3 161 ? 10.527  31.312  28.574  1.00 62.55  ? 167  MET A C     1 
ATOM   2056  O  O     . MET E 3 161 ? 10.447  32.359  29.221  1.00 62.55  ? 167  MET A O     1 
ATOM   2057  C  CB    . MET E 3 161 ? 9.435   31.063  26.352  1.00 58.05  ? 167  MET A CB    1 
ATOM   2058  C  CG    . MET E 3 161 ? 8.356   32.077  26.686  1.00 58.05  ? 167  MET A CG    1 
ATOM   2059  S  SD    . MET E 3 161 ? 6.797   31.805  25.856  1.00 58.05  ? 167  MET A SD    1 
ATOM   2060  C  CE    . MET E 3 161 ? 7.216   32.243  24.186  1.00 58.05  ? 167  MET A CE    1 
ATOM   2061  N  N     . MET E 3 162 ? 10.415  30.115  29.134  1.00 48.33  ? 168  MET A N     1 
ATOM   2062  C  CA    . MET E 3 162 ? 10.197  29.984  30.557  1.00 48.33  ? 168  MET A CA    1 
ATOM   2063  C  C     . MET E 3 162 ? 11.354  30.579  31.305  1.00 48.33  ? 168  MET A C     1 
ATOM   2064  O  O     . MET E 3 162 ? 11.188  31.020  32.437  1.00 48.33  ? 168  MET A O     1 
ATOM   2065  C  CB    . MET E 3 162 ? 10.080  28.534  30.950  1.00 60.37  ? 168  MET A CB    1 
ATOM   2066  C  CG    . MET E 3 162 ? 9.911   28.343  32.430  1.00 60.37  ? 168  MET A CG    1 
ATOM   2067  S  SD    . MET E 3 162 ? 8.324   28.928  32.991  1.00 60.37  ? 168  MET A SD    1 
ATOM   2068  C  CE    . MET E 3 162 ? 8.824   30.158  34.236  1.00 60.37  ? 168  MET A CE    1 
ATOM   2069  N  N     . ASP E 3 163 ? 12.533  30.566  30.677  1.00 75.75  ? 169  ASP A N     1 
ATOM   2070  C  CA    . ASP E 3 163 ? 13.757  31.111  31.276  1.00 75.75  ? 169  ASP A CA    1 
ATOM   2071  C  C     . ASP E 3 163 ? 13.759  32.627  31.214  1.00 75.75  ? 169  ASP A C     1 
ATOM   2072  O  O     . ASP E 3 163 ? 13.822  33.301  32.238  1.00 75.75  ? 169  ASP A O     1 
ATOM   2073  C  CB    . ASP E 3 163 ? 15.007  30.584  30.562  1.00 95.51  ? 169  ASP A CB    1 
ATOM   2074  C  CG    . ASP E 3 163 ? 15.419  29.201  31.040  1.00 95.51  ? 169  ASP A CG    1 
ATOM   2075  O  OD1   . ASP E 3 163 ? 15.022  28.818  32.165  1.00 95.51  ? 169  ASP A OD1   1 
ATOM   2076  O  OD2   . ASP E 3 163 ? 16.155  28.505  30.299  1.00 95.51  ? 169  ASP A OD2   1 
ATOM   2077  N  N     . TYR E 3 164 ? 13.701  33.162  30.001  1.00 90.01  ? 170  TYR A N     1 
ATOM   2078  C  CA    . TYR E 3 164 ? 13.683  34.602  29.819  1.00 90.01  ? 170  TYR A CA    1 
ATOM   2079  C  C     . TYR E 3 164 ? 12.568  35.180  30.691  1.00 90.01  ? 170  TYR A C     1 
ATOM   2080  O  O     . TYR E 3 164 ? 12.600  36.348  31.077  1.00 90.01  ? 170  TYR A O     1 
ATOM   2081  C  CB    . TYR E 3 164 ? 13.452  34.941  28.342  1.00 30.89  ? 170  TYR A CB    1 
ATOM   2082  N  N     . ASN E 3 165 ? 11.581  34.349  31.006  1.00 54.18  ? 171  ASN A N     1 
ATOM   2083  C  CA    . ASN E 3 165 ? 10.478  34.780  31.840  1.00 54.18  ? 171  ASN A CA    1 
ATOM   2084  C  C     . ASN E 3 165 ? 11.116  35.111  33.173  1.00 54.18  ? 171  ASN A C     1 
ATOM   2085  O  O     . ASN E 3 165 ? 11.248  36.276  33.542  1.00 54.18  ? 171  ASN A O     1 
ATOM   2086  C  CB    . ASN E 3 165 ? 9.477   33.636  32.001  1.00 68.61  ? 171  ASN A CB    1 
ATOM   2087  C  CG    . ASN E 3 165 ? 8.188   34.068  32.676  1.00 68.61  ? 171  ASN A CG    1 
ATOM   2088  O  OD1   . ASN E 3 165 ? 7.279   33.259  32.858  1.00 68.61  ? 171  ASN A OD1   1 
ATOM   2089  N  ND2   . ASN E 3 165 ? 8.100   35.340  33.050  1.00 68.61  ? 171  ASN A ND2   1 
ATOM   2090  N  N     . VAL E 3 166 ? 11.539  34.063  33.874  1.00 39.00  ? 172  VAL A N     1 
ATOM   2091  C  CA    . VAL E 3 166 ? 12.186  34.173  35.192  1.00 39.00  ? 172  VAL A CA    1 
ATOM   2092  C  C     . VAL E 3 166 ? 13.216  35.303  35.309  1.00 39.00  ? 172  VAL A C     1 
ATOM   2093  O  O     . VAL E 3 166 ? 13.331  35.928  36.359  1.00 39.00  ? 172  VAL A O     1 
ATOM   2094  C  CB    . VAL E 3 166 ? 12.893  32.847  35.564  1.00 28.06  ? 172  VAL A CB    1 
ATOM   2095  C  CG1   . VAL E 3 166 ? 13.483  32.943  36.951  1.00 28.06  ? 172  VAL A CG1   1 
ATOM   2096  C  CG2   . VAL E 3 166 ? 11.918  31.692  35.437  1.00 28.06  ? 172  VAL A CG2   1 
ATOM   2097  N  N     . GLN E 3 167 ? 13.973  35.552  34.242  1.00 57.94  ? 173  GLN A N     1 
ATOM   2098  C  CA    . GLN E 3 167 ? 14.972  36.607  34.288  1.00 57.94  ? 173  GLN A CA    1 
ATOM   2099  C  C     . GLN E 3 167 ? 14.291  37.964  34.285  1.00 57.94  ? 173  GLN A C     1 
ATOM   2100  O  O     . GLN E 3 167 ? 14.774  38.917  34.894  1.00 57.94  ? 173  GLN A O     1 
ATOM   2101  C  CB    . GLN E 3 167 ? 15.934  36.499  33.111  1.00 72.83  ? 173  GLN A CB    1 
ATOM   2102  C  CG    . GLN E 3 167 ? 17.317  37.052  33.428  1.00 72.83  ? 173  GLN A CG    1 
ATOM   2103  C  CD    . GLN E 3 167 ? 17.862  36.569  34.785  1.00 72.83  ? 173  GLN A CD    1 
ATOM   2104  O  OE1   . GLN E 3 167 ? 17.582  35.440  35.223  1.00 72.83  ? 173  GLN A OE1   1 
ATOM   2105  N  NE2   . GLN E 3 167 ? 18.656  37.422  35.448  1.00 72.83  ? 173  GLN A NE2   1 
ATOM   2106  N  N     . ASP E 3 168 ? 13.154  38.045  33.603  1.00 77.15  ? 174  ASP A N     1 
ATOM   2107  C  CA    . ASP E 3 168 ? 12.398  39.284  33.527  1.00 77.15  ? 174  ASP A CA    1 
ATOM   2108  C  C     . ASP E 3 168 ? 12.166  39.776  34.943  1.00 77.15  ? 174  ASP A C     1 
ATOM   2109  O  O     . ASP E 3 168 ? 12.520  40.900  35.292  1.00 77.15  ? 174  ASP A O     1 
ATOM   2110  C  CB    . ASP E 3 168 ? 11.051  39.037  32.841  1.00 137.40 ? 174  ASP A CB    1 
ATOM   2111  C  CG    . ASP E 3 168 ? 10.864  39.877  31.589  1.00 137.40 ? 174  ASP A CG    1 
ATOM   2112  O  OD1   . ASP E 3 168 ? 11.705  39.775  30.669  1.00 137.40 ? 174  ASP A OD1   1 
ATOM   2113  O  OD2   . ASP E 3 168 ? 9.870   40.635  31.524  1.00 137.40 ? 174  ASP A OD2   1 
ATOM   2114  N  N     . VAL E 3 169 ? 11.586  38.914  35.765  1.00 49.99  ? 175  VAL A N     1 
ATOM   2115  C  CA    . VAL E 3 169 ? 11.285  39.272  37.142  1.00 49.99  ? 175  VAL A CA    1 
ATOM   2116  C  C     . VAL E 3 169 ? 12.485  39.746  37.936  1.00 49.99  ? 175  VAL A C     1 
ATOM   2117  O  O     . VAL E 3 169 ? 12.393  40.730  38.680  1.00 49.99  ? 175  VAL A O     1 
ATOM   2118  C  CB    . VAL E 3 169 ? 10.626  38.098  37.902  1.00 34.86  ? 175  VAL A CB    1 
ATOM   2119  C  CG1   . VAL E 3 169 ? 10.640  38.367  39.418  1.00 34.86  ? 175  VAL A CG1   1 
ATOM   2120  C  CG2   . VAL E 3 169 ? 9.199   37.916  37.413  1.00 34.86  ? 175  VAL A CG2   1 
ATOM   2121  N  N     . VAL E 3 170 ? 13.612  39.059  37.798  1.00 55.39  ? 176  VAL A N     1 
ATOM   2122  C  CA    . VAL E 3 170 ? 14.770  39.490  38.565  1.00 55.39  ? 176  VAL A CA    1 
ATOM   2123  C  C     . VAL E 3 170 ? 15.133  40.934  38.175  1.00 55.39  ? 176  VAL A C     1 
ATOM   2124  O  O     . VAL E 3 170 ? 15.247  41.811  39.028  1.00 55.39  ? 176  VAL A O     1 
ATOM   2125  C  CB    . VAL E 3 170 ? 15.987  38.505  38.393  1.00 60.47  ? 176  VAL A CB    1 
ATOM   2126  C  CG1   . VAL E 3 170 ? 15.573  37.085  38.763  1.00 60.47  ? 176  VAL A CG1   1 
ATOM   2127  C  CG2   . VAL E 3 170 ? 16.522  38.555  36.983  1.00 60.47  ? 176  VAL A CG2   1 
ATOM   2128  N  N     . VAL E 3 171 ? 15.286  41.195  36.888  1.00 36.26  ? 177  VAL A N     1 
ATOM   2129  C  CA    . VAL E 3 171 ? 15.615  42.539  36.492  1.00 36.26  ? 177  VAL A CA    1 
ATOM   2130  C  C     . VAL E 3 171 ? 14.560  43.459  37.059  1.00 36.26  ? 177  VAL A C     1 
ATOM   2131  O  O     . VAL E 3 171 ? 14.862  44.567  37.478  1.00 36.26  ? 177  VAL A O     1 
ATOM   2132  C  CB    . VAL E 3 171 ? 15.631  42.699  34.982  1.00 10.43  ? 177  VAL A CB    1 
ATOM   2133  C  CG1   . VAL E 3 171 ? 16.048  44.124  34.644  1.00 10.43  ? 177  VAL A CG1   1 
ATOM   2134  C  CG2   . VAL E 3 171 ? 16.554  41.689  34.371  1.00 10.43  ? 177  VAL A CG2   1 
ATOM   2135  N  N     . THR E 3 172 ? 13.316  42.992  37.062  1.00 48.26  ? 178  THR A N     1 
ATOM   2136  C  CA    . THR E 3 172 ? 12.205  43.768  37.590  1.00 48.26  ? 178  THR A CA    1 
ATOM   2137  C  C     . THR E 3 172 ? 12.447  44.047  39.075  1.00 48.26  ? 178  THR A C     1 
ATOM   2138  O  O     . THR E 3 172 ? 12.581  45.200  39.471  1.00 48.26  ? 178  THR A O     1 
ATOM   2139  C  CB    . THR E 3 172 ? 10.907  43.005  37.393  1.00 45.13  ? 178  THR A CB    1 
ATOM   2140  O  OG1   . THR E 3 172 ? 10.738  42.756  35.994  1.00 45.13  ? 178  THR A OG1   1 
ATOM   2141  C  CG2   . THR E 3 172 ? 9.711   43.801  37.946  1.00 45.13  ? 178  THR A CG2   1 
ATOM   2142  N  N     . LYS E 3 173 ? 12.518  43.003  39.896  1.00 56.72  ? 179  LYS A N     1 
ATOM   2143  C  CA    . LYS E 3 173 ? 12.780  43.214  41.322  1.00 56.72  ? 179  LYS A CA    1 
ATOM   2144  C  C     . LYS E 3 173 ? 13.990  44.130  41.469  1.00 56.72  ? 179  LYS A C     1 
ATOM   2145  O  O     . LYS E 3 173 ? 14.029  44.982  42.352  1.00 56.72  ? 179  LYS A O     1 
ATOM   2146  C  CB    . LYS E 3 173 ? 13.078  41.896  42.059  1.00 29.74  ? 179  LYS A CB    1 
ATOM   2147  N  N     . ALA E 3 174 ? 14.982  43.949  40.602  1.00 64.11  ? 180  ALA A N     1 
ATOM   2148  C  CA    . ALA E 3 174 ? 16.181  44.774  40.640  1.00 64.11  ? 180  ALA A CA    1 
ATOM   2149  C  C     . ALA E 3 174 ? 15.796  46.248  40.500  1.00 64.11  ? 180  ALA A C     1 
ATOM   2150  O  O     . ALA E 3 174 ? 16.179  47.081  41.322  1.00 64.11  ? 180  ALA A O     1 
ATOM   2151  C  CB    . ALA E 3 174 ? 17.112  44.366  39.522  1.00 68.44  ? 180  ALA A CB    1 
ATOM   2152  N  N     . LEU E 3 175 ? 15.042  46.552  39.448  1.00 44.86  ? 181  LEU A N     1 
ATOM   2153  C  CA    . LEU E 3 175 ? 14.562  47.894  39.163  1.00 44.86  ? 181  LEU A CA    1 
ATOM   2154  C  C     . LEU E 3 175 ? 13.812  48.354  40.396  1.00 44.86  ? 181  LEU A C     1 
ATOM   2155  O  O     . LEU E 3 175 ? 14.233  49.262  41.098  1.00 44.86  ? 181  LEU A O     1 
ATOM   2156  C  CB    . LEU E 3 175 ? 13.555  47.851  38.024  1.00 32.41  ? 181  LEU A CB    1 
ATOM   2157  C  CG    . LEU E 3 175 ? 13.463  48.815  36.835  1.00 32.41  ? 181  LEU A CG    1 
ATOM   2158  C  CD1   . LEU E 3 175 ? 12.090  48.571  36.209  1.00 32.41  ? 181  LEU A CD1   1 
ATOM   2159  C  CD2   . LEU E 3 175 ? 13.647  50.277  37.209  1.00 32.41  ? 181  LEU A CD2   1 
ATOM   2160  N  N     . LEU E 3 176 ? 12.675  47.710  40.641  1.00 67.67  ? 182  LEU A N     1 
ATOM   2161  C  CA    . LEU E 3 176 ? 11.809  48.029  41.763  1.00 67.67  ? 182  LEU A CA    1 
ATOM   2162  C  C     . LEU E 3 176 ? 12.546  48.584  42.950  1.00 67.67  ? 182  LEU A C     1 
ATOM   2163  O  O     . LEU E 3 176 ? 12.129  49.571  43.537  1.00 67.67  ? 182  LEU A O     1 
ATOM   2164  C  CB    . LEU E 3 176 ? 11.047  46.797  42.210  1.00 45.62  ? 182  LEU A CB    1 
ATOM   2165  C  CG    . LEU E 3 176 ? 10.277  47.154  43.475  1.00 45.62  ? 182  LEU A CG    1 
ATOM   2166  C  CD1   . LEU E 3 176 ? 9.345   48.325  43.170  1.00 45.62  ? 182  LEU A CD1   1 
ATOM   2167  C  CD2   . LEU E 3 176 ? 9.511   45.931  44.007  1.00 45.62  ? 182  LEU A CD2   1 
ATOM   2168  N  N     . GLU E 3 177 ? 13.635  47.928  43.317  1.00 54.14  ? 183  GLU A N     1 
ATOM   2169  C  CA    . GLU E 3 177 ? 14.428  48.373  44.448  1.00 54.14  ? 183  GLU A CA    1 
ATOM   2170  C  C     . GLU E 3 177 ? 15.111  49.722  44.148  1.00 54.14  ? 183  GLU A C     1 
ATOM   2171  O  O     . GLU E 3 177 ? 14.837  50.722  44.827  1.00 54.14  ? 183  GLU A O     1 
ATOM   2172  C  CB    . GLU E 3 177 ? 15.458  47.303  44.803  1.00 72.25  ? 183  GLU A CB    1 
ATOM   2173  N  N     . LYS E 3 178 ? 15.982  49.756  43.131  1.00 59.60  ? 184  LYS A N     1 
ATOM   2174  C  CA    . LYS E 3 178 ? 16.695  50.990  42.747  1.00 59.60  ? 184  LYS A CA    1 
ATOM   2175  C  C     . LYS E 3 178 ? 15.770  52.216  42.730  1.00 59.60  ? 184  LYS A C     1 
ATOM   2176  O  O     . LYS E 3 178 ? 16.219  53.349  42.749  1.00 59.60  ? 184  LYS A O     1 
ATOM   2177  C  CB    . LYS E 3 178 ? 17.366  50.829  41.362  1.00 8.80   ? 184  LYS A CB    1 
ATOM   2178  N  N     . LEU E 3 179 ? 14.474  51.970  42.699  1.00 55.65  ? 185  LEU A N     1 
ATOM   2179  C  CA    . LEU E 3 179 ? 13.490  53.034  42.663  1.00 55.65  ? 185  LEU A CA    1 
ATOM   2180  C  C     . LEU E 3 179 ? 13.007  53.341  44.057  1.00 55.65  ? 185  LEU A C     1 
ATOM   2181  O  O     . LEU E 3 179 ? 12.918  54.496  44.451  1.00 55.65  ? 185  LEU A O     1 
ATOM   2182  C  CB    . LEU E 3 179 ? 12.285  52.602  41.833  1.00 64.89  ? 185  LEU A CB    1 
ATOM   2183  C  CG    . LEU E 3 179 ? 12.442  52.361  40.345  1.00 64.89  ? 185  LEU A CG    1 
ATOM   2184  C  CD1   . LEU E 3 179 ? 11.474  51.280  39.906  1.00 64.89  ? 185  LEU A CD1   1 
ATOM   2185  C  CD2   . LEU E 3 179 ? 12.211  53.668  39.619  1.00 64.89  ? 185  LEU A CD2   1 
ATOM   2186  N  N     . LEU E 3 180 ? 12.650  52.299  44.795  1.00 74.87  ? 186  LEU A N     1 
ATOM   2187  C  CA    . LEU E 3 180 ? 12.167  52.501  46.146  1.00 74.87  ? 186  LEU A CA    1 
ATOM   2188  C  C     . LEU E 3 180 ? 13.299  53.119  46.969  1.00 74.87  ? 186  LEU A C     1 
ATOM   2189  O  O     . LEU E 3 180 ? 13.050  53.827  47.946  1.00 74.87  ? 186  LEU A O     1 
ATOM   2190  C  CB    . LEU E 3 180 ? 11.728  51.173  46.776  1.00 39.05  ? 186  LEU A CB    1 
ATOM   2191  C  CG    . LEU E 3 180 ? 10.698  50.241  46.121  1.00 39.05  ? 186  LEU A CG    1 
ATOM   2192  C  CD1   . LEU E 3 180 ? 10.627  48.994  46.949  1.00 39.05  ? 186  LEU A CD1   1 
ATOM   2193  C  CD2   . LEU E 3 180 ? 9.308   50.866  46.020  1.00 39.05  ? 186  LEU A CD2   1 
ATOM   2194  N  N     . SER E 3 181 ? 14.544  52.862  46.564  1.00 67.33  ? 187  SER A N     1 
ATOM   2195  C  CA    . SER E 3 181 ? 15.704  53.396  47.276  1.00 67.33  ? 187  SER A CA    1 
ATOM   2196  C  C     . SER E 3 181 ? 15.759  54.924  47.259  1.00 67.33  ? 187  SER A C     1 
ATOM   2197  O  O     . SER E 3 181 ? 16.355  55.523  48.140  1.00 67.33  ? 187  SER A O     1 
ATOM   2198  C  CB    . SER E 3 181 ? 16.990  52.838  46.679  1.00 56.23  ? 187  SER A CB    1 
ATOM   2199  O  OG    . SER E 3 181 ? 17.311  53.485  45.468  1.00 56.23  ? 187  SER A OG    1 
ATOM   2200  N  N     . ASP E 3 182 ? 15.139  55.545  46.257  1.00 57.22  ? 188  ASP A N     1 
ATOM   2201  C  CA    . ASP E 3 182 ? 15.111  57.001  46.128  1.00 57.22  ? 188  ASP A CA    1 
ATOM   2202  C  C     . ASP E 3 182 ? 14.460  57.610  47.356  1.00 57.22  ? 188  ASP A C     1 
ATOM   2203  O  O     . ASP E 3 182 ? 13.238  57.505  47.538  1.00 57.22  ? 188  ASP A O     1 
ATOM   2204  C  CB    . ASP E 3 182 ? 14.308  57.436  44.897  1.00 58.63  ? 188  ASP A CB    1 
ATOM   2205  C  CG    . ASP E 3 182 ? 14.360  58.956  44.659  1.00 58.63  ? 188  ASP A CG    1 
ATOM   2206  O  OD1   . ASP E 3 182 ? 14.300  59.724  45.646  1.00 58.63  ? 188  ASP A OD1   1 
ATOM   2207  O  OD2   . ASP E 3 182 ? 14.455  59.393  43.482  1.00 58.63  ? 188  ASP A OD2   1 
ATOM   2208  N  N     . LYS E 3 183 ? 15.275  58.271  48.178  1.00 43.25  ? 189  LYS A N     1 
ATOM   2209  C  CA    . LYS E 3 183 ? 14.801  58.904  49.402  1.00 43.25  ? 189  LYS A CA    1 
ATOM   2210  C  C     . LYS E 3 183 ? 13.824  60.103  49.204  1.00 43.25  ? 189  LYS A C     1 
ATOM   2211  O  O     . LYS E 3 183 ? 13.132  60.515  50.150  1.00 43.25  ? 189  LYS A O     1 
ATOM   2212  C  CB    . LYS E 3 183 ? 16.020  59.321  50.225  1.00 57.44  ? 189  LYS A CB    1 
ATOM   2213  N  N     . HIS E 3 184 ? 13.771  60.653  47.987  1.00 65.97  ? 190  HIS A N     1 
ATOM   2214  C  CA    . HIS E 3 184 ? 12.877  61.779  47.700  1.00 65.97  ? 190  HIS A CA    1 
ATOM   2215  C  C     . HIS E 3 184 ? 11.419  61.329  47.572  1.00 65.97  ? 190  HIS A C     1 
ATOM   2216  O  O     . HIS E 3 184 ? 10.504  62.062  47.962  1.00 65.97  ? 190  HIS A O     1 
ATOM   2217  C  CB    . HIS E 3 184 ? 13.290  62.502  46.414  1.00 60.89  ? 190  HIS A CB    1 
ATOM   2218  C  CG    . HIS E 3 184 ? 12.365  63.619  46.028  1.00 60.89  ? 190  HIS A CG    1 
ATOM   2219  N  ND1   . HIS E 3 184 ? 12.330  64.825  46.693  1.00 60.89  ? 190  HIS A ND1   1 
ATOM   2220  C  CD2   . HIS E 3 184 ? 11.421  63.701  45.060  1.00 60.89  ? 190  HIS A CD2   1 
ATOM   2221  C  CE1   . HIS E 3 184 ? 11.405  65.601  46.154  1.00 60.89  ? 190  HIS A CE1   1 
ATOM   2222  N  NE2   . HIS E 3 184 ? 10.838  64.943  45.160  1.00 60.89  ? 190  HIS A NE2   1 
ATOM   2223  N  N     . TYR E 3 185 ? 11.208  60.128  47.026  1.00 90.51  ? 191  TYR A N     1 
ATOM   2224  C  CA    . TYR E 3 185 ? 9.864   59.581  46.837  1.00 90.51  ? 191  TYR A CA    1 
ATOM   2225  C  C     . TYR E 3 185 ? 9.509   58.499  47.854  1.00 90.51  ? 191  TYR A C     1 
ATOM   2226  O  O     . TYR E 3 185 ? 8.327   58.220  48.087  1.00 90.51  ? 191  TYR A O     1 
ATOM   2227  C  CB    . TYR E 3 185 ? 9.710   59.008  45.431  1.00 43.79  ? 191  TYR A CB    1 
ATOM   2228  C  CG    . TYR E 3 185 ? 9.920   60.008  44.322  1.00 43.79  ? 191  TYR A CG    1 
ATOM   2229  C  CD1   . TYR E 3 185 ? 11.171  60.212  43.774  1.00 43.79  ? 191  TYR A CD1   1 
ATOM   2230  C  CD2   . TYR E 3 185 ? 8.865   60.770  43.839  1.00 43.79  ? 191  TYR A CD2   1 
ATOM   2231  C  CE1   . TYR E 3 185 ? 11.370  61.154  42.773  1.00 43.79  ? 191  TYR A CE1   1 
ATOM   2232  C  CE2   . TYR E 3 185 ? 9.055   61.717  42.838  1.00 43.79  ? 191  TYR A CE2   1 
ATOM   2233  C  CZ    . TYR E 3 185 ? 10.307  61.904  42.315  1.00 43.79  ? 191  TYR A CZ    1 
ATOM   2234  O  OH    . TYR E 3 185 ? 10.506  62.863  41.349  1.00 43.79  ? 191  TYR A OH    1 
ATOM   2235  N  N     . PHE E 3 186 ? 10.528  57.882  48.448  1.00 75.35  ? 192  PHE A N     1 
ATOM   2236  C  CA    . PHE E 3 186 ? 10.304  56.840  49.454  1.00 75.35  ? 192  PHE A CA    1 
ATOM   2237  C  C     . PHE E 3 186 ? 11.197  57.025  50.695  1.00 75.35  ? 192  PHE A C     1 
ATOM   2238  O  O     . PHE E 3 186 ? 12.427  56.873  50.619  1.00 75.35  ? 192  PHE A O     1 
ATOM   2239  C  CB    . PHE E 3 186 ? 10.545  55.450  48.851  1.00 62.53  ? 192  PHE A CB    1 
ATOM   2240  C  CG    . PHE E 3 186 ? 9.700   55.150  47.635  1.00 62.53  ? 192  PHE A CG    1 
ATOM   2241  C  CD1   . PHE E 3 186 ? 8.330   54.932  47.758  1.00 62.53  ? 192  PHE A CD1   1 
ATOM   2242  C  CD2   . PHE E 3 186 ? 10.279  55.108  46.362  1.00 62.53  ? 192  PHE A CD2   1 
ATOM   2243  C  CE1   . PHE E 3 186 ? 7.554   54.680  46.636  1.00 62.53  ? 192  PHE A CE1   1 
ATOM   2244  C  CE2   . PHE E 3 186 ? 9.507   54.857  45.231  1.00 62.53  ? 192  PHE A CE2   1 
ATOM   2245  C  CZ    . PHE E 3 186 ? 8.146   54.644  45.365  1.00 62.53  ? 192  PHE A CZ    1 
ATOM   2246  N  N     . PRO E 3 187 ? 10.584  57.361  51.855  1.00 96.36  ? 193  PRO A N     1 
ATOM   2247  C  CA    . PRO E 3 187 ? 11.296  57.572  53.124  1.00 96.36  ? 193  PRO A CA    1 
ATOM   2248  C  C     . PRO E 3 187 ? 12.070  56.332  53.555  1.00 96.36  ? 193  PRO A C     1 
ATOM   2249  O  O     . PRO E 3 187 ? 11.517  55.235  53.623  1.00 96.36  ? 193  PRO A O     1 
ATOM   2250  C  CB    . PRO E 3 187 ? 10.176  57.915  54.104  1.00 112.39 ? 193  PRO A CB    1 
ATOM   2251  C  CG    . PRO E 3 187 ? 9.170   58.573  53.240  1.00 112.39 ? 193  PRO A CG    1 
ATOM   2252  C  CD    . PRO E 3 187 ? 9.154   57.674  52.020  1.00 112.39 ? 193  PRO A CD    1 
ATOM   2253  N  N     . PRO E 3 188 ? 13.365  56.493  53.849  1.00 105.38 ? 194  PRO A N     1 
ATOM   2254  C  CA    . PRO E 3 188 ? 14.226  55.383  54.273  1.00 105.38 ? 194  PRO A CA    1 
ATOM   2255  C  C     . PRO E 3 188 ? 13.748  54.622  55.519  1.00 105.38 ? 194  PRO A C     1 
ATOM   2256  O  O     . PRO E 3 188 ? 14.012  53.421  55.669  1.00 105.38 ? 194  PRO A O     1 
ATOM   2257  C  CB    . PRO E 3 188 ? 15.571  56.068  54.480  1.00 108.73 ? 194  PRO A CB    1 
ATOM   2258  C  CG    . PRO E 3 188 ? 15.553  57.127  53.412  1.00 108.73 ? 194  PRO A CG    1 
ATOM   2259  C  CD    . PRO E 3 188 ? 14.166  57.701  53.593  1.00 108.73 ? 194  PRO A CD    1 
ATOM   2260  N  N     . GLU E 3 189 ? 13.037  55.333  56.393  1.00 76.69  ? 195  GLU A N     1 
ATOM   2261  C  CA    . GLU E 3 189 ? 12.496  54.795  57.646  1.00 76.69  ? 195  GLU A CA    1 
ATOM   2262  C  C     . GLU E 3 189 ? 11.528  53.616  57.480  1.00 76.69  ? 195  GLU A C     1 
ATOM   2263  O  O     . GLU E 3 189 ? 11.255  52.879  58.426  1.00 76.69  ? 195  GLU A O     1 
ATOM   2264  C  CB    . GLU E 3 189 ? 11.783  55.920  58.412  1.00 107.12 ? 195  GLU A CB    1 
ATOM   2265  C  CG    . GLU E 3 189 ? 12.698  57.007  58.997  1.00 107.12 ? 195  GLU A CG    1 
ATOM   2266  C  CD    . GLU E 3 189 ? 13.267  57.974  57.966  1.00 107.12 ? 195  GLU A CD    1 
ATOM   2267  O  OE1   . GLU E 3 189 ? 14.018  58.898  58.364  1.00 107.12 ? 195  GLU A OE1   1 
ATOM   2268  O  OE2   . GLU E 3 189 ? 12.963  57.815  56.763  1.00 107.12 ? 195  GLU A OE2   1 
ATOM   2269  N  N     . ILE E 3 190 ? 11.016  53.449  56.268  1.00 72.05  ? 196  ILE A N     1 
ATOM   2270  C  CA    . ILE E 3 190 ? 10.057  52.394  55.952  1.00 72.05  ? 196  ILE A CA    1 
ATOM   2271  C  C     . ILE E 3 190 ? 10.669  51.468  54.903  1.00 72.05  ? 196  ILE A C     1 
ATOM   2272  O  O     . ILE E 3 190 ? 11.544  51.883  54.141  1.00 72.05  ? 196  ILE A O     1 
ATOM   2273  C  CB    . ILE E 3 190 ? 8.746   53.015  55.340  1.00 42.79  ? 196  ILE A CB    1 
ATOM   2274  C  CG1   . ILE E 3 190 ? 8.178   54.081  56.270  1.00 42.79  ? 196  ILE A CG1   1 
ATOM   2275  C  CG2   . ILE E 3 190 ? 7.701   51.938  55.088  1.00 42.79  ? 196  ILE A CG2   1 
ATOM   2276  C  CD1   . ILE E 3 190 ? 6.992   54.804  55.686  1.00 42.79  ? 196  ILE A CD1   1 
ATOM   2277  N  N     . ASP E 3 191 ? 10.223  50.215  54.879  1.00 76.14  ? 197  ASP A N     1 
ATOM   2278  C  CA    . ASP E 3 191 ? 10.684  49.279  53.861  1.00 76.14  ? 197  ASP A CA    1 
ATOM   2279  C  C     . ASP E 3 191 ? 9.466   48.756  53.111  1.00 76.14  ? 197  ASP A C     1 
ATOM   2280  O  O     . ASP E 3 191 ? 8.850   47.761  53.505  1.00 76.14  ? 197  ASP A O     1 
ATOM   2281  C  CB    . ASP E 3 191 ? 11.453  48.105  54.452  1.00 74.67  ? 197  ASP A CB    1 
ATOM   2282  C  CG    . ASP E 3 191 ? 11.892  47.119  53.376  1.00 74.67  ? 197  ASP A CG    1 
ATOM   2283  O  OD1   . ASP E 3 191 ? 12.343  47.586  52.301  1.00 74.67  ? 197  ASP A OD1   1 
ATOM   2284  O  OD2   . ASP E 3 191 ? 11.786  45.889  53.598  1.00 74.67  ? 197  ASP A OD2   1 
ATOM   2285  N  N     . PHE E 3 192 ? 9.139   49.437  52.018  1.00 57.72  ? 198  PHE A N     1 
ATOM   2286  C  CA    . PHE E 3 192 ? 7.970   49.114  51.212  1.00 57.72  ? 198  PHE A CA    1 
ATOM   2287  C  C     . PHE E 3 192 ? 7.903   47.707  50.652  1.00 57.72  ? 198  PHE A C     1 
ATOM   2288  O  O     . PHE E 3 192 ? 6.824   47.227  50.284  1.00 57.72  ? 198  PHE A O     1 
ATOM   2289  C  CB    . PHE E 3 192 ? 7.813   50.177  50.129  1.00 56.63  ? 198  PHE A CB    1 
ATOM   2290  C  CG    . PHE E 3 192 ? 7.769   51.571  50.693  1.00 56.63  ? 198  PHE A CG    1 
ATOM   2291  C  CD1   . PHE E 3 192 ? 8.943   52.259  50.963  1.00 56.63  ? 198  PHE A CD1   1 
ATOM   2292  C  CD2   . PHE E 3 192 ? 6.559   52.145  51.068  1.00 56.63  ? 198  PHE A CD2   1 
ATOM   2293  C  CE1   . PHE E 3 192 ? 8.905   53.487  51.604  1.00 56.63  ? 198  PHE A CE1   1 
ATOM   2294  C  CE2   . PHE E 3 192 ? 6.520   53.375  51.710  1.00 56.63  ? 198  PHE A CE2   1 
ATOM   2295  C  CZ    . PHE E 3 192 ? 7.690   54.044  51.981  1.00 56.63  ? 198  PHE A CZ    1 
ATOM   2296  N  N     . THR E 3 193 ? 9.046   47.031  50.613  1.00 60.50  ? 199  THR A N     1 
ATOM   2297  C  CA    . THR E 3 193 ? 9.052   45.660  50.130  1.00 60.50  ? 199  THR A CA    1 
ATOM   2298  C  C     . THR E 3 193 ? 8.557   44.834  51.314  1.00 60.50  ? 199  THR A C     1 
ATOM   2299  O  O     . THR E 3 193 ? 8.703   43.616  51.348  1.00 60.50  ? 199  THR A O     1 
ATOM   2300  C  CB    . THR E 3 193 ? 10.464  45.180  49.704  1.00 59.33  ? 199  THR A CB    1 
ATOM   2301  O  OG1   . THR E 3 193 ? 11.131  44.574  50.819  1.00 59.33  ? 199  THR A OG1   1 
ATOM   2302  C  CG2   . THR E 3 193 ? 11.284  46.343  49.201  1.00 59.33  ? 199  THR A CG2   1 
ATOM   2303  N  N     . ASP E 3 194 ? 7.947   45.516  52.278  1.00 46.52  ? 200  ASP A N     1 
ATOM   2304  C  CA    . ASP E 3 194 ? 7.447   44.849  53.462  1.00 46.52  ? 200  ASP A CA    1 
ATOM   2305  C  C     . ASP E 3 194 ? 6.219   45.548  54.039  1.00 46.52  ? 200  ASP A C     1 
ATOM   2306  O  O     . ASP E 3 194 ? 5.908   45.395  55.214  1.00 46.52  ? 200  ASP A O     1 
ATOM   2307  C  CB    . ASP E 3 194 ? 8.570   44.771  54.511  1.00 82.60  ? 200  ASP A CB    1 
ATOM   2308  C  CG    . ASP E 3 194 ? 8.287   43.760  55.615  1.00 82.60  ? 200  ASP A CG    1 
ATOM   2309  O  OD1   . ASP E 3 194 ? 7.932   42.606  55.307  1.00 82.60  ? 200  ASP A OD1   1 
ATOM   2310  O  OD2   . ASP E 3 194 ? 8.434   44.112  56.799  1.00 82.60  ? 200  ASP A OD2   1 
ATOM   2311  N  N     . VAL E 3 195 ? 5.513   46.323  53.223  1.00 55.95  ? 201  VAL A N     1 
ATOM   2312  C  CA    . VAL E 3 195 ? 4.308   46.999  53.713  1.00 55.95  ? 201  VAL A CA    1 
ATOM   2313  C  C     . VAL E 3 195 ? 3.091   46.572  52.911  1.00 55.95  ? 201  VAL A C     1 
ATOM   2314  O  O     . VAL E 3 195 ? 3.208   45.964  51.846  1.00 55.95  ? 201  VAL A O     1 
ATOM   2315  C  CB    . VAL E 3 195 ? 4.398   48.546  53.611  1.00 91.45  ? 201  VAL A CB    1 
ATOM   2316  C  CG1   . VAL E 3 195 ? 5.605   49.058  54.365  1.00 91.45  ? 201  VAL A CG1   1 
ATOM   2317  C  CG2   . VAL E 3 195 ? 4.442   48.969  52.158  1.00 91.45  ? 201  VAL A CG2   1 
ATOM   2318  N  N     . GLY E 3 196 ? 1.920   46.894  53.445  1.00 61.99  ? 202  GLY A N     1 
ATOM   2319  C  CA    . GLY E 3 196 ? 0.673   46.584  52.770  1.00 61.99  ? 202  GLY A CA    1 
ATOM   2320  C  C     . GLY E 3 196 ? 0.330   47.733  51.843  1.00 61.99  ? 202  GLY A C     1 
ATOM   2321  O  O     . GLY E 3 196 ? 0.781   48.862  52.027  1.00 61.99  ? 202  GLY A O     1 
ATOM   2322  N  N     . TYR E 3 197 ? -0.476  47.447  50.838  1.00 65.03  ? 203  TYR A N     1 
ATOM   2323  C  CA    . TYR E 3 197 ? -0.845  48.467  49.880  1.00 65.03  ? 203  TYR A CA    1 
ATOM   2324  C  C     . TYR E 3 197 ? -1.223  49.813  50.526  1.00 65.03  ? 203  TYR A C     1 
ATOM   2325  O  O     . TYR E 3 197 ? -0.703  50.863  50.143  1.00 65.03  ? 203  TYR A O     1 
ATOM   2326  C  CB    . TYR E 3 197 ? -1.967  47.929  48.981  1.00 55.51  ? 203  TYR A CB    1 
ATOM   2327  C  CG    . TYR E 3 197 ? -3.359  47.956  49.563  1.00 55.51  ? 203  TYR A CG    1 
ATOM   2328  C  CD1   . TYR E 3 197 ? -4.151  49.079  49.438  1.00 55.51  ? 203  TYR A CD1   1 
ATOM   2329  C  CD2   . TYR E 3 197 ? -3.903  46.843  50.186  1.00 55.51  ? 203  TYR A CD2   1 
ATOM   2330  C  CE1   . TYR E 3 197 ? -5.452  49.098  49.902  1.00 55.51  ? 203  TYR A CE1   1 
ATOM   2331  C  CE2   . TYR E 3 197 ? -5.210  46.854  50.661  1.00 55.51  ? 203  TYR A CE2   1 
ATOM   2332  C  CZ    . TYR E 3 197 ? -5.981  47.989  50.507  1.00 55.51  ? 203  TYR A CZ    1 
ATOM   2333  O  OH    . TYR E 3 197 ? -7.299  48.024  50.919  1.00 55.51  ? 203  TYR A OH    1 
ATOM   2334  N  N     . THR E 3 198 ? -2.105  49.788  51.518  1.00 74.94  ? 204  THR A N     1 
ATOM   2335  C  CA    . THR E 3 198 ? -2.528  51.015  52.183  1.00 74.94  ? 204  THR A CA    1 
ATOM   2336  C  C     . THR E 3 198 ? -1.358  51.799  52.786  1.00 74.94  ? 204  THR A C     1 
ATOM   2337  O  O     . THR E 3 198 ? -1.384  53.028  52.834  1.00 74.94  ? 204  THR A O     1 
ATOM   2338  C  CB    . THR E 3 198 ? -3.591  50.711  53.273  1.00 88.76  ? 204  THR A CB    1 
ATOM   2339  O  OG1   . THR E 3 198 ? -3.452  49.354  53.725  1.00 88.76  ? 204  THR A OG1   1 
ATOM   2340  C  CG2   . THR E 3 198 ? -4.995  50.911  52.714  1.00 88.76  ? 204  THR A CG2   1 
ATOM   2341  N  N     . THR E 3 199 ? -0.326  51.092  53.232  1.00 55.23  ? 205  THR A N     1 
ATOM   2342  C  CA    . THR E 3 199 ? 0.839   51.754  53.812  1.00 55.23  ? 205  THR A CA    1 
ATOM   2343  C  C     . THR E 3 199 ? 1.803   52.227  52.728  1.00 55.23  ? 205  THR A C     1 
ATOM   2344  O  O     . THR E 3 199 ? 2.403   53.299  52.829  1.00 55.23  ? 205  THR A O     1 
ATOM   2345  C  CB    . THR E 3 199 ? 1.573   50.811  54.778  1.00 51.61  ? 205  THR A CB    1 
ATOM   2346  O  OG1   . THR E 3 199 ? 0.774   50.645  55.956  1.00 51.61  ? 205  THR A OG1   1 
ATOM   2347  C  CG2   . THR E 3 199 ? 2.945   51.358  55.155  1.00 51.61  ? 205  THR A CG2   1 
ATOM   2348  N  N     . PHE E 3 200 ? 1.951   51.422  51.685  1.00 60.73  ? 206  PHE A N     1 
ATOM   2349  C  CA    . PHE E 3 200 ? 2.838   51.787  50.594  1.00 60.73  ? 206  PHE A CA    1 
ATOM   2350  C  C     . PHE E 3 200 ? 2.380   53.116  50.022  1.00 60.73  ? 206  PHE A C     1 
ATOM   2351  O  O     . PHE E 3 200 ? 3.173   54.045  49.875  1.00 60.73  ? 206  PHE A O     1 
ATOM   2352  C  CB    . PHE E 3 200 ? 2.805   50.713  49.506  1.00 46.94  ? 206  PHE A CB    1 
ATOM   2353  C  CG    . PHE E 3 200 ? 3.628   51.048  48.305  1.00 46.94  ? 206  PHE A CG    1 
ATOM   2354  C  CD1   . PHE E 3 200 ? 3.052   51.677  47.208  1.00 46.94  ? 206  PHE A CD1   1 
ATOM   2355  C  CD2   . PHE E 3 200 ? 4.994   50.759  48.284  1.00 46.94  ? 206  PHE A CD2   1 
ATOM   2356  C  CE1   . PHE E 3 200 ? 3.825   52.020  46.102  1.00 46.94  ? 206  PHE A CE1   1 
ATOM   2357  C  CE2   . PHE E 3 200 ? 5.781   51.093  47.187  1.00 46.94  ? 206  PHE A CE2   1 
ATOM   2358  C  CZ    . PHE E 3 200 ? 5.196   51.728  46.090  1.00 46.94  ? 206  PHE A CZ    1 
ATOM   2359  N  N     . TRP E 3 201 ? 1.082   53.192  49.740  1.00 79.88  ? 207  TRP A N     1 
ATOM   2360  C  CA    . TRP E 3 201 ? 0.447   54.371  49.146  1.00 79.88  ? 207  TRP A CA    1 
ATOM   2361  C  C     . TRP E 3 201 ? 0.444   55.669  49.948  1.00 79.88  ? 207  TRP A C     1 
ATOM   2362  O  O     . TRP E 3 201 ? 0.823   56.725  49.435  1.00 79.88  ? 207  TRP A O     1 
ATOM   2363  C  CB    . TRP E 3 201 ? -0.995  54.039  48.756  1.00 49.76  ? 207  TRP A CB    1 
ATOM   2364  C  CG    . TRP E 3 201 ? -1.116  53.033  47.660  1.00 49.76  ? 207  TRP A CG    1 
ATOM   2365  C  CD1   . TRP E 3 201 ? -2.008  52.019  47.590  1.00 49.76  ? 207  TRP A CD1   1 
ATOM   2366  C  CD2   . TRP E 3 201 ? -0.309  52.942  46.481  1.00 49.76  ? 207  TRP A CD2   1 
ATOM   2367  N  NE1   . TRP E 3 201 ? -1.810  51.296  46.449  1.00 49.76  ? 207  TRP A NE1   1 
ATOM   2368  C  CE2   . TRP E 3 201 ? -0.772  51.847  45.747  1.00 49.76  ? 207  TRP A CE2   1 
ATOM   2369  C  CE3   . TRP E 3 201 ? 0.762   53.683  45.978  1.00 49.76  ? 207  TRP A CE3   1 
ATOM   2370  C  CZ2   . TRP E 3 201 ? -0.208  51.472  44.537  1.00 49.76  ? 207  TRP A CZ2   1 
ATOM   2371  C  CZ3   . TRP E 3 201 ? 1.318   53.309  44.781  1.00 49.76  ? 207  TRP A CZ3   1 
ATOM   2372  C  CH2   . TRP E 3 201 ? 0.833   52.216  44.072  1.00 49.76  ? 207  TRP A CH2   1 
ATOM   2373  N  N     . SER E 3 202 ? -0.013  55.599  51.191  1.00 76.82  ? 208  SER A N     1 
ATOM   2374  C  CA    . SER E 3 202 ? -0.059  56.780  52.039  1.00 76.82  ? 208  SER A CA    1 
ATOM   2375  C  C     . SER E 3 202 ? 1.339   57.171  52.515  1.00 76.82  ? 208  SER A C     1 
ATOM   2376  O  O     . SER E 3 202 ? 1.742   58.326  52.392  1.00 76.82  ? 208  SER A O     1 
ATOM   2377  C  CB    . SER E 3 202 ? -0.971  56.521  53.242  1.00 73.95  ? 208  SER A CB    1 
ATOM   2378  O  OG    . SER E 3 202 ? -0.597  55.332  53.917  1.00 73.95  ? 208  SER A OG    1 
ATOM   2379  N  N     . GLU E 3 203 ? 2.075   56.193  53.035  1.00 47.04  ? 209  GLU A N     1 
ATOM   2380  C  CA    . GLU E 3 203 ? 3.420   56.409  53.551  1.00 47.04  ? 209  GLU A CA    1 
ATOM   2381  C  C     . GLU E 3 203 ? 4.480   56.749  52.513  1.00 47.04  ? 209  GLU A C     1 
ATOM   2382  O  O     . GLU E 3 203 ? 5.673   56.580  52.760  1.00 47.04  ? 209  GLU A O     1 
ATOM   2383  C  CB    . GLU E 3 203 ? 3.870   55.181  54.335  1.00 101.00 ? 209  GLU A CB    1 
ATOM   2384  C  CG    . GLU E 3 203 ? 3.233   55.064  55.701  1.00 101.00 ? 209  GLU A CG    1 
ATOM   2385  C  CD    . GLU E 3 203 ? 3.934   55.910  56.734  1.00 101.00 ? 209  GLU A CD    1 
ATOM   2386  O  OE1   . GLU E 3 203 ? 4.100   57.133  56.513  1.00 101.00 ? 209  GLU A OE1   1 
ATOM   2387  O  OE2   . GLU E 3 203 ? 4.320   55.340  57.772  1.00 101.00 ? 209  GLU A OE2   1 
ATOM   2388  N  N     . SER E 3 204 ? 4.062   57.227  51.351  1.00 67.17  ? 210  SER A N     1 
ATOM   2389  C  CA    . SER E 3 204 ? 5.025   57.578  50.313  1.00 67.17  ? 210  SER A CA    1 
ATOM   2390  C  C     . SER E 3 204 ? 4.604   58.863  49.626  1.00 67.17  ? 210  SER A C     1 
ATOM   2391  O  O     . SER E 3 204 ? 3.447   59.286  49.740  1.00 67.17  ? 210  SER A O     1 
ATOM   2392  C  CB    . SER E 3 204 ? 5.148   56.471  49.269  1.00 58.10  ? 210  SER A CB    1 
ATOM   2393  O  OG    . SER E 3 204 ? 3.992   56.435  48.467  1.00 58.10  ? 210  SER A OG    1 
ATOM   2394  N  N     . LEU E 3 205 ? 5.548   59.472  48.906  1.00 52.31  ? 211  LEU A N     1 
ATOM   2395  C  CA    . LEU E 3 205 ? 5.289   60.728  48.220  1.00 52.31  ? 211  LEU A CA    1 
ATOM   2396  C  C     . LEU E 3 205 ? 4.033   60.649  47.362  1.00 52.31  ? 211  LEU A C     1 
ATOM   2397  O  O     . LEU E 3 205 ? 3.776   59.660  46.680  1.00 52.31  ? 211  LEU A O     1 
ATOM   2398  C  CB    . LEU E 3 205 ? 6.494   61.143  47.383  1.00 56.77  ? 211  LEU A CB    1 
ATOM   2399  C  CG    . LEU E 3 205 ? 6.351   62.565  46.842  1.00 56.77  ? 211  LEU A CG    1 
ATOM   2400  C  CD1   . LEU E 3 205 ? 5.944   63.507  47.979  1.00 56.77  ? 211  LEU A CD1   1 
ATOM   2401  C  CD2   . LEU E 3 205 ? 7.647   62.992  46.189  1.00 56.77  ? 211  LEU A CD2   1 
ATOM   2402  N  N     . GLU E 3 206 ? 3.252   61.716  47.406  1.00 61.95  ? 212  GLU A N     1 
ATOM   2403  C  CA    . GLU E 3 206 ? 1.980   61.770  46.703  1.00 61.95  ? 212  GLU A CA    1 
ATOM   2404  C  C     . GLU E 3 206 ? 1.994   61.429  45.222  1.00 61.95  ? 212  GLU A C     1 
ATOM   2405  O  O     . GLU E 3 206 ? 0.996   60.913  44.697  1.00 61.95  ? 212  GLU A O     1 
ATOM   2406  C  CB    . GLU E 3 206 ? 1.333   63.137  46.898  1.00 46.51  ? 212  GLU A CB    1 
ATOM   2407  C  CG    . GLU E 3 206 ? -0.169  63.069  46.966  1.00 46.51  ? 212  GLU A CG    1 
ATOM   2408  C  CD    . GLU E 3 206 ? -0.820  64.384  46.638  1.00 46.51  ? 212  GLU A CD    1 
ATOM   2409  O  OE1   . GLU E 3 206 ? -0.611  65.374  47.378  1.00 46.51  ? 212  GLU A OE1   1 
ATOM   2410  O  OE2   . GLU E 3 206 ? -1.541  64.418  45.621  1.00 46.51  ? 212  GLU A OE2   1 
ATOM   2411  N  N     . ALA E 3 207 ? 3.107   61.713  44.548  1.00 55.05  ? 213  ALA A N     1 
ATOM   2412  C  CA    . ALA E 3 207 ? 3.226   61.436  43.116  1.00 55.05  ? 213  ALA A CA    1 
ATOM   2413  C  C     . ALA E 3 207 ? 3.021   59.960  42.827  1.00 55.05  ? 213  ALA A C     1 
ATOM   2414  O  O     . ALA E 3 207 ? 2.316   59.589  41.898  1.00 55.05  ? 213  ALA A O     1 
ATOM   2415  C  CB    . ALA E 3 207 ? 4.594   61.873  42.609  1.00 100.61 ? 213  ALA A CB    1 
ATOM   2416  N  N     . VAL E 3 208 ? 3.655   59.122  43.632  1.00 41.40  ? 214  VAL A N     1 
ATOM   2417  C  CA    . VAL E 3 208 ? 3.555   57.683  43.484  1.00 41.40  ? 214  VAL A CA    1 
ATOM   2418  C  C     . VAL E 3 208 ? 2.104   57.206  43.402  1.00 41.40  ? 214  VAL A C     1 
ATOM   2419  O  O     . VAL E 3 208 ? 1.795   56.260  42.687  1.00 41.40  ? 214  VAL A O     1 
ATOM   2420  C  CB    . VAL E 3 208 ? 4.256   57.003  44.652  1.00 53.62  ? 214  VAL A CB    1 
ATOM   2421  C  CG1   . VAL E 3 208 ? 4.206   55.514  44.488  1.00 53.62  ? 214  VAL A CG1   1 
ATOM   2422  C  CG2   . VAL E 3 208 ? 5.695   57.474  44.717  1.00 53.62  ? 214  VAL A CG2   1 
ATOM   2423  N  N     . ASP E 3 209 ? 1.213   57.860  44.136  1.00 48.08  ? 215  ASP A N     1 
ATOM   2424  C  CA    . ASP E 3 209 ? -0.199  57.504  44.125  1.00 48.08  ? 215  ASP A CA    1 
ATOM   2425  C  C     . ASP E 3 209 ? -0.879  58.114  42.907  1.00 48.08  ? 215  ASP A C     1 
ATOM   2426  O  O     . ASP E 3 209 ? -1.533  57.417  42.146  1.00 48.08  ? 215  ASP A O     1 
ATOM   2427  C  CB    . ASP E 3 209 ? -0.887  58.026  45.391  1.00 95.20  ? 215  ASP A CB    1 
ATOM   2428  C  CG    . ASP E 3 209 ? -2.382  57.703  45.430  1.00 95.20  ? 215  ASP A CG    1 
ATOM   2429  O  OD1   . ASP E 3 209 ? -2.735  56.514  45.576  1.00 95.20  ? 215  ASP A OD1   1 
ATOM   2430  O  OD2   . ASP E 3 209 ? -3.205  58.637  45.316  1.00 95.20  ? 215  ASP A OD2   1 
ATOM   2431  N  N     . ILE E 3 210 ? -0.719  59.423  42.729  1.00 50.15  ? 216  ILE A N     1 
ATOM   2432  C  CA    . ILE E 3 210 ? -1.333  60.129  41.606  1.00 50.15  ? 216  ILE A CA    1 
ATOM   2433  C  C     . ILE E 3 210 ? -0.931  59.591  40.238  1.00 50.15  ? 216  ILE A C     1 
ATOM   2434  O  O     . ILE E 3 210 ? -1.700  59.660  39.288  1.00 50.15  ? 216  ILE A O     1 
ATOM   2435  C  CB    . ILE E 3 210 ? -1.004  61.640  41.637  1.00 52.99  ? 216  ILE A CB    1 
ATOM   2436  C  CG1   . ILE E 3 210 ? -1.933  62.366  42.618  1.00 52.99  ? 216  ILE A CG1   1 
ATOM   2437  C  CG2   . ILE E 3 210 ? -1.156  62.234  40.256  1.00 52.99  ? 216  ILE A CG2   1 
ATOM   2438  C  CD1   . ILE E 3 210 ? -1.731  63.889  42.699  1.00 52.99  ? 216  ILE A CD1   1 
ATOM   2439  N  N     . GLU E 3 211 ? 0.286   59.076  40.128  1.00 59.18  ? 217  GLU A N     1 
ATOM   2440  C  CA    . GLU E 3 211 ? 0.772   58.545  38.863  1.00 59.18  ? 217  GLU A CA    1 
ATOM   2441  C  C     . GLU E 3 211 ? 0.136   57.218  38.544  1.00 59.18  ? 217  GLU A C     1 
ATOM   2442  O  O     . GLU E 3 211 ? -0.370  57.019  37.441  1.00 59.18  ? 217  GLU A O     1 
ATOM   2443  C  CB    . GLU E 3 211 ? 2.288   58.382  38.893  1.00 67.88  ? 217  GLU A CB    1 
ATOM   2444  C  CG    . GLU E 3 211 ? 3.035   59.588  38.374  1.00 67.88  ? 217  GLU A CG    1 
ATOM   2445  C  CD    . GLU E 3 211 ? 2.456   60.111  37.057  1.00 67.88  ? 217  GLU A CD    1 
ATOM   2446  O  OE1   . GLU E 3 211 ? 2.098   59.292  36.170  1.00 67.88  ? 217  GLU A OE1   1 
ATOM   2447  O  OE2   . GLU E 3 211 ? 2.367   61.348  36.900  1.00 67.88  ? 217  GLU A OE2   1 
ATOM   2448  N  N     . HIS E 3 212 ? 0.174   56.308  39.514  1.00 56.12  ? 218  HIS A N     1 
ATOM   2449  C  CA    . HIS E 3 212 ? -0.398  54.980  39.356  1.00 56.12  ? 218  HIS A CA    1 
ATOM   2450  C  C     . HIS E 3 212 ? -1.887  55.063  39.061  1.00 56.12  ? 218  HIS A C     1 
ATOM   2451  O  O     . HIS E 3 212 ? -2.349  54.441  38.111  1.00 56.12  ? 218  HIS A O     1 
ATOM   2452  C  CB    . HIS E 3 212 ? -0.146  54.117  40.602  1.00 51.95  ? 218  HIS A CB    1 
ATOM   2453  C  CG    . HIS E 3 212 ? 1.237   53.536  40.674  1.00 51.95  ? 218  HIS A CG    1 
ATOM   2454  N  ND1   . HIS E 3 212 ? 2.363   54.302  40.895  1.00 51.95  ? 218  HIS A ND1   1 
ATOM   2455  C  CD2   . HIS E 3 212 ? 1.675   52.261  40.538  1.00 51.95  ? 218  HIS A CD2   1 
ATOM   2456  C  CE1   . HIS E 3 212 ? 3.432   53.525  40.890  1.00 51.95  ? 218  HIS A CE1   1 
ATOM   2457  N  NE2   . HIS E 3 212 ? 3.042   52.282  40.674  1.00 51.95  ? 218  HIS A NE2   1 
ATOM   2458  N  N     . ARG E 3 213 ? -2.640  55.833  39.845  1.00 46.27  ? 219  ARG A N     1 
ATOM   2459  C  CA    . ARG E 3 213 ? -4.073  55.942  39.596  1.00 46.27  ? 219  ARG A CA    1 
ATOM   2460  C  C     . ARG E 3 213 ? -4.299  56.413  38.169  1.00 46.27  ? 219  ARG A C     1 
ATOM   2461  O  O     . ARG E 3 213 ? -5.210  55.942  37.490  1.00 46.27  ? 219  ARG A O     1 
ATOM   2462  C  CB    . ARG E 3 213 ? -4.763  56.898  40.583  1.00 62.24  ? 219  ARG A CB    1 
ATOM   2463  C  CG    . ARG E 3 213 ? -5.086  56.287  41.968  1.00 62.24  ? 219  ARG A CG    1 
ATOM   2464  C  CD    . ARG E 3 213 ? -5.958  57.207  42.839  1.00 62.24  ? 219  ARG A CD    1 
ATOM   2465  N  NE    . ARG E 3 213 ? -5.584  57.168  44.256  1.00 62.24  ? 219  ARG A NE    1 
ATOM   2466  C  CZ    . ARG E 3 213 ? -6.361  56.719  45.249  1.00 62.24  ? 219  ARG A CZ    1 
ATOM   2467  N  NH1   . ARG E 3 213 ? -7.584  56.262  44.995  1.00 62.24  ? 219  ARG A NH1   1 
ATOM   2468  N  NH2   . ARG E 3 213 ? -5.911  56.717  46.509  1.00 62.24  ? 219  ARG A NH2   1 
ATOM   2469  N  N     . ALA E 3 214 ? -3.464  57.334  37.704  1.00 42.59  ? 220  ALA A N     1 
ATOM   2470  C  CA    . ALA E 3 214 ? -3.569  57.848  36.339  1.00 42.59  ? 220  ALA A CA    1 
ATOM   2471  C  C     . ALA E 3 214 ? -3.199  56.746  35.369  1.00 42.59  ? 220  ALA A C     1 
ATOM   2472  O  O     . ALA E 3 214 ? -3.967  56.396  34.480  1.00 42.59  ? 220  ALA A O     1 
ATOM   2473  C  CB    . ALA E 3 214 ? -2.631  59.032  36.152  1.00 21.52  ? 220  ALA A CB    1 
ATOM   2474  N  N     . ALA E 3 215 ? -2.001  56.209  35.546  1.00 47.67  ? 221  ALA A N     1 
ATOM   2475  C  CA    . ALA E 3 215 ? -1.507  55.131  34.708  1.00 47.67  ? 221  ALA A CA    1 
ATOM   2476  C  C     . ALA E 3 215 ? -2.551  54.030  34.571  1.00 47.67  ? 221  ALA A C     1 
ATOM   2477  O  O     . ALA E 3 215 ? -2.646  53.375  33.536  1.00 47.67  ? 221  ALA A O     1 
ATOM   2478  C  CB    . ALA E 3 215 ? -0.239  54.562  35.308  1.00 103.36 ? 221  ALA A CB    1 
ATOM   2479  N  N     . TRP E 3 216 ? -3.330  53.834  35.623  1.00 47.90  ? 222  TRP A N     1 
ATOM   2480  C  CA    . TRP E 3 216 ? -4.352  52.813  35.608  1.00 47.90  ? 222  TRP A CA    1 
ATOM   2481  C  C     . TRP E 3 216 ? -5.589  53.288  34.842  1.00 47.90  ? 222  TRP A C     1 
ATOM   2482  O  O     . TRP E 3 216 ? -6.156  52.532  34.051  1.00 47.90  ? 222  TRP A O     1 
ATOM   2483  C  CB    . TRP E 3 216 ? -4.697  52.422  37.042  1.00 42.17  ? 222  TRP A CB    1 
ATOM   2484  C  CG    . TRP E 3 216 ? -5.678  51.295  37.197  1.00 42.17  ? 222  TRP A CG    1 
ATOM   2485  C  CD1   . TRP E 3 216 ? -7.034  51.388  37.189  1.00 42.17  ? 222  TRP A CD1   1 
ATOM   2486  C  CD2   . TRP E 3 216 ? -5.375  49.924  37.491  1.00 42.17  ? 222  TRP A CD2   1 
ATOM   2487  N  NE1   . TRP E 3 216 ? -7.598  50.169  37.473  1.00 42.17  ? 222  TRP A NE1   1 
ATOM   2488  C  CE2   . TRP E 3 216 ? -6.599  49.253  37.664  1.00 42.17  ? 222  TRP A CE2   1 
ATOM   2489  C  CE3   . TRP E 3 216 ? -4.184  49.197  37.632  1.00 42.17  ? 222  TRP A CE3   1 
ATOM   2490  C  CZ2   . TRP E 3 216 ? -6.667  47.889  37.975  1.00 42.17  ? 222  TRP A CZ2   1 
ATOM   2491  C  CZ3   . TRP E 3 216 ? -4.256  47.845  37.941  1.00 42.17  ? 222  TRP A CZ3   1 
ATOM   2492  C  CH2   . TRP E 3 216 ? -5.487  47.209  38.110  1.00 42.17  ? 222  TRP A CH2   1 
ATOM   2493  N  N     . LEU E 3 217 ? -5.997  54.539  35.052  1.00 41.41  ? 223  LEU A N     1 
ATOM   2494  C  CA    . LEU E 3 217 ? -7.178  55.077  34.372  1.00 41.41  ? 223  LEU A CA    1 
ATOM   2495  C  C     . LEU E 3 217 ? -6.991  55.215  32.872  1.00 41.41  ? 223  LEU A C     1 
ATOM   2496  O  O     . LEU E 3 217 ? -7.761  54.657  32.105  1.00 41.41  ? 223  LEU A O     1 
ATOM   2497  C  CB    . LEU E 3 217 ? -7.612  56.447  34.966  1.00 27.97  ? 223  LEU A CB    1 
ATOM   2498  C  CG    . LEU E 3 217 ? -8.602  57.262  34.101  1.00 27.97  ? 223  LEU A CG    1 
ATOM   2499  C  CD1   . LEU E 3 217 ? -9.652  56.340  33.593  1.00 27.97  ? 223  LEU A CD1   1 
ATOM   2500  C  CD2   . LEU E 3 217 ? -9.268  58.393  34.836  1.00 27.97  ? 223  LEU A CD2   1 
ATOM   2501  N  N     . LEU E 3 218 ? -5.983  55.968  32.451  1.00 30.39  ? 224  LEU A N     1 
ATOM   2502  C  CA    . LEU E 3 218 ? -5.756  56.161  31.033  1.00 30.39  ? 224  LEU A CA    1 
ATOM   2503  C  C     . LEU E 3 218 ? -5.607  54.825  30.308  1.00 30.39  ? 224  LEU A C     1 
ATOM   2504  O  O     . LEU E 3 218 ? -5.932  54.691  29.120  1.00 30.39  ? 224  LEU A O     1 
ATOM   2505  C  CB    . LEU E 3 218 ? -4.531  57.027  30.841  1.00 49.44  ? 224  LEU A CB    1 
ATOM   2506  C  CG    . LEU E 3 218 ? -4.826  58.318  31.580  1.00 49.44  ? 224  LEU A CG    1 
ATOM   2507  C  CD1   . LEU E 3 218 ? -3.542  59.063  31.848  1.00 49.44  ? 224  LEU A CD1   1 
ATOM   2508  C  CD2   . LEU E 3 218 ? -5.798  59.141  30.764  1.00 49.44  ? 224  LEU A CD2   1 
ATOM   2509  N  N     . ALA E 3 219 ? -5.120  53.825  31.033  1.00 40.36  ? 225  ALA A N     1 
ATOM   2510  C  CA    . ALA E 3 219 ? -4.939  52.514  30.450  1.00 40.36  ? 225  ALA A CA    1 
ATOM   2511  C  C     . ALA E 3 219 ? -6.311  51.960  30.188  1.00 40.36  ? 225  ALA A C     1 
ATOM   2512  O  O     . ALA E 3 219 ? -6.476  51.097  29.354  1.00 40.36  ? 225  ALA A O     1 
ATOM   2513  C  CB    . ALA E 3 219 ? -4.187  51.627  31.393  1.00 73.19  ? 225  ALA A CB    1 
ATOM   2514  N  N     . LYS E 3 220 ? -7.298  52.464  30.919  1.00 67.25  ? 226  LYS A N     1 
ATOM   2515  C  CA    . LYS E 3 220 ? -8.691  52.046  30.768  1.00 67.25  ? 226  LYS A CA    1 
ATOM   2516  C  C     . LYS E 3 220 ? -9.256  52.781  29.562  1.00 67.25  ? 226  LYS A C     1 
ATOM   2517  O  O     . LYS E 3 220 ? -9.942  52.201  28.721  1.00 67.25  ? 226  LYS A O     1 
ATOM   2518  C  CB    . LYS E 3 220 ? -9.475  52.423  32.022  1.00 80.44  ? 226  LYS A CB    1 
ATOM   2519  C  CG    . LYS E 3 220 ? -10.963 52.268  31.905  1.00 80.44  ? 226  LYS A CG    1 
ATOM   2520  C  CD    . LYS E 3 220 ? -11.338 50.847  31.562  1.00 80.44  ? 226  LYS A CD    1 
ATOM   2521  C  CE    . LYS E 3 220 ? -12.827 50.675  31.722  1.00 80.44  ? 226  LYS A CE    1 
ATOM   2522  N  NZ    . LYS E 3 220 ? -13.226 51.156  33.079  1.00 80.44  ? 226  LYS A NZ    1 
ATOM   2523  N  N     . GLN E 3 221 ? -8.957  54.075  29.499  1.00 48.89  ? 227  GLN A N     1 
ATOM   2524  C  CA    . GLN E 3 221 ? -9.375  54.935  28.396  1.00 48.89  ? 227  GLN A CA    1 
ATOM   2525  C  C     . GLN E 3 221 ? -8.877  54.312  27.113  1.00 48.89  ? 227  GLN A C     1 
ATOM   2526  O  O     . GLN E 3 221 ? -9.635  54.101  26.193  1.00 48.89  ? 227  GLN A O     1 
ATOM   2527  C  CB    . GLN E 3 221 ? -8.749  56.309  28.560  1.00 55.07  ? 227  GLN A CB    1 
ATOM   2528  C  CG    . GLN E 3 221 ? -8.942  57.241  27.416  1.00 55.07  ? 227  GLN A CG    1 
ATOM   2529  C  CD    . GLN E 3 221 ? -8.007  58.430  27.514  1.00 55.07  ? 227  GLN A CD    1 
ATOM   2530  O  OE1   . GLN E 3 221 ? -8.055  59.214  28.473  1.00 55.07  ? 227  GLN A OE1   1 
ATOM   2531  N  NE2   . GLN E 3 221 ? -7.134  58.566  26.521  1.00 55.07  ? 227  GLN A NE2   1 
ATOM   2532  N  N     . GLU E 3 222 ? -7.587  54.014  27.055  1.00 54.58  ? 228  GLU A N     1 
ATOM   2533  C  CA    . GLU E 3 222 ? -7.023  53.394  25.862  1.00 54.58  ? 228  GLU A CA    1 
ATOM   2534  C  C     . GLU E 3 222 ? -7.873  52.209  25.391  1.00 54.58  ? 228  GLU A C     1 
ATOM   2535  O  O     . GLU E 3 222 ? -8.283  52.142  24.233  1.00 54.58  ? 228  GLU A O     1 
ATOM   2536  C  CB    . GLU E 3 222 ? -5.593  52.902  26.124  1.00 75.08  ? 228  GLU A CB    1 
ATOM   2537  C  CG    . GLU E 3 222 ? -4.504  53.935  25.905  1.00 75.08  ? 228  GLU A CG    1 
ATOM   2538  C  CD    . GLU E 3 222 ? -3.116  53.387  26.202  1.00 75.08  ? 228  GLU A CD    1 
ATOM   2539  O  OE1   . GLU E 3 222 ? -2.714  52.412  25.532  1.00 75.08  ? 228  GLU A OE1   1 
ATOM   2540  O  OE2   . GLU E 3 222 ? -2.431  53.927  27.106  1.00 75.08  ? 228  GLU A OE2   1 
ATOM   2541  N  N     . ARG E 3 223 ? -8.122  51.278  26.305  1.00 39.67  ? 229  ARG A N     1 
ATOM   2542  C  CA    . ARG E 3 223 ? -8.900  50.086  26.039  1.00 39.67  ? 229  ARG A CA    1 
ATOM   2543  C  C     . ARG E 3 223 ? -10.333 50.404  25.613  1.00 39.67  ? 229  ARG A C     1 
ATOM   2544  O  O     . ARG E 3 223 ? -10.939 49.632  24.851  1.00 39.67  ? 229  ARG A O     1 
ATOM   2545  C  CB    . ARG E 3 223 ? -8.927  49.252  27.300  1.00 34.14  ? 229  ARG A CB    1 
ATOM   2546  C  CG    . ARG E 3 223 ? -8.051  48.027  27.306  1.00 34.14  ? 229  ARG A CG    1 
ATOM   2547  C  CD    . ARG E 3 223 ? -8.056  47.437  28.688  1.00 34.14  ? 229  ARG A CD    1 
ATOM   2548  N  NE    . ARG E 3 223 ? -7.435  48.362  29.619  1.00 34.14  ? 229  ARG A NE    1 
ATOM   2549  C  CZ    . ARG E 3 223 ? -7.595  48.311  30.935  1.00 34.14  ? 229  ARG A CZ    1 
ATOM   2550  N  NH1   . ARG E 3 223 ? -8.363  47.370  31.458  1.00 34.14  ? 229  ARG A NH1   1 
ATOM   2551  N  NH2   . ARG E 3 223 ? -7.000  49.194  31.736  1.00 34.14  ? 229  ARG A NH2   1 
ATOM   2552  N  N     . ASN E 3 224 ? -10.882 51.515  26.128  1.00 62.13  ? 230  ASN A N     1 
ATOM   2553  C  CA    . ASN E 3 224 ? -12.245 51.951  25.777  1.00 62.13  ? 230  ASN A CA    1 
ATOM   2554  C  C     . ASN E 3 224 ? -12.230 52.166  24.293  1.00 62.13  ? 230  ASN A C     1 
ATOM   2555  O  O     . ASN E 3 224 ? -12.795 51.410  23.525  1.00 62.13  ? 230  ASN A O     1 
ATOM   2556  C  CB    . ASN E 3 224 ? -12.617 53.304  26.398  1.00 55.07  ? 230  ASN A CB    1 
ATOM   2557  C  CG    . ASN E 3 224 ? -12.943 53.213  27.863  1.00 55.07  ? 230  ASN A CG    1 
ATOM   2558  O  OD1   . ASN E 3 224 ? -12.984 52.118  28.437  1.00 55.07  ? 230  ASN A OD1   1 
ATOM   2559  N  ND2   . ASN E 3 224 ? -13.194 54.365  28.484  1.00 55.07  ? 230  ASN A ND2   1 
ATOM   2560  N  N     . GLY E 3 225 ? -11.554 53.226  23.904  1.00 36.06  ? 231  GLY A N     1 
ATOM   2561  C  CA    . GLY E 3 225 ? -11.450 53.562  22.511  1.00 36.06  ? 231  GLY A CA    1 
ATOM   2562  C  C     . GLY E 3 225 ? -12.124 54.885  22.279  1.00 36.06  ? 231  GLY A C     1 
ATOM   2563  O  O     . GLY E 3 225 ? -12.575 55.510  23.226  1.00 36.06  ? 231  GLY A O     1 
ATOM   2564  N  N     . PHE E 3 226 ? -12.176 55.323  21.028  1.00 56.99  ? 232  PHE A N     1 
ATOM   2565  C  CA    . PHE E 3 226 ? -12.827 56.574  20.686  1.00 56.99  ? 232  PHE A CA    1 
ATOM   2566  C  C     . PHE E 3 226 ? -13.612 56.213  19.461  1.00 56.99  ? 232  PHE A C     1 
ATOM   2567  O  O     . PHE E 3 226 ? -13.030 55.948  18.411  1.00 56.99  ? 232  PHE A O     1 
ATOM   2568  C  CB    . PHE E 3 226 ? -11.811 57.634  20.317  1.00 37.28  ? 232  PHE A CB    1 
ATOM   2569  C  CG    . PHE E 3 226 ? -12.268 59.021  20.585  1.00 37.28  ? 232  PHE A CG    1 
ATOM   2570  C  CD1   . PHE E 3 226 ? -13.453 59.491  20.059  1.00 37.28  ? 232  PHE A CD1   1 
ATOM   2571  C  CD2   . PHE E 3 226 ? -11.506 59.873  21.364  1.00 37.28  ? 232  PHE A CD2   1 
ATOM   2572  C  CE1   . PHE E 3 226 ? -13.881 60.812  20.313  1.00 37.28  ? 232  PHE A CE1   1 
ATOM   2573  C  CE2   . PHE E 3 226 ? -11.920 61.178  21.618  1.00 37.28  ? 232  PHE A CE2   1 
ATOM   2574  C  CZ    . PHE E 3 226 ? -13.113 61.652  21.094  1.00 37.28  ? 232  PHE A CZ    1 
ATOM   2575  N  N     . PRO E 3 227 ? -14.947 56.162  19.578  1.00 44.59  ? 233  PRO A N     1 
ATOM   2576  C  CA    . PRO E 3 227 ? -15.740 55.812  18.394  1.00 44.59  ? 233  PRO A CA    1 
ATOM   2577  C  C     . PRO E 3 227 ? -15.321 56.718  17.211  1.00 44.59  ? 233  PRO A C     1 
ATOM   2578  O  O     . PRO E 3 227 ? -15.406 57.958  17.256  1.00 44.59  ? 233  PRO A O     1 
ATOM   2579  C  CB    . PRO E 3 227 ? -17.168 56.035  18.877  1.00 46.06  ? 233  PRO A CB    1 
ATOM   2580  C  CG    . PRO E 3 227 ? -17.054 55.760  20.367  1.00 46.06  ? 233  PRO A CG    1 
ATOM   2581  C  CD    . PRO E 3 227 ? -15.812 56.481  20.729  1.00 46.06  ? 233  PRO A CD    1 
ATOM   2582  N  N     . PHE E 3 228 ? -14.839 56.083  16.162  1.00 46.12  ? 234  PHE A N     1 
ATOM   2583  C  CA    . PHE E 3 228 ? -14.375 56.820  15.017  1.00 46.12  ? 234  PHE A CA    1 
ATOM   2584  C  C     . PHE E 3 228 ? -15.221 56.476  13.819  1.00 46.12  ? 234  PHE A C     1 
ATOM   2585  O  O     . PHE E 3 228 ? -15.450 55.306  13.524  1.00 46.12  ? 234  PHE A O     1 
ATOM   2586  C  CB    . PHE E 3 228 ? -12.899 56.480  14.766  1.00 22.51  ? 234  PHE A CB    1 
ATOM   2587  C  CG    . PHE E 3 228 ? -12.365 56.966  13.450  1.00 22.51  ? 234  PHE A CG    1 
ATOM   2588  C  CD1   . PHE E 3 228 ? -12.184 56.080  12.399  1.00 22.51  ? 234  PHE A CD1   1 
ATOM   2589  C  CD2   . PHE E 3 228 ? -12.022 58.301  13.276  1.00 22.51  ? 234  PHE A CD2   1 
ATOM   2590  C  CE1   . PHE E 3 228 ? -11.662 56.517  11.184  1.00 22.51  ? 234  PHE A CE1   1 
ATOM   2591  C  CE2   . PHE E 3 228 ? -11.501 58.748  12.071  1.00 22.51  ? 234  PHE A CE2   1 
ATOM   2592  C  CZ    . PHE E 3 228 ? -11.319 57.856  11.019  1.00 22.51  ? 234  PHE A CZ    1 
ATOM   2593  N  N     . ASP E 3 229 ? -15.665 57.511  13.117  1.00 43.09  ? 235  ASP A N     1 
ATOM   2594  C  CA    . ASP E 3 229 ? -16.510 57.354  11.940  1.00 43.09  ? 235  ASP A CA    1 
ATOM   2595  C  C     . ASP E 3 229 ? -15.756 56.954  10.681  1.00 43.09  ? 235  ASP A C     1 
ATOM   2596  O  O     . ASP E 3 229 ? -15.562 57.793  9.808   1.00 43.09  ? 235  ASP A O     1 
ATOM   2597  C  CB    . ASP E 3 229 ? -17.238 58.674  11.673  1.00 72.06  ? 235  ASP A CB    1 
ATOM   2598  C  CG    . ASP E 3 229 ? -18.306 58.548  10.610  1.00 72.06  ? 235  ASP A CG    1 
ATOM   2599  O  OD1   . ASP E 3 229 ? -18.378 57.489  9.956   1.00 72.06  ? 235  ASP A OD1   1 
ATOM   2600  O  OD2   . ASP E 3 229 ? -19.073 59.514  10.431  1.00 72.06  ? 235  ASP A OD2   1 
ATOM   2601  N  N     . THR E 3 230 ? -15.341 55.697  10.554  1.00 25.73  ? 236  THR A N     1 
ATOM   2602  C  CA    . THR E 3 230 ? -14.618 55.322  9.345   1.00 25.73  ? 236  THR A CA    1 
ATOM   2603  C  C     . THR E 3 230 ? -15.247 55.967  8.108   1.00 25.73  ? 236  THR A C     1 
ATOM   2604  O  O     . THR E 3 230 ? -14.554 56.646  7.352   1.00 25.73  ? 236  THR A O     1 
ATOM   2605  C  CB    . THR E 3 230 ? -14.583 53.808  9.091   1.00 33.55  ? 236  THR A CB    1 
ATOM   2606  O  OG1   . THR E 3 230 ? -14.136 53.123  10.259  1.00 33.55  ? 236  THR A OG1   1 
ATOM   2607  C  CG2   . THR E 3 230 ? -13.619 53.488  7.976   1.00 33.55  ? 236  THR A CG2   1 
ATOM   2608  N  N     . LYS E 3 231 ? -16.556 55.777  7.905   1.00 45.96  ? 237  LYS A N     1 
ATOM   2609  C  CA    . LYS E 3 231 ? -17.262 56.345  6.737   1.00 45.96  ? 237  LYS A CA    1 
ATOM   2610  C  C     . LYS E 3 231 ? -17.025 57.840  6.515   1.00 45.96  ? 237  LYS A C     1 
ATOM   2611  O  O     . LYS E 3 231 ? -16.491 58.230  5.497   1.00 45.96  ? 237  LYS A O     1 
ATOM   2612  C  CB    . LYS E 3 231 ? -18.766 56.080  6.832   1.00 60.22  ? 237  LYS A CB    1 
ATOM   2613  N  N     . ALA E 3 232 ? -17.411 58.679  7.464   1.00 53.33  ? 238  ALA A N     1 
ATOM   2614  C  CA    . ALA E 3 232 ? -17.210 60.120  7.304   1.00 53.33  ? 238  ALA A CA    1 
ATOM   2615  C  C     . ALA E 3 232 ? -15.793 60.471  6.859   1.00 53.33  ? 238  ALA A C     1 
ATOM   2616  O  O     . ALA E 3 232 ? -15.576 61.431  6.104   1.00 53.33  ? 238  ALA A O     1 
ATOM   2617  C  CB    . ALA E 3 232 ? -17.527 60.875  8.624   1.00 15.03  ? 238  ALA A CB    1 
ATOM   2618  N  N     . ILE E 3 233 ? -14.824 59.699  7.335   1.00 52.83  ? 239  ILE A N     1 
ATOM   2619  C  CA    . ILE E 3 233 ? -13.441 59.986  6.995   1.00 52.83  ? 239  ILE A CA    1 
ATOM   2620  C  C     . ILE E 3 233 ? -13.019 59.379  5.676   1.00 52.83  ? 239  ILE A C     1 
ATOM   2621  O  O     . ILE E 3 233 ? -12.195 59.950  4.972   1.00 52.83  ? 239  ILE A O     1 
ATOM   2622  C  CB    . ILE E 3 233 ? -12.473 59.556  8.127   1.00 32.75  ? 239  ILE A CB    1 
ATOM   2623  C  CG1   . ILE E 3 233 ? -12.755 60.391  9.387   1.00 32.75  ? 239  ILE A CG1   1 
ATOM   2624  C  CG2   . ILE E 3 233 ? -11.028 59.762  7.688   1.00 32.75  ? 239  ILE A CG2   1 
ATOM   2625  C  CD1   . ILE E 3 233 ? -12.523 61.873  9.224   1.00 32.75  ? 239  ILE A CD1   1 
ATOM   2626  N  N     . GLU E 3 234 ? -13.564 58.220  5.338   1.00 54.21  ? 240  GLU A N     1 
ATOM   2627  C  CA    . GLU E 3 234 ? -13.230 57.631  4.060   1.00 54.21  ? 240  GLU A CA    1 
ATOM   2628  C  C     . GLU E 3 234 ? -13.861 58.579  3.064   1.00 54.21  ? 240  GLU A C     1 
ATOM   2629  O  O     . GLU E 3 234 ? -13.379 58.732  1.943   1.00 54.21  ? 240  GLU A O     1 
ATOM   2630  C  CB    . GLU E 3 234 ? -13.859 56.258  3.915   1.00 95.26  ? 240  GLU A CB    1 
ATOM   2631  C  CG    . GLU E 3 234 ? -13.229 55.228  4.780   1.00 95.26  ? 240  GLU A CG    1 
ATOM   2632  C  CD    . GLU E 3 234 ? -14.097 54.017  4.928   1.00 95.26  ? 240  GLU A CD    1 
ATOM   2633  O  OE1   . GLU E 3 234 ? -15.142 54.126  5.601   1.00 95.26  ? 240  GLU A OE1   1 
ATOM   2634  O  OE2   . GLU E 3 234 ? -13.740 52.959  4.371   1.00 95.26  ? 240  GLU A OE2   1 
ATOM   2635  N  N     . GLU E 3 235 ? -14.939 59.227  3.507   1.00 49.51  ? 241  GLU A N     1 
ATOM   2636  C  CA    . GLU E 3 235 ? -15.697 60.163  2.692   1.00 49.51  ? 241  GLU A CA    1 
ATOM   2637  C  C     . GLU E 3 235 ? -14.854 61.382  2.427   1.00 49.51  ? 241  GLU A C     1 
ATOM   2638  O  O     . GLU E 3 235 ? -14.825 61.902  1.311   1.00 49.51  ? 241  GLU A O     1 
ATOM   2639  C  CB    . GLU E 3 235 ? -16.983 60.568  3.423   1.00 78.25  ? 241  GLU A CB    1 
ATOM   2640  C  CG    . GLU E 3 235 ? -18.259 60.439  2.576   1.00 78.25  ? 241  GLU A CG    1 
ATOM   2641  C  CD    . GLU E 3 235 ? -19.509 60.150  3.405   1.00 78.25  ? 241  GLU A CD    1 
ATOM   2642  O  OE1   . GLU E 3 235 ? -19.989 61.062  4.125   1.00 78.25  ? 241  GLU A OE1   1 
ATOM   2643  O  OE2   . GLU E 3 235 ? -20.001 58.995  3.333   1.00 78.25  ? 241  GLU A OE2   1 
ATOM   2644  N  N     . LEU E 3 236 ? -14.169 61.842  3.466   1.00 47.20  ? 242  LEU A N     1 
ATOM   2645  C  CA    . LEU E 3 236 ? -13.296 63.011  3.346   1.00 47.20  ? 242  LEU A CA    1 
ATOM   2646  C  C     . LEU E 3 236 ? -12.085 62.672  2.505   1.00 47.20  ? 242  LEU A C     1 
ATOM   2647  O  O     . LEU E 3 236 ? -11.655 63.462  1.682   1.00 47.20  ? 242  LEU A O     1 
ATOM   2648  C  CB    . LEU E 3 236 ? -12.826 63.486  4.722   1.00 40.93  ? 242  LEU A CB    1 
ATOM   2649  C  CG    . LEU E 3 236 ? -11.869 64.673  4.761   1.00 40.93  ? 242  LEU A CG    1 
ATOM   2650  C  CD1   . LEU E 3 236 ? -12.351 65.759  3.848   1.00 40.93  ? 242  LEU A CD1   1 
ATOM   2651  C  CD2   . LEU E 3 236 ? -11.773 65.199  6.167   1.00 40.93  ? 242  LEU A CD2   1 
ATOM   2652  N  N     . TYR E 3 237 ? -11.544 61.479  2.705   1.00 57.44  ? 243  TYR A N     1 
ATOM   2653  C  CA    . TYR E 3 237 ? -10.373 61.087  1.962   1.00 57.44  ? 243  TYR A CA    1 
ATOM   2654  C  C     . TYR E 3 237 ? -10.597 61.107  0.480   1.00 57.44  ? 243  TYR A C     1 
ATOM   2655  O  O     . TYR E 3 237 ? -9.653  61.229  -0.278  1.00 57.44  ? 243  TYR A O     1 
ATOM   2656  C  CB    . TYR E 3 237 ? -9.894  59.710  2.378   1.00 40.94  ? 243  TYR A CB    1 
ATOM   2657  C  CG    . TYR E 3 237 ? -8.713  59.245  1.569   1.00 40.94  ? 243  TYR A CG    1 
ATOM   2658  C  CD1   . TYR E 3 237 ? -7.731  60.135  1.171   1.00 40.94  ? 243  TYR A CD1   1 
ATOM   2659  C  CD2   . TYR E 3 237 ? -8.578  57.917  1.200   1.00 40.94  ? 243  TYR A CD2   1 
ATOM   2660  C  CE1   . TYR E 3 237 ? -6.659  59.720  0.428   1.00 40.94  ? 243  TYR A CE1   1 
ATOM   2661  C  CE2   . TYR E 3 237 ? -7.502  57.494  0.462   1.00 40.94  ? 243  TYR A CE2   1 
ATOM   2662  C  CZ    . TYR E 3 237 ? -6.551  58.403  0.080   1.00 40.94  ? 243  TYR A CZ    1 
ATOM   2663  O  OH    . TYR E 3 237 ? -5.472  57.986  -0.650  1.00 40.94  ? 243  TYR A OH    1 
ATOM   2664  N  N     . VAL E 3 238 ? -11.838 60.982  0.042   1.00 54.13  ? 244  VAL A N     1 
ATOM   2665  C  CA    . VAL E 3 238 ? -12.078 61.008  -1.392  1.00 54.13  ? 244  VAL A CA    1 
ATOM   2666  C  C     . VAL E 3 238 ? -12.243 62.431  -1.884  1.00 54.13  ? 244  VAL A C     1 
ATOM   2667  O  O     . VAL E 3 238 ? -11.900 62.748  -3.019  1.00 54.13  ? 244  VAL A O     1 
ATOM   2668  C  CB    . VAL E 3 238 ? -13.305 60.207  -1.766  1.00 92.13  ? 244  VAL A CB    1 
ATOM   2669  C  CG1   . VAL E 3 238 ? -13.604 60.394  -3.247  1.00 92.13  ? 244  VAL A CG1   1 
ATOM   2670  C  CG2   . VAL E 3 238 ? -13.056 58.743  -1.452  1.00 92.13  ? 244  VAL A CG2   1 
ATOM   2671  N  N     . GLU E 3 239 ? -12.764 63.283  -1.012  1.00 46.79  ? 245  GLU A N     1 
ATOM   2672  C  CA    . GLU E 3 239 ? -12.977 64.675  -1.339  1.00 46.79  ? 245  GLU A CA    1 
ATOM   2673  C  C     . GLU E 3 239 ? -11.659 65.364  -1.462  1.00 46.79  ? 245  GLU A C     1 
ATOM   2674  O  O     . GLU E 3 239 ? -11.521 66.254  -2.287  1.00 46.79  ? 245  GLU A O     1 
ATOM   2675  C  CB    . GLU E 3 239 ? -13.779 65.386  -0.260  1.00 74.67  ? 245  GLU A CB    1 
ATOM   2676  C  CG    . GLU E 3 239 ? -13.872 66.882  -0.491  1.00 74.67  ? 245  GLU A CG    1 
ATOM   2677  C  CD    . GLU E 3 239 ? -14.402 67.619  0.716   1.00 74.67  ? 245  GLU A CD    1 
ATOM   2678  O  OE1   . GLU E 3 239 ? -15.298 67.067  1.398   1.00 74.67  ? 245  GLU A OE1   1 
ATOM   2679  O  OE2   . GLU E 3 239 ? -13.932 68.751  0.979   1.00 74.67  ? 245  GLU A OE2   1 
ATOM   2680  N  N     . LEU E 3 240 ? -10.699 64.963  -0.625  1.00 44.51  ? 246  LEU A N     1 
ATOM   2681  C  CA    . LEU E 3 240 ? -9.357  65.554  -0.617  1.00 44.51  ? 246  LEU A CA    1 
ATOM   2682  C  C     . LEU E 3 240 ? -8.509  64.964  -1.737  1.00 44.51  ? 246  LEU A C     1 
ATOM   2683  O  O     . LEU E 3 240 ? -7.975  65.693  -2.560  1.00 44.51  ? 246  LEU A O     1 
ATOM   2684  C  CB    . LEU E 3 240 ? -8.674  65.333  0.743   1.00 44.36  ? 246  LEU A CB    1 
ATOM   2685  C  CG    . LEU E 3 240 ? -9.285  66.012  1.982   1.00 44.36  ? 246  LEU A CG    1 
ATOM   2686  C  CD1   . LEU E 3 240 ? -8.825  65.337  3.273   1.00 44.36  ? 246  LEU A CD1   1 
ATOM   2687  C  CD2   . LEU E 3 240 ? -8.904  67.473  1.987   1.00 44.36  ? 246  LEU A CD2   1 
ATOM   2688  N  N     . ALA E 3 241 ? -8.404  63.647  -1.782  1.00 40.36  ? 247  ALA A N     1 
ATOM   2689  C  CA    . ALA E 3 241 ? -7.621  62.991  -2.812  1.00 40.36  ? 247  ALA A CA    1 
ATOM   2690  C  C     . ALA E 3 241 ? -7.942  63.606  -4.168  1.00 40.36  ? 247  ALA A C     1 
ATOM   2691  O  O     . ALA E 3 241 ? -7.109  63.607  -5.091  1.00 40.36  ? 247  ALA A O     1 
ATOM   2692  C  CB    . ALA E 3 241 ? -7.934  61.502  -2.824  1.00 41.67  ? 247  ALA A CB    1 
ATOM   2693  N  N     . ALA E 3 242 ? -9.167  64.127  -4.257  1.00 66.70  ? 248  ALA A N     1 
ATOM   2694  C  CA    . ALA E 3 242 ? -9.724  64.764  -5.451  1.00 66.70  ? 248  ALA A CA    1 
ATOM   2695  C  C     . ALA E 3 242 ? -9.269  66.205  -5.585  1.00 66.70  ? 248  ALA A C     1 
ATOM   2696  O  O     . ALA E 3 242 ? -8.696  66.597  -6.597  1.00 66.70  ? 248  ALA A O     1 
ATOM   2697  C  CB    . ALA E 3 242 ? -11.241 64.721  -5.388  1.00 83.10  ? 248  ALA A CB    1 
ATOM   2698  N  N     . ARG E 3 243 ? -9.556  67.008  -4.572  1.00 42.29  ? 249  ARG A N     1 
ATOM   2699  C  CA    . ARG E 3 243 ? -9.135  68.402  -4.585  1.00 42.29  ? 249  ARG A CA    1 
ATOM   2700  C  C     . ARG E 3 243 ? -7.636  68.452  -4.829  1.00 42.29  ? 249  ARG A C     1 
ATOM   2701  O  O     . ARG E 3 243 ? -7.118  69.422  -5.363  1.00 42.29  ? 249  ARG A O     1 
ATOM   2702  C  CB    . ARG E 3 243 ? -9.469  69.077  -3.256  1.00 41.90  ? 249  ARG A CB    1 
ATOM   2703  C  CG    . ARG E 3 243 ? -8.903  70.466  -3.089  1.00 41.90  ? 249  ARG A CG    1 
ATOM   2704  C  CD    . ARG E 3 243 ? -9.016  71.263  -4.371  1.00 41.90  ? 249  ARG A CD    1 
ATOM   2705  N  NE    . ARG E 3 243 ? -9.048  72.698  -4.115  1.00 41.90  ? 249  ARG A NE    1 
ATOM   2706  C  CZ    . ARG E 3 243 ? -8.917  73.621  -5.057  1.00 41.90  ? 249  ARG A CZ    1 
ATOM   2707  N  NH1   . ARG E 3 243 ? -8.734  73.251  -6.315  1.00 41.90  ? 249  ARG A NH1   1 
ATOM   2708  N  NH2   . ARG E 3 243 ? -8.986  74.908  -4.736  1.00 41.90  ? 249  ARG A NH2   1 
ATOM   2709  N  N     . ARG E 3 244 ? -6.946  67.392  -4.427  1.00 51.85  ? 250  ARG A N     1 
ATOM   2710  C  CA    . ARG E 3 244 ? -5.509  67.282  -4.629  1.00 51.85  ? 250  ARG A CA    1 
ATOM   2711  C  C     . ARG E 3 244 ? -5.245  67.147  -6.112  1.00 51.85  ? 250  ARG A C     1 
ATOM   2712  O  O     . ARG E 3 244 ? -4.556  67.972  -6.720  1.00 51.85  ? 250  ARG A O     1 
ATOM   2713  C  CB    . ARG E 3 244 ? -4.974  66.030  -3.940  1.00 38.16  ? 250  ARG A CB    1 
ATOM   2714  C  CG    . ARG E 3 244 ? -3.500  65.760  -4.227  1.00 38.16  ? 250  ARG A CG    1 
ATOM   2715  C  CD    . ARG E 3 244 ? -2.851  64.968  -3.113  1.00 38.16  ? 250  ARG A CD    1 
ATOM   2716  N  NE    . ARG E 3 244 ? -2.966  63.540  -3.291  1.00 38.16  ? 250  ARG A NE    1 
ATOM   2717  C  CZ    . ARG E 3 244 ? -3.034  62.702  -2.278  1.00 38.16  ? 250  ARG A CZ    1 
ATOM   2718  N  NH1   . ARG E 3 244 ? -3.005  63.187  -1.059  1.00 38.16  ? 250  ARG A NH1   1 
ATOM   2719  N  NH2   . ARG E 3 244 ? -3.121  61.395  -2.478  1.00 38.16  ? 250  ARG A NH2   1 
ATOM   2720  N  N     . SER E 3 245 ? -5.799  66.072  -6.668  1.00 55.89  ? 251  SER A N     1 
ATOM   2721  C  CA    . SER E 3 245 ? -5.671  65.741  -8.082  1.00 55.89  ? 251  SER A CA    1 
ATOM   2722  C  C     . SER E 3 245 ? -5.816  66.953  -9.006  1.00 55.89  ? 251  SER A C     1 
ATOM   2723  O  O     . SER E 3 245 ? -5.149  67.026  -10.038 1.00 55.89  ? 251  SER A O     1 
ATOM   2724  C  CB    . SER E 3 245 ? -6.698  64.666  -8.463  1.00 92.43  ? 251  SER A CB    1 
ATOM   2725  O  OG    . SER E 3 245 ? -6.512  64.216  -9.795  1.00 92.43  ? 251  SER A OG    1 
ATOM   2726  N  N     . GLU E 3 246 ? -6.684  67.895  -8.645  1.00 59.15  ? 252  GLU A N     1 
ATOM   2727  C  CA    . GLU E 3 246 ? -6.865  69.089  -9.461  1.00 59.15  ? 252  GLU A CA    1 
ATOM   2728  C  C     . GLU E 3 246 ? -5.663  70.003  -9.228  1.00 59.15  ? 252  GLU A C     1 
ATOM   2729  O  O     . GLU E 3 246 ? -4.799  70.134  -10.094 1.00 59.15  ? 252  GLU A O     1 
ATOM   2730  C  CB    . GLU E 3 246 ? -8.165  69.825  -9.089  1.00 54.32  ? 252  GLU A CB    1 
ATOM   2731  N  N     . LEU E 3 247 ? -5.611  70.627  -8.052  1.00 52.64  ? 253  LEU A N     1 
ATOM   2732  C  CA    . LEU E 3 247 ? -4.520  71.524  -7.691  1.00 52.64  ? 253  LEU A CA    1 
ATOM   2733  C  C     . LEU E 3 247 ? -3.244  71.040  -8.317  1.00 52.64  ? 253  LEU A C     1 
ATOM   2734  O  O     . LEU E 3 247 ? -2.433  71.838  -8.773  1.00 52.64  ? 253  LEU A O     1 
ATOM   2735  C  CB    . LEU E 3 247 ? -4.337  71.568  -6.186  1.00 30.66  ? 253  LEU A CB    1 
ATOM   2736  C  CG    . LEU E 3 247 ? -5.426  72.313  -5.430  1.00 30.66  ? 253  LEU A CG    1 
ATOM   2737  C  CD1   . LEU E 3 247 ? -5.169  72.134  -3.973  1.00 30.66  ? 253  LEU A CD1   1 
ATOM   2738  C  CD2   . LEU E 3 247 ? -5.438  73.792  -5.788  1.00 30.66  ? 253  LEU A CD2   1 
ATOM   2739  N  N     . LEU E 3 248 ? -3.055  69.723  -8.328  1.00 39.80  ? 254  LEU A N     1 
ATOM   2740  C  CA    . LEU E 3 248 ? -1.864  69.178  -8.941  1.00 39.80  ? 254  LEU A CA    1 
ATOM   2741  C  C     . LEU E 3 248 ? -1.897  69.580  -10.393 1.00 39.80  ? 254  LEU A C     1 
ATOM   2742  O  O     . LEU E 3 248 ? -1.134  70.439  -10.799 1.00 39.80  ? 254  LEU A O     1 
ATOM   2743  C  CB    . LEU E 3 248 ? -1.813  67.670  -8.830  1.00 45.79  ? 254  LEU A CB    1 
ATOM   2744  C  CG    . LEU E 3 248 ? -0.584  67.187  -9.586  1.00 45.79  ? 254  LEU A CG    1 
ATOM   2745  C  CD1   . LEU E 3 248 ? 0.617   67.884  -9.023  1.00 45.79  ? 254  LEU A CD1   1 
ATOM   2746  C  CD2   . LEU E 3 248 ? -0.430  65.689  -9.469  1.00 45.79  ? 254  LEU A CD2   1 
ATOM   2747  N  N     . ARG E 3 249 ? -2.799  68.982  -11.172 1.00 81.42  ? 255  ARG A N     1 
ATOM   2748  C  CA    . ARG E 3 249 ? -2.940  69.302  -12.601 1.00 81.42  ? 255  ARG A CA    1 
ATOM   2749  C  C     . ARG E 3 249 ? -2.870  70.799  -12.868 1.00 81.42  ? 255  ARG A C     1 
ATOM   2750  O  O     . ARG E 3 249 ? -2.026  71.266  -13.623 1.00 81.42  ? 255  ARG A O     1 
ATOM   2751  C  CB    . ARG E 3 249 ? -4.275  68.781  -13.148 1.00 62.24  ? 255  ARG A CB    1 
ATOM   2752  C  CG    . ARG E 3 249 ? -4.556  69.129  -14.630 1.00 62.24  ? 255  ARG A CG    1 
ATOM   2753  C  CD    . ARG E 3 249 ? -6.021  68.838  -15.029 1.00 62.24  ? 255  ARG A CD    1 
ATOM   2754  N  NE    . ARG E 3 249 ? -6.950  69.792  -14.422 1.00 62.24  ? 255  ARG A NE    1 
ATOM   2755  C  CZ    . ARG E 3 249 ? -7.091  71.055  -14.814 1.00 62.24  ? 255  ARG A CZ    1 
ATOM   2756  N  NH1   . ARG E 3 249 ? -6.371  71.533  -15.825 1.00 62.24  ? 255  ARG A NH1   1 
ATOM   2757  N  NH2   . ARG E 3 249 ? -7.945  71.846  -14.178 1.00 62.24  ? 255  ARG A NH2   1 
ATOM   2758  N  N     . LYS E 3 250 ? -3.775  71.544  -12.253 1.00 51.24  ? 256  LYS A N     1 
ATOM   2759  C  CA    . LYS E 3 250 ? -3.812  72.986  -12.426 1.00 51.24  ? 256  LYS A CA    1 
ATOM   2760  C  C     . LYS E 3 250 ? -2.407  73.599  -12.280 1.00 51.24  ? 256  LYS A C     1 
ATOM   2761  O  O     . LYS E 3 250 ? -2.102  74.625  -12.899 1.00 51.24  ? 256  LYS A O     1 
ATOM   2762  C  CB    . LYS E 3 250 ? -4.794  73.616  -11.410 1.00 22.47  ? 256  LYS A CB    1 
ATOM   2763  N  N     . LEU E 3 251 ? -1.560  72.958  -11.469 1.00 58.33  ? 257  LEU A N     1 
ATOM   2764  C  CA    . LEU E 3 251 ? -0.193  73.423  -11.214 1.00 58.33  ? 257  LEU A CA    1 
ATOM   2765  C  C     . LEU E 3 251 ? 0.794   72.886  -12.220 1.00 58.33  ? 257  LEU A C     1 
ATOM   2766  O  O     . LEU E 3 251 ? 1.455   73.651  -12.911 1.00 58.33  ? 257  LEU A O     1 
ATOM   2767  C  CB    . LEU E 3 251 ? 0.268   73.012  -9.815  1.00 38.13  ? 257  LEU A CB    1 
ATOM   2768  C  CG    . LEU E 3 251 ? -0.164  73.918  -8.672  1.00 38.13  ? 257  LEU A CG    1 
ATOM   2769  C  CD1   . LEU E 3 251 ? 0.148   73.267  -7.365  1.00 38.13  ? 257  LEU A CD1   1 
ATOM   2770  C  CD2   . LEU E 3 251 ? 0.548   75.256  -8.763  1.00 38.13  ? 257  LEU A CD2   1 
ATOM   2771  N  N     . THR E 3 252 ? 0.897   71.567  -12.302 1.00 45.88  ? 258  THR A N     1 
ATOM   2772  C  CA    . THR E 3 252 ? 1.829   70.970  -13.231 1.00 45.88  ? 258  THR A CA    1 
ATOM   2773  C  C     . THR E 3 252 ? 1.765   71.686  -14.587 1.00 45.88  ? 258  THR A C     1 
ATOM   2774  O  O     . THR E 3 252 ? 2.726   71.675  -15.362 1.00 45.88  ? 258  THR A O     1 
ATOM   2775  C  CB    . THR E 3 252 ? 1.572   69.474  -13.380 1.00 71.18  ? 258  THR A CB    1 
ATOM   2776  O  OG1   . THR E 3 252 ? 0.372   69.112  -12.683 1.00 71.18  ? 258  THR A OG1   1 
ATOM   2777  C  CG2   . THR E 3 252 ? 2.732   68.706  -12.791 1.00 71.18  ? 258  THR A CG2   1 
ATOM   2778  N  N     . GLU E 3 253 ? 0.635   72.333  -14.856 1.00 78.11  ? 259  GLU A N     1 
ATOM   2779  C  CA    . GLU E 3 253 ? 0.470   73.073  -16.095 1.00 78.11  ? 259  GLU A CA    1 
ATOM   2780  C  C     . GLU E 3 253 ? 1.275   74.355  -15.977 1.00 78.11  ? 259  GLU A C     1 
ATOM   2781  O  O     . GLU E 3 253 ? 2.127   74.643  -16.814 1.00 78.11  ? 259  GLU A O     1 
ATOM   2782  C  CB    . GLU E 3 253 ? -0.999  73.425  -16.327 1.00 102.58 ? 259  GLU A CB    1 
ATOM   2783  C  CG    . GLU E 3 253 ? -1.236  74.289  -17.559 1.00 102.58 ? 259  GLU A CG    1 
ATOM   2784  C  CD    . GLU E 3 253 ? -2.550  75.055  -17.496 1.00 102.58 ? 259  GLU A CD    1 
ATOM   2785  O  OE1   . GLU E 3 253 ? -2.700  75.915  -16.597 1.00 102.58 ? 259  GLU A OE1   1 
ATOM   2786  O  OE2   . GLU E 3 253 ? -3.430  74.795  -18.348 1.00 102.58 ? 259  GLU A OE2   1 
ATOM   2787  N  N     . THR E 3 254 ? 1.007   75.113  -14.920 1.00 50.97  ? 260  THR A N     1 
ATOM   2788  C  CA    . THR E 3 254 ? 1.688   76.385  -14.697 1.00 50.97  ? 260  THR A CA    1 
ATOM   2789  C  C     . THR E 3 254 ? 3.193   76.243  -14.536 1.00 50.97  ? 260  THR A C     1 
ATOM   2790  O  O     . THR E 3 254 ? 3.951   77.164  -14.852 1.00 50.97  ? 260  THR A O     1 
ATOM   2791  C  CB    . THR E 3 254 ? 1.168   77.074  -13.443 1.00 63.82  ? 260  THR A CB    1 
ATOM   2792  O  OG1   . THR E 3 254 ? -0.252  77.178  -13.522 1.00 63.82  ? 260  THR A OG1   1 
ATOM   2793  C  CG2   . THR E 3 254 ? 1.769   78.462  -13.317 1.00 63.82  ? 260  THR A CG2   1 
ATOM   2794  N  N     . PHE E 3 255 ? 3.617   75.091  -14.029 1.00 76.03  ? 261  PHE A N     1 
ATOM   2795  C  CA    . PHE E 3 255 ? 5.025   74.829  -13.798 1.00 76.03  ? 261  PHE A CA    1 
ATOM   2796  C  C     . PHE E 3 255 ? 5.448   73.553  -14.499 1.00 76.03  ? 261  PHE A C     1 
ATOM   2797  O  O     . PHE E 3 255 ? 5.341   72.465  -13.943 1.00 76.03  ? 261  PHE A O     1 
ATOM   2798  C  CB    . PHE E 3 255 ? 5.274   74.699  -12.308 1.00 40.46  ? 261  PHE A CB    1 
ATOM   2799  C  CG    . PHE E 3 255 ? 5.202   75.995  -11.558 1.00 40.46  ? 261  PHE A CG    1 
ATOM   2800  C  CD1   . PHE E 3 255 ? 5.936   77.102  -11.979 1.00 40.46  ? 261  PHE A CD1   1 
ATOM   2801  C  CD2   . PHE E 3 255 ? 4.446   76.097  -10.393 1.00 40.46  ? 261  PHE A CD2   1 
ATOM   2802  C  CE1   . PHE E 3 255 ? 5.922   78.303  -11.238 1.00 40.46  ? 261  PHE A CE1   1 
ATOM   2803  C  CE2   . PHE E 3 255 ? 4.423   77.289  -9.649  1.00 40.46  ? 261  PHE A CE2   1 
ATOM   2804  C  CZ    . PHE E 3 255 ? 5.161   78.391  -10.069 1.00 40.46  ? 261  PHE A CZ    1 
ATOM   2805  N  N     . GLY E 3 256 ? 5.941   73.689  -15.721 1.00 66.65  ? 262  GLY A N     1 
ATOM   2806  C  CA    . GLY E 3 256 ? 6.338   72.521  -16.477 1.00 66.65  ? 262  GLY A CA    1 
ATOM   2807  C  C     . GLY E 3 256 ? 7.451   71.729  -15.838 1.00 66.65  ? 262  GLY A C     1 
ATOM   2808  O  O     . GLY E 3 256 ? 8.076   72.177  -14.877 1.00 66.65  ? 262  GLY A O     1 
ATOM   2809  N  N     . SER E 3 257 ? 7.690   70.544  -16.384 1.00 58.88  ? 263  SER A N     1 
ATOM   2810  C  CA    . SER E 3 257 ? 8.745   69.688  -15.894 1.00 58.88  ? 263  SER A CA    1 
ATOM   2811  C  C     . SER E 3 257 ? 10.100  70.332  -16.210 1.00 58.88  ? 263  SER A C     1 
ATOM   2812  O  O     . SER E 3 257 ? 10.169  71.512  -16.582 1.00 58.88  ? 263  SER A O     1 
ATOM   2813  C  CB    . SER E 3 257 ? 8.657   68.321  -16.562 1.00 91.93  ? 263  SER A CB    1 
ATOM   2814  O  OG    . SER E 3 257 ? 8.980   68.429  -17.932 1.00 91.93  ? 263  SER A OG    1 
ATOM   2815  N  N     . TRP E 3 258 ? 11.171  69.551  -16.059 1.00 66.22  ? 264  TRP A N     1 
ATOM   2816  C  CA    . TRP E 3 258 ? 12.524  70.019  -16.328 1.00 66.22  ? 264  TRP A CA    1 
ATOM   2817  C  C     . TRP E 3 258 ? 13.519  68.908  -16.088 1.00 66.22  ? 264  TRP A C     1 
ATOM   2818  O  O     . TRP E 3 258 ? 13.192  67.909  -15.460 1.00 66.22  ? 264  TRP A O     1 
ATOM   2819  C  CB    . TRP E 3 258 ? 12.865  71.209  -15.432 1.00 75.82  ? 264  TRP A CB    1 
ATOM   2820  C  CG    . TRP E 3 258 ? 13.044  70.893  -13.976 1.00 75.82  ? 264  TRP A CG    1 
ATOM   2821  C  CD1   . TRP E 3 258 ? 14.201  70.526  -13.350 1.00 75.82  ? 264  TRP A CD1   1 
ATOM   2822  C  CD2   . TRP E 3 258 ? 12.050  71.005  -12.949 1.00 75.82  ? 264  TRP A CD2   1 
ATOM   2823  N  NE1   . TRP E 3 258 ? 13.994  70.414  -11.994 1.00 75.82  ? 264  TRP A NE1   1 
ATOM   2824  C  CE2   . TRP E 3 258 ? 12.683  70.701  -11.721 1.00 75.82  ? 264  TRP A CE2   1 
ATOM   2825  C  CE3   . TRP E 3 258 ? 10.685  71.337  -12.946 1.00 75.82  ? 264  TRP A CE3   1 
ATOM   2826  C  CZ2   . TRP E 3 258 ? 11.996  70.719  -10.501 1.00 75.82  ? 264  TRP A CZ2   1 
ATOM   2827  C  CZ3   . TRP E 3 258 ? 10.007  71.354  -11.734 1.00 75.82  ? 264  TRP A CZ3   1 
ATOM   2828  C  CH2   . TRP E 3 258 ? 10.665  71.047  -10.529 1.00 75.82  ? 264  TRP A CH2   1 
ATOM   2829  N  N     . TYR E 3 259 ? 14.733  69.079  -16.600 1.00 53.15  ? 265  TYR A N     1 
ATOM   2830  C  CA    . TYR E 3 259 ? 15.767  68.079  -16.408 1.00 53.15  ? 265  TYR A CA    1 
ATOM   2831  C  C     . TYR E 3 259 ? 16.761  68.447  -15.307 1.00 53.15  ? 265  TYR A C     1 
ATOM   2832  O  O     . TYR E 3 259 ? 17.073  69.626  -15.075 1.00 53.15  ? 265  TYR A O     1 
ATOM   2833  C  CB    . TYR E 3 259 ? 16.505  67.819  -17.716 1.00 60.79  ? 265  TYR A CB    1 
ATOM   2834  C  CG    . TYR E 3 259 ? 15.738  66.928  -18.650 1.00 60.79  ? 265  TYR A CG    1 
ATOM   2835  C  CD1   . TYR E 3 259 ? 14.883  67.453  -19.616 1.00 60.79  ? 265  TYR A CD1   1 
ATOM   2836  C  CD2   . TYR E 3 259 ? 15.833  65.553  -18.539 1.00 60.79  ? 265  TYR A CD2   1 
ATOM   2837  C  CE1   . TYR E 3 259 ? 14.142  66.625  -20.451 1.00 60.79  ? 265  TYR A CE1   1 
ATOM   2838  C  CE2   . TYR E 3 259 ? 15.097  64.712  -19.362 1.00 60.79  ? 265  TYR A CE2   1 
ATOM   2839  C  CZ    . TYR E 3 259 ? 14.252  65.250  -20.318 1.00 60.79  ? 265  TYR A CZ    1 
ATOM   2840  O  OH    . TYR E 3 259 ? 13.539  64.388  -21.134 1.00 60.79  ? 265  TYR A OH    1 
ATOM   2841  N  N     . GLN E 3 260 ? 17.225  67.413  -14.614 1.00 55.70  ? 266  GLN A N     1 
ATOM   2842  C  CA    . GLN E 3 260 ? 18.194  67.548  -13.539 1.00 55.70  ? 266  GLN A CA    1 
ATOM   2843  C  C     . GLN E 3 260 ? 19.220  66.439  -13.703 1.00 55.70  ? 266  GLN A C     1 
ATOM   2844  O  O     . GLN E 3 260 ? 18.878  65.305  -14.066 1.00 55.70  ? 266  GLN A O     1 
ATOM   2845  C  CB    . GLN E 3 260 ? 17.528  67.416  -12.170 1.00 111.30 ? 266  GLN A CB    1 
ATOM   2846  C  CG    . GLN E 3 260 ? 17.218  68.742  -11.509 1.00 111.30 ? 266  GLN A CG    1 
ATOM   2847  C  CD    . GLN E 3 260 ? 16.585  68.581  -10.135 1.00 111.30 ? 266  GLN A CD    1 
ATOM   2848  O  OE1   . GLN E 3 260 ? 16.299  69.573  -9.449  1.00 111.30 ? 266  GLN A OE1   1 
ATOM   2849  N  NE2   . GLN E 3 260 ? 16.361  67.329  -9.724  1.00 111.30 ? 266  GLN A NE2   1 
ATOM   2850  N  N     . PRO E 3 261 ? 20.505  66.755  -13.476 1.00 77.98  ? 267  PRO A N     1 
ATOM   2851  C  CA    . PRO E 3 261 ? 21.532  65.718  -13.614 1.00 77.98  ? 267  PRO A CA    1 
ATOM   2852  C  C     . PRO E 3 261 ? 21.402  64.696  -12.499 1.00 77.98  ? 267  PRO A C     1 
ATOM   2853  O  O     . PRO E 3 261 ? 21.256  65.056  -11.334 1.00 77.98  ? 267  PRO A O     1 
ATOM   2854  C  CB    . PRO E 3 261 ? 22.833  66.500  -13.552 1.00 45.77  ? 267  PRO A CB    1 
ATOM   2855  C  CG    . PRO E 3 261 ? 22.462  67.690  -12.734 1.00 45.77  ? 267  PRO A CG    1 
ATOM   2856  C  CD    . PRO E 3 261 ? 21.116  68.074  -13.248 1.00 45.77  ? 267  PRO A CD    1 
ATOM   2857  N  N     . LYS E 3 262 ? 21.442  63.419  -12.861 1.00 84.73  ? 268  LYS A N     1 
ATOM   2858  C  CA    . LYS E 3 262 ? 21.301  62.359  -11.873 1.00 84.73  ? 268  LYS A CA    1 
ATOM   2859  C  C     . LYS E 3 262 ? 21.797  60.988  -12.348 1.00 84.73  ? 268  LYS A C     1 
ATOM   2860  O  O     . LYS E 3 262 ? 21.216  60.389  -13.254 1.00 84.73  ? 268  LYS A O     1 
ATOM   2861  C  CB    . LYS E 3 262 ? 19.831  62.258  -11.451 1.00 41.15  ? 268  LYS A CB    1 
ATOM   2862  N  N     . GLY E 3 263 ? 22.867  60.491  -11.729 1.00 80.88  ? 269  GLY A N     1 
ATOM   2863  C  CA    . GLY E 3 263 ? 23.389  59.191  -12.111 1.00 80.88  ? 269  GLY A CA    1 
ATOM   2864  C  C     . GLY E 3 263 ? 24.846  59.131  -12.541 1.00 80.88  ? 269  GLY A C     1 
ATOM   2865  O  O     . GLY E 3 263 ? 25.402  58.039  -12.691 1.00 80.88  ? 269  GLY A O     1 
ATOM   2866  N  N     . GLY E 3 264 ? 25.465  60.293  -12.742 1.00 99.17  ? 270  GLY A N     1 
ATOM   2867  C  CA    . GLY E 3 264 ? 26.861  60.344  -13.152 1.00 99.17  ? 270  GLY A CA    1 
ATOM   2868  C  C     . GLY E 3 264 ? 27.812  59.708  -12.154 1.00 99.17  ? 270  GLY A C     1 
ATOM   2869  O  O     . GLY E 3 264 ? 27.763  59.994  -10.955 1.00 99.17  ? 270  GLY A O     1 
ATOM   2870  N  N     . THR E 3 265 ? 28.692  58.850  -12.656 1.00 113.95 ? 271  THR A N     1 
ATOM   2871  C  CA    . THR E 3 265 ? 29.657  58.150  -11.818 1.00 113.95 ? 271  THR A CA    1 
ATOM   2872  C  C     . THR E 3 265 ? 30.969  58.923  -11.677 1.00 113.95 ? 271  THR A C     1 
ATOM   2873  O  O     . THR E 3 265 ? 31.306  59.410  -10.595 1.00 113.95 ? 271  THR A O     1 
ATOM   2874  C  CB    . THR E 3 265 ? 29.964  56.776  -12.408 1.00 75.73  ? 271  THR A CB    1 
ATOM   2875  O  OG1   . THR E 3 265 ? 28.884  56.376  -13.262 1.00 75.73  ? 271  THR A OG1   1 
ATOM   2876  C  CG2   . THR E 3 265 ? 30.123  55.752  -11.293 1.00 75.73  ? 271  THR A CG2   1 
ATOM   2877  N  N     . GLU E 3 266 ? 31.711  59.019  -12.776 1.00 107.69 ? 272  GLU A N     1 
ATOM   2878  C  CA    . GLU E 3 266 ? 32.983  59.737  -12.795 1.00 107.69 ? 272  GLU A CA    1 
ATOM   2879  C  C     . GLU E 3 266 ? 32.743  61.239  -12.641 1.00 107.69 ? 272  GLU A C     1 
ATOM   2880  O  O     . GLU E 3 266 ? 31.606  61.680  -12.475 1.00 107.69 ? 272  GLU A O     1 
ATOM   2881  C  CB    . GLU E 3 266 ? 33.717  59.456  -14.112 1.00 113.13 ? 272  GLU A CB    1 
ATOM   2882  C  CG    . GLU E 3 266 ? 34.154  58.001  -14.273 1.00 113.13 ? 272  GLU A CG    1 
ATOM   2883  C  CD    . GLU E 3 266 ? 33.639  57.345  -15.551 1.00 113.13 ? 272  GLU A CD    1 
ATOM   2884  O  OE1   . GLU E 3 266 ? 32.404  57.206  -15.699 1.00 113.13 ? 272  GLU A OE1   1 
ATOM   2885  O  OE2   . GLU E 3 266 ? 34.474  56.962  -16.403 1.00 113.13 ? 272  GLU A OE2   1 
ATOM   2886  N  N     . MET E 3 267 ? 33.819  62.015  -12.694 1.00 102.53 ? 273  MET A N     1 
ATOM   2887  C  CA    . MET E 3 267 ? 33.739  63.465  -12.562 1.00 102.53 ? 273  MET A CA    1 
ATOM   2888  C  C     . MET E 3 267 ? 34.265  64.102  -13.848 1.00 102.53 ? 273  MET A C     1 
ATOM   2889  O  O     . MET E 3 267 ? 35.298  63.680  -14.356 1.00 102.53 ? 273  MET A O     1 
ATOM   2890  C  CB    . MET E 3 267 ? 34.584  63.908  -11.364 1.00 65.18  ? 273  MET A CB    1 
ATOM   2891  N  N     . PHE E 3 268 ? 33.567  65.101  -14.384 1.00 114.77 ? 274  PHE A N     1 
ATOM   2892  C  CA    . PHE E 3 268 ? 34.030  65.740  -15.616 1.00 114.77 ? 274  PHE A CA    1 
ATOM   2893  C  C     . PHE E 3 268 ? 35.447  66.248  -15.408 1.00 114.77 ? 274  PHE A C     1 
ATOM   2894  O  O     . PHE E 3 268 ? 35.716  66.984  -14.454 1.00 114.77 ? 274  PHE A O     1 
ATOM   2895  C  CB    . PHE E 3 268 ? 33.123  66.906  -16.013 1.00 75.36  ? 274  PHE A CB    1 
ATOM   2896  N  N     . CYS E 3 269 ? 36.347  65.843  -16.304 1.00 102.48 ? 275  CYS A N     1 
ATOM   2897  C  CA    . CYS E 3 269 ? 37.760  66.223  -16.238 1.00 102.48 ? 275  CYS A CA    1 
ATOM   2898  C  C     . CYS E 3 269 ? 38.119  67.172  -17.382 1.00 102.48 ? 275  CYS A C     1 
ATOM   2899  O  O     . CYS E 3 269 ? 37.865  66.859  -18.551 1.00 102.48 ? 275  CYS A O     1 
ATOM   2900  C  CB    . CYS E 3 269 ? 38.630  64.967  -16.335 1.00 101.48 ? 275  CYS A CB    1 
ATOM   2901  S  SG    . CYS E 3 269 ? 37.899  63.462  -15.625 1.00 101.48 ? 275  CYS A SG    1 
ATOM   2902  N  N     . HIS E 3 270 ? 38.728  68.311  -17.045 1.00 91.97  ? 276  HIS A N     1 
ATOM   2903  C  CA    . HIS E 3 270 ? 39.093  69.317  -18.042 1.00 91.97  ? 276  HIS A CA    1 
ATOM   2904  C  C     . HIS E 3 270 ? 39.616  68.684  -19.310 1.00 91.97  ? 276  HIS A C     1 
ATOM   2905  O  O     . HIS E 3 270 ? 40.382  67.730  -19.252 1.00 91.97  ? 276  HIS A O     1 
ATOM   2906  C  CB    . HIS E 3 270 ? 40.139  70.279  -17.509 1.00 90.64  ? 276  HIS A CB    1 
ATOM   2907  C  CG    . HIS E 3 270 ? 40.185  71.573  -18.255 1.00 90.64  ? 276  HIS A CG    1 
ATOM   2908  N  ND1   . HIS E 3 270 ? 39.565  72.718  -17.799 1.00 90.64  ? 276  HIS A ND1   1 
ATOM   2909  C  CD2   . HIS E 3 270 ? 40.741  71.897  -19.447 1.00 90.64  ? 276  HIS A CD2   1 
ATOM   2910  C  CE1   . HIS E 3 270 ? 39.738  73.692  -18.677 1.00 90.64  ? 276  HIS A CE1   1 
ATOM   2911  N  NE2   . HIS E 3 270 ? 40.447  73.220  -19.686 1.00 90.64  ? 276  HIS A NE2   1 
ATOM   2912  N  N     . PRO E 3 271 ? 39.204  69.201  -20.478 1.00 99.10  ? 277  PRO A N     1 
ATOM   2913  C  CA    . PRO E 3 271 ? 39.629  68.683  -21.782 1.00 99.10  ? 277  PRO A CA    1 
ATOM   2914  C  C     . PRO E 3 271 ? 41.145  68.533  -21.888 1.00 99.10  ? 277  PRO A C     1 
ATOM   2915  O  O     . PRO E 3 271 ? 41.651  67.566  -22.477 1.00 99.10  ? 277  PRO A O     1 
ATOM   2916  C  CB    . PRO E 3 271 ? 39.090  69.724  -22.749 1.00 123.68 ? 277  PRO A CB    1 
ATOM   2917  C  CG    . PRO E 3 271 ? 37.833  70.153  -22.083 1.00 123.68 ? 277  PRO A CG    1 
ATOM   2918  C  CD    . PRO E 3 271 ? 38.272  70.326  -20.654 1.00 123.68 ? 277  PRO A CD    1 
ATOM   2919  N  N     . ARG E 3 272 ? 41.861  69.505  -21.326 1.00 86.64  ? 278  ARG A N     1 
ATOM   2920  C  CA    . ARG E 3 272 ? 43.323  69.488  -21.326 1.00 86.64  ? 278  ARG A CA    1 
ATOM   2921  C  C     . ARG E 3 272 ? 43.776  68.943  -19.969 1.00 86.64  ? 278  ARG A C     1 
ATOM   2922  O  O     . ARG E 3 272 ? 44.098  67.763  -19.841 1.00 86.64  ? 278  ARG A O     1 
ATOM   2923  C  CB    . ARG E 3 272 ? 43.877  70.904  -21.544 1.00 115.89 ? 278  ARG A CB    1 
ATOM   2924  N  N     . THR E 3 273 ? 43.781  69.825  -18.974 1.00 60.55  ? 279  THR A N     1 
ATOM   2925  C  CA    . THR E 3 273 ? 44.146  69.531  -17.595 1.00 60.55  ? 279  THR A CA    1 
ATOM   2926  C  C     . THR E 3 273 ? 43.791  68.101  -17.164 1.00 60.55  ? 279  THR A C     1 
ATOM   2927  O  O     . THR E 3 273 ? 44.522  67.159  -17.447 1.00 60.55  ? 279  THR A O     1 
ATOM   2928  C  CB    . THR E 3 273 ? 43.423  70.545  -16.685 1.00 66.84  ? 279  THR A CB    1 
ATOM   2929  O  OG1   . THR E 3 273 ? 43.869  71.873  -17.007 1.00 66.84  ? 279  THR A OG1   1 
ATOM   2930  C  CG2   . THR E 3 273 ? 43.655  70.238  -15.217 1.00 66.84  ? 279  THR A CG2   1 
ATOM   2931  N  N     . GLY E 3 274 ? 42.663  67.945  -16.482 1.00 76.02  ? 280  GLY A N     1 
ATOM   2932  C  CA    . GLY E 3 274 ? 42.240  66.632  -16.028 1.00 76.02  ? 280  GLY A CA    1 
ATOM   2933  C  C     . GLY E 3 274 ? 41.735  66.737  -14.605 1.00 76.02  ? 280  GLY A C     1 
ATOM   2934  O  O     . GLY E 3 274 ? 41.515  65.736  -13.926 1.00 76.02  ? 280  GLY A O     1 
ATOM   2935  N  N     . LYS E 3 275 ? 41.553  67.974  -14.161 1.00 79.85  ? 281  LYS A N     1 
ATOM   2936  C  CA    . LYS E 3 275 ? 41.090  68.282  -12.816 1.00 79.85  ? 281  LYS A CA    1 
ATOM   2937  C  C     . LYS E 3 275 ? 39.663  67.759  -12.606 1.00 79.85  ? 281  LYS A C     1 
ATOM   2938  O  O     . LYS E 3 275 ? 38.803  67.942  -13.461 1.00 79.85  ? 281  LYS A O     1 
ATOM   2939  C  CB    . LYS E 3 275 ? 41.152  69.803  -12.655 1.00 67.32  ? 281  LYS A CB    1 
ATOM   2940  C  CG    . LYS E 3 275 ? 41.094  70.330  -11.252 1.00 67.32  ? 281  LYS A CG    1 
ATOM   2941  C  CD    . LYS E 3 275 ? 41.192  71.836  -11.271 1.00 67.32  ? 281  LYS A CD    1 
ATOM   2942  C  CE    . LYS E 3 275 ? 41.259  72.389  -9.863  1.00 67.32  ? 281  LYS A CE    1 
ATOM   2943  N  NZ    . LYS E 3 275 ? 41.446  73.873  -9.840  1.00 67.32  ? 281  LYS A NZ    1 
ATOM   2944  N  N     . PRO E 3 276 ? 39.401  67.084  -11.475 1.00 157.46 ? 282  PRO A N     1 
ATOM   2945  C  CA    . PRO E 3 276 ? 38.063  66.547  -11.181 1.00 157.46 ? 282  PRO A CA    1 
ATOM   2946  C  C     . PRO E 3 276 ? 37.035  67.603  -10.750 1.00 157.46 ? 282  PRO A C     1 
ATOM   2947  O  O     . PRO E 3 276 ? 36.430  67.493  -9.681  1.00 157.46 ? 282  PRO A O     1 
ATOM   2948  C  CB    . PRO E 3 276 ? 38.337  65.529  -10.074 1.00 124.42 ? 282  PRO A CB    1 
ATOM   2949  C  CG    . PRO E 3 276 ? 39.742  65.093  -10.356 1.00 124.42 ? 282  PRO A CG    1 
ATOM   2950  C  CD    . PRO E 3 276 ? 40.415  66.405  -10.651 1.00 124.42 ? 282  PRO A CD    1 
ATOM   2951  N  N     . LEU E 3 277 ? 36.843  68.612  -11.595 1.00 100.97 ? 283  LEU A N     1 
ATOM   2952  C  CA    . LEU E 3 277 ? 35.898  69.701  -11.349 1.00 100.97 ? 283  LEU A CA    1 
ATOM   2953  C  C     . LEU E 3 277 ? 34.591  69.167  -10.736 1.00 100.97 ? 283  LEU A C     1 
ATOM   2954  O  O     . LEU E 3 277 ? 33.773  68.579  -11.434 1.00 100.97 ? 283  LEU A O     1 
ATOM   2955  C  CB    . LEU E 3 277 ? 35.612  70.395  -12.688 1.00 66.03  ? 283  LEU A CB    1 
ATOM   2956  C  CG    . LEU E 3 277 ? 36.753  70.329  -13.724 1.00 66.03  ? 283  LEU A CG    1 
ATOM   2957  C  CD1   . LEU E 3 277 ? 36.259  69.588  -14.940 1.00 66.03  ? 283  LEU A CD1   1 
ATOM   2958  C  CD2   . LEU E 3 277 ? 37.236  71.725  -14.129 1.00 66.03  ? 283  LEU A CD2   1 
ATOM   2959  N  N     . PRO E 3 278 ? 34.380  69.381  -9.425  1.00 95.41  ? 284  PRO A N     1 
ATOM   2960  C  CA    . PRO E 3 278 ? 33.195  68.934  -8.681  1.00 95.41  ? 284  PRO A CA    1 
ATOM   2961  C  C     . PRO E 3 278 ? 31.896  69.671  -9.010  1.00 95.41  ? 284  PRO A C     1 
ATOM   2962  O  O     . PRO E 3 278 ? 30.863  69.042  -9.257  1.00 95.41  ? 284  PRO A O     1 
ATOM   2963  C  CB    . PRO E 3 278 ? 33.616  69.144  -7.233  1.00 158.26 ? 284  PRO A CB    1 
ATOM   2964  C  CG    . PRO E 3 278 ? 34.424  70.408  -7.327  1.00 158.26 ? 284  PRO A CG    1 
ATOM   2965  C  CD    . PRO E 3 278 ? 35.282  70.157  -8.551  1.00 158.26 ? 284  PRO A CD    1 
ATOM   2966  N  N     . LYS E 3 279 ? 31.958  71.001  -8.997  1.00 148.28 ? 285  LYS A N     1 
ATOM   2967  C  CA    . LYS E 3 279 ? 30.802  71.847  -9.282  1.00 148.28 ? 285  LYS A CA    1 
ATOM   2968  C  C     . LYS E 3 279 ? 30.000  71.311  -10.457 1.00 148.28 ? 285  LYS A C     1 
ATOM   2969  O  O     . LYS E 3 279 ? 28.768  71.368  -10.454 1.00 148.28 ? 285  LYS A O     1 
ATOM   2970  C  CB    . LYS E 3 279 ? 31.258  73.276  -9.591  1.00 125.97 ? 285  LYS A CB    1 
ATOM   2971  N  N     . TYR E 3 280 ? 30.712  70.795  -11.458 1.00 76.98  ? 286  TYR A N     1 
ATOM   2972  C  CA    . TYR E 3 280 ? 30.083  70.235  -12.654 1.00 76.98  ? 286  TYR A CA    1 
ATOM   2973  C  C     . TYR E 3 280 ? 29.459  68.858  -12.383 1.00 76.98  ? 286  TYR A C     1 
ATOM   2974  O  O     . TYR E 3 280 ? 30.083  67.995  -11.755 1.00 76.98  ? 286  TYR A O     1 
ATOM   2975  C  CB    . TYR E 3 280 ? 31.108  70.125  -13.792 1.00 51.82  ? 286  TYR A CB    1 
ATOM   2976  N  N     . PRO E 3 281 ? 28.213  68.646  -12.852 1.00 91.29  ? 287  PRO A N     1 
ATOM   2977  C  CA    . PRO E 3 281 ? 27.428  67.412  -12.707 1.00 91.29  ? 287  PRO A CA    1 
ATOM   2978  C  C     . PRO E 3 281 ? 28.167  66.156  -13.156 1.00 91.29  ? 287  PRO A C     1 
ATOM   2979  O  O     . PRO E 3 281 ? 28.720  66.114  -14.256 1.00 91.29  ? 287  PRO A O     1 
ATOM   2980  C  CB    . PRO E 3 281 ? 26.205  67.685  -13.570 1.00 101.89 ? 287  PRO A CB    1 
ATOM   2981  C  CG    . PRO E 3 281 ? 26.024  69.157  -13.418 1.00 101.89 ? 287  PRO A CG    1 
ATOM   2982  C  CD    . PRO E 3 281 ? 27.432  69.662  -13.579 1.00 101.89 ? 287  PRO A CD    1 
ATOM   2983  N  N     . ARG E 3 282 ? 28.163  65.132  -12.305 1.00 80.81  ? 288  ARG A N     1 
ATOM   2984  C  CA    . ARG E 3 282 ? 28.844  63.876  -12.613 1.00 80.81  ? 288  ARG A CA    1 
ATOM   2985  C  C     . ARG E 3 282 ? 28.375  63.311  -13.950 1.00 80.81  ? 288  ARG A C     1 
ATOM   2986  O  O     . ARG E 3 282 ? 27.207  63.403  -14.293 1.00 80.81  ? 288  ARG A O     1 
ATOM   2987  C  CB    . ARG E 3 282 ? 28.602  62.842  -11.501 1.00 33.39  ? 288  ARG A CB    1 
ATOM   2988  N  N     . ILE E 3 283 ? 29.297  62.729  -14.704 1.00 56.27  ? 289  ILE A N     1 
ATOM   2989  C  CA    . ILE E 3 283 ? 28.979  62.149  -16.000 1.00 56.27  ? 289  ILE A CA    1 
ATOM   2990  C  C     . ILE E 3 283 ? 29.241  60.653  -15.994 1.00 56.27  ? 289  ILE A C     1 
ATOM   2991  O  O     . ILE E 3 283 ? 29.484  60.064  -14.939 1.00 56.27  ? 289  ILE A O     1 
ATOM   2992  C  CB    . ILE E 3 283 ? 29.798  62.810  -17.145 1.00 64.15  ? 289  ILE A CB    1 
ATOM   2993  C  CG1   . ILE E 3 283 ? 31.301  62.772  -16.843 1.00 64.15  ? 289  ILE A CG1   1 
ATOM   2994  C  CG2   . ILE E 3 283 ? 29.364  64.248  -17.325 1.00 64.15  ? 289  ILE A CG2   1 
ATOM   2995  C  CD1   . ILE E 3 283 ? 31.983  61.478  -17.203 1.00 64.15  ? 289  ILE A CD1   1 
ATOM   2996  N  N     . LYS E 3 284 ? 29.174  60.040  -17.172 1.00 86.33  ? 290  LYS A N     1 
ATOM   2997  C  CA    . LYS E 3 284 ? 29.405  58.602  -17.313 1.00 86.33  ? 290  LYS A CA    1 
ATOM   2998  C  C     . LYS E 3 284 ? 30.164  58.355  -18.603 1.00 86.33  ? 290  LYS A C     1 
ATOM   2999  O  O     . LYS E 3 284 ? 29.594  58.469  -19.682 1.00 86.33  ? 290  LYS A O     1 
ATOM   3000  C  CB    . LYS E 3 284 ? 28.073  57.821  -17.354 1.00 33.45  ? 290  LYS A CB    1 
ATOM   3001  N  N     . THR E 3 285 ? 31.450  58.031  -18.494 1.00 116.19 ? 291  THR A N     1 
ATOM   3002  C  CA    . THR E 3 285 ? 32.250  57.765  -19.683 1.00 116.19 ? 291  THR A CA    1 
ATOM   3003  C  C     . THR E 3 285 ? 32.385  56.267  -19.899 1.00 116.19 ? 291  THR A C     1 
ATOM   3004  O  O     . THR E 3 285 ? 33.071  55.583  -19.138 1.00 116.19 ? 291  THR A O     1 
ATOM   3005  C  CB    . THR E 3 285 ? 33.663  58.361  -19.589 1.00 117.83 ? 291  THR A CB    1 
ATOM   3006  O  OG1   . THR E 3 285 ? 33.575  59.754  -19.268 1.00 117.83 ? 291  THR A OG1   1 
ATOM   3007  C  CG2   . THR E 3 285 ? 34.391  58.198  -20.929 1.00 117.83 ? 291  THR A CG2   1 
ATOM   3008  N  N     . PRO E 3 286 ? 31.699  55.728  -20.924 1.00 117.43 ? 292  PRO A N     1 
ATOM   3009  C  CA    . PRO E 3 286 ? 31.793  54.290  -21.188 1.00 117.43 ? 292  PRO A CA    1 
ATOM   3010  C  C     . PRO E 3 286 ? 32.836  53.948  -22.259 1.00 117.43 ? 292  PRO A C     1 
ATOM   3011  O  O     . PRO E 3 286 ? 33.436  54.892  -22.829 1.00 117.43 ? 292  PRO A O     1 
ATOM   3012  C  CB    . PRO E 3 286 ? 30.375  53.927  -21.606 1.00 83.54  ? 292  PRO A CB    1 
ATOM   3013  C  CG    . PRO E 3 286 ? 29.987  55.108  -22.412 1.00 83.54  ? 292  PRO A CG    1 
ATOM   3014  C  CD    . PRO E 3 286 ? 30.497  56.284  -21.571 1.00 83.54  ? 292  PRO A CD    1 
ATOM   3015  N  N     . VAL E 3 288 ? 33.260  50.533  -25.633 1.00 119.23 ? 294  VAL A N     1 
ATOM   3016  C  CA    . VAL E 3 288 ? 31.926  50.639  -26.298 1.00 119.23 ? 294  VAL A CA    1 
ATOM   3017  C  C     . VAL E 3 288 ? 31.854  51.818  -27.274 1.00 119.23 ? 294  VAL A C     1 
ATOM   3018  O  O     . VAL E 3 288 ? 32.135  52.965  -26.908 1.00 119.23 ? 294  VAL A O     1 
ATOM   3019  C  CB    . VAL E 3 288 ? 30.786  50.777  -25.253 1.00 126.45 ? 294  VAL A CB    1 
ATOM   3020  C  CG1   . VAL E 3 288 ? 30.261  49.399  -24.860 1.00 126.45 ? 294  VAL A CG1   1 
ATOM   3021  C  CG2   . VAL E 3 288 ? 31.299  51.513  -24.018 1.00 126.45 ? 294  VAL A CG2   1 
ATOM   3022  N  N     . GLY E 3 289 ? 31.480  51.518  -28.519 1.00 87.92  ? 295  GLY A N     1 
ATOM   3023  C  CA    . GLY E 3 289 ? 31.375  52.542  -29.544 1.00 87.92  ? 295  GLY A CA    1 
ATOM   3024  C  C     . GLY E 3 289 ? 32.720  53.080  -30.001 1.00 87.92  ? 295  GLY A C     1 
ATOM   3025  O  O     . GLY E 3 289 ? 33.287  53.970  -29.320 1.00 87.92  ? 295  GLY A O     1 
ATOM   3026  N  N     . ASP E 3 310 ? 27.184  51.276  -36.850 1.00 128.69 ? 316  ASP A N     1 
ATOM   3027  C  CA    . ASP E 3 310 ? 26.868  50.883  -35.451 1.00 128.69 ? 316  ASP A CA    1 
ATOM   3028  C  C     . ASP E 3 310 ? 25.766  51.749  -34.855 1.00 128.69 ? 316  ASP A C     1 
ATOM   3029  O  O     . ASP E 3 310 ? 25.943  52.954  -34.646 1.00 128.69 ? 316  ASP A O     1 
ATOM   3030  C  CB    . ASP E 3 310 ? 28.117  50.965  -34.559 1.00 132.49 ? 316  ASP A CB    1 
ATOM   3031  C  CG    . ASP E 3 310 ? 27.882  50.377  -33.158 1.00 132.49 ? 316  ASP A CG    1 
ATOM   3032  O  OD1   . ASP E 3 310 ? 28.773  50.511  -32.286 1.00 132.49 ? 316  ASP A OD1   1 
ATOM   3033  O  OD2   . ASP E 3 310 ? 26.808  49.776  -32.926 1.00 132.49 ? 316  ASP A OD2   1 
ATOM   3034  N  N     . THR E 3 311 ? 24.624  51.121  -34.587 1.00 120.30 ? 317  THR A N     1 
ATOM   3035  C  CA    . THR E 3 311 ? 23.485  51.808  -33.978 1.00 120.30 ? 317  THR A CA    1 
ATOM   3036  C  C     . THR E 3 311 ? 23.867  52.045  -32.511 1.00 120.30 ? 317  THR A C     1 
ATOM   3037  O  O     . THR E 3 311 ? 23.014  52.065  -31.615 1.00 120.30 ? 317  THR A O     1 
ATOM   3038  C  CB    . THR E 3 311 ? 22.192  50.932  -34.048 1.00 90.22  ? 317  THR A CB    1 
ATOM   3039  O  OG1   . THR E 3 311 ? 21.930  50.582  -35.411 1.00 90.22  ? 317  THR A OG1   1 
ATOM   3040  C  CG2   . THR E 3 311 ? 20.973  51.682  -33.485 1.00 90.22  ? 317  THR A CG2   1 
ATOM   3041  N  N     . ARG E 3 312 ? 25.169  52.218  -32.286 1.00 150.91 ? 318  ARG A N     1 
ATOM   3042  C  CA    . ARG E 3 312 ? 25.712  52.439  -30.955 1.00 150.91 ? 318  ARG A CA    1 
ATOM   3043  C  C     . ARG E 3 312 ? 25.152  53.692  -30.310 1.00 150.91 ? 318  ARG A C     1 
ATOM   3044  O  O     . ARG E 3 312 ? 25.029  54.745  -30.940 1.00 150.91 ? 318  ARG A O     1 
ATOM   3045  C  CB    . ARG E 3 312 ? 27.240  52.524  -31.008 1.00 65.51  ? 318  ARG A CB    1 
ATOM   3046  N  N     . GLU E 3 313 ? 24.821  53.557  -29.034 1.00 119.62 ? 319  GLU A N     1 
ATOM   3047  C  CA    . GLU E 3 313 ? 24.261  54.643  -28.270 1.00 119.62 ? 319  GLU A CA    1 
ATOM   3048  C  C     . GLU E 3 313 ? 25.355  55.598  -27.807 1.00 119.62 ? 319  GLU A C     1 
ATOM   3049  O  O     . GLU E 3 313 ? 25.128  56.802  -27.713 1.00 119.62 ? 319  GLU A O     1 
ATOM   3050  C  CB    . GLU E 3 313 ? 23.502  54.070  -27.075 1.00 150.59 ? 319  GLU A CB    1 
ATOM   3051  C  CG    . GLU E 3 313 ? 22.127  54.650  -26.899 1.00 150.59 ? 319  GLU A CG    1 
ATOM   3052  C  CD    . GLU E 3 313 ? 22.166  56.152  -26.785 1.00 150.59 ? 319  GLU A CD    1 
ATOM   3053  O  OE1   . GLU E 3 313 ? 22.872  56.650  -25.886 1.00 150.59 ? 319  GLU A OE1   1 
ATOM   3054  O  OE2   . GLU E 3 313 ? 21.497  56.833  -27.592 1.00 150.59 ? 319  GLU A OE2   1 
ATOM   3055  N  N     . TYR E 3 314 ? 26.551  55.072  -27.552 1.00 85.57  ? 320  TYR A N     1 
ATOM   3056  C  CA    . TYR E 3 314 ? 27.644  55.912  -27.076 1.00 85.57  ? 320  TYR A CA    1 
ATOM   3057  C  C     . TYR E 3 314 ? 28.955  55.758  -27.845 1.00 85.57  ? 320  TYR A C     1 
ATOM   3058  O  O     . TYR E 3 314 ? 29.017  55.081  -28.867 1.00 85.57  ? 320  TYR A O     1 
ATOM   3059  C  CB    . TYR E 3 314 ? 27.857  55.610  -25.604 1.00 76.89  ? 320  TYR A CB    1 
ATOM   3060  C  CG    . TYR E 3 314 ? 26.555  55.513  -24.851 1.00 76.89  ? 320  TYR A CG    1 
ATOM   3061  C  CD1   . TYR E 3 314 ? 26.005  56.625  -24.222 1.00 76.89  ? 320  TYR A CD1   1 
ATOM   3062  C  CD2   . TYR E 3 314 ? 25.862  54.308  -24.776 1.00 76.89  ? 320  TYR A CD2   1 
ATOM   3063  C  CE1   . TYR E 3 314 ? 24.798  56.536  -23.533 1.00 76.89  ? 320  TYR A CE1   1 
ATOM   3064  C  CE2   . TYR E 3 314 ? 24.656  54.214  -24.093 1.00 76.89  ? 320  TYR A CE2   1 
ATOM   3065  C  CZ    . TYR E 3 314 ? 24.136  55.327  -23.476 1.00 76.89  ? 320  TYR A CZ    1 
ATOM   3066  O  OH    . TYR E 3 314 ? 22.959  55.233  -22.786 1.00 76.89  ? 320  TYR A OH    1 
ATOM   3067  N  N     . VAL E 3 315 ? 29.996  56.419  -27.354 1.00 118.29 ? 321  VAL A N     1 
ATOM   3068  C  CA    . VAL E 3 315 ? 31.309  56.335  -27.969 1.00 118.29 ? 321  VAL A CA    1 
ATOM   3069  C  C     . VAL E 3 315 ? 32.389  56.495  -26.892 1.00 118.29 ? 321  VAL A C     1 
ATOM   3070  O  O     . VAL E 3 315 ? 32.111  56.958  -25.783 1.00 118.29 ? 321  VAL A O     1 
ATOM   3071  C  CB    . VAL E 3 315 ? 31.458  57.375  -29.111 1.00 80.40  ? 321  VAL A CB    1 
ATOM   3072  C  CG1   . VAL E 3 315 ? 32.857  57.316  -29.697 1.00 80.40  ? 321  VAL A CG1   1 
ATOM   3073  C  CG2   . VAL E 3 315 ? 30.443  57.081  -30.212 1.00 80.40  ? 321  VAL A CG2   1 
ATOM   3074  N  N     . ALA E 3 316 ? 33.609  56.068  -27.203 1.00 107.55 ? 322  ALA A N     1 
ATOM   3075  C  CA    . ALA E 3 316 ? 34.711  56.159  -26.252 1.00 107.55 ? 322  ALA A CA    1 
ATOM   3076  C  C     . ALA E 3 316 ? 35.657  57.288  -26.639 1.00 107.55 ? 322  ALA A C     1 
ATOM   3077  O  O     . ALA E 3 316 ? 35.587  57.701  -27.815 1.00 107.55 ? 322  ALA A O     1 
ATOM   3078  C  CB    . ALA E 3 316 ? 35.467  54.839  -26.203 1.00 109.74 ? 322  ALA A CB    1 
ATOM   3079  N  N     . ALA E 3 318 ? 34.165  59.672  -24.919 1.00 99.89  ? 324  ALA A N     1 
ATOM   3080  C  CA    . ALA E 3 318 ? 33.005  60.577  -25.211 1.00 99.89  ? 324  ALA A CA    1 
ATOM   3081  C  C     . ALA E 3 318 ? 32.032  60.590  -24.037 1.00 99.89  ? 324  ALA A C     1 
ATOM   3082  O  O     . ALA E 3 318 ? 31.026  59.873  -24.039 1.00 99.89  ? 324  ALA A O     1 
ATOM   3083  C  CB    . ALA E 3 318 ? 32.269  60.123  -26.486 1.00 57.35  ? 324  ALA A CB    1 
ATOM   3084  N  N     . PRO E 3 319 ? 32.313  61.422  -23.023 1.00 78.47  ? 325  PRO A N     1 
ATOM   3085  C  CA    . PRO E 3 319 ? 31.486  61.552  -21.818 1.00 78.47  ? 325  PRO A CA    1 
ATOM   3086  C  C     . PRO E 3 319 ? 30.086  62.100  -22.089 1.00 78.47  ? 325  PRO A C     1 
ATOM   3087  O  O     . PRO E 3 319 ? 29.786  62.567  -23.189 1.00 78.47  ? 325  PRO A O     1 
ATOM   3088  C  CB    . PRO E 3 319 ? 32.313  62.481  -20.943 1.00 84.15  ? 325  PRO A CB    1 
ATOM   3089  C  CG    . PRO E 3 319 ? 32.939  63.398  -21.971 1.00 84.15  ? 325  PRO A CG    1 
ATOM   3090  C  CD    . PRO E 3 319 ? 33.391  62.428  -23.038 1.00 84.15  ? 325  PRO A CD    1 
ATOM   3091  N  N     . TYR E 3 320 ? 29.232  62.039  -21.073 1.00 68.83  ? 326  TYR A N     1 
ATOM   3092  C  CA    . TYR E 3 320 ? 27.863  62.518  -21.199 1.00 68.83  ? 326  TYR A CA    1 
ATOM   3093  C  C     . TYR E 3 320 ? 27.162  62.501  -19.848 1.00 68.83  ? 326  TYR A C     1 
ATOM   3094  O  O     . TYR E 3 320 ? 27.232  61.516  -19.119 1.00 68.83  ? 326  TYR A O     1 
ATOM   3095  C  CB    . TYR E 3 320 ? 27.089  61.645  -22.198 1.00 77.60  ? 326  TYR A CB    1 
ATOM   3096  C  CG    . TYR E 3 320 ? 26.447  60.392  -21.628 1.00 77.60  ? 326  TYR A CG    1 
ATOM   3097  C  CD1   . TYR E 3 320 ? 27.177  59.220  -21.442 1.00 77.60  ? 326  TYR A CD1   1 
ATOM   3098  C  CD2   . TYR E 3 320 ? 25.086  60.367  -21.333 1.00 77.60  ? 326  TYR A CD2   1 
ATOM   3099  C  CE1   . TYR E 3 320 ? 26.562  58.044  -20.985 1.00 77.60  ? 326  TYR A CE1   1 
ATOM   3100  C  CE2   . TYR E 3 320 ? 24.457  59.202  -20.876 1.00 77.60  ? 326  TYR A CE2   1 
ATOM   3101  C  CZ    . TYR E 3 320 ? 25.199  58.045  -20.705 1.00 77.60  ? 326  TYR A CZ    1 
ATOM   3102  O  OH    . TYR E 3 320 ? 24.564  56.904  -20.253 1.00 77.60  ? 326  TYR A OH    1 
ATOM   3103  N  N     . THR E 3 321 ? 26.486  63.595  -19.518 1.00 59.94  ? 327  THR A N     1 
ATOM   3104  C  CA    . THR E 3 321 ? 25.779  63.679  -18.248 1.00 59.94  ? 327  THR A CA    1 
ATOM   3105  C  C     . THR E 3 321 ? 24.427  62.983  -18.330 1.00 59.94  ? 327  THR A C     1 
ATOM   3106  O  O     . THR E 3 321 ? 23.594  63.333  -19.169 1.00 59.94  ? 327  THR A O     1 
ATOM   3107  C  CB    . THR E 3 321 ? 25.508  65.127  -17.853 1.00 46.69  ? 327  THR A CB    1 
ATOM   3108  O  OG1   . THR E 3 321 ? 26.654  65.934  -18.148 1.00 46.69  ? 327  THR A OG1   1 
ATOM   3109  C  CG2   . THR E 3 321 ? 25.183  65.200  -16.359 1.00 46.69  ? 327  THR A CG2   1 
ATOM   3110  N  N     . PRO E 3 322 ? 24.199  61.971  -17.480 1.00 83.53  ? 328  PRO A N     1 
ATOM   3111  C  CA    . PRO E 3 322 ? 22.933  61.229  -17.453 1.00 83.53  ? 328  PRO A CA    1 
ATOM   3112  C  C     . PRO E 3 322 ? 21.935  62.046  -16.655 1.00 83.53  ? 328  PRO A C     1 
ATOM   3113  O  O     . PRO E 3 322 ? 22.215  62.405  -15.511 1.00 83.53  ? 328  PRO A O     1 
ATOM   3114  C  CB    . PRO E 3 322 ? 23.295  59.942  -16.721 1.00 102.41 ? 328  PRO A CB    1 
ATOM   3115  C  CG    . PRO E 3 322 ? 24.737  59.793  -16.984 1.00 102.41 ? 328  PRO A CG    1 
ATOM   3116  C  CD    . PRO E 3 322 ? 25.240  61.199  -16.793 1.00 102.41 ? 328  PRO A CD    1 
ATOM   3117  N  N     . VAL E 3 323 ? 20.774  62.333  -17.233 1.00 69.32  ? 329  VAL A N     1 
ATOM   3118  C  CA    . VAL E 3 323 ? 19.791  63.139  -16.526 1.00 69.32  ? 329  VAL A CA    1 
ATOM   3119  C  C     . VAL E 3 323 ? 18.450  62.474  -16.352 1.00 69.32  ? 329  VAL A C     1 
ATOM   3120  O  O     . VAL E 3 323 ? 18.156  61.456  -16.975 1.00 69.32  ? 329  VAL A O     1 
ATOM   3121  C  CB    . VAL E 3 323 ? 19.549  64.454  -17.240 1.00 80.52  ? 329  VAL A CB    1 
ATOM   3122  C  CG1   . VAL E 3 323 ? 20.828  65.247  -17.281 1.00 80.52  ? 329  VAL A CG1   1 
ATOM   3123  C  CG2   . VAL E 3 323 ? 19.038  64.193  -18.637 1.00 80.52  ? 329  VAL A CG2   1 
ATOM   3124  N  N     . GLU E 3 324 ? 17.632  63.074  -15.495 1.00 79.90  ? 330  GLU A N     1 
ATOM   3125  C  CA    . GLU E 3 324 ? 16.301  62.568  -15.212 1.00 79.90  ? 330  GLU A CA    1 
ATOM   3126  C  C     . GLU E 3 324 ? 15.280  63.662  -15.491 1.00 79.90  ? 330  GLU A C     1 
ATOM   3127  O  O     . GLU E 3 324 ? 15.545  64.852  -15.295 1.00 79.90  ? 330  GLU A O     1 
ATOM   3128  C  CB    . GLU E 3 324 ? 16.205  62.126  -13.746 1.00 64.06  ? 330  GLU A CB    1 
ATOM   3129  N  N     . HIS E 3 325 ? 14.116  63.240  -15.965 1.00 54.04  ? 331  HIS A N     1 
ATOM   3130  C  CA    . HIS E 3 325 ? 13.024  64.148  -16.276 1.00 54.04  ? 331  HIS A CA    1 
ATOM   3131  C  C     . HIS E 3 325 ? 12.187  64.226  -15.011 1.00 54.04  ? 331  HIS A C     1 
ATOM   3132  O  O     . HIS E 3 325 ? 11.672  63.209  -14.548 1.00 54.04  ? 331  HIS A O     1 
ATOM   3133  C  CB    . HIS E 3 325 ? 12.214  63.576  -17.432 1.00 81.91  ? 331  HIS A CB    1 
ATOM   3134  C  CG    . HIS E 3 325 ? 11.107  64.464  -17.880 1.00 81.91  ? 331  HIS A CG    1 
ATOM   3135  N  ND1   . HIS E 3 325 ? 9.796   64.254  -17.517 1.00 81.91  ? 331  HIS A ND1   1 
ATOM   3136  C  CD2   . HIS E 3 325 ? 11.123  65.603  -18.610 1.00 81.91  ? 331  HIS A CD2   1 
ATOM   3137  C  CE1   . HIS E 3 325 ? 9.050   65.229  -18.003 1.00 81.91  ? 331  HIS A CE1   1 
ATOM   3138  N  NE2   . HIS E 3 325 ? 9.831   66.061  -18.669 1.00 81.91  ? 331  HIS A NE2   1 
ATOM   3139  N  N     . VAL E 3 326 ? 12.038  65.426  -14.457 1.00 44.30  ? 332  VAL A N     1 
ATOM   3140  C  CA    . VAL E 3 326 ? 11.313  65.589  -13.199 1.00 44.30  ? 332  VAL A CA    1 
ATOM   3141  C  C     . VAL E 3 326 ? 10.130  66.565  -13.202 1.00 44.30  ? 332  VAL A C     1 
ATOM   3142  O  O     . VAL E 3 326 ? 10.290  67.765  -13.405 1.00 44.30  ? 332  VAL A O     1 
ATOM   3143  C  CB    . VAL E 3 326 ? 12.316  65.987  -12.053 1.00 67.70  ? 332  VAL A CB    1 
ATOM   3144  C  CG1   . VAL E 3 326 ? 12.974  67.333  -12.346 1.00 67.70  ? 332  VAL A CG1   1 
ATOM   3145  C  CG2   . VAL E 3 326 ? 11.599  66.034  -10.719 1.00 67.70  ? 332  VAL A CG2   1 
ATOM   3146  N  N     . VAL E 3 327 ? 8.946   66.025  -12.930 1.00 50.01  ? 333  VAL A N     1 
ATOM   3147  C  CA    . VAL E 3 327 ? 7.698   66.790  -12.889 1.00 50.01  ? 333  VAL A CA    1 
ATOM   3148  C  C     . VAL E 3 327 ? 7.496   67.581  -11.603 1.00 50.01  ? 333  VAL A C     1 
ATOM   3149  O  O     . VAL E 3 327 ? 7.650   67.042  -10.517 1.00 50.01  ? 333  VAL A O     1 
ATOM   3150  C  CB    . VAL E 3 327 ? 6.478   65.855  -13.055 1.00 54.51  ? 333  VAL A CB    1 
ATOM   3151  C  CG1   . VAL E 3 327 ? 5.192   66.641  -12.930 1.00 54.51  ? 333  VAL A CG1   1 
ATOM   3152  C  CG2   . VAL E 3 327 ? 6.541   65.148  -14.399 1.00 54.51  ? 333  VAL A CG2   1 
ATOM   3153  N  N     . PHE E 3 328 ? 7.115   68.849  -11.732 1.00 74.31  ? 334  PHE A N     1 
ATOM   3154  C  CA    . PHE E 3 328 ? 6.887   69.714  -10.576 1.00 74.31  ? 334  PHE A CA    1 
ATOM   3155  C  C     . PHE E 3 328 ? 6.049   68.992  -9.539  1.00 74.31  ? 334  PHE A C     1 
ATOM   3156  O  O     . PHE E 3 328 ? 5.016   68.397  -9.859  1.00 74.31  ? 334  PHE A O     1 
ATOM   3157  C  CB    . PHE E 3 328 ? 6.182   71.007  -10.990 1.00 47.32  ? 334  PHE A CB    1 
ATOM   3158  C  CG    . PHE E 3 328 ? 5.989   71.976  -9.866  1.00 47.32  ? 334  PHE A CG    1 
ATOM   3159  C  CD1   . PHE E 3 328 ? 7.070   72.539  -9.221  1.00 47.32  ? 334  PHE A CD1   1 
ATOM   3160  C  CD2   . PHE E 3 328 ? 4.719   72.302  -9.420  1.00 47.32  ? 334  PHE A CD2   1 
ATOM   3161  C  CE1   . PHE E 3 328 ? 6.881   73.411  -8.137  1.00 47.32  ? 334  PHE A CE1   1 
ATOM   3162  C  CE2   . PHE E 3 328 ? 4.529   73.172  -8.340  1.00 47.32  ? 334  PHE A CE2   1 
ATOM   3163  C  CZ    . PHE E 3 328 ? 5.607   73.722  -7.702  1.00 47.32  ? 334  PHE A CZ    1 
ATOM   3164  N  N     . ASN E 3 329 ? 6.508   69.054  -8.292  1.00 57.39  ? 335  ASN A N     1 
ATOM   3165  C  CA    . ASN E 3 329 ? 5.838   68.400  -7.177  1.00 57.39  ? 335  ASN A CA    1 
ATOM   3166  C  C     . ASN E 3 329 ? 5.495   69.402  -6.086  1.00 57.39  ? 335  ASN A C     1 
ATOM   3167  O  O     . ASN E 3 329 ? 6.350   69.747  -5.298  1.00 57.39  ? 335  ASN A O     1 
ATOM   3168  C  CB    . ASN E 3 329 ? 6.771   67.344  -6.606  1.00 54.06  ? 335  ASN A CB    1 
ATOM   3169  C  CG    . ASN E 3 329 ? 6.140   66.547  -5.499  1.00 54.06  ? 335  ASN A CG    1 
ATOM   3170  O  OD1   . ASN E 3 329 ? 5.138   66.956  -4.922  1.00 54.06  ? 335  ASN A OD1   1 
ATOM   3171  N  ND2   . ASN E 3 329 ? 6.736   65.400  -5.180  1.00 54.06  ? 335  ASN A ND2   1 
ATOM   3172  N  N     . PRO E 3 330 ? 4.240   69.872  -6.022  1.00 55.39  ? 336  PRO A N     1 
ATOM   3173  C  CA    . PRO E 3 330 ? 3.822   70.840  -5.004  1.00 55.39  ? 336  PRO A CA    1 
ATOM   3174  C  C     . PRO E 3 330 ? 4.252   70.496  -3.583  1.00 55.39  ? 336  PRO A C     1 
ATOM   3175  O  O     . PRO E 3 330 ? 4.393   71.384  -2.749  1.00 55.39  ? 336  PRO A O     1 
ATOM   3176  C  CB    . PRO E 3 330 ? 2.315   70.863  -5.170  1.00 57.50  ? 336  PRO A CB    1 
ATOM   3177  C  CG    . PRO E 3 330 ? 2.167   70.702  -6.651  1.00 57.50  ? 336  PRO A CG    1 
ATOM   3178  C  CD    . PRO E 3 330 ? 3.123   69.574  -6.937  1.00 57.50  ? 336  PRO A CD    1 
ATOM   3179  N  N     . SER E 3 331 ? 4.462   69.214  -3.301  1.00 51.34  ? 337  SER A N     1 
ATOM   3180  C  CA    . SER E 3 331 ? 4.893   68.807  -1.964  1.00 51.34  ? 337  SER A CA    1 
ATOM   3181  C  C     . SER E 3 331 ? 6.369   69.127  -1.742  1.00 51.34  ? 337  SER A C     1 
ATOM   3182  O  O     . SER E 3 331 ? 6.774   69.440  -0.631  1.00 51.34  ? 337  SER A O     1 
ATOM   3183  C  CB    . SER E 3 331 ? 4.646   67.305  -1.735  1.00 75.70  ? 337  SER A CB    1 
ATOM   3184  O  OG    . SER E 3 331 ? 3.467   67.072  -0.973  1.00 75.70  ? 337  SER A OG    1 
ATOM   3185  N  N     . SER E 3 332 ? 7.161   69.051  -2.806  1.00 51.23  ? 338  SER A N     1 
ATOM   3186  C  CA    . SER E 3 332 ? 8.596   69.333  -2.758  1.00 51.23  ? 338  SER A CA    1 
ATOM   3187  C  C     . SER E 3 332 ? 8.886   70.789  -2.446  1.00 51.23  ? 338  SER A C     1 
ATOM   3188  O  O     . SER E 3 332 ? 8.666   71.661  -3.281  1.00 51.23  ? 338  SER A O     1 
ATOM   3189  C  CB    . SER E 3 332 ? 9.239   68.978  -4.101  1.00 41.88  ? 338  SER A CB    1 
ATOM   3190  O  OG    . SER E 3 332 ? 10.482  69.622  -4.277  1.00 41.88  ? 338  SER A OG    1 
ATOM   3191  N  N     . ARG E 3 333 ? 9.401   71.052  -1.250  1.00 61.76  ? 339  ARG A N     1 
ATOM   3192  C  CA    . ARG E 3 333 ? 9.705   72.424  -0.865  1.00 61.76  ? 339  ARG A CA    1 
ATOM   3193  C  C     . ARG E 3 333 ? 10.855  72.951  -1.722  1.00 61.76  ? 339  ARG A C     1 
ATOM   3194  O  O     . ARG E 3 333 ? 11.096  74.160  -1.781  1.00 61.76  ? 339  ARG A O     1 
ATOM   3195  C  CB    . ARG E 3 333 ? 10.038  72.497  0.631   1.00 44.39  ? 339  ARG A CB    1 
ATOM   3196  N  N     . ASP E 3 334 ? 11.547  72.025  -2.392  1.00 63.80  ? 340  ASP A N     1 
ATOM   3197  C  CA    . ASP E 3 334 ? 12.663  72.353  -3.282  1.00 63.80  ? 340  ASP A CA    1 
ATOM   3198  C  C     . ASP E 3 334 ? 12.085  72.951  -4.556  1.00 63.80  ? 340  ASP A C     1 
ATOM   3199  O  O     . ASP E 3 334 ? 12.373  74.094  -4.902  1.00 63.80  ? 340  ASP A O     1 
ATOM   3200  C  CB    . ASP E 3 334 ? 13.472  71.098  -3.635  1.00 64.79  ? 340  ASP A CB    1 
ATOM   3201  N  N     . HIS E 3 335 ? 11.267  72.169  -5.252  1.00 40.93  ? 341  HIS A N     1 
ATOM   3202  C  CA    . HIS E 3 335 ? 10.641  72.641  -6.471  1.00 40.93  ? 341  HIS A CA    1 
ATOM   3203  C  C     . HIS E 3 335 ? 9.990   74.012  -6.216  1.00 40.93  ? 341  HIS A C     1 
ATOM   3204  O  O     . HIS E 3 335 ? 10.187  74.967  -6.965  1.00 40.93  ? 341  HIS A O     1 
ATOM   3205  C  CB    . HIS E 3 335 ? 9.606   71.623  -6.923  1.00 58.19  ? 341  HIS A CB    1 
ATOM   3206  C  CG    . HIS E 3 335 ? 10.186  70.291  -7.269  1.00 58.19  ? 341  HIS A CG    1 
ATOM   3207  N  ND1   . HIS E 3 335 ? 9.416   69.236  -7.708  1.00 58.19  ? 341  HIS A ND1   1 
ATOM   3208  C  CD2   . HIS E 3 335 ? 11.465  69.848  -7.270  1.00 58.19  ? 341  HIS A CD2   1 
ATOM   3209  C  CE1   . HIS E 3 335 ? 10.197  68.200  -7.967  1.00 58.19  ? 341  HIS A CE1   1 
ATOM   3210  N  NE2   . HIS E 3 335 ? 11.445  68.545  -7.710  1.00 58.19  ? 341  HIS A NE2   1 
ATOM   3211  N  N     . ILE E 3 336 ? 9.222   74.112  -5.142  1.00 50.77  ? 342  ILE A N     1 
ATOM   3212  C  CA    . ILE E 3 336 ? 8.572   75.364  -4.815  1.00 50.77  ? 342  ILE A CA    1 
ATOM   3213  C  C     . ILE E 3 336 ? 9.574   76.521  -4.780  1.00 50.77  ? 342  ILE A C     1 
ATOM   3214  O  O     . ILE E 3 336 ? 9.264   77.629  -5.219  1.00 50.77  ? 342  ILE A O     1 
ATOM   3215  C  CB    . ILE E 3 336 ? 7.899   75.268  -3.469  1.00 45.53  ? 342  ILE A CB    1 
ATOM   3216  C  CG1   . ILE E 3 336 ? 7.062   74.008  -3.425  1.00 45.53  ? 342  ILE A CG1   1 
ATOM   3217  C  CG2   . ILE E 3 336 ? 7.012   76.469  -3.240  1.00 45.53  ? 342  ILE A CG2   1 
ATOM   3218  C  CD1   . ILE E 3 336 ? 6.369   73.824  -2.105  1.00 45.53  ? 342  ILE A CD1   1 
ATOM   3219  N  N     . GLN E 3 337 ? 10.770  76.258  -4.248  1.00 56.82  ? 343  GLN A N     1 
ATOM   3220  C  CA    . GLN E 3 337 ? 11.840  77.269  -4.160  1.00 56.82  ? 343  GLN A CA    1 
ATOM   3221  C  C     . GLN E 3 337 ? 12.455  77.526  -5.520  1.00 56.82  ? 343  GLN A C     1 
ATOM   3222  O  O     . GLN E 3 337 ? 12.767  78.654  -5.856  1.00 56.82  ? 343  GLN A O     1 
ATOM   3223  C  CB    . GLN E 3 337 ? 12.958  76.834  -3.202  1.00 79.46  ? 343  GLN A CB    1 
ATOM   3224  C  CG    . GLN E 3 337 ? 14.347  77.396  -3.570  1.00 79.46  ? 343  GLN A CG    1 
ATOM   3225  C  CD    . GLN E 3 337 ? 15.072  76.573  -4.642  1.00 79.46  ? 343  GLN A CD    1 
ATOM   3226  O  OE1   . GLN E 3 337 ? 16.026  77.043  -5.276  1.00 79.46  ? 343  GLN A OE1   1 
ATOM   3227  N  NE2   . GLN E 3 337 ? 14.630  75.336  -4.834  1.00 79.46  ? 343  GLN A NE2   1 
ATOM   3228  N  N     . LYS E 3 338 ? 12.640  76.461  -6.285  1.00 34.71  ? 344  LYS A N     1 
ATOM   3229  C  CA    . LYS E 3 338 ? 13.214  76.562  -7.610  1.00 34.71  ? 344  LYS A CA    1 
ATOM   3230  C  C     . LYS E 3 338 ? 12.311  77.446  -8.440  1.00 34.71  ? 344  LYS A C     1 
ATOM   3231  O  O     . LYS E 3 338 ? 12.523  78.649  -8.544  1.00 34.71  ? 344  LYS A O     1 
ATOM   3232  C  CB    . LYS E 3 338 ? 13.307  75.175  -8.235  1.00 66.72  ? 344  LYS A CB    1 
ATOM   3233  C  CG    . LYS E 3 338 ? 13.942  75.138  -9.589  1.00 66.72  ? 344  LYS A CG    1 
ATOM   3234  C  CD    . LYS E 3 338 ? 13.854  73.739  -10.159 1.00 66.72  ? 344  LYS A CD    1 
ATOM   3235  C  CE    . LYS E 3 338 ? 14.492  73.657  -11.530 1.00 66.72  ? 344  LYS A CE    1 
ATOM   3236  N  NZ    . LYS E 3 338 ? 15.950  73.999  -11.458 1.00 66.72  ? 344  LYS A NZ    1 
ATOM   3237  N  N     . LYS E 3 339 ? 11.282  76.837  -9.015  1.00 57.47  ? 345  LYS A N     1 
ATOM   3238  C  CA    . LYS E 3 339 ? 10.316  77.538  -9.848  1.00 57.47  ? 345  LYS A CA    1 
ATOM   3239  C  C     . LYS E 3 339 ? 10.018  78.951  -9.334  1.00 57.47  ? 345  LYS A C     1 
ATOM   3240  O  O     . LYS E 3 339 ? 10.184  79.926  -10.063 1.00 57.47  ? 345  LYS A O     1 
ATOM   3241  C  CB    . LYS E 3 339 ? 9.019   76.731  -9.912  1.00 62.93  ? 345  LYS A CB    1 
ATOM   3242  C  CG    . LYS E 3 339 ? 9.209   75.229  -10.049 1.00 62.93  ? 345  LYS A CG    1 
ATOM   3243  C  CD    . LYS E 3 339 ? 9.042   74.733  -11.470 1.00 62.93  ? 345  LYS A CD    1 
ATOM   3244  C  CE    . LYS E 3 339 ? 10.149  75.213  -12.402 1.00 62.93  ? 345  LYS A CE    1 
ATOM   3245  N  NZ    . LYS E 3 339 ? 10.208  74.372  -13.655 1.00 62.93  ? 345  LYS A NZ    1 
ATOM   3246  N  N     . LEU E 3 340 ? 9.585   79.075  -8.083  1.00 54.71  ? 346  LEU A N     1 
ATOM   3247  C  CA    . LEU E 3 340 ? 9.273   80.401  -7.578  1.00 54.71  ? 346  LEU A CA    1 
ATOM   3248  C  C     . LEU E 3 340 ? 10.441  81.373  -7.627  1.00 54.71  ? 346  LEU A C     1 
ATOM   3249  O  O     . LEU E 3 340 ? 10.228  82.586  -7.729  1.00 54.71  ? 346  LEU A O     1 
ATOM   3250  C  CB    . LEU E 3 340 ? 8.694   80.339  -6.163  1.00 49.72  ? 346  LEU A CB    1 
ATOM   3251  C  CG    . LEU E 3 340 ? 7.173   80.138  -6.042  1.00 49.72  ? 346  LEU A CG    1 
ATOM   3252  C  CD1   . LEU E 3 340 ? 6.788   80.340  -4.576  1.00 49.72  ? 346  LEU A CD1   1 
ATOM   3253  C  CD2   . LEU E 3 340 ? 6.398   81.127  -6.924  1.00 49.72  ? 346  LEU A CD2   1 
ATOM   3254  N  N     . GLN E 3 341 ? 11.671  80.862  -7.570  1.00 67.18  ? 347  GLN A N     1 
ATOM   3255  C  CA    . GLN E 3 341 ? 12.841  81.744  -7.626  1.00 67.18  ? 347  GLN A CA    1 
ATOM   3256  C  C     . GLN E 3 341 ? 13.101  82.256  -9.035  1.00 67.18  ? 347  GLN A C     1 
ATOM   3257  O  O     . GLN E 3 341 ? 13.508  83.408  -9.208  1.00 67.18  ? 347  GLN A O     1 
ATOM   3258  C  CB    . GLN E 3 341 ? 14.100  81.056  -7.078  1.00 71.38  ? 347  GLN A CB    1 
ATOM   3259  C  CG    . GLN E 3 341 ? 14.695  81.800  -5.873  1.00 71.38  ? 347  GLN A CG    1 
ATOM   3260  C  CD    . GLN E 3 341 ? 16.021  81.250  -5.407  1.00 71.38  ? 347  GLN A CD    1 
ATOM   3261  O  OE1   . GLN E 3 341 ? 16.579  81.738  -4.437  1.00 71.38  ? 347  GLN A OE1   1 
ATOM   3262  N  NE2   . GLN E 3 341 ? 16.534  80.236  -6.093  1.00 71.38  ? 347  GLN A NE2   1 
ATOM   3263  N  N     . GLU E 3 342 ? 12.857  81.400  -10.030 1.00 65.88  ? 348  GLU A N     1 
ATOM   3264  C  CA    . GLU E 3 342 ? 13.030  81.769  -11.434 1.00 65.88  ? 348  GLU A CA    1 
ATOM   3265  C  C     . GLU E 3 342 ? 11.937  82.767  -11.808 1.00 65.88  ? 348  GLU A C     1 
ATOM   3266  O  O     . GLU E 3 342 ? 11.924  83.315  -12.908 1.00 65.88  ? 348  GLU A O     1 
ATOM   3267  C  CB    . GLU E 3 342 ? 12.896  80.556  -12.339 1.00 86.69  ? 348  GLU A CB    1 
ATOM   3268  C  CG    . GLU E 3 342 ? 13.672  79.348  -11.902 1.00 86.69  ? 348  GLU A CG    1 
ATOM   3269  C  CD    . GLU E 3 342 ? 13.532  78.214  -12.901 1.00 86.69  ? 348  GLU A CD    1 
ATOM   3270  O  OE1   . GLU E 3 342 ? 13.837  77.042  -12.560 1.00 86.69  ? 348  GLU A OE1   1 
ATOM   3271  O  OE2   . GLU E 3 342 ? 13.115  78.509  -14.045 1.00 86.69  ? 348  GLU A OE2   1 
ATOM   3272  N  N     . ALA E 3 343 ? 11.009  82.986  -10.882 1.00 68.58  ? 349  ALA A N     1 
ATOM   3273  C  CA    . ALA E 3 343 ? 9.912   83.912  -11.095 1.00 68.58  ? 349  ALA A CA    1 
ATOM   3274  C  C     . ALA E 3 343 ? 10.372  85.291  -10.686 1.00 68.58  ? 349  ALA A C     1 
ATOM   3275  O  O     . ALA E 3 343 ? 9.702   86.288  -10.961 1.00 68.58  ? 349  ALA A O     1 
ATOM   3276  C  CB    . ALA E 3 343 ? 8.723   83.496  -10.263 1.00 69.46  ? 349  ALA A CB    1 
ATOM   3277  N  N     . GLY E 3 344 ? 11.517  85.340  -10.015 1.00 78.73  ? 350  GLY A N     1 
ATOM   3278  C  CA    . GLY E 3 344 ? 12.064  86.612  -9.586  1.00 78.73  ? 350  GLY A CA    1 
ATOM   3279  C  C     . GLY E 3 344 ? 11.953  86.841  -8.097  1.00 78.73  ? 350  GLY A C     1 
ATOM   3280  O  O     . GLY E 3 344 ? 12.066  87.972  -7.615  1.00 78.73  ? 350  GLY A O     1 
ATOM   3281  N  N     . TRP E 3 345 ? 11.719  85.764  -7.360  1.00 87.26  ? 351  TRP A N     1 
ATOM   3282  C  CA    . TRP E 3 345 ? 11.596  85.871  -5.918  1.00 87.26  ? 351  TRP A CA    1 
ATOM   3283  C  C     . TRP E 3 345 ? 12.994  86.000  -5.331  1.00 87.26  ? 351  TRP A C     1 
ATOM   3284  O  O     . TRP E 3 345 ? 13.926  85.307  -5.750  1.00 87.26  ? 351  TRP A O     1 
ATOM   3285  C  CB    . TRP E 3 345 ? 10.869  84.632  -5.358  1.00 31.09  ? 351  TRP A CB    1 
ATOM   3286  C  CG    . TRP E 3 345 ? 10.836  84.528  -3.821  1.00 31.09  ? 351  TRP A CG    1 
ATOM   3287  C  CD1   . TRP E 3 345 ? 10.495  85.519  -2.915  1.00 31.09  ? 351  TRP A CD1   1 
ATOM   3288  C  CD2   . TRP E 3 345 ? 11.065  83.345  -3.042  1.00 31.09  ? 351  TRP A CD2   1 
ATOM   3289  N  NE1   . TRP E 3 345 ? 10.494  85.010  -1.631  1.00 31.09  ? 351  TRP A NE1   1 
ATOM   3290  C  CE2   . TRP E 3 345 ? 10.838  83.682  -1.682  1.00 31.09  ? 351  TRP A CE2   1 
ATOM   3291  C  CE3   . TRP E 3 345 ? 11.436  82.039  -3.359  1.00 31.09  ? 351  TRP A CE3   1 
ATOM   3292  C  CZ2   . TRP E 3 345 ? 10.968  82.747  -0.649  1.00 31.09  ? 351  TRP A CZ2   1 
ATOM   3293  C  CZ3   . TRP E 3 345 ? 11.566  81.118  -2.327  1.00 31.09  ? 351  TRP A CZ3   1 
ATOM   3294  C  CH2   . TRP E 3 345 ? 11.330  81.477  -0.991  1.00 31.09  ? 351  TRP A CH2   1 
ATOM   3295  N  N     . VAL E 3 346 ? 13.143  86.910  -4.380  1.00 86.81  ? 352  VAL A N     1 
ATOM   3296  C  CA    . VAL E 3 346 ? 14.423  87.105  -3.726  1.00 86.81  ? 352  VAL A CA    1 
ATOM   3297  C  C     . VAL E 3 346 ? 14.310  86.563  -2.302  1.00 86.81  ? 352  VAL A C     1 
ATOM   3298  O  O     . VAL E 3 346 ? 13.815  87.253  -1.411  1.00 86.81  ? 352  VAL A O     1 
ATOM   3299  C  CB    . VAL E 3 346 ? 14.780  88.598  -3.695  1.00 114.80 ? 352  VAL A CB    1 
ATOM   3300  C  CG1   . VAL E 3 346 ? 15.977  88.840  -2.791  1.00 114.80 ? 352  VAL A CG1   1 
ATOM   3301  C  CG2   . VAL E 3 346 ? 15.079  89.072  -5.102  1.00 114.80 ? 352  VAL A CG2   1 
ATOM   3302  N  N     . PRO E 3 347 ? 14.748  85.310  -2.077  1.00 59.91  ? 353  PRO A N     1 
ATOM   3303  C  CA    . PRO E 3 347 ? 14.692  84.676  -0.758  1.00 59.91  ? 353  PRO A CA    1 
ATOM   3304  C  C     . PRO E 3 347 ? 15.409  85.426  0.368   1.00 59.91  ? 353  PRO A C     1 
ATOM   3305  O  O     . PRO E 3 347 ? 16.623  85.636  0.337   1.00 59.91  ? 353  PRO A O     1 
ATOM   3306  C  CB    . PRO E 3 347 ? 15.278  83.298  -1.020  1.00 72.09  ? 353  PRO A CB    1 
ATOM   3307  C  CG    . PRO E 3 347 ? 14.805  83.016  -2.406  1.00 72.09  ? 353  PRO A CG    1 
ATOM   3308  C  CD    . PRO E 3 347 ? 15.094  84.319  -3.110  1.00 72.09  ? 353  PRO A CD    1 
ATOM   3309  N  N     . THR E 3 348 ? 14.626  85.831  1.362   1.00 63.04  ? 354  THR A N     1 
ATOM   3310  C  CA    . THR E 3 348 ? 15.125  86.554  2.516   1.00 63.04  ? 354  THR A CA    1 
ATOM   3311  C  C     . THR E 3 348 ? 15.604  85.551  3.551   1.00 63.04  ? 354  THR A C     1 
ATOM   3312  O  O     . THR E 3 348 ? 16.795  85.273  3.649   1.00 63.04  ? 354  THR A O     1 
ATOM   3313  C  CB    . THR E 3 348 ? 14.014  87.412  3.131   1.00 106.95 ? 354  THR A CB    1 
ATOM   3314  O  OG1   . THR E 3 348 ? 13.636  88.427  2.194   1.00 106.95 ? 354  THR A OG1   1 
ATOM   3315  C  CG2   . THR E 3 348 ? 14.475  88.049  4.434   1.00 106.95 ? 354  THR A CG2   1 
ATOM   3316  N  N     . LYS E 3 349 ? 14.667  84.994  4.311   1.00 69.12  ? 355  LYS A N     1 
ATOM   3317  C  CA    . LYS E 3 349 ? 15.013  84.028  5.347   1.00 69.12  ? 355  LYS A CA    1 
ATOM   3318  C  C     . LYS E 3 349 ? 15.501  82.692  4.790   1.00 69.12  ? 355  LYS A C     1 
ATOM   3319  O  O     . LYS E 3 349 ? 14.786  82.031  4.044   1.00 69.12  ? 355  LYS A O     1 
ATOM   3320  C  CB    . LYS E 3 349 ? 13.810  83.798  6.266   1.00 64.04  ? 355  LYS A CB    1 
ATOM   3321  N  N     . TYR E 3 350 ? 16.730  82.316  5.141   1.00 59.29  ? 356  TYR A N     1 
ATOM   3322  C  CA    . TYR E 3 350 ? 17.335  81.042  4.717   1.00 59.29  ? 356  TYR A CA    1 
ATOM   3323  C  C     . TYR E 3 350 ? 17.570  80.156  5.970   1.00 59.29  ? 356  TYR A C     1 
ATOM   3324  O  O     . TYR E 3 350 ? 17.385  80.602  7.107   1.00 59.29  ? 356  TYR A O     1 
ATOM   3325  C  CB    . TYR E 3 350 ? 18.695  81.274  4.016   1.00 40.38  ? 356  TYR A CB    1 
ATOM   3326  C  CG    . TYR E 3 350 ? 18.677  81.704  2.546   1.00 40.38  ? 356  TYR A CG    1 
ATOM   3327  C  CD1   . TYR E 3 350 ? 18.284  82.997  2.173   1.00 40.38  ? 356  TYR A CD1   1 
ATOM   3328  C  CD2   . TYR E 3 350 ? 19.088  80.820  1.522   1.00 40.38  ? 356  TYR A CD2   1 
ATOM   3329  C  CE1   . TYR E 3 350 ? 18.300  83.417  0.810   1.00 40.38  ? 356  TYR A CE1   1 
ATOM   3330  C  CE2   . TYR E 3 350 ? 19.107  81.219  0.149   1.00 40.38  ? 356  TYR A CE2   1 
ATOM   3331  C  CZ    . TYR E 3 350 ? 18.708  82.528  -0.204  1.00 40.38  ? 356  TYR A CZ    1 
ATOM   3332  O  OH    . TYR E 3 350 ? 18.687  82.952  -1.540  1.00 40.38  ? 356  TYR A OH    1 
ATOM   3333  N  N     . THR E 3 351 ? 17.976  78.907  5.776   1.00 70.39  ? 357  THR A N     1 
ATOM   3334  C  CA    . THR E 3 351 ? 18.248  78.032  6.914   1.00 70.39  ? 357  THR A CA    1 
ATOM   3335  C  C     . THR E 3 351 ? 19.732  77.766  7.124   1.00 70.39  ? 357  THR A C     1 
ATOM   3336  O  O     . THR E 3 351 ? 20.527  77.742  6.167   1.00 70.39  ? 357  THR A O     1 
ATOM   3337  C  CB    . THR E 3 351 ? 17.612  76.650  6.771   1.00 63.34  ? 357  THR A CB    1 
ATOM   3338  O  OG1   . THR E 3 351 ? 17.882  76.128  5.462   1.00 63.34  ? 357  THR A OG1   1 
ATOM   3339  C  CG2   . THR E 3 351 ? 16.139  76.727  7.041   1.00 63.34  ? 357  THR A CG2   1 
ATOM   3340  N  N     . ASP E 3 352 ? 20.090  77.556  8.390   1.00 75.04  ? 358  ASP A N     1 
ATOM   3341  C  CA    . ASP E 3 352 ? 21.454  77.238  8.759   1.00 75.04  ? 358  ASP A CA    1 
ATOM   3342  C  C     . ASP E 3 352 ? 21.707  75.850  8.182   1.00 75.04  ? 358  ASP A C     1 
ATOM   3343  O  O     . ASP E 3 352 ? 21.774  74.863  8.911   1.00 75.04  ? 358  ASP A O     1 
ATOM   3344  C  CB    . ASP E 3 352 ? 21.600  77.217  10.284  1.00 156.31 ? 358  ASP A CB    1 
ATOM   3345  C  CG    . ASP E 3 352 ? 21.405  78.590  10.910  1.00 156.31 ? 358  ASP A CG    1 
ATOM   3346  O  OD1   . ASP E 3 352 ? 20.341  79.208  10.681  1.00 156.31 ? 358  ASP A OD1   1 
ATOM   3347  O  OD2   . ASP E 3 352 ? 22.317  79.049  11.634  1.00 156.31 ? 358  ASP A OD2   1 
ATOM   3348  N  N     . LYS E 3 353 ? 21.790  75.798  6.856   1.00 88.42  ? 359  LYS A N     1 
ATOM   3349  C  CA    . LYS E 3 353 ? 22.052  74.583  6.090   1.00 88.42  ? 359  LYS A CA    1 
ATOM   3350  C  C     . LYS E 3 353 ? 22.049  74.995  4.621   1.00 88.42  ? 359  LYS A C     1 
ATOM   3351  O  O     . LYS E 3 353 ? 22.045  74.156  3.714   1.00 88.42  ? 359  LYS A O     1 
ATOM   3352  C  CB    . LYS E 3 353 ? 21.008  73.497  6.357   1.00 68.54  ? 359  LYS A CB    1 
ATOM   3353  N  N     . GLY E 3 354 ? 22.042  76.310  4.409   1.00 93.27  ? 360  GLY A N     1 
ATOM   3354  C  CA    . GLY E 3 354 ? 22.101  76.874  3.071   1.00 93.27  ? 360  GLY A CA    1 
ATOM   3355  C  C     . GLY E 3 354 ? 20.871  76.819  2.193   1.00 93.27  ? 360  GLY A C     1 
ATOM   3356  O  O     . GLY E 3 354 ? 21.005  76.725  0.967   1.00 93.27  ? 360  GLY A O     1 
ATOM   3357  N  N     . ALA E 3 355 ? 19.681  76.899  2.793   1.00 84.72  ? 361  ALA A N     1 
ATOM   3358  C  CA    . ALA E 3 355 ? 18.434  76.844  2.022   1.00 84.72  ? 361  ALA A CA    1 
ATOM   3359  C  C     . ALA E 3 355 ? 17.422  77.881  2.468   1.00 84.72  ? 361  ALA A C     1 
ATOM   3360  O  O     . ALA E 3 355 ? 17.416  78.281  3.624   1.00 84.72  ? 361  ALA A O     1 
ATOM   3361  C  CB    . ALA E 3 355 ? 17.822  75.473  2.140   1.00 46.93  ? 361  ALA A CB    1 
ATOM   3362  N  N     . PRO E 3 356 ? 16.538  78.318  1.551   1.00 59.54  ? 362  PRO A N     1 
ATOM   3363  C  CA    . PRO E 3 356 ? 15.504  79.320  1.841   1.00 59.54  ? 362  PRO A CA    1 
ATOM   3364  C  C     . PRO E 3 356 ? 14.280  78.725  2.548   1.00 59.54  ? 362  PRO A C     1 
ATOM   3365  O  O     . PRO E 3 356 ? 13.799  77.652  2.178   1.00 59.54  ? 362  PRO A O     1 
ATOM   3366  C  CB    . PRO E 3 356 ? 15.176  79.868  0.461   1.00 61.47  ? 362  PRO A CB    1 
ATOM   3367  C  CG    . PRO E 3 356 ? 15.267  78.643  -0.383  1.00 61.47  ? 362  PRO A CG    1 
ATOM   3368  C  CD    . PRO E 3 356 ? 16.532  77.973  0.116   1.00 61.47  ? 362  PRO A CD    1 
ATOM   3369  N  N     . VAL E 3 357 ? 13.792  79.423  3.574   1.00 65.86  ? 363  VAL A N     1 
ATOM   3370  C  CA    . VAL E 3 357 ? 12.634  78.964  4.332   1.00 65.86  ? 363  VAL A CA    1 
ATOM   3371  C  C     . VAL E 3 357 ? 11.408  79.153  3.461   1.00 65.86  ? 363  VAL A C     1 
ATOM   3372  O  O     . VAL E 3 357 ? 11.091  80.264  3.036   1.00 65.86  ? 363  VAL A O     1 
ATOM   3373  C  CB    . VAL E 3 357 ? 12.405  79.772  5.626   1.00 45.38  ? 363  VAL A CB    1 
ATOM   3374  C  CG1   . VAL E 3 357 ? 11.851  78.878  6.688   1.00 45.38  ? 363  VAL A CG1   1 
ATOM   3375  C  CG2   . VAL E 3 357 ? 13.679  80.396  6.103   1.00 45.38  ? 363  VAL A CG2   1 
ATOM   3376  N  N     . VAL E 3 358 ? 10.715  78.052  3.205   1.00 58.13  ? 364  VAL A N     1 
ATOM   3377  C  CA    . VAL E 3 358 ? 9.528   78.071  2.378   1.00 58.13  ? 364  VAL A CA    1 
ATOM   3378  C  C     . VAL E 3 358 ? 8.312   77.574  3.129   1.00 58.13  ? 364  VAL A C     1 
ATOM   3379  O  O     . VAL E 3 358 ? 7.596   76.708  2.657   1.00 58.13  ? 364  VAL A O     1 
ATOM   3380  C  CB    . VAL E 3 358 ? 9.735   77.217  1.117   1.00 59.16  ? 364  VAL A CB    1 
ATOM   3381  C  CG1   . VAL E 3 358 ? 8.492   77.235  0.264   1.00 59.16  ? 364  VAL A CG1   1 
ATOM   3382  C  CG2   . VAL E 3 358 ? 10.915  77.766  0.325   1.00 59.16  ? 364  VAL A CG2   1 
ATOM   3383  N  N     . ASP E 3 359 ? 8.094   78.102  4.323   1.00 43.02  ? 365  ASP A N     1 
ATOM   3384  C  CA    . ASP E 3 359 ? 6.919   77.729  5.076   1.00 43.02  ? 365  ASP A CA    1 
ATOM   3385  C  C     . ASP E 3 359 ? 5.780   78.635  4.553   1.00 43.02  ? 365  ASP A C     1 
ATOM   3386  O  O     . ASP E 3 359 ? 6.020   79.619  3.828   1.00 43.02  ? 365  ASP A O     1 
ATOM   3387  C  CB    . ASP E 3 359 ? 7.144   77.942  6.574   1.00 74.69  ? 365  ASP A CB    1 
ATOM   3388  C  CG    . ASP E 3 359 ? 7.816   79.267  6.883   1.00 74.69  ? 365  ASP A CG    1 
ATOM   3389  O  OD1   . ASP E 3 359 ? 7.729   80.196  6.052   1.00 74.69  ? 365  ASP A OD1   1 
ATOM   3390  O  OD2   . ASP E 3 359 ? 8.427   79.389  7.966   1.00 74.69  ? 365  ASP A OD2   1 
ATOM   3391  N  N     . ASP E 3 360 ? 4.542   78.301  4.909   1.00 76.72  ? 366  ASP A N     1 
ATOM   3392  C  CA    . ASP E 3 360 ? 3.401   79.085  4.461   1.00 76.72  ? 366  ASP A CA    1 
ATOM   3393  C  C     . ASP E 3 360 ? 3.642   80.564  4.721   1.00 76.72  ? 366  ASP A C     1 
ATOM   3394  O  O     . ASP E 3 360 ? 3.235   81.413  3.934   1.00 76.72  ? 366  ASP A O     1 
ATOM   3395  C  CB    . ASP E 3 360 ? 2.139   78.646  5.193   1.00 109.21 ? 366  ASP A CB    1 
ATOM   3396  C  CG    . ASP E 3 360 ? 0.875   79.050  4.464   1.00 109.21 ? 366  ASP A CG    1 
ATOM   3397  O  OD1   . ASP E 3 360 ? 0.472   78.312  3.537   1.00 109.21 ? 366  ASP A OD1   1 
ATOM   3398  O  OD2   . ASP E 3 360 ? 0.291   80.105  4.807   1.00 109.21 ? 366  ASP A OD2   1 
ATOM   3399  N  N     . GLU E 3 361 ? 4.305   80.864  5.832   1.00 63.53  ? 367  GLU A N     1 
ATOM   3400  C  CA    . GLU E 3 361 ? 4.602   82.240  6.200   1.00 63.53  ? 367  GLU A CA    1 
ATOM   3401  C  C     . GLU E 3 361 ? 5.249   82.969  5.027   1.00 63.53  ? 367  GLU A C     1 
ATOM   3402  O  O     . GLU E 3 361 ? 4.665   83.908  4.478   1.00 63.53  ? 367  GLU A O     1 
ATOM   3403  C  CB    . GLU E 3 361 ? 5.530   82.275  7.418   1.00 167.06 ? 367  GLU A CB    1 
ATOM   3404  C  CG    . GLU E 3 361 ? 5.203   83.377  8.417   1.00 167.06 ? 367  GLU A CG    1 
ATOM   3405  C  CD    . GLU E 3 361 ? 5.327   84.768  7.826   1.00 167.06 ? 367  GLU A CD    1 
ATOM   3406  O  OE1   . GLU E 3 361 ? 6.454   85.157  7.458   1.00 167.06 ? 367  GLU A OE1   1 
ATOM   3407  O  OE2   . GLU E 3 361 ? 4.299   85.473  7.731   1.00 167.06 ? 367  GLU A OE2   1 
ATOM   3408  N  N     . VAL E 3 362 ? 6.439   82.534  4.624   1.00 60.76  ? 368  VAL A N     1 
ATOM   3409  C  CA    . VAL E 3 362 ? 7.122   83.196  3.513   1.00 60.76  ? 368  VAL A CA    1 
ATOM   3410  C  C     . VAL E 3 362 ? 6.309   83.099  2.235   1.00 60.76  ? 368  VAL A C     1 
ATOM   3411  O  O     . VAL E 3 362 ? 6.221   84.060  1.480   1.00 60.76  ? 368  VAL A O     1 
ATOM   3412  C  CB    . VAL E 3 362 ? 8.527   82.607  3.230   1.00 43.60  ? 368  VAL A CB    1 
ATOM   3413  C  CG1   . VAL E 3 362 ? 9.402   82.730  4.438   1.00 43.60  ? 368  VAL A CG1   1 
ATOM   3414  C  CG2   . VAL E 3 362 ? 8.415   81.177  2.839   1.00 43.60  ? 368  VAL A CG2   1 
ATOM   3415  N  N     . LEU E 3 363 ? 5.714   81.936  1.990   1.00 79.14  ? 369  LEU A N     1 
ATOM   3416  C  CA    . LEU E 3 363 ? 4.912   81.744  0.789   1.00 79.14  ? 369  LEU A CA    1 
ATOM   3417  C  C     . LEU E 3 363 ? 3.832   82.802  0.694   1.00 79.14  ? 369  LEU A C     1 
ATOM   3418  O  O     . LEU E 3 363 ? 3.515   83.278  -0.391  1.00 79.14  ? 369  LEU A O     1 
ATOM   3419  C  CB    . LEU E 3 363 ? 4.276   80.360  0.793   1.00 39.14  ? 369  LEU A CB    1 
ATOM   3420  C  CG    . LEU E 3 363 ? 5.255   79.260  0.420   1.00 39.14  ? 369  LEU A CG    1 
ATOM   3421  C  CD1   . LEU E 3 363 ? 4.820   77.928  0.998   1.00 39.14  ? 369  LEU A CD1   1 
ATOM   3422  C  CD2   . LEU E 3 363 ? 5.347   79.202  -1.074  1.00 39.14  ? 369  LEU A CD2   1 
ATOM   3423  N  N     . GLU E 3 364 ? 3.266   83.166  1.836   1.00 53.09  ? 370  GLU A N     1 
ATOM   3424  C  CA    . GLU E 3 364 ? 2.225   84.178  1.867   1.00 53.09  ? 370  GLU A CA    1 
ATOM   3425  C  C     . GLU E 3 364 ? 2.824   85.479  1.357   1.00 53.09  ? 370  GLU A C     1 
ATOM   3426  O  O     . GLU E 3 364 ? 2.209   86.219  0.583   1.00 53.09  ? 370  GLU A O     1 
ATOM   3427  C  CB    . GLU E 3 364 ? 1.745   84.390  3.301   1.00 129.88 ? 370  GLU A CB    1 
ATOM   3428  C  CG    . GLU E 3 364 ? 0.450   85.164  3.411   1.00 129.88 ? 370  GLU A CG    1 
ATOM   3429  C  CD    . GLU E 3 364 ? -0.758  84.293  3.130   1.00 129.88 ? 370  GLU A CD    1 
ATOM   3430  O  OE1   . GLU E 3 364 ? -1.123  83.480  4.007   1.00 129.88 ? 370  GLU A OE1   1 
ATOM   3431  O  OE2   . GLU E 3 364 ? -1.337  84.410  2.030   1.00 129.88 ? 370  GLU A OE2   1 
ATOM   3432  N  N     . GLY E 3 365 ? 4.048   85.738  1.801   1.00 83.93  ? 371  GLY A N     1 
ATOM   3433  C  CA    . GLY E 3 365 ? 4.739   86.961  1.436   1.00 83.93  ? 371  GLY A CA    1 
ATOM   3434  C  C     . GLY E 3 365 ? 5.314   87.075  0.042   1.00 83.93  ? 371  GLY A C     1 
ATOM   3435  O  O     . GLY E 3 365 ? 5.346   88.170  -0.509  1.00 83.93  ? 371  GLY A O     1 
ATOM   3436  N  N     . VAL E 3 366 ? 5.767   85.963  -0.528  1.00 58.07  ? 372  VAL A N     1 
ATOM   3437  C  CA    . VAL E 3 366 ? 6.364   85.973  -1.862  1.00 58.07  ? 372  VAL A CA    1 
ATOM   3438  C  C     . VAL E 3 366 ? 5.572   86.769  -2.896  1.00 58.07  ? 372  VAL A C     1 
ATOM   3439  O  O     . VAL E 3 366 ? 4.351   86.701  -2.951  1.00 58.07  ? 372  VAL A O     1 
ATOM   3440  C  CB    . VAL E 3 366 ? 6.557   84.560  -2.393  1.00 44.02  ? 372  VAL A CB    1 
ATOM   3441  C  CG1   . VAL E 3 366 ? 7.203   84.617  -3.757  1.00 44.02  ? 372  VAL A CG1   1 
ATOM   3442  C  CG2   . VAL E 3 366 ? 7.385   83.746  -1.417  1.00 44.02  ? 372  VAL A CG2   1 
ATOM   3443  N  N     . ARG E 3 367 ? 6.282   87.532  -3.719  1.00 66.58  ? 373  ARG A N     1 
ATOM   3444  C  CA    . ARG E 3 367 ? 5.623   88.340  -4.727  1.00 66.58  ? 373  ARG A CA    1 
ATOM   3445  C  C     . ARG E 3 367 ? 6.355   88.341  -6.063  1.00 66.58  ? 373  ARG A C     1 
ATOM   3446  O  O     . ARG E 3 367 ? 7.355   89.025  -6.242  1.00 66.58  ? 373  ARG A O     1 
ATOM   3447  C  CB    . ARG E 3 367 ? 5.462   89.775  -4.215  1.00 99.93  ? 373  ARG A CB    1 
ATOM   3448  C  CG    . ARG E 3 367 ? 4.656   89.887  -2.930  1.00 99.93  ? 373  ARG A CG    1 
ATOM   3449  C  CD    . ARG E 3 367 ? 3.273   89.277  -3.092  1.00 99.93  ? 373  ARG A CD    1 
ATOM   3450  N  NE    . ARG E 3 367 ? 2.567   89.131  -1.820  1.00 99.93  ? 373  ARG A NE    1 
ATOM   3451  C  CZ    . ARG E 3 367 ? 1.875   90.097  -1.222  1.00 99.93  ? 373  ARG A CZ    1 
ATOM   3452  N  NH1   . ARG E 3 367 ? 1.785   91.298  -1.781  1.00 99.93  ? 373  ARG A NH1   1 
ATOM   3453  N  NH2   . ARG E 3 367 ? 1.272   89.861  -0.063  1.00 99.93  ? 373  ARG A NH2   1 
ATOM   3454  N  N     . VAL E 3 368 ? 5.868   87.564  -7.013  1.00 64.37  ? 374  VAL A N     1 
ATOM   3455  C  CA    . VAL E 3 368 ? 6.522   87.564  -8.299  1.00 64.37  ? 374  VAL A CA    1 
ATOM   3456  C  C     . VAL E 3 368 ? 5.700   88.405  -9.273  1.00 64.37  ? 374  VAL A C     1 
ATOM   3457  O  O     . VAL E 3 368 ? 4.631   88.927  -8.913  1.00 64.37  ? 374  VAL A O     1 
ATOM   3458  C  CB    . VAL E 3 368 ? 6.739   86.146  -8.813  1.00 39.29  ? 374  VAL A CB    1 
ATOM   3459  C  CG1   . VAL E 3 368 ? 7.635   85.400  -7.849  1.00 39.29  ? 374  VAL A CG1   1 
ATOM   3460  C  CG2   . VAL E 3 368 ? 5.424   85.440  -8.961  1.00 39.29  ? 374  VAL A CG2   1 
ATOM   3461  N  N     . ASP E 3 369 ? 6.201   88.557  -10.497 1.00 90.71  ? 375  ASP A N     1 
ATOM   3462  C  CA    . ASP E 3 369 ? 5.515   89.388  -11.474 1.00 90.71  ? 375  ASP A CA    1 
ATOM   3463  C  C     . ASP E 3 369 ? 4.509   88.690  -12.366 1.00 90.71  ? 375  ASP A C     1 
ATOM   3464  O  O     . ASP E 3 369 ? 3.441   89.231  -12.621 1.00 90.71  ? 375  ASP A O     1 
ATOM   3465  C  CB    . ASP E 3 369 ? 6.532   90.174  -12.309 1.00 127.93 ? 375  ASP A CB    1 
ATOM   3466  C  CG    . ASP E 3 369 ? 6.897   91.516  -11.670 1.00 127.93 ? 375  ASP A CG    1 
ATOM   3467  O  OD1   . ASP E 3 369 ? 7.260   91.541  -10.472 1.00 127.93 ? 375  ASP A OD1   1 
ATOM   3468  O  OD2   . ASP E 3 369 ? 6.821   92.551  -12.366 1.00 127.93 ? 375  ASP A OD2   1 
ATOM   3469  N  N     . ASP E 3 370 ? 4.830   87.499  -12.843 1.00 67.88  ? 376  ASP A N     1 
ATOM   3470  C  CA    . ASP E 3 370 ? 3.895   86.770  -13.692 1.00 67.88  ? 376  ASP A CA    1 
ATOM   3471  C  C     . ASP E 3 370 ? 2.625   86.465  -12.895 1.00 67.88  ? 376  ASP A C     1 
ATOM   3472  O  O     . ASP E 3 370 ? 2.651   85.663  -11.958 1.00 67.88  ? 376  ASP A O     1 
ATOM   3473  C  CB    . ASP E 3 370 ? 4.555   85.481  -14.174 1.00 83.91  ? 376  ASP A CB    1 
ATOM   3474  C  CG    . ASP E 3 370 ? 3.627   84.626  -14.991 1.00 83.91  ? 376  ASP A CG    1 
ATOM   3475  O  OD1   . ASP E 3 370 ? 4.076   84.096  -16.035 1.00 83.91  ? 376  ASP A OD1   1 
ATOM   3476  O  OD2   . ASP E 3 370 ? 2.456   84.474  -14.586 1.00 83.91  ? 376  ASP A OD2   1 
ATOM   3477  N  N     . PRO E 3 371 ? 1.490   87.090  -13.269 1.00 88.84  ? 377  PRO A N     1 
ATOM   3478  C  CA    . PRO E 3 371 ? 0.164   86.947  -12.637 1.00 88.84  ? 377  PRO A CA    1 
ATOM   3479  C  C     . PRO E 3 371 ? -0.327  85.507  -12.408 1.00 88.84  ? 377  PRO A C     1 
ATOM   3480  O  O     . PRO E 3 371 ? -0.745  85.160  -11.307 1.00 88.84  ? 377  PRO A O     1 
ATOM   3481  C  CB    . PRO E 3 371 ? -0.748  87.724  -13.582 1.00 116.79 ? 377  PRO A CB    1 
ATOM   3482  C  CG    . PRO E 3 371 ? -0.094  87.500  -14.913 1.00 116.79 ? 377  PRO A CG    1 
ATOM   3483  C  CD    . PRO E 3 371 ? 1.361   87.743  -14.584 1.00 116.79 ? 377  PRO A CD    1 
ATOM   3484  N  N     . GLU E 3 372 ? -0.299  84.683  -13.452 1.00 65.70  ? 378  GLU A N     1 
ATOM   3485  C  CA    . GLU E 3 372 ? -0.713  83.292  -13.336 1.00 65.70  ? 378  GLU A CA    1 
ATOM   3486  C  C     . GLU E 3 372 ? 0.088   82.588  -12.245 1.00 65.70  ? 378  GLU A C     1 
ATOM   3487  O  O     . GLU E 3 372 ? -0.452  81.782  -11.474 1.00 65.70  ? 378  GLU A O     1 
ATOM   3488  C  CB    . GLU E 3 372 ? -0.494  82.559  -14.662 1.00 60.32  ? 378  GLU A CB    1 
ATOM   3489  C  CG    . GLU E 3 372 ? -0.167  81.083  -14.495 1.00 60.32  ? 378  GLU A CG    1 
ATOM   3490  C  CD    . GLU E 3 372 ? -0.723  80.195  -15.607 1.00 60.32  ? 378  GLU A CD    1 
ATOM   3491  O  OE1   . GLU E 3 372 ? -0.464  80.472  -16.800 1.00 60.32  ? 378  GLU A OE1   1 
ATOM   3492  O  OE2   . GLU E 3 372 ? -1.414  79.201  -15.286 1.00 60.32  ? 378  GLU A OE2   1 
ATOM   3493  N  N     . LYS E 3 373 ? 1.381   82.897  -12.197 1.00 71.63  ? 379  LYS A N     1 
ATOM   3494  C  CA    . LYS E 3 373 ? 2.297   82.309  -11.231 1.00 71.63  ? 379  LYS A CA    1 
ATOM   3495  C  C     . LYS E 3 373 ? 2.047   82.692  -9.786  1.00 71.63  ? 379  LYS A C     1 
ATOM   3496  O  O     . LYS E 3 373 ? 1.950   81.818  -8.931  1.00 71.63  ? 379  LYS A O     1 
ATOM   3497  C  CB    . LYS E 3 373 ? 3.732   82.640  -11.606 1.00 57.00  ? 379  LYS A CB    1 
ATOM   3498  C  CG    . LYS E 3 373 ? 4.224   81.800  -12.754 1.00 57.00  ? 379  LYS A CG    1 
ATOM   3499  C  CD    . LYS E 3 373 ? 5.611   82.206  -13.206 1.00 57.00  ? 379  LYS A CD    1 
ATOM   3500  C  CE    . LYS E 3 373 ? 6.035   81.386  -14.413 1.00 57.00  ? 379  LYS A CE    1 
ATOM   3501  N  NZ    . LYS E 3 373 ? 6.006   79.950  -14.044 1.00 57.00  ? 379  LYS A NZ    1 
ATOM   3502  N  N     . GLN E 3 374 ? 1.959   83.977  -9.480  1.00 73.51  ? 380  GLN A N     1 
ATOM   3503  C  CA    . GLN E 3 374 ? 1.693   84.324  -8.091  1.00 73.51  ? 380  GLN A CA    1 
ATOM   3504  C  C     . GLN E 3 374 ? 0.343   83.739  -7.667  1.00 73.51  ? 380  GLN A C     1 
ATOM   3505  O  O     . GLN E 3 374 ? 0.086   83.514  -6.485  1.00 73.51  ? 380  GLN A O     1 
ATOM   3506  C  CB    . GLN E 3 374 ? 1.701   85.829  -7.883  1.00 60.65  ? 380  GLN A CB    1 
ATOM   3507  C  CG    . GLN E 3 374 ? 1.002   86.209  -6.623  1.00 60.65  ? 380  GLN A CG    1 
ATOM   3508  C  CD    . GLN E 3 374 ? 1.567   87.445  -6.010  1.00 60.65  ? 380  GLN A CD    1 
ATOM   3509  O  OE1   . GLN E 3 374 ? 1.958   88.382  -6.711  1.00 60.65  ? 380  GLN A OE1   1 
ATOM   3510  N  NE2   . GLN E 3 374 ? 1.600   87.476  -4.682  1.00 60.65  ? 380  GLN A NE2   1 
ATOM   3511  N  N     . ALA E 3 375 ? -0.509  83.485  -8.652  1.00 94.84  ? 381  ALA A N     1 
ATOM   3512  C  CA    . ALA E 3 375 ? -1.817  82.902  -8.413  1.00 94.84  ? 381  ALA A CA    1 
ATOM   3513  C  C     . ALA E 3 375 ? -1.604  81.490  -7.897  1.00 94.84  ? 381  ALA A C     1 
ATOM   3514  O  O     . ALA E 3 375 ? -2.290  81.043  -6.976  1.00 94.84  ? 381  ALA A O     1 
ATOM   3515  C  CB    . ALA E 3 375 ? -2.605  82.866  -9.711  1.00 37.42  ? 381  ALA A CB    1 
ATOM   3516  N  N     . ALA E 3 376 ? -0.641  80.795  -8.502  1.00 74.50  ? 382  ALA A N     1 
ATOM   3517  C  CA    . ALA E 3 376 ? -0.326  79.422  -8.128  1.00 74.50  ? 382  ALA A CA    1 
ATOM   3518  C  C     . ALA E 3 376 ? 0.361   79.295  -6.767  1.00 74.50  ? 382  ALA A C     1 
ATOM   3519  O  O     . ALA E 3 376 ? 0.470   78.187  -6.234  1.00 74.50  ? 382  ALA A O     1 
ATOM   3520  C  CB    . ALA E 3 376 ? 0.514   78.754  -9.217  1.00 59.21  ? 382  ALA A CB    1 
ATOM   3521  N  N     . ILE E 3 377 ? 0.831   80.408  -6.205  1.00 63.22  ? 383  ILE A N     1 
ATOM   3522  C  CA    . ILE E 3 377 ? 1.451   80.339  -4.890  1.00 63.22  ? 383  ILE A CA    1 
ATOM   3523  C  C     . ILE E 3 377 ? 0.343   80.013  -3.917  1.00 63.22  ? 383  ILE A C     1 
ATOM   3524  O  O     . ILE E 3 377 ? 0.526   79.200  -3.020  1.00 63.22  ? 383  ILE A O     1 
ATOM   3525  C  CB    . ILE E 3 377 ? 2.112   81.664  -4.459  1.00 51.01  ? 383  ILE A CB    1 
ATOM   3526  C  CG1   . ILE E 3 377 ? 3.577   81.675  -4.885  1.00 51.01  ? 383  ILE A CG1   1 
ATOM   3527  C  CG2   . ILE E 3 377 ? 2.086   81.814  -2.960  1.00 51.01  ? 383  ILE A CG2   1 
ATOM   3528  C  CD1   . ILE E 3 377 ? 4.237   83.058  -4.844  1.00 51.01  ? 383  ILE A CD1   1 
ATOM   3529  N  N     . ASP E 3 378 ? -0.819  80.632  -4.096  1.00 57.70  ? 384  ASP A N     1 
ATOM   3530  C  CA    . ASP E 3 378 ? -1.935  80.364  -3.192  1.00 57.70  ? 384  ASP A CA    1 
ATOM   3531  C  C     . ASP E 3 378 ? -2.465  78.939  -3.377  1.00 57.70  ? 384  ASP A C     1 
ATOM   3532  O  O     . ASP E 3 378 ? -3.124  78.396  -2.498  1.00 57.70  ? 384  ASP A O     1 
ATOM   3533  C  CB    . ASP E 3 378 ? -3.057  81.393  -3.404  1.00 49.94  ? 384  ASP A CB    1 
ATOM   3534  N  N     . LEU E 3 379 ? -2.157  78.327  -4.511  1.00 41.07  ? 385  LEU A N     1 
ATOM   3535  C  CA    . LEU E 3 379 ? -2.627  76.983  -4.773  1.00 41.07  ? 385  LEU A CA    1 
ATOM   3536  C  C     . LEU E 3 379 ? -1.665  75.966  -4.170  1.00 41.07  ? 385  LEU A C     1 
ATOM   3537  O  O     . LEU E 3 379 ? -2.046  74.826  -3.897  1.00 41.07  ? 385  LEU A O     1 
ATOM   3538  C  CB    . LEU E 3 379 ? -2.785  76.757  -6.286  1.00 75.86  ? 385  LEU A CB    1 
ATOM   3539  N  N     . ILE E 3 380 ? -0.414  76.369  -3.966  1.00 55.91  ? 386  ILE A N     1 
ATOM   3540  C  CA    . ILE E 3 380 ? 0.572   75.472  -3.360  1.00 55.91  ? 386  ILE A CA    1 
ATOM   3541  C  C     . ILE E 3 380 ? 0.296   75.475  -1.878  1.00 55.91  ? 386  ILE A C     1 
ATOM   3542  O  O     . ILE E 3 380 ? 0.222   74.433  -1.242  1.00 55.91  ? 386  ILE A O     1 
ATOM   3543  C  CB    . ILE E 3 380 ? 2.001   75.954  -3.576  1.00 48.70  ? 386  ILE A CB    1 
ATOM   3544  C  CG1   . ILE E 3 380 ? 2.358   75.870  -5.061  1.00 48.70  ? 386  ILE A CG1   1 
ATOM   3545  C  CG2   . ILE E 3 380 ? 2.931   75.113  -2.773  1.00 48.70  ? 386  ILE A CG2   1 
ATOM   3546  C  CD1   . ILE E 3 380 ? 3.775   76.357  -5.399  1.00 48.70  ? 386  ILE A CD1   1 
ATOM   3547  N  N     . LYS E 3 381 ? 0.145   76.676  -1.343  1.00 55.89  ? 387  LYS A N     1 
ATOM   3548  C  CA    . LYS E 3 381 ? -0.168  76.857  0.051   1.00 55.89  ? 387  LYS A CA    1 
ATOM   3549  C  C     . LYS E 3 381 ? -1.275  75.866  0.384   1.00 55.89  ? 387  LYS A C     1 
ATOM   3550  O  O     . LYS E 3 381 ? -1.157  75.066  1.308   1.00 55.89  ? 387  LYS A O     1 
ATOM   3551  C  CB    . LYS E 3 381 ? -0.688  78.265  0.270   1.00 43.26  ? 387  LYS A CB    1 
ATOM   3552  C  CG    . LYS E 3 381 ? 0.250   79.354  -0.146  1.00 43.26  ? 387  LYS A CG    1 
ATOM   3553  C  CD    . LYS E 3 381 ? 0.963   79.909  1.056   1.00 43.26  ? 387  LYS A CD    1 
ATOM   3554  C  CE    . LYS E 3 381 ? -0.024  80.550  2.027   1.00 43.26  ? 387  LYS A CE    1 
ATOM   3555  N  NZ    . LYS E 3 381 ? -0.721  81.770  1.493   1.00 43.26  ? 387  LYS A NZ    1 
ATOM   3556  N  N     . GLU E 3 382 ? -2.356  75.918  -0.385  1.00 48.14  ? 388  GLU A N     1 
ATOM   3557  C  CA    . GLU E 3 382 ? -3.493  75.025  -0.176  1.00 48.14  ? 388  GLU A CA    1 
ATOM   3558  C  C     . GLU E 3 382 ? -3.170  73.569  -0.519  1.00 48.14  ? 388  GLU A C     1 
ATOM   3559  O  O     . GLU E 3 382 ? -3.723  72.653  0.082   1.00 48.14  ? 388  GLU A O     1 
ATOM   3560  C  CB    . GLU E 3 382 ? -4.695  75.496  -1.009  1.00 69.87  ? 388  GLU A CB    1 
ATOM   3561  N  N     . TYR E 3 383 ? -2.283  73.349  -1.483  1.00 50.15  ? 389  TYR A N     1 
ATOM   3562  C  CA    . TYR E 3 383 ? -1.940  71.994  -1.856  1.00 50.15  ? 389  TYR A CA    1 
ATOM   3563  C  C     . TYR E 3 383 ? -1.137  71.329  -0.755  1.00 50.15  ? 389  TYR A C     1 
ATOM   3564  O  O     . TYR E 3 383 ? -1.298  70.131  -0.489  1.00 50.15  ? 389  TYR A O     1 
ATOM   3565  C  CB    . TYR E 3 383 ? -1.151  71.984  -3.142  1.00 45.03  ? 389  TYR A CB    1 
ATOM   3566  C  CG    . TYR E 3 383 ? -0.759  70.604  -3.549  1.00 45.03  ? 389  TYR A CG    1 
ATOM   3567  C  CD1   . TYR E 3 383 ? 0.225   69.912  -2.865  1.00 45.03  ? 389  TYR A CD1   1 
ATOM   3568  C  CD2   . TYR E 3 383 ? -1.391  69.977  -4.607  1.00 45.03  ? 389  TYR A CD2   1 
ATOM   3569  C  CE1   . TYR E 3 383 ? 0.573   68.631  -3.224  1.00 45.03  ? 389  TYR A CE1   1 
ATOM   3570  C  CE2   . TYR E 3 383 ? -1.053  68.690  -4.976  1.00 45.03  ? 389  TYR A CE2   1 
ATOM   3571  C  CZ    . TYR E 3 383 ? -0.068  68.024  -4.282  1.00 45.03  ? 389  TYR A CZ    1 
ATOM   3572  O  OH    . TYR E 3 383 ? 0.286   66.758  -4.666  1.00 45.03  ? 389  TYR A OH    1 
ATOM   3573  N  N     . LEU E 3 384 ? -0.266  72.109  -0.120  1.00 52.67  ? 390  LEU A N     1 
ATOM   3574  C  CA    . LEU E 3 384 ? 0.548   71.587  0.964   1.00 52.67  ? 390  LEU A CA    1 
ATOM   3575  C  C     . LEU E 3 384 ? -0.354  71.165  2.109   1.00 52.67  ? 390  LEU A C     1 
ATOM   3576  O  O     . LEU E 3 384 ? -0.128  70.121  2.718   1.00 52.67  ? 390  LEU A O     1 
ATOM   3577  C  CB    . LEU E 3 384 ? 1.548   72.644  1.456   1.00 35.41  ? 390  LEU A CB    1 
ATOM   3578  C  CG    . LEU E 3 384 ? 2.771   73.029  0.609   1.00 35.41  ? 390  LEU A CG    1 
ATOM   3579  C  CD1   . LEU E 3 384 ? 3.462   74.217  1.295   1.00 35.41  ? 390  LEU A CD1   1 
ATOM   3580  C  CD2   . LEU E 3 384 ? 3.721   71.834  0.414   1.00 35.41  ? 390  LEU A CD2   1 
ATOM   3581  N  N     . MET E 3 385 ? -1.374  71.979  2.392   1.00 45.97  ? 391  MET A N     1 
ATOM   3582  C  CA    . MET E 3 385 ? -2.325  71.694  3.472   1.00 45.97  ? 391  MET A CA    1 
ATOM   3583  C  C     . MET E 3 385 ? -3.207  70.471  3.191   1.00 45.97  ? 391  MET A C     1 
ATOM   3584  O  O     . MET E 3 385 ? -3.405  69.612  4.052   1.00 45.97  ? 391  MET A O     1 
ATOM   3585  C  CB    . MET E 3 385 ? -3.222  72.897  3.722   1.00 67.67  ? 391  MET A CB    1 
ATOM   3586  C  CG    . MET E 3 385 ? -4.239  72.652  4.818   1.00 67.67  ? 391  MET A CG    1 
ATOM   3587  S  SD    . MET E 3 385 ? -5.918  72.886  4.276   1.00 67.67  ? 391  MET A SD    1 
ATOM   3588  C  CE    . MET E 3 385 ? -6.156  71.430  3.422   1.00 67.67  ? 391  MET A CE    1 
ATOM   3589  N  N     . ILE E 3 386 ? -3.753  70.411  1.989   1.00 47.32  ? 392  ILE A N     1 
ATOM   3590  C  CA    . ILE E 3 386 ? -4.571  69.289  1.604   1.00 47.32  ? 392  ILE A CA    1 
ATOM   3591  C  C     . ILE E 3 386 ? -3.805  68.021  1.953   1.00 47.32  ? 392  ILE A C     1 
ATOM   3592  O  O     . ILE E 3 386 ? -4.402  67.008  2.327   1.00 47.32  ? 392  ILE A O     1 
ATOM   3593  C  CB    . ILE E 3 386 ? -4.834  69.319  0.087   1.00 53.44  ? 392  ILE A CB    1 
ATOM   3594  C  CG1   . ILE E 3 386 ? -5.830  70.433  -0.241  1.00 53.44  ? 392  ILE A CG1   1 
ATOM   3595  C  CG2   . ILE E 3 386 ? -5.327  67.965  -0.393  1.00 53.44  ? 392  ILE A CG2   1 
ATOM   3596  C  CD1   . ILE E 3 386 ? -7.183  70.300  0.460   1.00 53.44  ? 392  ILE A CD1   1 
ATOM   3597  N  N     . GLN E 3 387 ? -2.478  68.096  1.829   1.00 40.20  ? 393  GLN A N     1 
ATOM   3598  C  CA    . GLN E 3 387 ? -1.580  66.979  2.106   1.00 40.20  ? 393  GLN A CA    1 
ATOM   3599  C  C     . GLN E 3 387 ? -1.405  66.698  3.584   1.00 40.20  ? 393  GLN A C     1 
ATOM   3600  O  O     . GLN E 3 387 ? -1.278  65.558  3.982   1.00 40.20  ? 393  GLN A O     1 
ATOM   3601  C  CB    . GLN E 3 387 ? -0.218  67.262  1.496   1.00 58.54  ? 393  GLN A CB    1 
ATOM   3602  C  CG    . GLN E 3 387 ? -0.119  67.008  0.008   1.00 58.54  ? 393  GLN A CG    1 
ATOM   3603  C  CD    . GLN E 3 387 ? -0.064  65.527  -0.323  1.00 58.54  ? 393  GLN A CD    1 
ATOM   3604  O  OE1   . GLN E 3 387 ? 0.513   65.132  -1.344  1.00 58.54  ? 393  GLN A OE1   1 
ATOM   3605  N  NE2   . GLN E 3 387 ? -0.670  64.695  0.534   1.00 58.54  ? 393  GLN A NE2   1 
ATOM   3606  N  N     . LYS E 3 388 ? -1.383  67.743  4.393   1.00 53.36  ? 394  LYS A N     1 
ATOM   3607  C  CA    . LYS E 3 388 ? -1.212  67.604  5.836   1.00 53.36  ? 394  LYS A CA    1 
ATOM   3608  C  C     . LYS E 3 388 ? -2.425  66.890  6.413   1.00 53.36  ? 394  LYS A C     1 
ATOM   3609  O  O     . LYS E 3 388 ? -2.400  66.388  7.552   1.00 53.36  ? 394  LYS A O     1 
ATOM   3610  C  CB    . LYS E 3 388 ? -1.102  68.987  6.478   1.00 38.96  ? 394  LYS A CB    1 
ATOM   3611  C  CG    . LYS E 3 388 ? -0.810  69.011  7.965   1.00 38.96  ? 394  LYS A CG    1 
ATOM   3612  C  CD    . LYS E 3 388 ? 0.585   68.509  8.241   1.00 38.96  ? 394  LYS A CD    1 
ATOM   3613  C  CE    . LYS E 3 388 ? 1.155   69.078  9.538   1.00 38.96  ? 394  LYS A CE    1 
ATOM   3614  N  NZ    . LYS E 3 388 ? 0.545   68.474  10.763  1.00 38.96  ? 394  LYS A NZ    1 
ATOM   3615  N  N     . ARG E 3 389 ? -3.497  66.868  5.622   1.00 57.26  ? 395  ARG A N     1 
ATOM   3616  C  CA    . ARG E 3 389 ? -4.744  66.234  6.025   1.00 57.26  ? 395  ARG A CA    1 
ATOM   3617  C  C     . ARG E 3 389 ? -4.856  64.839  5.462   1.00 57.26  ? 395  ARG A C     1 
ATOM   3618  O  O     . ARG E 3 389 ? -5.199  63.904  6.161   1.00 57.26  ? 395  ARG A O     1 
ATOM   3619  C  CB    . ARG E 3 389 ? -5.905  67.063  5.542   1.00 38.45  ? 395  ARG A CB    1 
ATOM   3620  C  CG    . ARG E 3 389 ? -5.920  68.423  6.137   1.00 38.45  ? 395  ARG A CG    1 
ATOM   3621  C  CD    . ARG E 3 389 ? -6.730  68.471  7.393   1.00 38.45  ? 395  ARG A CD    1 
ATOM   3622  N  NE    . ARG E 3 389 ? -6.717  69.823  7.916   1.00 38.45  ? 395  ARG A NE    1 
ATOM   3623  C  CZ    . ARG E 3 389 ? -5.620  70.414  8.358   1.00 38.45  ? 395  ARG A CZ    1 
ATOM   3624  N  NH1   . ARG E 3 389 ? -4.479  69.744  8.334   1.00 38.45  ? 395  ARG A NH1   1 
ATOM   3625  N  NH2   . ARG E 3 389 ? -5.646  71.665  8.797   1.00 38.45  ? 395  ARG A NH2   1 
ATOM   3626  N  N     . ILE E 3 390 ? -4.571  64.697  4.184   1.00 33.87  ? 396  ILE A N     1 
ATOM   3627  C  CA    . ILE E 3 390 ? -4.645  63.388  3.570   1.00 33.87  ? 396  ILE A CA    1 
ATOM   3628  C  C     . ILE E 3 390 ? -3.656  62.437  4.246   1.00 33.87  ? 396  ILE A C     1 
ATOM   3629  O  O     . ILE E 3 390 ? -3.838  61.215  4.224   1.00 33.87  ? 396  ILE A O     1 
ATOM   3630  C  CB    . ILE E 3 390 ? -4.328  63.468  2.056   1.00 17.07  ? 396  ILE A CB    1 
ATOM   3631  C  CG1   . ILE E 3 390 ? -5.231  64.509  1.388   1.00 17.07  ? 396  ILE A CG1   1 
ATOM   3632  C  CG2   . ILE E 3 390 ? -4.552  62.141  1.399   1.00 17.07  ? 396  ILE A CG2   1 
ATOM   3633  C  CD1   . ILE E 3 390 ? -4.825  64.874  -0.025  1.00 17.07  ? 396  ILE A CD1   1 
ATOM   3634  N  N     . GLY E 3 391 ? -2.610  62.996  4.849   1.00 32.44  ? 397  GLY A N     1 
ATOM   3635  C  CA    . GLY E 3 391 ? -1.615  62.172  5.500   1.00 32.44  ? 397  GLY A CA    1 
ATOM   3636  C  C     . GLY E 3 391 ? -2.016  61.788  6.903   1.00 32.44  ? 397  GLY A C     1 
ATOM   3637  O  O     . GLY E 3 391 ? -1.859  60.644  7.298   1.00 32.44  ? 397  GLY A O     1 
ATOM   3638  N  N     . GLN E 3 392 ? -2.517  62.758  7.654   1.00 30.77  ? 398  GLN A N     1 
ATOM   3639  C  CA    . GLN E 3 392 ? -2.962  62.546  9.026   1.00 30.77  ? 398  GLN A CA    1 
ATOM   3640  C  C     . GLN E 3 392 ? -4.192  61.636  9.136   1.00 30.77  ? 398  GLN A C     1 
ATOM   3641  O  O     . GLN E 3 392 ? -4.390  60.956  10.145  1.00 30.77  ? 398  GLN A O     1 
ATOM   3642  C  CB    . GLN E 3 392 ? -3.260  63.906  9.676   1.00 28.17  ? 398  GLN A CB    1 
ATOM   3643  C  CG    . GLN E 3 392 ? -4.044  63.868  10.994  1.00 28.17  ? 398  GLN A CG    1 
ATOM   3644  C  CD    . GLN E 3 392 ? -3.977  65.211  11.732  1.00 28.17  ? 398  GLN A CD    1 
ATOM   3645  O  OE1   . GLN E 3 392 ? -3.933  66.290  11.102  1.00 28.17  ? 398  GLN A OE1   1 
ATOM   3646  N  NE2   . GLN E 3 392 ? -3.968  65.157  13.067  1.00 28.17  ? 398  GLN A NE2   1 
ATOM   3647  N  N     . SER E 3 393 ? -4.998  61.608  8.082   1.00 45.30  ? 399  SER A N     1 
ATOM   3648  C  CA    . SER E 3 393 ? -6.225  60.821  8.069   1.00 45.30  ? 399  SER A CA    1 
ATOM   3649  C  C     . SER E 3 393 ? -6.189  59.524  7.276   1.00 45.30  ? 399  SER A C     1 
ATOM   3650  O  O     . SER E 3 393 ? -6.652  58.489  7.737   1.00 45.30  ? 399  SER A O     1 
ATOM   3651  C  CB    . SER E 3 393 ? -7.339  61.650  7.481   1.00 42.84  ? 399  SER A CB    1 
ATOM   3652  O  OG    . SER E 3 393 ? -7.125  61.723  6.083   1.00 42.84  ? 399  SER A OG    1 
ATOM   3653  N  N     . ALA E 3 394 ? -5.652  59.576  6.072   1.00 31.41  ? 400  ALA A N     1 
ATOM   3654  C  CA    . ALA E 3 394 ? -5.660  58.395  5.256   1.00 31.41  ? 400  ALA A CA    1 
ATOM   3655  C  C     . ALA E 3 394 ? -4.370  57.731  4.839   1.00 31.41  ? 400  ALA A C     1 
ATOM   3656  O  O     . ALA E 3 394 ? -4.205  56.532  5.062   1.00 31.41  ? 400  ALA A O     1 
ATOM   3657  C  CB    . ALA E 3 394 ? -6.494  58.666  4.033   1.00 92.32  ? 400  ALA A CB    1 
ATOM   3658  N  N     . GLU E 3 395 ? -3.455  58.472  4.222   1.00 43.60  ? 401  GLU A N     1 
ATOM   3659  C  CA    . GLU E 3 395 ? -2.220  57.843  3.741   1.00 43.60  ? 401  GLU A CA    1 
ATOM   3660  C  C     . GLU E 3 395 ? -1.031  57.682  4.698   1.00 43.60  ? 401  GLU A C     1 
ATOM   3661  O  O     . GLU E 3 395 ? -0.269  56.736  4.556   1.00 43.60  ? 401  GLU A O     1 
ATOM   3662  C  CB    . GLU E 3 395 ? -1.793  58.527  2.441   1.00 53.51  ? 401  GLU A CB    1 
ATOM   3663  C  CG    . GLU E 3 395 ? -2.899  58.484  1.397   1.00 53.51  ? 401  GLU A CG    1 
ATOM   3664  C  CD    . GLU E 3 395 ? -2.693  59.456  0.253   1.00 53.51  ? 401  GLU A CD    1 
ATOM   3665  O  OE1   . GLU E 3 395 ? -2.275  60.594  0.526   1.00 53.51  ? 401  GLU A OE1   1 
ATOM   3666  O  OE2   . GLU E 3 395 ? -2.966  59.106  -0.916  1.00 53.51  ? 401  GLU A OE2   1 
ATOM   3667  N  N     . GLY E 3 396 ? -0.877  58.566  5.676   1.00 45.68  ? 402  GLY A N     1 
ATOM   3668  C  CA    . GLY E 3 396 ? 0.233   58.424  6.600   1.00 45.68  ? 402  GLY A CA    1 
ATOM   3669  C  C     . GLY E 3 396 ? 0.363   57.042  7.242   1.00 45.68  ? 402  GLY A C     1 
ATOM   3670  O  O     . GLY E 3 396 ? -0.510  56.197  7.055   1.00 45.68  ? 402  GLY A O     1 
ATOM   3671  N  N     . ASP E 3 397 ? 1.446   56.811  7.999   1.00 50.60  ? 403  ASP A N     1 
ATOM   3672  C  CA    . ASP E 3 397 ? 1.686   55.529  8.672   1.00 50.60  ? 403  ASP A CA    1 
ATOM   3673  C  C     . ASP E 3 397 ? 0.835   55.421  9.896   1.00 50.60  ? 403  ASP A C     1 
ATOM   3674  O  O     . ASP E 3 397 ? 0.397   54.349  10.242  1.00 50.60  ? 403  ASP A O     1 
ATOM   3675  C  CB    . ASP E 3 397 ? 3.123   55.384  9.135   1.00 62.59  ? 403  ASP A CB    1 
ATOM   3676  C  CG    . ASP E 3 397 ? 4.107   55.615  8.039   1.00 62.59  ? 403  ASP A CG    1 
ATOM   3677  O  OD1   . ASP E 3 397 ? 4.034   56.713  7.437   1.00 62.59  ? 403  ASP A OD1   1 
ATOM   3678  O  OD2   . ASP E 3 397 ? 4.950   54.716  7.790   1.00 62.59  ? 403  ASP A OD2   1 
ATOM   3679  N  N     . LYS E 3 398 ? 0.639   56.526  10.588  1.00 45.25  ? 404  LYS A N     1 
ATOM   3680  C  CA    . LYS E 3 398 ? -0.190  56.505  11.776  1.00 45.25  ? 404  LYS A CA    1 
ATOM   3681  C  C     . LYS E 3 398 ? -1.518  57.168  11.429  1.00 45.25  ? 404  LYS A C     1 
ATOM   3682  O  O     . LYS E 3 398 ? -2.101  57.886  12.242  1.00 45.25  ? 404  LYS A O     1 
ATOM   3683  C  CB    . LYS E 3 398 ? 0.478   57.267  12.900  1.00 51.43  ? 404  LYS A CB    1 
ATOM   3684  C  CG    . LYS E 3 398 ? 1.974   57.127  12.944  1.00 51.43  ? 404  LYS A CG    1 
ATOM   3685  C  CD    . LYS E 3 398 ? 2.441   55.808  13.520  1.00 51.43  ? 404  LYS A CD    1 
ATOM   3686  C  CE    . LYS E 3 398 ? 3.949   55.868  13.773  1.00 51.43  ? 404  LYS A CE    1 
ATOM   3687  N  NZ    . LYS E 3 398 ? 4.356   57.023  14.673  1.00 51.43  ? 404  LYS A NZ    1 
ATOM   3688  N  N     . ALA E 3 399 ? -1.981  56.930  10.204  1.00 62.94  ? 405  ALA A N     1 
ATOM   3689  C  CA    . ALA E 3 399 ? -3.230  57.490  9.721   1.00 62.94  ? 405  ALA A CA    1 
ATOM   3690  C  C     . ALA E 3 399 ? -4.424  56.869  10.439  1.00 62.94  ? 405  ALA A C     1 
ATOM   3691  O  O     . ALA E 3 399 ? -4.418  55.668  10.730  1.00 62.94  ? 405  ALA A O     1 
ATOM   3692  C  CB    . ALA E 3 399 ? -3.341  57.242  8.247   1.00 58.33  ? 405  ALA A CB    1 
ATOM   3693  N  N     . TRP E 3 400 ? -5.447  57.685  10.713  1.00 48.91  ? 406  TRP A N     1 
ATOM   3694  C  CA    . TRP E 3 400 ? -6.659  57.211  11.389  1.00 48.91  ? 406  TRP A CA    1 
ATOM   3695  C  C     . TRP E 3 400 ? -7.205  55.964  10.724  1.00 48.91  ? 406  TRP A C     1 
ATOM   3696  O  O     . TRP E 3 400 ? -7.396  54.939  11.376  1.00 48.91  ? 406  TRP A O     1 
ATOM   3697  C  CB    . TRP E 3 400 ? -7.749  58.278  11.375  1.00 44.58  ? 406  TRP A CB    1 
ATOM   3698  C  CG    . TRP E 3 400 ? -7.315  59.575  11.923  1.00 44.58  ? 406  TRP A CG    1 
ATOM   3699  C  CD1   . TRP E 3 400 ? -6.490  59.773  12.976  1.00 44.58  ? 406  TRP A CD1   1 
ATOM   3700  C  CD2   . TRP E 3 400 ? -7.732  60.872  11.494  1.00 44.58  ? 406  TRP A CD2   1 
ATOM   3701  N  NE1   . TRP E 3 400 ? -6.361  61.112  13.243  1.00 44.58  ? 406  TRP A NE1   1 
ATOM   3702  C  CE2   . TRP E 3 400 ? -7.119  61.811  12.347  1.00 44.58  ? 406  TRP A CE2   1 
ATOM   3703  C  CE3   . TRP E 3 400 ? -8.563  61.335  10.471  1.00 44.58  ? 406  TRP A CE3   1 
ATOM   3704  C  CZ2   . TRP E 3 400 ? -7.314  63.187  12.212  1.00 44.58  ? 406  TRP A CZ2   1 
ATOM   3705  C  CZ3   . TRP E 3 400 ? -8.752  62.695  10.333  1.00 44.58  ? 406  TRP A CZ3   1 
ATOM   3706  C  CH2   . TRP E 3 400 ? -8.132  63.608  11.202  1.00 44.58  ? 406  TRP A CH2   1 
ATOM   3707  N  N     . LEU E 3 401 ? -7.444  56.062  9.418   1.00 44.92  ? 407  LEU A N     1 
ATOM   3708  C  CA    . LEU E 3 401 ? -7.985  54.956  8.643   1.00 44.92  ? 407  LEU A CA    1 
ATOM   3709  C  C     . LEU E 3 401 ? -7.202  53.659  8.755   1.00 44.92  ? 407  LEU A C     1 
ATOM   3710  O  O     . LEU E 3 401 ? -7.741  52.588  8.462   1.00 44.92  ? 407  LEU A O     1 
ATOM   3711  C  CB    . LEU E 3 401 ? -8.105  55.342  7.167   1.00 43.49  ? 407  LEU A CB    1 
ATOM   3712  C  CG    . LEU E 3 401 ? -9.133  56.421  6.825   1.00 43.49  ? 407  LEU A CG    1 
ATOM   3713  C  CD1   . LEU E 3 401 ? -9.317  56.534  5.329   1.00 43.49  ? 407  LEU A CD1   1 
ATOM   3714  C  CD2   . LEU E 3 401 ? -10.439 56.066  7.492   1.00 43.49  ? 407  LEU A CD2   1 
ATOM   3715  N  N     . ARG E 3 402 ? -5.938  53.740  9.169   1.00 47.71  ? 408  ARG A N     1 
ATOM   3716  C  CA    . ARG E 3 402 ? -5.122  52.538  9.298   1.00 47.71  ? 408  ARG A CA    1 
ATOM   3717  C  C     . ARG E 3 402 ? -5.210  52.037  10.709  1.00 47.71  ? 408  ARG A C     1 
ATOM   3718  O  O     . ARG E 3 402 ? -5.072  50.848  10.949  1.00 47.71  ? 408  ARG A O     1 
ATOM   3719  C  CB    . ARG E 3 402 ? -3.664  52.812  8.941   1.00 53.42  ? 408  ARG A CB    1 
ATOM   3720  C  CG    . ARG E 3 402 ? -3.404  53.119  7.470   1.00 53.42  ? 408  ARG A CG    1 
ATOM   3721  C  CD    . ARG E 3 402 ? -2.048  53.762  7.271   1.00 53.42  ? 408  ARG A CD    1 
ATOM   3722  N  NE    . ARG E 3 402 ? -1.770  54.176  5.891   1.00 53.42  ? 408  ARG A NE    1 
ATOM   3723  C  CZ    . ARG E 3 402 ? -1.584  53.330  4.879   1.00 53.42  ? 408  ARG A CZ    1 
ATOM   3724  N  NH1   . ARG E 3 402 ? -1.658  52.020  5.095   1.00 53.42  ? 408  ARG A NH1   1 
ATOM   3725  N  NH2   . ARG E 3 402 ? -1.295  53.780  3.660   1.00 53.42  ? 408  ARG A NH2   1 
ATOM   3726  N  N     . TYR E 3 403 ? -5.479  52.951  11.634  1.00 53.29  ? 409  TYR A N     1 
ATOM   3727  C  CA    . TYR E 3 403 ? -5.578  52.617  13.048  1.00 53.29  ? 409  TYR A CA    1 
ATOM   3728  C  C     . TYR E 3 403 ? -6.961  52.280  13.585  1.00 53.29  ? 409  TYR A C     1 
ATOM   3729  O  O     . TYR E 3 403 ? -7.075  51.971  14.764  1.00 53.29  ? 409  TYR A O     1 
ATOM   3730  C  CB    . TYR E 3 403 ? -4.968  53.749  13.906  1.00 64.59  ? 409  TYR A CB    1 
ATOM   3731  C  CG    . TYR E 3 403 ? -3.475  53.601  14.126  1.00 64.59  ? 409  TYR A CG    1 
ATOM   3732  C  CD1   . TYR E 3 403 ? -2.986  52.731  15.085  1.00 64.59  ? 409  TYR A CD1   1 
ATOM   3733  C  CD2   . TYR E 3 403 ? -2.563  54.183  13.259  1.00 64.59  ? 409  TYR A CD2   1 
ATOM   3734  C  CE1   . TYR E 3 403 ? -1.645  52.424  15.162  1.00 64.59  ? 409  TYR A CE1   1 
ATOM   3735  C  CE2   . TYR E 3 403 ? -1.218  53.875  13.329  1.00 64.59  ? 409  TYR A CE2   1 
ATOM   3736  C  CZ    . TYR E 3 403 ? -0.767  52.987  14.278  1.00 64.59  ? 409  TYR A CZ    1 
ATOM   3737  O  OH    . TYR E 3 403 ? 0.555   52.605  14.307  1.00 64.59  ? 409  TYR A OH    1 
ATOM   3738  N  N     . VAL E 3 404 ? -8.012  52.325  12.766  1.00 77.97  ? 410  VAL A N     1 
ATOM   3739  C  CA    . VAL E 3 404 ? -9.347  52.012  13.293  1.00 77.97  ? 410  VAL A CA    1 
ATOM   3740  C  C     . VAL E 3 404 ? -9.434  50.541  13.636  1.00 77.97  ? 410  VAL A C     1 
ATOM   3741  O  O     . VAL E 3 404 ? -9.025  49.696  12.843  1.00 77.97  ? 410  VAL A O     1 
ATOM   3742  C  CB    . VAL E 3 404 ? -10.475 52.317  12.298  1.00 73.26  ? 410  VAL A CB    1 
ATOM   3743  C  CG1   . VAL E 3 404 ? -11.677 52.818  13.055  1.00 73.26  ? 410  VAL A CG1   1 
ATOM   3744  C  CG2   . VAL E 3 404 ? -10.034 53.334  11.284  1.00 73.26  ? 410  VAL A CG2   1 
ATOM   3745  N  N     . ALA E 3 405 ? -9.970  50.238  14.815  1.00 50.28  ? 411  ALA A N     1 
ATOM   3746  C  CA    . ALA E 3 405 ? -10.102 48.853  15.264  1.00 50.28  ? 411  ALA A CA    1 
ATOM   3747  C  C     . ALA E 3 405 ? -11.332 48.149  14.672  1.00 50.28  ? 411  ALA A C     1 
ATOM   3748  O  O     . ALA E 3 405 ? -12.186 48.787  14.044  1.00 50.28  ? 411  ALA A O     1 
ATOM   3749  C  CB    . ALA E 3 405 ? -10.170 48.818  16.784  1.00 119.62 ? 411  ALA A CB    1 
ATOM   3750  N  N     . GLU E 3 406 ? -11.437 46.836  14.866  1.00 66.71  ? 412  GLU A N     1 
ATOM   3751  C  CA    . GLU E 3 406 ? -12.601 46.113  14.339  1.00 66.71  ? 412  GLU A CA    1 
ATOM   3752  C  C     . GLU E 3 406 ? -13.870 46.583  15.037  1.00 66.71  ? 412  GLU A C     1 
ATOM   3753  O  O     . GLU E 3 406 ? -14.947 46.572  14.449  1.00 66.71  ? 412  GLU A O     1 
ATOM   3754  C  CB    . GLU E 3 406 ? -12.466 44.602  14.529  1.00 51.27  ? 412  GLU A CB    1 
ATOM   3755  N  N     . ASP E 3 407 ? -13.731 46.992  16.293  1.00 58.90  ? 413  ASP A N     1 
ATOM   3756  C  CA    . ASP E 3 407 ? -14.850 47.481  17.078  1.00 58.90  ? 413  ASP A CA    1 
ATOM   3757  C  C     . ASP E 3 407 ? -15.232 48.922  16.707  1.00 58.90  ? 413  ASP A C     1 
ATOM   3758  O  O     . ASP E 3 407 ? -16.059 49.554  17.378  1.00 58.90  ? 413  ASP A O     1 
ATOM   3759  C  CB    . ASP E 3 407 ? -14.499 47.369  18.567  1.00 85.46  ? 413  ASP A CB    1 
ATOM   3760  C  CG    . ASP E 3 407 ? -13.040 47.700  18.854  1.00 85.46  ? 413  ASP A CG    1 
ATOM   3761  O  OD1   . ASP E 3 407 ? -12.664 48.881  18.722  1.00 85.46  ? 413  ASP A OD1   1 
ATOM   3762  O  OD2   . ASP E 3 407 ? -12.267 46.780  19.203  1.00 85.46  ? 413  ASP A OD2   1 
ATOM   3763  N  N     . GLY E 3 408 ? -14.631 49.435  15.635  1.00 43.87  ? 414  GLY A N     1 
ATOM   3764  C  CA    . GLY E 3 408 ? -14.932 50.781  15.187  1.00 43.87  ? 414  GLY A CA    1 
ATOM   3765  C  C     . GLY E 3 408 ? -14.554 51.878  16.158  1.00 43.87  ? 414  GLY A C     1 
ATOM   3766  O  O     . GLY E 3 408 ? -15.324 52.823  16.400  1.00 43.87  ? 414  GLY A O     1 
ATOM   3767  N  N     . LYS E 3 409 ? -13.364 51.743  16.736  1.00 70.31  ? 415  LYS A N     1 
ATOM   3768  C  CA    . LYS E 3 409 ? -12.832 52.732  17.671  1.00 70.31  ? 415  LYS A CA    1 
ATOM   3769  C  C     . LYS E 3 409 ? -11.336 52.825  17.403  1.00 70.31  ? 415  LYS A C     1 
ATOM   3770  O  O     . LYS E 3 409 ? -10.721 51.877  16.913  1.00 70.31  ? 415  LYS A O     1 
ATOM   3771  C  CB    . LYS E 3 409 ? -13.061 52.313  19.131  1.00 76.23  ? 415  LYS A CB    1 
ATOM   3772  C  CG    . LYS E 3 409 ? -14.501 52.001  19.492  1.00 76.23  ? 415  LYS A CG    1 
ATOM   3773  C  CD    . LYS E 3 409 ? -14.634 51.574  20.946  1.00 76.23  ? 415  LYS A CD    1 
ATOM   3774  C  CE    . LYS E 3 409 ? -15.799 50.596  21.162  1.00 76.23  ? 415  LYS A CE    1 
ATOM   3775  N  NZ    . LYS E 3 409 ? -17.126 51.116  20.725  1.00 76.23  ? 415  LYS A NZ    1 
ATOM   3776  N  N     . ILE E 3 410 ? -10.763 53.983  17.697  1.00 57.41  ? 416  ILE A N     1 
ATOM   3777  C  CA    . ILE E 3 410 ? -9.340  54.180  17.523  1.00 57.41  ? 416  ILE A CA    1 
ATOM   3778  C  C     . ILE E 3 410 ? -8.718  54.233  18.913  1.00 57.41  ? 416  ILE A C     1 
ATOM   3779  O  O     . ILE E 3 410 ? -9.027  55.126  19.716  1.00 57.41  ? 416  ILE A O     1 
ATOM   3780  C  CB    . ILE E 3 410 ? -9.039  55.478  16.761  1.00 50.85  ? 416  ILE A CB    1 
ATOM   3781  C  CG1   . ILE E 3 410 ? -9.098  55.216  15.257  1.00 50.85  ? 416  ILE A CG1   1 
ATOM   3782  C  CG2   . ILE E 3 410 ? -7.669  55.986  17.131  1.00 50.85  ? 416  ILE A CG2   1 
ATOM   3783  C  CD1   . ILE E 3 410 ? -8.747  56.418  14.378  1.00 50.85  ? 416  ILE A CD1   1 
ATOM   3784  N  N     . HIS E 3 411 ? -7.846  53.266  19.190  1.00 48.04  ? 417  HIS A N     1 
ATOM   3785  C  CA    . HIS E 3 411 ? -7.192  53.187  20.480  1.00 48.04  ? 417  HIS A CA    1 
ATOM   3786  C  C     . HIS E 3 411 ? -5.823  53.834  20.553  1.00 48.04  ? 417  HIS A C     1 
ATOM   3787  O  O     . HIS E 3 411 ? -4.857  53.168  20.898  1.00 48.04  ? 417  HIS A O     1 
ATOM   3788  C  CB    . HIS E 3 411 ? -7.067  51.740  20.870  1.00 50.42  ? 417  HIS A CB    1 
ATOM   3789  C  CG    . HIS E 3 411 ? -8.380  51.047  20.993  1.00 50.42  ? 417  HIS A CG    1 
ATOM   3790  N  ND1   . HIS E 3 411 ? -9.208  51.217  22.082  1.00 50.42  ? 417  HIS A ND1   1 
ATOM   3791  C  CD2   . HIS E 3 411 ? -9.008  50.176  20.167  1.00 50.42  ? 417  HIS A CD2   1 
ATOM   3792  C  CE1   . HIS E 3 411 ? -10.290 50.476  21.924  1.00 50.42  ? 417  HIS A CE1   1 
ATOM   3793  N  NE2   . HIS E 3 411 ? -10.192 49.835  20.770  1.00 50.42  ? 417  HIS A NE2   1 
ATOM   3794  N  N     . GLY E 3 412 ? -5.733  55.122  20.242  1.00 55.63  ? 418  GLY A N     1 
ATOM   3795  C  CA    . GLY E 3 412 ? -4.449  55.787  20.311  1.00 55.63  ? 418  GLY A CA    1 
ATOM   3796  C  C     . GLY E 3 412 ? -3.849  55.475  21.666  1.00 55.63  ? 418  GLY A C     1 
ATOM   3797  O  O     . GLY E 3 412 ? -4.590  55.278  22.631  1.00 55.63  ? 418  GLY A O     1 
ATOM   3798  N  N     . SER E 3 413 ? -2.522  55.402  21.756  1.00 45.86  ? 419  SER A N     1 
ATOM   3799  C  CA    . SER E 3 413 ? -1.886  55.104  23.032  1.00 45.86  ? 419  SER A CA    1 
ATOM   3800  C  C     . SER E 3 413 ? -1.630  56.407  23.773  1.00 45.86  ? 419  SER A C     1 
ATOM   3801  O  O     . SER E 3 413 ? -1.542  57.478  23.157  1.00 45.86  ? 419  SER A O     1 
ATOM   3802  C  CB    . SER E 3 413 ? -0.558  54.381  22.822  1.00 73.55  ? 419  SER A CB    1 
ATOM   3803  O  OG    . SER E 3 413 ? 0.506   55.312  22.729  1.00 73.55  ? 419  SER A OG    1 
ATOM   3804  N  N     . VAL E 3 414 ? -1.529  56.320  25.095  1.00 39.04  ? 420  VAL A N     1 
ATOM   3805  C  CA    . VAL E 3 414 ? -1.266  57.494  25.904  1.00 39.04  ? 420  VAL A CA    1 
ATOM   3806  C  C     . VAL E 3 414 ? -0.201  57.167  26.927  1.00 39.04  ? 420  VAL A C     1 
ATOM   3807  O  O     . VAL E 3 414 ? -0.231  56.112  27.567  1.00 39.04  ? 420  VAL A O     1 
ATOM   3808  C  CB    . VAL E 3 414 ? -2.500  57.969  26.688  1.00 40.37  ? 420  VAL A CB    1 
ATOM   3809  C  CG1   . VAL E 3 414 ? -2.231  59.330  27.274  1.00 40.37  ? 420  VAL A CG1   1 
ATOM   3810  C  CG2   . VAL E 3 414 ? -3.717  58.008  25.802  1.00 40.37  ? 420  VAL A CG2   1 
ATOM   3811  N  N     . ASN E 3 415 ? 0.746   58.077  27.066  1.00 69.58  ? 421  ASN A N     1 
ATOM   3812  C  CA    . ASN E 3 415 ? 1.811   57.928  28.029  1.00 69.58  ? 421  ASN A CA    1 
ATOM   3813  C  C     . ASN E 3 415 ? 1.455   58.938  29.099  1.00 69.58  ? 421  ASN A C     1 
ATOM   3814  O  O     . ASN E 3 415 ? 1.586   60.134  28.885  1.00 69.58  ? 421  ASN A O     1 
ATOM   3815  C  CB    . ASN E 3 415 ? 3.125   58.311  27.395  1.00 41.65  ? 421  ASN A CB    1 
ATOM   3816  C  CG    . ASN E 3 415 ? 4.224   58.352  28.378  1.00 41.65  ? 421  ASN A CG    1 
ATOM   3817  O  OD1   . ASN E 3 415 ? 3.977   58.471  29.567  1.00 41.65  ? 421  ASN A OD1   1 
ATOM   3818  N  ND2   . ASN E 3 415 ? 5.461   58.267  27.898  1.00 41.65  ? 421  ASN A ND2   1 
ATOM   3819  N  N     . PRO E 3 416 ? 0.999   58.478  30.266  1.00 55.12  ? 422  PRO A N     1 
ATOM   3820  C  CA    . PRO E 3 416 ? 0.640   59.428  31.306  1.00 55.12  ? 422  PRO A CA    1 
ATOM   3821  C  C     . PRO E 3 416 ? 1.777   60.317  31.826  1.00 55.12  ? 422  PRO A C     1 
ATOM   3822  O  O     . PRO E 3 416 ? 1.551   61.113  32.733  1.00 55.12  ? 422  PRO A O     1 
ATOM   3823  C  CB    . PRO E 3 416 ? 0.040   58.537  32.372  1.00 51.03  ? 422  PRO A CB    1 
ATOM   3824  C  CG    . PRO E 3 416 ? 0.869   57.325  32.249  1.00 51.03  ? 422  PRO A CG    1 
ATOM   3825  C  CD    . PRO E 3 416 ? 0.878   57.107  30.769  1.00 51.03  ? 422  PRO A CD    1 
ATOM   3826  N  N     . ASN E 3 417 ? 2.987   60.179  31.275  1.00 41.58  ? 423  ASN A N     1 
ATOM   3827  C  CA    . ASN E 3 417 ? 4.125   61.025  31.660  1.00 41.58  ? 423  ASN A CA    1 
ATOM   3828  C  C     . ASN E 3 417 ? 4.929   61.376  30.413  1.00 41.58  ? 423  ASN A C     1 
ATOM   3829  O  O     . ASN E 3 417 ? 4.509   62.169  29.570  1.00 41.58  ? 423  ASN A O     1 
ATOM   3830  C  CB    . ASN E 3 417 ? 5.053   60.316  32.627  1.00 38.51  ? 423  ASN A CB    1 
ATOM   3831  C  CG    . ASN E 3 417 ? 4.938   60.831  34.055  1.00 38.51  ? 423  ASN A CG    1 
ATOM   3832  O  OD1   . ASN E 3 417 ? 5.059   62.040  34.332  1.00 38.51  ? 423  ASN A OD1   1 
ATOM   3833  N  ND2   . ASN E 3 417 ? 4.733   59.894  34.990  1.00 38.51  ? 423  ASN A ND2   1 
ATOM   3834  N  N     . GLY E 3 418 ? 6.113   60.799  30.301  1.00 58.01  ? 424  GLY A N     1 
ATOM   3835  C  CA    . GLY E 3 418 ? 6.925   61.057  29.124  1.00 58.01  ? 424  GLY A CA    1 
ATOM   3836  C  C     . GLY E 3 418 ? 7.093   62.499  28.667  1.00 58.01  ? 424  GLY A C     1 
ATOM   3837  O  O     . GLY E 3 418 ? 7.706   62.738  27.627  1.00 58.01  ? 424  GLY A O     1 
ATOM   3838  N  N     . ALA E 3 419 ? 6.557   63.461  29.409  1.00 73.95  ? 425  ALA A N     1 
ATOM   3839  C  CA    . ALA E 3 419 ? 6.742   64.853  29.027  1.00 73.95  ? 425  ALA A CA    1 
ATOM   3840  C  C     . ALA E 3 419 ? 7.970   65.386  29.788  1.00 73.95  ? 425  ALA A C     1 
ATOM   3841  O  O     . ALA E 3 419 ? 9.030   65.593  29.184  1.00 73.95  ? 425  ALA A O     1 
ATOM   3842  C  CB    . ALA E 3 419 ? 5.490   65.677  29.339  1.00 32.47  ? 425  ALA A CB    1 
ATOM   3843  N  N     . VAL E 3 420 ? 7.820   65.569  31.103  1.00 87.62  ? 426  VAL A N     1 
ATOM   3844  C  CA    . VAL E 3 420 ? 8.877   66.058  32.000  1.00 87.62  ? 426  VAL A CA    1 
ATOM   3845  C  C     . VAL E 3 420 ? 8.238   67.007  32.993  1.00 87.62  ? 426  VAL A C     1 
ATOM   3846  O  O     . VAL E 3 420 ? 8.766   67.266  34.075  1.00 87.62  ? 426  VAL A O     1 
ATOM   3847  C  CB    . VAL E 3 420 ? 9.987   66.855  31.257  1.00 72.76  ? 426  VAL A CB    1 
ATOM   3848  C  CG1   . VAL E 3 420 ? 9.464   68.214  30.800  1.00 72.76  ? 426  VAL A CG1   1 
ATOM   3849  C  CG2   . VAL E 3 420 ? 11.181  67.034  32.168  1.00 72.76  ? 426  VAL A CG2   1 
ATOM   3850  N  N     . THR E 3 421 ? 7.094   67.541  32.598  1.00 53.33  ? 427  THR A N     1 
ATOM   3851  C  CA    . THR E 3 421 ? 6.381   68.472  33.443  1.00 53.33  ? 427  THR A CA    1 
ATOM   3852  C  C     . THR E 3 421 ? 5.181   67.793  34.052  1.00 53.33  ? 427  THR A C     1 
ATOM   3853  O  O     . THR E 3 421 ? 4.602   68.289  35.016  1.00 53.33  ? 427  THR A O     1 
ATOM   3854  C  CB    . THR E 3 421 ? 5.898   69.741  32.673  1.00 62.15  ? 427  THR A CB    1 
ATOM   3855  O  OG1   . THR E 3 421 ? 5.423   69.387  31.374  1.00 62.15  ? 427  THR A OG1   1 
ATOM   3856  C  CG2   . THR E 3 421 ? 7.013   70.727  32.527  1.00 62.15  ? 427  THR A CG2   1 
ATOM   3857  N  N     . GLY E 3 422 ? 4.818   66.642  33.499  1.00 49.62  ? 428  GLY A N     1 
ATOM   3858  C  CA    . GLY E 3 422 ? 3.661   65.916  34.004  1.00 49.62  ? 428  GLY A CA    1 
ATOM   3859  C  C     . GLY E 3 422 ? 2.671   65.642  32.882  1.00 49.62  ? 428  GLY A C     1 
ATOM   3860  O  O     . GLY E 3 422 ? 1.843   64.728  32.959  1.00 49.62  ? 428  GLY A O     1 
ATOM   3861  N  N     . ARG E 3 423 ? 2.762   66.466  31.841  1.00 38.17  ? 429  ARG A N     1 
ATOM   3862  C  CA    . ARG E 3 423 ? 1.928   66.342  30.651  1.00 38.17  ? 429  ARG A CA    1 
ATOM   3863  C  C     . ARG E 3 423 ? 2.102   64.940  30.106  1.00 38.17  ? 429  ARG A C     1 
ATOM   3864  O  O     . ARG E 3 423 ? 3.168   64.363  30.224  1.00 38.17  ? 429  ARG A O     1 
ATOM   3865  C  CB    . ARG E 3 423 ? 2.390   67.329  29.564  1.00 68.73  ? 429  ARG A CB    1 
ATOM   3866  C  CG    . ARG E 3 423 ? 2.067   68.813  29.764  1.00 68.73  ? 429  ARG A CG    1 
ATOM   3867  C  CD    . ARG E 3 423 ? 0.603   69.098  29.449  1.00 68.73  ? 429  ARG A CD    1 
ATOM   3868  N  NE    . ARG E 3 423 ? 0.360   70.406  28.836  1.00 68.73  ? 429  ARG A NE    1 
ATOM   3869  C  CZ    . ARG E 3 423 ? 0.640   70.715  27.569  1.00 68.73  ? 429  ARG A CZ    1 
ATOM   3870  N  NH1   . ARG E 3 423 ? 1.183   69.823  26.752  1.00 68.73  ? 429  ARG A NH1   1 
ATOM   3871  N  NH2   . ARG E 3 423 ? 0.360   71.924  27.105  1.00 68.73  ? 429  ARG A NH2   1 
ATOM   3872  N  N     . ALA E 3 424 ? 1.066   64.394  29.506  1.00 34.81  ? 430  ALA A N     1 
ATOM   3873  C  CA    . ALA E 3 424 ? 1.192   63.075  28.929  1.00 34.81  ? 430  ALA A CA    1 
ATOM   3874  C  C     . ALA E 3 424 ? 1.647   63.287  27.487  1.00 34.81  ? 430  ALA A C     1 
ATOM   3875  O  O     . ALA E 3 424 ? 1.773   64.437  27.036  1.00 34.81  ? 430  ALA A O     1 
ATOM   3876  C  CB    . ALA E 3 424 ? -0.138  62.359  28.969  1.00 55.93  ? 430  ALA A CB    1 
ATOM   3877  N  N     . THR E 3 425 ? 1.941   62.195  26.778  1.00 54.33  ? 431  THR A N     1 
ATOM   3878  C  CA    . THR E 3 425 ? 2.344   62.266  25.376  1.00 54.33  ? 431  THR A CA    1 
ATOM   3879  C  C     . THR E 3 425 ? 1.441   61.292  24.659  1.00 54.33  ? 431  THR A C     1 
ATOM   3880  O  O     . THR E 3 425 ? 1.345   60.128  25.039  1.00 54.33  ? 431  THR A O     1 
ATOM   3881  C  CB    . THR E 3 425 ? 3.828   61.872  25.149  1.00 51.02  ? 431  THR A CB    1 
ATOM   3882  O  OG1   . THR E 3 425 ? 4.104   60.585  25.705  1.00 51.02  ? 431  THR A OG1   1 
ATOM   3883  C  CG2   . THR E 3 425 ? 4.723   62.889  25.767  1.00 51.02  ? 431  THR A CG2   1 
ATOM   3884  N  N     . HIS E 3 426 ? 0.763   61.764  23.627  1.00 34.57  ? 432  HIS A N     1 
ATOM   3885  C  CA    . HIS E 3 426 ? -0.153  60.897  22.916  1.00 34.57  ? 432  HIS A CA    1 
ATOM   3886  C  C     . HIS E 3 426 ? 0.520   60.335  21.657  1.00 34.57  ? 432  HIS A C     1 
ATOM   3887  O  O     . HIS E 3 426 ? 1.454   60.939  21.143  1.00 34.57  ? 432  HIS A O     1 
ATOM   3888  C  CB    . HIS E 3 426 ? -1.417  61.709  22.604  1.00 44.13  ? 432  HIS A CB    1 
ATOM   3889  C  CG    . HIS E 3 426 ? -1.996  62.403  23.808  1.00 44.13  ? 432  HIS A CG    1 
ATOM   3890  N  ND1   . HIS E 3 426 ? -1.359  63.448  24.447  1.00 44.13  ? 432  HIS A ND1   1 
ATOM   3891  C  CD2   . HIS E 3 426 ? -3.115  62.156  24.534  1.00 44.13  ? 432  HIS A CD2   1 
ATOM   3892  C  CE1   . HIS E 3 426 ? -2.056  63.812  25.511  1.00 44.13  ? 432  HIS A CE1   1 
ATOM   3893  N  NE2   . HIS E 3 426 ? -3.126  63.044  25.587  1.00 44.13  ? 432  HIS A NE2   1 
ATOM   3894  N  N     . ALA E 3 427 ? 0.095   59.165  21.180  1.00 29.34  ? 433  ALA A N     1 
ATOM   3895  C  CA    . ALA E 3 427 ? 0.690   58.600  19.969  1.00 29.34  ? 433  ALA A CA    1 
ATOM   3896  C  C     . ALA E 3 427 ? 0.035   57.322  19.481  1.00 29.34  ? 433  ALA A C     1 
ATOM   3897  O  O     . ALA E 3 427 ? -0.678  56.657  20.226  1.00 29.34  ? 433  ALA A O     1 
ATOM   3898  C  CB    . ALA E 3 427 ? 2.142   58.362  20.167  1.00 46.65  ? 433  ALA A CB    1 
ATOM   3899  N  N     . PHE E 3 428 ? 0.269   57.013  18.208  1.00 47.11  ? 434  PHE A N     1 
ATOM   3900  C  CA    . PHE E 3 428 ? -0.241  55.823  17.548  1.00 47.11  ? 434  PHE A CA    1 
ATOM   3901  C  C     . PHE E 3 428 ? -1.754  55.620  17.568  1.00 47.11  ? 434  PHE A C     1 
ATOM   3902  O  O     . PHE E 3 428 ? -2.258  54.648  18.157  1.00 47.11  ? 434  PHE A O     1 
ATOM   3903  C  CB    . PHE E 3 428 ? 0.418   54.583  18.144  1.00 41.16  ? 434  PHE A CB    1 
ATOM   3904  C  CG    . PHE E 3 428 ? 1.916   54.656  18.228  1.00 41.16  ? 434  PHE A CG    1 
ATOM   3905  C  CD1   . PHE E 3 428 ? 2.689   54.811  17.080  1.00 41.16  ? 434  PHE A CD1   1 
ATOM   3906  C  CD2   . PHE E 3 428 ? 2.556   54.501  19.451  1.00 41.16  ? 434  PHE A CD2   1 
ATOM   3907  C  CE1   . PHE E 3 428 ? 4.090   54.805  17.149  1.00 41.16  ? 434  PHE A CE1   1 
ATOM   3908  C  CE2   . PHE E 3 428 ? 3.935   54.492  19.533  1.00 41.16  ? 434  PHE A CE2   1 
ATOM   3909  C  CZ    . PHE E 3 428 ? 4.715   54.644  18.374  1.00 41.16  ? 434  PHE A CZ    1 
ATOM   3910  N  N     . PRO E 3 429 ? -2.506  56.522  16.930  1.00 33.44  ? 435  PRO A N     1 
ATOM   3911  C  CA    . PRO E 3 429 ? -2.004  57.690  16.223  1.00 33.44  ? 435  PRO A CA    1 
ATOM   3912  C  C     . PRO E 3 429 ? -2.051  58.719  17.296  1.00 33.44  ? 435  PRO A C     1 
ATOM   3913  O  O     . PRO E 3 429 ? -2.565  58.434  18.374  1.00 33.44  ? 435  PRO A O     1 
ATOM   3914  C  CB    . PRO E 3 429 ? -3.058  57.912  15.145  1.00 39.46  ? 435  PRO A CB    1 
ATOM   3915  C  CG    . PRO E 3 429 ? -4.322  57.529  15.828  1.00 39.46  ? 435  PRO A CG    1 
ATOM   3916  C  CD    . PRO E 3 429 ? -3.921  56.276  16.584  1.00 39.46  ? 435  PRO A CD    1 
ATOM   3917  N  N     . ASN E 3 430 ? -1.531  59.909  17.051  1.00 49.69  ? 436  ASN A N     1 
ATOM   3918  C  CA    . ASN E 3 430 ? -1.576  60.905  18.103  1.00 49.69  ? 436  ASN A CA    1 
ATOM   3919  C  C     . ASN E 3 430 ? -2.918  61.607  18.095  1.00 49.69  ? 436  ASN A C     1 
ATOM   3920  O  O     . ASN E 3 430 ? -3.218  62.366  17.177  1.00 49.69  ? 436  ASN A O     1 
ATOM   3921  C  CB    . ASN E 3 430 ? -0.472  61.933  17.925  1.00 29.80  ? 436  ASN A CB    1 
ATOM   3922  C  CG    . ASN E 3 430 ? -0.668  63.100  18.827  1.00 29.80  ? 436  ASN A CG    1 
ATOM   3923  O  OD1   . ASN E 3 430 ? -1.400  62.979  19.801  1.00 29.80  ? 436  ASN A OD1   1 
ATOM   3924  N  ND2   . ASN E 3 430 ? -0.030  64.234  18.531  1.00 29.80  ? 436  ASN A ND2   1 
ATOM   3925  N  N     . LEU E 3 431 ? -3.744  61.360  19.100  1.00 41.48  ? 437  LEU A N     1 
ATOM   3926  C  CA    . LEU E 3 431 ? -5.049  62.025  19.134  1.00 41.48  ? 437  LEU A CA    1 
ATOM   3927  C  C     . LEU E 3 431 ? -5.032  63.326  19.932  1.00 41.48  ? 437  LEU A C     1 
ATOM   3928  O  O     . LEU E 3 431 ? -5.999  63.663  20.590  1.00 41.48  ? 437  LEU A O     1 
ATOM   3929  C  CB    . LEU E 3 431 ? -6.140  61.099  19.698  1.00 18.91  ? 437  LEU A CB    1 
ATOM   3930  C  CG    . LEU E 3 431 ? -6.407  59.776  18.975  1.00 18.91  ? 437  LEU A CG    1 
ATOM   3931  C  CD1   . LEU E 3 431 ? -7.408  58.913  19.757  1.00 18.91  ? 437  LEU A CD1   1 
ATOM   3932  C  CD2   . LEU E 3 431 ? -6.894  60.065  17.605  1.00 18.91  ? 437  LEU A CD2   1 
ATOM   3933  N  N     . ALA E 3 432 ? -3.928  64.051  19.900  1.00 47.73  ? 438  ALA A N     1 
ATOM   3934  C  CA    . ALA E 3 432 ? -3.893  65.317  20.611  1.00 47.73  ? 438  ALA A CA    1 
ATOM   3935  C  C     . ALA E 3 432 ? -3.347  66.346  19.625  1.00 47.73  ? 438  ALA A C     1 
ATOM   3936  O  O     . ALA E 3 432 ? -2.788  67.385  20.000  1.00 47.73  ? 438  ALA A O     1 
ATOM   3937  C  CB    . ALA E 3 432 ? -3.044  65.224  21.898  1.00 19.72  ? 438  ALA A CB    1 
ATOM   3938  N  N     . GLN E 3 433 ? -3.527  66.023  18.347  1.00 45.17  ? 439  GLN A N     1 
ATOM   3939  C  CA    . GLN E 3 433 ? -3.127  66.896  17.254  1.00 45.17  ? 439  GLN A CA    1 
ATOM   3940  C  C     . GLN E 3 433 ? -4.117  66.728  16.097  1.00 45.17  ? 439  GLN A C     1 
ATOM   3941  O  O     . GLN E 3 433 ? -3.760  66.739  14.917  1.00 45.17  ? 439  GLN A O     1 
ATOM   3942  C  CB    . GLN E 3 433 ? -1.694  66.603  16.795  1.00 36.56  ? 439  GLN A CB    1 
ATOM   3943  C  CG    . GLN E 3 433 ? -1.475  65.186  16.325  1.00 36.56  ? 439  GLN A CG    1 
ATOM   3944  C  CD    . GLN E 3 433 ? -0.103  64.973  15.759  1.00 36.56  ? 439  GLN A CD    1 
ATOM   3945  O  OE1   . GLN E 3 433 ? 0.221   63.879  15.279  1.00 36.56  ? 439  GLN A OE1   1 
ATOM   3946  N  NE2   . GLN E 3 433 ? 0.720   66.017  15.802  1.00 36.56  ? 439  GLN A NE2   1 
ATOM   3947  N  N     . ILE E 3 434 ? -5.377  66.542  16.452  1.00 48.45  ? 440  ILE A N     1 
ATOM   3948  C  CA    . ILE E 3 434 ? -6.407  66.437  15.442  1.00 48.45  ? 440  ILE A CA    1 
ATOM   3949  C  C     . ILE E 3 434 ? -6.604  67.906  15.079  1.00 48.45  ? 440  ILE A C     1 
ATOM   3950  O  O     . ILE E 3 434 ? -6.685  68.750  15.970  1.00 48.45  ? 440  ILE A O     1 
ATOM   3951  C  CB    . ILE E 3 434 ? -7.752  65.925  16.030  1.00 34.20  ? 440  ILE A CB    1 
ATOM   3952  C  CG1   . ILE E 3 434 ? -7.590  64.565  16.726  1.00 34.20  ? 440  ILE A CG1   1 
ATOM   3953  C  CG2   . ILE E 3 434 ? -8.772  65.828  14.915  1.00 34.20  ? 440  ILE A CG2   1 
ATOM   3954  C  CD1   . ILE E 3 434 ? -7.553  63.394  15.782  1.00 34.20  ? 440  ILE A CD1   1 
ATOM   3955  N  N     . PRO E 3 435 ? -6.639  68.254  13.785  1.00 39.79  ? 441  PRO A N     1 
ATOM   3956  C  CA    . PRO E 3 435 ? -6.850  69.693  13.565  1.00 39.79  ? 441  PRO A CA    1 
ATOM   3957  C  C     . PRO E 3 435 ? -8.101  70.158  14.315  1.00 39.79  ? 441  PRO A C     1 
ATOM   3958  O  O     . PRO E 3 435 ? -9.044  69.401  14.484  1.00 39.79  ? 441  PRO A O     1 
ATOM   3959  C  CB    . PRO E 3 435 ? -6.988  69.812  12.043  1.00 46.06  ? 441  PRO A CB    1 
ATOM   3960  C  CG    . PRO E 3 435 ? -7.254  68.384  11.565  1.00 46.06  ? 441  PRO A CG    1 
ATOM   3961  C  CD    . PRO E 3 435 ? -6.436  67.538  12.517  1.00 46.06  ? 441  PRO A CD    1 
ATOM   3962  N  N     . GLY E 3 436 ? -8.094  71.387  14.803  1.00 61.74  ? 442  GLY A N     1 
ATOM   3963  C  CA    . GLY E 3 436 ? -9.247  71.892  15.524  1.00 61.74  ? 442  GLY A CA    1 
ATOM   3964  C  C     . GLY E 3 436 ? -10.293 72.340  14.530  1.00 61.74  ? 442  GLY A C     1 
ATOM   3965  O  O     . GLY E 3 436 ? -10.066 72.283  13.324  1.00 61.74  ? 442  GLY A O     1 
ATOM   3966  N  N     . VAL E 3 437 ? -11.439 72.791  15.022  1.00 73.06  ? 443  VAL A N     1 
ATOM   3967  C  CA    . VAL E 3 437 ? -12.513 73.236  14.143  1.00 73.06  ? 443  VAL A CA    1 
ATOM   3968  C  C     . VAL E 3 437 ? -12.176 74.528  13.421  1.00 73.06  ? 443  VAL A C     1 
ATOM   3969  O  O     . VAL E 3 437 ? -12.737 74.833  12.361  1.00 73.06  ? 443  VAL A O     1 
ATOM   3970  C  CB    . VAL E 3 437 ? -13.768 73.443  14.939  1.00 50.06  ? 443  VAL A CB    1 
ATOM   3971  C  CG1   . VAL E 3 437 ? -14.355 72.109  15.303  1.00 50.06  ? 443  VAL A CG1   1 
ATOM   3972  C  CG2   . VAL E 3 437 ? -13.435 74.203  16.187  1.00 50.06  ? 443  VAL A CG2   1 
ATOM   3973  N  N     . ARG E 3 438 ? -11.259 75.291  14.004  1.00 87.95  ? 444  ARG A N     1 
ATOM   3974  C  CA    . ARG E 3 438 ? -10.832 76.548  13.413  1.00 87.95  ? 444  ARG A CA    1 
ATOM   3975  C  C     . ARG E 3 438 ? -9.687  76.270  12.441  1.00 87.95  ? 444  ARG A C     1 
ATOM   3976  O  O     . ARG E 3 438 ? -8.710  77.013  12.397  1.00 87.95  ? 444  ARG A O     1 
ATOM   3977  C  CB    . ARG E 3 438 ? -10.365 77.503  14.515  1.00 85.80  ? 444  ARG A CB    1 
ATOM   3978  N  N     . SER E 3 439 ? -9.816  75.195  11.668  1.00 46.66  ? 445  SER A N     1 
ATOM   3979  C  CA    . SER E 3 439 ? -8.793  74.793  10.706  1.00 46.66  ? 445  SER A CA    1 
ATOM   3980  C  C     . SER E 3 439 ? -9.382  74.072  9.506   1.00 46.66  ? 445  SER A C     1 
ATOM   3981  O  O     . SER E 3 439 ? -10.205 73.179  9.660   1.00 46.66  ? 445  SER A O     1 
ATOM   3982  C  CB    . SER E 3 439 ? -7.766  73.857  11.364  1.00 73.73  ? 445  SER A CB    1 
ATOM   3983  O  OG    . SER E 3 439 ? -6.620  74.555  11.825  1.00 73.73  ? 445  SER A OG    1 
ATOM   3984  N  N     . PRO E 3 440 ? -8.947  74.430  8.290   1.00 39.60  ? 446  PRO A N     1 
ATOM   3985  C  CA    . PRO E 3 440 ? -9.466  73.775  7.089   1.00 39.60  ? 446  PRO A CA    1 
ATOM   3986  C  C     . PRO E 3 440 ? -9.738  72.295  7.343   1.00 39.60  ? 446  PRO A C     1 
ATOM   3987  O  O     . PRO E 3 440 ? -8.833  71.541  7.651   1.00 39.60  ? 446  PRO A O     1 
ATOM   3988  C  CB    . PRO E 3 440 ? -8.345  73.980  6.082   1.00 62.70  ? 446  PRO A CB    1 
ATOM   3989  C  CG    . PRO E 3 440 ? -7.793  75.311  6.460   1.00 62.70  ? 446  PRO A CG    1 
ATOM   3990  C  CD    . PRO E 3 440 ? -7.777  75.270  7.972   1.00 62.70  ? 446  PRO A CD    1 
ATOM   3991  N  N     . TYR E 3 441 ? -10.992 71.890  7.209   1.00 55.34  ? 447  TYR A N     1 
ATOM   3992  C  CA    . TYR E 3 441 ? -11.408 70.501  7.416   1.00 55.34  ? 447  TYR A CA    1 
ATOM   3993  C  C     . TYR E 3 441 ? -11.346 70.065  8.862   1.00 55.34  ? 447  TYR A C     1 
ATOM   3994  O  O     . TYR E 3 441 ? -11.567 68.899  9.164   1.00 55.34  ? 447  TYR A O     1 
ATOM   3995  C  CB    . TYR E 3 441 ? -10.561 69.562  6.580   1.00 43.39  ? 447  TYR A CB    1 
ATOM   3996  C  CG    . TYR E 3 441 ? -10.529 69.964  5.154   1.00 43.39  ? 447  TYR A CG    1 
ATOM   3997  C  CD1   . TYR E 3 441 ? -11.135 69.182  4.185   1.00 43.39  ? 447  TYR A CD1   1 
ATOM   3998  C  CD2   . TYR E 3 441 ? -9.915  71.143  4.765   1.00 43.39  ? 447  TYR A CD2   1 
ATOM   3999  C  CE1   . TYR E 3 441 ? -11.133 69.569  2.842   1.00 43.39  ? 447  TYR A CE1   1 
ATOM   4000  C  CE2   . TYR E 3 441 ? -9.905  71.544  3.438   1.00 43.39  ? 447  TYR A CE2   1 
ATOM   4001  C  CZ    . TYR E 3 441 ? -10.516 70.752  2.479   1.00 43.39  ? 447  TYR A CZ    1 
ATOM   4002  O  OH    . TYR E 3 441 ? -10.514 71.142  1.171   1.00 43.39  ? 447  TYR A OH    1 
ATOM   4003  N  N     . GLY E 3 442 ? -11.044 71.002  9.752   1.00 54.92  ? 448  GLY A N     1 
ATOM   4004  C  CA    . GLY E 3 442 ? -10.962 70.675  11.161  1.00 54.92  ? 448  GLY A CA    1 
ATOM   4005  C  C     . GLY E 3 442 ? -12.352 70.583  11.741  1.00 54.92  ? 448  GLY A C     1 
ATOM   4006  O  O     . GLY E 3 442 ? -12.531 70.552  12.951  1.00 54.92  ? 448  GLY A O     1 
ATOM   4007  N  N     . GLU E 3 443 ? -13.341 70.546  10.857  1.00 81.23  ? 449  GLU A N     1 
ATOM   4008  C  CA    . GLU E 3 443 ? -14.739 70.471  11.248  1.00 81.23  ? 449  GLU A CA    1 
ATOM   4009  C  C     . GLU E 3 443 ? -15.204 69.055  10.989  1.00 81.23  ? 449  GLU A C     1 
ATOM   4010  O  O     . GLU E 3 443 ? -16.030 68.508  11.718  1.00 81.23  ? 449  GLU A O     1 
ATOM   4011  C  CB    . GLU E 3 443 ? -15.556 71.433  10.384  1.00 108.02 ? 449  GLU A CB    1 
ATOM   4012  C  CG    . GLU E 3 443 ? -17.029 71.510  10.731  1.00 108.02 ? 449  GLU A CG    1 
ATOM   4013  C  CD    . GLU E 3 443 ? -17.283 72.340  11.968  1.00 108.02 ? 449  GLU A CD    1 
ATOM   4014  O  OE1   . GLU E 3 443 ? -17.964 73.385  11.855  1.00 108.02 ? 449  GLU A OE1   1 
ATOM   4015  O  OE2   . GLU E 3 443 ? -16.795 71.952  13.050  1.00 108.02 ? 449  GLU A OE2   1 
ATOM   4016  N  N     . GLN E 3 444 ? -14.660 68.477  9.925   1.00 52.27  ? 450  GLN A N     1 
ATOM   4017  C  CA    . GLN E 3 444 ? -15.006 67.121  9.506   1.00 52.27  ? 450  GLN A CA    1 
ATOM   4018  C  C     . GLN E 3 444 ? -14.241 66.048  10.266  1.00 52.27  ? 450  GLN A C     1 
ATOM   4019  O  O     . GLN E 3 444 ? -14.749 64.946  10.486  1.00 52.27  ? 450  GLN A O     1 
ATOM   4020  C  CB    . GLN E 3 444 ? -14.747 66.962  8.004   1.00 63.81  ? 450  GLN A CB    1 
ATOM   4021  C  CG    . GLN E 3 444 ? -15.939 67.279  7.116   1.00 63.81  ? 450  GLN A CG    1 
ATOM   4022  C  CD    . GLN E 3 444 ? -15.558 68.064  5.872   1.00 63.81  ? 450  GLN A CD    1 
ATOM   4023  O  OE1   . GLN E 3 444 ? -15.214 69.255  5.961   1.00 63.81  ? 450  GLN A OE1   1 
ATOM   4024  N  NE2   . GLN E 3 444 ? -15.614 67.408  4.705   1.00 63.81  ? 450  GLN A NE2   1 
ATOM   4025  N  N     . CYS E 3 445 ? -13.016 66.392  10.658  1.00 69.11  ? 451  CYS A N     1 
ATOM   4026  C  CA    . CYS E 3 445 ? -12.138 65.492  11.383  1.00 69.11  ? 451  CYS A CA    1 
ATOM   4027  C  C     . CYS E 3 445 ? -12.646 65.327  12.790  1.00 69.11  ? 451  CYS A C     1 
ATOM   4028  O  O     . CYS E 3 445 ? -12.822 64.211  13.275  1.00 69.11  ? 451  CYS A O     1 
ATOM   4029  C  CB    . CYS E 3 445 ? -10.741 66.065  11.398  1.00 48.33  ? 451  CYS A CB    1 
ATOM   4030  S  SG    . CYS E 3 445 ? -10.132 66.275  9.729   1.00 48.33  ? 451  CYS A SG    1 
ATOM   4031  N  N     . ARG E 3 446 ? -12.895 66.448  13.445  1.00 58.17  ? 452  ARG A N     1 
ATOM   4032  C  CA    . ARG E 3 446 ? -13.396 66.409  14.803  1.00 58.17  ? 452  ARG A CA    1 
ATOM   4033  C  C     . ARG E 3 446 ? -14.750 65.726  14.862  1.00 58.17  ? 452  ARG A C     1 
ATOM   4034  O  O     . ARG E 3 446 ? -15.050 64.988  15.794  1.00 58.17  ? 452  ARG A O     1 
ATOM   4035  C  CB    . ARG E 3 446 ? -13.530 67.816  15.340  1.00 59.81  ? 452  ARG A CB    1 
ATOM   4036  C  CG    . ARG E 3 446 ? -12.216 68.512  15.502  1.00 59.81  ? 452  ARG A CG    1 
ATOM   4037  C  CD    . ARG E 3 446 ? -11.607 68.193  16.825  1.00 59.81  ? 452  ARG A CD    1 
ATOM   4038  N  NE    . ARG E 3 446 ? -10.286 68.773  16.948  1.00 59.81  ? 452  ARG A NE    1 
ATOM   4039  C  CZ    . ARG E 3 446 ? -9.704  68.990  18.115  1.00 59.81  ? 452  ARG A CZ    1 
ATOM   4040  N  NH1   . ARG E 3 446 ? -10.347 68.676  19.230  1.00 59.81  ? 452  ARG A NH1   1 
ATOM   4041  N  NH2   . ARG E 3 446 ? -8.480  69.495  18.172  1.00 59.81  ? 452  ARG A NH2   1 
ATOM   4042  N  N     . ALA E 3 447 ? -15.579 65.971  13.864  1.00 67.22  ? 453  ALA A N     1 
ATOM   4043  C  CA    . ALA E 3 447 ? -16.894 65.368  13.839  1.00 67.22  ? 453  ALA A CA    1 
ATOM   4044  C  C     . ALA E 3 447 ? -16.840 63.844  13.684  1.00 67.22  ? 453  ALA A C     1 
ATOM   4045  O  O     . ALA E 3 447 ? -17.851 63.166  13.876  1.00 67.22  ? 453  ALA A O     1 
ATOM   4046  C  CB    . ALA E 3 447 ? -17.706 65.980  12.708  1.00 76.91  ? 453  ALA A CB    1 
ATOM   4047  N  N     . ALA E 3 448 ? -15.670 63.300  13.349  1.00 45.19  ? 454  ALA A N     1 
ATOM   4048  C  CA    . ALA E 3 448 ? -15.556 61.853  13.156  1.00 45.19  ? 454  ALA A CA    1 
ATOM   4049  C  C     . ALA E 3 448 ? -15.153 61.095  14.426  1.00 45.19  ? 454  ALA A C     1 
ATOM   4050  O  O     . ALA E 3 448 ? -15.109 59.859  14.462  1.00 45.19  ? 454  ALA A O     1 
ATOM   4051  C  CB    . ALA E 3 448 ? -14.584 61.561  12.017  1.00 45.83  ? 454  ALA A CB    1 
ATOM   4052  N  N     . PHE E 3 449 ? -14.857 61.852  15.467  1.00 45.50  ? 455  PHE A N     1 
ATOM   4053  C  CA    . PHE E 3 449 ? -14.476 61.279  16.744  1.00 45.50  ? 455  PHE A CA    1 
ATOM   4054  C  C     . PHE E 3 449 ? -15.606 61.664  17.674  1.00 45.50  ? 455  PHE A C     1 
ATOM   4055  O  O     . PHE E 3 449 ? -15.696 62.830  18.085  1.00 45.50  ? 455  PHE A O     1 
ATOM   4056  C  CB    . PHE E 3 449 ? -13.151 61.900  17.259  1.00 46.44  ? 455  PHE A CB    1 
ATOM   4057  C  CG    . PHE E 3 449 ? -11.935 61.514  16.447  1.00 46.44  ? 455  PHE A CG    1 
ATOM   4058  C  CD1   . PHE E 3 449 ? -11.726 62.054  15.170  1.00 46.44  ? 455  PHE A CD1   1 
ATOM   4059  C  CD2   . PHE E 3 449 ? -11.072 60.512  16.901  1.00 46.44  ? 455  PHE A CD2   1 
ATOM   4060  C  CE1   . PHE E 3 449 ? -10.703 61.595  14.365  1.00 46.44  ? 455  PHE A CE1   1 
ATOM   4061  C  CE2   . PHE E 3 449 ? -10.046 60.048  16.097  1.00 46.44  ? 455  PHE A CE2   1 
ATOM   4062  C  CZ    . PHE E 3 449 ? -9.867  60.589  14.826  1.00 46.44  ? 455  PHE A CZ    1 
ATOM   4063  N  N     . GLY E 3 450 ? -16.478 60.713  17.999  1.00 69.63  ? 456  GLY A N     1 
ATOM   4064  C  CA    . GLY E 3 450 ? -17.576 61.047  18.888  1.00 69.63  ? 456  GLY A CA    1 
ATOM   4065  C  C     . GLY E 3 450 ? -18.369 59.896  19.476  1.00 69.63  ? 456  GLY A C     1 
ATOM   4066  O  O     . GLY E 3 450 ? -18.420 58.802  18.904  1.00 69.63  ? 456  GLY A O     1 
ATOM   4067  N  N     . ALA E 3 451 ? -18.991 60.154  20.629  1.00 49.94  ? 457  ALA A N     1 
ATOM   4068  C  CA    . ALA E 3 451 ? -19.808 59.156  21.299  1.00 49.94  ? 457  ALA A CA    1 
ATOM   4069  C  C     . ALA E 3 451 ? -20.850 58.659  20.331  1.00 49.94  ? 457  ALA A C     1 
ATOM   4070  O  O     . ALA E 3 451 ? -21.109 57.463  20.238  1.00 49.94  ? 457  ALA A O     1 
ATOM   4071  C  CB    . ALA E 3 451 ? -20.491 59.759  22.483  1.00 23.68  ? 457  ALA A CB    1 
ATOM   4072  N  N     . GLU E 3 452 ? -21.440 59.608  19.609  1.00 49.64  ? 458  GLU A N     1 
ATOM   4073  C  CA    . GLU E 3 452 ? -22.488 59.339  18.629  1.00 49.64  ? 458  GLU A CA    1 
ATOM   4074  C  C     . GLU E 3 452 ? -22.129 58.291  17.593  1.00 49.64  ? 458  GLU A C     1 
ATOM   4075  O  O     . GLU E 3 452 ? -22.974 57.892  16.795  1.00 49.64  ? 458  GLU A O     1 
ATOM   4076  C  CB    . GLU E 3 452 ? -22.859 60.623  17.894  1.00 91.58  ? 458  GLU A CB    1 
ATOM   4077  C  CG    . GLU E 3 452 ? -21.812 61.062  16.900  1.00 91.58  ? 458  GLU A CG    1 
ATOM   4078  C  CD    . GLU E 3 452 ? -22.216 62.306  16.146  1.00 91.58  ? 458  GLU A CD    1 
ATOM   4079  O  OE1   . GLU E 3 452 ? -23.283 62.279  15.505  1.00 91.58  ? 458  GLU A OE1   1 
ATOM   4080  O  OE2   . GLU E 3 452 ? -21.472 63.307  16.191  1.00 91.58  ? 458  GLU A OE2   1 
ATOM   4081  N  N     . HIS E 3 453 ? -20.881 57.846  17.587  1.00 66.56  ? 459  HIS A N     1 
ATOM   4082  C  CA    . HIS E 3 453 ? -20.480 56.847  16.610  1.00 66.56  ? 459  HIS A CA    1 
ATOM   4083  C  C     . HIS E 3 453 ? -20.460 55.460  17.222  1.00 66.56  ? 459  HIS A C     1 
ATOM   4084  O  O     . HIS E 3 453 ? -20.053 54.483  16.577  1.00 66.56  ? 459  HIS A O     1 
ATOM   4085  C  CB    . HIS E 3 453 ? -19.123 57.206  16.036  1.00 51.56  ? 459  HIS A CB    1 
ATOM   4086  C  CG    . HIS E 3 453 ? -19.066 58.591  15.471  1.00 51.56  ? 459  HIS A CG    1 
ATOM   4087  N  ND1   . HIS E 3 453 ? -19.586 58.913  14.236  1.00 51.56  ? 459  HIS A ND1   1 
ATOM   4088  C  CD2   . HIS E 3 453 ? -18.539 59.736  15.970  1.00 51.56  ? 459  HIS A CD2   1 
ATOM   4089  C  CE1   . HIS E 3 453 ? -19.373 60.195  13.995  1.00 51.56  ? 459  HIS A CE1   1 
ATOM   4090  N  NE2   . HIS E 3 453 ? -18.739 60.716  15.031  1.00 51.56  ? 459  HIS A NE2   1 
ATOM   4091  N  N     . HIS E 3 454 ? -20.917 55.391  18.470  1.00 73.26  ? 460  HIS A N     1 
ATOM   4092  C  CA    . HIS E 3 454 ? -21.011 54.133  19.181  1.00 73.26  ? 460  HIS A CA    1 
ATOM   4093  C  C     . HIS E 3 454 ? -22.464 53.844  19.559  1.00 73.26  ? 460  HIS A C     1 
ATOM   4094  O  O     . HIS E 3 454 ? -23.058 54.520  20.414  1.00 73.26  ? 460  HIS A O     1 
ATOM   4095  C  CB    . HIS E 3 454 ? -20.137 54.147  20.433  1.00 69.23  ? 460  HIS A CB    1 
ATOM   4096  C  CG    . HIS E 3 454 ? -20.180 52.863  21.199  1.00 69.23  ? 460  HIS A CG    1 
ATOM   4097  N  ND1   . HIS E 3 454 ? -20.188 51.632  20.578  1.00 69.23  ? 460  HIS A ND1   1 
ATOM   4098  C  CD2   . HIS E 3 454 ? -20.262 52.617  22.526  1.00 69.23  ? 460  HIS A CD2   1 
ATOM   4099  C  CE1   . HIS E 3 454 ? -20.282 50.682  21.489  1.00 69.23  ? 460  HIS A CE1   1 
ATOM   4100  N  NE2   . HIS E 3 454 ? -20.329 51.253  22.679  1.00 69.23  ? 460  HIS A NE2   1 
ATOM   4101  N  N     . LEU E 3 455 ? -23.027 52.838  18.897  1.00 70.01  ? 461  LEU A N     1 
ATOM   4102  C  CA    . LEU E 3 455 ? -24.398 52.401  19.138  1.00 70.01  ? 461  LEU A CA    1 
ATOM   4103  C  C     . LEU E 3 455 ? -24.370 51.513  20.379  1.00 70.01  ? 461  LEU A C     1 
ATOM   4104  O  O     . LEU E 3 455 ? -23.592 50.556  20.437  1.00 70.01  ? 461  LEU A O     1 
ATOM   4105  C  CB    . LEU E 3 455 ? -24.895 51.558  17.970  1.00 49.33  ? 461  LEU A CB    1 
ATOM   4106  C  CG    . LEU E 3 455 ? -24.591 52.040  16.557  1.00 49.33  ? 461  LEU A CG    1 
ATOM   4107  C  CD1   . LEU E 3 455 ? -25.197 51.064  15.546  1.00 49.33  ? 461  LEU A CD1   1 
ATOM   4108  C  CD2   . LEU E 3 455 ? -25.115 53.460  16.378  1.00 49.33  ? 461  LEU A CD2   1 
ATOM   4109  N  N     . ASP E 3 456 ? -25.225 51.809  21.356  1.00 63.70  ? 462  ASP A N     1 
ATOM   4110  C  CA    . ASP E 3 456 ? -25.266 51.033  22.598  1.00 63.70  ? 462  ASP A CA    1 
ATOM   4111  C  C     . ASP E 3 456 ? -25.378 49.516  22.443  1.00 63.70  ? 462  ASP A C     1 
ATOM   4112  O  O     . ASP E 3 456 ? -25.964 48.997  21.493  1.00 63.70  ? 462  ASP A O     1 
ATOM   4113  C  CB    . ASP E 3 456 ? -26.387 51.518  23.522  1.00 72.22  ? 462  ASP A CB    1 
ATOM   4114  C  CG    . ASP E 3 456 ? -26.331 50.858  24.894  1.00 72.22  ? 462  ASP A CG    1 
ATOM   4115  O  OD1   . ASP E 3 456 ? -26.049 51.568  25.885  1.00 72.22  ? 462  ASP A OD1   1 
ATOM   4116  O  OD2   . ASP E 3 456 ? -26.557 49.627  24.982  1.00 72.22  ? 462  ASP A OD2   1 
ATOM   4117  N  N     . GLY E 3 457 ? -24.800 48.819  23.413  1.00 90.32  ? 463  GLY A N     1 
ATOM   4118  C  CA    . GLY E 3 457 ? -24.803 47.374  23.404  1.00 90.32  ? 463  GLY A CA    1 
ATOM   4119  C  C     . GLY E 3 457 ? -26.184 46.763  23.345  1.00 90.32  ? 463  GLY A C     1 
ATOM   4120  O  O     . GLY E 3 457 ? -26.426 45.877  22.520  1.00 90.32  ? 463  GLY A O     1 
ATOM   4121  N  N     . ILE E 3 458 ? -27.085 47.228  24.217  1.00 96.86  ? 464  ILE A N     1 
ATOM   4122  C  CA    . ILE E 3 458 ? -28.462 46.717  24.276  1.00 96.86  ? 464  ILE A CA    1 
ATOM   4123  C  C     . ILE E 3 458 ? -29.445 47.538  23.469  1.00 96.86  ? 464  ILE A C     1 
ATOM   4124  O  O     . ILE E 3 458 ? -29.932 47.092  22.419  1.00 96.86  ? 464  ILE A O     1 
ATOM   4125  C  CB    . ILE E 3 458 ? -28.994 46.661  25.715  1.00 85.76  ? 464  ILE A CB    1 
ATOM   4126  C  CG1   . ILE E 3 458 ? -28.529 47.897  26.489  1.00 85.76  ? 464  ILE A CG1   1 
ATOM   4127  C  CG2   . ILE E 3 458 ? -28.583 45.350  26.361  1.00 85.76  ? 464  ILE A CG2   1 
ATOM   4128  C  CD1   . ILE E 3 458 ? -28.682 47.784  28.002  1.00 85.76  ? 464  ILE A CD1   1 
ATOM   4129  N  N     . THR E 3 459 ? -29.738 48.735  23.973  1.00 59.16  ? 465  THR A N     1 
ATOM   4130  C  CA    . THR E 3 459 ? -30.667 49.640  23.307  1.00 59.16  ? 465  THR A CA    1 
ATOM   4131  C  C     . THR E 3 459 ? -30.296 49.909  21.853  1.00 59.16  ? 465  THR A C     1 
ATOM   4132  O  O     . THR E 3 459 ? -31.116 50.417  21.100  1.00 59.16  ? 465  THR A O     1 
ATOM   4133  C  CB    . THR E 3 459 ? -30.740 51.025  23.987  1.00 41.59  ? 465  THR A CB    1 
ATOM   4134  O  OG1   . THR E 3 459 ? -29.902 51.942  23.271  1.00 41.59  ? 465  THR A OG1   1 
ATOM   4135  C  CG2   . THR E 3 459 ? -30.317 50.947  25.467  1.00 41.59  ? 465  THR A CG2   1 
ATOM   4136  N  N     . GLY E 3 460 ? -29.061 49.587  21.470  1.00 58.47  ? 466  GLY A N     1 
ATOM   4137  C  CA    . GLY E 3 460 ? -28.598 49.817  20.109  1.00 58.47  ? 466  GLY A CA    1 
ATOM   4138  C  C     . GLY E 3 460 ? -28.622 51.287  19.704  1.00 58.47  ? 466  GLY A C     1 
ATOM   4139  O  O     . GLY E 3 460 ? -28.395 51.617  18.548  1.00 58.47  ? 466  GLY A O     1 
ATOM   4140  N  N     . LYS E 3 461 ? -28.900 52.176  20.652  1.00 75.58  ? 467  LYS A N     1 
ATOM   4141  C  CA    . LYS E 3 461 ? -28.972 53.604  20.361  1.00 75.58  ? 467  LYS A CA    1 
ATOM   4142  C  C     . LYS E 3 461 ? -27.668 54.349  20.636  1.00 75.58  ? 467  LYS A C     1 
ATOM   4143  O  O     . LYS E 3 461 ? -26.938 54.015  21.561  1.00 75.58  ? 467  LYS A O     1 
ATOM   4144  C  CB    . LYS E 3 461 ? -30.101 54.242  21.177  1.00 99.84  ? 467  LYS A CB    1 
ATOM   4145  N  N     . PRO E 3 462 ? -27.364 55.377  19.830  1.00 77.92  ? 468  PRO A N     1 
ATOM   4146  C  CA    . PRO E 3 462 ? -26.158 56.201  19.952  1.00 77.92  ? 468  PRO A CA    1 
ATOM   4147  C  C     . PRO E 3 462 ? -25.928 56.789  21.338  1.00 77.92  ? 468  PRO A C     1 
ATOM   4148  O  O     . PRO E 3 462 ? -26.886 57.136  22.037  1.00 77.92  ? 468  PRO A O     1 
ATOM   4149  C  CB    . PRO E 3 462 ? -26.387 57.285  18.914  1.00 96.78  ? 468  PRO A CB    1 
ATOM   4150  C  CG    . PRO E 3 462 ? -27.066 56.532  17.834  1.00 96.78  ? 468  PRO A CG    1 
ATOM   4151  C  CD    . PRO E 3 462 ? -28.086 55.715  18.591  1.00 96.78  ? 468  PRO A CD    1 
ATOM   4152  N  N     . TRP E 3 463 ? -24.659 56.890  21.734  1.00 38.11  ? 469  TRP A N     1 
ATOM   4153  C  CA    . TRP E 3 463 ? -24.325 57.454  23.032  1.00 38.11  ? 469  TRP A CA    1 
ATOM   4154  C  C     . TRP E 3 463 ? -24.239 58.961  22.833  1.00 38.11  ? 469  TRP A C     1 
ATOM   4155  O  O     . TRP E 3 463 ? -24.465 59.453  21.728  1.00 38.11  ? 469  TRP A O     1 
ATOM   4156  C  CB    . TRP E 3 463 ? -22.970 56.930  23.542  1.00 70.05  ? 469  TRP A CB    1 
ATOM   4157  C  CG    . TRP E 3 463 ? -23.007 55.639  24.342  1.00 70.05  ? 469  TRP A CG    1 
ATOM   4158  C  CD1   . TRP E 3 463 ? -23.610 54.469  23.983  1.00 70.05  ? 469  TRP A CD1   1 
ATOM   4159  C  CD2   . TRP E 3 463 ? -22.356 55.378  25.604  1.00 70.05  ? 469  TRP A CD2   1 
ATOM   4160  N  NE1   . TRP E 3 463 ? -23.377 53.498  24.937  1.00 70.05  ? 469  TRP A NE1   1 
ATOM   4161  C  CE2   . TRP E 3 463 ? -22.612 54.030  25.939  1.00 70.05  ? 469  TRP A CE2   1 
ATOM   4162  C  CE3   . TRP E 3 463 ? -21.581 56.150  26.477  1.00 70.05  ? 469  TRP A CE3   1 
ATOM   4163  C  CZ2   . TRP E 3 463 ? -22.124 53.441  27.108  1.00 70.05  ? 469  TRP A CZ2   1 
ATOM   4164  C  CZ3   . TRP E 3 463 ? -21.096 55.559  27.646  1.00 70.05  ? 469  TRP A CZ3   1 
ATOM   4165  C  CH2   . TRP E 3 463 ? -21.372 54.219  27.946  1.00 70.05  ? 469  TRP A CH2   1 
ATOM   4166  N  N     . VAL E 3 464 ? -23.915 59.677  23.907  1.00 87.81  ? 470  VAL A N     1 
ATOM   4167  C  CA    . VAL E 3 464 ? -23.770 61.129  23.880  1.00 87.81  ? 470  VAL A CA    1 
ATOM   4168  C  C     . VAL E 3 464 ? -22.416 61.460  24.481  1.00 87.81  ? 470  VAL A C     1 
ATOM   4169  O  O     . VAL E 3 464 ? -21.999 60.862  25.468  1.00 87.81  ? 470  VAL A O     1 
ATOM   4170  C  CB    . VAL E 3 464 ? -24.850 61.855  24.720  1.00 103.50 ? 470  VAL A CB    1 
ATOM   4171  C  CG1   . VAL E 3 464 ? -24.610 61.625  26.198  1.00 103.50 ? 470  VAL A CG1   1 
ATOM   4172  C  CG2   . VAL E 3 464 ? -24.819 63.345  24.432  1.00 103.50 ? 470  VAL A CG2   1 
ATOM   4173  N  N     . GLN E 3 465 ? -21.739 62.431  23.895  1.00 50.03  ? 471  GLN A N     1 
ATOM   4174  C  CA    . GLN E 3 465 ? -20.427 62.813  24.364  1.00 50.03  ? 471  GLN A CA    1 
ATOM   4175  C  C     . GLN E 3 465 ? -20.475 63.990  25.326  1.00 50.03  ? 471  GLN A C     1 
ATOM   4176  O  O     . GLN E 3 465 ? -21.352 64.841  25.227  1.00 50.03  ? 471  GLN A O     1 
ATOM   4177  C  CB    . GLN E 3 465 ? -19.559 63.159  23.154  1.00 69.75  ? 471  GLN A CB    1 
ATOM   4178  C  CG    . GLN E 3 465 ? -18.083 63.300  23.453  1.00 69.75  ? 471  GLN A CG    1 
ATOM   4179  C  CD    . GLN E 3 465 ? -17.258 63.235  22.200  1.00 69.75  ? 471  GLN A CD    1 
ATOM   4180  O  OE1   . GLN E 3 465 ? -17.591 62.499  21.265  1.00 69.75  ? 471  GLN A OE1   1 
ATOM   4181  N  NE2   . GLN E 3 465 ? -16.164 63.988  22.173  1.00 69.75  ? 471  GLN A NE2   1 
ATOM   4182  N  N     . ALA E 3 466 ? -19.519 64.050  26.245  1.00 57.67  ? 472  ALA A N     1 
ATOM   4183  C  CA    . ALA E 3 466 ? -19.478 65.141  27.202  1.00 57.67  ? 472  ALA A CA    1 
ATOM   4184  C  C     . ALA E 3 466 ? -18.077 65.743  27.288  1.00 57.67  ? 472  ALA A C     1 
ATOM   4185  O  O     . ALA E 3 466 ? -17.191 65.196  27.934  1.00 57.67  ? 472  ALA A O     1 
ATOM   4186  C  CB    . ALA E 3 466 ? -19.922 64.644  28.568  1.00 114.04 ? 472  ALA A CB    1 
ATOM   4187  N  N     . GLY E 3 467 ? -17.885 66.881  26.640  1.00 71.65  ? 473  GLY A N     1 
ATOM   4188  C  CA    . GLY E 3 467 ? -16.588 67.516  26.672  1.00 71.65  ? 473  GLY A CA    1 
ATOM   4189  C  C     . GLY E 3 467 ? -16.416 68.499  27.815  1.00 71.65  ? 473  GLY A C     1 
ATOM   4190  O  O     . GLY E 3 467 ? -17.041 69.559  27.849  1.00 71.65  ? 473  GLY A O     1 
ATOM   4191  N  N     . ILE E 3 468 ? -15.559 68.152  28.764  1.00 45.26  ? 474  ILE A N     1 
ATOM   4192  C  CA    . ILE E 3 468 ? -15.293 69.037  29.897  1.00 45.26  ? 474  ILE A CA    1 
ATOM   4193  C  C     . ILE E 3 468 ? -13.860 69.551  29.760  1.00 45.26  ? 474  ILE A C     1 
ATOM   4194  O  O     . ILE E 3 468 ? -12.976 68.795  29.394  1.00 45.26  ? 474  ILE A O     1 
ATOM   4195  C  CB    . ILE E 3 468 ? -15.446 68.284  31.252  1.00 58.15  ? 474  ILE A CB    1 
ATOM   4196  C  CG1   . ILE E 3 468 ? -16.891 67.799  31.435  1.00 58.15  ? 474  ILE A CG1   1 
ATOM   4197  C  CG2   . ILE E 3 468 ? -15.043 69.200  32.398  1.00 58.15  ? 474  ILE A CG2   1 
ATOM   4198  C  CD1   . ILE E 3 468 ? -17.412 66.913  30.314  1.00 58.15  ? 474  ILE A CD1   1 
ATOM   4199  N  N     . ASP E 3 469 ? -13.645 70.831  30.046  1.00 65.11  ? 475  ASP A N     1 
ATOM   4200  C  CA    . ASP E 3 469 ? -12.318 71.435  29.937  1.00 65.11  ? 475  ASP A CA    1 
ATOM   4201  C  C     . ASP E 3 469 ? -12.071 72.444  31.051  1.00 65.11  ? 475  ASP A C     1 
ATOM   4202  O  O     . ASP E 3 469 ? -13.005 73.078  31.536  1.00 65.11  ? 475  ASP A O     1 
ATOM   4203  C  CB    . ASP E 3 469 ? -12.157 72.141  28.588  1.00 74.57  ? 475  ASP A CB    1 
ATOM   4204  N  N     . ALA E 3 470 ? -10.807 72.596  31.440  1.00 93.84  ? 476  ALA A N     1 
ATOM   4205  C  CA    . ALA E 3 470 ? -10.427 73.520  32.507  1.00 93.84  ? 476  ALA A CA    1 
ATOM   4206  C  C     . ALA E 3 470 ? -10.296 74.946  32.005  1.00 93.84  ? 476  ALA A C     1 
ATOM   4207  O  O     . ALA E 3 470 ? -9.523  75.225  31.089  1.00 93.84  ? 476  ALA A O     1 
ATOM   4208  C  CB    . ALA E 3 470 ? -9.128  73.086  33.138  1.00 43.69  ? 476  ALA A CB    1 
ATOM   4209  N  N     . SER E 3 471 ? -11.039 75.851  32.631  1.00 64.53  ? 477  SER A N     1 
ATOM   4210  C  CA    . SER E 3 471 ? -11.027 77.246  32.236  1.00 64.53  ? 477  SER A CA    1 
ATOM   4211  C  C     . SER E 3 471 ? -9.818  78.007  32.745  1.00 64.53  ? 477  SER A C     1 
ATOM   4212  O  O     . SER E 3 471 ? -9.559  78.057  33.939  1.00 64.53  ? 477  SER A O     1 
ATOM   4213  C  CB    . SER E 3 471 ? -12.322 77.925  32.688  1.00 95.15  ? 477  SER A CB    1 
ATOM   4214  O  OG    . SER E 3 471 ? -13.426 77.441  31.937  1.00 95.15  ? 477  SER A OG    1 
ATOM   4215  N  N     . GLY E 3 472 ? -9.075  78.577  31.801  1.00 55.26  ? 478  GLY A N     1 
ATOM   4216  C  CA    . GLY E 3 472 ? -7.892  79.370  32.098  1.00 55.26  ? 478  GLY A CA    1 
ATOM   4217  C  C     . GLY E 3 472 ? -6.854  78.785  33.032  1.00 55.26  ? 478  GLY A C     1 
ATOM   4218  O  O     . GLY E 3 472 ? -6.072  79.511  33.645  1.00 55.26  ? 478  GLY A O     1 
ATOM   4219  N  N     . LEU E 3 473 ? -6.832  77.470  33.134  1.00 51.29  ? 479  LEU A N     1 
ATOM   4220  C  CA    . LEU E 3 473 ? -5.892  76.803  34.012  1.00 51.29  ? 479  LEU A CA    1 
ATOM   4221  C  C     . LEU E 3 473 ? -4.488  77.397  33.976  1.00 51.29  ? 479  LEU A C     1 
ATOM   4222  O  O     . LEU E 3 473 ? -3.757  77.344  34.960  1.00 51.29  ? 479  LEU A O     1 
ATOM   4223  C  CB    . LEU E 3 473 ? -5.835  75.315  33.659  1.00 53.76  ? 479  LEU A CB    1 
ATOM   4224  C  CG    . LEU E 3 473 ? -4.962  74.443  34.561  1.00 53.76  ? 479  LEU A CG    1 
ATOM   4225  C  CD1   . LEU E 3 473 ? -5.131  74.828  36.033  1.00 53.76  ? 479  LEU A CD1   1 
ATOM   4226  C  CD2   . LEU E 3 473 ? -5.340  73.009  34.337  1.00 53.76  ? 479  LEU A CD2   1 
ATOM   4227  N  N     . GLU E 3 474 ? -4.113  77.966  32.839  1.00 58.12  ? 480  GLU A N     1 
ATOM   4228  C  CA    . GLU E 3 474 ? -2.785  78.546  32.672  1.00 58.12  ? 480  GLU A CA    1 
ATOM   4229  C  C     . GLU E 3 474 ? -2.607  79.809  33.493  1.00 58.12  ? 480  GLU A C     1 
ATOM   4230  O  O     . GLU E 3 474 ? -1.862  79.826  34.475  1.00 58.12  ? 480  GLU A O     1 
ATOM   4231  C  CB    . GLU E 3 474 ? -2.534  78.861  31.189  1.00 58.95  ? 480  GLU A CB    1 
ATOM   4232  N  N     . LEU E 3 475 ? -3.296  80.870  33.078  1.00 101.93 ? 481  LEU A N     1 
ATOM   4233  C  CA    . LEU E 3 475 ? -3.218  82.162  33.759  1.00 101.93 ? 481  LEU A CA    1 
ATOM   4234  C  C     . LEU E 3 475 ? -3.422  81.986  35.265  1.00 101.93 ? 481  LEU A C     1 
ATOM   4235  O  O     . LEU E 3 475 ? -2.822  82.694  36.077  1.00 101.93 ? 481  LEU A O     1 
ATOM   4236  C  CB    . LEU E 3 475 ? -4.264  83.131  33.166  1.00 58.01  ? 481  LEU A CB    1 
ATOM   4237  N  N     . ARG E 3 476 ? -4.256  81.018  35.626  1.00 65.89  ? 482  ARG A N     1 
ATOM   4238  C  CA    . ARG E 3 476 ? -4.538  80.740  37.020  1.00 65.89  ? 482  ARG A CA    1 
ATOM   4239  C  C     . ARG E 3 476 ? -3.340  80.178  37.770  1.00 65.89  ? 482  ARG A C     1 
ATOM   4240  O  O     . ARG E 3 476 ? -3.066  80.586  38.892  1.00 65.89  ? 482  ARG A O     1 
ATOM   4241  C  CB    . ARG E 3 476 ? -5.716  79.786  37.126  1.00 52.26  ? 482  ARG A CB    1 
ATOM   4242  C  CG    . ARG E 3 476 ? -6.929  80.287  36.408  1.00 52.26  ? 482  ARG A CG    1 
ATOM   4243  C  CD    . ARG E 3 476 ? -8.175  79.900  37.140  1.00 52.26  ? 482  ARG A CD    1 
ATOM   4244  N  NE    . ARG E 3 476 ? -9.359  80.207  36.352  1.00 52.26  ? 482  ARG A NE    1 
ATOM   4245  C  CZ    . ARG E 3 476 ? -10.603 80.201  36.823  1.00 52.26  ? 482  ARG A CZ    1 
ATOM   4246  N  NH1   . ARG E 3 476 ? -10.836 79.904  38.096  1.00 52.26  ? 482  ARG A NH1   1 
ATOM   4247  N  NH2   . ARG E 3 476 ? -11.621 80.487  36.015  1.00 52.26  ? 482  ARG A NH2   1 
ATOM   4248  N  N     . CYS E 3 477 ? -2.624  79.240  37.176  1.00 59.57  ? 483  CYS A N     1 
ATOM   4249  C  CA    . CYS E 3 477 ? -1.464  78.701  37.866  1.00 59.57  ? 483  CYS A CA    1 
ATOM   4250  C  C     . CYS E 3 477 ? -0.478  79.828  38.182  1.00 59.57  ? 483  CYS A C     1 
ATOM   4251  O  O     . CYS E 3 477 ? 0.326   79.731  39.123  1.00 59.57  ? 483  CYS A O     1 
ATOM   4252  C  CB    . CYS E 3 477 ? -0.787  77.612  37.032  1.00 117.03 ? 483  CYS A CB    1 
ATOM   4253  S  SG    . CYS E 3 477 ? -1.499  75.970  37.284  1.00 117.03 ? 483  CYS A SG    1 
ATOM   4254  N  N     . LEU E 3 478 ? -0.548  80.898  37.395  1.00 91.05  ? 484  LEU A N     1 
ATOM   4255  C  CA    . LEU E 3 478 ? 0.315   82.052  37.599  1.00 91.05  ? 484  LEU A CA    1 
ATOM   4256  C  C     . LEU E 3 478 ? -0.219  82.843  38.785  1.00 91.05  ? 484  LEU A C     1 
ATOM   4257  O  O     . LEU E 3 478 ? 0.528   83.209  39.694  1.00 91.05  ? 484  LEU A O     1 
ATOM   4258  C  CB    . LEU E 3 478 ? 0.296   82.938  36.358  1.00 73.64  ? 484  LEU A CB    1 
ATOM   4259  C  CG    . LEU E 3 478 ? 0.892   84.337  36.541  1.00 73.64  ? 484  LEU A CG    1 
ATOM   4260  C  CD1   . LEU E 3 478 ? 2.393   84.271  36.868  1.00 73.64  ? 484  LEU A CD1   1 
ATOM   4261  C  CD2   . LEU E 3 478 ? 0.631   85.120  35.271  1.00 73.64  ? 484  LEU A CD2   1 
ATOM   4262  N  N     . ALA E 3 479 ? -1.524  83.110  38.751  1.00 78.90  ? 485  ALA A N     1 
ATOM   4263  C  CA    . ALA E 3 479 ? -2.201  83.852  39.811  1.00 78.90  ? 485  ALA A CA    1 
ATOM   4264  C  C     . ALA E 3 479 ? -1.756  83.270  41.123  1.00 78.90  ? 485  ALA A C     1 
ATOM   4265  O  O     . ALA E 3 479 ? -1.023  83.903  41.883  1.00 78.90  ? 485  ALA A O     1 
ATOM   4266  C  CB    . ALA E 3 479 ? -3.709  83.700  39.689  1.00 28.63  ? 485  ALA A CB    1 
ATOM   4267  N  N     . HIS E 3 480 ? -2.216  82.044  41.365  1.00 87.78  ? 486  HIS A N     1 
ATOM   4268  C  CA    . HIS E 3 480 ? -1.898  81.309  42.576  1.00 87.78  ? 486  HIS A CA    1 
ATOM   4269  C  C     . HIS E 3 480 ? -0.450  81.513  42.975  1.00 87.78  ? 486  HIS A C     1 
ATOM   4270  O  O     . HIS E 3 480 ? -0.167  82.079  44.027  1.00 87.78  ? 486  HIS A O     1 
ATOM   4271  C  CB    . HIS E 3 480 ? -2.162  79.813  42.386  1.00 71.06  ? 486  HIS A CB    1 
ATOM   4272  C  CG    . HIS E 3 480 ? -1.529  78.947  43.440  1.00 71.06  ? 486  HIS A CG    1 
ATOM   4273  N  ND1   . HIS E 3 480 ? -2.046  78.816  44.710  1.00 71.06  ? 486  HIS A ND1   1 
ATOM   4274  C  CD2   . HIS E 3 480 ? -0.387  78.215  43.425  1.00 71.06  ? 486  HIS A CD2   1 
ATOM   4275  C  CE1   . HIS E 3 480 ? -1.251  78.045  45.431  1.00 71.06  ? 486  HIS A CE1   1 
ATOM   4276  N  NE2   . HIS E 3 480 ? -0.237  77.668  44.675  1.00 71.06  ? 486  HIS A NE2   1 
ATOM   4277  N  N     . PHE E 3 481 ? 0.465   81.063  42.127  1.00 61.51  ? 487  PHE A N     1 
ATOM   4278  C  CA    . PHE E 3 481 ? 1.878   81.176  42.427  1.00 61.51  ? 487  PHE A CA    1 
ATOM   4279  C  C     . PHE E 3 481 ? 2.389   82.569  42.725  1.00 61.51  ? 487  PHE A C     1 
ATOM   4280  O  O     . PHE E 3 481 ? 3.327   82.724  43.520  1.00 61.51  ? 487  PHE A O     1 
ATOM   4281  C  CB    . PHE E 3 481 ? 2.687   80.540  41.307  1.00 97.86  ? 487  PHE A CB    1 
ATOM   4282  C  CG    . PHE E 3 481 ? 2.855   79.067  41.474  1.00 97.86  ? 487  PHE A CG    1 
ATOM   4283  C  CD1   . PHE E 3 481 ? 3.635   78.568  42.513  1.00 97.86  ? 487  PHE A CD1   1 
ATOM   4284  C  CD2   . PHE E 3 481 ? 2.208   78.178  40.629  1.00 97.86  ? 487  PHE A CD2   1 
ATOM   4285  C  CE1   . PHE E 3 481 ? 3.768   77.213  42.707  1.00 97.86  ? 487  PHE A CE1   1 
ATOM   4286  C  CE2   . PHE E 3 481 ? 2.334   76.817  40.814  1.00 97.86  ? 487  PHE A CE2   1 
ATOM   4287  C  CZ    . PHE E 3 481 ? 3.116   76.330  41.857  1.00 97.86  ? 487  PHE A CZ    1 
ATOM   4288  N  N     . MET E 3 482 ? 1.777   83.581  42.111  1.00 57.15  ? 488  MET A N     1 
ATOM   4289  C  CA    . MET E 3 482 ? 2.217   84.956  42.347  1.00 57.15  ? 488  MET A CA    1 
ATOM   4290  C  C     . MET E 3 482 ? 1.343   85.687  43.347  1.00 57.15  ? 488  MET A C     1 
ATOM   4291  O  O     . MET E 3 482 ? 1.320   86.917  43.377  1.00 57.15  ? 488  MET A O     1 
ATOM   4292  C  CB    . MET E 3 482 ? 2.272   85.763  41.039  1.00 74.42  ? 488  MET A CB    1 
ATOM   4293  C  CG    . MET E 3 482 ? 0.934   86.231  40.503  1.00 74.42  ? 488  MET A CG    1 
ATOM   4294  S  SD    . MET E 3 482 ? 1.188   87.528  39.284  1.00 74.42  ? 488  MET A SD    1 
ATOM   4295  C  CE    . MET E 3 482 ? -0.373  87.508  38.440  1.00 74.42  ? 488  MET A CE    1 
ATOM   4296  N  N     . ALA E 3 483 ? 0.626   84.919  44.164  1.00 62.79  ? 489  ALA A N     1 
ATOM   4297  C  CA    . ALA E 3 483 ? -0.256  85.475  45.195  1.00 62.79  ? 489  ALA A CA    1 
ATOM   4298  C  C     . ALA E 3 483 ? 0.555   85.694  46.467  1.00 62.79  ? 489  ALA A C     1 
ATOM   4299  O  O     . ALA E 3 483 ? 0.220   86.542  47.287  1.00 62.79  ? 489  ALA A O     1 
ATOM   4300  C  CB    . ALA E 3 483 ? -1.430  84.526  45.467  1.00 72.16  ? 489  ALA A CB    1 
ATOM   4301  N  N     . ARG E 3 484 ? 1.625   84.917  46.619  1.00 87.88  ? 490  ARG A N     1 
ATOM   4302  C  CA    . ARG E 3 484 ? 2.522   85.030  47.766  1.00 87.88  ? 490  ARG A CA    1 
ATOM   4303  C  C     . ARG E 3 484 ? 3.234   86.364  47.629  1.00 87.88  ? 490  ARG A C     1 
ATOM   4304  O  O     . ARG E 3 484 ? 4.157   86.684  48.383  1.00 87.88  ? 490  ARG A O     1 
ATOM   4305  C  CB    . ARG E 3 484 ? 3.539   83.879  47.748  1.00 90.51  ? 490  ARG A CB    1 
ATOM   4306  C  CG    . ARG E 3 484 ? 4.895   84.182  48.384  1.00 90.51  ? 490  ARG A CG    1 
ATOM   4307  C  CD    . ARG E 3 484 ? 5.691   82.907  48.645  1.00 90.51  ? 490  ARG A CD    1 
ATOM   4308  N  NE    . ARG E 3 484 ? 5.981   82.137  47.438  1.00 90.51  ? 490  ARG A NE    1 
ATOM   4309  C  CZ    . ARG E 3 484 ? 6.444   80.889  47.443  1.00 90.51  ? 490  ARG A CZ    1 
ATOM   4310  N  NH1   . ARG E 3 484 ? 6.667   80.264  48.594  1.00 90.51  ? 490  ARG A NH1   1 
ATOM   4311  N  NH2   . ARG E 3 484 ? 6.691   80.265  46.296  1.00 90.51  ? 490  ARG A NH2   1 
ATOM   4312  N  N     . PHE E 3 485 ? 2.785   87.133  46.643  1.00 80.50  ? 491  PHE A N     1 
ATOM   4313  C  CA    . PHE E 3 485 ? 3.341   88.441  46.357  1.00 80.50  ? 491  PHE A CA    1 
ATOM   4314  C  C     . PHE E 3 485 ? 2.216   89.425  46.092  1.00 80.50  ? 491  PHE A C     1 
ATOM   4315  O  O     . PHE E 3 485 ? 2.229   90.527  46.620  1.00 80.50  ? 491  PHE A O     1 
ATOM   4316  C  CB    . PHE E 3 485 ? 4.264   88.351  45.151  1.00 84.68  ? 491  PHE A CB    1 
ATOM   4317  C  CG    . PHE E 3 485 ? 5.415   87.420  45.352  1.00 84.68  ? 491  PHE A CG    1 
ATOM   4318  C  CD1   . PHE E 3 485 ? 6.424   87.733  46.251  1.00 84.68  ? 491  PHE A CD1   1 
ATOM   4319  C  CD2   . PHE E 3 485 ? 5.484   86.224  44.656  1.00 84.68  ? 491  PHE A CD2   1 
ATOM   4320  C  CE1   . PHE E 3 485 ? 7.495   86.867  46.459  1.00 84.68  ? 491  PHE A CE1   1 
ATOM   4321  C  CE2   . PHE E 3 485 ? 6.549   85.350  44.854  1.00 84.68  ? 491  PHE A CE2   1 
ATOM   4322  C  CZ    . PHE E 3 485 ? 7.561   85.674  45.761  1.00 84.68  ? 491  PHE A CZ    1 
ATOM   4323  N  N     . ASP E 3 486 ? 1.240   89.014  45.283  1.00 87.02  ? 492  ASP A N     1 
ATOM   4324  C  CA    . ASP E 3 486 ? 0.085   89.856  44.940  1.00 87.02  ? 492  ASP A CA    1 
ATOM   4325  C  C     . ASP E 3 486 ? -0.992  89.810  46.026  1.00 87.02  ? 492  ASP A C     1 
ATOM   4326  O  O     . ASP E 3 486 ? -1.838  90.697  46.106  1.00 87.02  ? 492  ASP A O     1 
ATOM   4327  C  CB    . ASP E 3 486 ? -0.536  89.398  43.606  1.00 56.32  ? 492  ASP A CB    1 
ATOM   4328  N  N     . ASN E 3 487 ? -0.944  88.769  46.856  1.00 82.30  ? 493  ASN A N     1 
ATOM   4329  C  CA    . ASN E 3 487 ? -1.906  88.549  47.942  1.00 82.30  ? 493  ASN A CA    1 
ATOM   4330  C  C     . ASN E 3 487 ? -3.352  88.553  47.450  1.00 82.30  ? 493  ASN A C     1 
ATOM   4331  O  O     . ASN E 3 487 ? -4.230  89.146  48.074  1.00 82.30  ? 493  ASN A O     1 
ATOM   4332  C  CB    . ASN E 3 487 ? -1.734  89.584  49.072  1.00 39.46  ? 493  ASN A CB    1 
ATOM   4333  N  N     . GLY E 3 488 ? -3.588  87.888  46.322  1.00 75.01  ? 494  GLY A N     1 
ATOM   4334  C  CA    . GLY E 3 488 ? -4.937  87.798  45.784  1.00 75.01  ? 494  GLY A CA    1 
ATOM   4335  C  C     . GLY E 3 488 ? -5.268  88.691  44.600  1.00 75.01  ? 494  GLY A C     1 
ATOM   4336  O  O     . GLY E 3 488 ? -6.382  88.636  44.057  1.00 75.01  ? 494  GLY A O     1 
ATOM   4337  N  N     . GLU E 3 489 ? -4.291  89.499  44.191  1.00 84.90  ? 495  GLU A N     1 
ATOM   4338  C  CA    . GLU E 3 489 ? -4.468  90.438  43.089  1.00 84.90  ? 495  GLU A CA    1 
ATOM   4339  C  C     . GLU E 3 489 ? -5.021  89.795  41.824  1.00 84.90  ? 495  GLU A C     1 
ATOM   4340  O  O     . GLU E 3 489 ? -6.235  89.823  41.581  1.00 84.90  ? 495  GLU A O     1 
ATOM   4341  C  CB    . GLU E 3 489 ? -3.137  91.137  42.785  1.00 103.24 ? 495  GLU A CB    1 
ATOM   4342  N  N     . TYR E 3 490 ? -4.127  89.223  41.019  1.00 79.01  ? 496  TYR A N     1 
ATOM   4343  C  CA    . TYR E 3 490 ? -4.530  88.586  39.773  1.00 79.01  ? 496  TYR A CA    1 
ATOM   4344  C  C     . TYR E 3 490 ? -5.568  87.520  40.075  1.00 79.01  ? 496  TYR A C     1 
ATOM   4345  O  O     . TYR E 3 490 ? -6.531  87.345  39.323  1.00 79.01  ? 496  TYR A O     1 
ATOM   4346  C  CB    . TYR E 3 490 ? -3.323  87.966  39.061  1.00 58.31  ? 496  TYR A CB    1 
ATOM   4347  N  N     . ALA E 3 491 ? -5.369  86.816  41.185  1.00 67.77  ? 497  ALA A N     1 
ATOM   4348  C  CA    . ALA E 3 491 ? -6.298  85.776  41.606  1.00 67.77  ? 497  ALA A CA    1 
ATOM   4349  C  C     . ALA E 3 491 ? -7.736  86.295  41.494  1.00 67.77  ? 497  ALA A C     1 
ATOM   4350  O  O     . ALA E 3 491 ? -8.563  85.733  40.758  1.00 67.77  ? 497  ALA A O     1 
ATOM   4351  C  CB    . ALA E 3 491 ? -6.003  85.379  43.039  1.00 95.59  ? 497  ALA A CB    1 
ATOM   4352  N  N     . HIS E 3 492 ? -8.015  87.376  42.224  1.00 116.13 ? 498  HIS A N     1 
ATOM   4353  C  CA    . HIS E 3 492 ? -9.335  87.997  42.224  1.00 116.13 ? 498  HIS A CA    1 
ATOM   4354  C  C     . HIS E 3 492 ? -9.652  88.590  40.861  1.00 116.13 ? 498  HIS A C     1 
ATOM   4355  O  O     . HIS E 3 492 ? -10.749 88.408  40.332  1.00 116.13 ? 498  HIS A O     1 
ATOM   4356  C  CB    . HIS E 3 492 ? -9.404  89.101  43.280  1.00 109.49 ? 498  HIS A CB    1 
ATOM   4357  N  N     . GLU E 3 493 ? -8.691  89.310  40.293  1.00 123.32 ? 499  GLU A N     1 
ATOM   4358  C  CA    . GLU E 3 493 ? -8.905  89.909  38.987  1.00 123.32 ? 499  GLU A CA    1 
ATOM   4359  C  C     . GLU E 3 493 ? -9.412  88.837  38.034  1.00 123.32 ? 499  GLU A C     1 
ATOM   4360  O  O     . GLU E 3 493 ? -10.492 88.970  37.465  1.00 123.32 ? 499  GLU A O     1 
ATOM   4361  C  CB    . GLU E 3 493 ? -7.608  90.506  38.457  1.00 41.29  ? 499  GLU A CB    1 
ATOM   4362  N  N     . ILE E 3 494 ? -8.638  87.766  37.887  1.00 109.02 ? 500  ILE A N     1 
ATOM   4363  C  CA    . ILE E 3 494 ? -8.990  86.659  37.005  1.00 109.02 ? 500  ILE A CA    1 
ATOM   4364  C  C     . ILE E 3 494 ? -10.406 86.112  37.220  1.00 109.02 ? 500  ILE A C     1 
ATOM   4365  O  O     . ILE E 3 494 ? -11.013 85.563  36.295  1.00 109.02 ? 500  ILE A O     1 
ATOM   4366  C  CB    . ILE E 3 494 ? -7.986  85.485  37.171  1.00 41.60  ? 500  ILE A CB    1 
ATOM   4367  N  N     . LEU E 3 495 ? -10.944 86.264  38.426  1.00 132.00 ? 501  LEU A N     1 
ATOM   4368  C  CA    . LEU E 3 495 ? -12.273 85.727  38.692  1.00 132.00 ? 501  LEU A CA    1 
ATOM   4369  C  C     . LEU E 3 495 ? -13.404 86.733  38.934  1.00 132.00 ? 501  LEU A C     1 
ATOM   4370  O  O     . LEU E 3 495 ? -14.352 86.798  38.151  1.00 132.00 ? 501  LEU A O     1 
ATOM   4371  C  CB    . LEU E 3 495 ? -12.208 84.728  39.861  1.00 63.35  ? 501  LEU A CB    1 
ATOM   4372  N  N     . ASN E 3 496 ? -13.310 87.515  40.006  1.00 145.12 ? 502  ASN A N     1 
ATOM   4373  C  CA    . ASN E 3 496 ? -14.356 88.479  40.348  1.00 145.12 ? 502  ASN A CA    1 
ATOM   4374  C  C     . ASN E 3 496 ? -14.350 89.792  39.558  1.00 145.12 ? 502  ASN A C     1 
ATOM   4375  O  O     . ASN E 3 496 ? -14.986 90.768  39.966  1.00 145.12 ? 502  ASN A O     1 
ATOM   4376  C  CB    . ASN E 3 496 ? -14.292 88.785  41.847  1.00 90.44  ? 502  ASN A CB    1 
ATOM   4377  N  N     . GLY E 3 497 ? -13.644 89.811  38.430  1.00 153.89 ? 503  GLY A N     1 
ATOM   4378  C  CA    . GLY E 3 497 ? -13.578 91.008  37.604  1.00 153.89 ? 503  GLY A CA    1 
ATOM   4379  C  C     . GLY E 3 497 ? -13.098 90.703  36.196  1.00 153.89 ? 503  GLY A C     1 
ATOM   4380  O  O     . GLY E 3 497 ? -13.752 89.961  35.457  1.00 153.89 ? 503  GLY A O     1 
ATOM   4381  N  N     . ASP E 3 498 ? -11.959 91.279  35.817  1.00 167.01 ? 504  ASP A N     1 
ATOM   4382  C  CA    . ASP E 3 498 ? -11.379 91.050  34.493  1.00 167.01 ? 504  ASP A CA    1 
ATOM   4383  C  C     . ASP E 3 498 ? -9.868  90.917  34.635  1.00 167.01 ? 504  ASP A C     1 
ATOM   4384  O  O     . ASP E 3 498 ? -9.267  91.531  35.522  1.00 167.01 ? 504  ASP A O     1 
ATOM   4385  C  CB    . ASP E 3 498 ? -11.698 92.212  33.548  1.00 108.39 ? 504  ASP A CB    1 
ATOM   4386  C  CG    . ASP E 3 498 ? -11.319 91.914  32.107  1.00 108.39 ? 504  ASP A CG    1 
ATOM   4387  O  OD1   . ASP E 3 498 ? -12.021 91.106  31.460  1.00 108.39 ? 504  ASP A OD1   1 
ATOM   4388  O  OD2   . ASP E 3 498 ? -10.316 92.481  31.626  1.00 108.39 ? 504  ASP A OD2   1 
ATOM   4389  N  N     . ILE E 3 499 ? -9.256  90.128  33.756  1.00 106.04 ? 505  ILE A N     1 
ATOM   4390  C  CA    . ILE E 3 499 ? -7.814  89.915  33.808  1.00 106.04 ? 505  ILE A CA    1 
ATOM   4391  C  C     . ILE E 3 499 ? -7.064  90.550  32.647  1.00 106.04 ? 505  ILE A C     1 
ATOM   4392  O  O     . ILE E 3 499 ? -6.115  91.305  32.850  1.00 106.04 ? 505  ILE A O     1 
ATOM   4393  C  CB    . ILE E 3 499 ? -7.480  88.397  33.851  1.00 97.94  ? 505  ILE A CB    1 
ATOM   4394  C  CG1   . ILE E 3 499 ? -5.959  88.171  33.813  1.00 97.94  ? 505  ILE A CG1   1 
ATOM   4395  C  CG2   . ILE E 3 499 ? -8.169  87.691  32.696  1.00 97.94  ? 505  ILE A CG2   1 
ATOM   4396  C  CD1   . ILE E 3 499 ? -5.198  88.589  35.080  1.00 97.94  ? 505  ILE A CD1   1 
ATOM   4397  N  N     . HIS E 3 500 ? -7.497  90.259  31.429  1.00 85.16  ? 506  HIS A N     1 
ATOM   4398  C  CA    . HIS E 3 500 ? -6.814  90.776  30.253  1.00 85.16  ? 506  HIS A CA    1 
ATOM   4399  C  C     . HIS E 3 500 ? -6.641  92.294  30.163  1.00 85.16  ? 506  HIS A C     1 
ATOM   4400  O  O     . HIS E 3 500 ? -5.542  92.775  29.864  1.00 85.16  ? 506  HIS A O     1 
ATOM   4401  C  CB    . HIS E 3 500 ? -7.479  90.221  28.991  1.00 85.42  ? 506  HIS A CB    1 
ATOM   4402  C  CG    . HIS E 3 500 ? -7.201  88.765  28.766  1.00 85.42  ? 506  HIS A CG    1 
ATOM   4403  N  ND1   . HIS E 3 500 ? -5.927  88.238  28.810  1.00 85.42  ? 506  HIS A ND1   1 
ATOM   4404  C  CD2   . HIS E 3 500 ? -8.028  87.727  28.489  1.00 85.42  ? 506  HIS A CD2   1 
ATOM   4405  C  CE1   . HIS E 3 500 ? -5.981  86.940  28.570  1.00 85.42  ? 506  HIS A CE1   1 
ATOM   4406  N  NE2   . HIS E 3 500 ? -7.244  86.604  28.371  1.00 85.42  ? 506  HIS A NE2   1 
ATOM   4407  N  N     . THR E 3 501 ? -7.698  93.057  30.425  1.00 66.79  ? 507  THR A N     1 
ATOM   4408  C  CA    . THR E 3 501 ? -7.561  94.508  30.355  1.00 66.79  ? 507  THR A CA    1 
ATOM   4409  C  C     . THR E 3 501 ? -6.468  94.967  31.314  1.00 66.79  ? 507  THR A C     1 
ATOM   4410  O  O     . THR E 3 501 ? -5.722  95.887  31.012  1.00 66.79  ? 507  THR A O     1 
ATOM   4411  C  CB    . THR E 3 501 ? -8.890  95.242  30.664  1.00 95.38  ? 507  THR A CB    1 
ATOM   4412  O  OG1   . THR E 3 501 ? -9.339  94.914  31.986  1.00 95.38  ? 507  THR A OG1   1 
ATOM   4413  C  CG2   . THR E 3 501 ? -9.953  94.847  29.638  1.00 95.38  ? 507  THR A CG2   1 
ATOM   4414  N  N     . LYS E 3 502 ? -6.365  94.318  32.467  1.00 80.29  ? 508  LYS A N     1 
ATOM   4415  C  CA    . LYS E 3 502 ? -5.325  94.680  33.423  1.00 80.29  ? 508  LYS A CA    1 
ATOM   4416  C  C     . LYS E 3 502 ? -3.990  94.436  32.725  1.00 80.29  ? 508  LYS A C     1 
ATOM   4417  O  O     . LYS E 3 502 ? -3.046  95.211  32.879  1.00 80.29  ? 508  LYS A O     1 
ATOM   4418  C  CB    . LYS E 3 502 ? -5.426  93.825  34.695  1.00 86.73  ? 508  LYS A CB    1 
ATOM   4419  N  N     . ASN E 3 503 ? -3.925  93.356  31.949  1.00 90.98  ? 509  ASN A N     1 
ATOM   4420  C  CA    . ASN E 3 503 ? -2.714  93.029  31.209  1.00 90.98  ? 509  ASN A CA    1 
ATOM   4421  C  C     . ASN E 3 503 ? -2.537  94.079  30.124  1.00 90.98  ? 509  ASN A C     1 
ATOM   4422  O  O     . ASN E 3 503 ? -1.477  94.708  30.010  1.00 90.98  ? 509  ASN A O     1 
ATOM   4423  C  CB    . ASN E 3 503 ? -2.828  91.670  30.520  1.00 82.52  ? 509  ASN A CB    1 
ATOM   4424  C  CG    . ASN E 3 503 ? -3.096  90.546  31.475  1.00 82.52  ? 509  ASN A CG    1 
ATOM   4425  O  OD1   . ASN E 3 503 ? -2.608  90.535  32.608  1.00 82.52  ? 509  ASN A OD1   1 
ATOM   4426  N  ND2   . ASN E 3 503 ? -3.859  89.565  31.011  1.00 82.52  ? 509  ASN A ND2   1 
ATOM   4427  N  N     . GLN E 3 504 ? -3.585  94.249  29.320  1.00 80.65  ? 510  GLN A N     1 
ATOM   4428  C  CA    . GLN E 3 504 ? -3.566  95.214  28.231  1.00 80.65  ? 510  GLN A CA    1 
ATOM   4429  C  C     . GLN E 3 504 ? -3.062  96.560  28.736  1.00 80.65  ? 510  GLN A C     1 
ATOM   4430  O  O     . GLN E 3 504 ? -2.408  97.298  28.000  1.00 80.65  ? 510  GLN A O     1 
ATOM   4431  C  CB    . GLN E 3 504 ? -4.965  95.371  27.631  1.00 88.40  ? 510  GLN A CB    1 
ATOM   4432  C  CG    . GLN E 3 504 ? -5.055  96.434  26.548  1.00 88.40  ? 510  GLN A CG    1 
ATOM   4433  C  CD    . GLN E 3 504 ? -6.448  96.551  25.952  1.00 88.40  ? 510  GLN A CD    1 
ATOM   4434  O  OE1   . GLN E 3 504 ? -6.663  97.277  24.978  1.00 88.40  ? 510  GLN A OE1   1 
ATOM   4435  N  NE2   . GLN E 3 504 ? -7.404  95.834  26.535  1.00 88.40  ? 510  GLN A NE2   1 
ATOM   4436  N  N     . ILE E 3 505 ? -3.374  96.872  29.994  1.00 70.82  ? 511  ILE A N     1 
ATOM   4437  C  CA    . ILE E 3 505 ? -2.940  98.116  30.608  1.00 70.82  ? 511  ILE A CA    1 
ATOM   4438  C  C     . ILE E 3 505 ? -1.564  97.875  31.195  1.00 70.82  ? 511  ILE A C     1 
ATOM   4439  O  O     . ILE E 3 505 ? -0.687  98.732  31.117  1.00 70.82  ? 511  ILE A O     1 
ATOM   4440  C  CB    . ILE E 3 505 ? -3.927  98.568  31.713  1.00 127.34 ? 511  ILE A CB    1 
ATOM   4441  C  CG1   . ILE E 3 505 ? -5.265  98.938  31.067  1.00 127.34 ? 511  ILE A CG1   1 
ATOM   4442  C  CG2   . ILE E 3 505 ? -3.356  99.755  32.493  1.00 127.34 ? 511  ILE A CG2   1 
ATOM   4443  C  CD1   . ILE E 3 505 ? -6.331  99.342  32.046  1.00 127.34 ? 511  ILE A CD1   1 
ATOM   4444  N  N     . ALA E 3 506 ? -1.381  96.693  31.774  1.00 91.88  ? 512  ALA A N     1 
ATOM   4445  C  CA    . ALA E 3 506 ? -0.102  96.320  32.366  1.00 91.88  ? 512  ALA A CA    1 
ATOM   4446  C  C     . ALA E 3 506 ? 0.978   96.724  31.381  1.00 91.88  ? 512  ALA A C     1 
ATOM   4447  O  O     . ALA E 3 506 ? 1.770   97.633  31.642  1.00 91.88  ? 512  ALA A O     1 
ATOM   4448  C  CB    . ALA E 3 506 ? -0.052  94.813  32.614  1.00 145.88 ? 512  ALA A CB    1 
ATOM   4449  N  N     . ALA E 3 507 ? 0.999   96.041  30.244  1.00 106.64 ? 513  ALA A N     1 
ATOM   4450  C  CA    . ALA E 3 507 ? 1.961   96.358  29.207  1.00 106.64 ? 513  ALA A CA    1 
ATOM   4451  C  C     . ALA E 3 507 ? 1.322   97.463  28.371  1.00 106.64 ? 513  ALA A C     1 
ATOM   4452  O  O     . ALA E 3 507 ? 0.146   97.365  28.029  1.00 106.64 ? 513  ALA A O     1 
ATOM   4453  C  CB    . ALA E 3 507 ? 2.229   95.134  28.357  1.00 122.14 ? 513  ALA A CB    1 
ATOM   4454  N  N     . GLU E 3 508 ? 2.072   98.520  28.062  1.00 103.06 ? 514  GLU A N     1 
ATOM   4455  C  CA    . GLU E 3 508 ? 1.504   99.602  27.264  1.00 103.06 ? 514  GLU A CA    1 
ATOM   4456  C  C     . GLU E 3 508 ? 1.128   99.067  25.886  1.00 103.06 ? 514  GLU A C     1 
ATOM   4457  O  O     . GLU E 3 508 ? 1.920   99.106  24.940  1.00 103.06 ? 514  GLU A O     1 
ATOM   4458  C  CB    . GLU E 3 508 ? 2.479   100.780 27.146  1.00 122.18 ? 514  GLU A CB    1 
ATOM   4459  C  CG    . GLU E 3 508 ? 2.481   101.737 28.355  1.00 122.18 ? 514  GLU A CG    1 
ATOM   4460  C  CD    . GLU E 3 508 ? 1.242   102.638 28.441  1.00 122.18 ? 514  GLU A CD    1 
ATOM   4461  O  OE1   . GLU E 3 508 ? 0.980   103.405 27.487  1.00 122.18 ? 514  GLU A OE1   1 
ATOM   4462  O  OE2   . GLU E 3 508 ? 0.531   102.590 29.470  1.00 122.18 ? 514  GLU A OE2   1 
ATOM   4463  N  N     . LEU E 3 509 ? -0.097  98.557  25.788  1.00 82.13  ? 515  LEU A N     1 
ATOM   4464  C  CA    . LEU E 3 509 ? -0.590  97.994  24.537  1.00 82.13  ? 515  LEU A CA    1 
ATOM   4465  C  C     . LEU E 3 509 ? -1.850  98.695  24.062  1.00 82.13  ? 515  LEU A C     1 
ATOM   4466  O  O     . LEU E 3 509 ? -2.497  99.416  24.823  1.00 82.13  ? 515  LEU A O     1 
ATOM   4467  C  CB    . LEU E 3 509 ? -0.861  96.490  24.693  1.00 121.71 ? 515  LEU A CB    1 
ATOM   4468  N  N     . PRO E 3 510 ? -2.197  98.503  22.780  1.00 89.40  ? 516  PRO A N     1 
ATOM   4469  C  CA    . PRO E 3 510 ? -3.375  99.092  22.141  1.00 89.40  ? 516  PRO A CA    1 
ATOM   4470  C  C     . PRO E 3 510 ? -4.672  98.305  22.334  1.00 89.40  ? 516  PRO A C     1 
ATOM   4471  O  O     . PRO E 3 510 ? -5.555  98.736  23.073  1.00 89.40  ? 516  PRO A O     1 
ATOM   4472  C  CB    . PRO E 3 510 ? -2.961  99.168  20.679  1.00 114.60 ? 516  PRO A CB    1 
ATOM   4473  C  CG    . PRO E 3 510 ? -2.116  97.943  20.527  1.00 114.60 ? 516  PRO A CG    1 
ATOM   4474  C  CD    . PRO E 3 510 ? -1.260  97.990  21.763  1.00 114.60 ? 516  PRO A CD    1 
ATOM   4475  N  N     . THR E 3 511 ? -4.781  97.154  21.675  1.00 118.53 ? 517  THR A N     1 
ATOM   4476  C  CA    . THR E 3 511 ? -5.983  96.332  21.760  1.00 118.53 ? 517  THR A CA    1 
ATOM   4477  C  C     . THR E 3 511 ? -5.905  95.223  22.811  1.00 118.53 ? 517  THR A C     1 
ATOM   4478  O  O     . THR E 3 511 ? -4.815  94.725  23.126  1.00 118.53 ? 517  THR A O     1 
ATOM   4479  C  CB    . THR E 3 511 ? -6.309  95.704  20.382  1.00 131.27 ? 517  THR A CB    1 
ATOM   4480  O  OG1   . THR E 3 511 ? -7.501  94.913  20.473  1.00 131.27 ? 517  THR A OG1   1 
ATOM   4481  C  CG2   . THR E 3 511 ? -5.163  94.830  19.914  1.00 131.27 ? 517  THR A CG2   1 
ATOM   4482  N  N     . ARG E 3 512 ? -7.070  94.847  23.348  1.00 108.74 ? 518  ARG A N     1 
ATOM   4483  C  CA    . ARG E 3 512 ? -7.159  93.799  24.364  1.00 108.74 ? 518  ARG A CA    1 
ATOM   4484  C  C     . ARG E 3 512 ? -6.716  92.463  23.789  1.00 108.74 ? 518  ARG A C     1 
ATOM   4485  O  O     . ARG E 3 512 ? -5.830  91.809  24.341  1.00 108.74 ? 518  ARG A O     1 
ATOM   4486  C  CB    . ARG E 3 512 ? -8.587  93.672  24.907  1.00 88.96  ? 518  ARG A CB    1 
ATOM   4487  C  CG    . ARG E 3 512 ? -8.692  92.740  26.114  1.00 88.96  ? 518  ARG A CG    1 
ATOM   4488  C  CD    . ARG E 3 512 ? -10.138 92.405  26.490  1.00 88.96  ? 518  ARG A CD    1 
ATOM   4489  N  NE    . ARG E 3 512 ? -10.219 91.152  27.246  1.00 88.96  ? 518  ARG A NE    1 
ATOM   4490  C  CZ    . ARG E 3 512 ? -11.323 90.422  27.402  1.00 88.96  ? 518  ARG A CZ    1 
ATOM   4491  N  NH1   . ARG E 3 512 ? -12.471 90.812  26.861  1.00 88.96  ? 518  ARG A NH1   1 
ATOM   4492  N  NH2   . ARG E 3 512 ? -11.273 89.279  28.077  1.00 88.96  ? 518  ARG A NH2   1 
ATOM   4493  N  N     . ASP E 3 513 ? -7.330  92.065  22.677  1.00 92.91  ? 519  ASP A N     1 
ATOM   4494  C  CA    . ASP E 3 513 ? -6.992  90.805  22.013  1.00 92.91  ? 519  ASP A CA    1 
ATOM   4495  C  C     . ASP E 3 513 ? -5.483  90.659  21.814  1.00 92.91  ? 519  ASP A C     1 
ATOM   4496  O  O     . ASP E 3 513 ? -4.962  89.544  21.715  1.00 92.91  ? 519  ASP A O     1 
ATOM   4497  C  CB    . ASP E 3 513 ? -7.694  90.717  20.653  1.00 85.74  ? 519  ASP A CB    1 
ATOM   4498  N  N     . ASN E 3 514 ? -4.787  91.790  21.742  1.00 115.09 ? 520  ASN A N     1 
ATOM   4499  C  CA    . ASN E 3 514 ? -3.338  91.777  21.572  1.00 115.09 ? 520  ASN A CA    1 
ATOM   4500  C  C     . ASN E 3 514 ? -2.750  91.287  22.880  1.00 115.09 ? 520  ASN A C     1 
ATOM   4501  O  O     . ASN E 3 514 ? -1.850  90.449  22.902  1.00 115.09 ? 520  ASN A O     1 
ATOM   4502  C  CB    . ASN E 3 514 ? -2.801  93.180  21.273  1.00 91.92  ? 520  ASN A CB    1 
ATOM   4503  N  N     . ALA E 3 515 ? -3.275  91.822  23.976  1.00 129.27 ? 521  ALA A N     1 
ATOM   4504  C  CA    . ALA E 3 515 ? -2.818  91.444  25.302  1.00 129.27 ? 521  ALA A CA    1 
ATOM   4505  C  C     . ALA E 3 515 ? -3.081  89.960  25.559  1.00 129.27 ? 521  ALA A C     1 
ATOM   4506  O  O     . ALA E 3 515 ? -2.293  89.296  26.235  1.00 129.27 ? 521  ALA A O     1 
ATOM   4507  C  CB    . ALA E 3 515 ? -3.520  92.291  26.346  1.00 109.88 ? 521  ALA A CB    1 
ATOM   4508  N  N     . LYS E 3 516 ? -4.186  89.446  25.015  1.00 83.58  ? 522  LYS A N     1 
ATOM   4509  C  CA    . LYS E 3 516 ? -4.554  88.035  25.176  1.00 83.58  ? 522  LYS A CA    1 
ATOM   4510  C  C     . LYS E 3 516 ? -3.489  87.134  24.544  1.00 83.58  ? 522  LYS A C     1 
ATOM   4511  O  O     . LYS E 3 516 ? -3.318  85.971  24.920  1.00 83.58  ? 522  LYS A O     1 
ATOM   4512  C  CB    . LYS E 3 516 ? -5.919  87.764  24.525  1.00 83.92  ? 522  LYS A CB    1 
ATOM   4513  N  N     . THR E 3 517 ? -2.779  87.690  23.571  1.00 90.38  ? 523  THR A N     1 
ATOM   4514  C  CA    . THR E 3 517 ? -1.717  86.978  22.880  1.00 90.38  ? 523  THR A CA    1 
ATOM   4515  C  C     . THR E 3 517 ? -0.428  87.205  23.658  1.00 90.38  ? 523  THR A C     1 
ATOM   4516  O  O     . THR E 3 517 ? 0.267   86.260  24.024  1.00 90.38  ? 523  THR A O     1 
ATOM   4517  C  CB    . THR E 3 517 ? -1.550  87.516  21.443  1.00 109.85 ? 523  THR A CB    1 
ATOM   4518  O  OG1   . THR E 3 517 ? -2.702  87.157  20.666  1.00 109.85 ? 523  THR A OG1   1 
ATOM   4519  C  CG2   . THR E 3 517 ? -0.291  86.955  20.791  1.00 109.85 ? 523  THR A CG2   1 
ATOM   4520  N  N     . PHE E 3 518 ? -0.129  88.471  23.919  1.00 96.35  ? 524  PHE A N     1 
ATOM   4521  C  CA    . PHE E 3 518 ? 1.069   88.852  24.651  1.00 96.35  ? 524  PHE A CA    1 
ATOM   4522  C  C     . PHE E 3 518 ? 1.307   88.002  25.887  1.00 96.35  ? 524  PHE A C     1 
ATOM   4523  O  O     . PHE E 3 518 ? 2.425   87.543  26.141  1.00 96.35  ? 524  PHE A O     1 
ATOM   4524  C  CB    . PHE E 3 518 ? 0.981   90.317  25.085  1.00 81.81  ? 524  PHE A CB    1 
ATOM   4525  C  CG    . PHE E 3 518 ? 2.161   90.784  25.907  1.00 81.81  ? 524  PHE A CG    1 
ATOM   4526  C  CD1   . PHE E 3 518 ? 3.467   90.497  25.513  1.00 81.81  ? 524  PHE A CD1   1 
ATOM   4527  C  CD2   . PHE E 3 518 ? 1.971   91.555  27.045  1.00 81.81  ? 524  PHE A CD2   1 
ATOM   4528  C  CE1   . PHE E 3 518 ? 4.565   90.977  26.238  1.00 81.81  ? 524  PHE A CE1   1 
ATOM   4529  C  CE2   . PHE E 3 518 ? 3.059   92.038  27.775  1.00 81.81  ? 524  PHE A CE2   1 
ATOM   4530  C  CZ    . PHE E 3 518 ? 4.355   91.749  27.369  1.00 81.81  ? 524  PHE A CZ    1 
ATOM   4531  N  N     . ILE E 3 519 ? 0.253   87.802  26.665  1.00 71.25  ? 525  ILE A N     1 
ATOM   4532  C  CA    . ILE E 3 519 ? 0.369   87.024  27.892  1.00 71.25  ? 525  ILE A CA    1 
ATOM   4533  C  C     . ILE E 3 519 ? 0.501   85.517  27.641  1.00 71.25  ? 525  ILE A C     1 
ATOM   4534  O  O     . ILE E 3 519 ? 1.562   84.936  27.894  1.00 71.25  ? 525  ILE A O     1 
ATOM   4535  C  CB    . ILE E 3 519 ? -0.839  87.311  28.857  1.00 58.86  ? 525  ILE A CB    1 
ATOM   4536  C  CG1   . ILE E 3 519 ? -0.430  87.026  30.291  1.00 58.86  ? 525  ILE A CG1   1 
ATOM   4537  C  CG2   . ILE E 3 519 ? -2.061  86.466  28.504  1.00 58.86  ? 525  ILE A CG2   1 
ATOM   4538  C  CD1   . ILE E 3 519 ? 0.428   88.113  30.887  1.00 58.86  ? 525  ILE A CD1   1 
ATOM   4539  N  N     . TYR E 3 520 ? -0.563  84.900  27.124  1.00 90.30  ? 526  TYR A N     1 
ATOM   4540  C  CA    . TYR E 3 520 ? -0.585  83.465  26.876  1.00 90.30  ? 526  TYR A CA    1 
ATOM   4541  C  C     . TYR E 3 520 ? 0.590   83.018  26.026  1.00 90.30  ? 526  TYR A C     1 
ATOM   4542  O  O     . TYR E 3 520 ? 0.712   81.841  25.681  1.00 90.30  ? 526  TYR A O     1 
ATOM   4543  C  CB    . TYR E 3 520 ? -1.907  83.055  26.223  1.00 59.94  ? 526  TYR A CB    1 
ATOM   4544  N  N     . GLY E 3 521 ? 1.459   83.967  25.700  1.00 65.59  ? 527  GLY A N     1 
ATOM   4545  C  CA    . GLY E 3 521 ? 2.633   83.654  24.912  1.00 65.59  ? 527  GLY A CA    1 
ATOM   4546  C  C     . GLY E 3 521 ? 3.867   84.231  25.576  1.00 65.59  ? 527  GLY A C     1 
ATOM   4547  O  O     . GLY E 3 521 ? 4.511   85.124  25.027  1.00 65.59  ? 527  GLY A O     1 
ATOM   4548  N  N     . PHE E 3 522 ? 4.203   83.725  26.761  1.00 117.10 ? 528  PHE A N     1 
ATOM   4549  C  CA    . PHE E 3 522 ? 5.367   84.222  27.487  1.00 117.10 ? 528  PHE A CA    1 
ATOM   4550  C  C     . PHE E 3 522 ? 5.471   83.616  28.895  1.00 117.10 ? 528  PHE A C     1 
ATOM   4551  O  O     . PHE E 3 522 ? 6.413   82.816  29.116  1.00 117.10 ? 528  PHE A O     1 
ATOM   4552  C  CB    . PHE E 3 522 ? 5.296   85.766  27.498  1.00 86.18  ? 528  PHE A CB    1 
ATOM   4553  C  CG    . PHE E 3 522 ? 5.609   86.400  28.811  1.00 86.18  ? 528  PHE A CG    1 
ATOM   4554  C  CD1   . PHE E 3 522 ? 6.760   87.162  28.963  1.00 86.18  ? 528  PHE A CD1   1 
ATOM   4555  C  CD2   . PHE E 3 522 ? 4.727   86.284  29.887  1.00 86.18  ? 528  PHE A CD2   1 
ATOM   4556  C  CE1   . PHE E 3 522 ? 7.032   87.812  30.176  1.00 86.18  ? 528  PHE A CE1   1 
ATOM   4557  C  CE2   . PHE E 3 522 ? 4.983   86.923  31.103  1.00 86.18  ? 528  PHE A CE2   1 
ATOM   4558  C  CZ    . PHE E 3 522 ? 6.137   87.690  31.250  1.00 86.18  ? 528  PHE A CZ    1 
ATOM   4559  N  N     . LYS E 3 530 ? 9.604   87.371  18.713  1.00 68.31  ? 536  LYS A N     1 
ATOM   4560  C  CA    . LYS E 3 530 ? 8.230   87.108  18.194  1.00 68.31  ? 536  LYS A CA    1 
ATOM   4561  C  C     . LYS E 3 530 ? 7.206   87.964  18.933  1.00 68.31  ? 536  LYS A C     1 
ATOM   4562  O  O     . LYS E 3 530 ? 6.015   87.944  18.612  1.00 68.31  ? 536  LYS A O     1 
ATOM   4563  C  CB    . LYS E 3 530 ? 7.872   85.627  18.360  1.00 59.28  ? 536  LYS A CB    1 
ATOM   4564  N  N     . ILE E 3 531 ? 7.675   88.714  19.927  1.00 85.11  ? 537  ILE A N     1 
ATOM   4565  C  CA    . ILE E 3 531 ? 6.794   89.577  20.714  1.00 85.11  ? 537  ILE A CA    1 
ATOM   4566  C  C     . ILE E 3 531 ? 6.563   90.891  19.989  1.00 85.11  ? 537  ILE A C     1 
ATOM   4567  O  O     . ILE E 3 531 ? 5.433   91.223  19.628  1.00 85.11  ? 537  ILE A O     1 
ATOM   4568  C  CB    . ILE E 3 531 ? 7.391   89.896  22.103  1.00 93.47  ? 537  ILE A CB    1 
ATOM   4569  N  N     . GLY E 3 532 ? 7.644   91.638  19.786  1.00 117.80 ? 538  GLY A N     1 
ATOM   4570  C  CA    . GLY E 3 532 ? 7.541   92.906  19.092  1.00 117.80 ? 538  GLY A CA    1 
ATOM   4571  C  C     . GLY E 3 532 ? 6.708   92.724  17.844  1.00 117.80 ? 538  GLY A C     1 
ATOM   4572  O  O     . GLY E 3 532 ? 5.755   93.464  17.610  1.00 117.80 ? 538  GLY A O     1 
ATOM   4573  N  N     . GLN E 3 533 ? 7.064   91.722  17.047  1.00 78.04  ? 539  GLN A N     1 
ATOM   4574  C  CA    . GLN E 3 533 ? 6.336   91.436  15.825  1.00 78.04  ? 539  GLN A CA    1 
ATOM   4575  C  C     . GLN E 3 533 ? 4.837   91.397  16.135  1.00 78.04  ? 539  GLN A C     1 
ATOM   4576  O  O     . GLN E 3 533 ? 4.052   92.114  15.514  1.00 78.04  ? 539  GLN A O     1 
ATOM   4577  C  CB    . GLN E 3 533 ? 6.800   90.092  15.225  1.00 29.04  ? 539  GLN A CB    1 
ATOM   4578  N  N     . ILE E 3 534 ? 4.455   90.576  17.113  1.00 132.08 ? 540  ILE A N     1 
ATOM   4579  C  CA    . ILE E 3 534 ? 3.055   90.419  17.511  1.00 132.08 ? 540  ILE A CA    1 
ATOM   4580  C  C     . ILE E 3 534 ? 2.318   91.736  17.764  1.00 132.08 ? 540  ILE A C     1 
ATOM   4581  O  O     . ILE E 3 534 ? 1.084   91.766  17.799  1.00 132.08 ? 540  ILE A O     1 
ATOM   4582  C  CB    . ILE E 3 534 ? 2.937   89.542  18.775  1.00 119.20 ? 540  ILE A CB    1 
ATOM   4583  N  N     . VAL E 3 535 ? 3.072   92.818  17.939  1.00 119.19 ? 541  VAL A N     1 
ATOM   4584  C  CA    . VAL E 3 535 ? 2.480   94.135  18.176  1.00 119.19 ? 541  VAL A CA    1 
ATOM   4585  C  C     . VAL E 3 535 ? 2.636   95.051  16.964  1.00 119.19 ? 541  VAL A C     1 
ATOM   4586  O  O     . VAL E 3 535 ? 1.856   95.984  16.774  1.00 119.19 ? 541  VAL A O     1 
ATOM   4587  C  CB    . VAL E 3 535 ? 3.122   94.831  19.390  1.00 125.31 ? 541  VAL A CB    1 
ATOM   4588  N  N     . GLY E 3 536 ? 3.647   94.776  16.147  1.00 169.31 ? 542  GLY A N     1 
ATOM   4589  C  CA    . GLY E 3 536 ? 3.892   95.580  14.964  1.00 169.31 ? 542  GLY A CA    1 
ATOM   4590  C  C     . GLY E 3 536 ? 5.358   95.556  14.581  1.00 169.31 ? 542  GLY A C     1 
ATOM   4591  O  O     . GLY E 3 536 ? 5.722   95.048  13.518  1.00 169.31 ? 542  GLY A O     1 
ATOM   4592  N  N     . ALA E 3 537 ? 6.196   96.100  15.462  1.00 145.74 ? 543  ALA A N     1 
ATOM   4593  C  CA    . ALA E 3 537 ? 7.642   96.164  15.255  1.00 145.74 ? 543  ALA A CA    1 
ATOM   4594  C  C     . ALA E 3 537 ? 8.299   94.785  15.114  1.00 145.74 ? 543  ALA A C     1 
ATOM   4595  O  O     . ALA E 3 537 ? 7.745   93.877  14.486  1.00 145.74 ? 543  ALA A O     1 
ATOM   4596  C  CB    . ALA E 3 537 ? 8.285   96.936  16.409  1.00 70.45  ? 543  ALA A CB    1 
ATOM   4597  N  N     . GLY E 3 538 ? 9.484   94.631  15.699  1.00 124.30 ? 544  GLY A N     1 
ATOM   4598  C  CA    . GLY E 3 538 ? 10.175  93.358  15.606  1.00 124.30 ? 544  GLY A CA    1 
ATOM   4599  C  C     . GLY E 3 538 ? 11.264  93.103  16.638  1.00 124.30 ? 544  GLY A C     1 
ATOM   4600  O  O     . GLY E 3 538 ? 11.805  91.991  16.703  1.00 124.30 ? 544  GLY A O     1 
ATOM   4601  N  N     . LYS E 3 539 ? 11.596  94.111  17.444  1.00 95.65  ? 545  LYS A N     1 
ATOM   4602  C  CA    . LYS E 3 539 ? 12.631  93.941  18.461  1.00 95.65  ? 545  LYS A CA    1 
ATOM   4603  C  C     . LYS E 3 539 ? 12.496  94.906  19.627  1.00 95.65  ? 545  LYS A C     1 
ATOM   4604  O  O     . LYS E 3 539 ? 12.038  94.516  20.692  1.00 95.65  ? 545  LYS A O     1 
ATOM   4605  C  CB    . LYS E 3 539 ? 14.020  94.092  17.837  1.00 88.80  ? 545  LYS A CB    1 
ATOM   4606  N  N     . GLU E 3 540 ? 12.891  96.159  19.421  1.00 136.14 ? 546  GLU A N     1 
ATOM   4607  C  CA    . GLU E 3 540 ? 12.831  97.176  20.469  1.00 136.14 ? 546  GLU A CA    1 
ATOM   4608  C  C     . GLU E 3 540 ? 11.498  97.243  21.213  1.00 136.14 ? 546  GLU A C     1 
ATOM   4609  O  O     . GLU E 3 540 ? 11.463  97.047  22.428  1.00 136.14 ? 546  GLU A O     1 
ATOM   4610  C  CB    . GLU E 3 540 ? 13.164  98.554  19.888  1.00 46.74  ? 546  GLU A CB    1 
ATOM   4611  N  N     . ARG E 3 541 ? 10.407  97.519  20.501  1.00 137.41 ? 547  ARG A N     1 
ATOM   4612  C  CA    . ARG E 3 541 ? 9.101   97.606  21.154  1.00 137.41 ? 547  ARG A CA    1 
ATOM   4613  C  C     . ARG E 3 541 ? 8.758   96.295  21.867  1.00 137.41 ? 547  ARG A C     1 
ATOM   4614  O  O     . ARG E 3 541 ? 8.117   96.306  22.918  1.00 137.41 ? 547  ARG A O     1 
ATOM   4615  C  CB    . ARG E 3 541 ? 8.008   97.982  20.147  1.00 71.30  ? 547  ARG A CB    1 
ATOM   4616  N  N     . GLY E 3 542 ? 9.189   95.169  21.302  1.00 109.94 ? 548  GLY A N     1 
ATOM   4617  C  CA    . GLY E 3 542 ? 8.940   93.893  21.945  1.00 109.94 ? 548  GLY A CA    1 
ATOM   4618  C  C     . GLY E 3 542 ? 9.731   93.857  23.242  1.00 109.94 ? 548  GLY A C     1 
ATOM   4619  O  O     . GLY E 3 542 ? 9.166   93.654  24.319  1.00 109.94 ? 548  GLY A O     1 
ATOM   4620  N  N     . LYS E 3 543 ? 11.043  94.076  23.131  1.00 99.36  ? 549  LYS A N     1 
ATOM   4621  C  CA    . LYS E 3 543 ? 11.958  94.085  24.277  1.00 99.36  ? 549  LYS A CA    1 
ATOM   4622  C  C     . LYS E 3 543 ? 11.871  95.403  25.036  1.00 99.36  ? 549  LYS A C     1 
ATOM   4623  O  O     . LYS E 3 543 ? 12.876  95.931  25.518  1.00 99.36  ? 549  LYS A O     1 
ATOM   4624  C  CB    . LYS E 3 543 ? 13.402  93.860  23.813  1.00 87.32  ? 549  LYS A CB    1 
ATOM   4625  N  N     . GLU E 3 544 ? 10.653  95.926  25.118  1.00 91.21  ? 550  GLU A N     1 
ATOM   4626  C  CA    . GLU E 3 544 ? 10.364  97.171  25.821  1.00 91.21  ? 550  GLU A CA    1 
ATOM   4627  C  C     . GLU E 3 544 ? 9.037   96.943  26.525  1.00 91.21  ? 550  GLU A C     1 
ATOM   4628  O  O     . GLU E 3 544 ? 8.788   97.477  27.606  1.00 91.21  ? 550  GLU A O     1 
ATOM   4629  C  CB    . GLU E 3 544 ? 10.240  98.335  24.831  1.00 105.04 ? 550  GLU A CB    1 
ATOM   4630  N  N     . LEU E 3 545 ? 8.194   96.133  25.893  1.00 117.66 ? 551  LEU A N     1 
ATOM   4631  C  CA    . LEU E 3 545 ? 6.893   95.797  26.443  1.00 117.66 ? 551  LEU A CA    1 
ATOM   4632  C  C     . LEU E 3 545 ? 7.098   94.914  27.664  1.00 117.66 ? 551  LEU A C     1 
ATOM   4633  O  O     . LEU E 3 545 ? 6.529   95.164  28.724  1.00 117.66 ? 551  LEU A O     1 
ATOM   4634  C  CB    . LEU E 3 545 ? 6.046   95.063  25.401  1.00 96.16  ? 551  LEU A CB    1 
ATOM   4635  C  CG    . LEU E 3 545 ? 5.578   95.883  24.200  1.00 96.16  ? 551  LEU A CG    1 
ATOM   4636  C  CD1   . LEU E 3 545 ? 4.707   95.008  23.320  1.00 96.16  ? 551  LEU A CD1   1 
ATOM   4637  C  CD2   . LEU E 3 545 ? 4.804   97.106  24.675  1.00 96.16  ? 551  LEU A CD2   1 
ATOM   4638  N  N     . LYS E 3 546 ? 7.918   93.881  27.507  1.00 113.88 ? 552  LYS A N     1 
ATOM   4639  C  CA    . LYS E 3 546 ? 8.206   92.980  28.610  1.00 113.88 ? 552  LYS A CA    1 
ATOM   4640  C  C     . LYS E 3 546 ? 8.623   93.848  29.790  1.00 113.88 ? 552  LYS A C     1 
ATOM   4641  O  O     . LYS E 3 546 ? 8.375   93.509  30.944  1.00 113.88 ? 552  LYS A O     1 
ATOM   4642  C  CB    . LYS E 3 546 ? 9.334   92.016  28.230  1.00 67.44  ? 552  LYS A CB    1 
ATOM   4643  N  N     . LYS E 3 547 ? 9.244   94.983  29.484  1.00 110.16 ? 553  LYS A N     1 
ATOM   4644  C  CA    . LYS E 3 547 ? 9.692   95.914  30.511  1.00 110.16 ? 553  LYS A CA    1 
ATOM   4645  C  C     . LYS E 3 547 ? 8.502   96.552  31.207  1.00 110.16 ? 553  LYS A C     1 
ATOM   4646  O  O     . LYS E 3 547 ? 8.314   96.365  32.404  1.00 110.16 ? 553  LYS A O     1 
ATOM   4647  C  CB    . LYS E 3 547 ? 10.570  97.011  29.900  1.00 97.45  ? 553  LYS A CB    1 
ATOM   4648  N  N     . LYS E 3 548 ? 7.699   97.294  30.450  1.00 79.77  ? 554  LYS A N     1 
ATOM   4649  C  CA    . LYS E 3 548 ? 6.526   97.977  31.003  1.00 79.77  ? 554  LYS A CA    1 
ATOM   4650  C  C     . LYS E 3 548 ? 5.539   97.003  31.618  1.00 79.77  ? 554  LYS A C     1 
ATOM   4651  O  O     . LYS E 3 548 ? 4.822   97.352  32.550  1.00 79.77  ? 554  LYS A O     1 
ATOM   4652  C  CB    . LYS E 3 548 ? 5.815   98.808  29.927  1.00 79.03  ? 554  LYS A CB    1 
ATOM   4653  N  N     . PHE E 3 549 ? 5.505   95.783  31.094  1.00 108.21 ? 555  PHE A N     1 
ATOM   4654  C  CA    . PHE E 3 549 ? 4.606   94.756  31.607  1.00 108.21 ? 555  PHE A CA    1 
ATOM   4655  C  C     . PHE E 3 549 ? 5.143   94.177  32.906  1.00 108.21 ? 555  PHE A C     1 
ATOM   4656  O  O     . PHE E 3 549 ? 4.422   94.066  33.888  1.00 108.21 ? 555  PHE A O     1 
ATOM   4657  C  CB    . PHE E 3 549 ? 4.448   93.630  30.595  1.00 144.98 ? 555  PHE A CB    1 
ATOM   4658  C  CG    . PHE E 3 549 ? 3.706   92.456  31.133  1.00 144.98 ? 555  PHE A CG    1 
ATOM   4659  C  CD1   . PHE E 3 549 ? 2.352   92.556  31.428  1.00 144.98 ? 555  PHE A CD1   1 
ATOM   4660  C  CD2   . PHE E 3 549 ? 4.368   91.263  31.384  1.00 144.98 ? 555  PHE A CD2   1 
ATOM   4661  C  CE1   . PHE E 3 549 ? 1.665   91.483  31.968  1.00 144.98 ? 555  PHE A CE1   1 
ATOM   4662  C  CE2   . PHE E 3 549 ? 3.692   90.184  31.923  1.00 144.98 ? 555  PHE A CE2   1 
ATOM   4663  C  CZ    . PHE E 3 549 ? 2.336   90.294  32.218  1.00 144.98 ? 555  PHE A CZ    1 
ATOM   4664  N  N     . LEU E 3 550 ? 6.411   93.786  32.890  1.00 84.97  ? 556  LEU A N     1 
ATOM   4665  C  CA    . LEU E 3 550 ? 7.048   93.242  34.076  1.00 84.97  ? 556  LEU A CA    1 
ATOM   4666  C  C     . LEU E 3 550 ? 7.562   94.417  34.926  1.00 84.97  ? 556  LEU A C     1 
ATOM   4667  O  O     . LEU E 3 550 ? 8.575   94.316  35.627  1.00 84.97  ? 556  LEU A O     1 
ATOM   4668  C  CB    . LEU E 3 550 ? 8.194   92.303  33.676  1.00 58.56  ? 556  LEU A CB    1 
ATOM   4669  N  N     . GLU E 3 551 ? 6.847   95.538  34.841  1.00 95.99  ? 557  GLU A N     1 
ATOM   4670  C  CA    . GLU E 3 551 ? 7.179   96.746  35.599  1.00 95.99  ? 557  GLU A CA    1 
ATOM   4671  C  C     . GLU E 3 551 ? 5.923   97.243  36.305  1.00 95.99  ? 557  GLU A C     1 
ATOM   4672  O  O     . GLU E 3 551 ? 5.983   97.671  37.456  1.00 95.99  ? 557  GLU A O     1 
ATOM   4673  C  CB    . GLU E 3 551 ? 7.714   97.851  34.684  1.00 78.41  ? 557  GLU A CB    1 
ATOM   4674  N  N     . ASN E 3 552 ? 4.788   97.193  35.608  1.00 140.43 ? 558  ASN A N     1 
ATOM   4675  C  CA    . ASN E 3 552 ? 3.511   97.616  36.187  1.00 140.43 ? 558  ASN A CA    1 
ATOM   4676  C  C     . ASN E 3 552 ? 2.814   96.399  36.814  1.00 140.43 ? 558  ASN A C     1 
ATOM   4677  O  O     . ASN E 3 552 ? 1.688   96.489  37.301  1.00 140.43 ? 558  ASN A O     1 
ATOM   4678  C  CB    . ASN E 3 552 ? 2.615   98.269  35.119  1.00 45.62  ? 558  ASN A CB    1 
ATOM   4679  N  N     . THR E 3 553 ? 3.501   95.260  36.779  1.00 136.28 ? 559  THR A N     1 
ATOM   4680  C  CA    . THR E 3 553 ? 3.017   94.010  37.370  1.00 136.28 ? 559  THR A CA    1 
ATOM   4681  C  C     . THR E 3 553 ? 4.263   93.373  37.989  1.00 136.28 ? 559  THR A C     1 
ATOM   4682  O  O     . THR E 3 553 ? 4.843   92.427  37.444  1.00 136.28 ? 559  THR A O     1 
ATOM   4683  C  CB    . THR E 3 553 ? 2.397   93.056  36.320  1.00 53.24  ? 559  THR A CB    1 
ATOM   4684  N  N     . PRO E 3 554 ? 4.690   93.901  39.150  1.00 91.69  ? 560  PRO A N     1 
ATOM   4685  C  CA    . PRO E 3 554 ? 5.868   93.443  39.897  1.00 91.69  ? 560  PRO A CA    1 
ATOM   4686  C  C     . PRO E 3 554 ? 5.720   92.040  40.460  1.00 91.69  ? 560  PRO A C     1 
ATOM   4687  O  O     . PRO E 3 554 ? 6.706   91.405  40.813  1.00 91.69  ? 560  PRO A O     1 
ATOM   4688  C  CB    . PRO E 3 554 ? 6.006   94.494  40.987  1.00 86.01  ? 560  PRO A CB    1 
ATOM   4689  C  CG    . PRO E 3 554 ? 4.561   94.795  41.308  1.00 86.01  ? 560  PRO A CG    1 
ATOM   4690  C  CD    . PRO E 3 554 ? 3.921   94.889  39.938  1.00 86.01  ? 560  PRO A CD    1 
ATOM   4691  N  N     . ALA E 3 555 ? 4.480   91.565  40.540  1.00 107.77 ? 561  ALA A N     1 
ATOM   4692  C  CA    . ALA E 3 555 ? 4.195   90.229  41.049  1.00 107.77 ? 561  ALA A CA    1 
ATOM   4693  C  C     . ALA E 3 555 ? 4.844   89.140  40.175  1.00 107.77 ? 561  ALA A C     1 
ATOM   4694  O  O     . ALA E 3 555 ? 5.512   88.244  40.701  1.00 107.77 ? 561  ALA A O     1 
ATOM   4695  C  CB    . ALA E 3 555 ? 2.685   90.026  41.127  1.00 76.80  ? 561  ALA A CB    1 
ATOM   4696  N  N     . ILE E 3 556 ? 4.650   89.214  38.853  1.00 63.28  ? 562  ILE A N     1 
ATOM   4697  C  CA    . ILE E 3 556 ? 5.242   88.227  37.943  1.00 63.28  ? 562  ILE A CA    1 
ATOM   4698  C  C     . ILE E 3 556 ? 6.742   88.408  38.017  1.00 63.28  ? 562  ILE A C     1 
ATOM   4699  O  O     . ILE E 3 556 ? 7.522   87.472  37.799  1.00 63.28  ? 562  ILE A O     1 
ATOM   4700  C  CB    . ILE E 3 556 ? 4.821   88.427  36.466  1.00 48.13  ? 562  ILE A CB    1 
ATOM   4701  C  CG1   . ILE E 3 556 ? 3.297   88.390  36.319  1.00 48.13  ? 562  ILE A CG1   1 
ATOM   4702  C  CG2   . ILE E 3 556 ? 5.423   87.334  35.614  1.00 48.13  ? 562  ILE A CG2   1 
ATOM   4703  C  CD1   . ILE E 3 556 ? 2.611   89.702  36.671  1.00 48.13  ? 562  ILE A CD1   1 
ATOM   4704  N  N     . ALA E 3 557 ? 7.127   89.640  38.323  1.00 72.39  ? 563  ALA A N     1 
ATOM   4705  C  CA    . ALA E 3 557 ? 8.524   90.006  38.450  1.00 72.39  ? 563  ALA A CA    1 
ATOM   4706  C  C     . ALA E 3 557 ? 9.039   89.391  39.741  1.00 72.39  ? 563  ALA A C     1 
ATOM   4707  O  O     . ALA E 3 557 ? 10.187  88.934  39.825  1.00 72.39  ? 563  ALA A O     1 
ATOM   4708  C  CB    . ALA E 3 557 ? 8.652   91.527  38.495  1.00 84.79  ? 563  ALA A CB    1 
ATOM   4709  N  N     . ALA E 3 558 ? 8.164   89.382  40.742  1.00 76.15  ? 564  ALA A N     1 
ATOM   4710  C  CA    . ALA E 3 558 ? 8.473   88.840  42.059  1.00 76.15  ? 564  ALA A CA    1 
ATOM   4711  C  C     . ALA E 3 558 ? 8.712   87.344  41.937  1.00 76.15  ? 564  ALA A C     1 
ATOM   4712  O  O     . ALA E 3 558 ? 9.746   86.817  42.372  1.00 76.15  ? 564  ALA A O     1 
ATOM   4713  C  CB    . ALA E 3 558 ? 7.311   89.105  43.000  1.00 97.75  ? 564  ALA A CB    1 
ATOM   4714  N  N     . LEU E 3 559 ? 7.728   86.670  41.350  1.00 68.99  ? 565  LEU A N     1 
ATOM   4715  C  CA    . LEU E 3 559 ? 7.786   85.234  41.113  1.00 68.99  ? 565  LEU A CA    1 
ATOM   4716  C  C     . LEU E 3 559 ? 9.128   84.889  40.481  1.00 68.99  ? 565  LEU A C     1 
ATOM   4717  O  O     . LEU E 3 559 ? 9.965   84.214  41.082  1.00 68.99  ? 565  LEU A O     1 
ATOM   4718  C  CB    . LEU E 3 559 ? 6.685   84.848  40.142  1.00 62.67  ? 565  LEU A CB    1 
ATOM   4719  C  CG    . LEU E 3 559 ? 5.701   83.809  40.620  1.00 62.67  ? 565  LEU A CG    1 
ATOM   4720  C  CD1   . LEU E 3 559 ? 5.197   84.227  41.987  1.00 62.67  ? 565  LEU A CD1   1 
ATOM   4721  C  CD2   . LEU E 3 559 ? 4.576   83.678  39.601  1.00 62.67  ? 565  LEU A CD2   1 
ATOM   4722  N  N     . ARG E 3 560 ? 9.304   85.372  39.251  1.00 75.66  ? 566  ARG A N     1 
ATOM   4723  C  CA    . ARG E 3 560 ? 10.512  85.164  38.464  1.00 75.66  ? 566  ARG A CA    1 
ATOM   4724  C  C     . ARG E 3 560 ? 11.797  85.220  39.287  1.00 75.66  ? 566  ARG A C     1 
ATOM   4725  O  O     . ARG E 3 560 ? 12.674  84.357  39.165  1.00 75.66  ? 566  ARG A O     1 
ATOM   4726  C  CB    . ARG E 3 560 ? 10.592  86.220  37.365  1.00 101.09 ? 566  ARG A CB    1 
ATOM   4727  C  CG    . ARG E 3 560 ? 9.636   86.020  36.212  1.00 101.09 ? 566  ARG A CG    1 
ATOM   4728  C  CD    . ARG E 3 560 ? 10.001  86.956  35.059  1.00 101.09 ? 566  ARG A CD    1 
ATOM   4729  N  NE    . ARG E 3 560 ? 11.438  86.936  34.764  1.00 101.09 ? 566  ARG A NE    1 
ATOM   4730  C  CZ    . ARG E 3 560 ? 12.112  85.860  34.360  1.00 101.09 ? 566  ARG A CZ    1 
ATOM   4731  N  NH1   . ARG E 3 560 ? 11.479  84.703  34.192  1.00 101.09 ? 566  ARG A NH1   1 
ATOM   4732  N  NH2   . ARG E 3 560 ? 13.423  85.935  34.138  1.00 101.09 ? 566  ARG A NH2   1 
ATOM   4733  N  N     . GLU E 3 561 ? 11.902  86.257  40.109  1.00 101.94 ? 567  GLU A N     1 
ATOM   4734  C  CA    . GLU E 3 561 ? 13.071  86.474  40.946  1.00 101.94 ? 567  GLU A CA    1 
ATOM   4735  C  C     . GLU E 3 561 ? 13.217  85.402  42.019  1.00 101.94 ? 567  GLU A C     1 
ATOM   4736  O  O     . GLU E 3 561 ? 14.294  84.828  42.198  1.00 101.94 ? 567  GLU A O     1 
ATOM   4737  C  CB    . GLU E 3 561 ? 12.973  87.857  41.595  1.00 69.01  ? 567  GLU A CB    1 
ATOM   4738  N  N     . SER E 3 562 ? 12.124  85.136  42.728  1.00 111.43 ? 568  SER A N     1 
ATOM   4739  C  CA    . SER E 3 562 ? 12.118  84.141  43.795  1.00 111.43 ? 568  SER A CA    1 
ATOM   4740  C  C     . SER E 3 562 ? 12.592  82.763  43.320  1.00 111.43 ? 568  SER A C     1 
ATOM   4741  O  O     . SER E 3 562 ? 13.210  82.023  44.086  1.00 111.43 ? 568  SER A O     1 
ATOM   4742  C  CB    . SER E 3 562 ? 10.712  84.038  44.412  1.00 85.07  ? 568  SER A CB    1 
ATOM   4743  N  N     . ILE E 3 563 ? 12.309  82.422  42.062  1.00 88.65  ? 569  ILE A N     1 
ATOM   4744  C  CA    . ILE E 3 563 ? 12.730  81.127  41.524  1.00 88.65  ? 569  ILE A CA    1 
ATOM   4745  C  C     . ILE E 3 563 ? 14.218  81.111  41.214  1.00 88.65  ? 569  ILE A C     1 
ATOM   4746  O  O     . ILE E 3 563 ? 14.954  80.243  41.684  1.00 88.65  ? 569  ILE A O     1 
ATOM   4747  C  CB    . ILE E 3 563 ? 11.974  80.737  40.235  1.00 68.33  ? 569  ILE A CB    1 
ATOM   4748  C  CG1   . ILE E 3 563 ? 10.503  80.464  40.550  1.00 68.33  ? 569  ILE A CG1   1 
ATOM   4749  C  CG2   . ILE E 3 563 ? 12.621  79.497  39.615  1.00 68.33  ? 569  ILE A CG2   1 
ATOM   4750  C  CD1   . ILE E 3 563 ? 9.696   79.979  39.368  1.00 68.33  ? 569  ILE A CD1   1 
ATOM   4751  N  N     . GLN E 3 564 ? 14.657  82.060  40.401  1.00 99.97  ? 570  GLN A N     1 
ATOM   4752  C  CA    . GLN E 3 564 ? 16.062  82.149  40.062  1.00 99.97  ? 570  GLN A CA    1 
ATOM   4753  C  C     . GLN E 3 564 ? 16.840  81.978  41.371  1.00 99.97  ? 570  GLN A C     1 
ATOM   4754  O  O     . GLN E 3 564 ? 17.893  81.329  41.416  1.00 99.97  ? 570  GLN A O     1 
ATOM   4755  C  CB    . GLN E 3 564 ? 16.338  83.519  39.430  1.00 59.12  ? 570  GLN A CB    1 
ATOM   4756  N  N     . GLN E 3 565 ? 16.279  82.545  42.436  1.00 93.71  ? 571  GLN A N     1 
ATOM   4757  C  CA    . GLN E 3 565 ? 16.873  82.496  43.766  1.00 93.71  ? 571  GLN A CA    1 
ATOM   4758  C  C     . GLN E 3 565 ? 16.973  81.074  44.304  1.00 93.71  ? 571  GLN A C     1 
ATOM   4759  O  O     . GLN E 3 565 ? 17.888  80.751  45.075  1.00 93.71  ? 571  GLN A O     1 
ATOM   4760  C  CB    . GLN E 3 565 ? 16.048  83.348  44.735  1.00 102.52 ? 571  GLN A CB    1 
ATOM   4761  N  N     . THR E 3 566 ? 16.026  80.228  43.910  1.00 80.27  ? 572  THR A N     1 
ATOM   4762  C  CA    . THR E 3 566 ? 16.029  78.842  44.360  1.00 80.27  ? 572  THR A CA    1 
ATOM   4763  C  C     . THR E 3 566 ? 16.367  77.899  43.210  1.00 80.27  ? 572  THR A C     1 
ATOM   4764  O  O     . THR E 3 566 ? 15.554  77.070  42.809  1.00 80.27  ? 572  THR A O     1 
ATOM   4765  C  CB    . THR E 3 566 ? 14.666  78.415  44.969  1.00 61.70  ? 572  THR A CB    1 
ATOM   4766  O  OG1   . THR E 3 566 ? 14.079  79.512  45.672  1.00 61.70  ? 572  THR A OG1   1 
ATOM   4767  C  CG2   . THR E 3 566 ? 14.870  77.288  45.972  1.00 61.70  ? 572  THR A CG2   1 
ATOM   4768  N  N     . LEU E 3 567 ? 17.579  78.034  42.685  1.00 90.77  ? 573  LEU A N     1 
ATOM   4769  C  CA    . LEU E 3 567 ? 18.043  77.194  41.591  1.00 90.77  ? 573  LEU A CA    1 
ATOM   4770  C  C     . LEU E 3 567 ? 19.371  77.736  41.104  1.00 90.77  ? 573  LEU A C     1 
ATOM   4771  O  O     . LEU E 3 567 ? 20.294  76.970  40.815  1.00 90.77  ? 573  LEU A O     1 
ATOM   4772  C  CB    . LEU E 3 567 ? 17.031  77.200  40.445  1.00 93.87  ? 573  LEU A CB    1 
ATOM   4773  N  N     . VAL E 3 568 ? 19.462  79.064  41.029  1.00 74.43  ? 574  VAL A N     1 
ATOM   4774  C  CA    . VAL E 3 568 ? 20.679  79.723  40.574  1.00 74.43  ? 574  VAL A CA    1 
ATOM   4775  C  C     . VAL E 3 568 ? 21.558  80.215  41.734  1.00 74.43  ? 574  VAL A C     1 
ATOM   4776  O  O     . VAL E 3 568 ? 21.054  80.762  42.721  1.00 74.43  ? 574  VAL A O     1 
ATOM   4777  C  CB    . VAL E 3 568 ? 20.346  80.921  39.673  1.00 94.28  ? 574  VAL A CB    1 
ATOM   4778  C  CG1   . VAL E 3 568 ? 21.521  81.203  38.749  1.00 94.28  ? 574  VAL A CG1   1 
ATOM   4779  C  CG2   . VAL E 3 568 ? 19.084  80.645  38.875  1.00 94.28  ? 574  VAL A CG2   1 
ATOM   4780  N  N     . GLU E 3 569 ? 22.870  80.006  41.604  1.00 126.58 ? 575  GLU A N     1 
ATOM   4781  C  CA    . GLU E 3 569 ? 23.844  80.425  42.610  1.00 126.58 ? 575  GLU A CA    1 
ATOM   4782  C  C     . GLU E 3 569 ? 25.259  80.067  42.167  1.00 126.58 ? 575  GLU A C     1 
ATOM   4783  O  O     . GLU E 3 569 ? 25.668  80.592  41.109  1.00 126.58 ? 575  GLU A O     1 
ATOM   4784  C  CB    . GLU E 3 569 ? 23.546  79.765  43.956  1.00 109.56 ? 575  GLU A CB    1 
ATOM   4785  N  N     . LYS E 3 581 ? 26.176  76.973  37.313  1.00 98.88  ? 587  LYS A N     1 
ATOM   4786  C  CA    . LYS E 3 581 ? 26.205  77.427  38.740  1.00 98.88  ? 587  LYS A CA    1 
ATOM   4787  C  C     . LYS E 3 581 ? 24.902  77.049  39.461  1.00 98.88  ? 587  LYS A C     1 
ATOM   4788  O  O     . LYS E 3 581 ? 24.278  77.884  40.130  1.00 98.88  ? 587  LYS A O     1 
ATOM   4789  C  CB    . LYS E 3 581 ? 26.410  78.949  38.799  1.00 104.37 ? 587  LYS A CB    1 
ATOM   4790  N  N     . TRP E 3 582 ? 24.513  75.780  39.336  1.00 118.52 ? 588  TRP A N     1 
ATOM   4791  C  CA    . TRP E 3 582 ? 23.272  75.284  39.934  1.00 118.52 ? 588  TRP A CA    1 
ATOM   4792  C  C     . TRP E 3 582 ? 23.305  74.826  41.393  1.00 118.52 ? 588  TRP A C     1 
ATOM   4793  O  O     . TRP E 3 582 ? 24.332  74.396  41.922  1.00 118.52 ? 588  TRP A O     1 
ATOM   4794  C  CB    . TRP E 3 582 ? 22.707  74.105  39.123  1.00 74.17  ? 588  TRP A CB    1 
ATOM   4795  C  CG    . TRP E 3 582 ? 22.288  74.378  37.696  1.00 74.17  ? 588  TRP A CG    1 
ATOM   4796  C  CD1   . TRP E 3 582 ? 23.009  74.116  36.561  1.00 74.17  ? 588  TRP A CD1   1 
ATOM   4797  C  CD2   . TRP E 3 582 ? 21.034  74.905  37.259  1.00 74.17  ? 588  TRP A CD2   1 
ATOM   4798  N  NE1   . TRP E 3 582 ? 22.275  74.444  35.447  1.00 74.17  ? 588  TRP A NE1   1 
ATOM   4799  C  CE2   . TRP E 3 582 ? 21.060  74.932  35.848  1.00 74.17  ? 588  TRP A CE2   1 
ATOM   4800  C  CE3   . TRP E 3 582 ? 19.889  75.357  37.921  1.00 74.17  ? 588  TRP A CE3   1 
ATOM   4801  C  CZ2   . TRP E 3 582 ? 19.985  75.396  35.088  1.00 74.17  ? 588  TRP A CZ2   1 
ATOM   4802  C  CZ3   . TRP E 3 582 ? 18.816  75.819  37.165  1.00 74.17  ? 588  TRP A CZ3   1 
ATOM   4803  C  CH2   . TRP E 3 582 ? 18.874  75.835  35.762  1.00 74.17  ? 588  TRP A CH2   1 
ATOM   4804  N  N     . LYS E 3 583 ? 22.135  74.908  42.017  1.00 107.25 ? 589  LYS A N     1 
ATOM   4805  C  CA    . LYS E 3 583 ? 21.921  74.467  43.389  1.00 107.25 ? 589  LYS A CA    1 
ATOM   4806  C  C     . LYS E 3 583 ? 21.008  73.237  43.225  1.00 107.25 ? 589  LYS A C     1 
ATOM   4807  O  O     . LYS E 3 583 ? 21.458  72.092  43.360  1.00 107.25 ? 589  LYS A O     1 
ATOM   4808  C  CB    . LYS E 3 583 ? 21.228  75.572  44.197  1.00 43.18  ? 589  LYS A CB    1 
ATOM   4809  N  N     . ARG E 3 584 ? 19.732  73.487  42.914  1.00 93.67  ? 590  ARG A N     1 
ATOM   4810  C  CA    . ARG E 3 584 ? 18.746  72.430  42.669  1.00 93.67  ? 590  ARG A CA    1 
ATOM   4811  C  C     . ARG E 3 584 ? 18.408  72.562  41.185  1.00 93.67  ? 590  ARG A C     1 
ATOM   4812  O  O     . ARG E 3 584 ? 17.733  73.509  40.779  1.00 93.67  ? 590  ARG A O     1 
ATOM   4813  C  CB    . ARG E 3 584 ? 17.486  72.641  43.524  1.00 50.13  ? 590  ARG A CB    1 
ATOM   4814  N  N     . ARG E 3 585 ? 18.906  71.628  40.377  1.00 84.81  ? 591  ARG A N     1 
ATOM   4815  C  CA    . ARG E 3 585 ? 18.670  71.650  38.930  1.00 84.81  ? 591  ARG A CA    1 
ATOM   4816  C  C     . ARG E 3 585 ? 17.232  71.275  38.614  1.00 84.81  ? 591  ARG A C     1 
ATOM   4817  O  O     . ARG E 3 585 ? 16.895  70.976  37.472  1.00 84.81  ? 591  ARG A O     1 
ATOM   4818  C  CB    . ARG E 3 585 ? 19.611  70.670  38.211  1.00 67.86  ? 591  ARG A CB    1 
ATOM   4819  N  N     . TRP E 3 586 ? 16.384  71.297  39.632  1.00 60.54  ? 592  TRP A N     1 
ATOM   4820  C  CA    . TRP E 3 586 ? 14.989  70.940  39.459  1.00 60.54  ? 592  TRP A CA    1 
ATOM   4821  C  C     . TRP E 3 586 ? 14.031  71.807  40.275  1.00 60.54  ? 592  TRP A C     1 
ATOM   4822  O  O     . TRP E 3 586 ? 14.430  72.783  40.880  1.00 60.54  ? 592  TRP A O     1 
ATOM   4823  C  CB    . TRP E 3 586 ? 14.795  69.467  39.821  1.00 64.19  ? 592  TRP A CB    1 
ATOM   4824  C  CG    . TRP E 3 586 ? 15.225  69.069  41.227  1.00 64.19  ? 592  TRP A CG    1 
ATOM   4825  C  CD1   . TRP E 3 586 ? 16.397  68.463  41.588  1.00 64.19  ? 592  TRP A CD1   1 
ATOM   4826  C  CD2   . TRP E 3 586 ? 14.440  69.169  42.428  1.00 64.19  ? 592  TRP A CD2   1 
ATOM   4827  N  NE1   . TRP E 3 586 ? 16.384  68.172  42.936  1.00 64.19  ? 592  TRP A NE1   1 
ATOM   4828  C  CE2   . TRP E 3 586 ? 15.195  68.593  43.472  1.00 64.19  ? 592  TRP A CE2   1 
ATOM   4829  C  CE3   . TRP E 3 586 ? 13.167  69.681  42.718  1.00 64.19  ? 592  TRP A CE3   1 
ATOM   4830  C  CZ2   . TRP E 3 586 ? 14.717  68.514  44.788  1.00 64.19  ? 592  TRP A CZ2   1 
ATOM   4831  C  CZ3   . TRP E 3 586 ? 12.688  69.601  44.029  1.00 64.19  ? 592  TRP A CZ3   1 
ATOM   4832  C  CH2   . TRP E 3 586 ? 13.463  69.021  45.046  1.00 64.19  ? 592  TRP A CH2   1 
ATOM   4833  N  N     . ILE E 3 587 ? 12.761  71.433  40.291  1.00 58.01  ? 593  ILE A N     1 
ATOM   4834  C  CA    . ILE E 3 587 ? 11.727  72.172  41.004  1.00 58.01  ? 593  ILE A CA    1 
ATOM   4835  C  C     . ILE E 3 587 ? 10.787  71.165  41.648  1.00 58.01  ? 593  ILE A C     1 
ATOM   4836  O  O     . ILE E 3 587 ? 10.829  69.980  41.323  1.00 58.01  ? 593  ILE A O     1 
ATOM   4837  C  CB    . ILE E 3 587 ? 10.947  73.069  40.014  1.00 65.42  ? 593  ILE A CB    1 
ATOM   4838  C  CG1   . ILE E 3 587 ? 11.631  74.431  39.914  1.00 65.42  ? 593  ILE A CG1   1 
ATOM   4839  C  CG2   . ILE E 3 587 ? 9.487   73.180  40.404  1.00 65.42  ? 593  ILE A CG2   1 
ATOM   4840  C  CD1   . ILE E 3 587 ? 11.730  75.175  41.224  1.00 65.42  ? 593  ILE A CD1   1 
ATOM   4841  N  N     . LYS E 3 588 ? 9.943   71.615  42.566  1.00 49.25  ? 594  LYS A N     1 
ATOM   4842  C  CA    . LYS E 3 588 ? 9.019   70.695  43.212  1.00 49.25  ? 594  LYS A CA    1 
ATOM   4843  C  C     . LYS E 3 588 ? 7.644   70.915  42.636  1.00 49.25  ? 594  LYS A C     1 
ATOM   4844  O  O     . LYS E 3 588 ? 7.212   72.052  42.515  1.00 49.25  ? 594  LYS A O     1 
ATOM   4845  C  CB    . LYS E 3 588 ? 8.994   70.929  44.729  1.00 52.82  ? 594  LYS A CB    1 
ATOM   4846  N  N     . GLY E 3 589 ? 6.952   69.835  42.289  1.00 47.96  ? 595  GLY A N     1 
ATOM   4847  C  CA    . GLY E 3 589 ? 5.619   69.968  41.713  1.00 47.96  ? 595  GLY A CA    1 
ATOM   4848  C  C     . GLY E 3 589 ? 4.501   69.920  42.728  1.00 47.96  ? 595  GLY A C     1 
ATOM   4849  O  O     . GLY E 3 589 ? 4.712   69.414  43.819  1.00 47.96  ? 595  GLY A O     1 
ATOM   4850  N  N     . LEU E 3 590 ? 3.320   70.432  42.369  1.00 71.81  ? 596  LEU A N     1 
ATOM   4851  C  CA    . LEU E 3 590 ? 2.145   70.447  43.271  1.00 71.81  ? 596  LEU A CA    1 
ATOM   4852  C  C     . LEU E 3 590 ? 1.920   69.168  44.077  1.00 71.81  ? 596  LEU A C     1 
ATOM   4853  O  O     . LEU E 3 590 ? 1.325   69.221  45.146  1.00 71.81  ? 596  LEU A O     1 
ATOM   4854  C  CB    . LEU E 3 590 ? 0.835   70.764  42.514  1.00 45.95  ? 596  LEU A CB    1 
ATOM   4855  C  CG    . LEU E 3 590 ? 0.625   72.156  41.889  1.00 45.95  ? 596  LEU A CG    1 
ATOM   4856  C  CD1   . LEU E 3 590 ? -0.676  72.193  41.105  1.00 45.95  ? 596  LEU A CD1   1 
ATOM   4857  C  CD2   . LEU E 3 590 ? 0.626   73.229  42.964  1.00 45.95  ? 596  LEU A CD2   1 
ATOM   4858  N  N     . ASP E 3 591 ? 2.372   68.021  43.578  1.00 73.72  ? 597  ASP A N     1 
ATOM   4859  C  CA    . ASP E 3 591 ? 2.184   66.793  44.338  1.00 73.72  ? 597  ASP A CA    1 
ATOM   4860  C  C     . ASP E 3 591 ? 3.417   66.362  45.141  1.00 73.72  ? 597  ASP A C     1 
ATOM   4861  O  O     . ASP E 3 591 ? 3.299   65.565  46.062  1.00 73.72  ? 597  ASP A O     1 
ATOM   4862  C  CB    . ASP E 3 591 ? 1.699   65.650  43.438  1.00 99.53  ? 597  ASP A CB    1 
ATOM   4863  C  CG    . ASP E 3 591 ? 2.824   64.920  42.748  1.00 99.53  ? 597  ASP A CG    1 
ATOM   4864  O  OD1   . ASP E 3 591 ? 3.825   64.584  43.418  1.00 99.53  ? 597  ASP A OD1   1 
ATOM   4865  O  OD2   . ASP E 3 591 ? 2.690   64.665  41.533  1.00 99.53  ? 597  ASP A OD2   1 
ATOM   4866  N  N     . GLY E 3 592 ? 4.591   66.886  44.795  1.00 58.99  ? 598  GLY A N     1 
ATOM   4867  C  CA    . GLY E 3 592 ? 5.797   66.552  45.530  1.00 58.99  ? 598  GLY A CA    1 
ATOM   4868  C  C     . GLY E 3 592 ? 6.926   66.152  44.616  1.00 58.99  ? 598  GLY A C     1 
ATOM   4869  O  O     . GLY E 3 592 ? 8.106   66.343  44.917  1.00 58.99  ? 598  GLY A O     1 
ATOM   4870  N  N     . ARG E 3 593 ? 6.550   65.590  43.479  1.00 73.42  ? 599  ARG A N     1 
ATOM   4871  C  CA    . ARG E 3 593 ? 7.513   65.132  42.493  1.00 73.42  ? 599  ARG A CA    1 
ATOM   4872  C  C     . ARG E 3 593 ? 8.583   66.175  42.196  1.00 73.42  ? 599  ARG A C     1 
ATOM   4873  O  O     . ARG E 3 593 ? 8.392   67.371  42.420  1.00 73.42  ? 599  ARG A O     1 
ATOM   4874  C  CB    . ARG E 3 593 ? 6.782   64.778  41.193  1.00 51.81  ? 599  ARG A CB    1 
ATOM   4875  C  CG    . ARG E 3 593 ? 6.247   65.999  40.437  1.00 51.81  ? 599  ARG A CG    1 
ATOM   4876  C  CD    . ARG E 3 593 ? 4.891   65.727  39.775  1.00 51.81  ? 599  ARG A CD    1 
ATOM   4877  N  NE    . ARG E 3 593 ? 4.937   64.665  38.772  1.00 51.81  ? 599  ARG A NE    1 
ATOM   4878  C  CZ    . ARG E 3 593 ? 3.952   63.797  38.558  1.00 51.81  ? 599  ARG A CZ    1 
ATOM   4879  N  NH1   . ARG E 3 593 ? 2.841   63.856  39.280  1.00 51.81  ? 599  ARG A NH1   1 
ATOM   4880  N  NH2   . ARG E 3 593 ? 4.076   62.875  37.612  1.00 51.81  ? 599  ARG A NH2   1 
ATOM   4881  N  N     . LYS E 3 594 ? 9.723   65.707  41.707  1.00 64.75  ? 600  LYS A N     1 
ATOM   4882  C  CA    . LYS E 3 594 ? 10.799  66.603  41.318  1.00 64.75  ? 600  LYS A CA    1 
ATOM   4883  C  C     . LYS E 3 594 ? 10.423  66.918  39.896  1.00 64.75  ? 600  LYS A C     1 
ATOM   4884  O  O     . LYS E 3 594 ? 9.867   66.056  39.206  1.00 64.75  ? 600  LYS A O     1 
ATOM   4885  C  CB    . LYS E 3 594 ? 12.151  65.894  41.321  1.00 56.54  ? 600  LYS A CB    1 
ATOM   4886  C  CG    . LYS E 3 594 ? 12.780  65.771  42.691  1.00 56.54  ? 600  LYS A CG    1 
ATOM   4887  C  CD    . LYS E 3 594 ? 13.997  64.881  42.675  1.00 56.54  ? 600  LYS A CD    1 
ATOM   4888  C  CE    . LYS E 3 594 ? 14.603  64.782  44.057  1.00 56.54  ? 600  LYS A CE    1 
ATOM   4889  N  NZ    . LYS E 3 594 ? 15.691  63.762  44.122  1.00 56.54  ? 600  LYS A NZ    1 
ATOM   4890  N  N     . VAL E 3 595 ? 10.696  68.140  39.455  1.00 44.43  ? 601  VAL A N     1 
ATOM   4891  C  CA    . VAL E 3 595 ? 10.376  68.539  38.086  1.00 44.43  ? 601  VAL A CA    1 
ATOM   4892  C  C     . VAL E 3 595 ? 11.619  69.190  37.543  1.00 44.43  ? 601  VAL A C     1 
ATOM   4893  O  O     . VAL E 3 595 ? 11.809  70.390  37.675  1.00 44.43  ? 601  VAL A O     1 
ATOM   4894  C  CB    . VAL E 3 595 ? 9.229   69.567  38.023  1.00 32.11  ? 601  VAL A CB    1 
ATOM   4895  C  CG1   . VAL E 3 595 ? 8.802   69.774  36.593  1.00 32.11  ? 601  VAL A CG1   1 
ATOM   4896  C  CG2   . VAL E 3 595 ? 8.055   69.095  38.856  1.00 32.11  ? 601  VAL A CG2   1 
ATOM   4897  N  N     . HIS E 3 596 ? 12.479  68.391  36.943  1.00 43.98  ? 602  HIS A N     1 
ATOM   4898  C  CA    . HIS E 3 596 ? 13.711  68.918  36.408  1.00 43.98  ? 602  HIS A CA    1 
ATOM   4899  C  C     . HIS E 3 596 ? 13.448  70.141  35.547  1.00 43.98  ? 602  HIS A C     1 
ATOM   4900  O  O     . HIS E 3 596 ? 12.361  70.298  34.997  1.00 43.98  ? 602  HIS A O     1 
ATOM   4901  C  CB    . HIS E 3 596 ? 14.402  67.862  35.584  1.00 64.04  ? 602  HIS A CB    1 
ATOM   4902  C  CG    . HIS E 3 596 ? 15.380  68.433  34.627  1.00 64.04  ? 602  HIS A CG    1 
ATOM   4903  N  ND1   . HIS E 3 596 ? 16.674  68.723  34.984  1.00 64.04  ? 602  HIS A ND1   1 
ATOM   4904  C  CD2   . HIS E 3 596 ? 15.227  68.869  33.355  1.00 64.04  ? 602  HIS A CD2   1 
ATOM   4905  C  CE1   . HIS E 3 596 ? 17.280  69.316  33.971  1.00 64.04  ? 602  HIS A CE1   1 
ATOM   4906  N  NE2   . HIS E 3 596 ? 16.423  69.417  32.972  1.00 64.04  ? 602  HIS A NE2   1 
ATOM   4907  N  N     . VAL E 3 597 ? 14.454  71.003  35.431  1.00 69.96  ? 603  VAL A N     1 
ATOM   4908  C  CA    . VAL E 3 597 ? 14.344  72.223  34.643  1.00 69.96  ? 603  VAL A CA    1 
ATOM   4909  C  C     . VAL E 3 597 ? 15.520  72.347  33.697  1.00 69.96  ? 603  VAL A C     1 
ATOM   4910  O  O     . VAL E 3 597 ? 16.673  72.316  34.125  1.00 69.96  ? 603  VAL A O     1 
ATOM   4911  C  CB    . VAL E 3 597 ? 14.339  73.456  35.537  1.00 73.33  ? 603  VAL A CB    1 
ATOM   4912  C  CG1   . VAL E 3 597 ? 14.440  74.691  34.686  1.00 73.33  ? 603  VAL A CG1   1 
ATOM   4913  C  CG2   . VAL E 3 597 ? 13.076  73.491  36.368  1.00 73.33  ? 603  VAL A CG2   1 
ATOM   4914  N  N     . ARG E 3 598 ? 15.219  72.512  32.413  1.00 76.34  ? 604  ARG A N     1 
ATOM   4915  C  CA    . ARG E 3 598 ? 16.242  72.628  31.374  1.00 76.34  ? 604  ARG A CA    1 
ATOM   4916  C  C     . ARG E 3 598 ? 17.133  73.860  31.498  1.00 76.34  ? 604  ARG A C     1 
ATOM   4917  O  O     . ARG E 3 598 ? 18.354  73.747  31.475  1.00 76.34  ? 604  ARG A O     1 
ATOM   4918  C  CB    . ARG E 3 598 ? 15.577  72.620  29.989  1.00 46.22  ? 604  ARG A CB    1 
ATOM   4919  N  N     . SER E 3 599 ? 16.519  75.032  31.628  1.00 70.26  ? 605  SER A N     1 
ATOM   4920  C  CA    . SER E 3 599 ? 17.264  76.288  31.722  1.00 70.26  ? 605  SER A CA    1 
ATOM   4921  C  C     . SER E 3 599 ? 16.615  77.348  32.607  1.00 70.26  ? 605  SER A C     1 
ATOM   4922  O  O     . SER E 3 599 ? 15.392  77.386  32.778  1.00 70.26  ? 605  SER A O     1 
ATOM   4923  C  CB    . SER E 3 599 ? 17.429  76.906  30.337  1.00 120.71 ? 605  SER A CB    1 
ATOM   4924  O  OG    . SER E 3 599 ? 16.260  77.637  29.983  1.00 120.71 ? 605  SER A OG    1 
ATOM   4925  N  N     . PRO E 3 600 ? 17.435  78.249  33.160  1.00 84.48  ? 606  PRO A N     1 
ATOM   4926  C  CA    . PRO E 3 600 ? 16.936  79.318  34.022  1.00 84.48  ? 606  PRO A CA    1 
ATOM   4927  C  C     . PRO E 3 600 ? 15.804  80.142  33.406  1.00 84.48  ? 606  PRO A C     1 
ATOM   4928  O  O     . PRO E 3 600 ? 14.878  80.539  34.116  1.00 84.48  ? 606  PRO A O     1 
ATOM   4929  C  CB    . PRO E 3 600 ? 18.188  80.134  34.300  1.00 76.92  ? 606  PRO A CB    1 
ATOM   4930  C  CG    . PRO E 3 600 ? 19.216  79.060  34.417  1.00 76.92  ? 606  PRO A CG    1 
ATOM   4931  C  CD    . PRO E 3 600 ? 18.904  78.186  33.218  1.00 76.92  ? 606  PRO A CD    1 
ATOM   4932  N  N     . HIS E 3 601 ? 15.863  80.387  32.096  1.00 78.37  ? 607  HIS A N     1 
ATOM   4933  C  CA    . HIS E 3 601 ? 14.819  81.167  31.425  1.00 78.37  ? 607  HIS A CA    1 
ATOM   4934  C  C     . HIS E 3 601 ? 13.515  80.382  31.292  1.00 78.37  ? 607  HIS A C     1 
ATOM   4935  O  O     . HIS E 3 601 ? 12.432  80.968  31.223  1.00 78.37  ? 607  HIS A O     1 
ATOM   4936  C  CB    . HIS E 3 601 ? 15.296  81.632  30.043  1.00 93.57  ? 607  HIS A CB    1 
ATOM   4937  C  CG    . HIS E 3 601 ? 14.417  82.674  29.409  1.00 93.57  ? 607  HIS A CG    1 
ATOM   4938  N  ND1   . HIS E 3 601 ? 13.890  83.736  30.114  1.00 93.57  ? 607  HIS A ND1   1 
ATOM   4939  C  CD2   . HIS E 3 601 ? 14.026  82.846  28.123  1.00 93.57  ? 607  HIS A CD2   1 
ATOM   4940  C  CE1   . HIS E 3 601 ? 13.213  84.517  29.291  1.00 93.57  ? 607  HIS A CE1   1 
ATOM   4941  N  NE2   . HIS E 3 601 ? 13.281  83.999  28.077  1.00 93.57  ? 607  HIS A NE2   1 
ATOM   4942  N  N     . ALA E 3 602 ? 13.620  79.057  31.261  1.00 74.20  ? 608  ALA A N     1 
ATOM   4943  C  CA    . ALA E 3 602 ? 12.441  78.208  31.159  1.00 74.20  ? 608  ALA A CA    1 
ATOM   4944  C  C     . ALA E 3 602 ? 11.839  77.973  32.557  1.00 74.20  ? 608  ALA A C     1 
ATOM   4945  O  O     . ALA E 3 602 ? 10.680  77.575  32.708  1.00 74.20  ? 608  ALA A O     1 
ATOM   4946  C  CB    . ALA E 3 602 ? 12.825  76.877  30.507  1.00 81.60  ? 608  ALA A CB    1 
ATOM   4947  N  N     . ALA E 3 603 ? 12.637  78.235  33.579  1.00 91.82  ? 609  ALA A N     1 
ATOM   4948  C  CA    . ALA E 3 603 ? 12.186  78.046  34.937  1.00 91.82  ? 609  ALA A CA    1 
ATOM   4949  C  C     . ALA E 3 603 ? 10.694  78.334  35.142  1.00 91.82  ? 609  ALA A C     1 
ATOM   4950  O  O     . ALA E 3 603 ? 9.926   77.409  35.410  1.00 91.82  ? 609  ALA A O     1 
ATOM   4951  C  CB    . ALA E 3 603 ? 13.024  78.885  35.872  1.00 62.54  ? 609  ALA A CB    1 
ATOM   4952  N  N     . LEU E 3 604 ? 10.268  79.588  34.983  1.00 75.24  ? 610  LEU A N     1 
ATOM   4953  C  CA    . LEU E 3 604 ? 8.856   79.922  35.220  1.00 75.24  ? 610  LEU A CA    1 
ATOM   4954  C  C     . LEU E 3 604 ? 7.793   79.160  34.438  1.00 75.24  ? 610  LEU A C     1 
ATOM   4955  O  O     . LEU E 3 604 ? 6.793   78.744  35.027  1.00 75.24  ? 610  LEU A O     1 
ATOM   4956  C  CB    . LEU E 3 604 ? 8.576   81.420  35.049  1.00 61.14  ? 610  LEU A CB    1 
ATOM   4957  C  CG    . LEU E 3 604 ? 7.198   81.840  35.618  1.00 61.14  ? 610  LEU A CG    1 
ATOM   4958  C  CD1   . LEU E 3 604 ? 7.197   81.659  37.137  1.00 61.14  ? 610  LEU A CD1   1 
ATOM   4959  C  CD2   . LEU E 3 604 ? 6.877   83.294  35.263  1.00 61.14  ? 610  LEU A CD2   1 
ATOM   4960  N  N     . ASN E 3 605 ? 7.964   78.989  33.127  1.00 76.00  ? 611  ASN A N     1 
ATOM   4961  C  CA    . ASN E 3 605 ? 6.948   78.250  32.376  1.00 76.00  ? 611  ASN A CA    1 
ATOM   4962  C  C     . ASN E 3 605 ? 6.889   76.825  32.901  1.00 76.00  ? 611  ASN A C     1 
ATOM   4963  O  O     . ASN E 3 605 ? 5.807   76.286  33.135  1.00 76.00  ? 611  ASN A O     1 
ATOM   4964  C  CB    . ASN E 3 605 ? 7.233   78.197  30.880  1.00 69.10  ? 611  ASN A CB    1 
ATOM   4965  C  CG    . ASN E 3 605 ? 6.094   77.540  30.111  1.00 69.10  ? 611  ASN A CG    1 
ATOM   4966  O  OD1   . ASN E 3 605 ? 6.310   76.863  29.100  1.00 69.10  ? 611  ASN A OD1   1 
ATOM   4967  N  ND2   . ASN E 3 605 ? 4.869   77.742  30.590  1.00 69.10  ? 611  ASN A ND2   1 
ATOM   4968  N  N     . THR E 3 606 ? 8.062   76.221  33.077  1.00 70.51  ? 612  THR A N     1 
ATOM   4969  C  CA    . THR E 3 606 ? 8.145   74.871  33.600  1.00 70.51  ? 612  THR A CA    1 
ATOM   4970  C  C     . THR E 3 606 ? 7.212   74.831  34.802  1.00 70.51  ? 612  THR A C     1 
ATOM   4971  O  O     . THR E 3 606 ? 6.176   74.159  34.779  1.00 70.51  ? 612  THR A O     1 
ATOM   4972  C  CB    . THR E 3 606 ? 9.581   74.546  34.049  1.00 71.98  ? 612  THR A CB    1 
ATOM   4973  O  OG1   . THR E 3 606 ? 10.465  74.614  32.923  1.00 71.98  ? 612  THR A OG1   1 
ATOM   4974  C  CG2   . THR E 3 606 ? 9.645   73.152  34.644  1.00 71.98  ? 612  THR A CG2   1 
ATOM   4975  N  N     . LEU E 3 607 ? 7.574   75.589  35.833  1.00 56.87  ? 613  LEU A N     1 
ATOM   4976  C  CA    . LEU E 3 607 ? 6.778   75.643  37.047  1.00 56.87  ? 613  LEU A CA    1 
ATOM   4977  C  C     . LEU E 3 607 ? 5.302   75.782  36.719  1.00 56.87  ? 613  LEU A C     1 
ATOM   4978  O  O     . LEU E 3 607 ? 4.453   75.156  37.340  1.00 56.87  ? 613  LEU A O     1 
ATOM   4979  C  CB    . LEU E 3 607 ? 7.221   76.817  37.931  1.00 65.72  ? 613  LEU A CB    1 
ATOM   4980  C  CG    . LEU E 3 607 ? 6.261   77.331  39.024  1.00 65.72  ? 613  LEU A CG    1 
ATOM   4981  C  CD1   . LEU E 3 607 ? 6.255   76.400  40.225  1.00 65.72  ? 613  LEU A CD1   1 
ATOM   4982  C  CD2   . LEU E 3 607 ? 6.691   78.714  39.458  1.00 65.72  ? 613  LEU A CD2   1 
ATOM   4983  N  N     . LEU E 3 608 ? 4.987   76.582  35.720  1.00 58.04  ? 614  LEU A N     1 
ATOM   4984  C  CA    . LEU E 3 608 ? 3.592   76.788  35.398  1.00 58.04  ? 614  LEU A CA    1 
ATOM   4985  C  C     . LEU E 3 608 ? 2.940   75.674  34.598  1.00 58.04  ? 614  LEU A C     1 
ATOM   4986  O  O     . LEU E 3 608 ? 1.798   75.312  34.866  1.00 58.04  ? 614  LEU A O     1 
ATOM   4987  C  CB    . LEU E 3 608 ? 3.432   78.135  34.698  1.00 102.39 ? 614  LEU A CB    1 
ATOM   4988  C  CG    . LEU E 3 608 ? 3.916   79.307  35.565  1.00 102.39 ? 614  LEU A CG    1 
ATOM   4989  C  CD1   . LEU E 3 608 ? 4.101   80.538  34.709  1.00 102.39 ? 614  LEU A CD1   1 
ATOM   4990  C  CD2   . LEU E 3 608 ? 2.930   79.570  36.692  1.00 102.39 ? 614  LEU A CD2   1 
ATOM   4991  N  N     . GLN E 3 609 ? 3.645   75.118  33.621  1.00 78.56  ? 615  GLN A N     1 
ATOM   4992  C  CA    . GLN E 3 609 ? 3.046   74.053  32.826  1.00 78.56  ? 615  GLN A CA    1 
ATOM   4993  C  C     . GLN E 3 609 ? 2.803   72.857  33.736  1.00 78.56  ? 615  GLN A C     1 
ATOM   4994  O  O     . GLN E 3 609 ? 1.759   72.209  33.661  1.00 78.56  ? 615  GLN A O     1 
ATOM   4995  C  CB    . GLN E 3 609 ? 3.962   73.674  31.650  1.00 99.39  ? 615  GLN A CB    1 
ATOM   4996  C  CG    . GLN E 3 609 ? 3.473   72.483  30.814  1.00 99.39  ? 615  GLN A CG    1 
ATOM   4997  C  CD    . GLN E 3 609 ? 4.453   72.079  29.718  1.00 99.39  ? 615  GLN A CD    1 
ATOM   4998  O  OE1   . GLN E 3 609 ? 4.506   70.915  29.310  1.00 99.39  ? 615  GLN A OE1   1 
ATOM   4999  N  NE2   . GLN E 3 609 ? 5.224   73.047  29.229  1.00 99.39  ? 615  GLN A NE2   1 
ATOM   5000  N  N     . SER E 3 610 ? 3.767   72.590  34.611  1.00 69.99  ? 616  SER A N     1 
ATOM   5001  C  CA    . SER E 3 610 ? 3.667   71.469  35.531  1.00 69.99  ? 616  SER A CA    1 
ATOM   5002  C  C     . SER E 3 610 ? 2.425   71.612  36.383  1.00 69.99  ? 616  SER A C     1 
ATOM   5003  O  O     . SER E 3 610 ? 1.560   70.745  36.367  1.00 69.99  ? 616  SER A O     1 
ATOM   5004  C  CB    . SER E 3 610 ? 4.897   71.397  36.436  1.00 42.23  ? 616  SER A CB    1 
ATOM   5005  O  OG    . SER E 3 610 ? 4.963   70.139  37.084  1.00 42.23  ? 616  SER A OG    1 
ATOM   5006  N  N     . ALA E 3 611 ? 2.331   72.713  37.118  1.00 61.36  ? 617  ALA A N     1 
ATOM   5007  C  CA    . ALA E 3 611 ? 1.181   72.942  37.988  1.00 61.36  ? 617  ALA A CA    1 
ATOM   5008  C  C     . ALA E 3 611 ? -0.176  72.646  37.329  1.00 61.36  ? 617  ALA A C     1 
ATOM   5009  O  O     . ALA E 3 611 ? -1.033  71.984  37.921  1.00 61.36  ? 617  ALA A O     1 
ATOM   5010  C  CB    . ALA E 3 611 ? 1.200   74.369  38.530  1.00 42.12  ? 617  ALA A CB    1 
ATOM   5011  N  N     . GLY E 3 612 ? -0.377  73.127  36.109  1.00 33.73  ? 618  GLY A N     1 
ATOM   5012  C  CA    . GLY E 3 612 ? -1.632  72.889  35.433  1.00 33.73  ? 618  GLY A CA    1 
ATOM   5013  C  C     . GLY E 3 612 ? -1.719  71.460  34.950  1.00 33.73  ? 618  GLY A C     1 
ATOM   5014  O  O     . GLY E 3 612 ? -2.809  70.935  34.736  1.00 33.73  ? 618  GLY A O     1 
ATOM   5015  N  N     . ALA E 3 613 ? -0.564  70.832  34.756  1.00 77.77  ? 619  ALA A N     1 
ATOM   5016  C  CA    . ALA E 3 613 ? -0.503  69.448  34.297  1.00 77.77  ? 619  ALA A CA    1 
ATOM   5017  C  C     . ALA E 3 613 ? -1.097  68.553  35.371  1.00 77.77  ? 619  ALA A C     1 
ATOM   5018  O  O     . ALA E 3 613 ? -2.143  67.929  35.179  1.00 77.77  ? 619  ALA A O     1 
ATOM   5019  C  CB    . ALA E 3 613 ? 0.938   69.061  34.051  1.00 8.80   ? 619  ALA A CB    1 
ATOM   5020  N  N     . LEU E 3 614 ? -0.400  68.506  36.505  1.00 63.66  ? 620  LEU A N     1 
ATOM   5021  C  CA    . LEU E 3 614 ? -0.795  67.719  37.665  1.00 63.66  ? 620  LEU A CA    1 
ATOM   5022  C  C     . LEU E 3 614 ? -2.199  68.059  38.071  1.00 63.66  ? 620  LEU A C     1 
ATOM   5023  O  O     . LEU E 3 614 ? -2.966  67.188  38.471  1.00 63.66  ? 620  LEU A O     1 
ATOM   5024  C  CB    . LEU E 3 614 ? 0.121   68.027  38.817  1.00 35.33  ? 620  LEU A CB    1 
ATOM   5025  C  CG    . LEU E 3 614 ? 1.528   68.013  38.287  1.00 35.33  ? 620  LEU A CG    1 
ATOM   5026  C  CD1   . LEU E 3 614 ? 2.415   68.722  39.252  1.00 35.33  ? 620  LEU A CD1   1 
ATOM   5027  C  CD2   . LEU E 3 614 ? 1.952   66.595  38.065  1.00 35.33  ? 620  LEU A CD2   1 
ATOM   5028  N  N     . ILE E 3 615 ? -2.527  69.338  37.988  1.00 61.71  ? 621  ILE A N     1 
ATOM   5029  C  CA    . ILE E 3 615 ? -3.861  69.767  38.334  1.00 61.71  ? 621  ILE A CA    1 
ATOM   5030  C  C     . ILE E 3 615 ? -4.900  68.959  37.553  1.00 61.71  ? 621  ILE A C     1 
ATOM   5031  O  O     . ILE E 3 615 ? -5.932  68.565  38.096  1.00 61.71  ? 621  ILE A O     1 
ATOM   5032  C  CB    . ILE E 3 615 ? -4.063  71.277  38.056  1.00 62.10  ? 621  ILE A CB    1 
ATOM   5033  C  CG1   . ILE E 3 615 ? -3.506  72.095  39.225  1.00 62.10  ? 621  ILE A CG1   1 
ATOM   5034  C  CG2   . ILE E 3 615 ? -5.555  71.585  37.847  1.00 62.10  ? 621  ILE A CG2   1 
ATOM   5035  C  CD1   . ILE E 3 615 ? -3.899  73.570  39.201  1.00 62.10  ? 621  ILE A CD1   1 
ATOM   5036  N  N     . CYS E 3 616 ? -4.628  68.700  36.281  1.00 61.05  ? 622  CYS A N     1 
ATOM   5037  C  CA    . CYS E 3 616 ? -5.568  67.942  35.476  1.00 61.05  ? 622  CYS A CA    1 
ATOM   5038  C  C     . CYS E 3 616 ? -5.454  66.450  35.739  1.00 61.05  ? 622  CYS A C     1 
ATOM   5039  O  O     . CYS E 3 616 ? -6.469  65.769  35.939  1.00 61.05  ? 622  CYS A O     1 
ATOM   5040  C  CB    . CYS E 3 616 ? -5.351  68.227  33.999  1.00 71.25  ? 622  CYS A CB    1 
ATOM   5041  S  SG    . CYS E 3 616 ? -5.661  69.936  33.545  1.00 71.25  ? 622  CYS A SG    1 
ATOM   5042  N  N     . LYS E 3 617 ? -4.222  65.941  35.733  1.00 58.12  ? 623  LYS A N     1 
ATOM   5043  C  CA    . LYS E 3 617 ? -3.994  64.535  35.989  1.00 58.12  ? 623  LYS A CA    1 
ATOM   5044  C  C     . LYS E 3 617 ? -4.809  64.180  37.217  1.00 58.12  ? 623  LYS A C     1 
ATOM   5045  O  O     . LYS E 3 617 ? -5.623  63.255  37.179  1.00 58.12  ? 623  LYS A O     1 
ATOM   5046  C  CB    . LYS E 3 617 ? -2.519  64.287  36.238  1.00 34.52  ? 623  LYS A CB    1 
ATOM   5047  C  CG    . LYS E 3 617 ? -2.167  62.826  36.405  1.00 34.52  ? 623  LYS A CG    1 
ATOM   5048  C  CD    . LYS E 3 617 ? -0.669  62.605  36.292  1.00 34.52  ? 623  LYS A CD    1 
ATOM   5049  C  CE    . LYS E 3 617 ? -0.150  63.034  34.929  1.00 34.52  ? 623  LYS A CE    1 
ATOM   5050  N  NZ    . LYS E 3 617 ? 1.283   62.718  34.802  1.00 34.52  ? 623  LYS A NZ    1 
ATOM   5051  N  N     . LEU E 3 618 ? -4.617  64.945  38.293  1.00 60.76  ? 624  LEU A N     1 
ATOM   5052  C  CA    . LEU E 3 618 ? -5.358  64.696  39.527  1.00 60.76  ? 624  LEU A CA    1 
ATOM   5053  C  C     . LEU E 3 618 ? -6.844  64.888  39.340  1.00 60.76  ? 624  LEU A C     1 
ATOM   5054  O  O     . LEU E 3 618 ? -7.637  64.178  39.954  1.00 60.76  ? 624  LEU A O     1 
ATOM   5055  C  CB    . LEU E 3 618 ? -4.916  65.612  40.660  1.00 53.44  ? 624  LEU A CB    1 
ATOM   5056  C  CG    . LEU E 3 618 ? -5.623  65.223  41.965  1.00 53.44  ? 624  LEU A CG    1 
ATOM   5057  C  CD1   . LEU E 3 618 ? -5.138  63.870  42.408  1.00 53.44  ? 624  LEU A CD1   1 
ATOM   5058  C  CD2   . LEU E 3 618 ? -5.346  66.217  43.047  1.00 53.44  ? 624  LEU A CD2   1 
ATOM   5059  N  N     . TRP E 3 619 ? -7.214  65.849  38.499  1.00 51.27  ? 625  TRP A N     1 
ATOM   5060  C  CA    . TRP E 3 619 ? -8.620  66.141  38.241  1.00 51.27  ? 625  TRP A CA    1 
ATOM   5061  C  C     . TRP E 3 619 ? -9.377  64.979  37.574  1.00 51.27  ? 625  TRP A C     1 
ATOM   5062  O  O     . TRP E 3 619 ? -10.393 64.516  38.102  1.00 51.27  ? 625  TRP A O     1 
ATOM   5063  C  CB    . TRP E 3 619 ? -8.729  67.431  37.420  1.00 58.66  ? 625  TRP A CB    1 
ATOM   5064  C  CG    . TRP E 3 619 ? -10.096 67.737  36.911  1.00 58.66  ? 625  TRP A CG    1 
ATOM   5065  C  CD1   . TRP E 3 619 ? -11.253 67.790  37.627  1.00 58.66  ? 625  TRP A CD1   1 
ATOM   5066  C  CD2   . TRP E 3 619 ? -10.453 67.984  35.554  1.00 58.66  ? 625  TRP A CD2   1 
ATOM   5067  N  NE1   . TRP E 3 619 ? -12.318 68.046  36.797  1.00 58.66  ? 625  TRP A NE1   1 
ATOM   5068  C  CE2   . TRP E 3 619 ? -11.851 68.168  35.517  1.00 58.66  ? 625  TRP A CE2   1 
ATOM   5069  C  CE3   . TRP E 3 619 ? -9.726  68.062  34.362  1.00 58.66  ? 625  TRP A CE3   1 
ATOM   5070  C  CZ2   . TRP E 3 619 ? -12.533 68.420  34.339  1.00 58.66  ? 625  TRP A CZ2   1 
ATOM   5071  C  CZ3   . TRP E 3 619 ? -10.397 68.311  33.200  1.00 58.66  ? 625  TRP A CZ3   1 
ATOM   5072  C  CH2   . TRP E 3 619 ? -11.793 68.487  33.191  1.00 58.66  ? 625  TRP A CH2   1 
ATOM   5073  N  N     . ILE E 3 620 ? -8.888  64.495  36.433  1.00 72.85  ? 626  ILE A N     1 
ATOM   5074  C  CA    . ILE E 3 620 ? -9.546  63.381  35.746  1.00 72.85  ? 626  ILE A CA    1 
ATOM   5075  C  C     . ILE E 3 620 ? -9.597  62.144  36.629  1.00 72.85  ? 626  ILE A C     1 
ATOM   5076  O  O     . ILE E 3 620 ? -10.424 61.267  36.425  1.00 72.85  ? 626  ILE A O     1 
ATOM   5077  C  CB    . ILE E 3 620 ? -8.805  62.998  34.453  1.00 94.27  ? 626  ILE A CB    1 
ATOM   5078  C  CG1   . ILE E 3 620 ? -7.302  63.173  34.651  1.00 94.27  ? 626  ILE A CG1   1 
ATOM   5079  C  CG2   . ILE E 3 620 ? -9.297  63.825  33.304  1.00 94.27  ? 626  ILE A CG2   1 
ATOM   5080  C  CD1   . ILE E 3 620 ? -6.482  62.805  33.433  1.00 94.27  ? 626  ILE A CD1   1 
ATOM   5081  N  N     . ILE E 3 621 ? -8.690  62.068  37.593  1.00 83.78  ? 627  ILE A N     1 
ATOM   5082  C  CA    . ILE E 3 621 ? -8.648  60.935  38.502  1.00 83.78  ? 627  ILE A CA    1 
ATOM   5083  C  C     . ILE E 3 621 ? -9.810  61.020  39.474  1.00 83.78  ? 627  ILE A C     1 
ATOM   5084  O  O     . ILE E 3 621 ? -10.542 60.047  39.682  1.00 83.78  ? 627  ILE A O     1 
ATOM   5085  C  CB    . ILE E 3 621 ? -7.362  60.927  39.319  1.00 53.38  ? 627  ILE A CB    1 
ATOM   5086  C  CG1   . ILE E 3 621 ? -6.185  60.578  38.424  1.00 53.38  ? 627  ILE A CG1   1 
ATOM   5087  C  CG2   . ILE E 3 621 ? -7.484  59.945  40.469  1.00 53.38  ? 627  ILE A CG2   1 
ATOM   5088  C  CD1   . ILE E 3 621 ? -4.874  60.729  39.130  1.00 53.38  ? 627  ILE A CD1   1 
ATOM   5089  N  N     . LYS E 3 622 ? -9.965  62.189  40.082  1.00 68.90  ? 628  LYS A N     1 
ATOM   5090  C  CA    . LYS E 3 622 ? -11.044 62.407  41.031  1.00 68.90  ? 628  LYS A CA    1 
ATOM   5091  C  C     . LYS E 3 622 ? -12.369 62.288  40.284  1.00 68.90  ? 628  LYS A C     1 
ATOM   5092  O  O     . LYS E 3 622 ? -13.271 61.574  40.707  1.00 68.90  ? 628  LYS A O     1 
ATOM   5093  C  CB    . LYS E 3 622 ? -10.936 63.804  41.652  1.00 69.21  ? 628  LYS A CB    1 
ATOM   5094  C  CG    . LYS E 3 622 ? -11.283 63.858  43.117  1.00 69.21  ? 628  LYS A CG    1 
ATOM   5095  C  CD    . LYS E 3 622 ? -12.494 62.998  43.421  1.00 69.21  ? 628  LYS A CD    1 
ATOM   5096  C  CE    . LYS E 3 622 ? -12.825 62.964  44.917  1.00 69.21  ? 628  LYS A CE    1 
ATOM   5097  N  NZ    . LYS E 3 622 ? -13.869 61.935  45.254  1.00 69.21  ? 628  LYS A NZ    1 
ATOM   5098  N  N     . THR E 3 623 ? -12.474 62.990  39.163  1.00 54.37  ? 629  THR A N     1 
ATOM   5099  C  CA    . THR E 3 623 ? -13.685 62.966  38.374  1.00 54.37  ? 629  THR A CA    1 
ATOM   5100  C  C     . THR E 3 623 ? -14.229 61.556  38.224  1.00 54.37  ? 629  THR A C     1 
ATOM   5101  O  O     . THR E 3 623 ? -15.308 61.256  38.708  1.00 54.37  ? 629  THR A O     1 
ATOM   5102  C  CB    . THR E 3 623 ? -13.444 63.578  36.989  1.00 54.27  ? 629  THR A CB    1 
ATOM   5103  O  OG1   . THR E 3 623 ? -13.364 65.001  37.118  1.00 54.27  ? 629  THR A OG1   1 
ATOM   5104  C  CG2   . THR E 3 623 ? -14.565 63.225  36.034  1.00 54.27  ? 629  THR A CG2   1 
ATOM   5105  N  N     . GLU E 3 624 ? -13.491 60.684  37.554  1.00 64.66  ? 630  GLU A N     1 
ATOM   5106  C  CA    . GLU E 3 624 ? -13.952 59.320  37.371  1.00 64.66  ? 630  GLU A CA    1 
ATOM   5107  C  C     . GLU E 3 624 ? -14.313 58.720  38.719  1.00 64.66  ? 630  GLU A C     1 
ATOM   5108  O  O     . GLU E 3 624 ? -15.432 58.241  38.902  1.00 64.66  ? 630  GLU A O     1 
ATOM   5109  C  CB    . GLU E 3 624 ? -12.866 58.487  36.712  1.00 57.78  ? 630  GLU A CB    1 
ATOM   5110  C  CG    . GLU E 3 624 ? -13.270 57.056  36.497  1.00 57.78  ? 630  GLU A CG    1 
ATOM   5111  C  CD    . GLU E 3 624 ? -12.196 56.090  36.941  1.00 57.78  ? 630  GLU A CD    1 
ATOM   5112  O  OE1   . GLU E 3 624 ? -11.621 56.321  38.040  1.00 57.78  ? 630  GLU A OE1   1 
ATOM   5113  O  OE2   . GLU E 3 624 ? -11.942 55.107  36.201  1.00 57.78  ? 630  GLU A OE2   1 
ATOM   5114  N  N     . GLU E 3 625 ? -13.369 58.755  39.663  1.00 73.95  ? 631  GLU A N     1 
ATOM   5115  C  CA    . GLU E 3 625 ? -13.600 58.209  41.005  1.00 73.95  ? 631  GLU A CA    1 
ATOM   5116  C  C     . GLU E 3 625 ? -14.978 58.608  41.501  1.00 73.95  ? 631  GLU A C     1 
ATOM   5117  O  O     . GLU E 3 625 ? -15.804 57.753  41.806  1.00 73.95  ? 631  GLU A O     1 
ATOM   5118  C  CB    . GLU E 3 625 ? -12.543 58.711  41.994  1.00 47.65  ? 631  GLU A CB    1 
ATOM   5119  N  N     . MET E 3 626 ? -15.216 59.916  41.562  1.00 68.89  ? 632  MET A N     1 
ATOM   5120  C  CA    . MET E 3 626 ? -16.496 60.462  42.009  1.00 68.89  ? 632  MET A CA    1 
ATOM   5121  C  C     . MET E 3 626 ? -17.676 59.868  41.226  1.00 68.89  ? 632  MET A C     1 
ATOM   5122  O  O     . MET E 3 626 ? -18.696 59.494  41.805  1.00 68.89  ? 632  MET A O     1 
ATOM   5123  C  CB    . MET E 3 626 ? -16.480 61.996  41.883  1.00 61.89  ? 632  MET A CB    1 
ATOM   5124  C  CG    . MET E 3 626 ? -15.537 62.654  42.880  1.00 61.89  ? 632  MET A CG    1 
ATOM   5125  S  SD    . MET E 3 626 ? -15.380 64.485  42.872  1.00 61.89  ? 632  MET A SD    1 
ATOM   5126  C  CE    . MET E 3 626 ? -15.924 64.965  44.518  1.00 61.89  ? 632  MET A CE    1 
ATOM   5127  N  N     . LEU E 3 627 ? -17.523 59.781  39.909  1.00 70.87  ? 633  LEU A N     1 
ATOM   5128  C  CA    . LEU E 3 627 ? -18.563 59.242  39.046  1.00 70.87  ? 633  LEU A CA    1 
ATOM   5129  C  C     . LEU E 3 627 ? -18.883 57.809  39.430  1.00 70.87  ? 633  LEU A C     1 
ATOM   5130  O  O     . LEU E 3 627 ? -19.930 57.270  39.052  1.00 70.87  ? 633  LEU A O     1 
ATOM   5131  C  CB    . LEU E 3 627 ? -18.108 59.283  37.582  1.00 81.16  ? 633  LEU A CB    1 
ATOM   5132  C  CG    . LEU E 3 627 ? -17.979 60.644  36.894  1.00 81.16  ? 633  LEU A CG    1 
ATOM   5133  C  CD1   . LEU E 3 627 ? -17.334 60.470  35.534  1.00 81.16  ? 633  LEU A CD1   1 
ATOM   5134  C  CD2   . LEU E 3 627 ? -19.357 61.271  36.737  1.00 81.16  ? 633  LEU A CD2   1 
ATOM   5135  N  N     . VAL E 3 628 ? -17.964 57.194  40.166  1.00 112.17 ? 634  VAL A N     1 
ATOM   5136  C  CA    . VAL E 3 628 ? -18.116 55.816  40.610  1.00 112.17 ? 634  VAL A CA    1 
ATOM   5137  C  C     . VAL E 3 628 ? -18.706 55.794  42.011  1.00 112.17 ? 634  VAL A C     1 
ATOM   5138  O  O     . VAL E 3 628 ? -19.576 54.978  42.317  1.00 112.17 ? 634  VAL A O     1 
ATOM   5139  C  CB    . VAL E 3 628 ? -16.752 55.088  40.645  1.00 91.20  ? 634  VAL A CB    1 
ATOM   5140  C  CG1   . VAL E 3 628 ? -16.942 53.636  41.038  1.00 91.20  ? 634  VAL A CG1   1 
ATOM   5141  C  CG2   . VAL E 3 628 ? -16.076 55.190  39.296  1.00 91.20  ? 634  VAL A CG2   1 
ATOM   5142  N  N     . GLU E 3 629 ? -18.225 56.694  42.862  1.00 123.31 ? 635  GLU A N     1 
ATOM   5143  C  CA    . GLU E 3 629 ? -18.718 56.774  44.229  1.00 123.31 ? 635  GLU A CA    1 
ATOM   5144  C  C     . GLU E 3 629 ? -20.149 57.325  44.226  1.00 123.31 ? 635  GLU A C     1 
ATOM   5145  O  O     . GLU E 3 629 ? -20.727 57.574  45.284  1.00 123.31 ? 635  GLU A O     1 
ATOM   5146  C  CB    . GLU E 3 629 ? -17.787 57.654  45.080  1.00 41.64  ? 635  GLU A CB    1 
ATOM   5147  N  N     . LYS E 3 630 ? -20.709 57.515  43.030  1.00 83.71  ? 636  LYS A N     1 
ATOM   5148  C  CA    . LYS E 3 630 ? -22.083 58.004  42.869  1.00 83.71  ? 636  LYS A CA    1 
ATOM   5149  C  C     . LYS E 3 630 ? -22.973 56.828  42.469  1.00 83.71  ? 636  LYS A C     1 
ATOM   5150  O  O     . LYS E 3 630 ? -24.091 56.690  42.968  1.00 83.71  ? 636  LYS A O     1 
ATOM   5151  C  CB    . LYS E 3 630 ? -22.172 59.105  41.793  1.00 27.88  ? 636  LYS A CB    1 
ATOM   5152  N  N     . GLY E 3 631 ? -22.473 55.980  41.572  1.00 86.04  ? 637  GLY A N     1 
ATOM   5153  C  CA    . GLY E 3 631 ? -23.239 54.824  41.148  1.00 86.04  ? 637  GLY A CA    1 
ATOM   5154  C  C     . GLY E 3 631 ? -23.022 54.380  39.712  1.00 86.04  ? 637  GLY A C     1 
ATOM   5155  O  O     . GLY E 3 631 ? -23.483 53.301  39.326  1.00 86.04  ? 637  GLY A O     1 
ATOM   5156  N  N     . LEU E 3 632 ? -22.325 55.194  38.919  1.00 93.64  ? 638  LEU A N     1 
ATOM   5157  C  CA    . LEU E 3 632 ? -22.077 54.867  37.515  1.00 93.64  ? 638  LEU A CA    1 
ATOM   5158  C  C     . LEU E 3 632 ? -20.874 53.939  37.312  1.00 93.64  ? 638  LEU A C     1 
ATOM   5159  O  O     . LEU E 3 632 ? -19.895 53.993  38.063  1.00 93.64  ? 638  LEU A O     1 
ATOM   5160  C  CB    . LEU E 3 632 ? -21.903 56.156  36.708  1.00 67.84  ? 638  LEU A CB    1 
ATOM   5161  N  N     . LYS E 3 633 ? -20.967 53.080  36.297  1.00 56.94  ? 639  LYS A N     1 
ATOM   5162  C  CA    . LYS E 3 633 ? -19.902 52.126  35.976  1.00 56.94  ? 639  LYS A CA    1 
ATOM   5163  C  C     . LYS E 3 633 ? -19.147 52.561  34.726  1.00 56.94  ? 639  LYS A C     1 
ATOM   5164  O  O     . LYS E 3 633 ? -19.764 52.863  33.696  1.00 56.94  ? 639  LYS A O     1 
ATOM   5165  C  CB    . LYS E 3 633 ? -20.477 50.719  35.759  1.00 71.51  ? 639  LYS A CB    1 
ATOM   5166  N  N     . HIS E 3 634 ? -17.815 52.593  34.824  1.00 64.50  ? 640  HIS A N     1 
ATOM   5167  C  CA    . HIS E 3 634 ? -16.953 53.001  33.707  1.00 64.50  ? 640  HIS A CA    1 
ATOM   5168  C  C     . HIS E 3 634 ? -16.758 51.850  32.738  1.00 64.50  ? 640  HIS A C     1 
ATOM   5169  O  O     . HIS E 3 634 ? -16.373 50.751  33.131  1.00 64.50  ? 640  HIS A O     1 
ATOM   5170  C  CB    . HIS E 3 634 ? -15.582 53.467  34.227  1.00 60.50  ? 640  HIS A CB    1 
ATOM   5171  C  CG    . HIS E 3 634 ? -14.684 54.046  33.169  1.00 60.50  ? 640  HIS A CG    1 
ATOM   5172  N  ND1   . HIS E 3 634 ? -13.506 54.699  33.469  1.00 60.50  ? 640  HIS A ND1   1 
ATOM   5173  C  CD2   . HIS E 3 634 ? -14.800 54.089  31.820  1.00 60.50  ? 640  HIS A CD2   1 
ATOM   5174  C  CE1   . HIS E 3 634 ? -12.939 55.121  32.353  1.00 60.50  ? 640  HIS A CE1   1 
ATOM   5175  N  NE2   . HIS E 3 634 ? -13.704 54.765  31.338  1.00 60.50  ? 640  HIS A NE2   1 
ATOM   5176  N  N     . GLY E 3 635 ? -17.021 52.108  31.466  1.00 54.44  ? 641  GLY A N     1 
ATOM   5177  C  CA    . GLY E 3 635 ? -16.873 51.070  30.469  1.00 54.44  ? 641  GLY A CA    1 
ATOM   5178  C  C     . GLY E 3 635 ? -17.953 51.218  29.424  1.00 54.44  ? 641  GLY A C     1 
ATOM   5179  O  O     . GLY E 3 635 ? -18.900 51.955  29.623  1.00 54.44  ? 641  GLY A O     1 
ATOM   5180  N  N     . TRP E 3 636 ? -17.822 50.530  28.303  1.00 83.38  ? 642  TRP A N     1 
ATOM   5181  C  CA    . TRP E 3 636 ? -18.829 50.630  27.261  1.00 83.38  ? 642  TRP A CA    1 
ATOM   5182  C  C     . TRP E 3 636 ? -20.107 49.967  27.717  1.00 83.38  ? 642  TRP A C     1 
ATOM   5183  O  O     . TRP E 3 636 ? -21.206 50.440  27.424  1.00 83.38  ? 642  TRP A O     1 
ATOM   5184  C  CB    . TRP E 3 636 ? -18.327 49.960  25.977  1.00 64.59  ? 642  TRP A CB    1 
ATOM   5185  C  CG    . TRP E 3 636 ? -17.304 50.793  25.249  1.00 64.59  ? 642  TRP A CG    1 
ATOM   5186  C  CD1   . TRP E 3 636 ? -16.130 50.363  24.688  1.00 64.59  ? 642  TRP A CD1   1 
ATOM   5187  C  CD2   . TRP E 3 636 ? -17.383 52.196  24.990  1.00 64.59  ? 642  TRP A CD2   1 
ATOM   5188  N  NE1   . TRP E 3 636 ? -15.480 51.416  24.100  1.00 64.59  ? 642  TRP A NE1   1 
ATOM   5189  C  CE2   . TRP E 3 636 ? -16.226 52.552  24.269  1.00 64.59  ? 642  TRP A CE2   1 
ATOM   5190  C  CE3   . TRP E 3 636 ? -18.322 53.186  25.294  1.00 64.59  ? 642  TRP A CE3   1 
ATOM   5191  C  CZ2   . TRP E 3 636 ? -15.984 53.855  23.849  1.00 64.59  ? 642  TRP A CZ2   1 
ATOM   5192  C  CZ3   . TRP E 3 636 ? -18.082 54.475  24.875  1.00 64.59  ? 642  TRP A CZ3   1 
ATOM   5193  C  CH2   . TRP E 3 636 ? -16.923 54.802  24.161  1.00 64.59  ? 642  TRP A CH2   1 
ATOM   5194  N  N     . ASP E 3 637 ? -19.951 48.867  28.442  1.00 60.16  ? 643  ASP A N     1 
ATOM   5195  C  CA    . ASP E 3 637 ? -21.088 48.112  28.933  1.00 60.16  ? 643  ASP A CA    1 
ATOM   5196  C  C     . ASP E 3 637 ? -21.703 48.764  30.166  1.00 60.16  ? 643  ASP A C     1 
ATOM   5197  O  O     . ASP E 3 637 ? -22.682 48.268  30.711  1.00 60.16  ? 643  ASP A O     1 
ATOM   5198  C  CB    . ASP E 3 637 ? -20.666 46.668  29.236  1.00 92.21  ? 643  ASP A CB    1 
ATOM   5199  C  CG    . ASP E 3 637 ? -19.456 46.586  30.153  1.00 92.21  ? 643  ASP A CG    1 
ATOM   5200  O  OD1   . ASP E 3 637 ? -19.499 47.193  31.248  1.00 92.21  ? 643  ASP A OD1   1 
ATOM   5201  O  OD2   . ASP E 3 637 ? -18.470 45.907  29.781  1.00 92.21  ? 643  ASP A OD2   1 
ATOM   5202  N  N     . GLY E 3 638 ? -21.140 49.889  30.586  1.00 66.74  ? 644  GLY A N     1 
ATOM   5203  C  CA    . GLY E 3 638 ? -21.645 50.575  31.762  1.00 66.74  ? 644  GLY A CA    1 
ATOM   5204  C  C     . GLY E 3 638 ? -22.540 51.766  31.468  1.00 66.74  ? 644  GLY A C     1 
ATOM   5205  O  O     . GLY E 3 638 ? -23.536 51.651  30.751  1.00 66.74  ? 644  GLY A O     1 
ATOM   5206  N  N     . ASP E 3 639 ? -22.178 52.914  32.032  1.00 99.05  ? 645  ASP A N     1 
ATOM   5207  C  CA    . ASP E 3 639 ? -22.948 54.130  31.847  1.00 99.05  ? 645  ASP A CA    1 
ATOM   5208  C  C     . ASP E 3 639 ? -22.122 55.216  31.155  1.00 99.05  ? 645  ASP A C     1 
ATOM   5209  O  O     . ASP E 3 639 ? -22.657 56.012  30.374  1.00 99.05  ? 645  ASP A O     1 
ATOM   5210  C  CB    . ASP E 3 639 ? -23.439 54.626  33.205  1.00 117.78 ? 645  ASP A CB    1 
ATOM   5211  C  CG    . ASP E 3 639 ? -23.906 53.493  34.103  1.00 117.78 ? 645  ASP A CG    1 
ATOM   5212  O  OD1   . ASP E 3 639 ? -24.643 52.601  33.623  1.00 117.78 ? 645  ASP A OD1   1 
ATOM   5213  O  OD2   . ASP E 3 639 ? -23.537 53.499  35.297  1.00 117.78 ? 645  ASP A OD2   1 
ATOM   5214  N  N     . PHE E 3 640 ? -20.819 55.241  31.444  1.00 86.67  ? 646  PHE A N     1 
ATOM   5215  C  CA    . PHE E 3 640 ? -19.905 56.221  30.854  1.00 86.67  ? 646  PHE A CA    1 
ATOM   5216  C  C     . PHE E 3 640 ? -18.564 55.592  30.509  1.00 86.67  ? 646  PHE A C     1 
ATOM   5217  O  O     . PHE E 3 640 ? -18.240 54.499  30.970  1.00 86.67  ? 646  PHE A O     1 
ATOM   5218  C  CB    . PHE E 3 640 ? -19.643 57.356  31.830  1.00 59.21  ? 646  PHE A CB    1 
ATOM   5219  C  CG    . PHE E 3 640 ? -18.766 56.964  32.971  1.00 59.21  ? 646  PHE A CG    1 
ATOM   5220  C  CD1   . PHE E 3 640 ? -19.229 56.104  33.953  1.00 59.21  ? 646  PHE A CD1   1 
ATOM   5221  C  CD2   . PHE E 3 640 ? -17.472 57.454  33.063  1.00 59.21  ? 646  PHE A CD2   1 
ATOM   5222  C  CE1   . PHE E 3 640 ? -18.413 55.738  35.019  1.00 59.21  ? 646  PHE A CE1   1 
ATOM   5223  C  CE2   . PHE E 3 640 ? -16.652 57.093  34.121  1.00 59.21  ? 646  PHE A CE2   1 
ATOM   5224  C  CZ    . PHE E 3 640 ? -17.128 56.232  35.104  1.00 59.21  ? 646  PHE A CZ    1 
ATOM   5225  N  N     . ALA E 3 641 ? -17.769 56.302  29.718  1.00 66.54  ? 647  ALA A N     1 
ATOM   5226  C  CA    . ALA E 3 641 ? -16.460 55.797  29.334  1.00 66.54  ? 647  ALA A CA    1 
ATOM   5227  C  C     . ALA E 3 641 ? -15.531 56.922  28.900  1.00 66.54  ? 647  ALA A C     1 
ATOM   5228  O  O     . ALA E 3 641 ? -15.944 57.835  28.184  1.00 66.54  ? 647  ALA A O     1 
ATOM   5229  C  CB    . ALA E 3 641 ? -16.606 54.762  28.217  1.00 26.10  ? 647  ALA A CB    1 
ATOM   5230  N  N     . TYR E 3 642 ? -14.280 56.863  29.352  1.00 45.28  ? 648  TYR A N     1 
ATOM   5231  C  CA    . TYR E 3 642 ? -13.314 57.882  28.979  1.00 45.28  ? 648  TYR A CA    1 
ATOM   5232  C  C     . TYR E 3 642 ? -12.849 57.581  27.573  1.00 45.28  ? 648  TYR A C     1 
ATOM   5233  O  O     . TYR E 3 642 ? -12.488 56.447  27.276  1.00 45.28  ? 648  TYR A O     1 
ATOM   5234  C  CB    . TYR E 3 642 ? -12.137 57.874  29.937  1.00 49.18  ? 648  TYR A CB    1 
ATOM   5235  C  CG    . TYR E 3 642 ? -12.354 58.716  31.162  1.00 49.18  ? 648  TYR A CG    1 
ATOM   5236  C  CD1   . TYR E 3 642 ? -13.593 58.748  31.800  1.00 49.18  ? 648  TYR A CD1   1 
ATOM   5237  C  CD2   . TYR E 3 642 ? -11.322 59.473  31.695  1.00 49.18  ? 648  TYR A CD2   1 
ATOM   5238  C  CE1   . TYR E 3 642 ? -13.805 59.511  32.929  1.00 49.18  ? 648  TYR A CE1   1 
ATOM   5239  C  CE2   . TYR E 3 642 ? -11.520 60.238  32.832  1.00 49.18  ? 648  TYR A CE2   1 
ATOM   5240  C  CZ    . TYR E 3 642 ? -12.770 60.254  33.442  1.00 49.18  ? 648  TYR A CZ    1 
ATOM   5241  O  OH    . TYR E 3 642 ? -12.979 61.041  34.552  1.00 49.18  ? 648  TYR A OH    1 
ATOM   5242  N  N     . MET E 3 643 ? -12.890 58.591  26.709  1.00 55.85  ? 649  MET A N     1 
ATOM   5243  C  CA    . MET E 3 643 ? -12.468 58.454  25.317  1.00 55.85  ? 649  MET A CA    1 
ATOM   5244  C  C     . MET E 3 643 ? -11.201 59.243  25.005  1.00 55.85  ? 649  MET A C     1 
ATOM   5245  O  O     . MET E 3 643 ? -10.442 58.865  24.135  1.00 55.85  ? 649  MET A O     1 
ATOM   5246  C  CB    . MET E 3 643 ? -13.561 58.935  24.373  1.00 71.56  ? 649  MET A CB    1 
ATOM   5247  C  CG    . MET E 3 643 ? -14.822 58.145  24.435  1.00 71.56  ? 649  MET A CG    1 
ATOM   5248  S  SD    . MET E 3 643 ? -15.987 58.765  23.225  1.00 71.56  ? 649  MET A SD    1 
ATOM   5249  C  CE    . MET E 3 643 ? -16.631 60.166  24.126  1.00 71.56  ? 649  MET A CE    1 
ATOM   5250  N  N     . ALA E 3 644 ? -10.966 60.337  25.713  1.00 44.91  ? 650  ALA A N     1 
ATOM   5251  C  CA    . ALA E 3 644 ? -9.798  61.133  25.423  1.00 44.91  ? 650  ALA A CA    1 
ATOM   5252  C  C     . ALA E 3 644 ? -9.474  62.190  26.463  1.00 44.91  ? 650  ALA A C     1 
ATOM   5253  O  O     . ALA E 3 644 ? -10.373 62.727  27.113  1.00 44.91  ? 650  ALA A O     1 
ATOM   5254  C  CB    . ALA E 3 644 ? -9.982  61.795  24.099  1.00 34.07  ? 650  ALA A CB    1 
ATOM   5255  N  N     . TRP E 3 645 ? -8.180  62.493  26.592  1.00 57.04  ? 651  TRP A N     1 
ATOM   5256  C  CA    . TRP E 3 645 ? -7.697  63.497  27.522  1.00 57.04  ? 651  TRP A CA    1 
ATOM   5257  C  C     . TRP E 3 645 ? -6.525  64.278  26.953  1.00 57.04  ? 651  TRP A C     1 
ATOM   5258  O  O     . TRP E 3 645 ? -5.373  63.854  27.015  1.00 57.04  ? 651  TRP A O     1 
ATOM   5259  C  CB    . TRP E 3 645 ? -7.270  62.864  28.819  1.00 47.30  ? 651  TRP A CB    1 
ATOM   5260  C  CG    . TRP E 3 645 ? -6.478  63.800  29.640  1.00 47.30  ? 651  TRP A CG    1 
ATOM   5261  C  CD1   . TRP E 3 645 ? -6.790  65.082  29.942  1.00 47.30  ? 651  TRP A CD1   1 
ATOM   5262  C  CD2   . TRP E 3 645 ? -5.240  63.523  30.286  1.00 47.30  ? 651  TRP A CD2   1 
ATOM   5263  N  NE1   . TRP E 3 645 ? -5.822  65.628  30.742  1.00 47.30  ? 651  TRP A NE1   1 
ATOM   5264  C  CE2   . TRP E 3 645 ? -4.857  64.686  30.967  1.00 47.30  ? 651  TRP A CE2   1 
ATOM   5265  C  CE3   . TRP E 3 645 ? -4.414  62.397  30.355  1.00 47.30  ? 651  TRP A CE3   1 
ATOM   5266  C  CZ2   . TRP E 3 645 ? -3.688  64.760  31.707  1.00 47.30  ? 651  TRP A CZ2   1 
ATOM   5267  C  CZ3   . TRP E 3 645 ? -3.256  62.470  31.086  1.00 47.30  ? 651  TRP A CZ3   1 
ATOM   5268  C  CH2   . TRP E 3 645 ? -2.900  63.643  31.755  1.00 47.30  ? 651  TRP A CH2   1 
ATOM   5269  N  N     . VAL E 3 646 ? -6.840  65.450  26.429  1.00 45.40  ? 652  VAL A N     1 
ATOM   5270  C  CA    . VAL E 3 646 ? -5.871  66.335  25.819  1.00 45.40  ? 652  VAL A CA    1 
ATOM   5271  C  C     . VAL E 3 646 ? -5.464  67.512  26.704  1.00 45.40  ? 652  VAL A C     1 
ATOM   5272  O  O     . VAL E 3 646 ? -5.933  68.626  26.536  1.00 45.40  ? 652  VAL A O     1 
ATOM   5273  C  CB    . VAL E 3 646 ? -6.445  66.839  24.514  1.00 32.29  ? 652  VAL A CB    1 
ATOM   5274  C  CG1   . VAL E 3 646 ? -5.509  67.801  23.835  1.00 32.29  ? 652  VAL A CG1   1 
ATOM   5275  C  CG2   . VAL E 3 646 ? -6.725  65.647  23.644  1.00 32.29  ? 652  VAL A CG2   1 
ATOM   5276  N  N     . HIS E 3 647 ? -4.582  67.242  27.655  1.00 58.63  ? 653  HIS A N     1 
ATOM   5277  C  CA    . HIS E 3 647 ? -4.077  68.256  28.560  1.00 58.63  ? 653  HIS A CA    1 
ATOM   5278  C  C     . HIS E 3 647 ? -5.121  68.840  29.464  1.00 58.63  ? 653  HIS A C     1 
ATOM   5279  O  O     . HIS E 3 647 ? -5.412  68.266  30.499  1.00 58.63  ? 653  HIS A O     1 
ATOM   5280  C  CB    . HIS E 3 647 ? -3.409  69.338  27.756  1.00 60.63  ? 653  HIS A CB    1 
ATOM   5281  C  CG    . HIS E 3 647 ? -2.382  68.801  26.825  1.00 60.63  ? 653  HIS A CG    1 
ATOM   5282  N  ND1   . HIS E 3 647 ? -1.182  68.290  27.267  1.00 60.63  ? 653  HIS A ND1   1 
ATOM   5283  C  CD2   . HIS E 3 647 ? -2.410  68.608  25.489  1.00 60.63  ? 653  HIS A CD2   1 
ATOM   5284  C  CE1   . HIS E 3 647 ? -0.513  67.801  26.240  1.00 60.63  ? 653  HIS A CE1   1 
ATOM   5285  N  NE2   . HIS E 3 647 ? -1.237  67.981  25.149  1.00 60.63  ? 653  HIS A NE2   1 
ATOM   5286  N  N     . ASP E 3 648 ? -5.697  69.975  29.101  1.00 66.98  ? 654  ASP A N     1 
ATOM   5287  C  CA    . ASP E 3 648 ? -6.696  70.541  29.982  1.00 66.98  ? 654  ASP A CA    1 
ATOM   5288  C  C     . ASP E 3 648 ? -8.136  70.201  29.626  1.00 66.98  ? 654  ASP A C     1 
ATOM   5289  O  O     . ASP E 3 648 ? -9.059  70.884  30.046  1.00 66.98  ? 654  ASP A O     1 
ATOM   5290  C  CB    . ASP E 3 648 ? -6.523  72.047  30.103  1.00 62.50  ? 654  ASP A CB    1 
ATOM   5291  C  CG    . ASP E 3 648 ? -6.592  72.749  28.782  1.00 62.50  ? 654  ASP A CG    1 
ATOM   5292  O  OD1   . ASP E 3 648 ? -6.898  72.090  27.757  1.00 62.50  ? 654  ASP A OD1   1 
ATOM   5293  O  OD2   . ASP E 3 648 ? -6.335  73.973  28.788  1.00 62.50  ? 654  ASP A OD2   1 
ATOM   5294  N  N     . GLU E 3 649 ? -8.346  69.128  28.878  1.00 35.44  ? 655  GLU A N     1 
ATOM   5295  C  CA    . GLU E 3 649 ? -9.697  68.758  28.537  1.00 35.44  ? 655  GLU A CA    1 
ATOM   5296  C  C     . GLU E 3 649 ? -9.918  67.249  28.502  1.00 35.44  ? 655  GLU A C     1 
ATOM   5297  O  O     . GLU E 3 649 ? -8.976  66.474  28.423  1.00 35.44  ? 655  GLU A O     1 
ATOM   5298  C  CB    . GLU E 3 649 ? -10.072 69.376  27.196  1.00 70.23  ? 655  GLU A CB    1 
ATOM   5299  C  CG    . GLU E 3 649 ? -10.001 68.430  26.026  1.00 70.23  ? 655  GLU A CG    1 
ATOM   5300  C  CD    . GLU E 3 649 ? -10.009 69.174  24.713  1.00 70.23  ? 655  GLU A CD    1 
ATOM   5301  O  OE1   . GLU E 3 649 ? -10.229 68.540  23.646  1.00 70.23  ? 655  GLU A OE1   1 
ATOM   5302  O  OE2   . GLU E 3 649 ? -9.779  70.405  24.758  1.00 70.23  ? 655  GLU A OE2   1 
ATOM   5303  N  N     . ILE E 3 650 ? -11.180 66.838  28.577  1.00 52.28  ? 656  ILE A N     1 
ATOM   5304  C  CA    . ILE E 3 650 ? -11.528 65.430  28.535  1.00 52.28  ? 656  ILE A CA    1 
ATOM   5305  C  C     . ILE E 3 650 ? -12.830 65.255  27.799  1.00 52.28  ? 656  ILE A C     1 
ATOM   5306  O  O     . ILE E 3 650 ? -13.748 66.062  27.956  1.00 52.28  ? 656  ILE A O     1 
ATOM   5307  C  CB    . ILE E 3 650 ? -11.717 64.834  29.926  1.00 68.03  ? 656  ILE A CB    1 
ATOM   5308  C  CG1   . ILE E 3 650 ? -12.719 65.672  30.703  1.00 68.03  ? 656  ILE A CG1   1 
ATOM   5309  C  CG2   . ILE E 3 650 ? -10.398 64.756  30.638  1.00 68.03  ? 656  ILE A CG2   1 
ATOM   5310  C  CD1   . ILE E 3 650 ? -13.093 65.075  32.033  1.00 68.03  ? 656  ILE A CD1   1 
ATOM   5311  N  N     . GLN E 3 651 ? -12.895 64.186  27.008  1.00 53.71  ? 657  GLN A N     1 
ATOM   5312  C  CA    . GLN E 3 651 ? -14.064 63.859  26.224  1.00 53.71  ? 657  GLN A CA    1 
ATOM   5313  C  C     . GLN E 3 651 ? -14.657 62.555  26.706  1.00 53.71  ? 657  GLN A C     1 
ATOM   5314  O  O     . GLN E 3 651 ? -14.311 61.496  26.194  1.00 53.71  ? 657  GLN A O     1 
ATOM   5315  C  CB    . GLN E 3 651 ? -13.678 63.731  24.761  1.00 70.50  ? 657  GLN A CB    1 
ATOM   5316  C  CG    . GLN E 3 651 ? -13.071 64.991  24.198  1.00 70.50  ? 657  GLN A CG    1 
ATOM   5317  C  CD    . GLN E 3 651 ? -14.072 66.122  24.096  1.00 70.50  ? 657  GLN A CD    1 
ATOM   5318  O  OE1   . GLN E 3 651 ? -15.065 66.019  23.373  1.00 70.50  ? 657  GLN A OE1   1 
ATOM   5319  N  NE2   . GLN E 3 651 ? -13.817 67.210  24.817  1.00 70.50  ? 657  GLN A NE2   1 
ATOM   5320  N  N     . VAL E 3 652 ? -15.561 62.632  27.683  1.00 59.82  ? 658  VAL A N     1 
ATOM   5321  C  CA    . VAL E 3 652 ? -16.203 61.436  28.217  1.00 59.82  ? 658  VAL A CA    1 
ATOM   5322  C  C     . VAL E 3 652 ? -17.431 61.034  27.408  1.00 59.82  ? 658  VAL A C     1 
ATOM   5323  O  O     . VAL E 3 652 ? -18.174 61.887  26.910  1.00 59.82  ? 658  VAL A O     1 
ATOM   5324  C  CB    . VAL E 3 652 ? -16.675 61.614  29.667  1.00 48.78  ? 658  VAL A CB    1 
ATOM   5325  C  CG1   . VAL E 3 652 ? -16.931 60.253  30.278  1.00 48.78  ? 658  VAL A CG1   1 
ATOM   5326  C  CG2   . VAL E 3 652 ? -15.663 62.374  30.473  1.00 48.78  ? 658  VAL A CG2   1 
ATOM   5327  N  N     . GLY E 3 653 ? -17.626 59.724  27.283  1.00 66.74  ? 659  GLY A N     1 
ATOM   5328  C  CA    . GLY E 3 653 ? -18.773 59.188  26.571  1.00 66.74  ? 659  GLY A CA    1 
ATOM   5329  C  C     . GLY E 3 653 ? -19.827 58.771  27.592  1.00 66.74  ? 659  GLY A C     1 
ATOM   5330  O  O     . GLY E 3 653 ? -19.538 58.029  28.536  1.00 66.74  ? 659  GLY A O     1 
ATOM   5331  N  N     . CYS E 3 654 ? -21.053 59.248  27.405  1.00 87.25  ? 660  CYS A N     1 
ATOM   5332  C  CA    . CYS E 3 654 ? -22.149 58.952  28.318  1.00 87.25  ? 660  CYS A CA    1 
ATOM   5333  C  C     . CYS E 3 654 ? -23.263 58.186  27.598  1.00 87.25  ? 660  CYS A C     1 
ATOM   5334  O  O     . CYS E 3 654 ? -23.601 58.506  26.462  1.00 87.25  ? 660  CYS A O     1 
ATOM   5335  C  CB    . CYS E 3 654 ? -22.667 60.271  28.872  1.00 74.24  ? 660  CYS A CB    1 
ATOM   5336  S  SG    . CYS E 3 654 ? -21.325 61.403  29.344  1.00 74.24  ? 660  CYS A SG    1 
ATOM   5337  N  N     . ARG E 3 655 ? -23.819 57.168  28.249  1.00 62.17  ? 661  ARG A N     1 
ATOM   5338  C  CA    . ARG E 3 655 ? -24.871 56.362  27.635  1.00 62.17  ? 661  ARG A CA    1 
ATOM   5339  C  C     . ARG E 3 655 ? -26.205 57.109  27.460  1.00 62.17  ? 661  ARG A C     1 
ATOM   5340  O  O     . ARG E 3 655 ? -26.981 56.813  26.541  1.00 62.17  ? 661  ARG A O     1 
ATOM   5341  C  CB    . ARG E 3 655 ? -25.084 55.100  28.461  1.00 61.75  ? 661  ARG A CB    1 
ATOM   5342  C  CG    . ARG E 3 655 ? -26.216 54.221  27.967  1.00 61.75  ? 661  ARG A CG    1 
ATOM   5343  C  CD    . ARG E 3 655 ? -26.710 53.329  29.092  1.00 61.75  ? 661  ARG A CD    1 
ATOM   5344  N  NE    . ARG E 3 655 ? -26.896 54.123  30.304  1.00 61.75  ? 661  ARG A NE    1 
ATOM   5345  C  CZ    . ARG E 3 655 ? -27.199 53.624  31.495  1.00 61.75  ? 661  ARG A CZ    1 
ATOM   5346  N  NH1   . ARG E 3 655 ? -27.360 52.317  31.656  1.00 61.75  ? 661  ARG A NH1   1 
ATOM   5347  N  NH2   . ARG E 3 655 ? -27.331 54.440  32.527  1.00 61.75  ? 661  ARG A NH2   1 
ATOM   5348  N  N     . THR E 3 656 ? -26.460 58.078  28.343  1.00 66.49  ? 662  THR A N     1 
ATOM   5349  C  CA    . THR E 3 656 ? -27.682 58.879  28.312  1.00 66.49  ? 662  THR A CA    1 
ATOM   5350  C  C     . THR E 3 656 ? -27.373 60.335  28.638  1.00 66.49  ? 662  THR A C     1 
ATOM   5351  O  O     . THR E 3 656 ? -26.512 60.633  29.486  1.00 66.49  ? 662  THR A O     1 
ATOM   5352  C  CB    . THR E 3 656 ? -28.709 58.388  29.354  1.00 90.77  ? 662  THR A CB    1 
ATOM   5353  O  OG1   . THR E 3 656 ? -28.186 58.594  30.675  1.00 90.77  ? 662  THR A OG1   1 
ATOM   5354  C  CG2   . THR E 3 656 ? -29.016 56.906  29.148  1.00 90.77  ? 662  THR A CG2   1 
ATOM   5355  N  N     . GLU E 3 657 ? -28.092 61.234  27.967  1.00 119.22 ? 663  GLU A N     1 
ATOM   5356  C  CA    . GLU E 3 657 ? -27.932 62.669  28.163  1.00 119.22 ? 663  GLU A CA    1 
ATOM   5357  C  C     . GLU E 3 657 ? -27.947 62.996  29.660  1.00 119.22 ? 663  GLU A C     1 
ATOM   5358  O  O     . GLU E 3 657 ? -27.255 63.909  30.120  1.00 119.22 ? 663  GLU A O     1 
ATOM   5359  C  CB    . GLU E 3 657 ? -29.059 63.409  27.433  1.00 81.64  ? 663  GLU A CB    1 
ATOM   5360  N  N     . GLU E 3 658 ? -28.738 62.233  30.412  1.00 118.40 ? 664  GLU A N     1 
ATOM   5361  C  CA    . GLU E 3 658 ? -28.854 62.409  31.858  1.00 118.40 ? 664  GLU A CA    1 
ATOM   5362  C  C     . GLU E 3 658 ? -27.496 62.200  32.497  1.00 118.40 ? 664  GLU A C     1 
ATOM   5363  O  O     . GLU E 3 658 ? -26.973 63.087  33.172  1.00 118.40 ? 664  GLU A O     1 
ATOM   5364  C  CB    . GLU E 3 658 ? -29.843 61.396  32.440  1.00 142.36 ? 664  GLU A CB    1 
ATOM   5365  N  N     . ILE E 3 659 ? -26.933 61.014  32.281  1.00 118.99 ? 665  ILE A N     1 
ATOM   5366  C  CA    . ILE E 3 659 ? -25.617 60.680  32.825  1.00 118.99 ? 665  ILE A CA    1 
ATOM   5367  C  C     . ILE E 3 659 ? -24.634 61.757  32.367  1.00 118.99 ? 665  ILE A C     1 
ATOM   5368  O  O     . ILE E 3 659 ? -23.835 62.275  33.151  1.00 118.99 ? 665  ILE A O     1 
ATOM   5369  C  CB    . ILE E 3 659 ? -25.133 59.294  32.319  1.00 94.81  ? 665  ILE A CB    1 
ATOM   5370  N  N     . ALA E 3 660 ? -24.723 62.086  31.083  1.00 64.98  ? 666  ALA A N     1 
ATOM   5371  C  CA    . ALA E 3 660 ? -23.880 63.099  30.459  1.00 64.98  ? 666  ALA A CA    1 
ATOM   5372  C  C     . ALA E 3 660 ? -23.827 64.394  31.265  1.00 64.98  ? 666  ALA A C     1 
ATOM   5373  O  O     . ALA E 3 660 ? -22.761 64.971  31.462  1.00 64.98  ? 666  ALA A O     1 
ATOM   5374  C  CB    . ALA E 3 660 ? -24.395 63.389  29.044  1.00 35.11  ? 666  ALA A CB    1 
ATOM   5375  N  N     . GLN E 3 661 ? -24.985 64.848  31.729  1.00 100.00 ? 667  GLN A N     1 
ATOM   5376  C  CA    . GLN E 3 661 ? -25.046 66.089  32.485  1.00 100.00 ? 667  GLN A CA    1 
ATOM   5377  C  C     . GLN E 3 661 ? -24.427 65.942  33.869  1.00 100.00 ? 667  GLN A C     1 
ATOM   5378  O  O     . GLN E 3 661 ? -23.891 66.904  34.415  1.00 100.00 ? 667  GLN A O     1 
ATOM   5379  C  CB    . GLN E 3 661 ? -26.499 66.575  32.596  1.00 68.90  ? 667  GLN A CB    1 
ATOM   5380  N  N     . VAL E 3 662 ? -24.494 64.739  34.433  1.00 103.12 ? 668  VAL A N     1 
ATOM   5381  C  CA    . VAL E 3 662 ? -23.930 64.496  35.764  1.00 103.12 ? 668  VAL A CA    1 
ATOM   5382  C  C     . VAL E 3 662 ? -22.417 64.602  35.690  1.00 103.12 ? 668  VAL A C     1 
ATOM   5383  O  O     . VAL E 3 662 ? -21.786 65.260  36.513  1.00 103.12 ? 668  VAL A O     1 
ATOM   5384  C  CB    . VAL E 3 662 ? -24.257 63.076  36.298  1.00 110.46 ? 668  VAL A CB    1 
ATOM   5385  C  CG1   . VAL E 3 662 ? -23.823 62.960  37.762  1.00 110.46 ? 668  VAL A CG1   1 
ATOM   5386  C  CG2   . VAL E 3 662 ? -25.736 62.775  36.139  1.00 110.46 ? 668  VAL A CG2   1 
ATOM   5387  N  N     . VAL E 3 663 ? -21.847 63.928  34.698  1.00 97.17  ? 669  VAL A N     1 
ATOM   5388  C  CA    . VAL E 3 663 ? -20.413 63.934  34.491  1.00 97.17  ? 669  VAL A CA    1 
ATOM   5389  C  C     . VAL E 3 663 ? -19.942 65.378  34.412  1.00 97.17  ? 669  VAL A C     1 
ATOM   5390  O  O     . VAL E 3 663 ? -19.002 65.777  35.102  1.00 97.17  ? 669  VAL A O     1 
ATOM   5391  C  CB    . VAL E 3 663 ? -20.063 63.234  33.188  1.00 76.42  ? 669  VAL A CB    1 
ATOM   5392  C  CG1   . VAL E 3 663 ? -18.564 63.159  33.027  1.00 76.42  ? 669  VAL A CG1   1 
ATOM   5393  C  CG2   . VAL E 3 663 ? -20.692 61.852  33.170  1.00 76.42  ? 669  VAL A CG2   1 
ATOM   5394  N  N     . ILE E 3 664 ? -20.611 66.156  33.566  1.00 71.47  ? 670  ILE A N     1 
ATOM   5395  C  CA    . ILE E 3 664 ? -20.287 67.567  33.384  1.00 71.47  ? 670  ILE A CA    1 
ATOM   5396  C  C     . ILE E 3 664 ? -20.253 68.291  34.724  1.00 71.47  ? 670  ILE A C     1 
ATOM   5397  O  O     . ILE E 3 664 ? -19.472 69.223  34.929  1.00 71.47  ? 670  ILE A O     1 
ATOM   5398  C  CB    . ILE E 3 664 ? -21.350 68.268  32.540  1.00 35.04  ? 670  ILE A CB    1 
ATOM   5399  C  CG1   . ILE E 3 664 ? -21.694 67.403  31.324  1.00 35.04  ? 670  ILE A CG1   1 
ATOM   5400  C  CG2   . ILE E 3 664 ? -20.896 69.703  32.240  1.00 35.04  ? 670  ILE A CG2   1 
ATOM   5401  C  CD1   . ILE E 3 664 ? -21.492 68.071  29.967  1.00 35.04  ? 670  ILE A CD1   1 
ATOM   5402  N  N     . GLU E 3 665 ? -21.131 67.867  35.627  1.00 78.76  ? 671  GLU A N     1 
ATOM   5403  C  CA    . GLU E 3 665 ? -21.221 68.477  36.941  1.00 78.76  ? 671  GLU A CA    1 
ATOM   5404  C  C     . GLU E 3 665 ? -20.248 67.808  37.889  1.00 78.76  ? 671  GLU A C     1 
ATOM   5405  O  O     . GLU E 3 665 ? -19.698 68.458  38.780  1.00 78.76  ? 671  GLU A O     1 
ATOM   5406  C  CB    . GLU E 3 665 ? -22.646 68.362  37.488  1.00 103.06 ? 671  GLU A CB    1 
ATOM   5407  N  N     . THR E 3 666 ? -20.034 66.507  37.696  1.00 80.53  ? 672  THR A N     1 
ATOM   5408  C  CA    . THR E 3 666 ? -19.112 65.758  38.549  1.00 80.53  ? 672  THR A CA    1 
ATOM   5409  C  C     . THR E 3 666 ? -17.715 66.271  38.279  1.00 80.53  ? 672  THR A C     1 
ATOM   5410  O  O     . THR E 3 666 ? -16.880 66.380  39.179  1.00 80.53  ? 672  THR A O     1 
ATOM   5411  C  CB    . THR E 3 666 ? -19.120 64.272  38.233  1.00 81.95  ? 672  THR A CB    1 
ATOM   5412  O  OG1   . THR E 3 666 ? -20.465 63.841  37.986  1.00 81.95  ? 672  THR A OG1   1 
ATOM   5413  C  CG2   . THR E 3 666 ? -18.528 63.493  39.408  1.00 81.95  ? 672  THR A CG2   1 
ATOM   5414  N  N     . ALA E 3 667 ? -17.480 66.574  37.011  1.00 78.85  ? 673  ALA A N     1 
ATOM   5415  C  CA    . ALA E 3 667 ? -16.211 67.100  36.574  1.00 78.85  ? 673  ALA A CA    1 
ATOM   5416  C  C     . ALA E 3 667 ? -15.946 68.403  37.326  1.00 78.85  ? 673  ALA A C     1 
ATOM   5417  O  O     . ALA E 3 667 ? -14.797 68.741  37.628  1.00 78.85  ? 673  ALA A O     1 
ATOM   5418  C  CB    . ALA E 3 667 ? -16.261 67.348  35.080  1.00 92.38  ? 673  ALA A CB    1 
ATOM   5419  N  N     . GLN E 3 668 ? -17.020 69.125  37.636  1.00 93.44  ? 674  GLN A N     1 
ATOM   5420  C  CA    . GLN E 3 668 ? -16.911 70.395  38.345  1.00 93.44  ? 674  GLN A CA    1 
ATOM   5421  C  C     . GLN E 3 668 ? -16.376 70.220  39.755  1.00 93.44  ? 674  GLN A C     1 
ATOM   5422  O  O     . GLN E 3 668 ? -15.291 70.706  40.077  1.00 93.44  ? 674  GLN A O     1 
ATOM   5423  C  CB    . GLN E 3 668 ? -18.266 71.082  38.422  1.00 71.82  ? 674  GLN A CB    1 
ATOM   5424  C  CG    . GLN E 3 668 ? -18.205 72.462  39.039  1.00 71.82  ? 674  GLN A CG    1 
ATOM   5425  C  CD    . GLN E 3 668 ? -17.333 73.394  38.238  1.00 71.82  ? 674  GLN A CD    1 
ATOM   5426  O  OE1   . GLN E 3 668 ? -17.473 73.487  37.018  1.00 71.82  ? 674  GLN A OE1   1 
ATOM   5427  N  NE2   . GLN E 3 668 ? -16.429 74.098  38.913  1.00 71.82  ? 674  GLN A NE2   1 
ATOM   5428  N  N     . GLU E 3 669 ? -17.149 69.536  40.596  1.00 117.89 ? 675  GLU A N     1 
ATOM   5429  C  CA    . GLU E 3 669 ? -16.761 69.292  41.982  1.00 117.89 ? 675  GLU A CA    1 
ATOM   5430  C  C     . GLU E 3 669 ? -15.303 68.861  42.038  1.00 117.89 ? 675  GLU A C     1 
ATOM   5431  O  O     . GLU E 3 669 ? -14.476 69.521  42.672  1.00 117.89 ? 675  GLU A O     1 
ATOM   5432  C  CB    . GLU E 3 669 ? -17.645 68.200  42.591  1.00 104.91 ? 675  GLU A CB    1 
ATOM   5433  N  N     . ALA E 3 670 ? -15.012 67.752  41.356  1.00 81.75  ? 676  ALA A N     1 
ATOM   5434  C  CA    . ALA E 3 670 ? -13.674 67.166  41.267  1.00 81.75  ? 676  ALA A CA    1 
ATOM   5435  C  C     . ALA E 3 670 ? -12.602 68.230  41.183  1.00 81.75  ? 676  ALA A C     1 
ATOM   5436  O  O     . ALA E 3 670 ? -11.641 68.226  41.960  1.00 81.75  ? 676  ALA A O     1 
ATOM   5437  C  CB    . ALA E 3 670 ? -13.590 66.275  40.036  1.00 46.68  ? 676  ALA A CB    1 
ATOM   5438  N  N     . MET E 3 671 ? -12.774 69.129  40.217  1.00 82.35  ? 677  MET A N     1 
ATOM   5439  C  CA    . MET E 3 671 ? -11.824 70.215  40.000  1.00 82.35  ? 677  MET A CA    1 
ATOM   5440  C  C     . MET E 3 671 ? -11.722 71.066  41.255  1.00 82.35  ? 677  MET A C     1 
ATOM   5441  O  O     . MET E 3 671 ? -10.624 71.274  41.787  1.00 82.35  ? 677  MET A O     1 
ATOM   5442  C  CB    . MET E 3 671 ? -12.256 71.081  38.811  1.00 79.93  ? 677  MET A CB    1 
ATOM   5443  C  CG    . MET E 3 671 ? -11.323 72.263  38.523  1.00 79.93  ? 677  MET A CG    1 
ATOM   5444  S  SD    . MET E 3 671 ? -9.625  71.796  38.110  1.00 79.93  ? 677  MET A SD    1 
ATOM   5445  C  CE    . MET E 3 671 ? -9.864  71.073  36.468  1.00 79.93  ? 677  MET A CE    1 
ATOM   5446  N  N     . ARG E 3 672 ? -12.875 71.548  41.721  1.00 104.45 ? 678  ARG A N     1 
ATOM   5447  C  CA    . ARG E 3 672 ? -12.939 72.372  42.921  1.00 104.45 ? 678  ARG A CA    1 
ATOM   5448  C  C     . ARG E 3 672 ? -12.192 71.655  44.044  1.00 104.45 ? 678  ARG A C     1 
ATOM   5449  O  O     . ARG E 3 672 ? -11.431 72.271  44.789  1.00 104.45 ? 678  ARG A O     1 
ATOM   5450  C  CB    . ARG E 3 672 ? -14.398 72.604  43.324  1.00 67.56  ? 678  ARG A CB    1 
ATOM   5451  C  CG    . ARG E 3 672 ? -15.032 73.912  42.828  1.00 67.56  ? 678  ARG A CG    1 
ATOM   5452  C  CD    . ARG E 3 672 ? -14.089 75.123  43.002  1.00 67.56  ? 678  ARG A CD    1 
ATOM   5453  N  NE    . ARG E 3 672 ? -14.739 76.451  43.066  1.00 67.56  ? 678  ARG A NE    1 
ATOM   5454  C  CZ    . ARG E 3 672 ? -15.748 76.885  42.304  1.00 67.56  ? 678  ARG A CZ    1 
ATOM   5455  N  NH1   . ARG E 3 672 ? -16.309 76.116  41.376  1.00 67.56  ? 678  ARG A NH1   1 
ATOM   5456  N  NH2   . ARG E 3 672 ? -16.166 78.133  42.435  1.00 67.56  ? 678  ARG A NH2   1 
ATOM   5457  N  N     . TRP E 3 673 ? -12.416 70.346  44.142  1.00 73.91  ? 679  TRP A N     1 
ATOM   5458  C  CA    . TRP E 3 673 ? -11.777 69.500  45.146  1.00 73.91  ? 679  TRP A CA    1 
ATOM   5459  C  C     . TRP E 3 673 ? -10.270 69.653  45.036  1.00 73.91  ? 679  TRP A C     1 
ATOM   5460  O  O     . TRP E 3 673 ? -9.582  70.038  45.984  1.00 73.91  ? 679  TRP A O     1 
ATOM   5461  C  CB    . TRP E 3 673 ? -12.138 68.041  44.898  1.00 74.13  ? 679  TRP A CB    1 
ATOM   5462  C  CG    . TRP E 3 673 ? -11.652 67.132  45.961  1.00 74.13  ? 679  TRP A CG    1 
ATOM   5463  C  CD1   . TRP E 3 673 ? -12.337 66.728  47.058  1.00 74.13  ? 679  TRP A CD1   1 
ATOM   5464  C  CD2   . TRP E 3 673 ? -10.357 66.527  46.051  1.00 74.13  ? 679  TRP A CD2   1 
ATOM   5465  N  NE1   . TRP E 3 673 ? -11.562 65.909  47.829  1.00 74.13  ? 679  TRP A NE1   1 
ATOM   5466  C  CE2   . TRP E 3 673 ? -10.336 65.768  47.235  1.00 74.13  ? 679  TRP A CE2   1 
ATOM   5467  C  CE3   . TRP E 3 673 ? -9.209  66.553  45.245  1.00 74.13  ? 679  TRP A CE3   1 
ATOM   5468  C  CZ2   . TRP E 3 673 ? -9.204  65.037  47.642  1.00 74.13  ? 679  TRP A CZ2   1 
ATOM   5469  C  CZ3   . TRP E 3 673 ? -8.088  65.825  45.651  1.00 74.13  ? 679  TRP A CZ3   1 
ATOM   5470  C  CH2   . TRP E 3 673 ? -8.098  65.080  46.839  1.00 74.13  ? 679  TRP A CH2   1 
ATOM   5471  N  N     . VAL E 3 674 ? -9.765  69.326  43.856  1.00 62.07  ? 680  VAL A N     1 
ATOM   5472  C  CA    . VAL E 3 674 ? -8.350  69.418  43.572  1.00 62.07  ? 680  VAL A CA    1 
ATOM   5473  C  C     . VAL E 3 674 ? -7.817  70.760  44.054  1.00 62.07  ? 680  VAL A C     1 
ATOM   5474  O  O     . VAL E 3 674 ? -6.634  70.897  44.378  1.00 62.07  ? 680  VAL A O     1 
ATOM   5475  C  CB    . VAL E 3 674 ? -8.123  69.282  42.066  1.00 75.45  ? 680  VAL A CB    1 
ATOM   5476  C  CG1   . VAL E 3 674 ? -6.666  69.525  41.717  1.00 75.45  ? 680  VAL A CG1   1 
ATOM   5477  C  CG2   . VAL E 3 674 ? -8.560  67.906  41.626  1.00 75.45  ? 680  VAL A CG2   1 
ATOM   5478  N  N     . GLY E 3 675 ? -8.706  71.749  44.099  1.00 61.02  ? 681  GLY A N     1 
ATOM   5479  C  CA    . GLY E 3 675 ? -8.324  73.081  44.542  1.00 61.02  ? 681  GLY A CA    1 
ATOM   5480  C  C     . GLY E 3 675 ? -8.013  73.136  46.026  1.00 61.02  ? 681  GLY A C     1 
ATOM   5481  O  O     . GLY E 3 675 ? -6.896  73.495  46.429  1.00 61.02  ? 681  GLY A O     1 
ATOM   5482  N  N     . ASP E 3 676 ? -9.001  72.785  46.842  1.00 65.78  ? 682  ASP A N     1 
ATOM   5483  C  CA    . ASP E 3 676 ? -8.824  72.774  48.283  1.00 65.78  ? 682  ASP A CA    1 
ATOM   5484  C  C     . ASP E 3 676 ? -7.673  71.817  48.589  1.00 65.78  ? 682  ASP A C     1 
ATOM   5485  O  O     . ASP E 3 676 ? -6.758  72.132  49.357  1.00 65.78  ? 682  ASP A O     1 
ATOM   5486  C  CB    . ASP E 3 676 ? -10.112 72.287  48.957  1.00 107.19 ? 682  ASP A CB    1 
ATOM   5487  C  CG    . ASP E 3 676 ? -10.090 72.458  50.469  1.00 107.19 ? 682  ASP A CG    1 
ATOM   5488  O  OD1   . ASP E 3 676 ? -10.177 73.608  50.949  1.00 107.19 ? 682  ASP A OD1   1 
ATOM   5489  O  OD2   . ASP E 3 676 ? -9.982  71.439  51.183  1.00 107.19 ? 682  ASP A OD2   1 
ATOM   5490  N  N     . HIS E 3 677 ? -7.708  70.649  47.961  1.00 65.00  ? 683  HIS A N     1 
ATOM   5491  C  CA    . HIS E 3 677 ? -6.661  69.671  48.197  1.00 65.00  ? 683  HIS A CA    1 
ATOM   5492  C  C     . HIS E 3 677 ? -5.246  70.227  48.065  1.00 65.00  ? 683  HIS A C     1 
ATOM   5493  O  O     . HIS E 3 677 ? -4.374  69.842  48.828  1.00 65.00  ? 683  HIS A O     1 
ATOM   5494  C  CB    . HIS E 3 677 ? -6.817  68.434  47.291  1.00 56.01  ? 683  HIS A CB    1 
ATOM   5495  C  CG    . HIS E 3 677 ? -5.729  67.410  47.474  1.00 56.01  ? 683  HIS A CG    1 
ATOM   5496  N  ND1   . HIS E 3 677 ? -5.097  67.202  48.682  1.00 56.01  ? 683  HIS A ND1   1 
ATOM   5497  C  CD2   . HIS E 3 677 ? -5.170  66.536  46.606  1.00 56.01  ? 683  HIS A CD2   1 
ATOM   5498  C  CE1   . HIS E 3 677 ? -4.196  66.247  48.549  1.00 56.01  ? 683  HIS A CE1   1 
ATOM   5499  N  NE2   . HIS E 3 677 ? -4.222  65.826  47.298  1.00 56.01  ? 683  HIS A NE2   1 
ATOM   5500  N  N     . TRP E 3 678 ? -4.989  71.121  47.118  1.00 69.66  ? 684  TRP A N     1 
ATOM   5501  C  CA    . TRP E 3 678 ? -3.633  71.633  47.010  1.00 69.66  ? 684  TRP A CA    1 
ATOM   5502  C  C     . TRP E 3 678 ? -3.479  73.059  47.484  1.00 69.66  ? 684  TRP A C     1 
ATOM   5503  O  O     . TRP E 3 678 ? -2.469  73.739  47.202  1.00 69.66  ? 684  TRP A O     1 
ATOM   5504  C  CB    . TRP E 3 678 ? -3.118  71.479  45.589  1.00 81.25  ? 684  TRP A CB    1 
ATOM   5505  C  CG    . TRP E 3 678 ? -2.605  70.106  45.330  1.00 81.25  ? 684  TRP A CG    1 
ATOM   5506  C  CD1   . TRP E 3 678 ? -1.855  69.336  46.178  1.00 81.25  ? 684  TRP A CD1   1 
ATOM   5507  C  CD2   . TRP E 3 678 ? -2.733  69.364  44.119  1.00 81.25  ? 684  TRP A CD2   1 
ATOM   5508  N  NE1   . TRP E 3 678 ? -1.506  68.160  45.562  1.00 81.25  ? 684  TRP A NE1   1 
ATOM   5509  C  CE2   . TRP E 3 678 ? -2.030  68.152  44.296  1.00 81.25  ? 684  TRP A CE2   1 
ATOM   5510  C  CE3   . TRP E 3 678 ? -3.370  69.606  42.898  1.00 81.25  ? 684  TRP A CE3   1 
ATOM   5511  C  CZ2   . TRP E 3 678 ? -1.945  67.187  43.297  1.00 81.25  ? 684  TRP A CZ2   1 
ATOM   5512  C  CZ3   . TRP E 3 678 ? -3.284  68.648  41.910  1.00 81.25  ? 684  TRP A CZ3   1 
ATOM   5513  C  CH2   . TRP E 3 678 ? -2.575  67.451  42.115  1.00 81.25  ? 684  TRP A CH2   1 
ATOM   5514  N  N     . ASN E 3 679 ? -4.485  73.487  48.239  1.00 107.24 ? 685  ASN A N     1 
ATOM   5515  C  CA    . ASN E 3 679 ? -4.519  74.818  48.812  1.00 107.24 ? 685  ASN A CA    1 
ATOM   5516  C  C     . ASN E 3 679 ? -4.260  75.851  47.738  1.00 107.24 ? 685  ASN A C     1 
ATOM   5517  O  O     . ASN E 3 679 ? -3.451  76.759  47.924  1.00 107.24 ? 685  ASN A O     1 
ATOM   5518  C  CB    . ASN E 3 679 ? -3.473  74.928  49.923  1.00 84.95  ? 685  ASN A CB    1 
ATOM   5519  C  CG    . ASN E 3 679 ? -3.604  73.818  50.953  1.00 84.95  ? 685  ASN A CG    1 
ATOM   5520  O  OD1   . ASN E 3 679 ? -4.685  73.586  51.500  1.00 84.95  ? 685  ASN A OD1   1 
ATOM   5521  N  ND2   . ASN E 3 679 ? -2.500  73.128  51.222  1.00 84.95  ? 685  ASN A ND2   1 
ATOM   5522  N  N     . PHE E 3 680 ? -4.938  75.695  46.605  1.00 117.41 ? 686  PHE A N     1 
ATOM   5523  C  CA    . PHE E 3 680 ? -4.782  76.634  45.506  1.00 117.41 ? 686  PHE A CA    1 
ATOM   5524  C  C     . PHE E 3 680 ? -5.341  77.964  45.989  1.00 117.41 ? 686  PHE A C     1 
ATOM   5525  O  O     . PHE E 3 680 ? -6.362  77.997  46.674  1.00 117.41 ? 686  PHE A O     1 
ATOM   5526  C  CB    . PHE E 3 680 ? -5.552  76.153  44.272  1.00 87.43  ? 686  PHE A CB    1 
ATOM   5527  N  N     . ARG E 3 681 ? -4.665  79.056  45.646  1.00 72.58  ? 687  ARG A N     1 
ATOM   5528  C  CA    . ARG E 3 681 ? -5.102  80.383  46.069  1.00 72.58  ? 687  ARG A CA    1 
ATOM   5529  C  C     . ARG E 3 681 ? -6.023  81.051  45.040  1.00 72.58  ? 687  ARG A C     1 
ATOM   5530  O  O     . ARG E 3 681 ? -6.451  82.189  45.226  1.00 72.58  ? 687  ARG A O     1 
ATOM   5531  C  CB    . ARG E 3 681 ? -3.879  81.269  46.364  1.00 21.70  ? 687  ARG A CB    1 
ATOM   5532  N  N     . CYS E 3 682 ? -6.331  80.332  43.967  1.00 49.15  ? 688  CYS A N     1 
ATOM   5533  C  CA    . CYS E 3 682 ? -7.201  80.856  42.934  1.00 49.15  ? 688  CYS A CA    1 
ATOM   5534  C  C     . CYS E 3 682 ? -8.234  79.813  42.538  1.00 49.15  ? 688  CYS A C     1 
ATOM   5535  O  O     . CYS E 3 682 ? -7.904  78.831  41.875  1.00 49.15  ? 688  CYS A O     1 
ATOM   5536  C  CB    . CYS E 3 682 ? -6.392  81.264  41.698  1.00 83.41  ? 688  CYS A CB    1 
ATOM   5537  S  SG    . CYS E 3 682 ? -7.426  81.792  40.295  1.00 83.41  ? 688  CYS A SG    1 
ATOM   5538  N  N     . LEU E 3 683 ? -9.485  80.023  42.936  1.00 85.44  ? 689  LEU A N     1 
ATOM   5539  C  CA    . LEU E 3 683 ? -10.543 79.075  42.605  1.00 85.44  ? 689  LEU A CA    1 
ATOM   5540  C  C     . LEU E 3 683 ? -10.391 78.617  41.148  1.00 85.44  ? 689  LEU A C     1 
ATOM   5541  O  O     . LEU E 3 683 ? -10.300 79.440  40.239  1.00 85.44  ? 689  LEU A O     1 
ATOM   5542  C  CB    . LEU E 3 683 ? -11.918 79.722  42.827  1.00 60.15  ? 689  LEU A CB    1 
ATOM   5543  N  N     . LEU E 3 684 ? -10.333 77.303  40.945  1.00 87.37  ? 690  LEU A N     1 
ATOM   5544  C  CA    . LEU E 3 684 ? -10.190 76.730  39.611  1.00 87.37  ? 690  LEU A CA    1 
ATOM   5545  C  C     . LEU E 3 684 ? -11.574 76.343  39.135  1.00 87.37  ? 690  LEU A C     1 
ATOM   5546  O  O     . LEU E 3 684 ? -12.475 76.147  39.944  1.00 87.37  ? 690  LEU A O     1 
ATOM   5547  C  CB    . LEU E 3 684 ? -9.316  75.478  39.653  1.00 50.13  ? 690  LEU A CB    1 
ATOM   5548  C  CG    . LEU E 3 684 ? -8.015  75.602  40.435  1.00 50.13  ? 690  LEU A CG    1 
ATOM   5549  C  CD1   . LEU E 3 684 ? -7.443  74.222  40.594  1.00 50.13  ? 690  LEU A CD1   1 
ATOM   5550  C  CD2   . LEU E 3 684 ? -7.038  76.539  39.743  1.00 50.13  ? 690  LEU A CD2   1 
ATOM   5551  N  N     . ASP E 3 685 ? -11.739 76.211  37.825  1.00 70.59  ? 691  ASP A N     1 
ATOM   5552  C  CA    . ASP E 3 685 ? -13.035 75.852  37.282  1.00 70.59  ? 691  ASP A CA    1 
ATOM   5553  C  C     . ASP E 3 685 ? -12.955 75.056  35.990  1.00 70.59  ? 691  ASP A C     1 
ATOM   5554  O  O     . ASP E 3 685 ? -11.876 74.781  35.475  1.00 70.59  ? 691  ASP A O     1 
ATOM   5555  C  CB    . ASP E 3 685 ? -13.865 77.117  37.057  1.00 150.60 ? 691  ASP A CB    1 
ATOM   5556  C  CG    . ASP E 3 685 ? -14.214 77.818  38.351  1.00 150.60 ? 691  ASP A CG    1 
ATOM   5557  O  OD1   . ASP E 3 685 ? -15.026 77.263  39.120  1.00 150.60 ? 691  ASP A OD1   1 
ATOM   5558  O  OD2   . ASP E 3 685 ? -13.675 78.916  38.605  1.00 150.60 ? 691  ASP A OD2   1 
ATOM   5559  N  N     . THR E 3 686 ? -14.130 74.700  35.484  1.00 67.75  ? 692  THR A N     1 
ATOM   5560  C  CA    . THR E 3 686 ? -14.276 73.923  34.268  1.00 67.75  ? 692  THR A CA    1 
ATOM   5561  C  C     . THR E 3 686 ? -15.558 74.395  33.590  1.00 67.75  ? 692  THR A C     1 
ATOM   5562  O  O     . THR E 3 686 ? -16.429 74.972  34.242  1.00 67.75  ? 692  THR A O     1 
ATOM   5563  C  CB    . THR E 3 686 ? -14.428 72.418  34.597  1.00 75.92  ? 692  THR A CB    1 
ATOM   5564  O  OG1   . THR E 3 686 ? -15.744 72.171  35.114  1.00 75.92  ? 692  THR A OG1   1 
ATOM   5565  C  CG2   . THR E 3 686 ? -13.404 71.990  35.646  1.00 75.92  ? 692  THR A CG2   1 
ATOM   5566  N  N     . GLU E 3 687 ? -15.677 74.152  32.291  1.00 45.85  ? 693  GLU A N     1 
ATOM   5567  C  CA    . GLU E 3 687 ? -16.874 74.546  31.563  1.00 45.85  ? 693  GLU A CA    1 
ATOM   5568  C  C     . GLU E 3 687 ? -17.327 73.333  30.774  1.00 45.85  ? 693  GLU A C     1 
ATOM   5569  O  O     . GLU E 3 687 ? -16.592 72.834  29.926  1.00 45.85  ? 693  GLU A O     1 
ATOM   5570  C  CB    . GLU E 3 687 ? -16.571 75.702  30.604  1.00 78.28  ? 693  GLU A CB    1 
ATOM   5571  N  N     . GLY E 3 688 ? -18.536 72.854  31.045  1.00 75.78  ? 694  GLY A N     1 
ATOM   5572  C  CA    . GLY E 3 688 ? -19.010 71.681  30.342  1.00 75.78  ? 694  GLY A CA    1 
ATOM   5573  C  C     . GLY E 3 688 ? -19.770 71.967  29.070  1.00 75.78  ? 694  GLY A C     1 
ATOM   5574  O  O     . GLY E 3 688 ? -20.200 73.096  28.826  1.00 75.78  ? 694  GLY A O     1 
ATOM   5575  N  N     . LYS E 3 689 ? -19.925 70.924  28.260  1.00 49.97  ? 695  LYS A N     1 
ATOM   5576  C  CA    . LYS E 3 689 ? -20.653 71.005  27.010  1.00 49.97  ? 695  LYS A CA    1 
ATOM   5577  C  C     . LYS E 3 689 ? -21.028 69.589  26.598  1.00 49.97  ? 695  LYS A C     1 
ATOM   5578  O  O     . LYS E 3 689 ? -20.209 68.683  26.623  1.00 49.97  ? 695  LYS A O     1 
ATOM   5579  C  CB    . LYS E 3 689 ? -19.794 71.681  25.946  1.00 49.70  ? 695  LYS A CB    1 
ATOM   5580  N  N     . MET E 3 690 ? -22.285 69.399  26.233  1.00 76.23  ? 696  MET A N     1 
ATOM   5581  C  CA    . MET E 3 690 ? -22.781 68.092  25.827  1.00 76.23  ? 696  MET A CA    1 
ATOM   5582  C  C     . MET E 3 690 ? -23.035 68.071  24.318  1.00 76.23  ? 696  MET A C     1 
ATOM   5583  O  O     . MET E 3 690 ? -23.433 69.079  23.725  1.00 76.23  ? 696  MET A O     1 
ATOM   5584  C  CB    . MET E 3 690 ? -24.076 67.791  26.583  1.00 93.01  ? 696  MET A CB    1 
ATOM   5585  C  CG    . MET E 3 690 ? -24.724 66.459  26.256  1.00 93.01  ? 696  MET A CG    1 
ATOM   5586  S  SD    . MET E 3 690 ? -26.299 66.309  27.112  1.00 93.01  ? 696  MET A SD    1 
ATOM   5587  C  CE    . MET E 3 690 ? -25.785 66.743  28.770  1.00 93.01  ? 696  MET A CE    1 
ATOM   5588  N  N     . GLY E 3 691 ? -22.806 66.918  23.702  1.00 73.57  ? 697  GLY A N     1 
ATOM   5589  C  CA    . GLY E 3 691 ? -23.003 66.795  22.271  1.00 73.57  ? 697  GLY A CA    1 
ATOM   5590  C  C     . GLY E 3 691 ? -22.730 65.395  21.753  1.00 73.57  ? 697  GLY A C     1 
ATOM   5591  O  O     . GLY E 3 691 ? -22.443 64.479  22.525  1.00 73.57  ? 697  GLY A O     1 
ATOM   5592  N  N     . PRO E 3 692 ? -22.804 65.205  20.431  1.00 68.71  ? 698  PRO A N     1 
ATOM   5593  C  CA    . PRO E 3 692 ? -22.580 63.929  19.744  1.00 68.71  ? 698  PRO A CA    1 
ATOM   5594  C  C     . PRO E 3 692 ? -21.123 63.597  19.390  1.00 68.71  ? 698  PRO A C     1 
ATOM   5595  O  O     . PRO E 3 692 ? -20.741 62.429  19.381  1.00 68.71  ? 698  PRO A O     1 
ATOM   5596  C  CB    . PRO E 3 692 ? -23.447 64.076  18.506  1.00 49.62  ? 698  PRO A CB    1 
ATOM   5597  C  CG    . PRO E 3 692 ? -23.243 65.511  18.170  1.00 49.62  ? 698  PRO A CG    1 
ATOM   5598  C  CD    . PRO E 3 692 ? -23.333 66.214  19.497  1.00 49.62  ? 698  PRO A CD    1 
ATOM   5599  N  N     . ASN E 3 693 ? -20.320 64.619  19.099  1.00 67.30  ? 699  ASN A N     1 
ATOM   5600  C  CA    . ASN E 3 693 ? -18.930 64.409  18.723  1.00 67.30  ? 699  ASN A CA    1 
ATOM   5601  C  C     . ASN E 3 693 ? -18.010 65.536  19.167  1.00 67.30  ? 699  ASN A C     1 
ATOM   5602  O  O     . ASN E 3 693 ? -18.466 66.628  19.492  1.00 67.30  ? 699  ASN A O     1 
ATOM   5603  C  CB    . ASN E 3 693 ? -18.836 64.266  17.218  1.00 59.54  ? 699  ASN A CB    1 
ATOM   5604  C  CG    . ASN E 3 693 ? -19.296 65.502  16.506  1.00 59.54  ? 699  ASN A CG    1 
ATOM   5605  O  OD1   . ASN E 3 693 ? -18.827 66.596  16.787  1.00 59.54  ? 699  ASN A OD1   1 
ATOM   5606  N  ND2   . ASN E 3 693 ? -20.219 65.339  15.577  1.00 59.54  ? 699  ASN A ND2   1 
ATOM   5607  N  N     . TRP E 3 694 ? -16.707 65.252  19.149  1.00 82.44  ? 700  TRP A N     1 
ATOM   5608  C  CA    . TRP E 3 694 ? -15.643 66.180  19.552  1.00 82.44  ? 700  TRP A CA    1 
ATOM   5609  C  C     . TRP E 3 694 ? -15.773 67.548  18.904  1.00 82.44  ? 700  TRP A C     1 
ATOM   5610  O  O     . TRP E 3 694 ? -15.293 68.548  19.439  1.00 82.44  ? 700  TRP A O     1 
ATOM   5611  C  CB    . TRP E 3 694 ? -14.295 65.590  19.147  1.00 51.45  ? 700  TRP A CB    1 
ATOM   5612  C  CG    . TRP E 3 694 ? -13.115 66.030  19.961  1.00 51.45  ? 700  TRP A CG    1 
ATOM   5613  C  CD1   . TRP E 3 694 ? -13.052 67.063  20.854  1.00 51.45  ? 700  TRP A CD1   1 
ATOM   5614  C  CD2   . TRP E 3 694 ? -11.839 65.395  19.994  1.00 51.45  ? 700  TRP A CD2   1 
ATOM   5615  N  NE1   . TRP E 3 694 ? -11.811 67.100  21.452  1.00 51.45  ? 700  TRP A NE1   1 
ATOM   5616  C  CE2   . TRP E 3 694 ? -11.049 66.085  20.939  1.00 51.45  ? 700  TRP A CE2   1 
ATOM   5617  C  CE3   . TRP E 3 694 ? -11.285 64.303  19.316  1.00 51.45  ? 700  TRP A CE3   1 
ATOM   5618  C  CZ2   . TRP E 3 694 ? -9.739  65.715  21.222  1.00 51.45  ? 700  TRP A CZ2   1 
ATOM   5619  C  CZ3   . TRP E 3 694 ? -9.983  63.937  19.597  1.00 51.45  ? 700  TRP A CZ3   1 
ATOM   5620  C  CH2   . TRP E 3 694 ? -9.224  64.640  20.542  1.00 51.45  ? 700  TRP A CH2   1 
ATOM   5621  N  N     . ALA E 3 695 ? -16.411 67.572  17.739  1.00 71.45  ? 701  ALA A N     1 
ATOM   5622  C  CA    . ALA E 3 695 ? -16.586 68.794  16.961  1.00 71.45  ? 701  ALA A CA    1 
ATOM   5623  C  C     . ALA E 3 695 ? -17.575 69.775  17.565  1.00 71.45  ? 701  ALA A C     1 
ATOM   5624  O  O     . ALA E 3 695 ? -17.372 70.988  17.531  1.00 71.45  ? 701  ALA A O     1 
ATOM   5625  C  CB    . ALA E 3 695 ? -17.004 68.440  15.537  1.00 15.29  ? 701  ALA A CB    1 
ATOM   5626  N  N     . ILE E 3 696 ? -18.645 69.244  18.129  1.00 77.82  ? 702  ILE A N     1 
ATOM   5627  C  CA    . ILE E 3 696 ? -19.679 70.069  18.719  1.00 77.82  ? 702  ILE A CA    1 
ATOM   5628  C  C     . ILE E 3 696 ? -19.437 70.307  20.203  1.00 77.82  ? 702  ILE A C     1 
ATOM   5629  O  O     . ILE E 3 696 ? -20.063 71.178  20.807  1.00 77.82  ? 702  ILE A O     1 
ATOM   5630  C  CB    . ILE E 3 696 ? -21.052 69.410  18.493  1.00 73.91  ? 702  ILE A CB    1 
ATOM   5631  C  CG1   . ILE E 3 696 ? -21.250 69.196  16.984  1.00 73.91  ? 702  ILE A CG1   1 
ATOM   5632  C  CG2   . ILE E 3 696 ? -22.152 70.269  19.076  1.00 73.91  ? 702  ILE A CG2   1 
ATOM   5633  C  CD1   . ILE E 3 696 ? -22.373 68.272  16.600  1.00 73.91  ? 702  ILE A CD1   1 
ATOM   5634  N  N     . CYS E 3 697 ? -18.517 69.544  20.789  1.00 74.81  ? 703  CYS A N     1 
ATOM   5635  C  CA    . CYS E 3 697 ? -18.205 69.690  22.206  1.00 74.81  ? 703  CYS A CA    1 
ATOM   5636  C  C     . CYS E 3 697 ? -17.010 70.600  22.397  1.00 74.81  ? 703  CYS A C     1 
ATOM   5637  O  O     . CYS E 3 697 ? -16.349 70.548  23.425  1.00 74.81  ? 703  CYS A O     1 
ATOM   5638  C  CB    . CYS E 3 697 ? -17.929 68.326  22.825  1.00 88.03  ? 703  CYS A CB    1 
ATOM   5639  S  SG    . CYS E 3 697 ? -19.280 67.150  22.522  1.00 88.03  ? 703  CYS A SG    1 
ATOM   5640  N  N     . HIS E 3 698 ? -16.751 71.441  21.396  1.00 89.15  ? 704  HIS A N     1 
ATOM   5641  C  CA    . HIS E 3 698 ? -15.638 72.387  21.429  1.00 89.15  ? 704  HIS A CA    1 
ATOM   5642  C  C     . HIS E 3 698 ? -15.662 73.308  20.199  1.00 89.15  ? 704  HIS A C     1 
ATOM   5643  O  O     . HIS E 3 698 ? -15.017 74.386  20.249  1.00 89.15  ? 704  HIS A O     1 
ATOM   5644  C  CB    . HIS E 3 698 ? -14.314 71.617  21.490  1.00 67.54  ? 704  HIS A CB    1 
ATOM   5645  N  N     . LYS F 4 3   ? 25.338  81.250  -38.408 1.00 80.11  ? 3    LYS B N     1 
ATOM   5646  C  CA    . LYS F 4 3   ? 25.907  79.911  -38.745 1.00 80.11  ? 3    LYS B CA    1 
ATOM   5647  C  C     . LYS F 4 3   ? 25.027  78.742  -38.274 1.00 80.11  ? 3    LYS B C     1 
ATOM   5648  O  O     . LYS F 4 3   ? 24.399  78.058  -39.090 1.00 80.11  ? 3    LYS B O     1 
ATOM   5649  C  CB    . LYS F 4 3   ? 27.314  79.776  -38.143 1.00 89.07  ? 3    LYS B CB    1 
ATOM   5650  N  N     . ILE F 4 4   ? 24.985  78.524  -36.957 1.00 69.49  ? 4    ILE B N     1 
ATOM   5651  C  CA    . ILE F 4 4   ? 24.206  77.436  -36.360 1.00 69.49  ? 4    ILE B CA    1 
ATOM   5652  C  C     . ILE F 4 4   ? 22.835  77.897  -35.879 1.00 69.49  ? 4    ILE B C     1 
ATOM   5653  O  O     . ILE F 4 4   ? 22.706  78.981  -35.294 1.00 69.49  ? 4    ILE B O     1 
ATOM   5654  C  CB    . ILE F 4 4   ? 24.933  76.819  -35.143 1.00 119.83 ? 4    ILE B CB    1 
ATOM   5655  C  CG1   . ILE F 4 4   ? 26.391  76.507  -35.494 1.00 119.83 ? 4    ILE B CG1   1 
ATOM   5656  C  CG2   . ILE F 4 4   ? 24.211  75.555  -34.695 1.00 119.83 ? 4    ILE B CG2   1 
ATOM   5657  C  CD1   . ILE F 4 4   ? 27.310  77.733  -35.534 1.00 119.83 ? 4    ILE B CD1   1 
ATOM   5658  N  N     . ILE F 4 5   ? 21.826  77.055  -36.115 1.00 81.59  ? 5    ILE B N     1 
ATOM   5659  C  CA    . ILE F 4 5   ? 20.438  77.326  -35.723 1.00 81.59  ? 5    ILE B CA    1 
ATOM   5660  C  C     . ILE F 4 5   ? 20.179  77.208  -34.219 1.00 81.59  ? 5    ILE B C     1 
ATOM   5661  O  O     . ILE F 4 5   ? 20.670  76.285  -33.572 1.00 81.59  ? 5    ILE B O     1 
ATOM   5662  C  CB    . ILE F 4 5   ? 19.475  76.358  -36.425 1.00 61.08  ? 5    ILE B CB    1 
ATOM   5663  C  CG1   . ILE F 4 5   ? 19.349  76.724  -37.911 1.00 61.08  ? 5    ILE B CG1   1 
ATOM   5664  C  CG2   . ILE F 4 5   ? 18.130  76.362  -35.718 1.00 61.08  ? 5    ILE B CG2   1 
ATOM   5665  C  CD1   . ILE F 4 5   ? 18.348  75.860  -38.694 1.00 61.08  ? 5    ILE B CD1   1 
ATOM   5666  N  N     . HIS F 4 6   ? 19.389  78.130  -33.672 1.00 48.41  ? 6    HIS B N     1 
ATOM   5667  C  CA    . HIS F 4 6   ? 19.061  78.121  -32.246 1.00 48.41  ? 6    HIS B CA    1 
ATOM   5668  C  C     . HIS F 4 6   ? 17.549  77.997  -32.018 1.00 48.41  ? 6    HIS B C     1 
ATOM   5669  O  O     . HIS F 4 6   ? 16.873  78.975  -31.709 1.00 48.41  ? 6    HIS B O     1 
ATOM   5670  C  CB    . HIS F 4 6   ? 19.601  79.380  -31.586 1.00 78.31  ? 6    HIS B CB    1 
ATOM   5671  C  CG    . HIS F 4 6   ? 21.081  79.543  -31.745 1.00 78.31  ? 6    HIS B CG    1 
ATOM   5672  N  ND1   . HIS F 4 6   ? 21.991  78.686  -31.164 1.00 78.31  ? 6    HIS B ND1   1 
ATOM   5673  C  CD2   . HIS F 4 6   ? 21.811  80.436  -32.459 1.00 78.31  ? 6    HIS B CD2   1 
ATOM   5674  C  CE1   . HIS F 4 6   ? 23.216  79.042  -31.514 1.00 78.31  ? 6    HIS B CE1   1 
ATOM   5675  N  NE2   . HIS F 4 6   ? 23.135  80.101  -32.300 1.00 78.31  ? 6    HIS B NE2   1 
ATOM   5676  N  N     . LEU F 4 7   ? 17.046  76.769  -32.170 1.00 46.62  ? 7    LEU B N     1 
ATOM   5677  C  CA    . LEU F 4 7   ? 15.642  76.413  -32.012 1.00 46.62  ? 7    LEU B CA    1 
ATOM   5678  C  C     . LEU F 4 7   ? 15.006  76.848  -30.706 1.00 46.62  ? 7    LEU B C     1 
ATOM   5679  O  O     . LEU F 4 7   ? 15.670  77.352  -29.804 1.00 46.62  ? 7    LEU B O     1 
ATOM   5680  C  CB    . LEU F 4 7   ? 15.484  74.904  -32.110 1.00 55.36  ? 7    LEU B CB    1 
ATOM   5681  C  CG    . LEU F 4 7   ? 16.098  74.173  -33.301 1.00 55.36  ? 7    LEU B CG    1 
ATOM   5682  C  CD1   . LEU F 4 7   ? 15.678  72.707  -33.213 1.00 55.36  ? 7    LEU B CD1   1 
ATOM   5683  C  CD2   . LEU F 4 7   ? 15.643  74.794  -34.630 1.00 55.36  ? 7    LEU B CD2   1 
ATOM   5684  N  N     . THR F 4 8   ? 13.695  76.640  -30.620 1.00 57.89  ? 8    THR B N     1 
ATOM   5685  C  CA    . THR F 4 8   ? 12.923  76.961  -29.421 1.00 57.89  ? 8    THR B CA    1 
ATOM   5686  C  C     . THR F 4 8   ? 11.738  76.003  -29.395 1.00 57.89  ? 8    THR B C     1 
ATOM   5687  O  O     . THR F 4 8   ? 11.385  75.436  -30.424 1.00 57.89  ? 8    THR B O     1 
ATOM   5688  C  CB    . THR F 4 8   ? 12.384  78.395  -29.447 1.00 82.48  ? 8    THR B CB    1 
ATOM   5689  O  OG1   . THR F 4 8   ? 11.325  78.488  -30.404 1.00 82.48  ? 8    THR B OG1   1 
ATOM   5690  C  CG2   . THR F 4 8   ? 13.491  79.370  -29.816 1.00 82.48  ? 8    THR B CG2   1 
ATOM   5691  N  N     . ASP F 4 9   ? 11.140  75.802  -28.227 1.00 53.51  ? 9    ASP B N     1 
ATOM   5692  C  CA    . ASP F 4 9   ? 10.000  74.911  -28.136 1.00 53.51  ? 9    ASP B CA    1 
ATOM   5693  C  C     . ASP F 4 9   ? 9.045   75.219  -29.280 1.00 53.51  ? 9    ASP B C     1 
ATOM   5694  O  O     . ASP F 4 9   ? 8.708   74.335  -30.065 1.00 53.51  ? 9    ASP B O     1 
ATOM   5695  C  CB    . ASP F 4 9   ? 9.254   75.089  -26.805 1.00 90.30  ? 9    ASP B CB    1 
ATOM   5696  C  CG    . ASP F 4 9   ? 9.775   74.175  -25.704 1.00 90.30  ? 9    ASP B CG    1 
ATOM   5697  O  OD1   . ASP F 4 9   ? 10.210  73.050  -26.018 1.00 90.30  ? 9    ASP B OD1   1 
ATOM   5698  O  OD2   . ASP F 4 9   ? 9.729   74.570  -24.516 1.00 90.30  ? 9    ASP B OD2   1 
ATOM   5699  N  N     . ASP F 4 10  ? 8.626   76.479  -29.385 1.00 80.62  ? 10   ASP B N     1 
ATOM   5700  C  CA    . ASP F 4 10  ? 7.677   76.896  -30.422 1.00 80.62  ? 10   ASP B CA    1 
ATOM   5701  C  C     . ASP F 4 10  ? 8.219   76.860  -31.846 1.00 80.62  ? 10   ASP B C     1 
ATOM   5702  O  O     . ASP F 4 10  ? 7.471   76.640  -32.793 1.00 80.62  ? 10   ASP B O     1 
ATOM   5703  C  CB    . ASP F 4 10  ? 7.125   78.301  -30.122 1.00 119.73 ? 10   ASP B CB    1 
ATOM   5704  C  CG    . ASP F 4 10  ? 6.103   78.308  -28.984 1.00 119.73 ? 10   ASP B CG    1 
ATOM   5705  O  OD1   . ASP F 4 10  ? 5.183   77.464  -29.007 1.00 119.73 ? 10   ASP B OD1   1 
ATOM   5706  O  OD2   . ASP F 4 10  ? 6.210   79.163  -28.075 1.00 119.73 ? 10   ASP B OD2   1 
ATOM   5707  N  N     . SER F 4 11  ? 9.520   77.065  -31.989 1.00 74.38  ? 11   SER B N     1 
ATOM   5708  C  CA    . SER F 4 11  ? 10.179  77.067  -33.289 1.00 74.38  ? 11   SER B CA    1 
ATOM   5709  C  C     . SER F 4 11  ? 10.498  75.680  -33.838 1.00 74.38  ? 11   SER B C     1 
ATOM   5710  O  O     . SER F 4 11  ? 10.513  75.474  -35.052 1.00 74.38  ? 11   SER B O     1 
ATOM   5711  C  CB    . SER F 4 11  ? 11.481  77.850  -33.173 1.00 46.76  ? 11   SER B CB    1 
ATOM   5712  O  OG    . SER F 4 11  ? 12.221  77.780  -34.372 1.00 46.76  ? 11   SER B OG    1 
ATOM   5713  N  N     . PHE F 4 12  ? 10.767  74.742  -32.935 1.00 147.11 ? 12   PHE B N     1 
ATOM   5714  C  CA    . PHE F 4 12  ? 11.138  73.380  -33.305 1.00 147.11 ? 12   PHE B CA    1 
ATOM   5715  C  C     . PHE F 4 12  ? 10.382  72.775  -34.485 1.00 147.11 ? 12   PHE B C     1 
ATOM   5716  O  O     . PHE F 4 12  ? 11.000  72.393  -35.479 1.00 147.11 ? 12   PHE B O     1 
ATOM   5717  C  CB    . PHE F 4 12  ? 11.030  72.452  -32.081 1.00 60.32  ? 12   PHE B CB    1 
ATOM   5718  C  CG    . PHE F 4 12  ? 11.594  71.060  -32.308 1.00 60.32  ? 12   PHE B CG    1 
ATOM   5719  C  CD1   . PHE F 4 12  ? 10.759  69.998  -32.643 1.00 60.32  ? 12   PHE B CD1   1 
ATOM   5720  C  CD2   . PHE F 4 12  ? 12.959  70.815  -32.169 1.00 60.32  ? 12   PHE B CD2   1 
ATOM   5721  C  CE1   . PHE F 4 12  ? 11.270  68.721  -32.831 1.00 60.32  ? 12   PHE B CE1   1 
ATOM   5722  C  CE2   . PHE F 4 12  ? 13.478  69.537  -32.357 1.00 60.32  ? 12   PHE B CE2   1 
ATOM   5723  C  CZ    . PHE F 4 12  ? 12.628  68.489  -32.688 1.00 60.32  ? 12   PHE B CZ    1 
ATOM   5724  N  N     . ASP F 4 13  ? 9.056   72.701  -34.396 1.00 81.88  ? 13   ASP B N     1 
ATOM   5725  C  CA    . ASP F 4 13  ? 8.285   72.089  -35.476 1.00 81.88  ? 13   ASP B CA    1 
ATOM   5726  C  C     . ASP F 4 13  ? 8.670   72.571  -36.878 1.00 81.88  ? 13   ASP B C     1 
ATOM   5727  O  O     . ASP F 4 13  ? 9.408   71.892  -37.584 1.00 81.88  ? 13   ASP B O     1 
ATOM   5728  C  CB    . ASP F 4 13  ? 6.782   72.282  -35.261 1.00 94.81  ? 13   ASP B CB    1 
ATOM   5729  C  CG    . ASP F 4 13  ? 5.950   71.297  -36.082 1.00 94.81  ? 13   ASP B CG    1 
ATOM   5730  O  OD1   . ASP F 4 13  ? 6.341   71.027  -37.237 1.00 94.81  ? 13   ASP B OD1   1 
ATOM   5731  O  OD2   . ASP F 4 13  ? 4.910   70.797  -35.587 1.00 94.81  ? 13   ASP B OD2   1 
ATOM   5732  N  N     . THR F 4 14  ? 8.174   73.742  -37.272 1.00 83.43  ? 14   THR B N     1 
ATOM   5733  C  CA    . THR F 4 14  ? 8.448   74.309  -38.596 1.00 83.43  ? 14   THR B CA    1 
ATOM   5734  C  C     . THR F 4 14  ? 9.913   74.589  -38.889 1.00 83.43  ? 14   THR B C     1 
ATOM   5735  O  O     . THR F 4 14  ? 10.235  75.079  -39.970 1.00 83.43  ? 14   THR B O     1 
ATOM   5736  C  CB    . THR F 4 14  ? 7.675   75.661  -38.825 1.00 81.25  ? 14   THR B CB    1 
ATOM   5737  O  OG1   . THR F 4 14  ? 7.995   76.593  -37.785 1.00 81.25  ? 14   THR B OG1   1 
ATOM   5738  C  CG2   . THR F 4 14  ? 6.175   75.443  -38.847 1.00 81.25  ? 14   THR B CG2   1 
ATOM   5739  N  N     . ASP F 4 15  ? 10.803  74.291  -37.948 1.00 62.42  ? 15   ASP B N     1 
ATOM   5740  C  CA    . ASP F 4 15  ? 12.215  74.582  -38.178 1.00 62.42  ? 15   ASP B CA    1 
ATOM   5741  C  C     . ASP F 4 15  ? 13.127  73.373  -38.385 1.00 62.42  ? 15   ASP B C     1 
ATOM   5742  O  O     . ASP F 4 15  ? 14.119  73.446  -39.121 1.00 62.42  ? 15   ASP B O     1 
ATOM   5743  C  CB    . ASP F 4 15  ? 12.761  75.442  -37.050 1.00 82.62  ? 15   ASP B CB    1 
ATOM   5744  C  CG    . ASP F 4 15  ? 13.531  76.614  -37.571 1.00 82.62  ? 15   ASP B CG    1 
ATOM   5745  O  OD1   . ASP F 4 15  ? 14.176  76.440  -38.629 1.00 82.62  ? 15   ASP B OD1   1 
ATOM   5746  O  OD2   . ASP F 4 15  ? 13.497  77.695  -36.940 1.00 82.62  ? 15   ASP B OD2   1 
ATOM   5747  N  N     . VAL F 4 16  ? 12.782  72.272  -37.728 1.00 79.65  ? 16   VAL B N     1 
ATOM   5748  C  CA    . VAL F 4 16  ? 13.542  71.037  -37.826 1.00 79.65  ? 16   VAL B CA    1 
ATOM   5749  C  C     . VAL F 4 16  ? 12.653  69.979  -38.470 1.00 79.65  ? 16   VAL B C     1 
ATOM   5750  O  O     . VAL F 4 16  ? 13.048  69.344  -39.445 1.00 79.65  ? 16   VAL B O     1 
ATOM   5751  C  CB    . VAL F 4 16  ? 14.032  70.553  -36.415 1.00 51.05  ? 16   VAL B CB    1 
ATOM   5752  C  CG1   . VAL F 4 16  ? 12.873  70.250  -35.515 1.00 51.05  ? 16   VAL B CG1   1 
ATOM   5753  C  CG2   . VAL F 4 16  ? 14.866  69.330  -36.548 1.00 51.05  ? 16   VAL B CG2   1 
ATOM   5754  N  N     . LEU F 4 17  ? 11.443  69.820  -37.941 1.00 84.91  ? 17   LEU B N     1 
ATOM   5755  C  CA    . LEU F 4 17  ? 10.502  68.834  -38.450 1.00 84.91  ? 17   LEU B CA    1 
ATOM   5756  C  C     . LEU F 4 17  ? 10.170  68.927  -39.931 1.00 84.91  ? 17   LEU B C     1 
ATOM   5757  O  O     . LEU F 4 17  ? 10.150  67.907  -40.626 1.00 84.91  ? 17   LEU B O     1 
ATOM   5758  C  CB    . LEU F 4 17  ? 9.204   68.876  -37.658 1.00 53.50  ? 17   LEU B CB    1 
ATOM   5759  C  CG    . LEU F 4 17  ? 9.139   67.910  -36.479 1.00 53.50  ? 17   LEU B CG    1 
ATOM   5760  C  CD1   . LEU F 4 17  ? 7.727   67.869  -35.927 1.00 53.50  ? 17   LEU B CD1   1 
ATOM   5761  C  CD2   . LEU F 4 17  ? 9.528   66.529  -36.939 1.00 53.50  ? 17   LEU B CD2   1 
ATOM   5762  N  N     . LYS F 4 18  ? 9.899   70.133  -40.421 1.00 95.99  ? 18   LYS B N     1 
ATOM   5763  C  CA    . LYS F 4 18  ? 9.560   70.306  -41.829 1.00 95.99  ? 18   LYS B CA    1 
ATOM   5764  C  C     . LYS F 4 18  ? 10.701  70.885  -42.641 1.00 95.99  ? 18   LYS B C     1 
ATOM   5765  O  O     . LYS F 4 18  ? 10.502  71.428  -43.722 1.00 95.99  ? 18   LYS B O     1 
ATOM   5766  C  CB    . LYS F 4 18  ? 8.313   71.168  -41.950 1.00 76.03  ? 18   LYS B CB    1 
ATOM   5767  C  CG    . LYS F 4 18  ? 7.074   70.387  -41.583 1.00 76.03  ? 18   LYS B CG    1 
ATOM   5768  C  CD    . LYS F 4 18  ? 5.960   71.288  -41.153 1.00 76.03  ? 18   LYS B CD    1 
ATOM   5769  C  CE    . LYS F 4 18  ? 6.348   72.049  -39.913 1.00 76.03  ? 18   LYS B CE    1 
ATOM   5770  N  NZ    . LYS F 4 18  ? 5.213   72.869  -39.403 1.00 76.03  ? 18   LYS B NZ    1 
ATOM   5771  N  N     . ALA F 4 19  ? 11.908  70.738  -42.116 1.00 118.83 ? 19   ALA B N     1 
ATOM   5772  C  CA    . ALA F 4 19  ? 13.094  71.251  -42.777 1.00 118.83 ? 19   ALA B CA    1 
ATOM   5773  C  C     . ALA F 4 19  ? 13.344  70.596  -44.131 1.00 118.83 ? 19   ALA B C     1 
ATOM   5774  O  O     . ALA F 4 19  ? 14.068  71.146  -44.965 1.00 118.83 ? 19   ALA B O     1 
ATOM   5775  C  CB    . ALA F 4 19  ? 14.301  71.064  -41.873 1.00 109.11 ? 19   ALA B CB    1 
ATOM   5776  N  N     . ASP F 4 20  ? 12.748  69.427  -44.348 1.00 174.16 ? 20   ASP B N     1 
ATOM   5777  C  CA    . ASP F 4 20  ? 12.921  68.698  -45.602 1.00 174.16 ? 20   ASP B CA    1 
ATOM   5778  C  C     . ASP F 4 20  ? 14.373  68.234  -45.755 1.00 174.16 ? 20   ASP B C     1 
ATOM   5779  O  O     . ASP F 4 20  ? 14.636  67.156  -46.292 1.00 174.16 ? 20   ASP B O     1 
ATOM   5780  C  CB    . ASP F 4 20  ? 12.522  69.580  -46.792 1.00 117.91 ? 20   ASP B CB    1 
ATOM   5781  N  N     . GLY F 4 21  ? 15.309  69.057  -45.287 1.00 87.30  ? 21   GLY B N     1 
ATOM   5782  C  CA    . GLY F 4 21  ? 16.714  68.705  -45.354 1.00 87.30  ? 21   GLY B CA    1 
ATOM   5783  C  C     . GLY F 4 21  ? 17.079  67.870  -44.137 1.00 87.30  ? 21   GLY B C     1 
ATOM   5784  O  O     . GLY F 4 21  ? 16.199  67.300  -43.486 1.00 87.30  ? 21   GLY B O     1 
ATOM   5785  N  N     . ALA F 4 22  ? 18.369  67.791  -43.825 1.00 103.47 ? 22   ALA B N     1 
ATOM   5786  C  CA    . ALA F 4 22  ? 18.828  67.022  -42.670 1.00 103.47 ? 22   ALA B CA    1 
ATOM   5787  C  C     . ALA F 4 22  ? 19.290  67.960  -41.566 1.00 103.47 ? 22   ALA B C     1 
ATOM   5788  O  O     . ALA F 4 22  ? 20.203  68.765  -41.757 1.00 103.47 ? 22   ALA B O     1 
ATOM   5789  C  CB    . ALA F 4 22  ? 19.968  66.093  -43.074 1.00 123.93 ? 22   ALA B CB    1 
ATOM   5790  N  N     . ILE F 4 23  ? 18.649  67.851  -40.410 1.00 103.06 ? 23   ILE B N     1 
ATOM   5791  C  CA    . ILE F 4 23  ? 18.988  68.692  -39.277 1.00 103.06 ? 23   ILE B CA    1 
ATOM   5792  C  C     . ILE F 4 23  ? 19.458  67.813  -38.123 1.00 103.06 ? 23   ILE B C     1 
ATOM   5793  O  O     . ILE F 4 23  ? 18.723  66.940  -37.654 1.00 103.06 ? 23   ILE B O     1 
ATOM   5794  C  CB    . ILE F 4 23  ? 17.758  69.518  -38.806 1.00 86.29  ? 23   ILE B CB    1 
ATOM   5795  C  CG1   . ILE F 4 23  ? 16.890  69.903  -40.001 1.00 86.29  ? 23   ILE B CG1   1 
ATOM   5796  C  CG2   . ILE F 4 23  ? 18.210  70.801  -38.126 1.00 86.29  ? 23   ILE B CG2   1 
ATOM   5797  C  CD1   . ILE F 4 23  ? 17.600  70.778  -41.029 1.00 86.29  ? 23   ILE B CD1   1 
ATOM   5798  N  N     . LEU F 4 24  ? 20.690  68.034  -37.683 1.00 83.80  ? 24   LEU B N     1 
ATOM   5799  C  CA    . LEU F 4 24  ? 21.242  67.287  -36.566 1.00 83.80  ? 24   LEU B CA    1 
ATOM   5800  C  C     . LEU F 4 24  ? 20.901  68.096  -35.307 1.00 83.80  ? 24   LEU B C     1 
ATOM   5801  O  O     . LEU F 4 24  ? 21.657  68.981  -34.910 1.00 83.80  ? 24   LEU B O     1 
ATOM   5802  C  CB    . LEU F 4 24  ? 22.752  67.174  -36.740 1.00 72.53  ? 24   LEU B CB    1 
ATOM   5803  C  CG    . LEU F 4 24  ? 23.533  66.543  -35.596 1.00 72.53  ? 24   LEU B CG    1 
ATOM   5804  C  CD1   . LEU F 4 24  ? 23.022  65.129  -35.356 1.00 72.53  ? 24   LEU B CD1   1 
ATOM   5805  C  CD2   . LEU F 4 24  ? 25.014  66.554  -35.926 1.00 72.53  ? 24   LEU B CD2   1 
ATOM   5806  N  N     . VAL F 4 25  ? 19.755  67.818  -34.691 1.00 69.70  ? 25   VAL B N     1 
ATOM   5807  C  CA    . VAL F 4 25  ? 19.375  68.567  -33.499 1.00 69.70  ? 25   VAL B CA    1 
ATOM   5808  C  C     . VAL F 4 25  ? 20.156  68.129  -32.264 1.00 69.70  ? 25   VAL B C     1 
ATOM   5809  O  O     . VAL F 4 25  ? 20.327  66.937  -32.001 1.00 69.70  ? 25   VAL B O     1 
ATOM   5810  C  CB    . VAL F 4 25  ? 17.856  68.484  -33.215 1.00 40.42  ? 25   VAL B CB    1 
ATOM   5811  C  CG1   . VAL F 4 25  ? 17.496  69.373  -32.011 1.00 40.42  ? 25   VAL B CG1   1 
ATOM   5812  C  CG2   . VAL F 4 25  ? 17.096  68.944  -34.425 1.00 40.42  ? 25   VAL B CG2   1 
ATOM   5813  N  N     . ASP F 4 26  ? 20.630  69.117  -31.512 1.00 61.85  ? 26   ASP B N     1 
ATOM   5814  C  CA    . ASP F 4 26  ? 21.417  68.873  -30.314 1.00 61.85  ? 26   ASP B CA    1 
ATOM   5815  C  C     . ASP F 4 26  ? 20.798  69.392  -29.022 1.00 61.85  ? 26   ASP B C     1 
ATOM   5816  O  O     . ASP F 4 26  ? 20.894  70.573  -28.711 1.00 61.85  ? 26   ASP B O     1 
ATOM   5817  C  CB    . ASP F 4 26  ? 22.806  69.484  -30.493 1.00 93.87  ? 26   ASP B CB    1 
ATOM   5818  C  CG    . ASP F 4 26  ? 23.586  69.531  -29.203 1.00 93.87  ? 26   ASP B CG    1 
ATOM   5819  O  OD1   . ASP F 4 26  ? 23.413  68.608  -28.383 1.00 93.87  ? 26   ASP B OD1   1 
ATOM   5820  O  OD2   . ASP F 4 26  ? 24.378  70.479  -29.012 1.00 93.87  ? 26   ASP B OD2   1 
ATOM   5821  N  N     . PHE F 4 27  ? 20.163  68.505  -28.270 1.00 54.10  ? 27   PHE B N     1 
ATOM   5822  C  CA    . PHE F 4 27  ? 19.568  68.881  -27.001 1.00 54.10  ? 27   PHE B CA    1 
ATOM   5823  C  C     . PHE F 4 27  ? 20.718  69.107  -26.031 1.00 54.10  ? 27   PHE B C     1 
ATOM   5824  O  O     . PHE F 4 27  ? 21.652  68.319  -26.002 1.00 54.10  ? 27   PHE B O     1 
ATOM   5825  C  CB    . PHE F 4 27  ? 18.671  67.752  -26.517 1.00 64.01  ? 27   PHE B CB    1 
ATOM   5826  C  CG    . PHE F 4 27  ? 17.552  67.440  -27.464 1.00 64.01  ? 27   PHE B CG    1 
ATOM   5827  C  CD1   . PHE F 4 27  ? 17.821  67.021  -28.761 1.00 64.01  ? 27   PHE B CD1   1 
ATOM   5828  C  CD2   . PHE F 4 27  ? 16.225  67.634  -27.087 1.00 64.01  ? 27   PHE B CD2   1 
ATOM   5829  C  CE1   . PHE F 4 27  ? 16.787  66.806  -29.669 1.00 64.01  ? 27   PHE B CE1   1 
ATOM   5830  C  CE2   . PHE F 4 27  ? 15.187  67.421  -27.992 1.00 64.01  ? 27   PHE B CE2   1 
ATOM   5831  C  CZ    . PHE F 4 27  ? 15.470  67.008  -29.285 1.00 64.01  ? 27   PHE B CZ    1 
ATOM   5832  N  N     . TRP F 4 28  ? 20.675  70.175  -25.242 1.00 53.06  ? 28   TRP B N     1 
ATOM   5833  C  CA    . TRP F 4 28  ? 21.770  70.427  -24.322 1.00 53.06  ? 28   TRP B CA    1 
ATOM   5834  C  C     . TRP F 4 28  ? 21.425  71.261  -23.091 1.00 53.06  ? 28   TRP B C     1 
ATOM   5835  O  O     . TRP F 4 28  ? 20.263  71.455  -22.785 1.00 53.06  ? 28   TRP B O     1 
ATOM   5836  C  CB    . TRP F 4 28  ? 22.911  71.077  -25.085 1.00 46.38  ? 28   TRP B CB    1 
ATOM   5837  C  CG    . TRP F 4 28  ? 22.574  72.416  -25.600 1.00 46.38  ? 28   TRP B CG    1 
ATOM   5838  C  CD1   . TRP F 4 28  ? 21.870  72.709  -26.730 1.00 46.38  ? 28   TRP B CD1   1 
ATOM   5839  C  CD2   . TRP F 4 28  ? 23.010  73.662  -25.061 1.00 46.38  ? 28   TRP B CD2   1 
ATOM   5840  N  NE1   . TRP F 4 28  ? 21.855  74.069  -26.941 1.00 46.38  ? 28   TRP B NE1   1 
ATOM   5841  C  CE2   . TRP F 4 28  ? 22.549  74.677  -25.930 1.00 46.38  ? 28   TRP B CE2   1 
ATOM   5842  C  CE3   . TRP F 4 28  ? 23.754  74.020  -23.932 1.00 46.38  ? 28   TRP B CE3   1 
ATOM   5843  C  CZ2   . TRP F 4 28  ? 22.808  76.028  -25.709 1.00 46.38  ? 28   TRP B CZ2   1 
ATOM   5844  C  CZ3   . TRP F 4 28  ? 24.016  75.365  -23.707 1.00 46.38  ? 28   TRP B CZ3   1 
ATOM   5845  C  CH2   . TRP F 4 28  ? 23.543  76.356  -24.597 1.00 46.38  ? 28   TRP B CH2   1 
ATOM   5846  N  N     . ALA F 4 29  ? 22.446  71.735  -22.382 1.00 57.55  ? 29   ALA B N     1 
ATOM   5847  C  CA    . ALA F 4 29  ? 22.253  72.541  -21.178 1.00 57.55  ? 29   ALA B CA    1 
ATOM   5848  C  C     . ALA F 4 29  ? 23.601  73.078  -20.718 1.00 57.55  ? 29   ALA B C     1 
ATOM   5849  O  O     . ALA F 4 29  ? 24.568  72.338  -20.664 1.00 57.55  ? 29   ALA B O     1 
ATOM   5850  C  CB    . ALA F 4 29  ? 21.632  71.703  -20.086 1.00 40.62  ? 29   ALA B CB    1 
ATOM   5851  N  N     . GLU F 4 30  ? 23.663  74.360  -20.376 1.00 73.08  ? 30   GLU B N     1 
ATOM   5852  C  CA    . GLU F 4 30  ? 24.916  74.989  -19.952 1.00 73.08  ? 30   GLU B CA    1 
ATOM   5853  C  C     . GLU F 4 30  ? 25.542  74.368  -18.701 1.00 73.08  ? 30   GLU B C     1 
ATOM   5854  O  O     . GLU F 4 30  ? 26.609  74.788  -18.275 1.00 73.08  ? 30   GLU B O     1 
ATOM   5855  C  CB    . GLU F 4 30  ? 24.677  76.486  -19.715 1.00 102.78 ? 30   GLU B CB    1 
ATOM   5856  C  CG    . GLU F 4 30  ? 25.925  77.344  -19.513 1.00 102.78 ? 30   GLU B CG    1 
ATOM   5857  C  CD    . GLU F 4 30  ? 26.455  77.933  -20.813 1.00 102.78 ? 30   GLU B CD    1 
ATOM   5858  O  OE1   . GLU F 4 30  ? 25.631  78.382  -21.639 1.00 102.78 ? 30   GLU B OE1   1 
ATOM   5859  O  OE2   . GLU F 4 30  ? 27.690  77.966  -21.009 1.00 102.78 ? 30   GLU B OE2   1 
ATOM   5860  N  N     . TRP F 4 31  ? 24.892  73.374  -18.111 1.00 69.24  ? 31   TRP B N     1 
ATOM   5861  C  CA    . TRP F 4 31  ? 25.425  72.755  -16.900 1.00 69.24  ? 31   TRP B CA    1 
ATOM   5862  C  C     . TRP F 4 31  ? 26.099  71.424  -17.143 1.00 69.24  ? 31   TRP B C     1 
ATOM   5863  O  O     . TRP F 4 31  ? 26.762  70.886  -16.260 1.00 69.24  ? 31   TRP B O     1 
ATOM   5864  C  CB    . TRP F 4 31  ? 24.321  72.557  -15.854 1.00 59.00  ? 31   TRP B CB    1 
ATOM   5865  C  CG    . TRP F 4 31  ? 22.998  72.057  -16.392 1.00 59.00  ? 31   TRP B CG    1 
ATOM   5866  C  CD1   . TRP F 4 31  ? 21.992  72.817  -16.883 1.00 59.00  ? 31   TRP B CD1   1 
ATOM   5867  C  CD2   . TRP F 4 31  ? 22.518  70.696  -16.417 1.00 59.00  ? 31   TRP B CD2   1 
ATOM   5868  N  NE1   . TRP F 4 31  ? 20.913  72.031  -17.202 1.00 59.00  ? 31   TRP B NE1   1 
ATOM   5869  C  CE2   . TRP F 4 31  ? 21.208  70.726  -16.925 1.00 59.00  ? 31   TRP B CE2   1 
ATOM   5870  C  CE3   . TRP F 4 31  ? 23.070  69.459  -16.055 1.00 59.00  ? 31   TRP B CE3   1 
ATOM   5871  C  CZ2   . TRP F 4 31  ? 20.435  69.575  -17.081 1.00 59.00  ? 31   TRP B CZ2   1 
ATOM   5872  C  CZ3   . TRP F 4 31  ? 22.287  68.303  -16.214 1.00 59.00  ? 31   TRP B CZ3   1 
ATOM   5873  C  CH2   . TRP F 4 31  ? 20.988  68.380  -16.719 1.00 59.00  ? 31   TRP B CH2   1 
ATOM   5874  N  N     . CYS F 4 32  ? 25.924  70.892  -18.342 1.00 73.23  ? 32   CYS B N     1 
ATOM   5875  C  CA    . CYS F 4 32  ? 26.501  69.611  -18.701 1.00 73.23  ? 32   CYS B CA    1 
ATOM   5876  C  C     . CYS F 4 32  ? 27.881  69.816  -19.319 1.00 73.23  ? 32   CYS B C     1 
ATOM   5877  O  O     . CYS F 4 32  ? 28.018  70.503  -20.331 1.00 73.23  ? 32   CYS B O     1 
ATOM   5878  C  CB    . CYS F 4 32  ? 25.565  68.913  -19.681 1.00 76.32  ? 32   CYS B CB    1 
ATOM   5879  S  SG    . CYS F 4 32  ? 26.104  67.317  -20.243 1.00 76.32  ? 32   CYS B SG    1 
ATOM   5880  N  N     . GLY F 4 33  ? 28.902  69.232  -18.699 1.00 77.01  ? 33   GLY B N     1 
ATOM   5881  C  CA    . GLY F 4 33  ? 30.250  69.375  -19.219 1.00 77.01  ? 33   GLY B CA    1 
ATOM   5882  C  C     . GLY F 4 33  ? 30.332  68.894  -20.651 1.00 77.01  ? 33   GLY B C     1 
ATOM   5883  O  O     . GLY F 4 33  ? 30.631  69.672  -21.554 1.00 77.01  ? 33   GLY B O     1 
ATOM   5884  N  N     . PRO F 4 34  ? 30.076  67.604  -20.884 1.00 64.27  ? 34   PRO B N     1 
ATOM   5885  C  CA    . PRO F 4 34  ? 30.113  67.009  -22.218 1.00 64.27  ? 34   PRO B CA    1 
ATOM   5886  C  C     . PRO F 4 34  ? 29.344  67.844  -23.245 1.00 64.27  ? 34   PRO B C     1 
ATOM   5887  O  O     . PRO F 4 34  ? 29.787  67.989  -24.387 1.00 64.27  ? 34   PRO B O     1 
ATOM   5888  C  CB    . PRO F 4 34  ? 29.485  65.642  -21.996 1.00 50.80  ? 34   PRO B CB    1 
ATOM   5889  C  CG    . PRO F 4 34  ? 29.935  65.298  -20.604 1.00 50.80  ? 34   PRO B CG    1 
ATOM   5890  C  CD    . PRO F 4 34  ? 29.756  66.598  -19.856 1.00 50.80  ? 34   PRO B CD    1 
ATOM   5891  N  N     . CYS F 4 35  ? 28.197  68.399  -22.858 1.00 68.31  ? 35   CYS B N     1 
ATOM   5892  C  CA    . CYS F 4 35  ? 27.433  69.218  -23.799 1.00 68.31  ? 35   CYS B CA    1 
ATOM   5893  C  C     . CYS F 4 35  ? 28.257  70.426  -24.240 1.00 68.31  ? 35   CYS B C     1 
ATOM   5894  O  O     . CYS F 4 35  ? 28.194  70.841  -25.401 1.00 68.31  ? 35   CYS B O     1 
ATOM   5895  C  CB    . CYS F 4 35  ? 26.101  69.659  -23.183 1.00 121.75 ? 35   CYS B CB    1 
ATOM   5896  S  SG    . CYS F 4 35  ? 24.869  68.321  -23.085 1.00 121.75 ? 35   CYS B SG    1 
ATOM   5897  N  N     . LYS F 4 36  ? 29.047  70.969  -23.316 1.00 74.74  ? 36   LYS B N     1 
ATOM   5898  C  CA    . LYS F 4 36  ? 29.899  72.112  -23.620 1.00 74.74  ? 36   LYS B CA    1 
ATOM   5899  C  C     . LYS F 4 36  ? 31.083  71.651  -24.453 1.00 74.74  ? 36   LYS B C     1 
ATOM   5900  O  O     . LYS F 4 36  ? 31.695  72.445  -25.169 1.00 74.74  ? 36   LYS B O     1 
ATOM   5901  C  CB    . LYS F 4 36  ? 30.402  72.777  -22.336 1.00 53.26  ? 36   LYS B CB    1 
ATOM   5902  N  N     . MET F 4 37  ? 31.400  70.363  -24.351 1.00 93.22  ? 37   MET B N     1 
ATOM   5903  C  CA    . MET F 4 37  ? 32.508  69.781  -25.094 1.00 93.22  ? 37   MET B CA    1 
ATOM   5904  C  C     . MET F 4 37  ? 32.132  69.626  -26.555 1.00 93.22  ? 37   MET B C     1 
ATOM   5905  O  O     . MET F 4 37  ? 32.748  70.253  -27.423 1.00 93.22  ? 37   MET B O     1 
ATOM   5906  C  CB    . MET F 4 37  ? 32.889  68.413  -24.523 1.00 43.05  ? 37   MET B CB    1 
ATOM   5907  N  N     . ILE F 4 38  ? 31.121  68.802  -26.838 1.00 42.97  ? 38   ILE B N     1 
ATOM   5908  C  CA    . ILE F 4 38  ? 30.724  68.603  -28.232 1.00 42.97  ? 38   ILE B CA    1 
ATOM   5909  C  C     . ILE F 4 38  ? 30.359  69.931  -28.878 1.00 42.97  ? 38   ILE B C     1 
ATOM   5910  O  O     . ILE F 4 38  ? 30.283  70.033  -30.098 1.00 42.97  ? 38   ILE B O     1 
ATOM   5911  C  CB    . ILE F 4 38  ? 29.529  67.656  -28.398 1.00 56.85  ? 38   ILE B CB    1 
ATOM   5912  C  CG1   . ILE F 4 38  ? 29.385  67.295  -29.876 1.00 56.85  ? 38   ILE B CG1   1 
ATOM   5913  C  CG2   . ILE F 4 38  ? 28.252  68.330  -27.932 1.00 56.85  ? 38   ILE B CG2   1 
ATOM   5914  C  CD1   . ILE F 4 38  ? 28.188  66.427  -30.197 1.00 56.85  ? 38   ILE B CD1   1 
ATOM   5915  N  N     . ALA F 4 39  ? 30.155  70.949  -28.051 1.00 85.02  ? 39   ALA B N     1 
ATOM   5916  C  CA    . ALA F 4 39  ? 29.790  72.269  -28.536 1.00 85.02  ? 39   ALA B CA    1 
ATOM   5917  C  C     . ALA F 4 39  ? 30.585  72.782  -29.748 1.00 85.02  ? 39   ALA B C     1 
ATOM   5918  O  O     . ALA F 4 39  ? 30.050  72.829  -30.858 1.00 85.02  ? 39   ALA B O     1 
ATOM   5919  C  CB    . ALA F 4 39  ? 29.864  73.271  -27.384 1.00 68.53  ? 39   ALA B CB    1 
ATOM   5920  N  N     . PRO F 4 40  ? 31.868  73.166  -29.565 1.00 112.41 ? 40   PRO B N     1 
ATOM   5921  C  CA    . PRO F 4 40  ? 32.625  73.666  -30.723 1.00 112.41 ? 40   PRO B CA    1 
ATOM   5922  C  C     . PRO F 4 40  ? 32.707  72.688  -31.888 1.00 112.41 ? 40   PRO B C     1 
ATOM   5923  O  O     . PRO F 4 40  ? 32.777  73.096  -33.049 1.00 112.41 ? 40   PRO B O     1 
ATOM   5924  C  CB    . PRO F 4 40  ? 33.995  73.989  -30.130 1.00 83.59  ? 40   PRO B CB    1 
ATOM   5925  C  CG    . PRO F 4 40  ? 33.670  74.355  -28.714 1.00 83.59  ? 40   PRO B CG    1 
ATOM   5926  C  CD    . PRO F 4 40  ? 32.695  73.250  -28.348 1.00 83.59  ? 40   PRO B CD    1 
ATOM   5927  N  N     . ILE F 4 41  ? 32.696  71.399  -31.568 1.00 68.23  ? 41   ILE B N     1 
ATOM   5928  C  CA    . ILE F 4 41  ? 32.746  70.354  -32.581 1.00 68.23  ? 41   ILE B CA    1 
ATOM   5929  C  C     . ILE F 4 41  ? 31.623  70.625  -33.577 1.00 68.23  ? 41   ILE B C     1 
ATOM   5930  O  O     . ILE F 4 41  ? 31.873  70.868  -34.757 1.00 68.23  ? 41   ILE B O     1 
ATOM   5931  C  CB    . ILE F 4 41  ? 32.524  68.960  -31.942 1.00 94.22  ? 41   ILE B CB    1 
ATOM   5932  C  CG1   . ILE F 4 41  ? 33.463  68.780  -30.742 1.00 94.22  ? 41   ILE B CG1   1 
ATOM   5933  C  CG2   . ILE F 4 41  ? 32.687  67.865  -32.985 1.00 94.22  ? 41   ILE B CG2   1 
ATOM   5934  C  CD1   . ILE F 4 41  ? 34.905  69.177  -30.991 1.00 94.22  ? 41   ILE B CD1   1 
ATOM   5935  N  N     . LEU F 4 42  ? 30.388  70.601  -33.077 1.00 74.18  ? 42   LEU B N     1 
ATOM   5936  C  CA    . LEU F 4 42  ? 29.206  70.818  -33.901 1.00 74.18  ? 42   LEU B CA    1 
ATOM   5937  C  C     . LEU F 4 42  ? 29.253  72.161  -34.620 1.00 74.18  ? 42   LEU B C     1 
ATOM   5938  O  O     . LEU F 4 42  ? 28.731  72.295  -35.725 1.00 74.18  ? 42   LEU B O     1 
ATOM   5939  C  CB    . LEU F 4 42  ? 27.939  70.699  -33.042 1.00 74.58  ? 42   LEU B CB    1 
ATOM   5940  N  N     . ASP F 4 43  ? 29.897  73.147  -34.003 1.00 76.48  ? 43   ASP B N     1 
ATOM   5941  C  CA    . ASP F 4 43  ? 29.999  74.468  -34.607 1.00 76.48  ? 43   ASP B CA    1 
ATOM   5942  C  C     . ASP F 4 43  ? 30.764  74.368  -35.924 1.00 76.48  ? 43   ASP B C     1 
ATOM   5943  O  O     . ASP F 4 43  ? 30.304  74.844  -36.964 1.00 76.48  ? 43   ASP B O     1 
ATOM   5944  C  CB    . ASP F 4 43  ? 30.708  75.434  -33.651 1.00 86.38  ? 43   ASP B CB    1 
ATOM   5945  N  N     . GLU F 4 44  ? 31.931  73.737  -35.877 1.00 148.30 ? 44   GLU B N     1 
ATOM   5946  C  CA    . GLU F 4 44  ? 32.742  73.571  -37.073 1.00 148.30 ? 44   GLU B CA    1 
ATOM   5947  C  C     . GLU F 4 44  ? 32.061  72.584  -38.020 1.00 148.30 ? 44   GLU B C     1 
ATOM   5948  O  O     . GLU F 4 44  ? 32.220  72.676  -39.237 1.00 148.30 ? 44   GLU B O     1 
ATOM   5949  C  CB    . GLU F 4 44  ? 34.133  73.065  -36.699 1.00 80.17  ? 44   GLU B CB    1 
ATOM   5950  N  N     . ILE F 4 45  ? 31.307  71.643  -37.451 1.00 80.71  ? 45   ILE B N     1 
ATOM   5951  C  CA    . ILE F 4 45  ? 30.577  70.641  -38.229 1.00 80.71  ? 45   ILE B CA    1 
ATOM   5952  C  C     . ILE F 4 45  ? 29.603  71.374  -39.128 1.00 80.71  ? 45   ILE B C     1 
ATOM   5953  O  O     . ILE F 4 45  ? 29.340  70.960  -40.253 1.00 80.71  ? 45   ILE B O     1 
ATOM   5954  C  CB    . ILE F 4 45  ? 29.710  69.711  -37.332 1.00 87.25  ? 45   ILE B CB    1 
ATOM   5955  C  CG1   . ILE F 4 45  ? 30.565  69.017  -36.266 1.00 87.25  ? 45   ILE B CG1   1 
ATOM   5956  C  CG2   . ILE F 4 45  ? 28.994  68.676  -38.203 1.00 87.25  ? 45   ILE B CG2   1 
ATOM   5957  C  CD1   . ILE F 4 45  ? 31.492  67.939  -36.783 1.00 87.25  ? 45   ILE B CD1   1 
ATOM   5958  N  N     . ALA F 4 46  ? 29.058  72.462  -38.601 1.00 100.19 ? 46   ALA B N     1 
ATOM   5959  C  CA    . ALA F 4 46  ? 28.091  73.273  -39.320 1.00 100.19 ? 46   ALA B CA    1 
ATOM   5960  C  C     . ALA F 4 46  ? 28.688  73.937  -40.551 1.00 100.19 ? 46   ALA B C     1 
ATOM   5961  O  O     . ALA F 4 46  ? 28.060  73.950  -41.609 1.00 100.19 ? 46   ALA B O     1 
ATOM   5962  C  CB    . ALA F 4 46  ? 27.515  74.325  -38.394 1.00 120.41 ? 46   ALA B CB    1 
ATOM   5963  N  N     . ASP F 4 47  ? 29.893  74.487  -40.418 1.00 101.42 ? 47   ASP B N     1 
ATOM   5964  C  CA    . ASP F 4 47  ? 30.552  75.152  -41.542 1.00 101.42 ? 47   ASP B CA    1 
ATOM   5965  C  C     . ASP F 4 47  ? 31.125  74.161  -42.566 1.00 101.42 ? 47   ASP B C     1 
ATOM   5966  O  O     . ASP F 4 47  ? 30.957  74.337  -43.778 1.00 101.42 ? 47   ASP B O     1 
ATOM   5967  C  CB    . ASP F 4 47  ? 31.659  76.077  -41.027 1.00 68.10  ? 47   ASP B CB    1 
ATOM   5968  N  N     . GLU F 4 48  ? 31.789  73.118  -42.079 1.00 130.01 ? 48   GLU B N     1 
ATOM   5969  C  CA    . GLU F 4 48  ? 32.372  72.112  -42.957 1.00 130.01 ? 48   GLU B CA    1 
ATOM   5970  C  C     . GLU F 4 48  ? 31.311  71.195  -43.578 1.00 130.01 ? 48   GLU B C     1 
ATOM   5971  O  O     . GLU F 4 48  ? 31.638  70.171  -44.172 1.00 130.01 ? 48   GLU B O     1 
ATOM   5972  C  CB    . GLU F 4 48  ? 33.402  71.280  -42.185 1.00 114.58 ? 48   GLU B CB    1 
ATOM   5973  N  N     . TYR F 4 49  ? 30.041  71.568  -43.446 1.00 127.94 ? 49   TYR B N     1 
ATOM   5974  C  CA    . TYR F 4 49  ? 28.948  70.774  -44.005 1.00 127.94 ? 49   TYR B CA    1 
ATOM   5975  C  C     . TYR F 4 49  ? 27.828  71.646  -44.577 1.00 127.94 ? 49   TYR B C     1 
ATOM   5976  O  O     . TYR F 4 49  ? 26.758  71.145  -44.934 1.00 127.94 ? 49   TYR B O     1 
ATOM   5977  C  CB    . TYR F 4 49  ? 28.385  69.829  -42.938 1.00 127.41 ? 49   TYR B CB    1 
ATOM   5978  C  CG    . TYR F 4 49  ? 28.991  68.439  -42.954 1.00 127.41 ? 49   TYR B CG    1 
ATOM   5979  C  CD1   . TYR F 4 49  ? 29.405  67.823  -41.774 1.00 127.41 ? 49   TYR B CD1   1 
ATOM   5980  C  CD2   . TYR F 4 49  ? 29.112  67.723  -44.146 1.00 127.41 ? 49   TYR B CD2   1 
ATOM   5981  C  CE1   . TYR F 4 49  ? 29.925  66.522  -41.777 1.00 127.41 ? 49   TYR B CE1   1 
ATOM   5982  C  CE2   . TYR F 4 49  ? 29.629  66.420  -44.161 1.00 127.41 ? 49   TYR B CE2   1 
ATOM   5983  C  CZ    . TYR F 4 49  ? 30.032  65.826  -42.973 1.00 127.41 ? 49   TYR B CZ    1 
ATOM   5984  O  OH    . TYR F 4 49  ? 30.528  64.539  -42.980 1.00 127.41 ? 49   TYR B OH    1 
ATOM   5985  N  N     . GLN F 4 50  ? 28.089  72.950  -44.667 1.00 107.91 ? 50   GLN B N     1 
ATOM   5986  C  CA    . GLN F 4 50  ? 27.125  73.912  -45.194 1.00 107.91 ? 50   GLN B CA    1 
ATOM   5987  C  C     . GLN F 4 50  ? 26.547  73.427  -46.525 1.00 107.91 ? 50   GLN B C     1 
ATOM   5988  O  O     . GLN F 4 50  ? 27.286  73.000  -47.406 1.00 107.91 ? 50   GLN B O     1 
ATOM   5989  C  CB    . GLN F 4 50  ? 27.806  75.276  -45.387 1.00 98.94  ? 50   GLN B CB    1 
ATOM   5990  C  CG    . GLN F 4 50  ? 26.895  76.366  -45.968 1.00 98.94  ? 50   GLN B CG    1 
ATOM   5991  C  CD    . GLN F 4 50  ? 26.003  77.050  -44.927 1.00 98.94  ? 50   GLN B CD    1 
ATOM   5992  O  OE1   . GLN F 4 50  ? 25.415  76.399  -44.057 1.00 98.94  ? 50   GLN B OE1   1 
ATOM   5993  N  NE2   . GLN F 4 50  ? 25.888  78.373  -45.030 1.00 98.94  ? 50   GLN B NE2   1 
ATOM   5994  N  N     . GLY F 4 51  ? 25.226  73.489  -46.661 1.00 130.63 ? 51   GLY B N     1 
ATOM   5995  C  CA    . GLY F 4 51  ? 24.591  73.052  -47.891 1.00 130.63 ? 51   GLY B CA    1 
ATOM   5996  C  C     . GLY F 4 51  ? 24.005  71.652  -47.812 1.00 130.63 ? 51   GLY B C     1 
ATOM   5997  O  O     . GLY F 4 51  ? 22.856  71.429  -48.197 1.00 130.63 ? 51   GLY B O     1 
ATOM   5998  N  N     . LYS F 4 52  ? 24.792  70.704  -47.313 1.00 100.81 ? 52   LYS B N     1 
ATOM   5999  C  CA    . LYS F 4 52  ? 24.330  69.330  -47.200 1.00 100.81 ? 52   LYS B CA    1 
ATOM   6000  C  C     . LYS F 4 52  ? 23.705  69.041  -45.834 1.00 100.81 ? 52   LYS B C     1 
ATOM   6001  O  O     . LYS F 4 52  ? 22.787  68.222  -45.729 1.00 100.81 ? 52   LYS B O     1 
ATOM   6002  C  CB    . LYS F 4 52  ? 25.487  68.366  -47.468 1.00 88.06  ? 52   LYS B CB    1 
ATOM   6003  N  N     . LEU F 4 53  ? 24.188  69.715  -44.790 1.00 121.04 ? 53   LEU B N     1 
ATOM   6004  C  CA    . LEU F 4 53  ? 23.649  69.501  -43.446 1.00 121.04 ? 53   LEU B CA    1 
ATOM   6005  C  C     . LEU F 4 53  ? 23.369  70.785  -42.664 1.00 121.04 ? 53   LEU B C     1 
ATOM   6006  O  O     . LEU F 4 53  ? 24.135  71.754  -42.725 1.00 121.04 ? 53   LEU B O     1 
ATOM   6007  C  CB    . LEU F 4 53  ? 24.593  68.612  -42.629 1.00 75.62  ? 53   LEU B CB    1 
ATOM   6008  C  CG    . LEU F 4 53  ? 23.971  67.912  -41.417 1.00 75.62  ? 53   LEU B CG    1 
ATOM   6009  C  CD1   . LEU F 4 53  ? 23.044  66.806  -41.885 1.00 75.62  ? 53   LEU B CD1   1 
ATOM   6010  C  CD2   . LEU F 4 53  ? 25.063  67.338  -40.537 1.00 75.62  ? 53   LEU B CD2   1 
ATOM   6011  N  N     . THR F 4 54  ? 22.258  70.773  -41.928 1.00 82.17  ? 54   THR B N     1 
ATOM   6012  C  CA    . THR F 4 54  ? 21.845  71.913  -41.103 1.00 82.17  ? 54   THR B CA    1 
ATOM   6013  C  C     . THR F 4 54  ? 21.914  71.540  -39.613 1.00 82.17  ? 54   THR B C     1 
ATOM   6014  O  O     . THR F 4 54  ? 21.225  70.623  -39.142 1.00 82.17  ? 54   THR B O     1 
ATOM   6015  C  CB    . THR F 4 54  ? 20.412  72.369  -41.453 1.00 123.99 ? 54   THR B CB    1 
ATOM   6016  N  N     . VAL F 4 55  ? 22.757  72.263  -38.883 1.00 92.74  ? 55   VAL B N     1 
ATOM   6017  C  CA    . VAL F 4 55  ? 22.960  72.013  -37.460 1.00 92.74  ? 55   VAL B CA    1 
ATOM   6018  C  C     . VAL F 4 55  ? 22.154  72.991  -36.589 1.00 92.74  ? 55   VAL B C     1 
ATOM   6019  O  O     . VAL F 4 55  ? 22.341  74.212  -36.646 1.00 92.74  ? 55   VAL B O     1 
ATOM   6020  C  CB    . VAL F 4 55  ? 24.467  72.105  -37.131 1.00 73.23  ? 55   VAL B CB    1 
ATOM   6021  C  CG1   . VAL F 4 55  ? 24.810  71.136  -36.020 1.00 73.23  ? 55   VAL B CG1   1 
ATOM   6022  C  CG2   . VAL F 4 55  ? 25.298  71.819  -38.399 1.00 73.23  ? 55   VAL B CG2   1 
ATOM   6023  N  N     . ALA F 4 56  ? 21.250  72.432  -35.788 1.00 83.68  ? 56   ALA B N     1 
ATOM   6024  C  CA    . ALA F 4 56  ? 20.385  73.220  -34.915 1.00 83.68  ? 56   ALA B CA    1 
ATOM   6025  C  C     . ALA F 4 56  ? 20.507  72.803  -33.457 1.00 83.68  ? 56   ALA B C     1 
ATOM   6026  O  O     . ALA F 4 56  ? 20.264  71.648  -33.116 1.00 83.68  ? 56   ALA B O     1 
ATOM   6027  C  CB    . ALA F 4 56  ? 18.931  73.078  -35.362 1.00 69.64  ? 56   ALA B CB    1 
ATOM   6028  N  N     . LYS F 4 57  ? 20.878  73.752  -32.605 1.00 83.87  ? 57   LYS B N     1 
ATOM   6029  C  CA    . LYS F 4 57  ? 21.017  73.496  -31.177 1.00 83.87  ? 57   LYS B CA    1 
ATOM   6030  C  C     . LYS F 4 57  ? 19.735  73.891  -30.435 1.00 83.87  ? 57   LYS B C     1 
ATOM   6031  O  O     . LYS F 4 57  ? 19.079  74.874  -30.778 1.00 83.87  ? 57   LYS B O     1 
ATOM   6032  C  CB    . LYS F 4 57  ? 22.209  74.288  -30.599 1.00 64.27  ? 57   LYS B CB    1 
ATOM   6033  C  CG    . LYS F 4 57  ? 23.441  73.447  -30.291 1.00 64.27  ? 57   LYS B CG    1 
ATOM   6034  C  CD    . LYS F 4 57  ? 24.410  74.151  -29.356 1.00 64.27  ? 57   LYS B CD    1 
ATOM   6035  C  CE    . LYS F 4 57  ? 25.120  75.305  -30.041 1.00 64.27  ? 57   LYS B CE    1 
ATOM   6036  N  NZ    . LYS F 4 57  ? 26.129  75.997  -29.164 1.00 64.27  ? 57   LYS B NZ    1 
ATOM   6037  N  N     . LEU F 4 58  ? 19.374  73.114  -29.422 1.00 64.84  ? 58   LEU B N     1 
ATOM   6038  C  CA    . LEU F 4 58  ? 18.193  73.421  -28.637 1.00 64.84  ? 58   LEU B CA    1 
ATOM   6039  C  C     . LEU F 4 58  ? 18.504  73.086  -27.192 1.00 64.84  ? 58   LEU B C     1 
ATOM   6040  O  O     . LEU F 4 58  ? 18.789  71.941  -26.846 1.00 64.84  ? 58   LEU B O     1 
ATOM   6041  C  CB    . LEU F 4 58  ? 16.969  72.629  -29.138 1.00 47.79  ? 58   LEU B CB    1 
ATOM   6042  C  CG    . LEU F 4 58  ? 15.576  72.878  -28.535 1.00 47.79  ? 58   LEU B CG    1 
ATOM   6043  C  CD1   . LEU F 4 58  ? 14.540  72.182  -29.376 1.00 47.79  ? 58   LEU B CD1   1 
ATOM   6044  C  CD2   . LEU F 4 58  ? 15.494  72.356  -27.131 1.00 47.79  ? 58   LEU B CD2   1 
ATOM   6045  N  N     . ASN F 4 59  ? 18.479  74.118  -26.362 1.00 53.55  ? 59   ASN B N     1 
ATOM   6046  C  CA    . ASN F 4 59  ? 18.734  73.983  -24.947 1.00 53.55  ? 59   ASN B CA    1 
ATOM   6047  C  C     . ASN F 4 59  ? 17.456  73.409  -24.343 1.00 53.55  ? 59   ASN B C     1 
ATOM   6048  O  O     . ASN F 4 59  ? 16.370  73.754  -24.774 1.00 53.55  ? 59   ASN B O     1 
ATOM   6049  C  CB    . ASN F 4 59  ? 19.044  75.362  -24.390 1.00 56.97  ? 59   ASN B CB    1 
ATOM   6050  C  CG    . ASN F 4 59  ? 19.137  75.368  -22.913 1.00 56.97  ? 59   ASN B CG    1 
ATOM   6051  O  OD1   . ASN F 4 59  ? 18.234  74.909  -22.237 1.00 56.97  ? 59   ASN B OD1   1 
ATOM   6052  N  ND2   . ASN F 4 59  ? 20.227  75.895  -22.387 1.00 56.97  ? 59   ASN B ND2   1 
ATOM   6053  N  N     . ILE F 4 60  ? 17.571  72.532  -23.356 1.00 52.85  ? 60   ILE B N     1 
ATOM   6054  C  CA    . ILE F 4 60  ? 16.395  71.918  -22.747 1.00 52.85  ? 60   ILE B CA    1 
ATOM   6055  C  C     . ILE F 4 60  ? 16.085  72.497  -21.365 1.00 52.85  ? 60   ILE B C     1 
ATOM   6056  O  O     . ILE F 4 60  ? 15.294  71.961  -20.596 1.00 52.85  ? 60   ILE B O     1 
ATOM   6057  C  CB    . ILE F 4 60  ? 16.603  70.397  -22.625 1.00 46.48  ? 60   ILE B CB    1 
ATOM   6058  C  CG1   . ILE F 4 60  ? 17.688  70.092  -21.589 1.00 46.48  ? 60   ILE B CG1   1 
ATOM   6059  C  CG2   . ILE F 4 60  ? 17.010  69.829  -23.976 1.00 46.48  ? 60   ILE B CG2   1 
ATOM   6060  C  CD1   . ILE F 4 60  ? 17.916  68.633  -21.381 1.00 46.48  ? 60   ILE B CD1   1 
ATOM   6061  N  N     . ASP F 4 61  ? 16.732  73.598  -21.052 1.00 66.13  ? 61   ASP B N     1 
ATOM   6062  C  CA    . ASP F 4 61  ? 16.549  74.256  -19.778 1.00 66.13  ? 61   ASP B CA    1 
ATOM   6063  C  C     . ASP F 4 61  ? 15.631  75.412  -20.128 1.00 66.13  ? 61   ASP B C     1 
ATOM   6064  O  O     . ASP F 4 61  ? 14.788  75.827  -19.332 1.00 66.13  ? 61   ASP B O     1 
ATOM   6065  C  CB    . ASP F 4 61  ? 17.917  74.769  -19.294 1.00 66.66  ? 61   ASP B CB    1 
ATOM   6066  C  CG    . ASP F 4 61  ? 18.217  74.427  -17.838 1.00 66.66  ? 61   ASP B CG    1 
ATOM   6067  O  OD1   . ASP F 4 61  ? 17.932  73.294  -17.388 1.00 66.66  ? 61   ASP B OD1   1 
ATOM   6068  O  OD2   . ASP F 4 61  ? 18.773  75.303  -17.144 1.00 66.66  ? 61   ASP B OD2   1 
ATOM   6069  N  N     . GLN F 4 62  ? 15.803  75.907  -21.350 1.00 77.68  ? 62   GLN B N     1 
ATOM   6070  C  CA    . GLN F 4 62  ? 15.035  77.022  -21.871 1.00 77.68  ? 62   GLN B CA    1 
ATOM   6071  C  C     . GLN F 4 62  ? 13.803  76.547  -22.621 1.00 77.68  ? 62   GLN B C     1 
ATOM   6072  O  O     . GLN F 4 62  ? 12.834  77.296  -22.779 1.00 77.68  ? 62   GLN B O     1 
ATOM   6073  C  CB    . GLN F 4 62  ? 15.910  77.841  -22.803 1.00 63.52  ? 62   GLN B CB    1 
ATOM   6074  C  CG    . GLN F 4 62  ? 17.161  78.368  -22.151 1.00 63.52  ? 62   GLN B CG    1 
ATOM   6075  C  CD    . GLN F 4 62  ? 17.806  79.464  -22.973 1.00 63.52  ? 62   GLN B CD    1 
ATOM   6076  O  OE1   . GLN F 4 62  ? 18.195  79.249  -24.124 1.00 63.52  ? 62   GLN B OE1   1 
ATOM   6077  N  NE2   . GLN F 4 62  ? 17.915  80.655  -22.389 1.00 63.52  ? 62   GLN B NE2   1 
ATOM   6078  N  N     . ASN F 4 63  ? 13.850  75.305  -23.094 1.00 43.61  ? 63   ASN B N     1 
ATOM   6079  C  CA    . ASN F 4 63  ? 12.742  74.710  -23.828 1.00 43.61  ? 63   ASN B CA    1 
ATOM   6080  C  C     . ASN F 4 63  ? 12.527  73.312  -23.255 1.00 43.61  ? 63   ASN B C     1 
ATOM   6081  O  O     . ASN F 4 63  ? 13.021  72.314  -23.796 1.00 43.61  ? 63   ASN B O     1 
ATOM   6082  C  CB    . ASN F 4 63  ? 13.082  74.630  -25.318 1.00 72.38  ? 63   ASN B CB    1 
ATOM   6083  C  CG    . ASN F 4 63  ? 13.729  75.904  -25.845 1.00 72.38  ? 63   ASN B CG    1 
ATOM   6084  O  OD1   . ASN F 4 63  ? 13.237  77.011  -25.631 1.00 72.38  ? 63   ASN B OD1   1 
ATOM   6085  N  ND2   . ASN F 4 63  ? 14.838  75.745  -26.552 1.00 72.38  ? 63   ASN B ND2   1 
ATOM   6086  N  N     . PRO F 4 64  ? 11.783  73.220  -22.148 1.00 62.18  ? 64   PRO B N     1 
ATOM   6087  C  CA    . PRO F 4 64  ? 11.499  71.955  -21.472 1.00 62.18  ? 64   PRO B CA    1 
ATOM   6088  C  C     . PRO F 4 64  ? 10.406  71.107  -22.097 1.00 62.18  ? 64   PRO B C     1 
ATOM   6089  O  O     . PRO F 4 64  ? 10.143  69.994  -21.637 1.00 62.18  ? 64   PRO B O     1 
ATOM   6090  C  CB    . PRO F 4 64  ? 11.142  72.409  -20.062 1.00 67.30  ? 64   PRO B CB    1 
ATOM   6091  C  CG    . PRO F 4 64  ? 10.363  73.664  -20.336 1.00 67.30  ? 64   PRO B CG    1 
ATOM   6092  C  CD    . PRO F 4 64  ? 11.164  74.351  -21.433 1.00 67.30  ? 64   PRO B CD    1 
ATOM   6093  N  N     . GLY F 4 65  ? 9.771   71.622  -23.142 1.00 54.25  ? 65   GLY B N     1 
ATOM   6094  C  CA    . GLY F 4 65  ? 8.699   70.865  -23.755 1.00 54.25  ? 65   GLY B CA    1 
ATOM   6095  C  C     . GLY F 4 65  ? 9.130   69.891  -24.829 1.00 54.25  ? 65   GLY B C     1 
ATOM   6096  O  O     . GLY F 4 65  ? 8.725   68.723  -24.836 1.00 54.25  ? 65   GLY B O     1 
ATOM   6097  N  N     . THR F 4 66  ? 9.964   70.382  -25.734 1.00 47.15  ? 66   THR B N     1 
ATOM   6098  C  CA    . THR F 4 66  ? 10.447  69.597  -26.850 1.00 47.15  ? 66   THR B CA    1 
ATOM   6099  C  C     . THR F 4 66  ? 11.065  68.247  -26.517 1.00 47.15  ? 66   THR B C     1 
ATOM   6100  O  O     . THR F 4 66  ? 10.495  67.212  -26.836 1.00 47.15  ? 66   THR B O     1 
ATOM   6101  C  CB    . THR F 4 66  ? 11.477  70.363  -27.630 1.00 56.28  ? 66   THR B CB    1 
ATOM   6102  O  OG1   . THR F 4 66  ? 11.044  71.716  -27.804 1.00 56.28  ? 66   THR B OG1   1 
ATOM   6103  C  CG2   . THR F 4 66  ? 11.672  69.702  -28.981 1.00 56.28  ? 66   THR B CG2   1 
ATOM   6104  N  N     . ALA F 4 67  ? 12.238  68.269  -25.888 1.00 85.43  ? 67   ALA B N     1 
ATOM   6105  C  CA    . ALA F 4 67  ? 12.975  67.052  -25.540 1.00 85.43  ? 67   ALA B CA    1 
ATOM   6106  C  C     . ALA F 4 67  ? 12.136  65.902  -25.016 1.00 85.43  ? 67   ALA B C     1 
ATOM   6107  O  O     . ALA F 4 67  ? 12.207  64.795  -25.538 1.00 85.43  ? 67   ALA B O     1 
ATOM   6108  C  CB    . ALA F 4 67  ? 14.075  67.369  -24.543 1.00 56.98  ? 67   ALA B CB    1 
ATOM   6109  N  N     . PRO F 4 68  ? 11.333  66.138  -23.974 1.00 60.70  ? 68   PRO B N     1 
ATOM   6110  C  CA    . PRO F 4 68  ? 10.513  65.046  -23.445 1.00 60.70  ? 68   PRO B CA    1 
ATOM   6111  C  C     . PRO F 4 68  ? 9.525   64.548  -24.489 1.00 60.70  ? 68   PRO B C     1 
ATOM   6112  O  O     . PRO F 4 68  ? 8.332   64.838  -24.424 1.00 60.70  ? 68   PRO B O     1 
ATOM   6113  C  CB    . PRO F 4 68  ? 9.829   65.687  -22.250 1.00 102.25 ? 68   PRO B CB    1 
ATOM   6114  C  CG    . PRO F 4 68  ? 9.635   67.090  -22.717 1.00 102.25 ? 68   PRO B CG    1 
ATOM   6115  C  CD    . PRO F 4 68  ? 10.969  67.417  -23.347 1.00 102.25 ? 68   PRO B CD    1 
ATOM   6116  N  N     . LYS F 4 69  ? 10.031  63.798  -25.455 1.00 106.39 ? 69   LYS B N     1 
ATOM   6117  C  CA    . LYS F 4 69  ? 9.213   63.271  -26.535 1.00 106.39 ? 69   LYS B CA    1 
ATOM   6118  C  C     . LYS F 4 69  ? 10.110  62.317  -27.298 1.00 106.39 ? 69   LYS B C     1 
ATOM   6119  O  O     . LYS F 4 69  ? 9.654   61.482  -28.074 1.00 106.39 ? 69   LYS B O     1 
ATOM   6120  C  CB    . LYS F 4 69  ? 8.745   64.410  -27.447 1.00 84.68  ? 69   LYS B CB    1 
ATOM   6121  N  N     . TYR F 4 70  ? 11.405  62.460  -27.068 1.00 111.51 ? 70   TYR B N     1 
ATOM   6122  C  CA    . TYR F 4 70  ? 12.385  61.598  -27.698 1.00 111.51 ? 70   TYR B CA    1 
ATOM   6123  C  C     . TYR F 4 70  ? 13.069  60.826  -26.581 1.00 111.51 ? 70   TYR B C     1 
ATOM   6124  O  O     . TYR F 4 70  ? 14.253  60.477  -26.673 1.00 111.51 ? 70   TYR B O     1 
ATOM   6125  C  CB    . TYR F 4 70  ? 13.397  62.423  -28.483 1.00 62.75  ? 70   TYR B CB    1 
ATOM   6126  C  CG    . TYR F 4 70  ? 12.794  63.179  -29.643 1.00 62.75  ? 70   TYR B CG    1 
ATOM   6127  C  CD1   . TYR F 4 70  ? 12.055  62.522  -30.613 1.00 62.75  ? 70   TYR B CD1   1 
ATOM   6128  C  CD2   . TYR F 4 70  ? 13.003  64.546  -29.791 1.00 62.75  ? 70   TYR B CD2   1 
ATOM   6129  C  CE1   . TYR F 4 70  ? 11.545  63.216  -31.709 1.00 62.75  ? 70   TYR B CE1   1 
ATOM   6130  C  CE2   . TYR F 4 70  ? 12.495  65.243  -30.879 1.00 62.75  ? 70   TYR B CE2   1 
ATOM   6131  C  CZ    . TYR F 4 70  ? 11.770  64.573  -31.834 1.00 62.75  ? 70   TYR B CZ    1 
ATOM   6132  O  OH    . TYR F 4 70  ? 11.286  65.255  -32.920 1.00 62.75  ? 70   TYR B OH    1 
ATOM   6133  N  N     . GLY F 4 71  ? 12.292  60.581  -25.525 1.00 89.22  ? 71   GLY B N     1 
ATOM   6134  C  CA    . GLY F 4 71  ? 12.764  59.844  -24.366 1.00 89.22  ? 71   GLY B CA    1 
ATOM   6135  C  C     . GLY F 4 71  ? 14.131  60.270  -23.874 1.00 89.22  ? 71   GLY B C     1 
ATOM   6136  O  O     . GLY F 4 71  ? 14.858  59.478  -23.266 1.00 89.22  ? 71   GLY B O     1 
ATOM   6137  N  N     . ILE F 4 72  ? 14.485  61.522  -24.140 1.00 82.66  ? 72   ILE B N     1 
ATOM   6138  C  CA    . ILE F 4 72  ? 15.773  62.052  -23.720 1.00 82.66  ? 72   ILE B CA    1 
ATOM   6139  C  C     . ILE F 4 72  ? 16.079  61.624  -22.300 1.00 82.66  ? 72   ILE B C     1 
ATOM   6140  O  O     . ILE F 4 72  ? 15.334  61.938  -21.367 1.00 82.66  ? 72   ILE B O     1 
ATOM   6141  C  CB    . ILE F 4 72  ? 15.799  63.586  -23.778 1.00 66.87  ? 72   ILE B CB    1 
ATOM   6142  C  CG1   . ILE F 4 72  ? 15.727  64.054  -25.236 1.00 66.87  ? 72   ILE B CG1   1 
ATOM   6143  C  CG2   . ILE F 4 72  ? 17.037  64.107  -23.067 1.00 66.87  ? 72   ILE B CG2   1 
ATOM   6144  C  CD1   . ILE F 4 72  ? 16.906  63.649  -26.075 1.00 66.87  ? 72   ILE B CD1   1 
ATOM   6145  N  N     . ARG F 4 73  ? 17.181  60.894  -22.154 1.00 81.35  ? 73   ARG B N     1 
ATOM   6146  C  CA    . ARG F 4 73  ? 17.625  60.403  -20.858 1.00 81.35  ? 73   ARG B CA    1 
ATOM   6147  C  C     . ARG F 4 73  ? 19.100  60.769  -20.654 1.00 81.35  ? 73   ARG B C     1 
ATOM   6148  O  O     . ARG F 4 73  ? 19.678  60.524  -19.597 1.00 81.35  ? 73   ARG B O     1 
ATOM   6149  C  CB    . ARG F 4 73  ? 17.408  58.885  -20.776 1.00 48.73  ? 73   ARG B CB    1 
ATOM   6150  N  N     . GLY F 4 74  ? 19.693  61.377  -21.674 1.00 73.64  ? 74   GLY B N     1 
ATOM   6151  C  CA    . GLY F 4 74  ? 21.084  61.782  -21.584 1.00 73.64  ? 74   GLY B CA    1 
ATOM   6152  C  C     . GLY F 4 74  ? 21.411  63.003  -22.428 1.00 73.64  ? 74   GLY B C     1 
ATOM   6153  O  O     . GLY F 4 74  ? 20.595  63.460  -23.232 1.00 73.64  ? 74   GLY B O     1 
ATOM   6154  N  N     . ILE F 4 75  ? 22.616  63.528  -22.262 1.00 55.85  ? 75   ILE B N     1 
ATOM   6155  C  CA    . ILE F 4 75  ? 23.018  64.703  -23.018 1.00 55.85  ? 75   ILE B CA    1 
ATOM   6156  C  C     . ILE F 4 75  ? 24.534  64.770  -23.175 1.00 55.85  ? 75   ILE B C     1 
ATOM   6157  O  O     . ILE F 4 75  ? 25.270  64.381  -22.280 1.00 55.85  ? 75   ILE B O     1 
ATOM   6158  C  CB    . ILE F 4 75  ? 22.494  65.952  -22.307 1.00 47.07  ? 75   ILE B CB    1 
ATOM   6159  C  CG1   . ILE F 4 75  ? 22.249  65.630  -20.828 1.00 47.07  ? 75   ILE B CG1   1 
ATOM   6160  C  CG2   . ILE F 4 75  ? 21.187  66.379  -22.923 1.00 47.07  ? 75   ILE B CG2   1 
ATOM   6161  C  CD1   . ILE F 4 75  ? 21.784  66.796  -20.018 1.00 47.07  ? 75   ILE B CD1   1 
ATOM   6162  N  N     . PRO F 4 76  ? 25.021  65.302  -24.298 1.00 70.08  ? 76   PRO B N     1 
ATOM   6163  C  CA    . PRO F 4 76  ? 24.242  65.841  -25.411 1.00 70.08  ? 76   PRO B CA    1 
ATOM   6164  C  C     . PRO F 4 76  ? 23.590  64.836  -26.351 1.00 70.08  ? 76   PRO B C     1 
ATOM   6165  O  O     . PRO F 4 76  ? 24.208  64.425  -27.336 1.00 70.08  ? 76   PRO B O     1 
ATOM   6166  C  CB    . PRO F 4 76  ? 25.255  66.720  -26.133 1.00 72.58  ? 76   PRO B CB    1 
ATOM   6167  C  CG    . PRO F 4 76  ? 26.531  65.971  -25.934 1.00 72.58  ? 76   PRO B CG    1 
ATOM   6168  C  CD    . PRO F 4 76  ? 26.455  65.589  -24.475 1.00 72.58  ? 76   PRO B CD    1 
ATOM   6169  N  N     . THR F 4 77  ? 22.343  64.446  -26.078 1.00 81.31  ? 77   THR B N     1 
ATOM   6170  C  CA    . THR F 4 77  ? 21.681  63.502  -26.985 1.00 81.31  ? 77   THR B CA    1 
ATOM   6171  C  C     . THR F 4 77  ? 21.594  64.138  -28.373 1.00 81.31  ? 77   THR B C     1 
ATOM   6172  O  O     . THR F 4 77  ? 21.094  65.251  -28.536 1.00 81.31  ? 77   THR B O     1 
ATOM   6173  C  CB    . THR F 4 77  ? 20.242  63.093  -26.549 1.00 59.81  ? 77   THR B CB    1 
ATOM   6174  O  OG1   . THR F 4 77  ? 20.290  62.161  -25.454 1.00 59.81  ? 77   THR B OG1   1 
ATOM   6175  C  CG2   . THR F 4 77  ? 19.532  62.421  -27.713 1.00 59.81  ? 77   THR B CG2   1 
ATOM   6176  N  N     . LEU F 4 78  ? 22.092  63.421  -29.371 1.00 88.49  ? 78   LEU B N     1 
ATOM   6177  C  CA    . LEU F 4 78  ? 22.091  63.914  -30.736 1.00 88.49  ? 78   LEU B CA    1 
ATOM   6178  C  C     . LEU F 4 78  ? 21.167  63.132  -31.668 1.00 88.49  ? 78   LEU B C     1 
ATOM   6179  O  O     . LEU F 4 78  ? 21.203  61.902  -31.730 1.00 88.49  ? 78   LEU B O     1 
ATOM   6180  C  CB    . LEU F 4 78  ? 23.515  63.887  -31.292 1.00 63.75  ? 78   LEU B CB    1 
ATOM   6181  C  CG    . LEU F 4 78  ? 24.518  64.859  -30.675 1.00 63.75  ? 78   LEU B CG    1 
ATOM   6182  C  CD1   . LEU F 4 78  ? 25.932  64.386  -30.944 1.00 63.75  ? 78   LEU B CD1   1 
ATOM   6183  C  CD2   . LEU F 4 78  ? 24.305  66.239  -31.267 1.00 63.75  ? 78   LEU B CD2   1 
ATOM   6184  N  N     . LEU F 4 79  ? 20.330  63.865  -32.387 1.00 66.49  ? 79   LEU B N     1 
ATOM   6185  C  CA    . LEU F 4 79  ? 19.422  63.265  -33.339 1.00 66.49  ? 79   LEU B CA    1 
ATOM   6186  C  C     . LEU F 4 79  ? 19.679  63.878  -34.713 1.00 66.49  ? 79   LEU B C     1 
ATOM   6187  O  O     . LEU F 4 79  ? 19.842  65.092  -34.849 1.00 66.49  ? 79   LEU B O     1 
ATOM   6188  C  CB    . LEU F 4 79  ? 17.974  63.522  -32.941 1.00 49.38  ? 79   LEU B CB    1 
ATOM   6189  C  CG    . LEU F 4 79  ? 17.404  62.754  -31.757 1.00 49.38  ? 79   LEU B CG    1 
ATOM   6190  C  CD1   . LEU F 4 79  ? 18.219  63.041  -30.533 1.00 49.38  ? 79   LEU B CD1   1 
ATOM   6191  C  CD2   . LEU F 4 79  ? 15.955  63.160  -31.525 1.00 49.38  ? 79   LEU B CD2   1 
ATOM   6192  N  N     . LEU F 4 80  ? 19.759  63.032  -35.732 1.00 110.32 ? 80   LEU B N     1 
ATOM   6193  C  CA    . LEU F 4 80  ? 19.939  63.521  -37.088 1.00 110.32 ? 80   LEU B CA    1 
ATOM   6194  C  C     . LEU F 4 80  ? 18.556  63.388  -37.700 1.00 110.32 ? 80   LEU B C     1 
ATOM   6195  O  O     . LEU F 4 80  ? 18.124  62.294  -38.053 1.00 110.32 ? 80   LEU B O     1 
ATOM   6196  C  CB    . LEU F 4 80  ? 20.934  62.666  -37.879 1.00 64.97  ? 80   LEU B CB    1 
ATOM   6197  C  CG    . LEU F 4 80  ? 20.783  62.760  -39.408 1.00 64.97  ? 80   LEU B CG    1 
ATOM   6198  C  CD1   . LEU F 4 80  ? 20.840  64.212  -39.869 1.00 64.97  ? 80   LEU B CD1   1 
ATOM   6199  C  CD2   . LEU F 4 80  ? 21.879  61.964  -40.071 1.00 64.97  ? 80   LEU B CD2   1 
ATOM   6200  N  N     . PHE F 4 81  ? 17.848  64.505  -37.793 1.00 131.80 ? 81   PHE B N     1 
ATOM   6201  C  CA    . PHE F 4 81  ? 16.513  64.494  -38.357 1.00 131.80 ? 81   PHE B CA    1 
ATOM   6202  C  C     . PHE F 4 81  ? 16.543  64.395  -39.872 1.00 131.80 ? 81   PHE B C     1 
ATOM   6203  O  O     . PHE F 4 81  ? 17.312  65.091  -40.538 1.00 131.80 ? 81   PHE B O     1 
ATOM   6204  C  CB    . PHE F 4 81  ? 15.739  65.747  -37.911 1.00 57.98  ? 81   PHE B CB    1 
ATOM   6205  C  CG    . PHE F 4 81  ? 15.058  65.580  -36.582 1.00 57.98  ? 81   PHE B CG    1 
ATOM   6206  C  CD1   . PHE F 4 81  ? 15.801  65.574  -35.400 1.00 57.98  ? 81   PHE B CD1   1 
ATOM   6207  C  CD2   . PHE F 4 81  ? 13.696  65.290  -36.518 1.00 57.98  ? 81   PHE B CD2   1 
ATOM   6208  C  CE1   . PHE F 4 81  ? 15.204  65.267  -34.180 1.00 57.98  ? 81   PHE B CE1   1 
ATOM   6209  C  CE2   . PHE F 4 81  ? 13.085  64.980  -35.301 1.00 57.98  ? 81   PHE B CE2   1 
ATOM   6210  C  CZ    . PHE F 4 81  ? 13.841  64.966  -34.132 1.00 57.98  ? 81   PHE B CZ    1 
ATOM   6211  N  N     . LYS F 4 82  ? 15.713  63.507  -40.410 1.00 92.38  ? 82   LYS B N     1 
ATOM   6212  C  CA    . LYS F 4 82  ? 15.621  63.319  -41.853 1.00 92.38  ? 82   LYS B CA    1 
ATOM   6213  C  C     . LYS F 4 82  ? 14.159  63.136  -42.239 1.00 92.38  ? 82   LYS B C     1 
ATOM   6214  O  O     . LYS F 4 82  ? 13.727  62.024  -42.546 1.00 92.38  ? 82   LYS B O     1 
ATOM   6215  C  CB    . LYS F 4 82  ? 16.426  62.094  -42.293 1.00 97.20  ? 82   LYS B CB    1 
ATOM   6216  N  N     . ASN F 4 83  ? 13.404  64.236  -42.200 1.00 119.05 ? 83   ASN B N     1 
ATOM   6217  C  CA    . ASN F 4 83  ? 11.984  64.248  -42.549 1.00 119.05 ? 83   ASN B CA    1 
ATOM   6218  C  C     . ASN F 4 83  ? 11.013  63.687  -41.518 1.00 119.05 ? 83   ASN B C     1 
ATOM   6219  O  O     . ASN F 4 83  ? 10.724  62.487  -41.506 1.00 119.05 ? 83   ASN B O     1 
ATOM   6220  C  CB    . ASN F 4 83  ? 11.754  63.525  -43.877 1.00 102.64 ? 83   ASN B CB    1 
ATOM   6221  C  CG    . ASN F 4 83  ? 12.048  64.401  -45.073 1.00 102.64 ? 83   ASN B CG    1 
ATOM   6222  O  OD1   . ASN F 4 83  ? 11.405  65.436  -45.262 1.00 102.64 ? 83   ASN B OD1   1 
ATOM   6223  N  ND2   . ASN F 4 83  ? 13.020  63.995  -45.892 1.00 102.64 ? 83   ASN B ND2   1 
ATOM   6224  N  N     . GLY F 4 84  ? 10.509  64.574  -40.663 1.00 96.19  ? 84   GLY B N     1 
ATOM   6225  C  CA    . GLY F 4 84  ? 9.533   64.194  -39.655 1.00 96.19  ? 84   GLY B CA    1 
ATOM   6226  C  C     . GLY F 4 84  ? 9.988   63.322  -38.506 1.00 96.19  ? 84   GLY B C     1 
ATOM   6227  O  O     . GLY F 4 84  ? 9.723   63.646  -37.348 1.00 96.19  ? 84   GLY B O     1 
ATOM   6228  N  N     . GLU F 4 85  ? 10.659  62.213  -38.813 1.00 96.42  ? 85   GLU B N     1 
ATOM   6229  C  CA    . GLU F 4 85  ? 11.123  61.298  -37.774 1.00 96.42  ? 85   GLU B CA    1 
ATOM   6230  C  C     . GLU F 4 85  ? 12.624  61.346  -37.554 1.00 96.42  ? 85   GLU B C     1 
ATOM   6231  O  O     . GLU F 4 85  ? 13.374  61.938  -38.333 1.00 96.42  ? 85   GLU B O     1 
ATOM   6232  C  CB    . GLU F 4 85  ? 10.711  59.861  -38.105 1.00 65.36  ? 85   GLU B CB    1 
ATOM   6233  N  N     . VAL F 4 86  ? 13.053  60.709  -36.475 1.00 103.12 ? 86   VAL B N     1 
ATOM   6234  C  CA    . VAL F 4 86  ? 14.461  60.666  -36.131 1.00 103.12 ? 86   VAL B CA    1 
ATOM   6235  C  C     . VAL F 4 86  ? 15.167  59.711  -37.075 1.00 103.12 ? 86   VAL B C     1 
ATOM   6236  O  O     . VAL F 4 86  ? 14.701  58.598  -37.300 1.00 103.12 ? 86   VAL B O     1 
ATOM   6237  C  CB    . VAL F 4 86  ? 14.668  60.147  -34.690 1.00 126.75 ? 86   VAL B CB    1 
ATOM   6238  C  CG1   . VAL F 4 86  ? 15.928  60.762  -34.091 1.00 126.75 ? 86   VAL B CG1   1 
ATOM   6239  C  CG2   . VAL F 4 86  ? 13.436  60.442  -33.841 1.00 126.75 ? 86   VAL B CG2   1 
ATOM   6240  N  N     . ALA F 4 87  ? 16.285  60.140  -37.639 1.00 108.81 ? 87   ALA B N     1 
ATOM   6241  C  CA    . ALA F 4 87  ? 17.027  59.259  -38.525 1.00 108.81 ? 87   ALA B CA    1 
ATOM   6242  C  C     . ALA F 4 87  ? 17.946  58.381  -37.674 1.00 108.81 ? 87   ALA B C     1 
ATOM   6243  O  O     . ALA F 4 87  ? 17.941  57.152  -37.795 1.00 108.81 ? 87   ALA B O     1 
ATOM   6244  C  CB    . ALA F 4 87  ? 17.850  60.073  -39.521 1.00 107.67 ? 87   ALA B CB    1 
ATOM   6245  N  N     . ALA F 4 88  ? 18.721  59.026  -36.804 1.00 110.55 ? 88   ALA B N     1 
ATOM   6246  C  CA    . ALA F 4 88  ? 19.666  58.337  -35.933 1.00 110.55 ? 88   ALA B CA    1 
ATOM   6247  C  C     . ALA F 4 88  ? 19.846  59.082  -34.616 1.00 110.55 ? 88   ALA B C     1 
ATOM   6248  O  O     . ALA F 4 88  ? 19.739  60.303  -34.566 1.00 110.55 ? 88   ALA B O     1 
ATOM   6249  C  CB    . ALA F 4 88  ? 21.023  58.203  -36.636 1.00 83.27  ? 88   ALA B CB    1 
ATOM   6250  N  N     . THR F 4 89  ? 20.139  58.335  -33.557 1.00 78.98  ? 89   THR B N     1 
ATOM   6251  C  CA    . THR F 4 89  ? 20.344  58.894  -32.230 1.00 78.98  ? 89   THR B CA    1 
ATOM   6252  C  C     . THR F 4 89  ? 21.725  58.486  -31.698 1.00 78.98  ? 89   THR B C     1 
ATOM   6253  O  O     . THR F 4 89  ? 22.175  57.366  -31.937 1.00 78.98  ? 89   THR B O     1 
ATOM   6254  C  CB    . THR F 4 89  ? 19.247  58.372  -31.270 1.00 85.05  ? 89   THR B CB    1 
ATOM   6255  O  OG1   . THR F 4 89  ? 17.992  58.991  -31.586 1.00 85.05  ? 89   THR B OG1   1 
ATOM   6256  C  CG2   . THR F 4 89  ? 19.610  58.660  -29.826 1.00 85.05  ? 89   THR B CG2   1 
ATOM   6257  N  N     . LYS F 4 90  ? 22.388  59.397  -30.985 1.00 75.68  ? 90   LYS B N     1 
ATOM   6258  C  CA    . LYS F 4 90  ? 23.717  59.144  -30.411 1.00 75.68  ? 90   LYS B CA    1 
ATOM   6259  C  C     . LYS F 4 90  ? 23.954  60.087  -29.226 1.00 75.68  ? 90   LYS B C     1 
ATOM   6260  O  O     . LYS F 4 90  ? 23.920  61.307  -29.368 1.00 75.68  ? 90   LYS B O     1 
ATOM   6261  C  CB    . LYS F 4 90  ? 24.814  59.351  -31.477 1.00 59.21  ? 90   LYS B CB    1 
ATOM   6262  N  N     . VAL F 4 91  ? 24.211  59.519  -28.060 1.00 63.38  ? 91   VAL B N     1 
ATOM   6263  C  CA    . VAL F 4 91  ? 24.418  60.317  -26.867 1.00 63.38  ? 91   VAL B CA    1 
ATOM   6264  C  C     . VAL F 4 91  ? 25.877  60.422  -26.431 1.00 63.38  ? 91   VAL B C     1 
ATOM   6265  O  O     . VAL F 4 91  ? 26.495  59.417  -26.067 1.00 63.38  ? 91   VAL B O     1 
ATOM   6266  C  CB    . VAL F 4 91  ? 23.601  59.735  -25.708 1.00 48.38  ? 91   VAL B CB    1 
ATOM   6267  C  CG1   . VAL F 4 91  ? 23.695  60.638  -24.519 1.00 48.38  ? 91   VAL B CG1   1 
ATOM   6268  C  CG2   . VAL F 4 91  ? 22.149  59.535  -26.134 1.00 48.38  ? 91   VAL B CG2   1 
ATOM   6269  N  N     . GLY F 4 92  ? 26.424  61.637  -26.455 1.00 54.20  ? 92   GLY B N     1 
ATOM   6270  C  CA    . GLY F 4 92  ? 27.806  61.834  -26.039 1.00 54.20  ? 92   GLY B CA    1 
ATOM   6271  C  C     . GLY F 4 92  ? 28.604  62.859  -26.833 1.00 54.20  ? 92   GLY B C     1 
ATOM   6272  O  O     . GLY F 4 92  ? 28.099  63.450  -27.781 1.00 54.20  ? 92   GLY B O     1 
ATOM   6273  N  N     . ALA F 4 93  ? 29.863  63.061  -26.456 1.00 90.42  ? 93   ALA B N     1 
ATOM   6274  C  CA    . ALA F 4 93  ? 30.712  64.035  -27.134 1.00 90.42  ? 93   ALA B CA    1 
ATOM   6275  C  C     . ALA F 4 93  ? 31.610  63.429  -28.207 1.00 90.42  ? 93   ALA B C     1 
ATOM   6276  O  O     . ALA F 4 93  ? 32.822  63.318  -28.013 1.00 90.42  ? 93   ALA B O     1 
ATOM   6277  C  CB    . ALA F 4 93  ? 31.571  64.782  -26.111 1.00 47.56  ? 93   ALA B CB    1 
ATOM   6278  N  N     . LEU F 4 94  ? 31.022  63.060  -29.343 1.00 72.71  ? 94   LEU B N     1 
ATOM   6279  C  CA    . LEU F 4 94  ? 31.792  62.483  -30.440 1.00 72.71  ? 94   LEU B CA    1 
ATOM   6280  C  C     . LEU F 4 94  ? 32.848  63.474  -30.940 1.00 72.71  ? 94   LEU B C     1 
ATOM   6281  O  O     . LEU F 4 94  ? 32.586  64.677  -31.051 1.00 72.71  ? 94   LEU B O     1 
ATOM   6282  C  CB    . LEU F 4 94  ? 30.857  62.065  -31.574 1.00 67.15  ? 94   LEU B CB    1 
ATOM   6283  C  CG    . LEU F 4 94  ? 29.605  61.344  -31.062 1.00 67.15  ? 94   LEU B CG    1 
ATOM   6284  C  CD1   . LEU F 4 94  ? 28.898  60.639  -32.213 1.00 67.15  ? 94   LEU B CD1   1 
ATOM   6285  C  CD2   . LEU F 4 94  ? 29.991  60.351  -29.983 1.00 67.15  ? 94   LEU B CD2   1 
ATOM   6286  N  N     . SER F 4 95  ? 34.043  62.959  -31.234 1.00 92.23  ? 95   SER B N     1 
ATOM   6287  C  CA    . SER F 4 95  ? 35.171  63.780  -31.686 1.00 92.23  ? 95   SER B CA    1 
ATOM   6288  C  C     . SER F 4 95  ? 34.924  64.544  -32.979 1.00 92.23  ? 95   SER B C     1 
ATOM   6289  O  O     . SER F 4 95  ? 34.024  64.210  -33.753 1.00 92.23  ? 95   SER B O     1 
ATOM   6290  C  CB    . SER F 4 95  ? 36.428  62.922  -31.863 1.00 111.33 ? 95   SER B CB    1 
ATOM   6291  O  OG    . SER F 4 95  ? 36.495  62.362  -33.163 1.00 111.33 ? 95   SER B OG    1 
ATOM   6292  N  N     . LYS F 4 96  ? 35.744  65.566  -33.214 1.00 57.36  ? 96   LYS B N     1 
ATOM   6293  C  CA    . LYS F 4 96  ? 35.599  66.368  -34.423 1.00 57.36  ? 96   LYS B CA    1 
ATOM   6294  C  C     . LYS F 4 96  ? 35.701  65.447  -35.618 1.00 57.36  ? 96   LYS B C     1 
ATOM   6295  O  O     . LYS F 4 96  ? 35.333  65.827  -36.730 1.00 57.36  ? 96   LYS B O     1 
ATOM   6296  C  CB    . LYS F 4 96  ? 36.672  67.463  -34.509 1.00 43.53  ? 96   LYS B CB    1 
ATOM   6297  N  N     . GLY F 4 97  ? 36.195  64.232  -35.366 1.00 77.74  ? 97   GLY B N     1 
ATOM   6298  C  CA    . GLY F 4 97  ? 36.347  63.227  -36.406 1.00 77.74  ? 97   GLY B CA    1 
ATOM   6299  C  C     . GLY F 4 97  ? 35.329  62.115  -36.246 1.00 77.74  ? 97   GLY B C     1 
ATOM   6300  O  O     . GLY F 4 97  ? 34.852  61.556  -37.232 1.00 77.74  ? 97   GLY B O     1 
ATOM   6301  N  N     . GLN F 4 98  ? 34.995  61.796  -34.999 1.00 120.89 ? 98   GLN B N     1 
ATOM   6302  C  CA    . GLN F 4 98  ? 34.008  60.758  -34.703 1.00 120.89 ? 98   GLN B CA    1 
ATOM   6303  C  C     . GLN F 4 98  ? 32.641  61.178  -35.231 1.00 120.89 ? 98   GLN B C     1 
ATOM   6304  O  O     . GLN F 4 98  ? 31.877  60.359  -35.751 1.00 120.89 ? 98   GLN B O     1 
ATOM   6305  C  CB    . GLN F 4 98  ? 33.908  60.525  -33.189 1.00 75.49  ? 98   GLN B CB    1 
ATOM   6306  C  CG    . GLN F 4 98  ? 35.158  59.924  -32.575 1.00 75.49  ? 98   GLN B CG    1 
ATOM   6307  C  CD    . GLN F 4 98  ? 35.026  59.668  -31.097 1.00 75.49  ? 98   GLN B CD    1 
ATOM   6308  O  OE1   . GLN F 4 98  ? 34.823  60.592  -30.322 1.00 75.49  ? 98   GLN B OE1   1 
ATOM   6309  N  NE2   . GLN F 4 98  ? 35.148  58.408  -30.694 1.00 75.49  ? 98   GLN B NE2   1 
ATOM   6310  N  N     . LEU F 4 99  ? 32.343  62.465  -35.080 1.00 144.23 ? 99   LEU B N     1 
ATOM   6311  C  CA    . LEU F 4 99  ? 31.075  63.021  -35.526 1.00 144.23 ? 99   LEU B CA    1 
ATOM   6312  C  C     . LEU F 4 99  ? 31.013  62.998  -37.041 1.00 144.23 ? 99   LEU B C     1 
ATOM   6313  O  O     . LEU F 4 99  ? 29.990  62.631  -37.615 1.00 144.23 ? 99   LEU B O     1 
ATOM   6314  C  CB    . LEU F 4 99  ? 30.908  64.459  -35.017 1.00 109.35 ? 99   LEU B CB    1 
ATOM   6315  N  N     . LYS F 4 100 ? 32.111  63.384  -37.688 1.00 94.92  ? 100  LYS B N     1 
ATOM   6316  C  CA    . LYS F 4 100 ? 32.137  63.398  -39.147 1.00 94.92  ? 100  LYS B CA    1 
ATOM   6317  C  C     . LYS F 4 100 ? 31.965  61.983  -39.695 1.00 94.92  ? 100  LYS B C     1 
ATOM   6318  O  O     . LYS F 4 100 ? 31.637  61.807  -40.872 1.00 94.92  ? 100  LYS B O     1 
ATOM   6319  C  CB    . LYS F 4 100 ? 33.436  64.025  -39.684 1.00 29.68  ? 100  LYS B CB    1 
ATOM   6320  N  N     . GLU F 4 101 ? 32.170  60.982  -38.836 1.00 147.73 ? 101  GLU B N     1 
ATOM   6321  C  CA    . GLU F 4 101 ? 32.023  59.578  -39.225 1.00 147.73 ? 101  GLU B CA    1 
ATOM   6322  C  C     . GLU F 4 101 ? 30.595  59.094  -38.960 1.00 147.73 ? 101  GLU B C     1 
ATOM   6323  O  O     . GLU F 4 101 ? 30.038  58.320  -39.740 1.00 147.73 ? 101  GLU B O     1 
ATOM   6324  C  CB    . GLU F 4 101 ? 33.025  58.704  -38.461 1.00 53.65  ? 101  GLU B CB    1 
ATOM   6325  N  N     . PHE F 4 102 ? 30.009  59.554  -37.856 1.00 125.57 ? 102  PHE B N     1 
ATOM   6326  C  CA    . PHE F 4 102 ? 28.640  59.183  -37.507 1.00 125.57 ? 102  PHE B CA    1 
ATOM   6327  C  C     . PHE F 4 102 ? 27.693  59.873  -38.479 1.00 125.57 ? 102  PHE B C     1 
ATOM   6328  O  O     . PHE F 4 102 ? 26.626  59.359  -38.810 1.00 125.57 ? 102  PHE B O     1 
ATOM   6329  C  CB    . PHE F 4 102 ? 28.313  59.626  -36.081 1.00 99.86  ? 102  PHE B CB    1 
ATOM   6330  N  N     . LEU F 4 103 ? 28.096  61.051  -38.932 1.00 114.41 ? 103  LEU B N     1 
ATOM   6331  C  CA    . LEU F 4 103 ? 27.291  61.802  -39.867 1.00 114.41 ? 103  LEU B CA    1 
ATOM   6332  C  C     . LEU F 4 103 ? 27.343  61.140  -41.247 1.00 114.41 ? 103  LEU B C     1 
ATOM   6333  O  O     . LEU F 4 103 ? 26.383  60.481  -41.651 1.00 114.41 ? 103  LEU B O     1 
ATOM   6334  C  CB    . LEU F 4 103 ? 27.788  63.251  -39.944 1.00 91.99  ? 103  LEU B CB    1 
ATOM   6335  N  N     . ASP F 4 104 ? 28.467  61.301  -41.949 1.00 115.05 ? 104  ASP B N     1 
ATOM   6336  C  CA    . ASP F 4 104 ? 28.655  60.749  -43.299 1.00 115.05 ? 104  ASP B CA    1 
ATOM   6337  C  C     . ASP F 4 104 ? 28.032  59.378  -43.522 1.00 115.05 ? 104  ASP B C     1 
ATOM   6338  O  O     . ASP F 4 104 ? 27.424  59.132  -44.561 1.00 115.05 ? 104  ASP B O     1 
ATOM   6339  C  CB    . ASP F 4 104 ? 30.143  60.680  -43.643 1.00 67.50  ? 104  ASP B CB    1 
ATOM   6340  N  N     . ALA F 4 105 ? 28.192  58.489  -42.548 1.00 88.73  ? 105  ALA B N     1 
ATOM   6341  C  CA    . ALA F 4 105 ? 27.636  57.142  -42.638 1.00 88.73  ? 105  ALA B CA    1 
ATOM   6342  C  C     . ALA F 4 105 ? 26.112  57.178  -42.608 1.00 88.73  ? 105  ALA B C     1 
ATOM   6343  O  O     . ALA F 4 105 ? 25.455  56.133  -42.617 1.00 88.73  ? 105  ALA B O     1 
ATOM   6344  C  CB    . ALA F 4 105 ? 28.154  56.289  -41.490 1.00 116.27 ? 105  ALA B CB    1 
ATOM   6345  N  N     . ASN F 4 106 ? 25.567  58.392  -42.566 1.00 93.72  ? 106  ASN B N     1 
ATOM   6346  C  CA    . ASN F 4 106 ? 24.127  58.632  -42.535 1.00 93.72  ? 106  ASN B CA    1 
ATOM   6347  C  C     . ASN F 4 106 ? 23.813  59.753  -43.518 1.00 93.72  ? 106  ASN B C     1 
ATOM   6348  O  O     . ASN F 4 106 ? 22.709  59.838  -44.055 1.00 93.72  ? 106  ASN B O     1 
ATOM   6349  C  CB    . ASN F 4 106 ? 23.691  59.071  -41.130 1.00 62.99  ? 106  ASN B CB    1 
ATOM   6350  C  CG    . ASN F 4 106 ? 23.627  57.918  -40.135 1.00 62.99  ? 106  ASN B CG    1 
ATOM   6351  O  OD1   . ASN F 4 106 ? 22.583  57.265  -39.974 1.00 62.99  ? 106  ASN B OD1   1 
ATOM   6352  N  ND2   . ASN F 4 106 ? 24.747  57.659  -39.463 1.00 62.99  ? 106  ASN B ND2   1 
ATOM   6353  N  N     . LEU F 4 107 ? 24.806  60.607  -43.743 1.00 79.68  ? 107  LEU B N     1 
ATOM   6354  C  CA    . LEU F 4 107 ? 24.687  61.756  -44.636 1.00 79.68  ? 107  LEU B CA    1 
ATOM   6355  C  C     . LEU F 4 107 ? 25.404  61.512  -45.972 1.00 79.68  ? 107  LEU B C     1 
ATOM   6356  O  O     . LEU F 4 107 ? 24.736  61.091  -46.946 1.00 79.68  ? 107  LEU B O     1 
ATOM   6357  C  CB    . LEU F 4 107 ? 25.291  62.977  -43.939 1.00 63.64  ? 107  LEU B CB    1 
ATOM   6358  C  CG    . LEU F 4 107 ? 25.071  64.384  -44.491 1.00 63.64  ? 107  LEU B CG    1 
ATOM   6359  C  CD1   . LEU F 4 107 ? 23.592  64.778  -44.346 1.00 63.64  ? 107  LEU B CD1   1 
ATOM   6360  C  CD2   . LEU F 4 107 ? 25.968  65.357  -43.730 1.00 63.64  ? 107  LEU B CD2   1 
ATOM   6361  N  N     . MET G 3 1   ? 2.933   94.198  57.609  1.00 104.79 ? 1    MET C N     1 
ATOM   6362  C  CA    . MET G 3 1   ? 3.081   93.729  59.015  1.00 104.79 ? 1    MET C CA    1 
ATOM   6363  C  C     . MET G 3 1   ? 3.588   94.859  59.893  1.00 104.79 ? 1    MET C C     1 
ATOM   6364  O  O     . MET G 3 1   ? 4.125   95.840  59.388  1.00 104.79 ? 1    MET C O     1 
ATOM   6365  C  CB    . MET G 3 1   ? 4.062   92.562  59.084  1.00 66.36  ? 1    MET C CB    1 
ATOM   6366  C  CG    . MET G 3 1   ? 4.026   91.813  60.389  1.00 66.36  ? 1    MET C CG    1 
ATOM   6367  S  SD    . MET G 3 1   ? 5.155   90.435  60.332  1.00 66.36  ? 1    MET C SD    1 
ATOM   6368  C  CE    . MET G 3 1   ? 4.073   89.111  59.749  1.00 66.36  ? 1    MET C CE    1 
ATOM   6369  N  N     . ILE G 3 2   ? 3.392   94.722  61.203  1.00 102.52 ? 2    ILE C N     1 
ATOM   6370  C  CA    . ILE G 3 2   ? 3.850   95.713  62.176  1.00 102.52 ? 2    ILE C CA    1 
ATOM   6371  C  C     . ILE G 3 2   ? 4.159   95.007  63.473  1.00 102.52 ? 2    ILE C C     1 
ATOM   6372  O  O     . ILE G 3 2   ? 3.668   93.909  63.729  1.00 102.52 ? 2    ILE C O     1 
ATOM   6373  C  CB    . ILE G 3 2   ? 2.803   96.735  62.533  1.00 61.61  ? 2    ILE C CB    1 
ATOM   6374  C  CG1   . ILE G 3 2   ? 1.988   97.111  61.306  1.00 61.61  ? 2    ILE C CG1   1 
ATOM   6375  C  CG2   . ILE G 3 2   ? 3.483   97.938  63.138  1.00 61.61  ? 2    ILE C CG2   1 
ATOM   6376  C  CD1   . ILE G 3 2   ? 0.555   97.444  61.655  1.00 61.61  ? 2    ILE C CD1   1 
ATOM   6377  N  N     . VAL G 3 3   ? 4.935   95.667  64.315  1.00 64.22  ? 3    VAL C N     1 
ATOM   6378  C  CA    . VAL G 3 3   ? 5.335   95.093  65.588  1.00 64.22  ? 3    VAL C CA    1 
ATOM   6379  C  C     . VAL G 3 3   ? 5.102   96.039  66.762  1.00 64.22  ? 3    VAL C C     1 
ATOM   6380  O  O     . VAL G 3 3   ? 6.004   96.789  67.151  1.00 64.22  ? 3    VAL C O     1 
ATOM   6381  C  CB    . VAL G 3 3   ? 6.806   94.721  65.508  1.00 47.28  ? 3    VAL C CB    1 
ATOM   6382  C  CG1   . VAL G 3 3   ? 7.359   94.377  66.883  1.00 47.28  ? 3    VAL C CG1   1 
ATOM   6383  C  CG2   . VAL G 3 3   ? 6.954   93.581  64.543  1.00 47.28  ? 3    VAL C CG2   1 
ATOM   6384  N  N     . SER G 3 4   ? 3.907   95.976  67.349  1.00 90.25  ? 4    SER C N     1 
ATOM   6385  C  CA    . SER G 3 4   ? 3.549   96.862  68.456  1.00 90.25  ? 4    SER C CA    1 
ATOM   6386  C  C     . SER G 3 4   ? 3.664   96.271  69.873  1.00 90.25  ? 4    SER C C     1 
ATOM   6387  O  O     . SER G 3 4   ? 3.864   95.068  70.053  1.00 90.25  ? 4    SER C O     1 
ATOM   6388  C  CB    . SER G 3 4   ? 2.127   97.400  68.227  1.00 57.41  ? 4    SER C CB    1 
ATOM   6389  O  OG    . SER G 3 4   ? 1.911   98.609  68.938  1.00 57.41  ? 4    SER C OG    1 
ATOM   6390  N  N     . ASP G 3 5   ? 3.526   97.151  70.865  1.00 57.14  ? 5    ASP C N     1 
ATOM   6391  C  CA    . ASP G 3 5   ? 3.609   96.814  72.287  1.00 57.14  ? 5    ASP C CA    1 
ATOM   6392  C  C     . ASP G 3 5   ? 2.968   97.978  73.049  1.00 57.14  ? 5    ASP C C     1 
ATOM   6393  O  O     . ASP G 3 5   ? 3.030   99.105  72.595  1.00 57.14  ? 5    ASP C O     1 
ATOM   6394  C  CB    . ASP G 3 5   ? 5.084   96.675  72.692  1.00 70.62  ? 5    ASP C CB    1 
ATOM   6395  C  CG    . ASP G 3 5   ? 5.289   96.718  74.194  1.00 70.62  ? 5    ASP C CG    1 
ATOM   6396  O  OD1   . ASP G 3 5   ? 5.474   95.646  74.805  1.00 70.62  ? 5    ASP C OD1   1 
ATOM   6397  O  OD2   . ASP G 3 5   ? 5.256   97.825  74.769  1.00 70.62  ? 5    ASP C OD2   1 
ATOM   6398  N  N     . ILE G 3 6   ? 2.346   97.719  74.194  1.00 57.54  ? 6    ILE C N     1 
ATOM   6399  C  CA    . ILE G 3 6   ? 1.724   98.798  74.951  1.00 57.54  ? 6    ILE C CA    1 
ATOM   6400  C  C     . ILE G 3 6   ? 2.081   98.686  76.417  1.00 57.54  ? 6    ILE C C     1 
ATOM   6401  O  O     . ILE G 3 6   ? 2.359   97.595  76.916  1.00 57.54  ? 6    ILE C O     1 
ATOM   6402  C  CB    . ILE G 3 6   ? 0.161   98.783  74.879  1.00 65.06  ? 6    ILE C CB    1 
ATOM   6403  C  CG1   . ILE G 3 6   ? -0.396  97.757  75.860  1.00 65.06  ? 6    ILE C CG1   1 
ATOM   6404  C  CG2   . ILE G 3 6   ? -0.326  98.423  73.487  1.00 65.06  ? 6    ILE C CG2   1 
ATOM   6405  C  CD1   . ILE G 3 6   ? -1.859  97.965  76.201  1.00 65.06  ? 6    ILE C CD1   1 
ATOM   6406  N  N     . GLU G 3 7   ? 2.049   99.825  77.102  1.00 70.47  ? 7    GLU C N     1 
ATOM   6407  C  CA    . GLU G 3 7   ? 2.324   99.915  78.533  1.00 70.47  ? 7    GLU C CA    1 
ATOM   6408  C  C     . GLU G 3 7   ? 1.036   100.389 79.209  1.00 70.47  ? 7    GLU C C     1 
ATOM   6409  O  O     . GLU G 3 7   ? 0.565   101.490 78.940  1.00 70.47  ? 7    GLU C O     1 
ATOM   6410  C  CB    . GLU G 3 7   ? 3.439   100.928 78.778  1.00 82.56  ? 7    GLU C CB    1 
ATOM   6411  C  CG    . GLU G 3 7   ? 4.797   100.451 78.324  1.00 82.56  ? 7    GLU C CG    1 
ATOM   6412  C  CD    . GLU G 3 7   ? 5.395   99.487  79.310  1.00 82.56  ? 7    GLU C CD    1 
ATOM   6413  O  OE1   . GLU G 3 7   ? 4.609   98.893  80.081  1.00 82.56  ? 7    GLU C OE1   1 
ATOM   6414  O  OE2   . GLU G 3 7   ? 6.635   99.322  79.316  1.00 82.56  ? 7    GLU C OE2   1 
ATOM   6415  N  N     . ALA G 3 8   ? 0.458   99.558  80.072  1.00 43.84  ? 8    ALA C N     1 
ATOM   6416  C  CA    . ALA G 3 8   ? -0.780  99.908  80.768  1.00 43.84  ? 8    ALA C CA    1 
ATOM   6417  C  C     . ALA G 3 8   ? -0.468  100.220 82.210  1.00 43.84  ? 8    ALA C C     1 
ATOM   6418  O  O     . ALA G 3 8   ? 0.682   100.127 82.629  1.00 43.84  ? 8    ALA C O     1 
ATOM   6419  C  CB    . ALA G 3 8   ? -1.750  98.759  80.700  1.00 31.55  ? 8    ALA C CB    1 
ATOM   6420  N  N     . ASN G 3 9   ? -1.503  100.562 82.967  1.00 54.09  ? 9    ASN C N     1 
ATOM   6421  C  CA    . ASN G 3 9   ? -1.373  100.907 84.383  1.00 54.09  ? 9    ASN C CA    1 
ATOM   6422  C  C     . ASN G 3 9   ? -1.484  99.695  85.302  1.00 54.09  ? 9    ASN C C     1 
ATOM   6423  O  O     . ASN G 3 9   ? -1.313  99.836  86.509  1.00 54.09  ? 9    ASN C O     1 
ATOM   6424  C  CB    . ASN G 3 9   ? -2.474  101.866 84.774  1.00 87.97  ? 9    ASN C CB    1 
ATOM   6425  C  CG    . ASN G 3 9   ? -3.823  101.176 84.841  1.00 87.97  ? 9    ASN C CG    1 
ATOM   6426  O  OD1   . ASN G 3 9   ? -4.350  100.693 83.834  1.00 87.97  ? 9    ASN C OD1   1 
ATOM   6427  N  ND2   . ASN G 3 9   ? -4.380  101.106 86.040  1.00 87.97  ? 9    ASN C ND2   1 
ATOM   6428  N  N     . ALA G 3 10  ? -1.801  98.524  84.747  1.00 48.81  ? 10   ALA C N     1 
ATOM   6429  C  CA    . ALA G 3 10  ? -1.924  97.313  85.551  1.00 48.81  ? 10   ALA C CA    1 
ATOM   6430  C  C     . ALA G 3 10  ? -2.121  96.045  84.750  1.00 48.81  ? 10   ALA C C     1 
ATOM   6431  O  O     . ALA G 3 10  ? -2.303  96.080  83.536  1.00 48.81  ? 10   ALA C O     1 
ATOM   6432  C  CB    . ALA G 3 10  ? -3.045  97.455  86.501  1.00 39.90  ? 10   ALA C CB    1 
ATOM   6433  N  N     . LEU G 3 11  ? -2.092  94.909  85.438  1.00 59.79  ? 11   LEU C N     1 
ATOM   6434  C  CA    . LEU G 3 11  ? -2.273  93.639  84.751  1.00 59.79  ? 11   LEU C CA    1 
ATOM   6435  C  C     . LEU G 3 11  ? -3.654  93.631  84.158  1.00 59.79  ? 11   LEU C C     1 
ATOM   6436  O  O     . LEU G 3 11  ? -4.501  94.431  84.553  1.00 59.79  ? 11   LEU C O     1 
ATOM   6437  C  CB    . LEU G 3 11  ? -2.082  92.458  85.701  1.00 51.46  ? 11   LEU C CB    1 
ATOM   6438  C  CG    . LEU G 3 11  ? -0.628  92.048  85.968  1.00 51.46  ? 11   LEU C CG    1 
ATOM   6439  C  CD1   . LEU G 3 11  ? -0.572  90.898  86.937  1.00 51.46  ? 11   LEU C CD1   1 
ATOM   6440  C  CD2   . LEU G 3 11  ? 0.020   91.652  84.665  1.00 51.46  ? 11   LEU C CD2   1 
ATOM   6441  N  N     . LEU G 3 12  ? -3.897  92.735  83.213  1.00 55.73  ? 12   LEU C N     1 
ATOM   6442  C  CA    . LEU G 3 12  ? -5.199  92.721  82.556  1.00 55.73  ? 12   LEU C CA    1 
ATOM   6443  C  C     . LEU G 3 12  ? -6.391  92.753  83.520  1.00 55.73  ? 12   LEU C C     1 
ATOM   6444  O  O     . LEU G 3 12  ? -7.271  93.608  83.421  1.00 55.73  ? 12   LEU C O     1 
ATOM   6445  C  CB    . LEU G 3 12  ? -5.318  91.509  81.622  1.00 57.36  ? 12   LEU C CB    1 
ATOM   6446  C  CG    . LEU G 3 12  ? -6.629  91.542  80.829  1.00 57.36  ? 12   LEU C CG    1 
ATOM   6447  C  CD1   . LEU G 3 12  ? -6.703  92.835  80.048  1.00 57.36  ? 12   LEU C CD1   1 
ATOM   6448  C  CD2   . LEU G 3 12  ? -6.718  90.356  79.893  1.00 57.36  ? 12   LEU C CD2   1 
ATOM   6449  N  N     . GLU G 3 13  ? -6.390  91.817  84.458  1.00 67.52  ? 13   GLU C N     1 
ATOM   6450  C  CA    . GLU G 3 13  ? -7.462  91.683  85.421  1.00 67.52  ? 13   GLU C CA    1 
ATOM   6451  C  C     . GLU G 3 13  ? -7.791  92.939  86.210  1.00 67.52  ? 13   GLU C C     1 
ATOM   6452  O  O     . GLU G 3 13  ? -8.790  92.962  86.931  1.00 67.52  ? 13   GLU C O     1 
ATOM   6453  C  CB    . GLU G 3 13  ? -7.134  90.546  86.385  1.00 78.44  ? 13   GLU C CB    1 
ATOM   6454  N  N     . SER G 3 14  ? -6.971  93.981  86.077  1.00 69.19  ? 14   SER C N     1 
ATOM   6455  C  CA    . SER G 3 14  ? -7.195  95.228  86.810  1.00 69.19  ? 14   SER C CA    1 
ATOM   6456  C  C     . SER G 3 14  ? -6.762  96.456  86.040  1.00 69.19  ? 14   SER C C     1 
ATOM   6457  O  O     . SER G 3 14  ? -6.764  97.549  86.583  1.00 69.19  ? 14   SER C O     1 
ATOM   6458  C  CB    . SER G 3 14  ? -6.437  95.205  88.134  1.00 67.17  ? 14   SER C CB    1 
ATOM   6459  O  OG    . SER G 3 14  ? -6.843  94.119  88.949  1.00 67.17  ? 14   SER C OG    1 
ATOM   6460  N  N     . VAL G 3 15  ? -6.386  96.281  84.781  1.00 63.91  ? 15   VAL C N     1 
ATOM   6461  C  CA    . VAL G 3 15  ? -5.942  97.400  83.951  1.00 63.91  ? 15   VAL C CA    1 
ATOM   6462  C  C     . VAL G 3 15  ? -7.078  98.372  83.617  1.00 63.91  ? 15   VAL C C     1 
ATOM   6463  O  O     . VAL G 3 15  ? -8.209  97.959  83.350  1.00 63.91  ? 15   VAL C O     1 
ATOM   6464  C  CB    . VAL G 3 15  ? -5.365  96.886  82.643  1.00 47.91  ? 15   VAL C CB    1 
ATOM   6465  C  CG1   . VAL G 3 15  ? -6.462  96.245  81.823  1.00 47.91  ? 15   VAL C CG1   1 
ATOM   6466  C  CG2   . VAL G 3 15  ? -4.707  98.018  81.894  1.00 47.91  ? 15   VAL C CG2   1 
ATOM   6467  N  N     . THR G 3 16  ? -6.784  99.668  83.627  1.00 67.69  ? 16   THR C N     1 
ATOM   6468  C  CA    . THR G 3 16  ? -7.817  100.652 83.312  1.00 67.69  ? 16   THR C CA    1 
ATOM   6469  C  C     . THR G 3 16  ? -7.285  101.932 82.665  1.00 67.69  ? 16   THR C C     1 
ATOM   6470  O  O     . THR G 3 16  ? -8.039  102.864 82.421  1.00 67.69  ? 16   THR C O     1 
ATOM   6471  C  CB    . THR G 3 16  ? -8.685  101.016 84.570  1.00 68.83  ? 16   THR C CB    1 
ATOM   6472  O  OG1   . THR G 3 16  ? -7.849  101.469 85.646  1.00 68.83  ? 16   THR C OG1   1 
ATOM   6473  C  CG2   . THR G 3 16  ? -9.476  99.804  85.036  1.00 68.83  ? 16   THR C CG2   1 
ATOM   6474  N  N     . LYS G 3 17  ? -5.994  101.978 82.373  1.00 50.66  ? 17   LYS C N     1 
ATOM   6475  C  CA    . LYS G 3 17  ? -5.436  103.152 81.730  1.00 50.66  ? 17   LYS C CA    1 
ATOM   6476  C  C     . LYS G 3 17  ? -4.258  102.841 80.801  1.00 50.66  ? 17   LYS C C     1 
ATOM   6477  O  O     . LYS G 3 17  ? -3.222  102.295 81.215  1.00 50.66  ? 17   LYS C O     1 
ATOM   6478  C  CB    . LYS G 3 17  ? -5.014  104.173 82.785  1.00 91.06  ? 17   LYS C CB    1 
ATOM   6479  N  N     . PHE G 3 18  ? -4.431  103.188 79.530  1.00 64.37  ? 18   PHE C N     1 
ATOM   6480  C  CA    . PHE G 3 18  ? -3.379  102.985 78.544  1.00 64.37  ? 18   PHE C CA    1 
ATOM   6481  C  C     . PHE G 3 18  ? -2.357  104.066 78.817  1.00 64.37  ? 18   PHE C C     1 
ATOM   6482  O  O     . PHE G 3 18  ? -2.731  105.205 79.079  1.00 64.37  ? 18   PHE C O     1 
ATOM   6483  C  CB    . PHE G 3 18  ? -3.925  103.141 77.127  1.00 90.47  ? 18   PHE C CB    1 
ATOM   6484  N  N     . HIS G 3 19  ? -1.078  103.719 78.776  1.00 86.78  ? 19   HIS C N     1 
ATOM   6485  C  CA    . HIS G 3 19  ? -0.038  104.708 79.029  1.00 86.78  ? 19   HIS C CA    1 
ATOM   6486  C  C     . HIS G 3 19  ? 0.657   105.176 77.778  1.00 86.78  ? 19   HIS C C     1 
ATOM   6487  O  O     . HIS G 3 19  ? 1.022   106.346 77.673  1.00 86.78  ? 19   HIS C O     1 
ATOM   6488  C  CB    . HIS G 3 19  ? 1.036   104.178 79.968  1.00 83.46  ? 19   HIS C CB    1 
ATOM   6489  C  CG    . HIS G 3 19  ? 0.639   104.200 81.407  1.00 83.46  ? 19   HIS C CG    1 
ATOM   6490  N  ND1   . HIS G 3 19  ? -0.348  105.030 81.890  1.00 83.46  ? 19   HIS C ND1   1 
ATOM   6491  C  CD2   . HIS G 3 19  ? 1.124   103.526 82.476  1.00 83.46  ? 19   HIS C CD2   1 
ATOM   6492  C  CE1   . HIS G 3 19  ? -0.454  104.866 83.196  1.00 83.46  ? 19   HIS C CE1   1 
ATOM   6493  N  NE2   . HIS G 3 19  ? 0.428   103.959 83.577  1.00 83.46  ? 19   HIS C NE2   1 
ATOM   6494  N  N     . CYS G 3 20  ? 0.854   104.258 76.837  1.00 133.80 ? 20   CYS C N     1 
ATOM   6495  C  CA    . CYS G 3 20  ? 1.536   104.572 75.589  1.00 133.80 ? 20   CYS C CA    1 
ATOM   6496  C  C     . CYS G 3 20  ? 1.678   103.337 74.716  1.00 133.80 ? 20   CYS C C     1 
ATOM   6497  O  O     . CYS G 3 20  ? 1.566   102.213 75.192  1.00 133.80 ? 20   CYS C O     1 
ATOM   6498  C  CB    . CYS G 3 20  ? 2.927   105.148 75.880  1.00 81.54  ? 20   CYS C CB    1 
ATOM   6499  S  SG    . CYS G 3 20  ? 3.970   104.108 76.914  1.00 81.54  ? 20   CYS C SG    1 
ATOM   6500  N  N     . GLY G 3 21  ? 1.936   103.560 73.435  1.00 156.11 ? 21   GLY C N     1 
ATOM   6501  C  CA    . GLY G 3 21  ? 2.093   102.457 72.511  1.00 156.11 ? 21   GLY C CA    1 
ATOM   6502  C  C     . GLY G 3 21  ? 3.077   102.764 71.401  1.00 156.11 ? 21   GLY C C     1 
ATOM   6503  O  O     . GLY G 3 21  ? 2.936   103.759 70.688  1.00 156.11 ? 21   GLY C O     1 
ATOM   6504  N  N     . VAL G 3 22  ? 4.082   101.903 71.271  1.00 102.79 ? 22   VAL C N     1 
ATOM   6505  C  CA    . VAL G 3 22  ? 5.118   102.027 70.250  1.00 102.79 ? 22   VAL C CA    1 
ATOM   6506  C  C     . VAL G 3 22  ? 4.699   101.157 69.070  1.00 102.79 ? 22   VAL C C     1 
ATOM   6507  O  O     . VAL G 3 22  ? 3.889   100.245 69.222  1.00 102.79 ? 22   VAL C O     1 
ATOM   6508  C  CB    . VAL G 3 22  ? 6.486   101.514 70.778  1.00 87.28  ? 22   VAL C CB    1 
ATOM   6509  C  CG1   . VAL G 3 22  ? 7.545   101.658 69.718  1.00 87.28  ? 22   VAL C CG1   1 
ATOM   6510  C  CG2   . VAL G 3 22  ? 6.889   102.283 72.010  1.00 87.28  ? 22   VAL C CG2   1 
ATOM   6511  N  N     . ILE G 3 23  ? 5.262   101.432 67.901  1.00 70.07  ? 23   ILE C N     1 
ATOM   6512  C  CA    . ILE G 3 23  ? 4.937   100.684 66.694  1.00 70.07  ? 23   ILE C CA    1 
ATOM   6513  C  C     . ILE G 3 23  ? 6.076   100.746 65.701  1.00 70.07  ? 23   ILE C C     1 
ATOM   6514  O  O     . ILE G 3 23  ? 6.698   101.782 65.534  1.00 70.07  ? 23   ILE C O     1 
ATOM   6515  C  CB    . ILE G 3 23  ? 3.693   101.279 66.005  1.00 58.17  ? 23   ILE C CB    1 
ATOM   6516  C  CG1   . ILE G 3 23  ? 2.429   100.615 66.545  1.00 58.17  ? 23   ILE C CG1   1 
ATOM   6517  C  CG2   . ILE G 3 23  ? 3.825   101.162 64.502  1.00 58.17  ? 23   ILE C CG2   1 
ATOM   6518  C  CD1   . ILE G 3 23  ? 1.154   101.094 65.869  1.00 58.17  ? 23   ILE C CD1   1 
ATOM   6519  N  N     . TYR G 3 24  ? 6.323   99.636  65.027  1.00 71.70  ? 24   TYR C N     1 
ATOM   6520  C  CA    . TYR G 3 24  ? 7.366   99.568  64.016  1.00 71.70  ? 24   TYR C CA    1 
ATOM   6521  C  C     . TYR G 3 24  ? 6.751   99.017  62.737  1.00 71.70  ? 24   TYR C C     1 
ATOM   6522  O  O     . TYR G 3 24  ? 6.729   97.811  62.549  1.00 71.70  ? 24   TYR C O     1 
ATOM   6523  C  CB    . TYR G 3 24  ? 8.491   98.653  64.509  1.00 124.72 ? 24   TYR C CB    1 
ATOM   6524  C  CG    . TYR G 3 24  ? 9.524   98.271  63.468  1.00 124.72 ? 24   TYR C CG    1 
ATOM   6525  C  CD1   . TYR G 3 24  ? 9.768   99.078  62.358  1.00 124.72 ? 24   TYR C CD1   1 
ATOM   6526  C  CD2   . TYR G 3 24  ? 10.285  97.110  63.616  1.00 124.72 ? 24   TYR C CD2   1 
ATOM   6527  C  CE1   . TYR G 3 24  ? 10.743  98.737  61.421  1.00 124.72 ? 24   TYR C CE1   1 
ATOM   6528  C  CE2   . TYR G 3 24  ? 11.265  96.762  62.686  1.00 124.72 ? 24   TYR C CE2   1 
ATOM   6529  C  CZ    . TYR G 3 24  ? 11.485  97.578  61.592  1.00 124.72 ? 24   TYR C CZ    1 
ATOM   6530  O  OH    . TYR G 3 24  ? 12.436  97.228  60.663  1.00 124.72 ? 24   TYR C OH    1 
ATOM   6531  N  N     . ASP G 3 25  ? 6.233   99.883  61.870  1.00 96.31  ? 25   ASP C N     1 
ATOM   6532  C  CA    . ASP G 3 25  ? 5.630   99.410  60.623  1.00 96.31  ? 25   ASP C CA    1 
ATOM   6533  C  C     . ASP G 3 25  ? 6.747   98.909  59.725  1.00 96.31  ? 25   ASP C C     1 
ATOM   6534  O  O     . ASP G 3 25  ? 7.731   99.605  59.509  1.00 96.31  ? 25   ASP C O     1 
ATOM   6535  C  CB    . ASP G 3 25  ? 4.858   100.536 59.914  1.00 112.98 ? 25   ASP C CB    1 
ATOM   6536  C  CG    . ASP G 3 25  ? 4.149   100.058 58.638  1.00 112.98 ? 25   ASP C CG    1 
ATOM   6537  O  OD1   . ASP G 3 25  ? 3.417   100.857 58.012  1.00 112.98 ? 25   ASP C OD1   1 
ATOM   6538  O  OD2   . ASP G 3 25  ? 4.323   98.883  58.254  1.00 112.98 ? 25   ASP C OD2   1 
ATOM   6539  N  N     . TYR G 3 26  ? 6.602   97.698  59.205  1.00 137.91 ? 26   TYR C N     1 
ATOM   6540  C  CA    . TYR G 3 26  ? 7.629   97.144  58.347  1.00 137.91 ? 26   TYR C CA    1 
ATOM   6541  C  C     . TYR G 3 26  ? 7.698   97.795  56.973  1.00 137.91 ? 26   TYR C C     1 
ATOM   6542  O  O     . TYR G 3 26  ? 8.773   97.874  56.370  1.00 137.91 ? 26   TYR C O     1 
ATOM   6543  C  CB    . TYR G 3 26  ? 7.436   95.637  58.234  1.00 91.20  ? 26   TYR C CB    1 
ATOM   6544  C  CG    . TYR G 3 26  ? 8.304   94.905  59.214  1.00 91.20  ? 26   TYR C CG    1 
ATOM   6545  C  CD1   . TYR G 3 26  ? 9.673   95.177  59.272  1.00 91.20  ? 26   TYR C CD1   1 
ATOM   6546  C  CD2   . TYR G 3 26  ? 7.782   93.934  60.068  1.00 91.20  ? 26   TYR C CD2   1 
ATOM   6547  C  CE1   . TYR G 3 26  ? 10.512  94.504  60.150  1.00 91.20  ? 26   TYR C CE1   1 
ATOM   6548  C  CE2   . TYR G 3 26  ? 8.617   93.246  60.959  1.00 91.20  ? 26   TYR C CE2   1 
ATOM   6549  C  CZ    . TYR G 3 26  ? 9.986   93.539  60.990  1.00 91.20  ? 26   TYR C CZ    1 
ATOM   6550  O  OH    . TYR G 3 26  ? 10.849  92.873  61.831  1.00 91.20  ? 26   TYR C OH    1 
ATOM   6551  N  N     . SER G 3 27  ? 6.559   98.285  56.491  1.00 80.57  ? 27   SER C N     1 
ATOM   6552  C  CA    . SER G 3 27  ? 6.512   98.930  55.188  1.00 80.57  ? 27   SER C CA    1 
ATOM   6553  C  C     . SER G 3 27  ? 7.088   100.350 55.226  1.00 80.57  ? 27   SER C C     1 
ATOM   6554  O  O     . SER G 3 27  ? 7.304   100.957 54.177  1.00 80.57  ? 27   SER C O     1 
ATOM   6555  C  CB    . SER G 3 27  ? 5.069   98.985  54.675  1.00 87.48  ? 27   SER C CB    1 
ATOM   6556  O  OG    . SER G 3 27  ? 4.302   99.938  55.398  1.00 87.48  ? 27   SER C OG    1 
ATOM   6557  N  N     . THR G 3 28  ? 7.331   100.893 56.416  1.00 85.34  ? 28   THR C N     1 
ATOM   6558  C  CA    . THR G 3 28  ? 7.885   102.245 56.492  1.00 85.34  ? 28   THR C CA    1 
ATOM   6559  C  C     . THR G 3 28  ? 9.197   102.346 57.273  1.00 85.34  ? 28   THR C C     1 
ATOM   6560  O  O     . THR G 3 28  ? 9.860   103.379 57.238  1.00 85.34  ? 28   THR C O     1 
ATOM   6561  C  CB    . THR G 3 28  ? 6.868   103.272 57.059  1.00 88.40  ? 28   THR C CB    1 
ATOM   6562  O  OG1   . THR G 3 28  ? 6.717   103.091 58.474  1.00 88.40  ? 28   THR C OG1   1 
ATOM   6563  C  CG2   . THR G 3 28  ? 5.521   103.113 56.363  1.00 88.40  ? 28   THR C CG2   1 
ATOM   6564  N  N     . ALA G 3 29  ? 9.581   101.270 57.953  1.00 75.58  ? 29   ALA C N     1 
ATOM   6565  C  CA    . ALA G 3 29  ? 10.826  101.240 58.715  1.00 75.58  ? 29   ALA C CA    1 
ATOM   6566  C  C     . ALA G 3 29  ? 10.888  102.329 59.771  1.00 75.58  ? 29   ALA C C     1 
ATOM   6567  O  O     . ALA G 3 29  ? 11.970  102.845 60.072  1.00 75.58  ? 29   ALA C O     1 
ATOM   6568  C  CB    . ALA G 3 29  ? 11.997  101.381 57.786  1.00 49.29  ? 29   ALA C CB    1 
ATOM   6569  N  N     . GLU G 3 30  ? 9.733   102.657 60.344  1.00 124.59 ? 30   GLU C N     1 
ATOM   6570  C  CA    . GLU G 3 30  ? 9.631   103.695 61.366  1.00 124.59 ? 30   GLU C CA    1 
ATOM   6571  C  C     . GLU G 3 30  ? 9.071   103.210 62.709  1.00 124.59 ? 30   GLU C C     1 
ATOM   6572  O  O     . GLU G 3 30  ? 8.403   102.182 62.777  1.00 124.59 ? 30   GLU C O     1 
ATOM   6573  C  CB    . GLU G 3 30  ? 8.740   104.832 60.855  1.00 99.77  ? 30   GLU C CB    1 
ATOM   6574  C  CG    . GLU G 3 30  ? 9.340   105.665 59.739  1.00 99.77  ? 30   GLU C CG    1 
ATOM   6575  C  CD    . GLU G 3 30  ? 10.632  106.367 60.150  1.00 99.77  ? 30   GLU C CD    1 
ATOM   6576  O  OE1   . GLU G 3 30  ? 11.662  105.678 60.322  1.00 99.77  ? 30   GLU C OE1   1 
ATOM   6577  O  OE2   . GLU G 3 30  ? 10.617  107.609 60.302  1.00 99.77  ? 30   GLU C OE2   1 
ATOM   6578  N  N     . TYR G 3 31  ? 9.350   103.980 63.763  1.00 82.88  ? 31   TYR C N     1 
ATOM   6579  C  CA    . TYR G 3 31  ? 8.883   103.723 65.126  1.00 82.88  ? 31   TYR C CA    1 
ATOM   6580  C  C     . TYR G 3 31  ? 8.022   104.908 65.563  1.00 82.88  ? 31   TYR C C     1 
ATOM   6581  O  O     . TYR G 3 31  ? 8.523   105.839 66.196  1.00 82.88  ? 31   TYR C O     1 
ATOM   6582  C  CB    . TYR G 3 31  ? 10.064  103.620 66.090  1.00 69.56  ? 31   TYR C CB    1 
ATOM   6583  C  CG    . TYR G 3 31  ? 10.903  102.387 65.912  1.00 69.56  ? 31   TYR C CG    1 
ATOM   6584  C  CD1   . TYR G 3 31  ? 12.279  102.408 66.162  1.00 69.56  ? 31   TYR C CD1   1 
ATOM   6585  C  CD2   . TYR G 3 31  ? 10.331  101.201 65.466  1.00 69.56  ? 31   TYR C CD2   1 
ATOM   6586  C  CE1   . TYR G 3 31  ? 13.058  101.272 65.957  1.00 69.56  ? 31   TYR C CE1   1 
ATOM   6587  C  CE2   . TYR G 3 31  ? 11.096  100.072 65.258  1.00 69.56  ? 31   TYR C CE2   1 
ATOM   6588  C  CZ    . TYR G 3 31  ? 12.448  100.105 65.493  1.00 69.56  ? 31   TYR C CZ    1 
ATOM   6589  O  OH    . TYR G 3 31  ? 13.180  98.982  65.191  1.00 69.56  ? 31   TYR C OH    1 
ATOM   6590  N  N     . VAL G 3 32  ? 6.736   104.877 65.223  1.00 62.66  ? 32   VAL C N     1 
ATOM   6591  C  CA    . VAL G 3 32  ? 5.817   105.952 65.588  1.00 62.66  ? 32   VAL C CA    1 
ATOM   6592  C  C     . VAL G 3 32  ? 5.327   105.813 67.029  1.00 62.66  ? 32   VAL C C     1 
ATOM   6593  O  O     . VAL G 3 32  ? 4.527   104.930 67.315  1.00 62.66  ? 32   VAL C O     1 
ATOM   6594  C  CB    . VAL G 3 32  ? 4.579   105.948 64.663  1.00 125.67 ? 32   VAL C CB    1 
ATOM   6595  C  CG1   . VAL G 3 32  ? 3.613   107.057 65.068  1.00 125.67 ? 32   VAL C CG1   1 
ATOM   6596  C  CG2   . VAL G 3 32  ? 5.012   106.114 63.216  1.00 125.67 ? 32   VAL C CG2   1 
ATOM   6597  N  N     . SER G 3 33  ? 5.779   106.664 67.946  1.00 107.48 ? 33   SER C N     1 
ATOM   6598  C  CA    . SER G 3 33  ? 5.296   106.520 69.317  1.00 107.48 ? 33   SER C CA    1 
ATOM   6599  C  C     . SER G 3 33  ? 3.994   107.221 69.611  1.00 107.48 ? 33   SER C C     1 
ATOM   6600  O  O     . SER G 3 33  ? 3.811   108.391 69.288  1.00 107.48 ? 33   SER C O     1 
ATOM   6601  C  CB    . SER G 3 33  ? 6.282   107.012 70.353  1.00 61.87  ? 33   SER C CB    1 
ATOM   6602  O  OG    . SER G 3 33  ? 5.593   107.028 71.592  1.00 61.87  ? 33   SER C OG    1 
ATOM   6603  N  N     . TYR G 3 34  ? 3.087   106.496 70.249  1.00 73.99  ? 34   TYR C N     1 
ATOM   6604  C  CA    . TYR G 3 34  ? 1.812   107.073 70.612  1.00 73.99  ? 34   TYR C CA    1 
ATOM   6605  C  C     . TYR G 3 34  ? 1.848   107.305 72.107  1.00 73.99  ? 34   TYR C C     1 
ATOM   6606  O  O     . TYR G 3 34  ? 2.365   106.476 72.854  1.00 73.99  ? 34   TYR C O     1 
ATOM   6607  C  CB    . TYR G 3 34  ? 0.673   106.137 70.245  1.00 60.86  ? 34   TYR C CB    1 
ATOM   6608  C  CG    . TYR G 3 34  ? 0.599   105.847 68.772  1.00 60.86  ? 34   TYR C CG    1 
ATOM   6609  C  CD1   . TYR G 3 34  ? 1.581   105.077 68.147  1.00 60.86  ? 34   TYR C CD1   1 
ATOM   6610  C  CD2   . TYR G 3 34  ? -0.463  106.330 67.997  1.00 60.86  ? 34   TYR C CD2   1 
ATOM   6611  C  CE1   . TYR G 3 34  ? 1.514   104.783 66.773  1.00 60.86  ? 34   TYR C CE1   1 
ATOM   6612  C  CE2   . TYR G 3 34  ? -0.550  106.049 66.622  1.00 60.86  ? 34   TYR C CE2   1 
ATOM   6613  C  CZ    . TYR G 3 34  ? 0.445   105.266 66.005  1.00 60.86  ? 34   TYR C CZ    1 
ATOM   6614  O  OH    . TYR G 3 34  ? 0.363   104.947 64.647  1.00 60.86  ? 34   TYR C OH    1 
ATOM   6615  N  N     . ARG G 3 35  ? 1.342   108.452 72.543  1.00 66.63  ? 35   ARG C N     1 
ATOM   6616  C  CA    . ARG G 3 35  ? 1.325   108.747 73.964  1.00 66.63  ? 35   ARG C CA    1 
ATOM   6617  C  C     . ARG G 3 35  ? -0.119  108.662 74.455  1.00 66.63  ? 35   ARG C C     1 
ATOM   6618  O  O     . ARG G 3 35  ? -1.034  108.547 73.642  1.00 66.63  ? 35   ARG C O     1 
ATOM   6619  C  CB    . ARG G 3 35  ? 1.981   110.106 74.230  1.00 85.67  ? 35   ARG C CB    1 
ATOM   6620  C  CG    . ARG G 3 35  ? 3.503   110.029 74.095  1.00 85.67  ? 35   ARG C CG    1 
ATOM   6621  C  CD    . ARG G 3 35  ? 4.236   111.156 74.816  1.00 85.67  ? 35   ARG C CD    1 
ATOM   6622  N  NE    . ARG G 3 35  ? 5.685   110.987 74.727  1.00 85.67  ? 35   ARG C NE    1 
ATOM   6623  C  CZ    . ARG G 3 35  ? 6.355   110.957 73.579  1.00 85.67  ? 35   ARG C CZ    1 
ATOM   6624  N  NH1   . ARG G 3 35  ? 5.708   111.089 72.426  1.00 85.67  ? 35   ARG C NH1   1 
ATOM   6625  N  NH2   . ARG G 3 35  ? 7.667   110.782 73.577  1.00 85.67  ? 35   ARG C NH2   1 
ATOM   6626  N  N     . PRO G 3 36  ? -0.342  108.705 75.783  1.00 60.42  ? 36   PRO C N     1 
ATOM   6627  C  CA    . PRO G 3 36  ? -1.689  108.611 76.348  1.00 60.42  ? 36   PRO C CA    1 
ATOM   6628  C  C     . PRO G 3 36  ? -2.802  109.367 75.607  1.00 60.42  ? 36   PRO C C     1 
ATOM   6629  O  O     . PRO G 3 36  ? -3.969  108.936 75.597  1.00 60.42  ? 36   PRO C O     1 
ATOM   6630  C  CB    . PRO G 3 36  ? -1.486  109.064 77.791  1.00 58.66  ? 36   PRO C CB    1 
ATOM   6631  C  CG    . PRO G 3 36  ? -0.337  109.972 77.686  1.00 58.66  ? 36   PRO C CG    1 
ATOM   6632  C  CD    . PRO G 3 36  ? 0.585   109.202 76.805  1.00 58.66  ? 36   PRO C CD    1 
ATOM   6633  N  N     . SER G 3 37  ? -2.446  110.476 74.971  1.00 91.66  ? 37   SER C N     1 
ATOM   6634  C  CA    . SER G 3 37  ? -3.426  111.259 74.227  1.00 91.66  ? 37   SER C CA    1 
ATOM   6635  C  C     . SER G 3 37  ? -3.630  110.616 72.859  1.00 91.66  ? 37   SER C C     1 
ATOM   6636  O  O     . SER G 3 37  ? -4.709  110.680 72.270  1.00 91.66  ? 37   SER C O     1 
ATOM   6637  C  CB    . SER G 3 37  ? -2.911  112.689 74.054  1.00 109.05 ? 37   SER C CB    1 
ATOM   6638  O  OG    . SER G 3 37  ? -2.293  113.145 75.248  1.00 109.05 ? 37   SER C OG    1 
ATOM   6639  N  N     . ASP G 3 38  ? -2.568  109.981 72.377  1.00 99.39  ? 38   ASP C N     1 
ATOM   6640  C  CA    . ASP G 3 38  ? -2.547  109.335 71.075  1.00 99.39  ? 38   ASP C CA    1 
ATOM   6641  C  C     . ASP G 3 38  ? -3.207  107.965 71.070  1.00 99.39  ? 38   ASP C C     1 
ATOM   6642  O  O     . ASP G 3 38  ? -3.362  107.360 70.013  1.00 99.39  ? 38   ASP C O     1 
ATOM   6643  C  CB    . ASP G 3 38  ? -1.093  109.201 70.599  1.00 128.93 ? 38   ASP C CB    1 
ATOM   6644  C  CG    . ASP G 3 38  ? -0.317  110.514 70.687  1.00 128.93 ? 38   ASP C CG    1 
ATOM   6645  O  OD1   . ASP G 3 38  ? -0.744  111.506 70.057  1.00 128.93 ? 38   ASP C OD1   1 
ATOM   6646  O  OD2   . ASP G 3 38  ? 0.723   110.554 71.384  1.00 128.93 ? 38   ASP C OD2   1 
ATOM   6647  N  N     . PHE G 3 39  ? -3.597  107.479 72.244  1.00 91.46  ? 39   PHE C N     1 
ATOM   6648  C  CA    . PHE G 3 39  ? -4.218  106.163 72.346  1.00 91.46  ? 39   PHE C CA    1 
ATOM   6649  C  C     . PHE G 3 39  ? -5.197  105.918 71.216  1.00 91.46  ? 39   PHE C C     1 
ATOM   6650  O  O     . PHE G 3 39  ? -5.037  104.972 70.455  1.00 91.46  ? 39   PHE C O     1 
ATOM   6651  C  CB    . PHE G 3 39  ? -4.944  106.003 73.673  1.00 65.88  ? 39   PHE C CB    1 
ATOM   6652  C  CG    . PHE G 3 39  ? -5.523  104.645 73.871  1.00 65.88  ? 39   PHE C CG    1 
ATOM   6653  C  CD1   . PHE G 3 39  ? -4.696  103.560 74.144  1.00 65.88  ? 39   PHE C CD1   1 
ATOM   6654  C  CD2   . PHE G 3 39  ? -6.905  104.441 73.764  1.00 65.88  ? 39   PHE C CD2   1 
ATOM   6655  C  CE1   . PHE G 3 39  ? -5.238  102.279 74.311  1.00 65.88  ? 39   PHE C CE1   1 
ATOM   6656  C  CE2   . PHE G 3 39  ? -7.467  103.163 73.929  1.00 65.88  ? 39   PHE C CE2   1 
ATOM   6657  C  CZ    . PHE G 3 39  ? -6.635  102.079 74.202  1.00 65.88  ? 39   PHE C CZ    1 
ATOM   6658  N  N     . GLY G 3 40  ? -6.209  106.769 71.108  1.00 71.39  ? 40   GLY C N     1 
ATOM   6659  C  CA    . GLY G 3 40  ? -7.185  106.610 70.042  1.00 71.39  ? 40   GLY C CA    1 
ATOM   6660  C  C     . GLY G 3 40  ? -6.527  106.419 68.685  1.00 71.39  ? 40   GLY C C     1 
ATOM   6661  O  O     . GLY G 3 40  ? -7.000  105.629 67.863  1.00 71.39  ? 40   GLY C O     1 
ATOM   6662  N  N     . ALA G 3 41  ? -5.433  107.149 68.463  1.00 119.76 ? 41   ALA C N     1 
ATOM   6663  C  CA    . ALA G 3 41  ? -4.665  107.083 67.220  1.00 119.76 ? 41   ALA C CA    1 
ATOM   6664  C  C     . ALA G 3 41  ? -3.974  105.731 67.130  1.00 119.76 ? 41   ALA C C     1 
ATOM   6665  O  O     . ALA G 3 41  ? -3.954  105.102 66.070  1.00 119.76 ? 41   ALA C O     1 
ATOM   6666  C  CB    . ALA G 3 41  ? -3.634  108.190 67.196  1.00 89.85  ? 41   ALA C CB    1 
ATOM   6667  N  N     . TYR G 3 42  ? -3.392  105.311 68.251  1.00 61.37  ? 42   TYR C N     1 
ATOM   6668  C  CA    . TYR G 3 42  ? -2.722  104.020 68.366  1.00 61.37  ? 42   TYR C CA    1 
ATOM   6669  C  C     . TYR G 3 42  ? -3.682  102.966 67.883  1.00 61.37  ? 42   TYR C C     1 
ATOM   6670  O  O     . TYR G 3 42  ? -3.320  102.147 67.053  1.00 61.37  ? 42   TYR C O     1 
ATOM   6671  C  CB    . TYR G 3 42  ? -2.388  103.718 69.816  1.00 67.80  ? 42   TYR C CB    1 
ATOM   6672  C  CG    . TYR G 3 42  ? -1.705  102.394 70.024  1.00 67.80  ? 42   TYR C CG    1 
ATOM   6673  C  CD1   . TYR G 3 42  ? -0.320  102.268 69.862  1.00 67.80  ? 42   TYR C CD1   1 
ATOM   6674  C  CD2   . TYR G 3 42  ? -2.429  101.273 70.424  1.00 67.80  ? 42   TYR C CD2   1 
ATOM   6675  C  CE1   . TYR G 3 42  ? 0.333   101.055 70.103  1.00 67.80  ? 42   TYR C CE1   1 
ATOM   6676  C  CE2   . TYR G 3 42  ? -1.791  100.052 70.667  1.00 67.80  ? 42   TYR C CE2   1 
ATOM   6677  C  CZ    . TYR G 3 42  ? -0.409  99.951  70.506  1.00 67.80  ? 42   TYR C CZ    1 
ATOM   6678  O  OH    . TYR G 3 42  ? 0.225   98.749  70.750  1.00 67.80  ? 42   TYR C OH    1 
ATOM   6679  N  N     . LEU G 3 43  ? -4.903  102.986 68.415  1.00 106.79 ? 43   LEU C N     1 
ATOM   6680  C  CA    . LEU G 3 43  ? -5.912  102.020 68.005  1.00 106.79 ? 43   LEU C CA    1 
ATOM   6681  C  C     . LEU G 3 43  ? -6.218  102.164 66.514  1.00 106.79 ? 43   LEU C C     1 
ATOM   6682  O  O     . LEU G 3 43  ? -6.456  101.166 65.829  1.00 106.79 ? 43   LEU C O     1 
ATOM   6683  C  CB    . LEU G 3 43  ? -7.201  102.174 68.819  1.00 60.23  ? 43   LEU C CB    1 
ATOM   6684  C  CG    . LEU G 3 43  ? -7.215  101.880 70.323  1.00 60.23  ? 43   LEU C CG    1 
ATOM   6685  C  CD1   . LEU G 3 43  ? -8.640  101.597 70.706  1.00 60.23  ? 43   LEU C CD1   1 
ATOM   6686  C  CD2   . LEU G 3 43  ? -6.351  100.692 70.686  1.00 60.23  ? 43   LEU C CD2   1 
ATOM   6687  N  N     . ASP G 3 44  ? -6.208  103.398 66.008  1.00 74.05  ? 44   ASP C N     1 
ATOM   6688  C  CA    . ASP G 3 44  ? -6.461  103.629 64.585  1.00 74.05  ? 44   ASP C CA    1 
ATOM   6689  C  C     . ASP G 3 44  ? -5.373  103.011 63.699  1.00 74.05  ? 44   ASP C C     1 
ATOM   6690  O  O     . ASP G 3 44  ? -5.673  102.404 62.674  1.00 74.05  ? 44   ASP C O     1 
ATOM   6691  C  CB    . ASP G 3 44  ? -6.579  105.129 64.289  1.00 102.80 ? 44   ASP C CB    1 
ATOM   6692  C  CG    . ASP G 3 44  ? -8.029  105.616 64.281  1.00 102.80 ? 44   ASP C CG    1 
ATOM   6693  O  OD1   . ASP G 3 44  ? -8.919  104.866 63.816  1.00 102.80 ? 44   ASP C OD1   1 
ATOM   6694  O  OD2   . ASP G 3 44  ? -8.278  106.760 64.720  1.00 102.80 ? 44   ASP C OD2   1 
ATOM   6695  N  N     . ALA G 3 45  ? -4.117  103.166 64.104  1.00 69.19  ? 45   ALA C N     1 
ATOM   6696  C  CA    . ALA G 3 45  ? -2.984  102.625 63.362  1.00 69.19  ? 45   ALA C CA    1 
ATOM   6697  C  C     . ALA G 3 45  ? -3.081  101.115 63.154  1.00 69.19  ? 45   ALA C C     1 
ATOM   6698  O  O     . ALA G 3 45  ? -2.924  100.627 62.026  1.00 69.19  ? 45   ALA C O     1 
ATOM   6699  C  CB    . ALA G 3 45  ? -1.681  102.966 64.076  1.00 28.77  ? 45   ALA C CB    1 
ATOM   6700  N  N     . LEU G 3 46  ? -3.320  100.383 64.244  1.00 69.58  ? 46   LEU C N     1 
ATOM   6701  C  CA    . LEU G 3 46  ? -3.444  98.926  64.212  1.00 69.58  ? 46   LEU C CA    1 
ATOM   6702  C  C     . LEU G 3 46  ? -4.686  98.534  63.448  1.00 69.58  ? 46   LEU C C     1 
ATOM   6703  O  O     . LEU G 3 46  ? -4.662  97.610  62.655  1.00 69.58  ? 46   LEU C O     1 
ATOM   6704  C  CB    . LEU G 3 46  ? -3.507  98.367  65.637  1.00 61.15  ? 46   LEU C CB    1 
ATOM   6705  C  CG    . LEU G 3 46  ? -2.306  98.793  66.489  1.00 61.15  ? 46   LEU C CG    1 
ATOM   6706  C  CD1   . LEU G 3 46  ? -2.311  98.070  67.821  1.00 61.15  ? 46   LEU C CD1   1 
ATOM   6707  C  CD2   . LEU G 3 46  ? -1.024  98.493  65.725  1.00 61.15  ? 46   LEU C CD2   1 
ATOM   6708  N  N     . GLU G 3 47  ? -5.775  99.246  63.691  1.00 87.69  ? 47   GLU C N     1 
ATOM   6709  C  CA    . GLU G 3 47  ? -7.022  98.968  63.006  1.00 87.69  ? 47   GLU C CA    1 
ATOM   6710  C  C     . GLU G 3 47  ? -6.780  99.177  61.508  1.00 87.69  ? 47   GLU C C     1 
ATOM   6711  O  O     . GLU G 3 47  ? -7.547  98.701  60.666  1.00 87.69  ? 47   GLU C O     1 
ATOM   6712  C  CB    . GLU G 3 47  ? -8.117  99.913  63.531  1.00 79.73  ? 47   GLU C CB    1 
ATOM   6713  C  CG    . GLU G 3 47  ? -9.561  99.461  63.277  1.00 79.73  ? 47   GLU C CG    1 
ATOM   6714  C  CD    . GLU G 3 47  ? -10.559 100.110 64.241  1.00 79.73  ? 47   GLU C CD    1 
ATOM   6715  O  OE1   . GLU G 3 47  ? -10.452 99.881  65.462  1.00 79.73  ? 47   GLU C OE1   1 
ATOM   6716  O  OE2   . GLU G 3 47  ? -11.457 100.850 63.789  1.00 79.73  ? 47   GLU C OE2   1 
ATOM   6717  N  N     . ALA G 3 48  ? -5.695  99.880  61.186  1.00 117.48 ? 48   ALA C N     1 
ATOM   6718  C  CA    . ALA G 3 48  ? -5.331  100.160 59.801  1.00 117.48 ? 48   ALA C CA    1 
ATOM   6719  C  C     . ALA G 3 48  ? -4.746  98.930  59.105  1.00 117.48 ? 48   ALA C C     1 
ATOM   6720  O  O     . ALA G 3 48  ? -5.122  98.620  57.972  1.00 117.48 ? 48   ALA C O     1 
ATOM   6721  C  CB    . ALA G 3 48  ? -4.330  101.313 59.751  1.00 112.95 ? 48   ALA C CB    1 
ATOM   6722  N  N     . GLU G 3 49  ? -3.824  98.239  59.779  1.00 68.86  ? 49   GLU C N     1 
ATOM   6723  C  CA    . GLU G 3 49  ? -3.197  97.044  59.215  1.00 68.86  ? 49   GLU C CA    1 
ATOM   6724  C  C     . GLU G 3 49  ? -4.262  96.012  58.897  1.00 68.86  ? 49   GLU C C     1 
ATOM   6725  O  O     . GLU G 3 49  ? -4.212  95.345  57.864  1.00 68.86  ? 49   GLU C O     1 
ATOM   6726  C  CB    . GLU G 3 49  ? -2.199  96.432  60.189  1.00 82.98  ? 49   GLU C CB    1 
ATOM   6727  C  CG    . GLU G 3 49  ? -1.079  95.720  59.482  1.00 82.98  ? 49   GLU C CG    1 
ATOM   6728  C  CD    . GLU G 3 49  ? -0.149  96.702  58.794  1.00 82.98  ? 49   GLU C CD    1 
ATOM   6729  O  OE1   . GLU G 3 49  ? -0.615  97.817  58.462  1.00 82.98  ? 49   GLU C OE1   1 
ATOM   6730  O  OE2   . GLU G 3 49  ? 1.043   96.364  58.581  1.00 82.98  ? 49   GLU C OE2   1 
ATOM   6731  N  N     . VAL G 3 50  ? -5.226  95.888  59.801  1.00 82.80  ? 50   VAL C N     1 
ATOM   6732  C  CA    . VAL G 3 50  ? -6.329  94.952  59.642  1.00 82.80  ? 50   VAL C CA    1 
ATOM   6733  C  C     . VAL G 3 50  ? -7.066  95.247  58.344  1.00 82.80  ? 50   VAL C C     1 
ATOM   6734  O  O     . VAL G 3 50  ? -7.589  94.337  57.696  1.00 82.80  ? 50   VAL C O     1 
ATOM   6735  C  CB    . VAL G 3 50  ? -7.344  95.069  60.802  1.00 95.92  ? 50   VAL C CB    1 
ATOM   6736  C  CG1   . VAL G 3 50  ? -8.409  93.998  60.667  1.00 95.92  ? 50   VAL C CG1   1 
ATOM   6737  C  CG2   . VAL G 3 50  ? -6.636  94.946  62.136  1.00 95.92  ? 50   VAL C CG2   1 
ATOM   6738  N  N     . ALA G 3 51  ? -7.115  96.525  57.975  1.00 133.28 ? 51   ALA C N     1 
ATOM   6739  C  CA    . ALA G 3 51  ? -7.781  96.944  56.745  1.00 133.28 ? 51   ALA C CA    1 
ATOM   6740  C  C     . ALA G 3 51  ? -6.971  96.452  55.554  1.00 133.28 ? 51   ALA C C     1 
ATOM   6741  O  O     . ALA G 3 51  ? -7.531  95.991  54.561  1.00 133.28 ? 51   ALA C O     1 
ATOM   6742  C  CB    . ALA G 3 51  ? -7.900  98.462  56.705  1.00 140.50 ? 51   ALA C CB    1 
ATOM   6743  N  N     . ARG G 3 52  ? -5.649  96.564  55.667  1.00 76.49  ? 52   ARG C N     1 
ATOM   6744  C  CA    . ARG G 3 52  ? -4.738  96.120  54.622  1.00 76.49  ? 52   ARG C CA    1 
ATOM   6745  C  C     . ARG G 3 52  ? -4.846  94.612  54.521  1.00 76.49  ? 52   ARG C C     1 
ATOM   6746  O  O     . ARG G 3 52  ? -4.591  94.024  53.471  1.00 76.49  ? 52   ARG C O     1 
ATOM   6747  C  CB    . ARG G 3 52  ? -3.280  96.400  54.983  1.00 77.37  ? 52   ARG C CB    1 
ATOM   6748  C  CG    . ARG G 3 52  ? -2.853  97.821  55.205  1.00 77.37  ? 52   ARG C CG    1 
ATOM   6749  C  CD    . ARG G 3 52  ? -1.381  97.792  55.612  1.00 77.37  ? 52   ARG C CD    1 
ATOM   6750  N  NE    . ARG G 3 52  ? -0.717  99.090  55.554  1.00 77.37  ? 52   ARG C NE    1 
ATOM   6751  C  CZ    . ARG G 3 52  ? -0.992  100.118 56.351  1.00 77.37  ? 52   ARG C CZ    1 
ATOM   6752  N  NH1   . ARG G 3 52  ? -1.929  100.009 57.286  1.00 77.37  ? 52   ARG C NH1   1 
ATOM   6753  N  NH2   . ARG G 3 52  ? -0.324  101.263 56.207  1.00 77.37  ? 52   ARG C NH2   1 
ATOM   6754  N  N     . GLY G 3 53  ? -5.212  93.989  55.632  1.00 71.03  ? 53   GLY C N     1 
ATOM   6755  C  CA    . GLY G 3 53  ? -5.270  92.547  55.664  1.00 71.03  ? 53   GLY C CA    1 
ATOM   6756  C  C     . GLY G 3 53  ? -3.828  92.203  55.982  1.00 71.03  ? 53   GLY C C     1 
ATOM   6757  O  O     . GLY G 3 53  ? -3.247  91.278  55.411  1.00 71.03  ? 53   GLY C O     1 
ATOM   6758  N  N     . GLY G 3 54  ? -3.239  92.982  56.888  1.00 90.29  ? 54   GLY C N     1 
ATOM   6759  C  CA    . GLY G 3 54  ? -1.853  92.768  57.280  1.00 90.29  ? 54   GLY C CA    1 
ATOM   6760  C  C     . GLY G 3 54  ? -1.684  91.894  58.513  1.00 90.29  ? 54   GLY C C     1 
ATOM   6761  O  O     . GLY G 3 54  ? -2.577  91.130  58.880  1.00 90.29  ? 54   GLY C O     1 
ATOM   6762  N  N     . LEU G 3 55  ? -0.530  92.002  59.157  1.00 95.27  ? 55   LEU C N     1 
ATOM   6763  C  CA    . LEU G 3 55  ? -0.256  91.214  60.349  1.00 95.27  ? 55   LEU C CA    1 
ATOM   6764  C  C     . LEU G 3 55  ? 0.304   92.085  61.463  1.00 95.27  ? 55   LEU C C     1 
ATOM   6765  O  O     . LEU G 3 55  ? 1.210   92.892  61.234  1.00 95.27  ? 55   LEU C O     1 
ATOM   6766  C  CB    . LEU G 3 55  ? 0.734   90.099  60.024  1.00 76.51  ? 55   LEU C CB    1 
ATOM   6767  C  CG    . LEU G 3 55  ? 0.139   88.971  59.187  1.00 76.51  ? 55   LEU C CG    1 
ATOM   6768  C  CD1   . LEU G 3 55  ? 1.235   88.120  58.580  1.00 76.51  ? 55   LEU C CD1   1 
ATOM   6769  C  CD2   . LEU G 3 55  ? -0.780  88.141  60.070  1.00 76.51  ? 55   LEU C CD2   1 
ATOM   6770  N  N     . ILE G 3 56  ? -0.236  91.912  62.669  1.00 88.79  ? 56   ILE C N     1 
ATOM   6771  C  CA    . ILE G 3 56  ? 0.183   92.675  63.842  1.00 88.79  ? 56   ILE C CA    1 
ATOM   6772  C  C     . ILE G 3 56  ? 0.925   91.742  64.775  1.00 88.79  ? 56   ILE C C     1 
ATOM   6773  O  O     . ILE G 3 56  ? 0.369   90.731  65.199  1.00 88.79  ? 56   ILE C O     1 
ATOM   6774  C  CB    . ILE G 3 56  ? -1.044  93.235  64.591  1.00 40.94  ? 56   ILE C CB    1 
ATOM   6775  C  CG1   . ILE G 3 56  ? -1.890  94.118  63.646  1.00 40.94  ? 56   ILE C CG1   1 
ATOM   6776  C  CG2   . ILE G 3 56  ? -0.593  94.023  65.788  1.00 40.94  ? 56   ILE C CG2   1 
ATOM   6777  C  CD1   . ILE G 3 56  ? -3.364  94.323  64.071  1.00 40.94  ? 56   ILE C CD1   1 
ATOM   6778  N  N     . VAL G 3 57  ? 2.174   92.070  65.090  1.00 69.75  ? 57   VAL C N     1 
ATOM   6779  C  CA    . VAL G 3 57  ? 2.970   91.231  65.979  1.00 69.75  ? 57   VAL C CA    1 
ATOM   6780  C  C     . VAL G 3 57  ? 3.087   91.860  67.352  1.00 69.75  ? 57   VAL C C     1 
ATOM   6781  O  O     . VAL G 3 57  ? 3.377   93.051  67.469  1.00 69.75  ? 57   VAL C O     1 
ATOM   6782  C  CB    . VAL G 3 57  ? 4.402   90.986  65.418  1.00 78.24  ? 57   VAL C CB    1 
ATOM   6783  C  CG1   . VAL G 3 57  ? 5.362   90.588  66.533  1.00 78.24  ? 57   VAL C CG1   1 
ATOM   6784  C  CG2   . VAL G 3 57  ? 4.366   89.878  64.390  1.00 78.24  ? 57   VAL C CG2   1 
ATOM   6785  N  N     . PHE G 3 58  ? 2.850   91.044  68.382  1.00 71.52  ? 58   PHE C N     1 
ATOM   6786  C  CA    . PHE G 3 58  ? 2.920   91.443  69.795  1.00 71.52  ? 58   PHE C CA    1 
ATOM   6787  C  C     . PHE G 3 58  ? 3.706   90.358  70.536  1.00 71.52  ? 58   PHE C C     1 
ATOM   6788  O  O     . PHE G 3 58  ? 3.833   89.236  70.051  1.00 71.52  ? 58   PHE C O     1 
ATOM   6789  C  CB    . PHE G 3 58  ? 1.521   91.483  70.424  1.00 64.24  ? 58   PHE C CB    1 
ATOM   6790  C  CG    . PHE G 3 58  ? 0.737   92.745  70.170  1.00 64.24  ? 58   PHE C CG    1 
ATOM   6791  C  CD1   . PHE G 3 58  ? 1.284   93.993  70.424  1.00 64.24  ? 58   PHE C CD1   1 
ATOM   6792  C  CD2   . PHE G 3 58  ? -0.603  92.672  69.793  1.00 64.24  ? 58   PHE C CD2   1 
ATOM   6793  C  CE1   . PHE G 3 58  ? 0.498   95.151  70.314  1.00 64.24  ? 58   PHE C CE1   1 
ATOM   6794  C  CE2   . PHE G 3 58  ? -1.389  93.819  69.683  1.00 64.24  ? 58   PHE C CE2   1 
ATOM   6795  C  CZ    . PHE G 3 58  ? -0.840  95.059  69.945  1.00 64.24  ? 58   PHE C CZ    1 
ATOM   6796  N  N     . HIS G 3 59  ? 4.225   90.677  71.712  1.00 61.49  ? 59   HIS C N     1 
ATOM   6797  C  CA    . HIS G 3 59  ? 4.919   89.663  72.489  1.00 61.49  ? 59   HIS C CA    1 
ATOM   6798  C  C     . HIS G 3 59  ? 3.995   89.299  73.630  1.00 61.49  ? 59   HIS C C     1 
ATOM   6799  O  O     . HIS G 3 59  ? 3.881   90.062  74.578  1.00 61.49  ? 59   HIS C O     1 
ATOM   6800  C  CB    . HIS G 3 59  ? 6.204   90.187  73.077  1.00 54.78  ? 59   HIS C CB    1 
ATOM   6801  C  CG    . HIS G 3 59  ? 6.995   89.134  73.770  1.00 54.78  ? 59   HIS C CG    1 
ATOM   6802  N  ND1   . HIS G 3 59  ? 7.478   88.027  73.111  1.00 54.78  ? 59   HIS C ND1   1 
ATOM   6803  C  CD2   . HIS G 3 59  ? 7.372   89.000  75.059  1.00 54.78  ? 59   HIS C CD2   1 
ATOM   6804  C  CE1   . HIS G 3 59  ? 8.121   87.254  73.964  1.00 54.78  ? 59   HIS C CE1   1 
ATOM   6805  N  NE2   . HIS G 3 59  ? 8.072   87.822  75.155  1.00 54.78  ? 59   HIS C NE2   1 
ATOM   6806  N  N     . ASN G 3 60  ? 3.338   88.145  73.537  1.00 81.06  ? 60   ASN C N     1 
ATOM   6807  C  CA    . ASN G 3 60  ? 2.387   87.698  74.556  1.00 81.06  ? 60   ASN C CA    1 
ATOM   6808  C  C     . ASN G 3 60  ? 1.134   88.564  74.428  1.00 81.06  ? 60   ASN C C     1 
ATOM   6809  O  O     . ASN G 3 60  ? 0.338   88.673  75.356  1.00 81.06  ? 60   ASN C O     1 
ATOM   6810  C  CB    . ASN G 3 60  ? 2.982   87.858  75.958  1.00 86.48  ? 60   ASN C CB    1 
ATOM   6811  C  CG    . ASN G 3 60  ? 2.138   87.201  77.030  1.00 86.48  ? 60   ASN C CG    1 
ATOM   6812  O  OD1   . ASN G 3 60  ? 0.912   87.181  76.947  1.00 86.48  ? 60   ASN C OD1   1 
ATOM   6813  N  ND2   . ASN G 3 60  ? 2.795   86.672  78.058  1.00 86.48  ? 60   ASN C ND2   1 
ATOM   6814  N  N     . GLY G 3 61  ? 0.971   89.186  73.266  1.00 48.15  ? 61   GLY C N     1 
ATOM   6815  C  CA    . GLY G 3 61  ? -0.173  90.037  73.050  1.00 48.15  ? 61   GLY C CA    1 
ATOM   6816  C  C     . GLY G 3 61  ? -1.450  89.233  73.040  1.00 48.15  ? 61   GLY C C     1 
ATOM   6817  O  O     . GLY G 3 61  ? -2.536  89.762  73.281  1.00 48.15  ? 61   GLY C O     1 
ATOM   6818  N  N     . HIS G 3 62  ? -1.316  87.945  72.755  1.00 67.42  ? 62   HIS C N     1 
ATOM   6819  C  CA    . HIS G 3 62  ? -2.454  87.040  72.704  1.00 67.42  ? 62   HIS C CA    1 
ATOM   6820  C  C     . HIS G 3 62  ? -3.217  87.003  74.019  1.00 67.42  ? 62   HIS C C     1 
ATOM   6821  O  O     . HIS G 3 62  ? -4.460  87.018  74.044  1.00 67.42  ? 62   HIS C O     1 
ATOM   6822  C  CB    . HIS G 3 62  ? -1.959  85.634  72.356  1.00 61.64  ? 62   HIS C CB    1 
ATOM   6823  C  CG    . HIS G 3 62  ? -2.280  85.215  70.954  1.00 61.64  ? 62   HIS C CG    1 
ATOM   6824  N  ND1   . HIS G 3 62  ? -1.946  85.977  69.855  1.00 61.64  ? 62   HIS C ND1   1 
ATOM   6825  C  CD2   . HIS G 3 62  ? -2.963  84.146  70.478  1.00 61.64  ? 62   HIS C CD2   1 
ATOM   6826  C  CE1   . HIS G 3 62  ? -2.416  85.399  68.766  1.00 61.64  ? 62   HIS C CE1   1 
ATOM   6827  N  NE2   . HIS G 3 62  ? -3.038  84.288  69.115  1.00 61.64  ? 62   HIS C NE2   1 
ATOM   6828  N  N     . LYS G 3 63  ? -2.445  86.974  75.103  1.00 50.29  ? 63   LYS C N     1 
ATOM   6829  C  CA    . LYS G 3 63  ? -2.949  86.896  76.469  1.00 50.29  ? 63   LYS C CA    1 
ATOM   6830  C  C     . LYS G 3 63  ? -2.997  88.262  77.129  1.00 50.29  ? 63   LYS C C     1 
ATOM   6831  O  O     . LYS G 3 63  ? -3.382  88.362  78.282  1.00 50.29  ? 63   LYS C O     1 
ATOM   6832  C  CB    . LYS G 3 63  ? -2.023  85.982  77.281  1.00 69.01  ? 63   LYS C CB    1 
ATOM   6833  C  CG    . LYS G 3 63  ? -2.620  85.251  78.475  1.00 69.01  ? 63   LYS C CG    1 
ATOM   6834  C  CD    . LYS G 3 63  ? -1.667  84.113  78.872  1.00 69.01  ? 63   LYS C CD    1 
ATOM   6835  C  CE    . LYS G 3 63  ? -2.258  83.123  79.884  1.00 69.01  ? 63   LYS C CE    1 
ATOM   6836  N  NZ    . LYS G 3 63  ? -2.146  83.538  81.324  1.00 69.01  ? 63   LYS C NZ    1 
ATOM   6837  N  N     . TYR G 3 64  ? -2.586  89.319  76.439  1.00 63.58  ? 64   TYR C N     1 
ATOM   6838  C  CA    . TYR G 3 64  ? -2.648  90.633  77.074  1.00 63.58  ? 64   TYR C CA    1 
ATOM   6839  C  C     . TYR G 3 64  ? -2.859  91.838  76.185  1.00 63.58  ? 64   TYR C C     1 
ATOM   6840  O  O     . TYR G 3 64  ? -3.984  92.320  76.020  1.00 63.58  ? 64   TYR C O     1 
ATOM   6841  C  CB    . TYR G 3 64  ? -1.404  90.913  77.900  1.00 63.92  ? 64   TYR C CB    1 
ATOM   6842  C  CG    . TYR G 3 64  ? -1.445  92.261  78.606  1.00 63.92  ? 64   TYR C CG    1 
ATOM   6843  C  CD1   . TYR G 3 64  ? -2.063  92.402  79.845  1.00 63.92  ? 64   TYR C CD1   1 
ATOM   6844  C  CD2   . TYR G 3 64  ? -0.827  93.381  78.054  1.00 63.92  ? 64   TYR C CD2   1 
ATOM   6845  C  CE1   . TYR G 3 64  ? -2.051  93.627  80.531  1.00 63.92  ? 64   TYR C CE1   1 
ATOM   6846  C  CE2   . TYR G 3 64  ? -0.809  94.608  78.722  1.00 63.92  ? 64   TYR C CE2   1 
ATOM   6847  C  CZ    . TYR G 3 64  ? -1.415  94.726  79.968  1.00 63.92  ? 64   TYR C CZ    1 
ATOM   6848  O  OH    . TYR G 3 64  ? -1.330  95.913  80.675  1.00 63.92  ? 64   TYR C OH    1 
ATOM   6849  N  N     . ASP G 3 65  ? -1.759  92.346  75.642  1.00 59.19  ? 65   ASP C N     1 
ATOM   6850  C  CA    . ASP G 3 65  ? -1.802  93.531  74.801  1.00 59.19  ? 65   ASP C CA    1 
ATOM   6851  C  C     . ASP G 3 65  ? -3.069  93.581  73.947  1.00 59.19  ? 65   ASP C C     1 
ATOM   6852  O  O     . ASP G 3 65  ? -3.700  94.629  73.806  1.00 59.19  ? 65   ASP C O     1 
ATOM   6853  C  CB    . ASP G 3 65  ? -0.535  93.594  73.932  1.00 69.27  ? 65   ASP C CB    1 
ATOM   6854  C  CG    . ASP G 3 65  ? 0.752   93.668  74.770  1.00 69.27  ? 65   ASP C CG    1 
ATOM   6855  O  OD1   . ASP G 3 65  ? 1.039   92.700  75.509  1.00 69.27  ? 65   ASP C OD1   1 
ATOM   6856  O  OD2   . ASP G 3 65  ? 1.481   94.687  74.703  1.00 69.27  ? 65   ASP C OD2   1 
ATOM   6857  N  N     . VAL G 3 66  ? -3.471  92.435  73.419  1.00 49.05  ? 66   VAL C N     1 
ATOM   6858  C  CA    . VAL G 3 66  ? -4.647  92.410  72.585  1.00 49.05  ? 66   VAL C CA    1 
ATOM   6859  C  C     . VAL G 3 66  ? -5.965  92.468  73.319  1.00 49.05  ? 66   VAL C C     1 
ATOM   6860  O  O     . VAL G 3 66  ? -6.828  93.257  72.948  1.00 49.05  ? 66   VAL C O     1 
ATOM   6861  C  CB    . VAL G 3 66  ? -4.664  91.199  71.688  1.00 30.62  ? 66   VAL C CB    1 
ATOM   6862  C  CG1   . VAL G 3 66  ? -5.778  91.356  70.625  1.00 30.62  ? 66   VAL C CG1   1 
ATOM   6863  C  CG2   . VAL G 3 66  ? -3.322  91.045  71.054  1.00 30.62  ? 66   VAL C CG2   1 
ATOM   6864  N  N     . PRO G 3 67  ? -6.168  91.610  74.337  1.00 75.06  ? 67   PRO C N     1 
ATOM   6865  C  CA    . PRO G 3 67  ? -7.454  91.689  75.031  1.00 75.06  ? 67   PRO C CA    1 
ATOM   6866  C  C     . PRO G 3 67  ? -7.505  92.868  75.986  1.00 75.06  ? 67   PRO C C     1 
ATOM   6867  O  O     . PRO G 3 67  ? -8.580  93.231  76.461  1.00 75.06  ? 67   PRO C O     1 
ATOM   6868  C  CB    . PRO G 3 67  ? -7.545  90.342  75.742  1.00 71.70  ? 67   PRO C CB    1 
ATOM   6869  C  CG    . PRO G 3 67  ? -6.131  90.018  76.021  1.00 71.70  ? 67   PRO C CG    1 
ATOM   6870  C  CD    . PRO G 3 67  ? -5.452  90.384  74.723  1.00 71.70  ? 67   PRO C CD    1 
ATOM   6871  N  N     . ALA G 3 68  ? -6.343  93.468  76.245  1.00 50.16  ? 68   ALA C N     1 
ATOM   6872  C  CA    . ALA G 3 68  ? -6.250  94.601  77.155  1.00 50.16  ? 68   ALA C CA    1 
ATOM   6873  C  C     . ALA G 3 68  ? -6.625  95.870  76.436  1.00 50.16  ? 68   ALA C C     1 
ATOM   6874  O  O     . ALA G 3 68  ? -6.974  96.865  77.057  1.00 50.16  ? 68   ALA C O     1 
ATOM   6875  C  CB    . ALA G 3 68  ? -4.854  94.718  77.703  1.00 70.46  ? 68   ALA C CB    1 
ATOM   6876  N  N     . LEU G 3 69  ? -6.541  95.838  75.114  1.00 57.61  ? 69   LEU C N     1 
ATOM   6877  C  CA    . LEU G 3 69  ? -6.899  97.009  74.328  1.00 57.61  ? 69   LEU C CA    1 
ATOM   6878  C  C     . LEU G 3 69  ? -8.396  96.996  74.133  1.00 57.61  ? 69   LEU C C     1 
ATOM   6879  O  O     . LEU G 3 69  ? -9.035  98.033  74.156  1.00 57.61  ? 69   LEU C O     1 
ATOM   6880  C  CB    . LEU G 3 69  ? -6.204  97.003  72.966  1.00 46.80  ? 69   LEU C CB    1 
ATOM   6881  C  CG    . LEU G 3 69  ? -4.695  97.221  72.924  1.00 46.80  ? 69   LEU C CG    1 
ATOM   6882  C  CD1   . LEU G 3 69  ? -4.255  97.117  71.493  1.00 46.80  ? 69   LEU C CD1   1 
ATOM   6883  C  CD2   . LEU G 3 69  ? -4.333  98.575  73.487  1.00 46.80  ? 69   LEU C CD2   1 
ATOM   6884  N  N     . THR G 3 70  ? -8.952  95.812  73.930  1.00 79.93  ? 70   THR C N     1 
ATOM   6885  C  CA    . THR G 3 70  ? -10.385 95.683  73.761  1.00 79.93  ? 70   THR C CA    1 
ATOM   6886  C  C     . THR G 3 70  ? -11.000 96.279  75.021  1.00 79.93  ? 70   THR C C     1 
ATOM   6887  O  O     . THR G 3 70  ? -11.943 97.072  74.956  1.00 79.93  ? 70   THR C O     1 
ATOM   6888  C  CB    . THR G 3 70  ? -10.794 94.206  73.654  1.00 98.77  ? 70   THR C CB    1 
ATOM   6889  O  OG1   . THR G 3 70  ? -10.109 93.594  72.556  1.00 98.77  ? 70   THR C OG1   1 
ATOM   6890  C  CG2   . THR G 3 70  ? -12.281 94.083  73.437  1.00 98.77  ? 70   THR C CG2   1 
ATOM   6891  N  N     . LYS G 3 71  ? -10.439 95.901  76.167  1.00 52.70  ? 71   LYS C N     1 
ATOM   6892  C  CA    . LYS G 3 71  ? -10.917 96.375  77.455  1.00 52.70  ? 71   LYS C CA    1 
ATOM   6893  C  C     . LYS G 3 71  ? -10.758 97.880  77.547  1.00 52.70  ? 71   LYS C C     1 
ATOM   6894  O  O     . LYS G 3 71  ? -11.733 98.593  77.727  1.00 52.70  ? 71   LYS C O     1 
ATOM   6895  C  CB    . LYS G 3 71  ? -10.136 95.700  78.587  1.00 72.95  ? 71   LYS C CB    1 
ATOM   6896  C  CG    . LYS G 3 71  ? -10.683 95.943  79.992  1.00 72.95  ? 71   LYS C CG    1 
ATOM   6897  C  CD    . LYS G 3 71  ? -9.980  95.063  81.008  1.00 72.95  ? 71   LYS C CD    1 
ATOM   6898  C  CE    . LYS G 3 71  ? -10.681 95.102  82.354  1.00 72.95  ? 71   LYS C CE    1 
ATOM   6899  N  NZ    . LYS G 3 71  ? -10.515 96.408  83.068  1.00 72.95  ? 71   LYS C NZ    1 
ATOM   6900  N  N     . LEU G 3 72  ? -9.525  98.358  77.414  1.00 69.11  ? 72   LEU C N     1 
ATOM   6901  C  CA    . LEU G 3 72  ? -9.247  99.790  77.496  1.00 69.11  ? 72   LEU C CA    1 
ATOM   6902  C  C     . LEU G 3 72  ? -10.021 100.605 76.463  1.00 69.11  ? 72   LEU C C     1 
ATOM   6903  O  O     . LEU G 3 72  ? -10.431 101.729 76.721  1.00 69.11  ? 72   LEU C O     1 
ATOM   6904  C  CB    . LEU G 3 72  ? -7.749  100.055 77.305  1.00 73.30  ? 72   LEU C CB    1 
ATOM   6905  C  CG    . LEU G 3 72  ? -6.753  99.371  78.243  1.00 73.30  ? 72   LEU C CG    1 
ATOM   6906  C  CD1   . LEU G 3 72  ? -5.378  99.977  78.039  1.00 73.30  ? 72   LEU C CD1   1 
ATOM   6907  C  CD2   . LEU G 3 72  ? -7.191  99.534  79.681  1.00 73.30  ? 72   LEU C CD2   1 
ATOM   6908  N  N     . ALA G 3 73  ? -10.212 100.039 75.287  1.00 62.16  ? 73   ALA C N     1 
ATOM   6909  C  CA    . ALA G 3 73  ? -10.922 100.742 74.244  1.00 62.16  ? 73   ALA C CA    1 
ATOM   6910  C  C     . ALA G 3 73  ? -12.309 101.162 74.703  1.00 62.16  ? 73   ALA C C     1 
ATOM   6911  O  O     . ALA G 3 73  ? -12.665 102.327 74.595  1.00 62.16  ? 73   ALA C O     1 
ATOM   6912  C  CB    . ALA G 3 73  ? -11.019 99.873  72.994  1.00 72.90  ? 73   ALA C CB    1 
ATOM   6913  N  N     . LYS G 3 74  ? -13.109 100.229 75.200  1.00 91.60  ? 74   LYS C N     1 
ATOM   6914  C  CA    . LYS G 3 74  ? -14.444 100.614 75.635  1.00 91.60  ? 74   LYS C CA    1 
ATOM   6915  C  C     . LYS G 3 74  ? -14.312 101.556 76.808  1.00 91.60  ? 74   LYS C C     1 
ATOM   6916  O  O     . LYS G 3 74  ? -14.890 102.636 76.802  1.00 91.60  ? 74   LYS C O     1 
ATOM   6917  C  CB    . LYS G 3 74  ? -15.286 99.407  76.044  1.00 56.22  ? 74   LYS C CB    1 
ATOM   6918  N  N     . LEU G 3 75  ? -13.530 101.166 77.808  1.00 100.31 ? 75   LEU C N     1 
ATOM   6919  C  CA    . LEU G 3 75  ? -13.366 102.008 78.984  1.00 100.31 ? 75   LEU C CA    1 
ATOM   6920  C  C     . LEU G 3 75  ? -12.977 103.445 78.688  1.00 100.31 ? 75   LEU C C     1 
ATOM   6921  O  O     . LEU G 3 75  ? -13.810 104.341 78.792  1.00 100.31 ? 75   LEU C O     1 
ATOM   6922  C  CB    . LEU G 3 75  ? -12.377 101.386 79.974  1.00 66.68  ? 75   LEU C CB    1 
ATOM   6923  C  CG    . LEU G 3 75  ? -12.984 100.157 80.661  1.00 66.68  ? 75   LEU C CG    1 
ATOM   6924  C  CD1   . LEU G 3 75  ? -12.073 99.686  81.758  1.00 66.68  ? 75   LEU C CD1   1 
ATOM   6925  C  CD2   . LEU G 3 75  ? -14.359 100.497 81.243  1.00 66.68  ? 75   LEU C CD2   1 
ATOM   6926  N  N     . GLN G 3 76  ? -11.731 103.667 78.295  1.00 97.44  ? 76   GLN C N     1 
ATOM   6927  C  CA    . GLN G 3 76  ? -11.260 105.016 78.031  1.00 97.44  ? 76   GLN C CA    1 
ATOM   6928  C  C     . GLN G 3 76  ? -11.883 105.820 76.890  1.00 97.44  ? 76   GLN C C     1 
ATOM   6929  O  O     . GLN G 3 76  ? -11.921 107.050 76.956  1.00 97.44  ? 76   GLN C O     1 
ATOM   6930  C  CB    . GLN G 3 76  ? -9.750  104.992 77.865  1.00 73.39  ? 76   GLN C CB    1 
ATOM   6931  C  CG    . GLN G 3 76  ? -9.048  104.549 79.111  1.00 73.39  ? 76   GLN C CG    1 
ATOM   6932  C  CD    . GLN G 3 76  ? -7.609  105.001 79.141  1.00 73.39  ? 76   GLN C CD    1 
ATOM   6933  O  OE1   . GLN G 3 76  ? -6.682  104.187 79.088  1.00 73.39  ? 76   GLN C OE1   1 
ATOM   6934  N  NE2   . GLN G 3 76  ? -7.410  106.316 79.223  1.00 73.39  ? 76   GLN C NE2   1 
ATOM   6935  N  N     . LEU G 3 77  ? -12.380 105.165 75.849  1.00 69.26  ? 77   LEU C N     1 
ATOM   6936  C  CA    . LEU G 3 77  ? -12.948 105.932 74.744  1.00 69.26  ? 77   LEU C CA    1 
ATOM   6937  C  C     . LEU G 3 77  ? -14.340 105.480 74.334  1.00 69.26  ? 77   LEU C C     1 
ATOM   6938  O  O     . LEU G 3 77  ? -14.875 105.958 73.340  1.00 69.26  ? 77   LEU C O     1 
ATOM   6939  C  CB    . LEU G 3 77  ? -12.007 105.884 73.529  1.00 63.35  ? 77   LEU C CB    1 
ATOM   6940  C  CG    . LEU G 3 77  ? -10.500 105.790 73.820  1.00 63.35  ? 77   LEU C CG    1 
ATOM   6941  C  CD1   . LEU G 3 77  ? -9.767  105.663 72.513  1.00 63.35  ? 77   LEU C CD1   1 
ATOM   6942  C  CD2   . LEU G 3 77  ? -9.997  106.999 74.591  1.00 63.35  ? 77   LEU C CD2   1 
ATOM   6943  N  N     . ASN G 3 78  ? -14.940 104.584 75.108  1.00 109.12 ? 78   ASN C N     1 
ATOM   6944  C  CA    . ASN G 3 78  ? -16.267 104.081 74.776  1.00 109.12 ? 78   ASN C CA    1 
ATOM   6945  C  C     . ASN G 3 78  ? -16.232 103.611 73.326  1.00 109.12 ? 78   ASN C C     1 
ATOM   6946  O  O     . ASN G 3 78  ? -17.164 103.865 72.560  1.00 109.12 ? 78   ASN C O     1 
ATOM   6947  C  CB    . ASN G 3 78  ? -17.326 105.176 74.938  1.00 42.72  ? 78   ASN C CB    1 
ATOM   6948  N  N     . ARG G 3 79  ? -15.144 102.929 72.963  1.00 69.02  ? 79   ARG C N     1 
ATOM   6949  C  CA    . ARG G 3 79  ? -14.956 102.421 71.608  1.00 69.02  ? 79   ARG C CA    1 
ATOM   6950  C  C     . ARG G 3 79  ? -15.001 100.885 71.543  1.00 69.02  ? 79   ARG C C     1 
ATOM   6951  O  O     . ARG G 3 79  ? -14.571 100.207 72.471  1.00 69.02  ? 79   ARG C O     1 
ATOM   6952  C  CB    . ARG G 3 79  ? -13.598 102.909 71.057  1.00 70.38  ? 79   ARG C CB    1 
ATOM   6953  C  CG    . ARG G 3 79  ? -13.395 102.597 69.571  1.00 70.38  ? 79   ARG C CG    1 
ATOM   6954  C  CD    . ARG G 3 79  ? -11.939 102.440 69.158  1.00 70.38  ? 79   ARG C CD    1 
ATOM   6955  N  NE    . ARG G 3 79  ? -11.341 103.680 68.677  1.00 70.38  ? 79   ARG C NE    1 
ATOM   6956  C  CZ    . ARG G 3 79  ? -10.284 103.742 67.863  1.00 70.38  ? 79   ARG C CZ    1 
ATOM   6957  N  NH1   . ARG G 3 79  ? -9.700  102.628 67.420  1.00 70.38  ? 79   ARG C NH1   1 
ATOM   6958  N  NH2   . ARG G 3 79  ? -9.794  104.927 67.504  1.00 70.38  ? 79   ARG C NH2   1 
ATOM   6959  N  N     . GLU G 3 80  ? -15.530 100.338 70.451  1.00 77.46  ? 80   GLU C N     1 
ATOM   6960  C  CA    . GLU G 3 80  ? -15.553 98.888  70.274  1.00 77.46  ? 80   GLU C CA    1 
ATOM   6961  C  C     . GLU G 3 80  ? -14.363 98.517  69.368  1.00 77.46  ? 80   GLU C C     1 
ATOM   6962  O  O     . GLU G 3 80  ? -14.421 98.666  68.147  1.00 77.46  ? 80   GLU C O     1 
ATOM   6963  C  CB    . GLU G 3 80  ? -16.872 98.443  69.639  1.00 54.93  ? 80   GLU C CB    1 
ATOM   6964  N  N     . PHE G 3 81  ? -13.278 98.059  69.987  1.00 97.25  ? 81   PHE C N     1 
ATOM   6965  C  CA    . PHE G 3 81  ? -12.050 97.673  69.285  1.00 97.25  ? 81   PHE C CA    1 
ATOM   6966  C  C     . PHE G 3 81  ? -11.881 96.159  69.381  1.00 97.25  ? 81   PHE C C     1 
ATOM   6967  O  O     . PHE G 3 81  ? -11.950 95.601  70.475  1.00 97.25  ? 81   PHE C O     1 
ATOM   6968  C  CB    . PHE G 3 81  ? -10.866 98.360  69.956  1.00 77.78  ? 81   PHE C CB    1 
ATOM   6969  C  CG    . PHE G 3 81  ? -9.524  98.017  69.367  1.00 77.78  ? 81   PHE C CG    1 
ATOM   6970  C  CD1   . PHE G 3 81  ? -8.862  98.920  68.548  1.00 77.78  ? 81   PHE C CD1   1 
ATOM   6971  C  CD2   . PHE G 3 81  ? -8.885  96.835  69.703  1.00 77.78  ? 81   PHE C CD2   1 
ATOM   6972  C  CE1   . PHE G 3 81  ? -7.579  98.658  68.082  1.00 77.78  ? 81   PHE C CE1   1 
ATOM   6973  C  CE2   . PHE G 3 81  ? -7.603  96.561  69.241  1.00 77.78  ? 81   PHE C CE2   1 
ATOM   6974  C  CZ    . PHE G 3 81  ? -6.946  97.478  68.430  1.00 77.78  ? 81   PHE C CZ    1 
ATOM   6975  N  N     . HIS G 3 82  ? -11.645 95.491  68.253  1.00 75.56  ? 82   HIS C N     1 
ATOM   6976  C  CA    . HIS G 3 82  ? -11.490 94.034  68.264  1.00 75.56  ? 82   HIS C CA    1 
ATOM   6977  C  C     . HIS G 3 82  ? -10.588 93.454  67.206  1.00 75.56  ? 82   HIS C C     1 
ATOM   6978  O  O     . HIS G 3 82  ? -11.054 93.112  66.130  1.00 75.56  ? 82   HIS C O     1 
ATOM   6979  C  CB    . HIS G 3 82  ? -12.846 93.369  68.120  1.00 76.78  ? 82   HIS C CB    1 
ATOM   6980  C  CG    . HIS G 3 82  ? -13.809 93.776  69.174  1.00 76.78  ? 82   HIS C CG    1 
ATOM   6981  N  ND1   . HIS G 3 82  ? -13.737 93.298  70.463  1.00 76.78  ? 82   HIS C ND1   1 
ATOM   6982  C  CD2   . HIS G 3 82  ? -14.801 94.694  69.162  1.00 76.78  ? 82   HIS C CD2   1 
ATOM   6983  C  CE1   . HIS G 3 82  ? -14.644 93.908  71.203  1.00 76.78  ? 82   HIS C CE1   1 
ATOM   6984  N  NE2   . HIS G 3 82  ? -15.301 94.761  70.438  1.00 76.78  ? 82   HIS C NE2   1 
ATOM   6985  N  N     . LEU G 3 83  ? -9.304  93.329  67.496  1.00 79.52  ? 83   LEU C N     1 
ATOM   6986  C  CA    . LEU G 3 83  ? -8.413  92.730  66.521  1.00 79.52  ? 83   LEU C CA    1 
ATOM   6987  C  C     . LEU G 3 83  ? -8.802  91.267  66.359  1.00 79.52  ? 83   LEU C C     1 
ATOM   6988  O  O     . LEU G 3 83  ? -8.944  90.541  67.356  1.00 79.52  ? 83   LEU C O     1 
ATOM   6989  C  CB    . LEU G 3 83  ? -6.981  92.787  66.992  1.00 39.99  ? 83   LEU C CB    1 
ATOM   6990  C  CG    . LEU G 3 83  ? -6.316  94.134  66.919  1.00 39.99  ? 83   LEU C CG    1 
ATOM   6991  C  CD1   . LEU G 3 83  ? -4.865  94.034  67.438  1.00 39.99  ? 83   LEU C CD1   1 
ATOM   6992  C  CD2   . LEU G 3 83  ? -6.368  94.580  65.476  1.00 39.99  ? 83   LEU C CD2   1 
ATOM   6993  N  N     . PRO G 3 84  ? -8.989  90.811  65.104  1.00 70.54  ? 84   PRO C N     1 
ATOM   6994  C  CA    . PRO G 3 84  ? -9.363  89.421  64.838  1.00 70.54  ? 84   PRO C CA    1 
ATOM   6995  C  C     . PRO G 3 84  ? -8.130  88.543  64.865  1.00 70.54  ? 84   PRO C C     1 
ATOM   6996  O  O     . PRO G 3 84  ? -7.044  88.957  64.451  1.00 70.54  ? 84   PRO C O     1 
ATOM   6997  C  CB    . PRO G 3 84  ? -10.010 89.497  63.466  1.00 87.41  ? 84   PRO C CB    1 
ATOM   6998  C  CG    . PRO G 3 84  ? -9.182  90.510  62.798  1.00 87.41  ? 84   PRO C CG    1 
ATOM   6999  C  CD    . PRO G 3 84  ? -9.020  91.592  63.856  1.00 87.41  ? 84   PRO C CD    1 
ATOM   7000  N  N     . ARG G 3 85  ? -8.309  87.334  65.373  1.00 75.19  ? 85   ARG C N     1 
ATOM   7001  C  CA    . ARG G 3 85  ? -7.222  86.375  65.492  1.00 75.19  ? 85   ARG C CA    1 
ATOM   7002  C  C     . ARG G 3 85  ? -6.270  86.344  64.296  1.00 75.19  ? 85   ARG C C     1 
ATOM   7003  O  O     . ARG G 3 85  ? -5.056  86.579  64.451  1.00 75.19  ? 85   ARG C O     1 
ATOM   7004  C  CB    . ARG G 3 85  ? -7.812  84.974  65.739  1.00 91.37  ? 85   ARG C CB    1 
ATOM   7005  C  CG    . ARG G 3 85  ? -6.812  83.831  65.671  1.00 91.37  ? 85   ARG C CG    1 
ATOM   7006  C  CD    . ARG G 3 85  ? -6.974  83.041  64.387  1.00 91.37  ? 85   ARG C CD    1 
ATOM   7007  N  NE    . ARG G 3 85  ? -5.689  82.535  63.920  1.00 91.37  ? 85   ARG C NE    1 
ATOM   7008  C  CZ    . ARG G 3 85  ? -5.500  81.930  62.751  1.00 91.37  ? 85   ARG C CZ    1 
ATOM   7009  N  NH1   . ARG G 3 85  ? -6.522  81.746  61.918  1.00 91.37  ? 85   ARG C NH1   1 
ATOM   7010  N  NH2   . ARG G 3 85  ? -4.281  81.519  62.410  1.00 91.37  ? 85   ARG C NH2   1 
ATOM   7011  N  N     . GLU G 3 86  ? -6.841  86.078  63.113  1.00 64.21  ? 86   GLU C N     1 
ATOM   7012  C  CA    . GLU G 3 86  ? -6.093  85.943  61.859  1.00 64.21  ? 86   GLU C CA    1 
ATOM   7013  C  C     . GLU G 3 86  ? -4.955  86.911  61.547  1.00 64.21  ? 86   GLU C C     1 
ATOM   7014  O  O     . GLU G 3 86  ? -3.992  86.529  60.877  1.00 64.21  ? 86   GLU C O     1 
ATOM   7015  C  CB    . GLU G 3 86  ? -7.053  85.885  60.663  1.00 91.15  ? 86   GLU C CB    1 
ATOM   7016  C  CG    . GLU G 3 86  ? -8.284  86.770  60.720  1.00 91.15  ? 86   GLU C CG    1 
ATOM   7017  C  CD    . GLU G 3 86  ? -9.151  86.595  59.468  1.00 91.15  ? 86   GLU C CD    1 
ATOM   7018  O  OE1   . GLU G 3 86  ? -9.451  85.429  59.118  1.00 91.15  ? 86   GLU C OE1   1 
ATOM   7019  O  OE2   . GLU G 3 86  ? -9.532  87.608  58.829  1.00 91.15  ? 86   GLU C OE2   1 
ATOM   7020  N  N     . ASN G 3 87  ? -5.047  88.145  62.042  1.00 98.66  ? 87   ASN C N     1 
ATOM   7021  C  CA    . ASN G 3 87  ? -4.017  89.145  61.778  1.00 98.66  ? 87   ASN C CA    1 
ATOM   7022  C  C     . ASN G 3 87  ? -3.020  89.298  62.908  1.00 98.66  ? 87   ASN C C     1 
ATOM   7023  O  O     . ASN G 3 87  ? -2.174  90.187  62.847  1.00 98.66  ? 87   ASN C O     1 
ATOM   7024  C  CB    . ASN G 3 87  ? -4.635  90.525  61.528  1.00 67.35  ? 87   ASN C CB    1 
ATOM   7025  C  CG    . ASN G 3 87  ? -5.847  90.476  60.614  1.00 67.35  ? 87   ASN C CG    1 
ATOM   7026  O  OD1   . ASN G 3 87  ? -6.882  89.919  60.979  1.00 67.35  ? 87   ASN C OD1   1 
ATOM   7027  N  ND2   . ASN G 3 87  ? -5.729  91.065  59.421  1.00 67.35  ? 87   ASN C ND2   1 
ATOM   7028  N  N     . CYS G 3 88  ? -3.095  88.451  63.933  1.00 50.49  ? 88   CYS C N     1 
ATOM   7029  C  CA    . CYS G 3 88  ? -2.166  88.609  65.058  1.00 50.49  ? 88   CYS C CA    1 
ATOM   7030  C  C     . CYS G 3 88  ? -1.120  87.534  65.209  1.00 50.49  ? 88   CYS C C     1 
ATOM   7031  O  O     . CYS G 3 88  ? -1.392  86.347  65.037  1.00 50.49  ? 88   CYS C O     1 
ATOM   7032  C  CB    . CYS G 3 88  ? -2.932  88.722  66.370  1.00 68.41  ? 88   CYS C CB    1 
ATOM   7033  S  SG    . CYS G 3 88  ? -4.411  89.688  66.228  1.00 68.41  ? 88   CYS C SG    1 
ATOM   7034  N  N     . ILE G 3 89  ? 0.083   87.964  65.538  1.00 50.34  ? 89   ILE C N     1 
ATOM   7035  C  CA    . ILE G 3 89  ? 1.189   87.048  65.747  1.00 50.34  ? 89   ILE C CA    1 
ATOM   7036  C  C     . ILE G 3 89  ? 1.605   87.257  67.189  1.00 50.34  ? 89   ILE C C     1 
ATOM   7037  O  O     . ILE G 3 89  ? 1.396   88.342  67.737  1.00 50.34  ? 89   ILE C O     1 
ATOM   7038  C  CB    . ILE G 3 89  ? 2.409   87.368  64.824  1.00 54.69  ? 89   ILE C CB    1 
ATOM   7039  C  CG1   . ILE G 3 89  ? 2.221   86.696  63.465  1.00 54.69  ? 89   ILE C CG1   1 
ATOM   7040  C  CG2   . ILE G 3 89  ? 3.734   86.923  65.475  1.00 54.69  ? 89   ILE C CG2   1 
ATOM   7041  C  CD1   . ILE G 3 89  ? 1.531   87.569  62.438  1.00 54.69  ? 89   ILE C CD1   1 
ATOM   7042  N  N     . ASP G 3 90  ? 2.184   86.232  67.806  1.00 63.61  ? 90   ASP C N     1 
ATOM   7043  C  CA    . ASP G 3 90  ? 2.622   86.346  69.189  1.00 63.61  ? 90   ASP C CA    1 
ATOM   7044  C  C     . ASP G 3 90  ? 4.019   85.758  69.343  1.00 63.61  ? 90   ASP C C     1 
ATOM   7045  O  O     . ASP G 3 90  ? 4.183   84.543  69.362  1.00 63.61  ? 90   ASP C O     1 
ATOM   7046  C  CB    . ASP G 3 90  ? 1.643   85.604  70.110  1.00 71.41  ? 90   ASP C CB    1 
ATOM   7047  C  CG    . ASP G 3 90  ? 1.896   85.885  71.589  1.00 71.41  ? 90   ASP C CG    1 
ATOM   7048  O  OD1   . ASP G 3 90  ? 3.034   85.658  72.064  1.00 71.41  ? 90   ASP C OD1   1 
ATOM   7049  O  OD2   . ASP G 3 90  ? 0.947   86.335  72.270  1.00 71.41  ? 90   ASP C OD2   1 
ATOM   7050  N  N     . THR G 3 91  ? 5.029   86.603  69.469  1.00 62.13  ? 91   THR C N     1 
ATOM   7051  C  CA    . THR G 3 91  ? 6.379   86.078  69.600  1.00 62.13  ? 91   THR C CA    1 
ATOM   7052  C  C     . THR G 3 91  ? 6.532   85.101  70.762  1.00 62.13  ? 91   THR C C     1 
ATOM   7053  O  O     . THR G 3 91  ? 7.363   84.196  70.704  1.00 62.13  ? 91   THR C O     1 
ATOM   7054  C  CB    . THR G 3 91  ? 7.419   87.225  69.705  1.00 78.82  ? 91   THR C CB    1 
ATOM   7055  O  OG1   . THR G 3 91  ? 8.603   86.766  70.370  1.00 78.82  ? 91   THR C OG1   1 
ATOM   7056  C  CG2   . THR G 3 91  ? 6.834   88.390  70.445  1.00 78.82  ? 91   THR C CG2   1 
ATOM   7057  N  N     . LEU G 3 92  ? 5.736   85.257  71.812  1.00 90.90  ? 92   LEU C N     1 
ATOM   7058  C  CA    . LEU G 3 92  ? 5.852   84.331  72.931  1.00 90.90  ? 92   LEU C CA    1 
ATOM   7059  C  C     . LEU G 3 92  ? 5.348   82.969  72.480  1.00 90.90  ? 92   LEU C C     1 
ATOM   7060  O  O     . LEU G 3 92  ? 6.032   81.965  72.646  1.00 90.90  ? 92   LEU C O     1 
ATOM   7061  C  CB    . LEU G 3 92  ? 5.040   84.810  74.129  1.00 47.83  ? 92   LEU C CB    1 
ATOM   7062  C  CG    . LEU G 3 92  ? 5.142   83.940  75.383  1.00 47.83  ? 92   LEU C CG    1 
ATOM   7063  C  CD1   . LEU G 3 92  ? 6.549   83.977  75.975  1.00 47.83  ? 92   LEU C CD1   1 
ATOM   7064  C  CD2   . LEU G 3 92  ? 4.132   84.447  76.385  1.00 47.83  ? 92   LEU C CD2   1 
ATOM   7065  N  N     . VAL G 3 93  ? 4.151   82.942  71.898  1.00 54.33  ? 93   VAL C N     1 
ATOM   7066  C  CA    . VAL G 3 93  ? 3.578   81.699  71.422  1.00 54.33  ? 93   VAL C CA    1 
ATOM   7067  C  C     . VAL G 3 93  ? 4.612   81.029  70.559  1.00 54.33  ? 93   VAL C C     1 
ATOM   7068  O  O     . VAL G 3 93  ? 4.959   79.883  70.786  1.00 54.33  ? 93   VAL C O     1 
ATOM   7069  C  CB    . VAL G 3 93  ? 2.307   81.949  70.609  1.00 53.04  ? 93   VAL C CB    1 
ATOM   7070  C  CG1   . VAL G 3 93  ? 1.978   80.730  69.741  1.00 53.04  ? 93   VAL C CG1   1 
ATOM   7071  C  CG2   . VAL G 3 93  ? 1.163   82.240  71.548  1.00 53.04  ? 93   VAL C CG2   1 
ATOM   7072  N  N     . LEU G 3 94  ? 5.124   81.764  69.581  1.00 42.92  ? 94   LEU C N     1 
ATOM   7073  C  CA    . LEU G 3 94  ? 6.145   81.237  68.676  1.00 42.92  ? 94   LEU C CA    1 
ATOM   7074  C  C     . LEU G 3 94  ? 7.409   80.826  69.421  1.00 42.92  ? 94   LEU C C     1 
ATOM   7075  O  O     . LEU G 3 94  ? 7.929   79.752  69.209  1.00 42.92  ? 94   LEU C O     1 
ATOM   7076  C  CB    . LEU G 3 94  ? 6.490   82.276  67.600  1.00 122.75 ? 94   LEU C CB    1 
ATOM   7077  N  N     . SER G 3 95  ? 7.894   81.678  70.301  1.00 54.55  ? 95   SER C N     1 
ATOM   7078  C  CA    . SER G 3 95  ? 9.093   81.346  71.043  1.00 54.55  ? 95   SER C CA    1 
ATOM   7079  C  C     . SER G 3 95  ? 8.906   80.114  71.949  1.00 54.55  ? 95   SER C C     1 
ATOM   7080  O  O     . SER G 3 95  ? 9.854   79.642  72.601  1.00 54.55  ? 95   SER C O     1 
ATOM   7081  C  CB    . SER G 3 95  ? 9.531   82.546  71.889  1.00 85.38  ? 95   SER C CB    1 
ATOM   7082  O  OG    . SER G 3 95  ? 10.841  82.347  72.396  1.00 85.38  ? 95   SER C OG    1 
ATOM   7083  N  N     . ARG G 3 96  ? 7.680   79.604  72.009  1.00 80.93  ? 96   ARG C N     1 
ATOM   7084  C  CA    . ARG G 3 96  ? 7.379   78.438  72.837  1.00 80.93  ? 96   ARG C CA    1 
ATOM   7085  C  C     . ARG G 3 96  ? 7.290   77.242  71.920  1.00 80.93  ? 96   ARG C C     1 
ATOM   7086  O  O     . ARG G 3 96  ? 7.336   76.097  72.361  1.00 80.93  ? 96   ARG C O     1 
ATOM   7087  C  CB    . ARG G 3 96  ? 6.035   78.610  73.546  1.00 79.63  ? 96   ARG C CB    1 
ATOM   7088  C  CG    . ARG G 3 96  ? 6.040   79.537  74.733  1.00 79.63  ? 96   ARG C CG    1 
ATOM   7089  C  CD    . ARG G 3 96  ? 6.199   78.764  76.020  1.00 79.63  ? 96   ARG C CD    1 
ATOM   7090  N  NE    . ARG G 3 96  ? 6.037   79.595  77.218  1.00 79.63  ? 96   ARG C NE    1 
ATOM   7091  C  CZ    . ARG G 3 96  ? 4.947   80.305  77.526  1.00 79.63  ? 96   ARG C CZ    1 
ATOM   7092  N  NH1   . ARG G 3 96  ? 3.879   80.317  76.722  1.00 79.63  ? 96   ARG C NH1   1 
ATOM   7093  N  NH2   . ARG G 3 96  ? 4.917   80.993  78.662  1.00 79.63  ? 96   ARG C NH2   1 
ATOM   7094  N  N     . LEU G 3 97  ? 7.149   77.532  70.633  1.00 79.13  ? 97   LEU C N     1 
ATOM   7095  C  CA    . LEU G 3 97  ? 7.036   76.524  69.590  1.00 79.13  ? 97   LEU C CA    1 
ATOM   7096  C  C     . LEU G 3 97  ? 8.381   76.258  68.919  1.00 79.13  ? 97   LEU C C     1 
ATOM   7097  O  O     . LEU G 3 97  ? 8.514   75.333  68.135  1.00 79.13  ? 97   LEU C O     1 
ATOM   7098  C  CB    . LEU G 3 97  ? 6.054   77.012  68.539  1.00 42.19  ? 97   LEU C CB    1 
ATOM   7099  C  CG    . LEU G 3 97  ? 5.898   76.047  67.380  1.00 42.19  ? 97   LEU C CG    1 
ATOM   7100  C  CD1   . LEU G 3 97  ? 5.240   74.782  67.924  1.00 42.19  ? 97   LEU C CD1   1 
ATOM   7101  C  CD2   . LEU G 3 97  ? 5.103   76.686  66.231  1.00 42.19  ? 97   LEU C CD2   1 
ATOM   7102  N  N     . ILE G 3 98  ? 9.377   77.081  69.213  1.00 61.32  ? 98   ILE C N     1 
ATOM   7103  C  CA    . ILE G 3 98  ? 10.685  76.893  68.616  1.00 61.32  ? 98   ILE C CA    1 
ATOM   7104  C  C     . ILE G 3 98  ? 11.757  76.585  69.648  1.00 61.32  ? 98   ILE C C     1 
ATOM   7105  O  O     . ILE G 3 98  ? 12.648  75.790  69.370  1.00 61.32  ? 98   ILE C O     1 
ATOM   7106  C  CB    . ILE G 3 98  ? 11.054  78.095  67.725  1.00 55.78  ? 98   ILE C CB    1 
ATOM   7107  C  CG1   . ILE G 3 98  ? 10.178  78.046  66.461  1.00 55.78  ? 98   ILE C CG1   1 
ATOM   7108  C  CG2   . ILE G 3 98  ? 12.549  78.083  67.391  1.00 55.78  ? 98   ILE C CG2   1 
ATOM   7109  C  CD1   . ILE G 3 98  ? 10.108  79.344  65.699  1.00 55.78  ? 98   ILE C CD1   1 
ATOM   7110  N  N     . HIS G 3 99  ? 11.687  77.188  70.832  1.00 135.57 ? 99   HIS C N     1 
ATOM   7111  C  CA    . HIS G 3 99  ? 12.665  76.850  71.859  1.00 135.57 ? 99   HIS C CA    1 
ATOM   7112  C  C     . HIS G 3 99  ? 12.019  75.930  72.888  1.00 135.57 ? 99   HIS C C     1 
ATOM   7113  O  O     . HIS G 3 99  ? 12.141  76.113  74.101  1.00 135.57 ? 99   HIS C O     1 
ATOM   7114  C  CB    . HIS G 3 99  ? 13.260  78.096  72.501  1.00 78.77  ? 99   HIS C CB    1 
ATOM   7115  C  CG    . HIS G 3 99  ? 14.569  78.489  71.896  1.00 78.77  ? 99   HIS C CG    1 
ATOM   7116  N  ND1   . HIS G 3 99  ? 15.566  77.573  71.643  1.00 78.77  ? 99   HIS C ND1   1 
ATOM   7117  C  CD2   . HIS G 3 99  ? 15.039  79.686  71.474  1.00 78.77  ? 99   HIS C CD2   1 
ATOM   7118  C  CE1   . HIS G 3 99  ? 16.596  78.188  71.090  1.00 78.77  ? 99   HIS C CE1   1 
ATOM   7119  N  NE2   . HIS G 3 99  ? 16.302  79.471  70.977  1.00 78.77  ? 99   HIS C NE2   1 
ATOM   7120  N  N     . SER G 3 100 ? 11.346  74.912  72.359  1.00 72.73  ? 100  SER C N     1 
ATOM   7121  C  CA    . SER G 3 100 ? 10.634  73.920  73.155  1.00 72.73  ? 100  SER C CA    1 
ATOM   7122  C  C     . SER G 3 100 ? 11.451  73.227  74.230  1.00 72.73  ? 100  SER C C     1 
ATOM   7123  O  O     . SER G 3 100 ? 10.882  72.750  75.202  1.00 72.73  ? 100  SER C O     1 
ATOM   7124  C  CB    . SER G 3 100 ? 10.015  72.852  72.244  1.00 82.28  ? 100  SER C CB    1 
ATOM   7125  O  OG    . SER G 3 100 ? 11.017  72.087  71.594  1.00 82.28  ? 100  SER C OG    1 
ATOM   7126  N  N     . ASN G 3 101 ? 12.771  73.177  74.084  1.00 107.08 ? 101  ASN C N     1 
ATOM   7127  C  CA    . ASN G 3 101 ? 13.588  72.481  75.075  1.00 107.08 ? 101  ASN C CA    1 
ATOM   7128  C  C     . ASN G 3 101 ? 14.179  73.286  76.239  1.00 107.08 ? 101  ASN C C     1 
ATOM   7129  O  O     . ASN G 3 101 ? 14.551  72.700  77.260  1.00 107.08 ? 101  ASN C O     1 
ATOM   7130  C  CB    . ASN G 3 101 ? 14.704  71.706  74.372  1.00 82.88  ? 101  ASN C CB    1 
ATOM   7131  C  CG    . ASN G 3 101 ? 15.652  72.610  73.613  1.00 82.88  ? 101  ASN C CG    1 
ATOM   7132  O  OD1   . ASN G 3 101 ? 15.224  73.542  72.920  1.00 82.88  ? 101  ASN C OD1   1 
ATOM   7133  N  ND2   . ASN G 3 101 ? 16.950  72.334  73.728  1.00 82.88  ? 101  ASN C ND2   1 
ATOM   7134  N  N     . LEU G 3 102 ? 14.259  74.610  76.116  1.00 96.64  ? 102  LEU C N     1 
ATOM   7135  C  CA    . LEU G 3 102 ? 14.827  75.419  77.201  1.00 96.64  ? 102  LEU C CA    1 
ATOM   7136  C  C     . LEU G 3 102 ? 13.824  75.639  78.363  1.00 96.64  ? 102  LEU C C     1 
ATOM   7137  O  O     . LEU G 3 102 ? 13.246  74.678  78.871  1.00 96.64  ? 102  LEU C O     1 
ATOM   7138  C  CB    . LEU G 3 102 ? 15.346  76.755  76.629  1.00 70.31  ? 102  LEU C CB    1 
ATOM   7139  N  N     . LYS G 3 103 ? 13.636  76.891  78.784  1.00 86.71  ? 103  LYS C N     1 
ATOM   7140  C  CA    . LYS G 3 103 ? 12.715  77.230  79.871  1.00 86.71  ? 103  LYS C CA    1 
ATOM   7141  C  C     . LYS G 3 103 ? 12.607  78.748  80.111  1.00 86.71  ? 103  LYS C C     1 
ATOM   7142  O  O     . LYS G 3 103 ? 13.612  79.472  80.113  1.00 86.71  ? 103  LYS C O     1 
ATOM   7143  C  CB    . LYS G 3 103 ? 13.146  76.536  81.159  1.00 55.79  ? 103  LYS C CB    1 
ATOM   7144  N  N     . ASP G 3 104 ? 11.379  79.223  80.316  1.00 134.67 ? 104  ASP C N     1 
ATOM   7145  C  CA    . ASP G 3 104 ? 11.121  80.646  80.544  1.00 134.67 ? 104  ASP C CA    1 
ATOM   7146  C  C     . ASP G 3 104 ? 10.687  80.967  81.967  1.00 134.67 ? 104  ASP C C     1 
ATOM   7147  O  O     . ASP G 3 104 ? 10.171  80.112  82.686  1.00 134.67 ? 104  ASP C O     1 
ATOM   7148  C  CB    . ASP G 3 104 ? 10.043  81.158  79.579  1.00 88.40  ? 104  ASP C CB    1 
ATOM   7149  C  CG    . ASP G 3 104 ? 8.885   80.188  79.429  1.00 88.40  ? 104  ASP C CG    1 
ATOM   7150  O  OD1   . ASP G 3 104 ? 8.558   79.484  80.415  1.00 88.40  ? 104  ASP C OD1   1 
ATOM   7151  O  OD2   . ASP G 3 104 ? 8.302   80.139  78.325  1.00 88.40  ? 104  ASP C OD2   1 
ATOM   7152  N  N     . THR G 3 105 ? 10.893  82.220  82.355  1.00 143.15 ? 105  THR C N     1 
ATOM   7153  C  CA    . THR G 3 105 ? 10.529  82.703  83.679  1.00 143.15 ? 105  THR C CA    1 
ATOM   7154  C  C     . THR G 3 105 ? 9.055   83.117  83.723  1.00 143.15 ? 105  THR C C     1 
ATOM   7155  O  O     . THR G 3 105 ? 8.581   83.642  84.733  1.00 143.15 ? 105  THR C O     1 
ATOM   7156  C  CB    . THR G 3 105 ? 11.388  83.928  84.055  1.00 112.00 ? 105  THR C CB    1 
ATOM   7157  O  OG1   . THR G 3 105 ? 12.134  84.358  82.907  1.00 112.00 ? 105  THR C OG1   1 
ATOM   7158  C  CG2   . THR G 3 105 ? 12.340  83.591  85.186  1.00 112.00 ? 105  THR C CG2   1 
ATOM   7159  N  N     . ASP G 3 106 ? 8.342   82.878  82.622  1.00 85.56  ? 106  ASP C N     1 
ATOM   7160  C  CA    . ASP G 3 106 ? 6.928   83.234  82.497  1.00 85.56  ? 106  ASP C CA    1 
ATOM   7161  C  C     . ASP G 3 106 ? 6.732   84.748  82.600  1.00 85.56  ? 106  ASP C C     1 
ATOM   7162  O  O     . ASP G 3 106 ? 5.822   85.227  83.276  1.00 85.56  ? 106  ASP C O     1 
ATOM   7163  C  CB    . ASP G 3 106 ? 6.096   82.525  83.571  1.00 91.24  ? 106  ASP C CB    1 
ATOM   7164  N  N     . MET G 3 107 ? 7.600   85.491  81.921  1.00 139.91 ? 107  MET C N     1 
ATOM   7165  C  CA    . MET G 3 107 ? 7.555   86.950  81.905  1.00 139.91 ? 107  MET C CA    1 
ATOM   7166  C  C     . MET G 3 107 ? 7.757   87.606  83.277  1.00 139.91 ? 107  MET C C     1 
ATOM   7167  O  O     . MET G 3 107 ? 7.144   88.632  83.581  1.00 139.91 ? 107  MET C O     1 
ATOM   7168  C  CB    . MET G 3 107 ? 6.241   87.427  81.279  1.00 111.32 ? 107  MET C CB    1 
ATOM   7169  N  N     . GLY G 3 108 ? 8.618   87.008  84.098  1.00 112.52 ? 108  GLY C N     1 
ATOM   7170  C  CA    . GLY G 3 108 ? 8.918   87.565  85.408  1.00 112.52 ? 108  GLY C CA    1 
ATOM   7171  C  C     . GLY G 3 108 ? 7.984   87.236  86.558  1.00 112.52 ? 108  GLY C C     1 
ATOM   7172  O  O     . GLY G 3 108 ? 7.844   88.028  87.493  1.00 112.52 ? 108  GLY C O     1 
ATOM   7173  N  N     . LEU G 3 109 ? 7.341   86.077  86.504  1.00 101.31 ? 109  LEU C N     1 
ATOM   7174  C  CA    . LEU G 3 109 ? 6.434   85.672  87.575  1.00 101.31 ? 109  LEU C CA    1 
ATOM   7175  C  C     . LEU G 3 109 ? 6.989   84.432  88.280  1.00 101.31 ? 109  LEU C C     1 
ATOM   7176  O  O     . LEU G 3 109 ? 6.263   83.711  88.968  1.00 101.31 ? 109  LEU C O     1 
ATOM   7177  C  CB    . LEU G 3 109 ? 5.037   85.389  87.014  1.00 97.16  ? 109  LEU C CB    1 
ATOM   7178  N  N     . LEU G 3 110 ? 8.289   84.206  88.096  1.00 135.01 ? 110  LEU C N     1 
ATOM   7179  C  CA    . LEU G 3 110 ? 9.002   83.081  88.700  1.00 135.01 ? 110  LEU C CA    1 
ATOM   7180  C  C     . LEU G 3 110 ? 10.508  83.376  88.713  1.00 135.01 ? 110  LEU C C     1 
ATOM   7181  O  O     . LEU G 3 110 ? 11.042  83.970  87.772  1.00 135.01 ? 110  LEU C O     1 
ATOM   7182  C  CB    . LEU G 3 110 ? 8.725   81.792  87.915  1.00 75.18  ? 110  LEU C CB    1 
ATOM   7183  N  N     . ARG G 3 111 ? 11.182  82.966  89.786  1.00 93.81  ? 111  ARG C N     1 
ATOM   7184  C  CA    . ARG G 3 111 ? 12.623  83.184  89.938  1.00 93.81  ? 111  ARG C CA    1 
ATOM   7185  C  C     . ARG G 3 111 ? 13.427  82.083  89.239  1.00 93.81  ? 111  ARG C C     1 
ATOM   7186  O  O     . ARG G 3 111 ? 13.270  80.901  89.550  1.00 93.81  ? 111  ARG C O     1 
ATOM   7187  C  CB    . ARG G 3 111 ? 12.981  83.241  91.434  1.00 43.35  ? 111  ARG C CB    1 
ATOM   7188  N  N     . SER G 3 112 ? 14.290  82.482  88.302  1.00 92.61  ? 112  SER C N     1 
ATOM   7189  C  CA    . SER G 3 112 ? 15.106  81.530  87.538  1.00 92.61  ? 112  SER C CA    1 
ATOM   7190  C  C     . SER G 3 112 ? 16.283  80.948  88.307  1.00 92.61  ? 112  SER C C     1 
ATOM   7191  O  O     . SER G 3 112 ? 17.050  80.148  87.762  1.00 92.61  ? 112  SER C O     1 
ATOM   7192  C  CB    . SER G 3 112 ? 15.629  82.177  86.256  1.00 59.07  ? 112  SER C CB    1 
ATOM   7193  N  N     . GLY G 3 113 ? 16.432  81.355  89.565  1.00 161.91 ? 113  GLY C N     1 
ATOM   7194  C  CA    . GLY G 3 113 ? 17.515  80.840  90.385  1.00 161.91 ? 113  GLY C CA    1 
ATOM   7195  C  C     . GLY G 3 113 ? 17.199  79.420  90.815  1.00 161.91 ? 113  GLY C C     1 
ATOM   7196  O  O     . GLY G 3 113 ? 18.079  78.675  91.256  1.00 161.91 ? 113  GLY C O     1 
ATOM   7197  N  N     . LYS G 3 114 ? 15.925  79.053  90.679  1.00 150.74 ? 114  LYS C N     1 
ATOM   7198  C  CA    . LYS G 3 114 ? 15.436  77.724  91.037  1.00 150.74 ? 114  LYS C CA    1 
ATOM   7199  C  C     . LYS G 3 114 ? 15.114  76.921  89.777  1.00 150.74 ? 114  LYS C C     1 
ATOM   7200  O  O     . LYS G 3 114 ? 14.971  75.699  89.833  1.00 150.74 ? 114  LYS C O     1 
ATOM   7201  C  CB    . LYS G 3 114 ? 14.177  77.843  91.913  1.00 80.30  ? 114  LYS C CB    1 
ATOM   7202  N  N     . LEU G 3 115 ? 15.001  77.619  88.647  1.00 136.30 ? 115  LEU C N     1 
ATOM   7203  C  CA    . LEU G 3 115 ? 14.691  76.984  87.366  1.00 136.30 ? 115  LEU C CA    1 
ATOM   7204  C  C     . LEU G 3 115 ? 15.958  76.432  86.704  1.00 136.30 ? 115  LEU C C     1 
ATOM   7205  O  O     . LEU G 3 115 ? 16.934  77.160  86.490  1.00 136.30 ? 115  LEU C O     1 
ATOM   7206  C  CB    . LEU G 3 115 ? 13.990  77.981  86.429  1.00 59.96  ? 115  LEU C CB    1 
ATOM   7207  N  N     . PRO G 3 116 ? 15.951  75.129  86.366  1.00 155.55 ? 116  PRO C N     1 
ATOM   7208  C  CA    . PRO G 3 116 ? 17.084  74.448  85.733  1.00 155.55 ? 116  PRO C CA    1 
ATOM   7209  C  C     . PRO G 3 116 ? 17.345  74.852  84.285  1.00 155.55 ? 116  PRO C C     1 
ATOM   7210  O  O     . PRO G 3 116 ? 16.618  75.664  83.706  1.00 155.55 ? 116  PRO C O     1 
ATOM   7211  C  CB    . PRO G 3 116 ? 16.694  72.977  85.842  1.00 102.94 ? 116  PRO C CB    1 
ATOM   7212  C  CG    . PRO G 3 116 ? 15.225  73.033  85.607  1.00 102.94 ? 116  PRO C CG    1 
ATOM   7213  C  CD    . PRO G 3 116 ? 14.800  74.209  86.477  1.00 102.94 ? 116  PRO C CD    1 
ATOM   7214  N  N     . GLY G 3 117 ? 18.396  74.264  83.718  1.00 80.07  ? 117  GLY C N     1 
ATOM   7215  C  CA    . GLY G 3 117 ? 18.773  74.522  82.338  1.00 80.07  ? 117  GLY C CA    1 
ATOM   7216  C  C     . GLY G 3 117 ? 19.349  75.894  82.036  1.00 80.07  ? 117  GLY C C     1 
ATOM   7217  O  O     . GLY G 3 117 ? 19.850  76.604  82.913  1.00 80.07  ? 117  GLY C O     1 
ATOM   7218  N  N     . ALA G 3 118 ? 19.276  76.258  80.762  1.00 87.81  ? 124  ALA C N     1 
ATOM   7219  C  CA    . ALA G 3 118 ? 19.766  77.546  80.302  1.00 87.81  ? 124  ALA C CA    1 
ATOM   7220  C  C     . ALA G 3 118 ? 18.606  78.452  79.883  1.00 87.81  ? 124  ALA C C     1 
ATOM   7221  O  O     . ALA G 3 118 ? 17.654  78.022  79.227  1.00 87.81  ? 124  ALA C O     1 
ATOM   7222  C  CB    . ALA G 3 118 ? 20.735  77.357  79.140  1.00 42.37  ? 124  ALA C CB    1 
ATOM   7223  N  N     . LEU G 3 119 ? 18.692  79.712  80.291  1.00 108.55 ? 125  LEU C N     1 
ATOM   7224  C  CA    . LEU G 3 119 ? 17.674  80.693  79.958  1.00 108.55 ? 125  LEU C CA    1 
ATOM   7225  C  C     . LEU G 3 119 ? 18.020  81.304  78.600  1.00 108.55 ? 125  LEU C C     1 
ATOM   7226  O  O     . LEU G 3 119 ? 19.196  81.461  78.250  1.00 108.55 ? 125  LEU C O     1 
ATOM   7227  C  CB    . LEU G 3 119 ? 17.606  81.781  81.033  1.00 77.92  ? 125  LEU C CB    1 
ATOM   7228  N  N     . GLU G 3 120 ? 16.988  81.640  77.832  1.00 164.90 ? 126  GLU C N     1 
ATOM   7229  C  CA    . GLU G 3 120 ? 17.180  82.216  76.500  1.00 164.90 ? 126  GLU C CA    1 
ATOM   7230  C  C     . GLU G 3 120 ? 17.880  83.579  76.554  1.00 164.90 ? 126  GLU C C     1 
ATOM   7231  O  O     . GLU G 3 120 ? 18.408  83.979  77.594  1.00 164.90 ? 126  GLU C O     1 
ATOM   7232  C  CB    . GLU G 3 120 ? 15.832  82.340  75.768  1.00 110.08 ? 126  GLU C CB    1 
ATOM   7233  C  CG    . GLU G 3 120 ? 15.940  82.651  74.273  1.00 110.08 ? 126  GLU C CG    1 
ATOM   7234  C  CD    . GLU G 3 120 ? 14.615  83.085  73.671  1.00 110.08 ? 126  GLU C CD    1 
ATOM   7235  O  OE1   . GLU G 3 120 ? 13.667  82.273  73.685  1.00 110.08 ? 126  GLU C OE1   1 
ATOM   7236  O  OE2   . GLU G 3 120 ? 14.520  84.237  73.188  1.00 110.08 ? 126  GLU C OE2   1 
ATOM   7237  N  N     . ALA G 3 121 ? 17.884  84.284  75.425  1.00 70.86  ? 127  ALA C N     1 
ATOM   7238  C  CA    . ALA G 3 121 ? 18.530  85.589  75.319  1.00 70.86  ? 127  ALA C CA    1 
ATOM   7239  C  C     . ALA G 3 121 ? 17.556  86.728  75.525  1.00 70.86  ? 127  ALA C C     1 
ATOM   7240  O  O     . ALA G 3 121 ? 17.657  87.468  76.500  1.00 70.86  ? 127  ALA C O     1 
ATOM   7241  C  CB    . ALA G 3 121 ? 19.195  85.729  73.958  1.00 125.97 ? 127  ALA C CB    1 
ATOM   7242  N  N     . TRP G 3 122 ? 16.624  86.874  74.594  1.00 84.67  ? 128  TRP C N     1 
ATOM   7243  C  CA    . TRP G 3 122 ? 15.634  87.930  74.683  1.00 84.67  ? 128  TRP C CA    1 
ATOM   7244  C  C     . TRP G 3 122 ? 14.619  87.555  75.751  1.00 84.67  ? 128  TRP C C     1 
ATOM   7245  O  O     . TRP G 3 122 ? 14.025  88.426  76.393  1.00 84.67  ? 128  TRP C O     1 
ATOM   7246  C  CB    . TRP G 3 122 ? 14.994  88.120  73.308  1.00 116.49 ? 128  TRP C CB    1 
ATOM   7247  C  CG    . TRP G 3 122 ? 16.011  88.513  72.249  1.00 116.49 ? 128  TRP C CG    1 
ATOM   7248  C  CD1   . TRP G 3 122 ? 15.830  88.504  70.892  1.00 116.49 ? 128  TRP C CD1   1 
ATOM   7249  C  CD2   . TRP G 3 122 ? 17.357  88.996  72.469  1.00 116.49 ? 128  TRP C CD2   1 
ATOM   7250  N  NE1   . TRP G 3 122 ? 16.970  88.948  70.257  1.00 116.49 ? 128  TRP C NE1   1 
ATOM   7251  C  CE2   . TRP G 3 122 ? 17.919  89.255  71.200  1.00 116.49 ? 128  TRP C CE2   1 
ATOM   7252  C  CE3   . TRP G 3 122 ? 18.137  89.236  73.613  1.00 116.49 ? 128  TRP C CE3   1 
ATOM   7253  C  CZ2   . TRP G 3 122 ? 19.226  89.739  71.047  1.00 116.49 ? 128  TRP C CZ2   1 
ATOM   7254  C  CZ3   . TRP G 3 122 ? 19.433  89.716  73.456  1.00 116.49 ? 128  TRP C CZ3   1 
ATOM   7255  C  CH2   . TRP G 3 122 ? 19.962  89.962  72.184  1.00 116.49 ? 128  TRP C CH2   1 
ATOM   7256  N  N     . GLY G 3 123 ? 14.453  86.250  75.955  1.00 75.01  ? 129  GLY C N     1 
ATOM   7257  C  CA    . GLY G 3 123 ? 13.528  85.766  76.960  1.00 75.01  ? 129  GLY C CA    1 
ATOM   7258  C  C     . GLY G 3 123 ? 13.846  86.408  78.293  1.00 75.01  ? 129  GLY C C     1 
ATOM   7259  O  O     . GLY G 3 123 ? 13.000  87.060  78.906  1.00 75.01  ? 129  GLY C O     1 
ATOM   7260  N  N     . TYR G 3 124 ? 15.080  86.218  78.740  1.00 84.33  ? 130  TYR C N     1 
ATOM   7261  C  CA    . TYR G 3 124 ? 15.540  86.791  79.992  1.00 84.33  ? 130  TYR C CA    1 
ATOM   7262  C  C     . TYR G 3 124 ? 15.647  88.296  79.755  1.00 84.33  ? 130  TYR C C     1 
ATOM   7263  O  O     . TYR G 3 124 ? 15.617  89.091  80.690  1.00 84.33  ? 130  TYR C O     1 
ATOM   7264  C  CB    . TYR G 3 124 ? 16.910  86.209  80.338  1.00 66.72  ? 130  TYR C CB    1 
ATOM   7265  C  CG    . TYR G 3 124 ? 17.369  86.483  81.746  1.00 66.72  ? 130  TYR C CG    1 
ATOM   7266  C  CD1   . TYR G 3 124 ? 17.040  85.617  82.788  1.00 66.72  ? 130  TYR C CD1   1 
ATOM   7267  C  CD2   . TYR G 3 124 ? 18.103  87.640  82.048  1.00 66.72  ? 130  TYR C CD2   1 
ATOM   7268  C  CE1   . TYR G 3 124 ? 17.428  85.898  84.093  1.00 66.72  ? 130  TYR C CE1   1 
ATOM   7269  C  CE2   . TYR G 3 124 ? 18.492  87.937  83.345  1.00 66.72  ? 130  TYR C CE2   1 
ATOM   7270  C  CZ    . TYR G 3 124 ? 18.152  87.064  84.362  1.00 66.72  ? 130  TYR C CZ    1 
ATOM   7271  O  OH    . TYR G 3 124 ? 18.528  87.363  85.652  1.00 66.72  ? 130  TYR C OH    1 
ATOM   7272  N  N     . ARG G 3 125 ? 15.750  88.682  78.488  1.00 124.69 ? 131  ARG C N     1 
ATOM   7273  C  CA    . ARG G 3 125 ? 15.873  90.089  78.135  1.00 124.69 ? 131  ARG C CA    1 
ATOM   7274  C  C     . ARG G 3 125 ? 14.574  90.790  77.777  1.00 124.69 ? 131  ARG C C     1 
ATOM   7275  O  O     . ARG G 3 125 ? 14.589  91.835  77.134  1.00 124.69 ? 131  ARG C O     1 
ATOM   7276  C  CB    . ARG G 3 125 ? 16.881  90.262  77.000  1.00 88.53  ? 131  ARG C CB    1 
ATOM   7277  C  CG    . ARG G 3 125 ? 18.283  90.571  77.485  1.00 88.53  ? 131  ARG C CG    1 
ATOM   7278  C  CD    . ARG G 3 125 ? 18.363  91.991  78.017  1.00 88.53  ? 131  ARG C CD    1 
ATOM   7279  N  NE    . ARG G 3 125 ? 18.837  92.054  79.400  1.00 88.53  ? 131  ARG C NE    1 
ATOM   7280  C  CZ    . ARG G 3 125 ? 18.077  91.862  80.479  1.00 88.53  ? 131  ARG C CZ    1 
ATOM   7281  N  NH1   . ARG G 3 125 ? 16.780  91.589  80.348  1.00 88.53  ? 131  ARG C NH1   1 
ATOM   7282  N  NH2   . ARG G 3 125 ? 18.612  91.954  81.697  1.00 88.53  ? 131  ARG C NH2   1 
ATOM   7283  N  N     . LEU G 3 126 ? 13.455  90.214  78.194  1.00 66.60  ? 132  LEU C N     1 
ATOM   7284  C  CA    . LEU G 3 126 ? 12.137  90.795  77.941  1.00 66.60  ? 132  LEU C CA    1 
ATOM   7285  C  C     . LEU G 3 126 ? 11.305  90.629  79.211  1.00 66.60  ? 132  LEU C C     1 
ATOM   7286  O  O     . LEU G 3 126 ? 10.413  91.439  79.503  1.00 66.60  ? 132  LEU C O     1 
ATOM   7287  C  CB    . LEU G 3 126 ? 11.435  90.066  76.792  1.00 51.74  ? 132  LEU C CB    1 
ATOM   7288  C  CG    . LEU G 3 126 ? 11.545  90.471  75.322  1.00 51.74  ? 132  LEU C CG    1 
ATOM   7289  C  CD1   . LEU G 3 126 ? 11.008  89.321  74.479  1.00 51.74  ? 132  LEU C CD1   1 
ATOM   7290  C  CD2   . LEU G 3 126 ? 10.750  91.729  75.033  1.00 51.74  ? 132  LEU C CD2   1 
ATOM   7291  N  N     . GLY G 3 127 ? 11.607  89.555  79.943  1.00 72.59  ? 133  GLY C N     1 
ATOM   7292  C  CA    . GLY G 3 127 ? 10.914  89.252  81.182  1.00 72.59  ? 133  GLY C CA    1 
ATOM   7293  C  C     . GLY G 3 127 ? 11.488  90.071  82.321  1.00 72.59  ? 133  GLY C C     1 
ATOM   7294  O  O     . GLY G 3 127 ? 10.780  90.856  82.967  1.00 72.59  ? 133  GLY C O     1 
ATOM   7295  N  N     . GLU G 3 128 ? 12.781  89.896  82.573  1.00 112.11 ? 134  GLU C N     1 
ATOM   7296  C  CA    . GLU G 3 128 ? 13.446  90.643  83.629  1.00 112.11 ? 134  GLU C CA    1 
ATOM   7297  C  C     . GLU G 3 128 ? 13.503  92.108  83.213  1.00 112.11 ? 134  GLU C C     1 
ATOM   7298  O  O     . GLU G 3 128 ? 13.631  92.994  84.052  1.00 112.11 ? 134  GLU C O     1 
ATOM   7299  C  CB    . GLU G 3 128 ? 14.859  90.105  83.855  1.00 61.57  ? 134  GLU C CB    1 
ATOM   7300  N  N     . MET G 3 129 ? 13.389  92.355  81.912  1.00 97.28  ? 135  MET C N     1 
ATOM   7301  C  CA    . MET G 3 129 ? 13.430  93.714  81.388  1.00 97.28  ? 135  MET C CA    1 
ATOM   7302  C  C     . MET G 3 129 ? 12.413  94.635  82.066  1.00 97.28  ? 135  MET C C     1 
ATOM   7303  O  O     . MET G 3 129 ? 12.510  95.858  81.965  1.00 97.28  ? 135  MET C O     1 
ATOM   7304  C  CB    . MET G 3 129 ? 13.192  93.719  79.876  1.00 101.15 ? 135  MET C CB    1 
ATOM   7305  C  CG    . MET G 3 129 ? 13.658  95.008  79.202  1.00 101.15 ? 135  MET C CG    1 
ATOM   7306  S  SD    . MET G 3 129 ? 13.269  95.120  77.447  1.00 101.15 ? 135  MET C SD    1 
ATOM   7307  C  CE    . MET G 3 129 ? 12.100  96.508  77.423  1.00 101.15 ? 135  MET C CE    1 
ATOM   7308  N  N     . LYS G 3 130 ? 11.435  94.054  82.751  1.00 103.08 ? 136  LYS C N     1 
ATOM   7309  C  CA    . LYS G 3 130 ? 10.429  94.853  83.447  1.00 103.08 ? 136  LYS C CA    1 
ATOM   7310  C  C     . LYS G 3 130 ? 11.040  95.486  84.699  1.00 103.08 ? 136  LYS C C     1 
ATOM   7311  O  O     . LYS G 3 130 ? 10.796  96.654  85.000  1.00 103.08 ? 136  LYS C O     1 
ATOM   7312  C  CB    . LYS G 3 130 ? 9.235   93.979  83.843  1.00 118.51 ? 136  LYS C CB    1 
ATOM   7313  N  N     . GLY G 3 131 ? 11.836  94.704  85.424  1.00 98.57  ? 137  GLY C N     1 
ATOM   7314  C  CA    . GLY G 3 131 ? 12.480  95.192  86.635  1.00 98.57  ? 137  GLY C CA    1 
ATOM   7315  C  C     . GLY G 3 131 ? 13.544  96.240  86.355  1.00 98.57  ? 137  GLY C C     1 
ATOM   7316  O  O     . GLY G 3 131 ? 13.891  97.034  87.228  1.00 98.57  ? 137  GLY C O     1 
ATOM   7317  N  N     . GLU G 3 132 ? 14.069  96.239  85.135  1.00 143.57 ? 138  GLU C N     1 
ATOM   7318  C  CA    . GLU G 3 132 ? 15.080  97.212  84.752  1.00 143.57 ? 138  GLU C CA    1 
ATOM   7319  C  C     . GLU G 3 132 ? 14.437  98.595  84.804  1.00 143.57 ? 138  GLU C C     1 
ATOM   7320  O  O     . GLU G 3 132 ? 15.099  99.591  85.101  1.00 143.57 ? 138  GLU C O     1 
ATOM   7321  C  CB    . GLU G 3 132 ? 15.593  96.918  83.338  1.00 110.14 ? 138  GLU C CB    1 
ATOM   7322  N  N     . TYR G 3 133 ? 13.139  98.636  84.515  1.00 92.36  ? 139  TYR C N     1 
ATOM   7323  C  CA    . TYR G 3 133 ? 12.363  99.874  84.527  1.00 92.36  ? 139  TYR C CA    1 
ATOM   7324  C  C     . TYR G 3 133 ? 11.983  100.251 85.950  1.00 92.36  ? 139  TYR C C     1 
ATOM   7325  O  O     . TYR G 3 133 ? 11.796  101.428 86.261  1.00 92.36  ? 139  TYR C O     1 
ATOM   7326  C  CB    . TYR G 3 133 ? 11.079  99.710  83.711  1.00 109.33 ? 139  TYR C CB    1 
ATOM   7327  C  CG    . TYR G 3 133 ? 10.081  100.823 83.942  1.00 109.33 ? 139  TYR C CG    1 
ATOM   7328  C  CD1   . TYR G 3 133 ? 10.225  102.059 83.308  1.00 109.33 ? 139  TYR C CD1   1 
ATOM   7329  C  CD2   . TYR G 3 133 ? 9.016   100.656 84.829  1.00 109.33 ? 139  TYR C CD2   1 
ATOM   7330  C  CE1   . TYR G 3 133 ? 9.334   103.103 83.551  1.00 109.33 ? 139  TYR C CE1   1 
ATOM   7331  C  CE2   . TYR G 3 133 ? 8.124   101.693 85.082  1.00 109.33 ? 139  TYR C CE2   1 
ATOM   7332  C  CZ    . TYR G 3 133 ? 8.290   102.912 84.439  1.00 109.33 ? 139  TYR C CZ    1 
ATOM   7333  O  OH    . TYR G 3 133 ? 7.414   103.938 84.684  1.00 109.33 ? 139  TYR C OH    1 
ATOM   7334  N  N     . LYS G 3 134 ? 11.851  99.245  86.808  1.00 84.12  ? 140  LYS C N     1 
ATOM   7335  C  CA    . LYS G 3 134 ? 11.482  99.494  88.189  1.00 84.12  ? 140  LYS C CA    1 
ATOM   7336  C  C     . LYS G 3 134 ? 12.553  100.279 88.923  1.00 84.12  ? 140  LYS C C     1 
ATOM   7337  O  O     . LYS G 3 134 ? 12.298  101.383 89.417  1.00 84.12  ? 140  LYS C O     1 
ATOM   7338  C  CB    . LYS G 3 134 ? 11.225  98.185  88.931  1.00 66.55  ? 140  LYS C CB    1 
ATOM   7339  C  CG    . LYS G 3 134 ? 11.185  98.379  90.442  1.00 66.55  ? 140  LYS C CG    1 
ATOM   7340  C  CD    . LYS G 3 134 ? 10.472  97.249  91.117  1.00 66.55  ? 140  LYS C CD    1 
ATOM   7341  C  CE    . LYS G 3 134 ? 10.342  97.495  92.590  1.00 66.55  ? 140  LYS C CE    1 
ATOM   7342  N  NZ    . LYS G 3 134 ? 9.457   96.446  93.148  1.00 66.55  ? 140  LYS C NZ    1 
ATOM   7343  N  N     . ASP G 3 135 ? 13.747  99.701  89.001  1.00 107.74 ? 141  ASP C N     1 
ATOM   7344  C  CA    . ASP G 3 135 ? 14.844  100.358 89.685  1.00 107.74 ? 141  ASP C CA    1 
ATOM   7345  C  C     . ASP G 3 135 ? 15.307  101.618 88.962  1.00 107.74 ? 141  ASP C C     1 
ATOM   7346  O  O     . ASP G 3 135 ? 15.814  102.546 89.589  1.00 107.74 ? 141  ASP C O     1 
ATOM   7347  C  CB    . ASP G 3 135 ? 15.980  99.367  89.912  1.00 131.15 ? 141  ASP C CB    1 
ATOM   7348  C  CG    . ASP G 3 135 ? 15.710  98.459  91.104  1.00 131.15 ? 141  ASP C CG    1 
ATOM   7349  O  OD1   . ASP G 3 135 ? 15.704  98.971  92.246  1.00 131.15 ? 141  ASP C OD1   1 
ATOM   7350  O  OD2   . ASP G 3 135 ? 15.489  97.244  90.908  1.00 131.15 ? 141  ASP C OD2   1 
ATOM   7351  N  N     . ASP G 3 136 ? 15.102  101.660 87.649  1.00 119.17 ? 142  ASP C N     1 
ATOM   7352  C  CA    . ASP G 3 136 ? 15.446  102.829 86.841  1.00 119.17 ? 142  ASP C CA    1 
ATOM   7353  C  C     . ASP G 3 136 ? 14.596  104.005 87.336  1.00 119.17 ? 142  ASP C C     1 
ATOM   7354  O  O     . ASP G 3 136 ? 15.042  105.152 87.344  1.00 119.17 ? 142  ASP C O     1 
ATOM   7355  C  CB    . ASP G 3 136 ? 15.117  102.550 85.368  1.00 104.10 ? 142  ASP C CB    1 
ATOM   7356  C  CG    . ASP G 3 136 ? 15.244  103.787 84.484  1.00 104.10 ? 142  ASP C CG    1 
ATOM   7357  O  OD1   . ASP G 3 136 ? 16.313  103.972 83.862  1.00 104.10 ? 142  ASP C OD1   1 
ATOM   7358  O  OD2   . ASP G 3 136 ? 14.277  104.579 84.411  1.00 104.10 ? 142  ASP C OD2   1 
ATOM   7359  N  N     . PHE G 3 137 ? 13.362  103.701 87.738  1.00 93.44  ? 143  PHE C N     1 
ATOM   7360  C  CA    . PHE G 3 137 ? 12.429  104.710 88.232  1.00 93.44  ? 143  PHE C CA    1 
ATOM   7361  C  C     . PHE G 3 137 ? 12.574  104.821 89.727  1.00 93.44  ? 143  PHE C C     1 
ATOM   7362  O  O     . PHE G 3 137 ? 12.579  105.915 90.279  1.00 93.44  ? 143  PHE C O     1 
ATOM   7363  C  CB    . PHE G 3 137 ? 10.979  104.341 87.904  1.00 48.23  ? 143  PHE C CB    1 
ATOM   7364  N  N     . LYS G 3 138 ? 12.686  103.673 90.379  1.00 66.21  ? 144  LYS C N     1 
ATOM   7365  C  CA    . LYS G 3 138 ? 12.834  103.629 91.814  1.00 66.21  ? 144  LYS C CA    1 
ATOM   7366  C  C     . LYS G 3 138 ? 14.020  104.525 92.167  1.00 66.21  ? 144  LYS C C     1 
ATOM   7367  O  O     . LYS G 3 138 ? 13.875  105.491 92.917  1.00 66.21  ? 144  LYS C O     1 
ATOM   7368  C  CB    . LYS G 3 138 ? 13.075  102.181 92.247  1.00 62.82  ? 144  LYS C CB    1 
ATOM   7369  C  CG    . LYS G 3 138 ? 12.647  101.827 93.662  1.00 62.82  ? 144  LYS C CG    1 
ATOM   7370  C  CD    . LYS G 3 138 ? 12.771  100.307 93.880  1.00 62.82  ? 144  LYS C CD    1 
ATOM   7371  C  CE    . LYS G 3 138 ? 12.457  99.855  95.321  1.00 62.82  ? 144  LYS C CE    1 
ATOM   7372  N  NZ    . LYS G 3 138 ? 12.592  98.375  95.512  1.00 62.82  ? 144  LYS C NZ    1 
ATOM   7373  N  N     . ARG G 3 139 ? 15.190  104.235 91.609  1.00 108.49 ? 145  ARG C N     1 
ATOM   7374  C  CA    . ARG G 3 139 ? 16.366  105.050 91.904  1.00 108.49 ? 145  ARG C CA    1 
ATOM   7375  C  C     . ARG G 3 139 ? 16.125  106.535 91.621  1.00 108.49 ? 145  ARG C C     1 
ATOM   7376  O  O     . ARG G 3 139 ? 16.184  107.356 92.536  1.00 108.49 ? 145  ARG C O     1 
ATOM   7377  C  CB    . ARG G 3 139 ? 17.580  104.546 91.121  1.00 106.68 ? 145  ARG C CB    1 
ATOM   7378  C  CG    . ARG G 3 139 ? 18.121  103.205 91.617  1.00 106.68 ? 145  ARG C CG    1 
ATOM   7379  C  CD    . ARG G 3 139 ? 19.330  102.786 90.800  1.00 106.68 ? 145  ARG C CD    1 
ATOM   7380  N  NE    . ARG G 3 139 ? 20.346  103.836 90.789  1.00 106.68 ? 145  ARG C NE    1 
ATOM   7381  C  CZ    . ARG G 3 139 ? 21.319  103.927 89.889  1.00 106.68 ? 145  ARG C CZ    1 
ATOM   7382  N  NH1   . ARG G 3 139 ? 21.408  103.028 88.921  1.00 106.68 ? 145  ARG C NH1   1 
ATOM   7383  N  NH2   . ARG G 3 139 ? 22.198  104.917 89.951  1.00 106.68 ? 145  ARG C NH2   1 
ATOM   7384  N  N     . MET G 3 140 ? 15.832  106.872 90.368  1.00 115.77 ? 146  MET C N     1 
ATOM   7385  C  CA    . MET G 3 140 ? 15.588  108.259 89.973  1.00 115.77 ? 146  MET C CA    1 
ATOM   7386  C  C     . MET G 3 140 ? 14.567  108.994 90.849  1.00 115.77 ? 146  MET C C     1 
ATOM   7387  O  O     . MET G 3 140 ? 14.235  110.153 90.590  1.00 115.77 ? 146  MET C O     1 
ATOM   7388  C  CB    . MET G 3 140 ? 15.141  108.311 88.507  1.00 78.08  ? 146  MET C CB    1 
ATOM   7389  N  N     . LEU G 3 141 ? 14.070  108.323 91.882  1.00 173.79 ? 147  LEU C N     1 
ATOM   7390  C  CA    . LEU G 3 141 ? 13.101  108.923 92.791  1.00 173.79 ? 147  LEU C CA    1 
ATOM   7391  C  C     . LEU G 3 141 ? 13.354  108.465 94.230  1.00 173.79 ? 147  LEU C C     1 
ATOM   7392  O  O     . LEU G 3 141 ? 12.836  109.059 95.175  1.00 173.79 ? 147  LEU C O     1 
ATOM   7393  C  CB    . LEU G 3 141 ? 11.670  108.555 92.358  1.00 72.76  ? 147  LEU C CB    1 
ATOM   7394  N  N     . GLU G 3 142 ? 14.160  107.417 94.390  1.00 84.31  ? 148  GLU C N     1 
ATOM   7395  C  CA    . GLU G 3 142 ? 14.476  106.881 95.713  1.00 84.31  ? 148  GLU C CA    1 
ATOM   7396  C  C     . GLU G 3 142 ? 15.639  107.669 96.307  1.00 84.31  ? 148  GLU C C     1 
ATOM   7397  O  O     . GLU G 3 142 ? 16.184  107.320 97.367  1.00 84.31  ? 148  GLU C O     1 
ATOM   7398  C  CB    . GLU G 3 142 ? 14.832  105.393 95.623  1.00 93.79  ? 148  GLU C CB    1 
ATOM   7399  N  N     . GLU G 3 143 ? 16.008  108.737 95.603  1.00 122.29 ? 149  GLU C N     1 
ATOM   7400  C  CA    . GLU G 3 143 ? 17.078  109.632 96.023  1.00 122.29 ? 149  GLU C CA    1 
ATOM   7401  C  C     . GLU G 3 143 ? 16.494  111.013 96.301  1.00 122.29 ? 149  GLU C C     1 
ATOM   7402  O  O     . GLU G 3 143 ? 17.008  111.753 97.140  1.00 122.29 ? 149  GLU C O     1 
ATOM   7403  C  CB    . GLU G 3 143 ? 18.153  109.755 94.934  1.00 105.94 ? 149  GLU C CB    1 
ATOM   7404  C  CG    . GLU G 3 143 ? 19.307  108.767 95.050  1.00 105.94 ? 149  GLU C CG    1 
ATOM   7405  C  CD    . GLU G 3 143 ? 18.959  107.381 94.550  1.00 105.94 ? 149  GLU C CD    1 
ATOM   7406  O  OE1   . GLU G 3 143 ? 18.734  107.229 93.332  1.00 105.94 ? 149  GLU C OE1   1 
ATOM   7407  O  OE2   . GLU G 3 143 ? 18.913  106.441 95.370  1.00 105.94 ? 149  GLU C OE2   1 
ATOM   7408  N  N     . GLN G 3 144 ? 15.415  111.348 95.595  1.00 91.13  ? 150  GLN C N     1 
ATOM   7409  C  CA    . GLN G 3 144 ? 14.754  112.649 95.742  1.00 91.13  ? 150  GLN C CA    1 
ATOM   7410  C  C     . GLN G 3 144 ? 13.745  112.664 96.889  1.00 91.13  ? 150  GLN C C     1 
ATOM   7411  O  O     . GLN G 3 144 ? 12.650  113.224 96.763  1.00 91.13  ? 150  GLN C O     1 
ATOM   7412  C  CB    . GLN G 3 144 ? 14.042  113.047 94.435  1.00 75.04  ? 150  GLN C CB    1 
ATOM   7413  C  CG    . GLN G 3 144 ? 14.908  113.013 93.163  1.00 75.04  ? 150  GLN C CG    1 
ATOM   7414  C  CD    . GLN G 3 144 ? 16.355  112.667 93.444  1.00 75.04  ? 150  GLN C CD    1 
ATOM   7415  O  OE1   . GLN G 3 144 ? 17.034  113.358 94.198  1.00 75.04  ? 150  GLN C OE1   1 
ATOM   7416  N  NE2   . GLN G 3 144 ? 16.832  111.588 92.841  1.00 75.04  ? 150  GLN C NE2   1 
ATOM   7417  N  N     . GLY G 3 145 ? 14.123  112.045 98.004  1.00 197.76 ? 151  GLY C N     1 
ATOM   7418  C  CA    . GLY G 3 145 ? 13.257  112.001 99.170  1.00 197.76 ? 151  GLY C CA    1 
ATOM   7419  C  C     . GLY G 3 145 ? 12.026  111.130 99.000  1.00 197.76 ? 151  GLY C C     1 
ATOM   7420  O  O     . GLY G 3 145 ? 11.638  110.413 99.926  1.00 197.76 ? 151  GLY C O     1 
ATOM   7421  N  N     . GLU G 3 146 ? 11.414  111.192 97.818  1.00 110.52 ? 152  GLU C N     1 
ATOM   7422  C  CA    . GLU G 3 146 ? 10.215  110.414 97.520  1.00 110.52 ? 152  GLU C CA    1 
ATOM   7423  C  C     . GLU G 3 146 ? 10.437  108.928 97.776  1.00 110.52 ? 152  GLU C C     1 
ATOM   7424  O  O     . GLU G 3 146 ? 11.120  108.259 97.003  1.00 110.52 ? 152  GLU C O     1 
ATOM   7425  C  CB    . GLU G 3 146 ? 9.801   110.588 96.050  1.00 80.52  ? 152  GLU C CB    1 
ATOM   7426  C  CG    . GLU G 3 146 ? 9.838   112.019 95.501  1.00 80.52  ? 152  GLU C CG    1 
ATOM   7427  C  CD    . GLU G 3 146 ? 8.914   112.209 94.292  1.00 80.52  ? 152  GLU C CD    1 
ATOM   7428  O  OE1   . GLU G 3 146 ? 9.149   113.154 93.509  1.00 80.52  ? 152  GLU C OE1   1 
ATOM   7429  O  OE2   . GLU G 3 146 ? 7.947   111.427 94.130  1.00 80.52  ? 152  GLU C OE2   1 
ATOM   7430  N  N     . GLU G 3 147 ? 9.862   108.411 98.856  1.00 153.94 ? 153  GLU C N     1 
ATOM   7431  C  CA    . GLU G 3 147 ? 10.003  106.994 99.170  1.00 153.94 ? 153  GLU C CA    1 
ATOM   7432  C  C     . GLU G 3 147 ? 9.205   106.186 98.152  1.00 153.94 ? 153  GLU C C     1 
ATOM   7433  O  O     . GLU G 3 147 ? 8.052   106.500 97.847  1.00 153.94 ? 153  GLU C O     1 
ATOM   7434  C  CB    . GLU G 3 147 ? 9.497   106.695 100.588 1.00 115.92 ? 153  GLU C CB    1 
ATOM   7435  N  N     . TYR G 3 148 ? 9.840   105.157 97.611  1.00 116.98 ? 154  TYR C N     1 
ATOM   7436  C  CA    . TYR G 3 148 ? 9.195   104.298 96.638  1.00 116.98 ? 154  TYR C CA    1 
ATOM   7437  C  C     . TYR G 3 148 ? 7.939   103.741 97.290  1.00 116.98 ? 154  TYR C C     1 
ATOM   7438  O  O     . TYR G 3 148 ? 7.964   103.334 98.458  1.00 116.98 ? 154  TYR C O     1 
ATOM   7439  C  CB    . TYR G 3 148 ? 10.146  103.156 96.245  1.00 74.69  ? 154  TYR C CB    1 
ATOM   7440  C  CG    . TYR G 3 148 ? 9.518   102.087 95.374  1.00 74.69  ? 154  TYR C CG    1 
ATOM   7441  C  CD1   . TYR G 3 148 ? 9.075   102.381 94.085  1.00 74.69  ? 154  TYR C CD1   1 
ATOM   7442  C  CD2   . TYR G 3 148 ? 9.352   100.786 95.849  1.00 74.69  ? 154  TYR C CD2   1 
ATOM   7443  C  CE1   . TYR G 3 148 ? 8.485   101.417 93.298  1.00 74.69  ? 154  TYR C CE1   1 
ATOM   7444  C  CE2   . TYR G 3 148 ? 8.761   99.810  95.066  1.00 74.69  ? 154  TYR C CE2   1 
ATOM   7445  C  CZ    . TYR G 3 148 ? 8.330   100.132 93.792  1.00 74.69  ? 154  TYR C CZ    1 
ATOM   7446  O  OH    . TYR G 3 148 ? 7.747   99.166  93.008  1.00 74.69  ? 154  TYR C OH    1 
ATOM   7447  N  N     . VAL G 3 149 ? 6.838   103.740 96.544  1.00 91.77  ? 155  VAL C N     1 
ATOM   7448  C  CA    . VAL G 3 149 ? 5.591   103.203 97.071  1.00 91.77  ? 155  VAL C CA    1 
ATOM   7449  C  C     . VAL G 3 149 ? 5.247   101.901 96.347  1.00 91.77  ? 155  VAL C C     1 
ATOM   7450  O  O     . VAL G 3 149 ? 5.275   101.837 95.123  1.00 91.77  ? 155  VAL C O     1 
ATOM   7451  C  CB    . VAL G 3 149 ? 4.440   104.229 96.938  1.00 75.30  ? 155  VAL C CB    1 
ATOM   7452  C  CG1   . VAL G 3 149 ? 3.186   103.696 97.603  1.00 75.30  ? 155  VAL C CG1   1 
ATOM   7453  C  CG2   . VAL G 3 149 ? 4.847   105.545 97.585  1.00 75.30  ? 155  VAL C CG2   1 
ATOM   7454  N  N     . ASP G 3 150 ? 4.956   100.866 97.129  1.00 121.86 ? 156  ASP C N     1 
ATOM   7455  C  CA    . ASP G 3 150 ? 4.606   99.541  96.619  1.00 121.86 ? 156  ASP C CA    1 
ATOM   7456  C  C     . ASP G 3 150 ? 4.980   99.306  95.163  1.00 121.86 ? 156  ASP C C     1 
ATOM   7457  O  O     . ASP G 3 150 ? 5.989   98.667  94.876  1.00 121.86 ? 156  ASP C O     1 
ATOM   7458  C  CB    . ASP G 3 150 ? 3.108   99.284  96.795  1.00 122.18 ? 156  ASP C CB    1 
ATOM   7459  N  N     . GLY G 3 151 ? 4.154   99.816  94.252  1.00 77.55  ? 157  GLY C N     1 
ATOM   7460  C  CA    . GLY G 3 151 ? 4.414   99.645  92.833  1.00 77.55  ? 157  GLY C CA    1 
ATOM   7461  C  C     . GLY G 3 151 ? 3.990   100.845 91.998  1.00 77.55  ? 157  GLY C C     1 
ATOM   7462  O  O     . GLY G 3 151 ? 3.452   100.710 90.893  1.00 77.55  ? 157  GLY C O     1 
ATOM   7463  N  N     . MET G 3 152 ? 4.251   102.033 92.523  1.00 70.58  ? 158  MET C N     1 
ATOM   7464  C  CA    . MET G 3 152 ? 3.883   103.259 91.839  1.00 70.58  ? 158  MET C CA    1 
ATOM   7465  C  C     . MET G 3 152 ? 4.610   103.488 90.516  1.00 70.58  ? 158  MET C C     1 
ATOM   7466  O  O     . MET G 3 152 ? 4.365   104.489 89.841  1.00 70.58  ? 158  MET C O     1 
ATOM   7467  C  CB    . MET G 3 152 ? 4.105   104.449 92.778  1.00 98.67  ? 158  MET C CB    1 
ATOM   7468  C  CG    . MET G 3 152 ? 5.475   104.478 93.433  1.00 98.67  ? 158  MET C CG    1 
ATOM   7469  S  SD    . MET G 3 152 ? 5.690   105.925 94.461  1.00 98.67  ? 158  MET C SD    1 
ATOM   7470  C  CE    . MET G 3 152 ? 5.678   107.218 93.206  1.00 98.67  ? 158  MET C CE    1 
ATOM   7471  N  N     . GLU G 3 153 ? 5.496   102.572 90.134  1.00 80.21  ? 159  GLU C N     1 
ATOM   7472  C  CA    . GLU G 3 153 ? 6.227   102.747 88.887  1.00 80.21  ? 159  GLU C CA    1 
ATOM   7473  C  C     . GLU G 3 153 ? 5.305   102.581 87.703  1.00 80.21  ? 159  GLU C C     1 
ATOM   7474  O  O     . GLU G 3 153 ? 5.723   102.779 86.561  1.00 80.21  ? 159  GLU C O     1 
ATOM   7475  C  CB    . GLU G 3 153 ? 7.367   101.744 88.751  1.00 73.32  ? 159  GLU C CB    1 
ATOM   7476  C  CG    . GLU G 3 153 ? 6.945   100.315 88.899  1.00 73.32  ? 159  GLU C CG    1 
ATOM   7477  C  CD    . GLU G 3 153 ? 7.061   99.858  90.323  1.00 73.32  ? 159  GLU C CD    1 
ATOM   7478  O  OE1   . GLU G 3 153 ? 6.766   100.673 91.213  1.00 73.32  ? 159  GLU C OE1   1 
ATOM   7479  O  OE2   . GLU G 3 153 ? 7.440   98.692  90.561  1.00 73.32  ? 159  GLU C OE2   1 
ATOM   7480  N  N     . TRP G 3 154 ? 4.051   102.227 87.975  1.00 87.99  ? 160  TRP C N     1 
ATOM   7481  C  CA    . TRP G 3 154 ? 3.064   102.011 86.914  1.00 87.99  ? 160  TRP C CA    1 
ATOM   7482  C  C     . TRP G 3 154 ? 1.803   102.853 87.020  1.00 87.99  ? 160  TRP C C     1 
ATOM   7483  O  O     . TRP G 3 154 ? 0.956   102.815 86.122  1.00 87.99  ? 160  TRP C O     1 
ATOM   7484  C  CB    . TRP G 3 154 ? 2.618   100.543 86.884  1.00 62.57  ? 160  TRP C CB    1 
ATOM   7485  C  CG    . TRP G 3 154 ? 3.714   99.567  86.599  1.00 62.57  ? 160  TRP C CG    1 
ATOM   7486  C  CD1   . TRP G 3 154 ? 4.389   98.800  87.500  1.00 62.57  ? 160  TRP C CD1   1 
ATOM   7487  C  CD2   . TRP G 3 154 ? 4.316   99.322  85.332  1.00 62.57  ? 160  TRP C CD2   1 
ATOM   7488  N  NE1   . TRP G 3 154 ? 5.382   98.098  86.870  1.00 62.57  ? 160  TRP C NE1   1 
ATOM   7489  C  CE2   . TRP G 3 154 ? 5.358   98.405  85.537  1.00 62.57  ? 160  TRP C CE2   1 
ATOM   7490  C  CE3   . TRP G 3 154 ? 4.075   99.795  84.039  1.00 62.57  ? 160  TRP C CE3   1 
ATOM   7491  C  CZ2   . TRP G 3 154 ? 6.163   97.953  84.502  1.00 62.57  ? 160  TRP C CZ2   1 
ATOM   7492  C  CZ3   . TRP G 3 154 ? 4.873   99.345  83.009  1.00 62.57  ? 160  TRP C CZ3   1 
ATOM   7493  C  CH2   . TRP G 3 154 ? 5.907   98.434  83.247  1.00 62.57  ? 160  TRP C CH2   1 
ATOM   7494  N  N     . TRP G 3 155 ? 1.651   103.587 88.117  1.00 72.34  ? 161  TRP C N     1 
ATOM   7495  C  CA    . TRP G 3 155 ? 0.449   104.385 88.275  1.00 72.34  ? 161  TRP C CA    1 
ATOM   7496  C  C     . TRP G 3 155 ? 0.325   105.420 87.174  1.00 72.34  ? 161  TRP C C     1 
ATOM   7497  O  O     . TRP G 3 155 ? -0.734  105.536 86.562  1.00 72.34  ? 161  TRP C O     1 
ATOM   7498  C  CB    . TRP G 3 155 ? 0.406   105.076 89.636  1.00 52.20  ? 161  TRP C CB    1 
ATOM   7499  C  CG    . TRP G 3 155 ? 0.355   104.134 90.816  1.00 52.20  ? 161  TRP C CG    1 
ATOM   7500  C  CD1   . TRP G 3 155 ? 0.016   102.813 90.804  1.00 52.20  ? 161  TRP C CD1   1 
ATOM   7501  C  CD2   . TRP G 3 155 ? 0.656   104.456 92.182  1.00 52.20  ? 161  TRP C CD2   1 
ATOM   7502  N  NE1   . TRP G 3 155 ? 0.092   102.293 92.074  1.00 52.20  ? 161  TRP C NE1   1 
ATOM   7503  C  CE2   . TRP G 3 155 ? 0.482   103.281 92.937  1.00 52.20  ? 161  TRP C CE2   1 
ATOM   7504  C  CE3   . TRP G 3 155 ? 1.060   105.628 92.837  1.00 52.20  ? 161  TRP C CE3   1 
ATOM   7505  C  CZ2   . TRP G 3 155 ? 0.699   103.240 94.310  1.00 52.20  ? 161  TRP C CZ2   1 
ATOM   7506  C  CZ3   . TRP G 3 155 ? 1.277   105.588 94.204  1.00 52.20  ? 161  TRP C CZ3   1 
ATOM   7507  C  CH2   . TRP G 3 155 ? 1.096   104.402 94.926  1.00 52.20  ? 161  TRP C CH2   1 
ATOM   7508  N  N     . ASN G 3 156 ? 1.403   106.154 86.904  1.00 81.36  ? 162  ASN C N     1 
ATOM   7509  C  CA    . ASN G 3 156 ? 1.369   107.187 85.872  1.00 81.36  ? 162  ASN C CA    1 
ATOM   7510  C  C     . ASN G 3 156 ? 2.429   107.087 84.786  1.00 81.36  ? 162  ASN C C     1 
ATOM   7511  O  O     . ASN G 3 156 ? 3.592   106.762 85.049  1.00 81.36  ? 162  ASN C O     1 
ATOM   7512  C  CB    . ASN G 3 156 ? 1.463   108.580 86.508  1.00 80.09  ? 162  ASN C CB    1 
ATOM   7513  C  CG    . ASN G 3 156 ? 0.197   108.982 87.238  1.00 80.09  ? 162  ASN C CG    1 
ATOM   7514  O  OD1   . ASN G 3 156 ? -0.896  109.021 86.656  1.00 80.09  ? 162  ASN C OD1   1 
ATOM   7515  N  ND2   . ASN G 3 156 ? 0.338   109.294 88.520  1.00 80.09  ? 162  ASN C ND2   1 
ATOM   7516  N  N     . PHE G 3 157 ? 1.994   107.404 83.568  1.00 91.42  ? 163  PHE C N     1 
ATOM   7517  C  CA    . PHE G 3 157 ? 2.828   107.407 82.372  1.00 91.42  ? 163  PHE C CA    1 
ATOM   7518  C  C     . PHE G 3 157 ? 3.928   108.446 82.486  1.00 91.42  ? 163  PHE C C     1 
ATOM   7519  O  O     . PHE G 3 157 ? 3.801   109.415 83.231  1.00 91.42  ? 163  PHE C O     1 
ATOM   7520  C  CB    . PHE G 3 157 ? 1.961   107.719 81.142  1.00 97.60  ? 163  PHE C CB    1 
ATOM   7521  C  CG    . PHE G 3 157 ? 2.736   108.252 79.966  1.00 97.60  ? 163  PHE C CG    1 
ATOM   7522  C  CD1   . PHE G 3 157 ? 3.730   107.490 79.360  1.00 97.60  ? 163  PHE C CD1   1 
ATOM   7523  C  CD2   . PHE G 3 157 ? 2.487   109.526 79.480  1.00 97.60  ? 163  PHE C CD2   1 
ATOM   7524  C  CE1   . PHE G 3 157 ? 4.464   107.992 78.290  1.00 97.60  ? 163  PHE C CE1   1 
ATOM   7525  C  CE2   . PHE G 3 157 ? 3.217   110.034 78.409  1.00 97.60  ? 163  PHE C CE2   1 
ATOM   7526  C  CZ    . PHE G 3 157 ? 4.207   109.264 77.814  1.00 97.60  ? 163  PHE C CZ    1 
ATOM   7527  N  N     . ASN G 3 158 ? 5.011   108.242 81.751  1.00 73.00  ? 164  ASN C N     1 
ATOM   7528  C  CA    . ASN G 3 158 ? 6.097   109.197 81.761  1.00 73.00  ? 164  ASN C CA    1 
ATOM   7529  C  C     . ASN G 3 158 ? 7.083   108.848 80.668  1.00 73.00  ? 164  ASN C C     1 
ATOM   7530  O  O     . ASN G 3 158 ? 6.880   107.869 79.953  1.00 73.00  ? 164  ASN C O     1 
ATOM   7531  C  CB    . ASN G 3 158 ? 6.768   109.234 83.136  1.00 71.58  ? 164  ASN C CB    1 
ATOM   7532  C  CG    . ASN G 3 158 ? 7.388   107.932 83.513  1.00 71.58  ? 164  ASN C CG    1 
ATOM   7533  O  OD1   . ASN G 3 158 ? 8.295   107.451 82.834  1.00 71.58  ? 164  ASN C OD1   1 
ATOM   7534  N  ND2   . ASN G 3 158 ? 6.915   107.348 84.608  1.00 71.58  ? 164  ASN C ND2   1 
ATOM   7535  N  N     . GLU G 3 159 ? 8.134   109.654 80.531  1.00 135.56 ? 165  GLU C N     1 
ATOM   7536  C  CA    . GLU G 3 159 ? 9.137   109.443 79.494  1.00 135.56 ? 165  GLU C CA    1 
ATOM   7537  C  C     . GLU G 3 159 ? 9.927   108.151 79.659  1.00 135.56 ? 165  GLU C C     1 
ATOM   7538  O  O     . GLU G 3 159 ? 10.050  107.376 78.709  1.00 135.56 ? 165  GLU C O     1 
ATOM   7539  C  CB    . GLU G 3 159 ? 10.093  110.638 79.441  1.00 86.45  ? 165  GLU C CB    1 
ATOM   7540  N  N     . GLU G 3 160 ? 10.467  107.914 80.851  1.00 88.77  ? 166  GLU C N     1 
ATOM   7541  C  CA    . GLU G 3 160 ? 11.228  106.687 81.073  1.00 88.77  ? 166  GLU C CA    1 
ATOM   7542  C  C     . GLU G 3 160 ? 10.423  105.542 80.480  1.00 88.77  ? 166  GLU C C     1 
ATOM   7543  O  O     . GLU G 3 160 ? 10.906  104.795 79.624  1.00 88.77  ? 166  GLU C O     1 
ATOM   7544  C  CB    . GLU G 3 160 ? 11.443  106.423 82.569  1.00 66.71  ? 166  GLU C CB    1 
ATOM   7545  N  N     . MET G 3 161 ? 9.179   105.432 80.938  1.00 79.51  ? 167  MET C N     1 
ATOM   7546  C  CA    . MET G 3 161 ? 8.253   104.398 80.489  1.00 79.51  ? 167  MET C CA    1 
ATOM   7547  C  C     . MET G 3 161 ? 8.041   104.443 78.978  1.00 79.51  ? 167  MET C C     1 
ATOM   7548  O  O     . MET G 3 161 ? 7.950   103.403 78.333  1.00 79.51  ? 167  MET C O     1 
ATOM   7549  C  CB    . MET G 3 161 ? 6.912   104.560 81.204  1.00 80.14  ? 167  MET C CB    1 
ATOM   7550  C  CG    . MET G 3 161 ? 5.858   103.550 80.805  1.00 80.14  ? 167  MET C CG    1 
ATOM   7551  S  SD    . MET G 3 161 ? 4.230   103.934 81.491  1.00 80.14  ? 167  MET C SD    1 
ATOM   7552  C  CE    . MET G 3 161 ? 4.457   103.416 83.214  1.00 80.14  ? 167  MET C CE    1 
ATOM   7553  N  N     . MET G 3 162 ? 7.951   105.645 78.420  1.00 71.25  ? 168  MET C N     1 
ATOM   7554  C  CA    . MET G 3 162 ? 7.769   105.805 76.984  1.00 71.25  ? 168  MET C CA    1 
ATOM   7555  C  C     . MET G 3 162 ? 8.989   105.256 76.268  1.00 71.25  ? 168  MET C C     1 
ATOM   7556  O  O     . MET G 3 162 ? 8.893   104.820 75.127  1.00 71.25  ? 168  MET C O     1 
ATOM   7557  C  CB    . MET G 3 162 ? 7.615   107.276 76.626  1.00 99.18  ? 168  MET C CB    1 
ATOM   7558  C  CG    . MET G 3 162 ? 7.396   107.524 75.156  1.00 99.18  ? 168  MET C CG    1 
ATOM   7559  S  SD    . MET G 3 162 ? 5.765   106.994 74.639  1.00 99.18  ? 168  MET C SD    1 
ATOM   7560  C  CE    . MET G 3 162 ? 6.105   105.328 74.176  1.00 99.18  ? 168  MET C CE    1 
ATOM   7561  N  N     . ASP G 3 163 ? 10.135  105.295 76.949  1.00 116.48 ? 169  ASP C N     1 
ATOM   7562  C  CA    . ASP G 3 163 ? 11.404  104.801 76.407  1.00 116.48 ? 169  ASP C CA    1 
ATOM   7563  C  C     . ASP G 3 163 ? 11.431  103.274 76.451  1.00 116.48 ? 169  ASP C C     1 
ATOM   7564  O  O     . ASP G 3 163 ? 11.528  102.608 75.417  1.00 116.48 ? 169  ASP C O     1 
ATOM   7565  C  CB    . ASP G 3 163 ? 12.579  105.368 77.221  1.00 108.16 ? 169  ASP C CB    1 
ATOM   7566  C  CG    . ASP G 3 163 ? 13.414  106.376 76.436  1.00 108.16 ? 169  ASP C CG    1 
ATOM   7567  O  OD1   . ASP G 3 163 ? 12.822  107.275 75.803  1.00 108.16 ? 169  ASP C OD1   1 
ATOM   7568  O  OD2   . ASP G 3 163 ? 14.664  106.276 76.463  1.00 108.16 ? 169  ASP C OD2   1 
ATOM   7569  N  N     . TYR G 3 164 ? 11.362  102.724 77.659  1.00 77.00  ? 170  TYR C N     1 
ATOM   7570  C  CA    . TYR G 3 164 ? 11.340  101.277 77.826  1.00 77.00  ? 170  TYR C CA    1 
ATOM   7571  C  C     . TYR G 3 164 ? 10.281  100.667 76.897  1.00 77.00  ? 170  TYR C C     1 
ATOM   7572  O  O     . TYR G 3 164 ? 10.372  99.503  76.511  1.00 77.00  ? 170  TYR C O     1 
ATOM   7573  C  CB    . TYR G 3 164 ? 10.997  100.931 79.265  1.00 88.04  ? 170  TYR C CB    1 
ATOM   7574  C  CG    . TYR G 3 164 ? 12.182  100.634 80.139  1.00 88.04  ? 170  TYR C CG    1 
ATOM   7575  C  CD1   . TYR G 3 164 ? 12.442  99.330  80.564  1.00 88.04  ? 170  TYR C CD1   1 
ATOM   7576  C  CD2   . TYR G 3 164 ? 13.025  101.650 80.575  1.00 88.04  ? 170  TYR C CD2   1 
ATOM   7577  C  CE1   . TYR G 3 164 ? 13.510  99.042  81.406  1.00 88.04  ? 170  TYR C CE1   1 
ATOM   7578  C  CE2   . TYR G 3 164 ? 14.102  101.370 81.421  1.00 88.04  ? 170  TYR C CE2   1 
ATOM   7579  C  CZ    . TYR G 3 164 ? 14.335  100.063 81.829  1.00 88.04  ? 170  TYR C CZ    1 
ATOM   7580  O  OH    . TYR G 3 164 ? 15.397  99.772  82.646  1.00 88.04  ? 170  TYR C OH    1 
ATOM   7581  N  N     . ASN G 3 165 ? 9.267   101.456 76.555  1.00 69.14  ? 171  ASN C N     1 
ATOM   7582  C  CA    . ASN G 3 165 ? 8.218   100.985 75.669  1.00 69.14  ? 171  ASN C CA    1 
ATOM   7583  C  C     . ASN G 3 165 ? 8.923   100.719 74.360  1.00 69.14  ? 171  ASN C C     1 
ATOM   7584  O  O     . ASN G 3 165 ? 9.102   99.571  73.980  1.00 69.14  ? 171  ASN C O     1 
ATOM   7585  C  CB    . ASN G 3 165 ? 7.130   102.057 75.467  1.00 85.40  ? 171  ASN C CB    1 
ATOM   7586  C  CG    . ASN G 3 165 ? 5.871   101.520 74.756  1.00 85.40  ? 171  ASN C CG    1 
ATOM   7587  O  OD1   . ASN G 3 165 ? 4.985   102.287 74.350  1.00 85.40  ? 171  ASN C OD1   1 
ATOM   7588  N  ND2   . ASN G 3 165 ? 5.790   100.205 74.616  1.00 85.40  ? 171  ASN C ND2   1 
ATOM   7589  N  N     . VAL G 3 166 ? 9.354   101.790 73.699  1.00 85.88  ? 172  VAL C N     1 
ATOM   7590  C  CA    . VAL G 3 166 ? 10.039  101.703 72.410  1.00 85.88  ? 172  VAL C CA    1 
ATOM   7591  C  C     . VAL G 3 166 ? 11.118  100.619 72.331  1.00 85.88  ? 172  VAL C C     1 
ATOM   7592  O  O     . VAL G 3 166 ? 11.301  100.008 71.276  1.00 85.88  ? 172  VAL C O     1 
ATOM   7593  C  CB    . VAL G 3 166 ? 10.678  103.057 72.026  1.00 83.49  ? 172  VAL C CB    1 
ATOM   7594  C  CG1   . VAL G 3 166 ? 12.061  103.192 72.662  1.00 83.49  ? 172  VAL C CG1   1 
ATOM   7595  C  CG2   . VAL G 3 166 ? 10.767  103.175 70.523  1.00 83.49  ? 172  VAL C CG2   1 
ATOM   7596  N  N     . GLN G 3 167 ? 11.834  100.386 73.428  1.00 70.84  ? 173  GLN C N     1 
ATOM   7597  C  CA    . GLN G 3 167 ? 12.876  99.362  73.443  1.00 70.84  ? 173  GLN C CA    1 
ATOM   7598  C  C     . GLN G 3 167 ? 12.243  97.977  73.401  1.00 70.84  ? 173  GLN C C     1 
ATOM   7599  O  O     . GLN G 3 167 ? 12.792  97.036  72.823  1.00 70.84  ? 173  GLN C O     1 
ATOM   7600  C  CB    . GLN G 3 167 ? 13.733  99.489  74.704  1.00 77.00  ? 173  GLN C CB    1 
ATOM   7601  N  N     . ASP G 3 168 ? 11.079  97.848  74.027  1.00 86.81  ? 174  ASP C N     1 
ATOM   7602  C  CA    . ASP G 3 168 ? 10.390  96.571  74.036  1.00 86.81  ? 174  ASP C CA    1 
ATOM   7603  C  C     . ASP G 3 168 ? 10.196  96.101  72.611  1.00 86.81  ? 174  ASP C C     1 
ATOM   7604  O  O     . ASP G 3 168 ? 10.597  94.994  72.276  1.00 86.81  ? 174  ASP C O     1 
ATOM   7605  C  CB    . ASP G 3 168 ? 9.042   96.677  74.755  1.00 112.22 ? 174  ASP C CB    1 
ATOM   7606  C  CG    . ASP G 3 168 ? 9.073   96.051  76.145  1.00 112.22 ? 174  ASP C CG    1 
ATOM   7607  O  OD1   . ASP G 3 168 ? 9.230   94.815  76.240  1.00 112.22 ? 174  ASP C OD1   1 
ATOM   7608  O  OD2   . ASP G 3 168 ? 8.947   96.790  77.145  1.00 112.22 ? 174  ASP C OD2   1 
ATOM   7609  N  N     . VAL G 3 169 ? 9.619   96.949  71.763  1.00 92.77  ? 175  VAL C N     1 
ATOM   7610  C  CA    . VAL G 3 169 ? 9.381   96.549  70.380  1.00 92.77  ? 175  VAL C CA    1 
ATOM   7611  C  C     . VAL G 3 169 ? 10.635  96.161  69.629  1.00 92.77  ? 175  VAL C C     1 
ATOM   7612  O  O     . VAL G 3 169 ? 10.610  95.202  68.855  1.00 92.77  ? 175  VAL C O     1 
ATOM   7613  C  CB    . VAL G 3 169 ? 8.639   97.616  69.533  1.00 64.33  ? 175  VAL C CB    1 
ATOM   7614  C  CG1   . VAL G 3 169 ? 8.663   97.195  68.057  1.00 64.33  ? 175  VAL C CG1   1 
ATOM   7615  C  CG2   . VAL G 3 169 ? 7.182   97.738  69.983  1.00 64.33  ? 175  VAL C CG2   1 
ATOM   7616  N  N     . VAL G 3 170 ? 11.734  96.877  69.829  1.00 67.29  ? 176  VAL C N     1 
ATOM   7617  C  CA    . VAL G 3 170 ? 12.935  96.487  69.101  1.00 67.29  ? 176  VAL C CA    1 
ATOM   7618  C  C     . VAL G 3 170 ? 13.317  95.053  69.486  1.00 67.29  ? 176  VAL C C     1 
ATOM   7619  O  O     . VAL G 3 170 ? 13.486  94.190  68.617  1.00 67.29  ? 176  VAL C O     1 
ATOM   7620  C  CB    . VAL G 3 170 ? 14.134  97.462  69.335  1.00 85.22  ? 176  VAL C CB    1 
ATOM   7621  C  CG1   . VAL G 3 170 ? 13.763  98.864  68.840  1.00 85.22  ? 176  VAL C CG1   1 
ATOM   7622  C  CG2   . VAL G 3 170 ? 14.561  97.464  70.801  1.00 85.22  ? 176  VAL C CG2   1 
ATOM   7623  N  N     . VAL G 3 171 ? 13.437  94.777  70.778  1.00 33.89  ? 177  VAL C N     1 
ATOM   7624  C  CA    . VAL G 3 171 ? 13.761  93.414  71.177  1.00 33.89  ? 177  VAL C CA    1 
ATOM   7625  C  C     . VAL G 3 171 ? 12.714  92.475  70.578  1.00 33.89  ? 177  VAL C C     1 
ATOM   7626  O  O     . VAL G 3 171 ? 13.020  91.369  70.180  1.00 33.89  ? 177  VAL C O     1 
ATOM   7627  C  CB    . VAL G 3 171 ? 13.727  93.229  72.679  1.00 40.35  ? 177  VAL C CB    1 
ATOM   7628  C  CG1   . VAL G 3 171 ? 14.228  91.858  73.015  1.00 40.35  ? 177  VAL C CG1   1 
ATOM   7629  C  CG2   . VAL G 3 171 ? 14.561  94.291  73.351  1.00 40.35  ? 177  VAL C CG2   1 
ATOM   7630  N  N     . THR G 3 172 ? 11.466  92.922  70.523  1.00 64.09  ? 178  THR C N     1 
ATOM   7631  C  CA    . THR G 3 172 ? 10.414  92.096  69.953  1.00 64.09  ? 178  THR C CA    1 
ATOM   7632  C  C     . THR G 3 172 ? 10.744  91.858  68.489  1.00 64.09  ? 178  THR C C     1 
ATOM   7633  O  O     . THR G 3 172 ? 10.966  90.715  68.103  1.00 64.09  ? 178  THR C O     1 
ATOM   7634  C  CB    . THR G 3 172 ? 8.993   92.746  70.110  1.00 58.71  ? 178  THR C CB    1 
ATOM   7635  O  OG1   . THR G 3 172 ? 8.600   92.688  71.482  1.00 58.71  ? 178  THR C OG1   1 
ATOM   7636  C  CG2   . THR G 3 172 ? 7.929   92.005  69.287  1.00 58.71  ? 178  THR C CG2   1 
ATOM   7637  N  N     . LYS G 3 173 ? 10.801  92.914  67.678  1.00 88.72  ? 179  LYS C N     1 
ATOM   7638  C  CA    . LYS G 3 173 ? 11.129  92.750  66.260  1.00 88.72  ? 179  LYS C CA    1 
ATOM   7639  C  C     . LYS G 3 173 ? 12.387  91.878  66.134  1.00 88.72  ? 179  LYS C C     1 
ATOM   7640  O  O     . LYS G 3 173 ? 12.489  91.039  65.235  1.00 88.72  ? 179  LYS C O     1 
ATOM   7641  C  CB    . LYS G 3 173 ? 11.361  94.117  65.599  1.00 50.72  ? 179  LYS C CB    1 
ATOM   7642  N  N     . ALA G 3 174 ? 13.335  92.072  67.046  1.00 64.23  ? 180  ALA C N     1 
ATOM   7643  C  CA    . ALA G 3 174 ? 14.558  91.295  67.046  1.00 64.23  ? 180  ALA C CA    1 
ATOM   7644  C  C     . ALA G 3 174 ? 14.224  89.801  67.166  1.00 64.23  ? 180  ALA C C     1 
ATOM   7645  O  O     . ALA G 3 174 ? 14.685  88.972  66.364  1.00 64.23  ? 180  ALA C O     1 
ATOM   7646  C  CB    . ALA G 3 174 ? 15.447  91.734  68.209  1.00 50.95  ? 180  ALA C CB    1 
ATOM   7647  N  N     . LEU G 3 175 ? 13.422  89.466  68.177  1.00 53.75  ? 181  LEU C N     1 
ATOM   7648  C  CA    . LEU G 3 175 ? 13.016  88.093  68.422  1.00 53.75  ? 181  LEU C CA    1 
ATOM   7649  C  C     . LEU G 3 175 ? 12.274  87.600  67.181  1.00 53.75  ? 181  LEU C C     1 
ATOM   7650  O  O     . LEU G 3 175 ? 12.753  86.700  66.490  1.00 53.75  ? 181  LEU C O     1 
ATOM   7651  C  CB    . LEU G 3 175 ? 12.122  88.052  69.660  1.00 70.29  ? 181  LEU C CB    1 
ATOM   7652  C  CG    . LEU G 3 175 ? 11.924  86.755  70.448  1.00 70.29  ? 181  LEU C CG    1 
ATOM   7653  C  CD1   . LEU G 3 175 ? 11.149  85.772  69.601  1.00 70.29  ? 181  LEU C CD1   1 
ATOM   7654  C  CD2   . LEU G 3 175 ? 13.275  86.181  70.876  1.00 70.29  ? 181  LEU C CD2   1 
ATOM   7655  N  N     . LEU G 3 176 ? 11.128  88.218  66.885  1.00 69.21  ? 182  LEU C N     1 
ATOM   7656  C  CA    . LEU G 3 176 ? 10.316  87.849  65.726  1.00 69.21  ? 182  LEU C CA    1 
ATOM   7657  C  C     . LEU G 3 176 ? 11.129  87.350  64.555  1.00 69.21  ? 182  LEU C C     1 
ATOM   7658  O  O     . LEU G 3 176 ? 10.762  86.363  63.924  1.00 69.21  ? 182  LEU C O     1 
ATOM   7659  C  CB    . LEU G 3 176 ? 9.466   89.018  65.240  1.00 55.74  ? 182  LEU C CB    1 
ATOM   7660  C  CG    . LEU G 3 176 ? 8.888   88.797  63.830  1.00 55.74  ? 182  LEU C CG    1 
ATOM   7661  C  CD1   . LEU G 3 176 ? 8.142   87.469  63.764  1.00 55.74  ? 182  LEU C CD1   1 
ATOM   7662  C  CD2   . LEU G 3 176 ? 7.956   89.951  63.449  1.00 55.74  ? 182  LEU C CD2   1 
ATOM   7663  N  N     . GLU G 3 177 ? 12.222  88.041  64.251  1.00 104.13 ? 183  GLU C N     1 
ATOM   7664  C  CA    . GLU G 3 177 ? 13.085  87.648  63.145  1.00 104.13 ? 183  GLU C CA    1 
ATOM   7665  C  C     . GLU G 3 177 ? 13.764  86.326  63.456  1.00 104.13 ? 183  GLU C C     1 
ATOM   7666  O  O     . GLU G 3 177 ? 13.543  85.334  62.756  1.00 104.13 ? 183  GLU C O     1 
ATOM   7667  C  CB    . GLU G 3 177 ? 14.153  88.713  62.897  1.00 82.66  ? 183  GLU C CB    1 
ATOM   7668  N  N     . LYS G 3 178 ? 14.585  86.318  64.508  1.00 66.67  ? 184  LYS C N     1 
ATOM   7669  C  CA    . LYS G 3 178 ? 15.311  85.114  64.925  1.00 66.67  ? 184  LYS C CA    1 
ATOM   7670  C  C     . LYS G 3 178 ? 14.425  83.860  64.901  1.00 66.67  ? 184  LYS C C     1 
ATOM   7671  O  O     . LYS G 3 178 ? 14.924  82.729  64.873  1.00 66.67  ? 184  LYS C O     1 
ATOM   7672  C  CB    . LYS G 3 178 ? 15.898  85.304  66.331  1.00 56.84  ? 184  LYS C CB    1 
ATOM   7673  N  N     . LEU G 3 179 ? 13.112  84.059  64.912  1.00 60.78  ? 185  LEU C N     1 
ATOM   7674  C  CA    . LEU G 3 179 ? 12.199  82.934  64.880  1.00 60.78  ? 185  LEU C CA    1 
ATOM   7675  C  C     . LEU G 3 179 ? 11.781  82.643  63.456  1.00 60.78  ? 185  LEU C C     1 
ATOM   7676  O  O     . LEU G 3 179 ? 11.781  81.493  63.028  1.00 60.78  ? 185  LEU C O     1 
ATOM   7677  C  CB    . LEU G 3 179 ? 10.955  83.199  65.731  1.00 72.31  ? 185  LEU C CB    1 
ATOM   7678  C  CG    . LEU G 3 179 ? 11.063  83.445  67.243  1.00 72.31  ? 185  LEU C CG    1 
ATOM   7679  C  CD1   . LEU G 3 179 ? 9.808   82.865  67.883  1.00 72.31  ? 185  LEU C CD1   1 
ATOM   7680  C  CD2   . LEU G 3 179 ? 12.296  82.801  67.850  1.00 72.31  ? 185  LEU C CD2   1 
ATOM   7681  N  N     . LEU G 3 180 ? 11.416  83.680  62.717  1.00 95.69  ? 186  LEU C N     1 
ATOM   7682  C  CA    . LEU G 3 180 ? 11.010  83.476  61.338  1.00 95.69  ? 186  LEU C CA    1 
ATOM   7683  C  C     . LEU G 3 180 ? 12.181  82.900  60.547  1.00 95.69  ? 186  LEU C C     1 
ATOM   7684  O  O     . LEU G 3 180 ? 11.991  82.186  59.562  1.00 95.69  ? 186  LEU C O     1 
ATOM   7685  C  CB    . LEU G 3 180 ? 10.541  84.795  60.727  1.00 59.33  ? 186  LEU C CB    1 
ATOM   7686  C  CG    . LEU G 3 180 ? 9.216   85.323  61.268  1.00 59.33  ? 186  LEU C CG    1 
ATOM   7687  C  CD1   . LEU G 3 180 ? 8.930   86.636  60.589  1.00 59.33  ? 186  LEU C CD1   1 
ATOM   7688  C  CD2   . LEU G 3 180 ? 8.088   84.329  61.015  1.00 59.33  ? 186  LEU C CD2   1 
ATOM   7689  N  N     . SER G 3 181 ? 13.394  83.196  61.002  1.00 75.04  ? 187  SER C N     1 
ATOM   7690  C  CA    . SER G 3 181 ? 14.594  82.715  60.339  1.00 75.04  ? 187  SER C CA    1 
ATOM   7691  C  C     . SER G 3 181 ? 14.682  81.194  60.332  1.00 75.04  ? 187  SER C C     1 
ATOM   7692  O  O     . SER G 3 181 ? 15.337  80.620  59.465  1.00 75.04  ? 187  SER C O     1 
ATOM   7693  C  CB    . SER G 3 181 ? 15.838  83.278  61.023  1.00 94.76  ? 187  SER C CB    1 
ATOM   7694  O  OG    . SER G 3 181 ? 16.068  82.632  62.263  1.00 94.76  ? 187  SER C OG    1 
ATOM   7695  N  N     . ASP G 3 182 ? 14.035  80.547  61.303  1.00 93.47  ? 188  ASP C N     1 
ATOM   7696  C  CA    . ASP G 3 182 ? 14.042  79.086  61.408  1.00 93.47  ? 188  ASP C CA    1 
ATOM   7697  C  C     . ASP G 3 182 ? 13.439  78.436  60.161  1.00 93.47  ? 188  ASP C C     1 
ATOM   7698  O  O     . ASP G 3 182 ? 12.229  78.505  59.922  1.00 93.47  ? 188  ASP C O     1 
ATOM   7699  C  CB    . ASP G 3 182 ? 13.263  78.641  62.645  1.00 122.52 ? 188  ASP C CB    1 
ATOM   7700  C  CG    . ASP G 3 182 ? 13.359  77.149  62.888  1.00 122.52 ? 188  ASP C CG    1 
ATOM   7701  O  OD1   . ASP G 3 182 ? 12.982  76.372  61.985  1.00 122.52 ? 188  ASP C OD1   1 
ATOM   7702  O  OD2   . ASP G 3 182 ? 13.810  76.756  63.984  1.00 122.52 ? 188  ASP C OD2   1 
ATOM   7703  N  N     . LYS G 3 183 ? 14.305  77.794  59.383  1.00 94.69  ? 189  LYS C N     1 
ATOM   7704  C  CA    . LYS G 3 183 ? 13.924  77.132  58.143  1.00 94.69  ? 189  LYS C CA    1 
ATOM   7705  C  C     . LYS G 3 183 ? 12.971  75.932  58.305  1.00 94.69  ? 189  LYS C C     1 
ATOM   7706  O  O     . LYS G 3 183 ? 12.328  75.505  57.336  1.00 94.69  ? 189  LYS C O     1 
ATOM   7707  C  CB    . LYS G 3 183 ? 15.197  76.686  57.414  1.00 96.34  ? 189  LYS C CB    1 
ATOM   7708  N  N     . HIS G 3 184 ? 12.887  75.390  59.519  1.00 63.65  ? 190  HIS C N     1 
ATOM   7709  C  CA    . HIS G 3 184 ? 12.022  74.241  59.796  1.00 63.65  ? 190  HIS C CA    1 
ATOM   7710  C  C     . HIS G 3 184 ? 10.543  74.636  59.834  1.00 63.65  ? 190  HIS C C     1 
ATOM   7711  O  O     . HIS G 3 184 ? 9.669   73.874  59.386  1.00 63.65  ? 190  HIS C O     1 
ATOM   7712  C  CB    . HIS G 3 184 ? 12.394  73.611  61.149  1.00 80.35  ? 190  HIS C CB    1 
ATOM   7713  C  CG    . HIS G 3 184 ? 11.698  72.309  61.430  1.00 80.35  ? 190  HIS C CG    1 
ATOM   7714  N  ND1   . HIS G 3 184 ? 10.412  72.037  61.004  1.00 80.35  ? 190  HIS C ND1   1 
ATOM   7715  C  CD2   . HIS G 3 184 ? 12.104  71.210  62.114  1.00 80.35  ? 190  HIS C CD2   1 
ATOM   7716  C  CE1   . HIS G 3 184 ? 10.060  70.830  61.411  1.00 80.35  ? 190  HIS C CE1   1 
ATOM   7717  N  NE2   . HIS G 3 184 ? 11.068  70.307  62.087  1.00 80.35  ? 190  HIS C NE2   1 
ATOM   7718  N  N     . TYR G 3 185 ? 10.277  75.828  60.376  1.00 87.58  ? 191  TYR C N     1 
ATOM   7719  C  CA    . TYR G 3 185 ? 8.913   76.339  60.519  1.00 87.58  ? 191  TYR C CA    1 
ATOM   7720  C  C     . TYR G 3 185 ? 8.566   77.412  59.478  1.00 87.58  ? 191  TYR C C     1 
ATOM   7721  O  O     . TYR G 3 185 ? 7.391   77.638  59.163  1.00 87.58  ? 191  TYR C O     1 
ATOM   7722  C  CB    . TYR G 3 185 ? 8.711   76.901  61.946  1.00 73.48  ? 191  TYR C CB    1 
ATOM   7723  C  CG    . TYR G 3 185 ? 9.208   75.997  63.080  1.00 73.48  ? 191  TYR C CG    1 
ATOM   7724  C  CD1   . TYR G 3 185 ? 10.580  75.883  63.355  1.00 73.48  ? 191  TYR C CD1   1 
ATOM   7725  C  CD2   . TYR G 3 185 ? 8.314   75.237  63.863  1.00 73.48  ? 191  TYR C CD2   1 
ATOM   7726  C  CE1   . TYR G 3 185 ? 11.061  75.040  64.370  1.00 73.48  ? 191  TYR C CE1   1 
ATOM   7727  C  CE2   . TYR G 3 185 ? 8.790   74.385  64.887  1.00 73.48  ? 191  TYR C CE2   1 
ATOM   7728  C  CZ    . TYR G 3 185 ? 10.168  74.297  65.126  1.00 73.48  ? 191  TYR C CZ    1 
ATOM   7729  O  OH    . TYR G 3 185 ? 10.678  73.460  66.091  1.00 73.48  ? 191  TYR C OH    1 
ATOM   7730  N  N     . PHE G 3 186 ? 9.598   78.053  58.937  1.00 95.01  ? 192  PHE C N     1 
ATOM   7731  C  CA    . PHE G 3 186 ? 9.417   79.109  57.949  1.00 95.01  ? 192  PHE C CA    1 
ATOM   7732  C  C     . PHE G 3 186 ? 10.336  78.958  56.728  1.00 95.01  ? 192  PHE C C     1 
ATOM   7733  O  O     . PHE G 3 186 ? 11.552  79.146  56.830  1.00 95.01  ? 192  PHE C O     1 
ATOM   7734  C  CB    . PHE G 3 186 ? 9.678   80.461  58.613  1.00 58.66  ? 192  PHE C CB    1 
ATOM   7735  C  CG    . PHE G 3 186 ? 8.781   80.744  59.788  1.00 58.66  ? 192  PHE C CG    1 
ATOM   7736  C  CD1   . PHE G 3 186 ? 7.409   80.926  59.610  1.00 58.66  ? 192  PHE C CD1   1 
ATOM   7737  C  CD2   . PHE G 3 186 ? 9.302   80.805  61.076  1.00 58.66  ? 192  PHE C CD2   1 
ATOM   7738  C  CE1   . PHE G 3 186 ? 6.572   81.161  60.694  1.00 58.66  ? 192  PHE C CE1   1 
ATOM   7739  C  CE2   . PHE G 3 186 ? 8.471   81.038  62.167  1.00 58.66  ? 192  PHE C CE2   1 
ATOM   7740  C  CZ    . PHE G 3 186 ? 7.108   81.215  61.975  1.00 58.66  ? 192  PHE C CZ    1 
ATOM   7741  N  N     . PRO G 3 187 ? 9.758   78.630  55.555  1.00 146.35 ? 193  PRO C N     1 
ATOM   7742  C  CA    . PRO G 3 187 ? 10.483  78.447  54.289  1.00 146.35 ? 193  PRO C CA    1 
ATOM   7743  C  C     . PRO G 3 187 ? 11.253  79.704  53.903  1.00 146.35 ? 193  PRO C C     1 
ATOM   7744  O  O     . PRO G 3 187 ? 10.679  80.788  53.828  1.00 146.35 ? 193  PRO C O     1 
ATOM   7745  C  CB    . PRO G 3 187 ? 9.368   78.159  53.287  1.00 118.63 ? 193  PRO C CB    1 
ATOM   7746  C  CG    . PRO G 3 187 ? 8.294   77.543  54.134  1.00 118.63 ? 193  PRO C CG    1 
ATOM   7747  C  CD    . PRO G 3 187 ? 8.315   78.395  55.369  1.00 118.63 ? 193  PRO C CD    1 
ATOM   7748  N  N     . PRO G 3 188 ? 12.561  79.573  53.647  1.00 90.02  ? 194  PRO C N     1 
ATOM   7749  C  CA    . PRO G 3 188 ? 13.440  80.691  53.262  1.00 90.02  ? 194  PRO C CA    1 
ATOM   7750  C  C     . PRO G 3 188 ? 12.982  81.473  52.011  1.00 90.02  ? 194  PRO C C     1 
ATOM   7751  O  O     . PRO G 3 188 ? 13.214  82.679  51.891  1.00 90.02  ? 194  PRO C O     1 
ATOM   7752  C  CB    . PRO G 3 188 ? 14.784  79.996  53.053  1.00 75.58  ? 194  PRO C CB    1 
ATOM   7753  C  CG    . PRO G 3 188 ? 14.729  78.870  54.065  1.00 75.58  ? 194  PRO C CG    1 
ATOM   7754  C  CD    . PRO G 3 188 ? 13.336  78.335  53.838  1.00 75.58  ? 194  PRO C CD    1 
ATOM   7755  N  N     . GLU G 3 189 ? 12.324  80.760  51.100  1.00 121.22 ? 195  GLU C N     1 
ATOM   7756  C  CA    . GLU G 3 189 ? 11.808  81.297  49.835  1.00 121.22 ? 195  GLU C CA    1 
ATOM   7757  C  C     . GLU G 3 189 ? 10.789  82.431  49.967  1.00 121.22 ? 195  GLU C C     1 
ATOM   7758  O  O     . GLU G 3 189 ? 10.502  83.147  49.005  1.00 121.22 ? 195  GLU C O     1 
ATOM   7759  C  CB    . GLU G 3 189 ? 11.186  80.145  49.045  1.00 102.38 ? 195  GLU C CB    1 
ATOM   7760  C  CG    . GLU G 3 189 ? 10.420  79.170  49.931  1.00 102.38 ? 195  GLU C CG    1 
ATOM   7761  C  CD    . GLU G 3 189 ? 10.378  77.781  49.351  1.00 102.38 ? 195  GLU C CD    1 
ATOM   7762  O  OE1   . GLU G 3 189 ? 11.465  77.193  49.128  1.00 102.38 ? 195  GLU C OE1   1 
ATOM   7763  O  OE2   . GLU G 3 189 ? 9.256   77.281  49.121  1.00 102.38 ? 195  GLU C OE2   1 
ATOM   7764  N  N     . ILE G 3 190 ? 10.247  82.583  51.166  1.00 92.61  ? 196  ILE C N     1 
ATOM   7765  C  CA    . ILE G 3 190 ? 9.247   83.602  51.437  1.00 92.61  ? 196  ILE C CA    1 
ATOM   7766  C  C     . ILE G 3 190 ? 9.775   84.526  52.517  1.00 92.61  ? 196  ILE C C     1 
ATOM   7767  O  O     . ILE G 3 190 ? 10.640  84.137  53.307  1.00 92.61  ? 196  ILE C O     1 
ATOM   7768  C  CB    . ILE G 3 190 ? 7.941   82.959  51.973  1.00 115.96 ? 196  ILE C CB    1 
ATOM   7769  C  CG1   . ILE G 3 190 ? 7.590   81.713  51.150  1.00 115.96 ? 196  ILE C CG1   1 
ATOM   7770  C  CG2   . ILE G 3 190 ? 6.803   83.968  51.921  1.00 115.96 ? 196  ILE C CG2   1 
ATOM   7771  C  CD1   . ILE G 3 190 ? 6.422   80.907  51.689  1.00 115.96 ? 196  ILE C CD1   1 
ATOM   7772  N  N     . ASP G 3 191 ? 9.279   85.758  52.539  1.00 86.08  ? 197  ASP C N     1 
ATOM   7773  C  CA    . ASP G 3 191 ? 9.670   86.683  53.592  1.00 86.08  ? 197  ASP C CA    1 
ATOM   7774  C  C     . ASP G 3 191 ? 8.419   87.216  54.280  1.00 86.08  ? 197  ASP C C     1 
ATOM   7775  O  O     . ASP G 3 191 ? 7.814   88.206  53.865  1.00 86.08  ? 197  ASP C O     1 
ATOM   7776  C  CB    . ASP G 3 191 ? 10.558  87.798  53.061  1.00 104.23 ? 197  ASP C CB    1 
ATOM   7777  C  CG    . ASP G 3 191 ? 11.971  87.687  53.598  1.00 104.23 ? 197  ASP C CG    1 
ATOM   7778  O  OD1   . ASP G 3 191 ? 12.591  86.612  53.416  1.00 104.23 ? 197  ASP C OD1   1 
ATOM   7779  O  OD2   . ASP G 3 191 ? 12.451  88.662  54.213  1.00 104.23 ? 197  ASP C OD2   1 
ATOM   7780  N  N     . PHE G 3 192 ? 8.054   86.500  55.341  1.00 97.19  ? 198  PHE C N     1 
ATOM   7781  C  CA    . PHE G 3 192 ? 6.883   86.756  56.159  1.00 97.19  ? 198  PHE C CA    1 
ATOM   7782  C  C     . PHE G 3 192 ? 6.756   88.180  56.671  1.00 97.19  ? 198  PHE C C     1 
ATOM   7783  O  O     . PHE G 3 192 ? 5.656   88.651  56.969  1.00 97.19  ? 198  PHE C O     1 
ATOM   7784  C  CB    . PHE G 3 192 ? 6.886   85.780  57.330  1.00 44.45  ? 198  PHE C CB    1 
ATOM   7785  N  N     . THR G 3 193 ? 7.886   88.862  56.785  1.00 74.46  ? 199  THR C N     1 
ATOM   7786  C  CA    . THR G 3 193 ? 7.888   90.237  57.245  1.00 74.46  ? 199  THR C CA    1 
ATOM   7787  C  C     . THR G 3 193 ? 7.360   91.057  56.079  1.00 74.46  ? 199  THR C C     1 
ATOM   7788  O  O     . THR G 3 193 ? 7.445   92.284  56.084  1.00 74.46  ? 199  THR C O     1 
ATOM   7789  C  CB    . THR G 3 193 ? 9.307   90.706  57.534  1.00 66.75  ? 199  THR C CB    1 
ATOM   7790  O  OG1   . THR G 3 193 ? 9.922   91.110  56.307  1.00 66.75  ? 199  THR C OG1   1 
ATOM   7791  C  CG2   . THR G 3 193 ? 10.126  89.583  58.116  1.00 66.75  ? 199  THR C CG2   1 
ATOM   7792  N  N     . ASP G 3 194 ? 6.820   90.372  55.075  1.00 85.44  ? 200  ASP C N     1 
ATOM   7793  C  CA    . ASP G 3 194 ? 6.308   91.049  53.894  1.00 85.44  ? 200  ASP C CA    1 
ATOM   7794  C  C     . ASP G 3 194 ? 5.122   90.323  53.267  1.00 85.44  ? 200  ASP C C     1 
ATOM   7795  O  O     . ASP G 3 194 ? 4.849   90.498  52.082  1.00 85.44  ? 200  ASP C O     1 
ATOM   7796  C  CB    . ASP G 3 194 ? 7.431   91.191  52.857  1.00 118.98 ? 200  ASP C CB    1 
ATOM   7797  C  CG    . ASP G 3 194 ? 7.212   92.362  51.907  1.00 118.98 ? 200  ASP C CG    1 
ATOM   7798  O  OD1   . ASP G 3 194 ? 7.335   93.522  52.355  1.00 118.98 ? 200  ASP C OD1   1 
ATOM   7799  O  OD2   . ASP G 3 194 ? 6.918   92.124  50.716  1.00 118.98 ? 200  ASP C OD2   1 
ATOM   7800  N  N     . VAL G 3 195 ? 4.417   89.508  54.046  1.00 65.75  ? 201  VAL C N     1 
ATOM   7801  C  CA    . VAL G 3 195 ? 3.263   88.798  53.507  1.00 65.75  ? 201  VAL C CA    1 
ATOM   7802  C  C     . VAL G 3 195 ? 1.996   89.159  54.260  1.00 65.75  ? 201  VAL C C     1 
ATOM   7803  O  O     . VAL G 3 195 ? 2.049   89.729  55.352  1.00 65.75  ? 201  VAL C O     1 
ATOM   7804  C  CB    . VAL G 3 195 ? 3.422   87.288  53.601  1.00 81.26  ? 201  VAL C CB    1 
ATOM   7805  C  CG1   . VAL G 3 195 ? 4.800   86.888  53.149  1.00 81.26  ? 201  VAL C CG1   1 
ATOM   7806  C  CG2   . VAL G 3 195 ? 3.153   86.831  55.015  1.00 81.26  ? 201  VAL C CG2   1 
ATOM   7807  N  N     . GLY G 3 196 ? 0.855   88.829  53.663  1.00 84.07  ? 202  GLY C N     1 
ATOM   7808  C  CA    . GLY G 3 196 ? -0.419  89.105  54.292  1.00 84.07  ? 202  GLY C CA    1 
ATOM   7809  C  C     . GLY G 3 196 ? -0.754  87.947  55.203  1.00 84.07  ? 202  GLY C C     1 
ATOM   7810  O  O     . GLY G 3 196 ? -0.239  86.840  55.033  1.00 84.07  ? 202  GLY C O     1 
ATOM   7811  N  N     . TYR G 3 197 ? -1.623  88.194  56.170  1.00 135.88 ? 203  TYR C N     1 
ATOM   7812  C  CA    . TYR G 3 197 ? -2.009  87.163  57.112  1.00 135.88 ? 203  TYR C CA    1 
ATOM   7813  C  C     . TYR G 3 197 ? -2.309  85.817  56.455  1.00 135.88 ? 203  TYR C C     1 
ATOM   7814  O  O     . TYR G 3 197 ? -1.764  84.789  56.862  1.00 135.88 ? 203  TYR C O     1 
ATOM   7815  C  CB    . TYR G 3 197 ? -3.205  87.647  57.940  1.00 66.09  ? 203  TYR C CB    1 
ATOM   7816  C  CG    . TYR G 3 197 ? -4.583  87.535  57.314  1.00 66.09  ? 203  TYR C CG    1 
ATOM   7817  C  CD1   . TYR G 3 197 ? -5.243  86.318  57.241  1.00 66.09  ? 203  TYR C CD1   1 
ATOM   7818  C  CD2   . TYR G 3 197 ? -5.265  88.659  56.896  1.00 66.09  ? 203  TYR C CD2   1 
ATOM   7819  C  CE1   . TYR G 3 197 ? -6.549  86.226  56.778  1.00 66.09  ? 203  TYR C CE1   1 
ATOM   7820  C  CE2   . TYR G 3 197 ? -6.573  88.575  56.428  1.00 66.09  ? 203  TYR C CE2   1 
ATOM   7821  C  CZ    . TYR G 3 197 ? -7.211  87.356  56.375  1.00 66.09  ? 203  TYR C CZ    1 
ATOM   7822  O  OH    . TYR G 3 197 ? -8.515  87.274  55.926  1.00 66.09  ? 203  TYR C OH    1 
ATOM   7823  N  N     . THR G 3 198 ? -3.154  85.820  55.428  1.00 91.22  ? 204  THR C N     1 
ATOM   7824  C  CA    . THR G 3 198 ? -3.509  84.580  54.752  1.00 91.22  ? 204  THR C CA    1 
ATOM   7825  C  C     . THR G 3 198 ? -2.298  83.848  54.181  1.00 91.22  ? 204  THR C C     1 
ATOM   7826  O  O     . THR G 3 198 ? -2.291  82.615  54.104  1.00 91.22  ? 204  THR C O     1 
ATOM   7827  C  CB    . THR G 3 198 ? -4.539  84.827  53.638  1.00 67.87  ? 204  THR C CB    1 
ATOM   7828  O  OG1   . THR G 3 198 ? -5.775  85.237  54.226  1.00 67.87  ? 204  THR C OG1   1 
ATOM   7829  C  CG2   . THR G 3 198 ? -4.788  83.555  52.839  1.00 67.87  ? 204  THR C CG2   1 
ATOM   7830  N  N     . THR G 3 199 ? -1.270  84.589  53.784  1.00 63.80  ? 205  THR C N     1 
ATOM   7831  C  CA    . THR G 3 199 ? -0.089  83.926  53.255  1.00 63.80  ? 205  THR C CA    1 
ATOM   7832  C  C     . THR G 3 199 ? 0.870   83.510  54.361  1.00 63.80  ? 205  THR C C     1 
ATOM   7833  O  O     . THR G 3 199 ? 1.515   82.468  54.261  1.00 63.80  ? 205  THR C O     1 
ATOM   7834  C  CB    . THR G 3 199 ? 0.629   84.795  52.200  1.00 91.04  ? 205  THR C CB    1 
ATOM   7835  O  OG1   . THR G 3 199 ? -0.055  84.648  50.944  1.00 91.04  ? 205  THR C OG1   1 
ATOM   7836  C  CG2   . THR G 3 199 ? 2.111   84.376  52.044  1.00 91.04  ? 205  THR C CG2   1 
ATOM   7837  N  N     . PHE G 3 200 ? 0.951   84.308  55.419  1.00 91.65  ? 206  PHE C N     1 
ATOM   7838  C  CA    . PHE G 3 200 ? 1.819   83.974  56.543  1.00 91.65  ? 206  PHE C CA    1 
ATOM   7839  C  C     . PHE G 3 200 ? 1.380   82.625  57.087  1.00 91.65  ? 206  PHE C C     1 
ATOM   7840  O  O     . PHE G 3 200 ? 2.186   81.723  57.278  1.00 91.65  ? 206  PHE C O     1 
ATOM   7841  C  CB    . PHE G 3 200 ? 1.689   85.024  57.652  1.00 66.81  ? 206  PHE C CB    1 
ATOM   7842  C  CG    . PHE G 3 200 ? 2.632   84.811  58.824  1.00 66.81  ? 206  PHE C CG    1 
ATOM   7843  C  CD1   . PHE G 3 200 ? 2.398   83.806  59.758  1.00 66.81  ? 206  PHE C CD1   1 
ATOM   7844  C  CD2   . PHE G 3 200 ? 3.760   85.626  58.989  1.00 66.81  ? 206  PHE C CD2   1 
ATOM   7845  C  CE1   . PHE G 3 200 ? 3.277   83.616  60.838  1.00 66.81  ? 206  PHE C CE1   1 
ATOM   7846  C  CE2   . PHE G 3 200 ? 4.636   85.443  60.057  1.00 66.81  ? 206  PHE C CE2   1 
ATOM   7847  C  CZ    . PHE G 3 200 ? 4.398   84.441  60.980  1.00 66.81  ? 206  PHE C CZ    1 
ATOM   7848  N  N     . TRP G 3 201 ? 0.079   82.513  57.310  1.00 91.60  ? 207  TRP C N     1 
ATOM   7849  C  CA    . TRP G 3 201 ? -0.566  81.327  57.855  1.00 91.60  ? 207  TRP C CA    1 
ATOM   7850  C  C     . TRP G 3 201 ? -0.486  80.026  57.054  1.00 91.60  ? 207  TRP C C     1 
ATOM   7851  O  O     . TRP G 3 201 ? -0.073  78.983  57.575  1.00 91.60  ? 207  TRP C O     1 
ATOM   7852  C  CB    . TRP G 3 201 ? -2.025  81.693  58.134  1.00 73.29  ? 207  TRP C CB    1 
ATOM   7853  C  CG    . TRP G 3 201 ? -2.143  82.638  59.284  1.00 73.29  ? 207  TRP C CG    1 
ATOM   7854  C  CD1   . TRP G 3 201 ? -3.025  83.669  59.418  1.00 73.29  ? 207  TRP C CD1   1 
ATOM   7855  C  CD2   . TRP G 3 201 ? -1.365  82.614  60.485  1.00 73.29  ? 207  TRP C CD2   1 
ATOM   7856  N  NE1   . TRP G 3 201 ? -2.842  84.288  60.634  1.00 73.29  ? 207  TRP C NE1   1 
ATOM   7857  C  CE2   . TRP G 3 201 ? -1.830  83.654  61.305  1.00 73.29  ? 207  TRP C CE2   1 
ATOM   7858  C  CE3   . TRP G 3 201 ? -0.322  81.807  60.947  1.00 73.29  ? 207  TRP C CE3   1 
ATOM   7859  C  CZ2   . TRP G 3 201 ? -1.291  83.906  62.558  1.00 73.29  ? 207  TRP C CZ2   1 
ATOM   7860  C  CZ3   . TRP G 3 201 ? 0.214   82.058  62.191  1.00 73.29  ? 207  TRP C CZ3   1 
ATOM   7861  C  CH2   . TRP G 3 201 ? -0.270  83.097  62.984  1.00 73.29  ? 207  TRP C CH2   1 
ATOM   7862  N  N     . SER G 3 202 ? -0.894  80.088  55.792  1.00 114.34 ? 208  SER C N     1 
ATOM   7863  C  CA    . SER G 3 202 ? -0.881  78.921  54.923  1.00 114.34 ? 208  SER C CA    1 
ATOM   7864  C  C     . SER G 3 202 ? 0.539   78.563  54.501  1.00 114.34 ? 208  SER C C     1 
ATOM   7865  O  O     . SER G 3 202 ? 0.975   77.419  54.643  1.00 114.34 ? 208  SER C O     1 
ATOM   7866  C  CB    . SER G 3 202 ? -1.731  79.202  53.683  1.00 113.78 ? 208  SER C CB    1 
ATOM   7867  O  OG    . SER G 3 202 ? -3.009  79.698  54.050  1.00 113.78 ? 208  SER C OG    1 
ATOM   7868  N  N     . GLU G 3 203 ? 1.260   79.556  53.993  1.00 65.12  ? 209  GLU C N     1 
ATOM   7869  C  CA    . GLU G 3 203 ? 2.626   79.354  53.522  1.00 65.12  ? 209  GLU C CA    1 
ATOM   7870  C  C     . GLU G 3 203 ? 3.645   79.055  54.609  1.00 65.12  ? 209  GLU C C     1 
ATOM   7871  O  O     . GLU G 3 203 ? 4.839   79.280  54.414  1.00 65.12  ? 209  GLU C O     1 
ATOM   7872  C  CB    . GLU G 3 203 ? 3.090   80.577  52.720  1.00 106.92 ? 209  GLU C CB    1 
ATOM   7873  C  CG    . GLU G 3 203 ? 2.396   80.790  51.362  1.00 106.92 ? 209  GLU C CG    1 
ATOM   7874  C  CD    . GLU G 3 203 ? 3.007   79.970  50.230  1.00 106.92 ? 209  GLU C CD    1 
ATOM   7875  O  OE1   . GLU G 3 203 ? 4.239   80.061  50.017  1.00 106.92 ? 209  GLU C OE1   1 
ATOM   7876  O  OE2   . GLU G 3 203 ? 2.251   79.244  49.549  1.00 106.92 ? 209  GLU C OE2   1 
ATOM   7877  N  N     . SER G 3 204 ? 3.192   78.537  55.744  1.00 76.77  ? 210  SER C N     1 
ATOM   7878  C  CA    . SER G 3 204 ? 4.106   78.242  56.843  1.00 76.77  ? 210  SER C CA    1 
ATOM   7879  C  C     . SER G 3 204 ? 3.723   76.947  57.515  1.00 76.77  ? 210  SER C C     1 
ATOM   7880  O  O     . SER G 3 204 ? 2.595   76.477  57.346  1.00 76.77  ? 210  SER C O     1 
ATOM   7881  C  CB    . SER G 3 204 ? 4.072   79.378  57.858  1.00 69.42  ? 210  SER C CB    1 
ATOM   7882  O  OG    . SER G 3 204 ? 2.726   79.742  58.094  1.00 69.42  ? 210  SER C OG    1 
ATOM   7883  N  N     . LEU G 3 205 ? 4.662   76.388  58.283  1.00 78.15  ? 211  LEU C N     1 
ATOM   7884  C  CA    . LEU G 3 205 ? 4.447   75.131  58.980  1.00 78.15  ? 211  LEU C CA    1 
ATOM   7885  C  C     . LEU G 3 205 ? 3.146   75.128  59.768  1.00 78.15  ? 211  LEU C C     1 
ATOM   7886  O  O     . LEU G 3 205 ? 2.832   76.089  60.470  1.00 78.15  ? 211  LEU C O     1 
ATOM   7887  C  CB    . LEU G 3 205 ? 5.616   74.841  59.901  1.00 44.88  ? 211  LEU C CB    1 
ATOM   7888  C  CG    . LEU G 3 205 ? 5.466   73.410  60.416  1.00 44.88  ? 211  LEU C CG    1 
ATOM   7889  C  CD1   . LEU G 3 205 ? 5.219   72.472  59.247  1.00 44.88  ? 211  LEU C CD1   1 
ATOM   7890  C  CD2   . LEU G 3 205 ? 6.705   72.985  61.189  1.00 44.88  ? 211  LEU C CD2   1 
ATOM   7891  N  N     . GLU G 3 206 ? 2.402   74.034  59.655  1.00 66.47  ? 212  GLU C N     1 
ATOM   7892  C  CA    . GLU G 3 206 ? 1.108   73.903  60.311  1.00 66.47  ? 212  GLU C CA    1 
ATOM   7893  C  C     . GLU G 3 206 ? 1.054   74.262  61.790  1.00 66.47  ? 212  GLU C C     1 
ATOM   7894  O  O     . GLU G 3 206 ? 0.047   74.782  62.270  1.00 66.47  ? 212  GLU C O     1 
ATOM   7895  C  CB    . GLU G 3 206 ? 0.578   72.488  60.119  1.00 69.78  ? 212  GLU C CB    1 
ATOM   7896  C  CG    . GLU G 3 206 ? -0.782  72.277  60.726  1.00 69.78  ? 212  GLU C CG    1 
ATOM   7897  C  CD    . GLU G 3 206 ? -1.408  70.970  60.310  1.00 69.78  ? 212  GLU C CD    1 
ATOM   7898  O  OE1   . GLU G 3 206 ? -0.675  69.963  60.173  1.00 69.78  ? 212  GLU C OE1   1 
ATOM   7899  O  OE2   . GLU G 3 206 ? -2.644  70.948  60.134  1.00 69.78  ? 212  GLU C OE2   1 
ATOM   7900  N  N     . ALA G 3 207 ? 2.127   73.981  62.517  1.00 67.54  ? 213  ALA C N     1 
ATOM   7901  C  CA    . ALA G 3 207 ? 2.169   74.264  63.945  1.00 67.54  ? 213  ALA C CA    1 
ATOM   7902  C  C     . ALA G 3 207 ? 1.928   75.734  64.238  1.00 67.54  ? 213  ALA C C     1 
ATOM   7903  O  O     . ALA G 3 207 ? 1.185   76.082  65.151  1.00 67.54  ? 213  ALA C O     1 
ATOM   7904  C  CB    . ALA G 3 207 ? 3.517   73.836  64.519  1.00 68.40  ? 213  ALA C CB    1 
ATOM   7905  N  N     . VAL G 3 208 ? 2.558   76.597  63.453  1.00 60.42  ? 214  VAL C N     1 
ATOM   7906  C  CA    . VAL G 3 208 ? 2.430   78.022  63.667  1.00 60.42  ? 214  VAL C CA    1 
ATOM   7907  C  C     . VAL G 3 208 ? 0.966   78.461  63.644  1.00 60.42  ? 214  VAL C C     1 
ATOM   7908  O  O     . VAL G 3 208 ? 0.594   79.404  64.332  1.00 60.42  ? 214  VAL C O     1 
ATOM   7909  C  CB    . VAL G 3 208 ? 3.318   78.786  62.650  1.00 46.83  ? 214  VAL C CB    1 
ATOM   7910  C  CG1   . VAL G 3 208 ? 3.181   80.295  62.817  1.00 46.83  ? 214  VAL C CG1   1 
ATOM   7911  C  CG2   . VAL G 3 208 ? 4.754   78.400  62.880  1.00 46.83  ? 214  VAL C CG2   1 
ATOM   7912  N  N     . ASP G 3 209 ? 0.124   77.775  62.881  1.00 75.57  ? 215  ASP C N     1 
ATOM   7913  C  CA    . ASP G 3 209 ? -1.283  78.148  62.861  1.00 75.57  ? 215  ASP C CA    1 
ATOM   7914  C  C     . ASP G 3 209 ? -2.022  77.478  64.028  1.00 75.57  ? 215  ASP C C     1 
ATOM   7915  O  O     . ASP G 3 209 ? -2.739  78.136  64.774  1.00 75.57  ? 215  ASP C O     1 
ATOM   7916  C  CB    . ASP G 3 209 ? -1.943  77.771  61.530  1.00 61.62  ? 215  ASP C CB    1 
ATOM   7917  C  CG    . ASP G 3 209 ? -3.355  78.337  61.404  1.00 61.62  ? 215  ASP C CG    1 
ATOM   7918  O  OD1   . ASP G 3 209 ? -4.040  78.105  60.383  1.00 61.62  ? 215  ASP C OD1   1 
ATOM   7919  O  OD2   . ASP G 3 209 ? -3.782  79.029  62.342  1.00 61.62  ? 215  ASP C OD2   1 
ATOM   7920  N  N     . ILE G 3 210 ? -1.832  76.174  64.195  1.00 60.31  ? 216  ILE C N     1 
ATOM   7921  C  CA    . ILE G 3 210 ? -2.482  75.430  65.266  1.00 60.31  ? 216  ILE C CA    1 
ATOM   7922  C  C     . ILE G 3 210 ? -2.144  75.957  66.664  1.00 60.31  ? 216  ILE C C     1 
ATOM   7923  O  O     . ILE G 3 210 ? -2.955  75.854  67.572  1.00 60.31  ? 216  ILE C O     1 
ATOM   7924  C  CB    . ILE G 3 210 ? -2.120  73.925  65.177  1.00 33.96  ? 216  ILE C CB    1 
ATOM   7925  N  N     . GLU G 3 211 ? -0.947  76.514  66.834  1.00 78.59  ? 217  GLU C N     1 
ATOM   7926  C  CA    . GLU G 3 211 ? -0.514  77.051  68.125  1.00 78.59  ? 217  GLU C CA    1 
ATOM   7927  C  C     . GLU G 3 211 ? -1.216  78.354  68.442  1.00 78.59  ? 217  GLU C C     1 
ATOM   7928  O  O     . GLU G 3 211 ? -1.782  78.518  69.517  1.00 78.59  ? 217  GLU C O     1 
ATOM   7929  C  CB    . GLU G 3 211 ? 0.992   77.313  68.125  1.00 62.26  ? 217  GLU C CB    1 
ATOM   7930  C  CG    . GLU G 3 211 ? 1.821   76.075  68.143  1.00 62.26  ? 217  GLU C CG    1 
ATOM   7931  C  CD    . GLU G 3 211 ? 1.527   75.195  69.345  1.00 62.26  ? 217  GLU C CD    1 
ATOM   7932  O  OE1   . GLU G 3 211 ? 1.615   75.683  70.494  1.00 62.26  ? 217  GLU C OE1   1 
ATOM   7933  O  OE2   . GLU G 3 211 ? 1.217   74.004  69.136  1.00 62.26  ? 217  GLU C OE2   1 
ATOM   7934  N  N     . HIS G 3 212 ? -1.140  79.282  67.497  1.00 52.06  ? 218  HIS C N     1 
ATOM   7935  C  CA    . HIS G 3 212 ? -1.741  80.589  67.617  1.00 52.06  ? 218  HIS C CA    1 
ATOM   7936  C  C     . HIS G 3 212 ? -3.235  80.454  67.862  1.00 52.06  ? 218  HIS C C     1 
ATOM   7937  O  O     . HIS G 3 212 ? -3.746  81.072  68.791  1.00 52.06  ? 218  HIS C O     1 
ATOM   7938  C  CB    . HIS G 3 212 ? -1.502  81.430  66.339  1.00 72.24  ? 218  HIS C CB    1 
ATOM   7939  C  CG    . HIS G 3 212 ? -0.208  82.199  66.322  1.00 72.24  ? 218  HIS C CG    1 
ATOM   7940  N  ND1   . HIS G 3 212 ? 1.024   81.596  66.188  1.00 72.24  ? 218  HIS C ND1   1 
ATOM   7941  C  CD2   . HIS G 3 212 ? 0.035   83.530  66.389  1.00 72.24  ? 218  HIS C CD2   1 
ATOM   7942  C  CE1   . HIS G 3 212 ? 1.969   82.519  66.173  1.00 72.24  ? 218  HIS C CE1   1 
ATOM   7943  N  NE2   . HIS G 3 212 ? 1.395   83.702  66.294  1.00 72.24  ? 218  HIS C NE2   1 
ATOM   7944  N  N     . ARG G 3 213 ? -3.939  79.671  67.040  1.00 55.37  ? 219  ARG C N     1 
ATOM   7945  C  CA    . ARG G 3 213 ? -5.384  79.493  67.215  1.00 55.37  ? 219  ARG C CA    1 
ATOM   7946  C  C     . ARG G 3 213 ? -5.668  79.031  68.638  1.00 55.37  ? 219  ARG C C     1 
ATOM   7947  O  O     . ARG G 3 213 ? -6.622  79.484  69.269  1.00 55.37  ? 219  ARG C O     1 
ATOM   7948  C  CB    . ARG G 3 213 ? -5.928  78.454  66.252  1.00 70.73  ? 219  ARG C CB    1 
ATOM   7949  C  CG    . ARG G 3 213 ? -5.896  78.841  64.811  1.00 70.73  ? 219  ARG C CG    1 
ATOM   7950  C  CD    . ARG G 3 213 ? -5.907  77.581  63.969  1.00 70.73  ? 219  ARG C CD    1 
ATOM   7951  N  NE    . ARG G 3 213 ? -6.112  77.848  62.554  1.00 70.73  ? 219  ARG C NE    1 
ATOM   7952  C  CZ    . ARG G 3 213 ? -7.230  78.364  62.055  1.00 70.73  ? 219  ARG C CZ    1 
ATOM   7953  N  NH1   . ARG G 3 213 ? -8.243  78.668  62.865  1.00 70.73  ? 219  ARG C NH1   1 
ATOM   7954  N  NH2   . ARG G 3 213 ? -7.332  78.579  60.748  1.00 70.73  ? 219  ARG C NH2   1 
ATOM   7955  N  N     . ALA G 3 214 ? -4.838  78.118  69.129  1.00 48.15  ? 220  ALA C N     1 
ATOM   7956  C  CA    . ALA G 3 214 ? -4.942  77.597  70.487  1.00 48.15  ? 220  ALA C CA    1 
ATOM   7957  C  C     . ALA G 3 214 ? -4.665  78.725  71.485  1.00 48.15  ? 220  ALA C C     1 
ATOM   7958  O  O     . ALA G 3 214 ? -5.490  79.051  72.337  1.00 48.15  ? 220  ALA C O     1 
ATOM   7959  C  CB    . ALA G 3 214 ? -3.914  76.505  70.684  1.00 19.66  ? 220  ALA C CB    1 
ATOM   7960  N  N     . ALA G 3 215 ? -3.471  79.296  71.375  1.00 72.43  ? 221  ALA C N     1 
ATOM   7961  C  CA    . ALA G 3 215 ? -3.044  80.378  72.241  1.00 72.43  ? 221  ALA C CA    1 
ATOM   7962  C  C     . ALA G 3 215 ? -4.113  81.449  72.327  1.00 72.43  ? 221  ALA C C     1 
ATOM   7963  O  O     . ALA G 3 215 ? -4.253  82.117  73.345  1.00 72.43  ? 221  ALA C O     1 
ATOM   7964  C  CB    . ALA G 3 215 ? -1.759  80.971  71.722  1.00 96.74  ? 221  ALA C CB    1 
ATOM   7965  N  N     . TRP G 3 216 ? -4.870  81.602  71.252  1.00 51.08  ? 222  TRP C N     1 
ATOM   7966  C  CA    . TRP G 3 216 ? -5.937  82.594  71.188  1.00 51.08  ? 222  TRP C CA    1 
ATOM   7967  C  C     . TRP G 3 216 ? -7.158  82.116  71.929  1.00 51.08  ? 222  TRP C C     1 
ATOM   7968  O  O     . TRP G 3 216 ? -7.770  82.871  72.674  1.00 51.08  ? 222  TRP C O     1 
ATOM   7969  C  CB    . TRP G 3 216 ? -6.322  82.854  69.732  1.00 49.10  ? 222  TRP C CB    1 
ATOM   7970  C  CG    . TRP G 3 216 ? -7.280  83.984  69.521  1.00 49.10  ? 222  TRP C CG    1 
ATOM   7971  C  CD1   . TRP G 3 216 ? -8.637  83.920  69.513  1.00 49.10  ? 222  TRP C CD1   1 
ATOM   7972  C  CD2   . TRP G 3 216 ? -6.941  85.347  69.253  1.00 49.10  ? 222  TRP C CD2   1 
ATOM   7973  N  NE1   . TRP G 3 216 ? -9.173  85.163  69.248  1.00 49.10  ? 222  TRP C NE1   1 
ATOM   7974  C  CE2   . TRP G 3 216 ? -8.149  86.055  69.089  1.00 49.10  ? 222  TRP C CE2   1 
ATOM   7975  C  CE3   . TRP G 3 216 ? -5.730  86.038  69.136  1.00 49.10  ? 222  TRP C CE3   1 
ATOM   7976  C  CZ2   . TRP G 3 216 ? -8.183  87.419  68.816  1.00 49.10  ? 222  TRP C CZ2   1 
ATOM   7977  C  CZ3   . TRP G 3 216 ? -5.763  87.391  68.864  1.00 49.10  ? 222  TRP C CZ3   1 
ATOM   7978  C  CH2   . TRP G 3 216 ? -6.984  88.071  68.708  1.00 49.10  ? 222  TRP C CH2   1 
ATOM   7979  N  N     . LEU G 3 217 ? -7.509  80.852  71.710  1.00 68.86  ? 223  LEU C N     1 
ATOM   7980  C  CA    . LEU G 3 217 ? -8.670  80.231  72.346  1.00 68.86  ? 223  LEU C CA    1 
ATOM   7981  C  C     . LEU G 3 217 ? -8.551  80.119  73.854  1.00 68.86  ? 223  LEU C C     1 
ATOM   7982  O  O     . LEU G 3 217 ? -9.350  80.677  74.591  1.00 68.86  ? 223  LEU C O     1 
ATOM   7983  C  CB    . LEU G 3 217 ? -8.890  78.835  71.779  1.00 54.81  ? 223  LEU C CB    1 
ATOM   7984  C  CG    . LEU G 3 217 ? -9.823  77.959  72.607  1.00 54.81  ? 223  LEU C CG    1 
ATOM   7985  C  CD1   . LEU G 3 217 ? -11.219 78.588  72.795  1.00 54.81  ? 223  LEU C CD1   1 
ATOM   7986  C  CD2   . LEU G 3 217 ? -9.908  76.636  71.895  1.00 54.81  ? 223  LEU C CD2   1 
ATOM   7987  N  N     . LEU G 3 218 ? -7.557  79.371  74.304  1.00 62.51  ? 224  LEU C N     1 
ATOM   7988  C  CA    . LEU G 3 218 ? -7.353  79.178  75.721  1.00 62.51  ? 224  LEU C CA    1 
ATOM   7989  C  C     . LEU G 3 218 ? -7.286  80.508  76.447  1.00 62.51  ? 224  LEU C C     1 
ATOM   7990  O  O     . LEU G 3 218 ? -7.657  80.624  77.624  1.00 62.51  ? 224  LEU C O     1 
ATOM   7991  C  CB    . LEU G 3 218 ? -6.067  78.408  75.950  1.00 70.05  ? 224  LEU C CB    1 
ATOM   7992  C  CG    . LEU G 3 218 ? -6.076  77.013  75.350  1.00 70.05  ? 224  LEU C CG    1 
ATOM   7993  C  CD1   . LEU G 3 218 ? -4.699  76.370  75.512  1.00 70.05  ? 224  LEU C CD1   1 
ATOM   7994  C  CD2   . LEU G 3 218 ? -7.168  76.201  76.031  1.00 70.05  ? 224  LEU C CD2   1 
ATOM   7995  N  N     . ALA G 3 219 ? -6.798  81.516  75.751  1.00 39.53  ? 225  ALA C N     1 
ATOM   7996  C  CA    . ALA G 3 219 ? -6.695  82.814  76.359  1.00 39.53  ? 225  ALA C CA    1 
ATOM   7997  C  C     . ALA G 3 219 ? -8.104  83.350  76.551  1.00 39.53  ? 225  ALA C C     1 
ATOM   7998  O  O     . ALA G 3 219 ? -8.329  84.219  77.372  1.00 39.53  ? 225  ALA C O     1 
ATOM   7999  C  CB    . ALA G 3 219 ? -5.898  83.705  75.488  1.00 20.35  ? 225  ALA C CB    1 
ATOM   8000  N  N     . LYS G 3 220 ? -9.053  82.819  75.788  1.00 57.56  ? 226  LYS C N     1 
ATOM   8001  C  CA    . LYS G 3 220 ? -10.457 83.215  75.902  1.00 57.56  ? 226  LYS C CA    1 
ATOM   8002  C  C     . LYS G 3 220 ? -11.065 82.439  77.053  1.00 57.56  ? 226  LYS C C     1 
ATOM   8003  O  O     . LYS G 3 220 ? -11.831 82.973  77.842  1.00 57.56  ? 226  LYS C O     1 
ATOM   8004  C  CB    . LYS G 3 220 ? -11.224 82.875  74.633  1.00 61.10  ? 226  LYS C CB    1 
ATOM   8005  C  CG    . LYS G 3 220 ? -12.730 82.986  74.766  1.00 61.10  ? 226  LYS C CG    1 
ATOM   8006  C  CD    . LYS G 3 220 ? -13.167 84.418  74.991  1.00 61.10  ? 226  LYS C CD    1 
ATOM   8007  C  CE    . LYS G 3 220 ? -14.222 84.850  73.969  1.00 61.10  ? 226  LYS C CE    1 
ATOM   8008  N  NZ    . LYS G 3 220 ? -15.482 84.040  73.997  1.00 61.10  ? 226  LYS C NZ    1 
ATOM   8009  N  N     . GLN G 3 221 ? -10.730 81.159  77.124  1.00 54.03  ? 227  GLN C N     1 
ATOM   8010  C  CA    . GLN G 3 221 ? -11.196 80.297  78.185  1.00 54.03  ? 227  GLN C CA    1 
ATOM   8011  C  C     . GLN G 3 221 ? -10.732 80.924  79.501  1.00 54.03  ? 227  GLN C C     1 
ATOM   8012  O  O     . GLN G 3 221 ? -11.534 81.146  80.407  1.00 54.03  ? 227  GLN C O     1 
ATOM   8013  C  CB    . GLN G 3 221 ? -10.608 78.908  77.969  1.00 54.95  ? 227  GLN C CB    1 
ATOM   8014  C  CG    . GLN G 3 221 ? -10.693 77.957  79.119  1.00 54.95  ? 227  GLN C CG    1 
ATOM   8015  C  CD    . GLN G 3 221 ? -10.039 76.618  78.798  1.00 54.95  ? 227  GLN C CD    1 
ATOM   8016  O  OE1   . GLN G 3 221 ? -10.589 75.811  78.045  1.00 54.95  ? 227  GLN C OE1   1 
ATOM   8017  N  NE2   . GLN G 3 221 ? -8.853  76.381  79.361  1.00 54.95  ? 227  GLN C NE2   1 
ATOM   8018  N  N     . GLU G 3 222 ? -9.447  81.244  79.605  1.00 69.85  ? 228  GLU C N     1 
ATOM   8019  C  CA    . GLU G 3 222 ? -8.944  81.857  80.821  1.00 69.85  ? 228  GLU C CA    1 
ATOM   8020  C  C     . GLU G 3 222 ? -9.835  83.011  81.270  1.00 69.85  ? 228  GLU C C     1 
ATOM   8021  O  O     . GLU G 3 222 ? -10.320 83.030  82.400  1.00 69.85  ? 228  GLU C O     1 
ATOM   8022  C  CB    . GLU G 3 222 ? -7.525  82.354  80.601  1.00 89.20  ? 228  GLU C CB    1 
ATOM   8023  C  CG    . GLU G 3 222 ? -6.537  81.239  80.390  1.00 89.20  ? 228  GLU C CG    1 
ATOM   8024  C  CD    . GLU G 3 222 ? -5.117  81.737  80.464  1.00 89.20  ? 228  GLU C CD    1 
ATOM   8025  O  OE1   . GLU G 3 222 ? -4.912  82.803  81.089  1.00 89.20  ? 228  GLU C OE1   1 
ATOM   8026  O  OE2   . GLU G 3 222 ? -4.214  81.064  79.916  1.00 89.20  ? 228  GLU C OE2   1 
ATOM   8027  N  N     . ARG G 3 223 ? -10.064 83.966  80.377  1.00 57.28  ? 229  ARG C N     1 
ATOM   8028  C  CA    . ARG G 3 223 ? -10.887 85.117  80.701  1.00 57.28  ? 229  ARG C CA    1 
ATOM   8029  C  C     . ARG G 3 223 ? -12.354 84.773  80.975  1.00 57.28  ? 229  ARG C C     1 
ATOM   8030  O  O     . ARG G 3 223 ? -13.056 85.542  81.645  1.00 57.28  ? 229  ARG C O     1 
ATOM   8031  C  CB    . ARG G 3 223 ? -10.737 86.187  79.614  1.00 71.48  ? 229  ARG C CB    1 
ATOM   8032  C  CG    . ARG G 3 223 ? -9.434  86.954  79.795  1.00 71.48  ? 229  ARG C CG    1 
ATOM   8033  C  CD    . ARG G 3 223 ? -9.164  88.028  78.751  1.00 71.48  ? 229  ARG C CD    1 
ATOM   8034  N  NE    . ARG G 3 223 ? -8.583  87.492  77.524  1.00 71.48  ? 229  ARG C NE    1 
ATOM   8035  C  CZ    . ARG G 3 223 ? -9.298  87.089  76.480  1.00 71.48  ? 229  ARG C CZ    1 
ATOM   8036  N  NH1   . ARG G 3 223 ? -10.627 87.169  76.520  1.00 71.48  ? 229  ARG C NH1   1 
ATOM   8037  N  NH2   . ARG G 3 223 ? -8.686  86.606  75.400  1.00 71.48  ? 229  ARG C NH2   1 
ATOM   8038  N  N     . ASN G 3 224 ? -12.820 83.627  80.467  1.00 75.31  ? 230  ASN C N     1 
ATOM   8039  C  CA    . ASN G 3 224 ? -14.194 83.184  80.730  1.00 75.31  ? 230  ASN C CA    1 
ATOM   8040  C  C     . ASN G 3 224 ? -14.247 82.933  82.217  1.00 75.31  ? 230  ASN C C     1 
ATOM   8041  O  O     . ASN G 3 224 ? -14.906 83.647  82.958  1.00 75.31  ? 230  ASN C O     1 
ATOM   8042  C  CB    . ASN G 3 224 ? -14.521 81.860  80.039  1.00 62.34  ? 230  ASN C CB    1 
ATOM   8043  C  CG    . ASN G 3 224 ? -14.905 82.026  78.591  1.00 62.34  ? 230  ASN C CG    1 
ATOM   8044  O  OD1   . ASN G 3 224 ? -15.396 83.080  78.179  1.00 62.34  ? 230  ASN C OD1   1 
ATOM   8045  N  ND2   . ASN G 3 224 ? -14.706 80.972  77.809  1.00 62.34  ? 230  ASN C ND2   1 
ATOM   8046  N  N     . GLY G 3 225 ? -13.517 81.908  82.638  1.00 94.43  ? 231  GLY C N     1 
ATOM   8047  C  CA    . GLY G 3 225 ? -13.464 81.548  84.036  1.00 94.43  ? 231  GLY C CA    1 
ATOM   8048  C  C     . GLY G 3 225 ? -14.137 80.210  84.224  1.00 94.43  ? 231  GLY C C     1 
ATOM   8049  O  O     . GLY G 3 225 ? -14.583 79.599  83.263  1.00 94.43  ? 231  GLY C O     1 
ATOM   8050  N  N     . PHE G 3 226 ? -14.200 79.749  85.464  1.00 54.24  ? 232  PHE C N     1 
ATOM   8051  C  CA    . PHE G 3 226 ? -14.839 78.487  85.784  1.00 54.24  ? 232  PHE C CA    1 
ATOM   8052  C  C     . PHE G 3 226 ? -15.691 78.811  86.987  1.00 54.24  ? 232  PHE C C     1 
ATOM   8053  O  O     . PHE G 3 226 ? -15.162 79.074  88.060  1.00 54.24  ? 232  PHE C O     1 
ATOM   8054  C  CB    . PHE G 3 226 ? -13.793 77.450  86.169  1.00 49.64  ? 232  PHE C CB    1 
ATOM   8055  C  CG    . PHE G 3 226 ? -14.229 76.045  85.941  1.00 49.64  ? 232  PHE C CG    1 
ATOM   8056  C  CD1   . PHE G 3 226 ? -15.491 75.623  86.322  1.00 49.64  ? 232  PHE C CD1   1 
ATOM   8057  C  CD2   . PHE G 3 226 ? -13.377 75.133  85.347  1.00 49.64  ? 232  PHE C CD2   1 
ATOM   8058  C  CE1   . PHE G 3 226 ? -15.895 74.301  86.107  1.00 49.64  ? 232  PHE C CE1   1 
ATOM   8059  C  CE2   . PHE G 3 226 ? -13.777 73.808  85.133  1.00 49.64  ? 232  PHE C CE2   1 
ATOM   8060  C  CZ    . PHE G 3 226 ? -15.031 73.397  85.511  1.00 49.64  ? 232  PHE C CZ    1 
ATOM   8061  N  N     . PRO G 3 227 ? -17.018 78.849  86.817  1.00 83.36  ? 233  PRO C N     1 
ATOM   8062  C  CA    . PRO G 3 227 ? -17.858 79.158  87.973  1.00 83.36  ? 233  PRO C CA    1 
ATOM   8063  C  C     . PRO G 3 227 ? -17.450 78.269  89.154  1.00 83.36  ? 233  PRO C C     1 
ATOM   8064  O  O     . PRO G 3 227 ? -17.522 77.035  89.087  1.00 83.36  ? 233  PRO C O     1 
ATOM   8065  C  CB    . PRO G 3 227 ? -19.267 78.877  87.452  1.00 56.01  ? 233  PRO C CB    1 
ATOM   8066  C  CG    . PRO G 3 227 ? -19.179 79.301  86.039  1.00 56.01  ? 233  PRO C CG    1 
ATOM   8067  C  CD    . PRO G 3 227 ? -17.837 78.712  85.601  1.00 56.01  ? 233  PRO C CD    1 
ATOM   8068  N  N     . PHE G 3 228 ? -16.999 78.901  90.228  1.00 55.00  ? 234  PHE C N     1 
ATOM   8069  C  CA    . PHE G 3 228 ? -16.559 78.157  91.387  1.00 55.00  ? 234  PHE C CA    1 
ATOM   8070  C  C     . PHE G 3 228 ? -17.472 78.454  92.545  1.00 55.00  ? 234  PHE C C     1 
ATOM   8071  O  O     . PHE G 3 228 ? -17.746 79.615  92.824  1.00 55.00  ? 234  PHE C O     1 
ATOM   8072  C  CB    . PHE G 3 228 ? -15.133 78.553  91.733  1.00 38.17  ? 234  PHE C CB    1 
ATOM   8073  C  CG    . PHE G 3 228 ? -14.637 77.939  92.987  1.00 38.17  ? 234  PHE C CG    1 
ATOM   8074  C  CD1   . PHE G 3 228 ? -14.405 76.579  93.066  1.00 38.17  ? 234  PHE C CD1   1 
ATOM   8075  C  CD2   . PHE G 3 228 ? -14.413 78.722  94.113  1.00 38.17  ? 234  PHE C CD2   1 
ATOM   8076  C  CE1   . PHE G 3 228 ? -13.950 76.007  94.260  1.00 38.17  ? 234  PHE C CE1   1 
ATOM   8077  C  CE2   . PHE G 3 228 ? -13.960 78.163  95.310  1.00 38.17  ? 234  PHE C CE2   1 
ATOM   8078  C  CZ    . PHE G 3 228 ? -13.728 76.805  95.379  1.00 38.17  ? 234  PHE C CZ    1 
ATOM   8079  N  N     . ASP G 3 229 ? -17.930 77.410  93.231  1.00 46.71  ? 235  ASP C N     1 
ATOM   8080  C  CA    . ASP G 3 229 ? -18.837 77.574  94.362  1.00 46.71  ? 235  ASP C CA    1 
ATOM   8081  C  C     . ASP G 3 229 ? -18.160 77.947  95.671  1.00 46.71  ? 235  ASP C C     1 
ATOM   8082  O  O     . ASP G 3 229 ? -17.987 77.107  96.543  1.00 46.71  ? 235  ASP C O     1 
ATOM   8083  C  CB    . ASP G 3 229 ? -19.639 76.300  94.559  1.00 75.55  ? 235  ASP C CB    1 
ATOM   8084  C  CG    . ASP G 3 229 ? -20.825 76.507  95.461  1.00 75.55  ? 235  ASP C CG    1 
ATOM   8085  O  OD1   . ASP G 3 229 ? -21.000 77.647  95.960  1.00 75.55  ? 235  ASP C OD1   1 
ATOM   8086  O  OD2   . ASP G 3 229 ? -21.579 75.530  95.662  1.00 75.55  ? 235  ASP C OD2   1 
ATOM   8087  N  N     . THR G 3 230 ? -17.788 79.205  95.823  1.00 57.47  ? 236  THR C N     1 
ATOM   8088  C  CA    . THR G 3 230 ? -17.132 79.617  97.047  1.00 57.47  ? 236  THR C CA    1 
ATOM   8089  C  C     . THR G 3 230 ? -17.770 78.930  98.262  1.00 57.47  ? 236  THR C C     1 
ATOM   8090  O  O     . THR G 3 230 ? -17.086 78.257  99.042  1.00 57.47  ? 236  THR C O     1 
ATOM   8091  C  CB    . THR G 3 230 ? -17.226 81.124  97.233  1.00 75.06  ? 236  THR C CB    1 
ATOM   8092  O  OG1   . THR G 3 230 ? -17.044 81.776  95.971  1.00 75.06  ? 236  THR C OG1   1 
ATOM   8093  C  CG2   . THR G 3 230 ? -16.156 81.590  98.196  1.00 75.06  ? 236  THR C CG2   1 
ATOM   8094  N  N     . LYS G 3 231 ? -19.086 79.076  98.406  1.00 52.53  ? 237  LYS C N     1 
ATOM   8095  C  CA    . LYS G 3 231 ? -19.809 78.485  99.539  1.00 52.53  ? 237  LYS C CA    1 
ATOM   8096  C  C     . LYS G 3 231 ? -19.512 77.013  99.769  1.00 52.53  ? 237  LYS C C     1 
ATOM   8097  O  O     . LYS G 3 231 ? -18.955 76.657  100.793 1.00 52.53  ? 237  LYS C O     1 
ATOM   8098  C  CB    . LYS G 3 231 ? -21.320 78.674  99.372  1.00 65.88  ? 237  LYS C CB    1 
ATOM   8099  N  N     . ALA G 3 232 ? -19.871 76.158  98.821  1.00 69.96  ? 238  ALA C N     1 
ATOM   8100  C  CA    . ALA G 3 232 ? -19.646 74.726  98.990  1.00 69.96  ? 238  ALA C CA    1 
ATOM   8101  C  C     . ALA G 3 232 ? -18.229 74.400  99.459  1.00 69.96  ? 238  ALA C C     1 
ATOM   8102  O  O     . ALA G 3 232 ? -18.008 73.433  100.208 1.00 69.96  ? 238  ALA C O     1 
ATOM   8103  C  CB    . ALA G 3 232 ? -19.961 73.979  97.690  1.00 59.97  ? 238  ALA C CB    1 
ATOM   8104  N  N     . ILE G 3 233 ? -17.277 75.221  99.034  1.00 62.55  ? 239  ILE C N     1 
ATOM   8105  C  CA    . ILE G 3 233 ? -15.896 74.999  99.392  1.00 62.55  ? 239  ILE C CA    1 
ATOM   8106  C  C     . ILE G 3 233 ? -15.519 75.585  100.734 1.00 62.55  ? 239  ILE C C     1 
ATOM   8107  O  O     . ILE G 3 233 ? -14.686 75.022  101.451 1.00 62.55  ? 239  ILE C O     1 
ATOM   8108  C  CB    . ILE G 3 233 ? -15.015 75.530  98.297  1.00 51.90  ? 239  ILE C CB    1 
ATOM   8109  C  CG1   . ILE G 3 233 ? -15.272 74.682  97.054  1.00 51.90  ? 239  ILE C CG1   1 
ATOM   8110  C  CG2   . ILE G 3 233 ? -13.558 75.521  98.725  1.00 51.90  ? 239  ILE C CG2   1 
ATOM   8111  C  CD1   . ILE G 3 233 ? -15.169 73.180  97.296  1.00 51.90  ? 239  ILE C CD1   1 
ATOM   8112  N  N     . GLU G 3 234 ? -16.121 76.717  101.076 1.00 61.65  ? 240  GLU C N     1 
ATOM   8113  C  CA    . GLU G 3 234 ? -15.851 77.314  102.370 1.00 61.65  ? 240  GLU C CA    1 
ATOM   8114  C  C     . GLU G 3 234 ? -16.505 76.352  103.365 1.00 61.65  ? 240  GLU C C     1 
ATOM   8115  O  O     . GLU G 3 234 ? -16.066 76.211  104.514 1.00 61.65  ? 240  GLU C O     1 
ATOM   8116  C  CB    . GLU G 3 234 ? -16.482 78.702  102.457 1.00 124.08 ? 240  GLU C CB    1 
ATOM   8117  C  CG    . GLU G 3 234 ? -15.930 79.671  101.431 1.00 124.08 ? 240  GLU C CG    1 
ATOM   8118  C  CD    . GLU G 3 234 ? -16.427 81.089  101.626 1.00 124.08 ? 240  GLU C CD    1 
ATOM   8119  O  OE1   . GLU G 3 234 ? -17.661 81.296  101.609 1.00 124.08 ? 240  GLU C OE1   1 
ATOM   8120  O  OE2   . GLU G 3 234 ? -15.581 81.996  101.793 1.00 124.08 ? 240  GLU C OE2   1 
ATOM   8121  N  N     . GLU G 3 235 ? -17.549 75.670  102.893 1.00 71.89  ? 241  GLU C N     1 
ATOM   8122  C  CA    . GLU G 3 235 ? -18.269 74.713  103.714 1.00 71.89  ? 241  GLU C CA    1 
ATOM   8123  C  C     . GLU G 3 235 ? -17.390 73.492  103.956 1.00 71.89  ? 241  GLU C C     1 
ATOM   8124  O  O     . GLU G 3 235 ? -17.359 72.952  105.051 1.00 71.89  ? 241  GLU C O     1 
ATOM   8125  C  CB    . GLU G 3 235 ? -19.576 74.305  103.037 1.00 59.39  ? 241  GLU C CB    1 
ATOM   8126  N  N     . LEU G 3 236 ? -16.672 73.063  102.928 1.00 59.53  ? 242  LEU C N     1 
ATOM   8127  C  CA    . LEU G 3 236 ? -15.775 71.923  103.036 1.00 59.53  ? 242  LEU C CA    1 
ATOM   8128  C  C     . LEU G 3 236 ? -14.605 72.292  103.935 1.00 59.53  ? 242  LEU C C     1 
ATOM   8129  O  O     . LEU G 3 236 ? -14.163 71.506  104.763 1.00 59.53  ? 242  LEU C O     1 
ATOM   8130  C  CB    . LEU G 3 236 ? -15.243 71.570  101.652 1.00 53.57  ? 242  LEU C CB    1 
ATOM   8131  C  CG    . LEU G 3 236 ? -14.213 70.454  101.527 1.00 53.57  ? 242  LEU C CG    1 
ATOM   8132  C  CD1   . LEU G 3 236 ? -14.878 69.102  101.712 1.00 53.57  ? 242  LEU C CD1   1 
ATOM   8133  C  CD2   . LEU G 3 236 ? -13.577 70.532  100.164 1.00 53.57  ? 242  LEU C CD2   1 
ATOM   8134  N  N     . TYR G 3 237 ? -14.093 73.498  103.763 1.00 60.94  ? 243  TYR C N     1 
ATOM   8135  C  CA    . TYR G 3 237 ? -12.968 73.927  104.555 1.00 60.94  ? 243  TYR C CA    1 
ATOM   8136  C  C     . TYR G 3 237 ? -13.238 73.881  106.036 1.00 60.94  ? 243  TYR C C     1 
ATOM   8137  O  O     . TYR G 3 237 ? -12.303 73.816  106.825 1.00 60.94  ? 243  TYR C O     1 
ATOM   8138  C  CB    . TYR G 3 237 ? -12.545 75.345  104.187 1.00 47.68  ? 243  TYR C CB    1 
ATOM   8139  C  CG    . TYR G 3 237 ? -11.389 75.860  105.034 1.00 47.68  ? 243  TYR C CG    1 
ATOM   8140  C  CD1   . TYR G 3 237 ? -10.240 75.090  105.223 1.00 47.68  ? 243  TYR C CD1   1 
ATOM   8141  C  CD2   . TYR G 3 237 ? -11.427 77.124  105.605 1.00 47.68  ? 243  TYR C CD2   1 
ATOM   8142  C  CE1   . TYR G 3 237 ? -9.172  75.562  105.948 1.00 47.68  ? 243  TYR C CE1   1 
ATOM   8143  C  CE2   . TYR G 3 237 ? -10.353 77.607  106.334 1.00 47.68  ? 243  TYR C CE2   1 
ATOM   8144  C  CZ    . TYR G 3 237 ? -9.232  76.816  106.504 1.00 47.68  ? 243  TYR C CZ    1 
ATOM   8145  O  OH    . TYR G 3 237 ? -8.196  77.263  107.285 1.00 47.68  ? 243  TYR C OH    1 
ATOM   8146  N  N     . VAL G 3 238 ? -14.503 73.939  106.427 1.00 85.23  ? 244  VAL C N     1 
ATOM   8147  C  CA    . VAL G 3 238 ? -14.836 73.910  107.849 1.00 85.23  ? 244  VAL C CA    1 
ATOM   8148  C  C     . VAL G 3 238 ? -14.936 72.473  108.340 1.00 85.23  ? 244  VAL C C     1 
ATOM   8149  O  O     . VAL G 3 238 ? -14.596 72.155  109.473 1.00 85.23  ? 244  VAL C O     1 
ATOM   8150  C  CB    . VAL G 3 238 ? -16.176 74.651  108.118 1.00 51.80  ? 244  VAL C CB    1 
ATOM   8151  C  CG1   . VAL G 3 238 ? -17.161 73.743  108.826 1.00 51.80  ? 244  VAL C CG1   1 
ATOM   8152  C  CG2   . VAL G 3 238 ? -15.920 75.890  108.953 1.00 51.80  ? 244  VAL C CG2   1 
ATOM   8153  N  N     . GLU G 3 239 ? -15.409 71.617  107.455 1.00 68.61  ? 245  GLU C N     1 
ATOM   8154  C  CA    . GLU G 3 239 ? -15.595 70.206  107.720 1.00 68.61  ? 245  GLU C CA    1 
ATOM   8155  C  C     . GLU G 3 239 ? -14.229 69.560  107.890 1.00 68.61  ? 245  GLU C C     1 
ATOM   8156  O  O     . GLU G 3 239 ? -14.040 68.671  108.718 1.00 68.61  ? 245  GLU C O     1 
ATOM   8157  C  CB    . GLU G 3 239 ? -16.333 69.600  106.525 1.00 106.42 ? 245  GLU C CB    1 
ATOM   8158  C  CG    . GLU G 3 239 ? -16.848 68.197  106.683 1.00 106.42 ? 245  GLU C CG    1 
ATOM   8159  C  CD    . GLU G 3 239 ? -17.670 67.776  105.480 1.00 106.42 ? 245  GLU C CD    1 
ATOM   8160  O  OE1   . GLU G 3 239 ? -18.630 68.504  105.133 1.00 106.42 ? 245  GLU C OE1   1 
ATOM   8161  O  OE2   . GLU G 3 239 ? -17.355 66.725  104.882 1.00 106.42 ? 245  GLU C OE2   1 
ATOM   8162  N  N     . LEU G 3 240 ? -13.277 70.020  107.095 1.00 53.65  ? 246  LEU C N     1 
ATOM   8163  C  CA    . LEU G 3 240 ? -11.921 69.501  107.120 1.00 53.65  ? 246  LEU C CA    1 
ATOM   8164  C  C     . LEU G 3 240 ? -11.134 70.059  108.309 1.00 53.65  ? 246  LEU C C     1 
ATOM   8165  O  O     . LEU G 3 240 ? -10.629 69.313  109.145 1.00 53.65  ? 246  LEU C O     1 
ATOM   8166  C  CB    . LEU G 3 240 ? -11.211 69.886  105.818 1.00 41.60  ? 246  LEU C CB    1 
ATOM   8167  C  CG    . LEU G 3 240 ? -11.770 69.395  104.488 1.00 41.60  ? 246  LEU C CG    1 
ATOM   8168  C  CD1   . LEU G 3 240 ? -11.069 70.079  103.325 1.00 41.60  ? 246  LEU C CD1   1 
ATOM   8169  C  CD2   . LEU G 3 240 ? -11.573 67.914  104.406 1.00 41.60  ? 246  LEU C CD2   1 
ATOM   8170  N  N     . ALA G 3 241 ? -11.025 71.379  108.367 1.00 56.76  ? 247  ALA C N     1 
ATOM   8171  C  CA    . ALA G 3 241 ? -10.298 72.035  109.433 1.00 56.76  ? 247  ALA C CA    1 
ATOM   8172  C  C     . ALA G 3 241 ? -10.675 71.418  110.754 1.00 56.76  ? 247  ALA C C     1 
ATOM   8173  O  O     . ALA G 3 241 ? -9.883  71.450  111.705 1.00 56.76  ? 247  ALA C O     1 
ATOM   8174  C  CB    . ALA G 3 241 ? -10.620 73.507  109.449 1.00 91.00  ? 247  ALA C CB    1 
ATOM   8175  N  N     . ALA G 3 242 ? -11.891 70.865  110.797 1.00 66.38  ? 248  ALA C N     1 
ATOM   8176  C  CA    . ALA G 3 242 ? -12.449 70.217  111.984 1.00 66.38  ? 248  ALA C CA    1 
ATOM   8177  C  C     . ALA G 3 242 ? -11.969 68.786  112.104 1.00 66.38  ? 248  ALA C C     1 
ATOM   8178  O  O     . ALA G 3 242 ? -11.398 68.410  113.119 1.00 66.38  ? 248  ALA C O     1 
ATOM   8179  C  CB    . ALA G 3 242 ? -13.958 70.244  111.932 1.00 60.98  ? 248  ALA C CB    1 
ATOM   8180  N  N     . ARG G 3 243 ? -12.208 67.982  111.075 1.00 52.13  ? 249  ARG C N     1 
ATOM   8181  C  CA    . ARG G 3 243 ? -11.763 66.603  111.106 1.00 52.13  ? 249  ARG C CA    1 
ATOM   8182  C  C     . ARG G 3 243 ? -10.276 66.583  111.410 1.00 52.13  ? 249  ARG C C     1 
ATOM   8183  O  O     . ARG G 3 243 ? -9.760  65.625  111.977 1.00 52.13  ? 249  ARG C O     1 
ATOM   8184  C  CB    . ARG G 3 243 ? -12.027 65.930  109.769 1.00 54.92  ? 249  ARG C CB    1 
ATOM   8185  C  CG    . ARG G 3 243 ? -11.420 64.537  109.661 1.00 54.92  ? 249  ARG C CG    1 
ATOM   8186  C  CD    . ARG G 3 243 ? -11.824 63.658  110.841 1.00 54.92  ? 249  ARG C CD    1 
ATOM   8187  N  NE    . ARG G 3 243 ? -11.832 62.254  110.455 1.00 54.92  ? 249  ARG C NE    1 
ATOM   8188  C  CZ    . ARG G 3 243 ? -11.984 61.249  111.304 1.00 54.92  ? 249  ARG C CZ    1 
ATOM   8189  N  NH1   . ARG G 3 243 ? -12.140 61.500  112.603 1.00 54.92  ? 249  ARG C NH1   1 
ATOM   8190  N  NH2   . ARG G 3 243 ? -11.984 60.000  110.845 1.00 54.92  ? 249  ARG C NH2   1 
ATOM   8191  N  N     . ARG G 3 244 ? -9.586  67.649  111.027 1.00 62.81  ? 250  ARG C N     1 
ATOM   8192  C  CA    . ARG G 3 244 ? -8.161  67.740  111.292 1.00 62.81  ? 250  ARG C CA    1 
ATOM   8193  C  C     . ARG G 3 244 ? -7.963  67.922  112.779 1.00 62.81  ? 250  ARG C C     1 
ATOM   8194  O  O     . ARG G 3 244 ? -7.252  67.140  113.411 1.00 62.81  ? 250  ARG C O     1 
ATOM   8195  C  CB    . ARG G 3 244 ? -7.529  68.921  110.554 1.00 46.86  ? 250  ARG C CB    1 
ATOM   8196  C  CG    . ARG G 3 244 ? -6.120  69.256  111.027 1.00 46.86  ? 250  ARG C CG    1 
ATOM   8197  C  CD    . ARG G 3 244 ? -5.389  70.146  110.040 1.00 46.86  ? 250  ARG C CD    1 
ATOM   8198  N  NE    . ARG G 3 244 ? -5.981  71.472  109.913 1.00 46.86  ? 250  ARG C NE    1 
ATOM   8199  C  CZ    . ARG G 3 244 ? -5.620  72.348  108.984 1.00 46.86  ? 250  ARG C CZ    1 
ATOM   8200  N  NH1   . ARG G 3 244 ? -4.678  72.017  108.120 1.00 46.86  ? 250  ARG C NH1   1 
ATOM   8201  N  NH2   . ARG G 3 244 ? -6.188  73.547  108.909 1.00 46.86  ? 250  ARG C NH2   1 
ATOM   8202  N  N     . SER G 3 245 ? -8.605  68.958  113.322 1.00 52.19  ? 251  SER C N     1 
ATOM   8203  C  CA    . SER G 3 245 ? -8.524  69.293  114.741 1.00 52.19  ? 251  SER C CA    1 
ATOM   8204  C  C     . SER G 3 245 ? -8.660  68.081  115.663 1.00 52.19  ? 251  SER C C     1 
ATOM   8205  O  O     . SER G 3 245 ? -8.028  68.029  116.718 1.00 52.19  ? 251  SER C O     1 
ATOM   8206  C  CB    . SER G 3 245 ? -9.587  70.335  115.086 1.00 125.04 ? 251  SER C CB    1 
ATOM   8207  O  OG    . SER G 3 245 ? -9.410  71.499  114.296 1.00 125.04 ? 251  SER C OG    1 
ATOM   8208  N  N     . GLU G 3 246 ? -9.481  67.111  115.272 1.00 54.06  ? 252  GLU C N     1 
ATOM   8209  C  CA    . GLU G 3 246 ? -9.655  65.917  116.084 1.00 54.06  ? 252  GLU C CA    1 
ATOM   8210  C  C     . GLU G 3 246 ? -8.439  65.044  115.861 1.00 54.06  ? 252  GLU C C     1 
ATOM   8211  O  O     . GLU G 3 246 ? -7.597  64.932  116.747 1.00 54.06  ? 252  GLU C O     1 
ATOM   8212  C  CB    . GLU G 3 246 ? -10.929 65.169  115.697 1.00 45.15  ? 252  GLU C CB    1 
ATOM   8213  N  N     . LEU G 3 247 ? -8.347  64.443  114.677 1.00 59.20  ? 253  LEU C N     1 
ATOM   8214  C  CA    . LEU G 3 247 ? -7.214  63.594  114.310 1.00 59.20  ? 253  LEU C CA    1 
ATOM   8215  C  C     . LEU G 3 247 ? -5.950  64.085  115.022 1.00 59.20  ? 253  LEU C C     1 
ATOM   8216  O  O     . LEU G 3 247 ? -5.136  63.295  115.511 1.00 59.20  ? 253  LEU C O     1 
ATOM   8217  C  CB    . LEU G 3 247 ? -6.996  63.650  112.792 1.00 37.93  ? 253  LEU C CB    1 
ATOM   8218  C  CG    . LEU G 3 247 ? -8.085  63.088  111.879 1.00 37.93  ? 253  LEU C CG    1 
ATOM   8219  C  CD1   . LEU G 3 247 ? -7.611  63.156  110.444 1.00 37.93  ? 253  LEU C CD1   1 
ATOM   8220  C  CD2   . LEU G 3 247 ? -8.403  61.654  112.267 1.00 37.93  ? 253  LEU C CD2   1 
ATOM   8221  N  N     . LEU G 3 248 ? -5.794  65.403  115.061 1.00 58.34  ? 254  LEU C N     1 
ATOM   8222  C  CA    . LEU G 3 248 ? -4.663  66.008  115.725 1.00 58.34  ? 254  LEU C CA    1 
ATOM   8223  C  C     . LEU G 3 248 ? -4.725  65.570  117.176 1.00 58.34  ? 254  LEU C C     1 
ATOM   8224  O  O     . LEU G 3 248 ? -3.941  64.739  117.613 1.00 58.34  ? 254  LEU C O     1 
ATOM   8225  C  CB    . LEU G 3 248 ? -4.761  67.522  115.627 1.00 49.42  ? 254  LEU C CB    1 
ATOM   8226  C  CG    . LEU G 3 248 ? -3.753  68.279  116.490 1.00 49.42  ? 254  LEU C CG    1 
ATOM   8227  C  CD1   . LEU G 3 248 ? -2.350  67.867  116.058 1.00 49.42  ? 254  LEU C CD1   1 
ATOM   8228  C  CD2   . LEU G 3 248 ? -3.982  69.805  116.383 1.00 49.42  ? 254  LEU C CD2   1 
ATOM   8229  N  N     . ARG G 3 249 ? -5.681  66.119  117.915 1.00 81.61  ? 255  ARG C N     1 
ATOM   8230  C  CA    . ARG G 3 249 ? -5.863  65.782  119.327 1.00 81.61  ? 255  ARG C CA    1 
ATOM   8231  C  C     . ARG G 3 249 ? -5.738  64.290  119.593 1.00 81.61  ? 255  ARG C C     1 
ATOM   8232  O  O     . ARG G 3 249 ? -4.902  63.855  120.386 1.00 81.61  ? 255  ARG C O     1 
ATOM   8233  C  CB    . ARG G 3 249 ? -7.242  66.231  119.807 1.00 67.90  ? 255  ARG C CB    1 
ATOM   8234  C  CG    . ARG G 3 249 ? -7.528  65.883  121.257 1.00 67.90  ? 255  ARG C CG    1 
ATOM   8235  C  CD    . ARG G 3 249 ? -8.939  66.263  121.623 1.00 67.90  ? 255  ARG C CD    1 
ATOM   8236  N  NE    . ARG G 3 249 ? -9.916  65.358  121.030 1.00 67.90  ? 255  ARG C NE    1 
ATOM   8237  C  CZ    . ARG G 3 249 ? -10.093 64.098  121.415 1.00 67.90  ? 255  ARG C CZ    1 
ATOM   8238  N  NH1   . ARG G 3 249 ? -9.352  63.594  122.397 1.00 67.90  ? 255  ARG C NH1   1 
ATOM   8239  N  NH2   . ARG G 3 249 ? -11.017 63.346  120.825 1.00 67.90  ? 255  ARG C NH2   1 
ATOM   8240  N  N     . LYS G 3 250 ? -6.590  63.515  118.933 1.00 65.78  ? 256  LYS C N     1 
ATOM   8241  C  CA    . LYS G 3 250 ? -6.591  62.069  119.101 1.00 65.78  ? 256  LYS C CA    1 
ATOM   8242  C  C     . LYS G 3 250 ? -5.180  61.512  119.006 1.00 65.78  ? 256  LYS C C     1 
ATOM   8243  O  O     . LYS G 3 250 ? -4.870  60.501  119.646 1.00 65.78  ? 256  LYS C O     1 
ATOM   8244  C  CB    . LYS G 3 250 ? -7.497  61.401  118.054 1.00 54.65  ? 256  LYS C CB    1 
ATOM   8245  N  N     . LEU G 3 251 ? -4.330  62.182  118.222 1.00 56.74  ? 257  LEU C N     1 
ATOM   8246  C  CA    . LEU G 3 251 ? -2.943  61.759  118.039 1.00 56.74  ? 257  LEU C CA    1 
ATOM   8247  C  C     . LEU G 3 251 ? -2.000  62.336  119.077 1.00 56.74  ? 257  LEU C C     1 
ATOM   8248  O  O     . LEU G 3 251 ? -1.308  61.594  119.764 1.00 56.74  ? 257  LEU C O     1 
ATOM   8249  C  CB    . LEU G 3 251 ? -2.440  62.139  116.660 1.00 61.17  ? 257  LEU C CB    1 
ATOM   8250  C  CG    . LEU G 3 251 ? -3.211  61.532  115.509 1.00 61.17  ? 257  LEU C CG    1 
ATOM   8251  C  CD1   . LEU G 3 251 ? -2.381  61.731  114.276 1.00 61.17  ? 257  LEU C CD1   1 
ATOM   8252  C  CD2   . LEU G 3 251 ? -3.482  60.062  115.740 1.00 61.17  ? 257  LEU C CD2   1 
ATOM   8253  N  N     . THR G 3 252 ? -1.963  63.656  119.183 1.00 82.36  ? 258  THR C N     1 
ATOM   8254  C  CA    . THR G 3 252 ? -1.106  64.304  120.163 1.00 82.36  ? 258  THR C CA    1 
ATOM   8255  C  C     . THR G 3 252 ? -1.161  63.527  121.481 1.00 82.36  ? 258  THR C C     1 
ATOM   8256  O  O     . THR G 3 252 ? -0.201  63.534  122.267 1.00 82.36  ? 258  THR C O     1 
ATOM   8257  C  CB    . THR G 3 252 ? -1.562  65.756  120.424 1.00 105.13 ? 258  THR C CB    1 
ATOM   8258  O  OG1   . THR G 3 252 ? -2.994  65.806  120.477 1.00 105.13 ? 258  THR C OG1   1 
ATOM   8259  C  CG2   . THR G 3 252 ? -1.056  66.681  119.338 1.00 105.13 ? 258  THR C CG2   1 
ATOM   8260  N  N     . GLU G 3 253 ? -2.295  62.865  121.713 1.00 98.26  ? 259  GLU C N     1 
ATOM   8261  C  CA    . GLU G 3 253 ? -2.504  62.064  122.911 1.00 98.26  ? 259  GLU C CA    1 
ATOM   8262  C  C     . GLU G 3 253 ? -1.638  60.818  122.829 1.00 98.26  ? 259  GLU C C     1 
ATOM   8263  O  O     . GLU G 3 253 ? -0.801  60.562  123.697 1.00 98.26  ? 259  GLU C O     1 
ATOM   8264  C  CB    . GLU G 3 253 ? -3.978  61.665  123.022 1.00 113.79 ? 259  GLU C CB    1 
ATOM   8265  C  CG    . GLU G 3 253 ? -4.794  62.533  123.973 1.00 113.79 ? 259  GLU C CG    1 
ATOM   8266  C  CD    . GLU G 3 253 ? -5.021  61.867  125.328 1.00 113.79 ? 259  GLU C CD    1 
ATOM   8267  O  OE1   . GLU G 3 253 ? -5.743  60.847  125.372 1.00 113.79 ? 259  GLU C OE1   1 
ATOM   8268  O  OE2   . GLU G 3 253 ? -4.479  62.355  126.349 1.00 113.79 ? 259  GLU C OE2   1 
ATOM   8269  N  N     . THR G 3 254 ? -1.846  60.053  121.766 1.00 66.17  ? 260  THR C N     1 
ATOM   8270  C  CA    . THR G 3 254 ? -1.107  58.820  121.533 1.00 66.17  ? 260  THR C CA    1 
ATOM   8271  C  C     . THR G 3 254 ? 0.399   59.021  121.443 1.00 66.17  ? 260  THR C C     1 
ATOM   8272  O  O     . THR G 3 254 ? 1.183   58.129  121.777 1.00 66.17  ? 260  THR C O     1 
ATOM   8273  C  CB    . THR G 3 254 ? -1.563  58.169  120.231 1.00 62.15  ? 260  THR C CB    1 
ATOM   8274  O  OG1   . THR G 3 254 ? -2.971  57.952  120.295 1.00 62.15  ? 260  THR C OG1   1 
ATOM   8275  C  CG2   . THR G 3 254 ? -0.856  56.838  120.010 1.00 62.15  ? 260  THR C CG2   1 
ATOM   8276  N  N     . PHE G 3 255 ? 0.799   60.194  120.980 1.00 62.19  ? 261  PHE C N     1 
ATOM   8277  C  CA    . PHE G 3 255 ? 2.201   60.503  120.822 1.00 62.19  ? 261  PHE C CA    1 
ATOM   8278  C  C     . PHE G 3 255 ? 2.548   61.782  121.544 1.00 62.19  ? 261  PHE C C     1 
ATOM   8279  O  O     . PHE G 3 255 ? 2.426   62.873  120.992 1.00 62.19  ? 261  PHE C O     1 
ATOM   8280  C  CB    . PHE G 3 255 ? 2.506   60.672  119.362 1.00 45.47  ? 261  PHE C CB    1 
ATOM   8281  C  CG    . PHE G 3 255 ? 2.326   59.444  118.578 1.00 45.47  ? 261  PHE C CG    1 
ATOM   8282  C  CD1   . PHE G 3 255 ? 3.127   58.347  118.815 1.00 45.47  ? 261  PHE C CD1   1 
ATOM   8283  C  CD2   . PHE G 3 255 ? 1.393   59.396  117.558 1.00 45.47  ? 261  PHE C CD2   1 
ATOM   8284  C  CE1   . PHE G 3 255 ? 3.009   57.208  118.035 1.00 45.47  ? 261  PHE C CE1   1 
ATOM   8285  C  CE2   . PHE G 3 255 ? 1.260   58.274  116.774 1.00 45.47  ? 261  PHE C CE2   1 
ATOM   8286  C  CZ    . PHE G 3 255 ? 2.071   57.170  117.007 1.00 45.47  ? 261  PHE C CZ    1 
ATOM   8287  N  N     . GLY G 3 256 ? 3.001   61.654  122.779 1.00 80.70  ? 262  GLY C N     1 
ATOM   8288  C  CA    . GLY G 3 256 ? 3.342   62.836  123.539 1.00 80.70  ? 262  GLY C CA    1 
ATOM   8289  C  C     . GLY G 3 256 ? 4.477   63.642  122.948 1.00 80.70  ? 262  GLY C C     1 
ATOM   8290  O  O     . GLY G 3 256 ? 5.156   63.219  122.013 1.00 80.70  ? 262  GLY C O     1 
ATOM   8291  N  N     . SER G 3 257 ? 4.671   64.824  123.514 1.00 71.91  ? 263  SER C N     1 
ATOM   8292  C  CA    . SER G 3 257 ? 5.735   65.723  123.096 1.00 71.91  ? 263  SER C CA    1 
ATOM   8293  C  C     . SER G 3 257 ? 7.087   65.092  123.434 1.00 71.91  ? 263  SER C C     1 
ATOM   8294  O  O     . SER G 3 257 ? 7.174   63.907  123.770 1.00 71.91  ? 263  SER C O     1 
ATOM   8295  C  CB    . SER G 3 257 ? 5.628   67.052  123.851 1.00 98.32  ? 263  SER C CB    1 
ATOM   8296  O  OG    . SER G 3 257 ? 4.283   67.411  124.113 1.00 98.32  ? 263  SER C OG    1 
ATOM   8297  N  N     . TRP G 3 258 ? 8.135   65.903  123.352 1.00 61.42  ? 264  TRP C N     1 
ATOM   8298  C  CA    . TRP G 3 258 ? 9.483   65.454  123.667 1.00 61.42  ? 264  TRP C CA    1 
ATOM   8299  C  C     . TRP G 3 258 ? 10.462  66.595  123.447 1.00 61.42  ? 264  TRP C C     1 
ATOM   8300  O  O     . TRP G 3 258 ? 10.118  67.587  122.788 1.00 61.42  ? 264  TRP C O     1 
ATOM   8301  C  CB    . TRP G 3 258 ? 9.863   64.253  122.799 1.00 76.90  ? 264  TRP C CB    1 
ATOM   8302  C  CG    . TRP G 3 258 ? 10.156  64.572  121.363 1.00 76.90  ? 264  TRP C CG    1 
ATOM   8303  C  CD1   . TRP G 3 258 ? 11.340  65.018  120.845 1.00 76.90  ? 264  TRP C CD1   1 
ATOM   8304  C  CD2   . TRP G 3 258 ? 9.249   64.465  120.259 1.00 76.90  ? 264  TRP C CD2   1 
ATOM   8305  N  NE1   . TRP G 3 258 ? 11.224  65.192  119.487 1.00 76.90  ? 264  TRP C NE1   1 
ATOM   8306  C  CE2   . TRP G 3 258 ? 9.949   64.860  119.104 1.00 76.90  ? 264  TRP C CE2   1 
ATOM   8307  C  CE3   . TRP G 3 258 ? 7.909   64.075  120.135 1.00 76.90  ? 264  TRP C CE3   1 
ATOM   8308  C  CZ2   . TRP G 3 258 ? 9.354   64.877  117.843 1.00 76.90  ? 264  TRP C CZ2   1 
ATOM   8309  C  CZ3   . TRP G 3 258 ? 7.321   64.093  118.879 1.00 76.90  ? 264  TRP C CZ3   1 
ATOM   8310  C  CH2   . TRP G 3 258 ? 8.041   64.490  117.754 1.00 76.90  ? 264  TRP C CH2   1 
ATOM   8311  N  N     . TYR G 3 259 ? 11.672  66.459  124.003 1.00 51.97  ? 265  TYR C N     1 
ATOM   8312  C  CA    . TYR G 3 259 ? 12.698  67.496  123.867 1.00 51.97  ? 265  TYR C CA    1 
ATOM   8313  C  C     . TYR G 3 259 ? 13.701  67.173  122.802 1.00 51.97  ? 265  TYR C C     1 
ATOM   8314  O  O     . TYR G 3 259 ? 14.024  66.014  122.557 1.00 51.97  ? 265  TYR C O     1 
ATOM   8315  C  CB    . TYR G 3 259 ? 13.440  67.746  125.173 1.00 57.85  ? 265  TYR C CB    1 
ATOM   8316  C  CG    . TYR G 3 259 ? 12.604  68.463  126.191 1.00 57.85  ? 265  TYR C CG    1 
ATOM   8317  C  CD1   . TYR G 3 259 ? 11.490  67.851  126.756 1.00 57.85  ? 265  TYR C CD1   1 
ATOM   8318  C  CD2   . TYR G 3 259 ? 12.908  69.758  126.577 1.00 57.85  ? 265  TYR C CD2   1 
ATOM   8319  C  CE1   . TYR G 3 259 ? 10.696  68.507  127.679 1.00 57.85  ? 265  TYR C CE1   1 
ATOM   8320  C  CE2   . TYR G 3 259 ? 12.119  70.431  127.510 1.00 57.85  ? 265  TYR C CE2   1 
ATOM   8321  C  CZ    . TYR G 3 259 ? 11.009  69.799  128.057 1.00 57.85  ? 265  TYR C CZ    1 
ATOM   8322  O  OH    . TYR G 3 259 ? 10.209  70.460  128.965 1.00 57.85  ? 265  TYR C OH    1 
ATOM   8323  N  N     . GLN G 3 260 ? 14.191  68.232  122.175 1.00 76.69  ? 266  GLN C N     1 
ATOM   8324  C  CA    . GLN G 3 260 ? 15.144  68.132  121.092 1.00 76.69  ? 266  GLN C CA    1 
ATOM   8325  C  C     . GLN G 3 260 ? 16.147  69.267  121.293 1.00 76.69  ? 266  GLN C C     1 
ATOM   8326  O  O     . GLN G 3 260 ? 15.785  70.390  121.663 1.00 76.69  ? 266  GLN C O     1 
ATOM   8327  C  CB    . GLN G 3 260 ? 14.377  68.293  119.772 1.00 129.19 ? 266  GLN C CB    1 
ATOM   8328  C  CG    . GLN G 3 260 ? 15.036  67.739  118.526 1.00 129.19 ? 266  GLN C CG    1 
ATOM   8329  C  CD    . GLN G 3 260 ? 14.108  67.795  117.318 1.00 129.19 ? 266  GLN C CD    1 
ATOM   8330  O  OE1   . GLN G 3 260 ? 13.567  68.850  116.984 1.00 129.19 ? 266  GLN C OE1   1 
ATOM   8331  N  NE2   . GLN G 3 260 ? 13.926  66.657  116.657 1.00 129.19 ? 266  GLN C NE2   1 
ATOM   8332  N  N     . PRO G 3 261 ? 17.427  68.979  121.078 1.00 67.84  ? 267  PRO C N     1 
ATOM   8333  C  CA    . PRO G 3 261 ? 18.481  69.983  121.233 1.00 67.84  ? 267  PRO C CA    1 
ATOM   8334  C  C     . PRO G 3 261 ? 18.333  71.062  120.157 1.00 67.84  ? 267  PRO C C     1 
ATOM   8335  O  O     . PRO G 3 261 ? 18.214  70.727  118.978 1.00 67.84  ? 267  PRO C O     1 
ATOM   8336  C  CB    . PRO G 3 261 ? 19.749  69.154  121.038 1.00 65.97  ? 267  PRO C CB    1 
ATOM   8337  C  CG    . PRO G 3 261 ? 19.305  68.111  120.031 1.00 65.97  ? 267  PRO C CG    1 
ATOM   8338  C  CD    . PRO G 3 261 ? 17.971  67.699  120.592 1.00 65.97  ? 267  PRO C CD    1 
ATOM   8339  N  N     . LYS G 3 262 ? 18.344  72.339  120.543 1.00 79.98  ? 268  LYS C N     1 
ATOM   8340  C  CA    . LYS G 3 262 ? 18.216  73.417  119.561 1.00 79.98  ? 268  LYS C CA    1 
ATOM   8341  C  C     . LYS G 3 262 ? 18.635  74.787  120.078 1.00 79.98  ? 268  LYS C C     1 
ATOM   8342  O  O     . LYS G 3 262 ? 17.989  75.356  120.963 1.00 79.98  ? 268  LYS C O     1 
ATOM   8343  C  CB    . LYS G 3 262 ? 16.776  73.495  119.042 1.00 103.34 ? 268  LYS C CB    1 
ATOM   8344  N  N     . GLY G 3 263 ? 19.719  75.317  119.520 1.00 84.21  ? 269  GLY C N     1 
ATOM   8345  C  CA    . GLY G 3 263 ? 20.177  76.632  119.931 1.00 84.21  ? 269  GLY C CA    1 
ATOM   8346  C  C     . GLY G 3 263 ? 21.613  76.735  120.402 1.00 84.21  ? 269  GLY C C     1 
ATOM   8347  O  O     . GLY G 3 263 ? 22.124  77.847  120.578 1.00 84.21  ? 269  GLY C O     1 
ATOM   8348  N  N     . GLY G 3 264 ? 22.260  75.588  120.604 1.00 60.82  ? 270  GLY C N     1 
ATOM   8349  C  CA    . GLY G 3 264 ? 23.641  75.573  121.065 1.00 60.82  ? 270  GLY C CA    1 
ATOM   8350  C  C     . GLY G 3 264 ? 24.620  76.248  120.121 1.00 60.82  ? 270  GLY C C     1 
ATOM   8351  O  O     . GLY G 3 264 ? 24.623  75.966  118.924 1.00 60.82  ? 270  GLY C O     1 
ATOM   8352  N  N     . THR G 3 265 ? 25.450  77.140  120.653 1.00 85.00  ? 271  THR C N     1 
ATOM   8353  C  CA    . THR G 3 265 ? 26.423  77.851  119.829 1.00 85.00  ? 271  THR C CA    1 
ATOM   8354  C  C     . THR G 3 265 ? 27.766  77.130  119.755 1.00 85.00  ? 271  THR C C     1 
ATOM   8355  O  O     . THR G 3 265 ? 28.156  76.662  118.687 1.00 85.00  ? 271  THR C O     1 
ATOM   8356  C  CB    . THR G 3 265 ? 26.660  79.290  120.335 1.00 99.82  ? 271  THR C CB    1 
ATOM   8357  O  OG1   . THR G 3 265 ? 27.010  79.260  121.723 1.00 99.82  ? 271  THR C OG1   1 
ATOM   8358  C  CG2   . THR G 3 265 ? 25.417  80.135  120.142 1.00 99.82  ? 271  THR C CG2   1 
ATOM   8359  N  N     . GLU G 3 266 ? 28.476  77.045  120.877 1.00 119.22 ? 272  GLU C N     1 
ATOM   8360  C  CA    . GLU G 3 266 ? 29.771  76.366  120.901 1.00 119.22 ? 272  GLU C CA    1 
ATOM   8361  C  C     . GLU G 3 266 ? 29.573  74.855  120.766 1.00 119.22 ? 272  GLU C C     1 
ATOM   8362  O  O     . GLU G 3 266 ? 28.446  74.389  120.596 1.00 119.22 ? 272  GLU C O     1 
ATOM   8363  C  CB    . GLU G 3 266 ? 30.512  76.683  122.203 1.00 113.18 ? 272  GLU C CB    1 
ATOM   8364  N  N     . MET G 3 267 ? 30.669  74.098  120.825 1.00 123.57 ? 273  MET C N     1 
ATOM   8365  C  CA    . MET G 3 267 ? 30.613  72.629  120.726 1.00 123.57 ? 273  MET C CA    1 
ATOM   8366  C  C     . MET G 3 267 ? 31.124  72.021  122.028 1.00 123.57 ? 273  MET C C     1 
ATOM   8367  O  O     . MET G 3 267 ? 32.129  72.479  122.570 1.00 123.57 ? 273  MET C O     1 
ATOM   8368  C  CB    . MET G 3 267 ? 31.472  72.099  119.557 1.00 34.66  ? 273  MET C CB    1 
ATOM   8369  N  N     . PHE G 3 268 ? 30.436  70.999  122.533 1.00 177.71 ? 274  PHE C N     1 
ATOM   8370  C  CA    . PHE G 3 268 ? 30.863  70.357  123.774 1.00 177.71 ? 274  PHE C CA    1 
ATOM   8371  C  C     . PHE G 3 268 ? 32.297  69.890  123.622 1.00 177.71 ? 274  PHE C C     1 
ATOM   8372  O  O     . PHE G 3 268 ? 32.627  69.167  122.683 1.00 177.71 ? 274  PHE C O     1 
ATOM   8373  C  CB    . PHE G 3 268 ? 29.973  69.160  124.119 1.00 63.13  ? 274  PHE C CB    1 
ATOM   8374  N  N     . CYS G 3 269 ? 33.147  70.315  124.550 1.00 162.65 ? 275  CYS C N     1 
ATOM   8375  C  CA    . CYS G 3 269 ? 34.551  69.946  124.514 1.00 162.65 ? 275  CYS C CA    1 
ATOM   8376  C  C     . CYS G 3 269 ? 34.912  69.040  125.691 1.00 162.65 ? 275  CYS C C     1 
ATOM   8377  O  O     . CYS G 3 269 ? 34.609  69.345  126.846 1.00 162.65 ? 275  CYS C O     1 
ATOM   8378  C  CB    . CYS G 3 269 ? 35.417  71.213  124.497 1.00 142.92 ? 275  CYS C CB    1 
ATOM   8379  S  SG    . CYS G 3 269 ? 35.171  72.254  123.010 1.00 142.92 ? 275  CYS C SG    1 
ATOM   8380  N  N     . HIS G 3 270 ? 35.540  67.914  125.365 1.00 172.13 ? 276  HIS C N     1 
ATOM   8381  C  CA    . HIS G 3 270 ? 35.975  66.908  126.332 1.00 172.13 ? 276  HIS C CA    1 
ATOM   8382  C  C     . HIS G 3 270 ? 36.401  67.555  127.655 1.00 172.13 ? 276  HIS C C     1 
ATOM   8383  O  O     . HIS G 3 270 ? 37.141  68.538  127.657 1.00 172.13 ? 276  HIS C O     1 
ATOM   8384  C  CB    . HIS G 3 270 ? 37.155  66.148  125.726 1.00 102.12 ? 276  HIS C CB    1 
ATOM   8385  C  CG    . HIS G 3 270 ? 37.372  64.783  126.298 1.00 102.12 ? 276  HIS C CG    1 
ATOM   8386  N  ND1   . HIS G 3 270 ? 36.667  63.678  125.873 1.00 102.12 ? 276  HIS C ND1   1 
ATOM   8387  C  CD2   . HIS G 3 270 ? 38.259  64.332  127.217 1.00 102.12 ? 276  HIS C CD2   1 
ATOM   8388  C  CE1   . HIS G 3 270 ? 37.113  62.603  126.500 1.00 102.12 ? 276  HIS C CE1   1 
ATOM   8389  N  NE2   . HIS G 3 270 ? 38.080  62.972  127.320 1.00 102.12 ? 276  HIS C NE2   1 
ATOM   8390  N  N     . PRO G 3 271 ? 35.943  67.011  128.795 1.00 117.64 ? 277  PRO C N     1 
ATOM   8391  C  CA    . PRO G 3 271 ? 36.295  67.558  130.115 1.00 117.64 ? 277  PRO C CA    1 
ATOM   8392  C  C     . PRO G 3 271 ? 37.806  67.736  130.288 1.00 117.64 ? 277  PRO C C     1 
ATOM   8393  O  O     . PRO G 3 271 ? 38.270  68.700  130.903 1.00 117.64 ? 277  PRO C O     1 
ATOM   8394  C  CB    . PRO G 3 271 ? 35.709  66.525  131.074 1.00 153.28 ? 277  PRO C CB    1 
ATOM   8395  C  CG    . PRO G 3 271 ? 34.483  66.058  130.335 1.00 153.28 ? 277  PRO C CG    1 
ATOM   8396  C  CD    . PRO G 3 271 ? 35.020  65.869  128.931 1.00 153.28 ? 277  PRO C CD    1 
ATOM   8397  N  N     . ARG G 3 272 ? 38.555  66.788  129.734 1.00 158.21 ? 278  ARG C N     1 
ATOM   8398  C  CA    . ARG G 3 272 ? 40.011  66.797  129.778 1.00 158.21 ? 278  ARG C CA    1 
ATOM   8399  C  C     . ARG G 3 272 ? 40.515  67.388  128.463 1.00 158.21 ? 278  ARG C C     1 
ATOM   8400  O  O     . ARG G 3 272 ? 40.817  68.582  128.374 1.00 158.21 ? 278  ARG C O     1 
ATOM   8401  C  CB    . ARG G 3 272 ? 40.535  65.360  129.926 1.00 74.18  ? 278  ARG C CB    1 
ATOM   8402  N  N     . THR G 3 273 ? 40.578  66.528  127.447 1.00 175.93 ? 279  THR C N     1 
ATOM   8403  C  CA    . THR G 3 273 ? 41.038  66.893  126.108 1.00 175.93 ? 279  THR C CA    1 
ATOM   8404  C  C     . THR G 3 273 ? 40.646  68.299  125.685 1.00 175.93 ? 279  THR C C     1 
ATOM   8405  O  O     . THR G 3 273 ? 41.337  69.267  125.996 1.00 175.93 ? 279  THR C O     1 
ATOM   8406  C  CB    . THR G 3 273 ? 40.501  65.923  125.035 1.00 103.11 ? 279  THR C CB    1 
ATOM   8407  O  OG1   . THR G 3 273 ? 40.997  64.604  125.286 1.00 103.11 ? 279  THR C OG1   1 
ATOM   8408  C  CG2   . THR G 3 273 ? 40.944  66.364  123.649 1.00 103.11 ? 279  THR C CG2   1 
ATOM   8409  N  N     . GLY G 3 274 ? 39.534  68.402  124.966 1.00 164.89 ? 280  GLY C N     1 
ATOM   8410  C  CA    . GLY G 3 274 ? 39.075  69.691  124.494 1.00 164.89 ? 280  GLY C CA    1 
ATOM   8411  C  C     . GLY G 3 274 ? 38.639  69.575  123.049 1.00 164.89 ? 280  GLY C C     1 
ATOM   8412  O  O     . GLY G 3 274 ? 38.422  70.584  122.377 1.00 164.89 ? 280  GLY C O     1 
ATOM   8413  N  N     . LYS G 3 275 ? 38.514  68.337  122.570 1.00 172.53 ? 281  LYS C N     1 
ATOM   8414  C  CA    . LYS G 3 275 ? 38.095  68.102  121.193 1.00 172.53 ? 281  LYS C CA    1 
ATOM   8415  C  C     . LYS G 3 275 ? 36.662  68.550  120.973 1.00 172.53 ? 281  LYS C C     1 
ATOM   8416  O  O     . LYS G 3 275 ? 35.787  68.308  121.805 1.00 172.53 ? 281  LYS C O     1 
ATOM   8417  C  CB    . LYS G 3 275 ? 38.222  66.629  120.796 1.00 134.16 ? 281  LYS C CB    1 
ATOM   8418  C  CG    . LYS G 3 275 ? 37.505  66.313  119.475 1.00 134.16 ? 281  LYS C CG    1 
ATOM   8419  C  CD    . LYS G 3 275 ? 38.137  65.164  118.685 1.00 134.16 ? 281  LYS C CD    1 
ATOM   8420  C  CE    . LYS G 3 275 ? 38.159  63.854  119.457 1.00 134.16 ? 281  LYS C CE    1 
ATOM   8421  N  NZ    . LYS G 3 275 ? 39.079  63.909  120.635 1.00 134.16 ? 281  LYS C NZ    1 
ATOM   8422  N  N     . PRO G 3 276 ? 36.404  69.212  119.836 1.00 160.41 ? 282  PRO C N     1 
ATOM   8423  C  CA    . PRO G 3 276 ? 35.065  69.702  119.502 1.00 160.41 ? 282  PRO C CA    1 
ATOM   8424  C  C     . PRO G 3 276 ? 34.105  68.609  119.020 1.00 160.41 ? 282  PRO C C     1 
ATOM   8425  O  O     . PRO G 3 276 ? 33.544  68.720  117.928 1.00 160.41 ? 282  PRO C O     1 
ATOM   8426  C  CB    . PRO G 3 276 ? 35.351  70.748  118.426 1.00 124.11 ? 282  PRO C CB    1 
ATOM   8427  C  CG    . PRO G 3 276 ? 36.502  70.143  117.697 1.00 124.11 ? 282  PRO C CG    1 
ATOM   8428  C  CD    . PRO G 3 276 ? 37.386  69.631  118.818 1.00 124.11 ? 282  PRO C CD    1 
ATOM   8429  N  N     . LEU G 3 277 ? 33.907  67.569  119.837 1.00 155.04 ? 283  LEU C N     1 
ATOM   8430  C  CA    . LEU G 3 277 ? 33.015  66.464  119.461 1.00 155.04 ? 283  LEU C CA    1 
ATOM   8431  C  C     . LEU G 3 277 ? 31.712  66.990  118.873 1.00 155.04 ? 283  LEU C C     1 
ATOM   8432  O  O     . LEU G 3 277 ? 30.881  67.567  119.576 1.00 155.04 ? 283  LEU C O     1 
ATOM   8433  C  CB    . LEU G 3 277 ? 32.722  65.529  120.646 1.00 52.35  ? 283  LEU C CB    1 
ATOM   8434  C  CG    . LEU G 3 277 ? 33.898  64.681  121.172 1.00 52.35  ? 283  LEU C CG    1 
ATOM   8435  C  CD1   . LEU G 3 277 ? 33.451  63.729  122.297 1.00 52.35  ? 283  LEU C CD1   1 
ATOM   8436  C  CD2   . LEU G 3 277 ? 34.487  63.879  120.007 1.00 52.35  ? 283  LEU C CD2   1 
ATOM   8437  N  N     . PRO G 3 278 ? 31.522  66.785  117.557 1.00 131.28 ? 284  PRO C N     1 
ATOM   8438  C  CA    . PRO G 3 278 ? 30.352  67.215  116.785 1.00 131.28 ? 284  PRO C CA    1 
ATOM   8439  C  C     . PRO G 3 278 ? 29.073  66.429  117.054 1.00 131.28 ? 284  PRO C C     1 
ATOM   8440  O  O     . PRO G 3 278 ? 28.008  67.017  117.261 1.00 131.28 ? 284  PRO C O     1 
ATOM   8441  C  CB    . PRO G 3 278 ? 30.825  67.053  115.348 1.00 139.19 ? 284  PRO C CB    1 
ATOM   8442  C  CG    . PRO G 3 278 ? 31.605  65.779  115.435 1.00 139.19 ? 284  PRO C CG    1 
ATOM   8443  C  CD    . PRO G 3 278 ? 32.416  65.963  116.716 1.00 139.19 ? 284  PRO C CD    1 
ATOM   8444  N  N     . LYS G 3 279 ? 29.183  65.102  117.040 1.00 119.58 ? 285  LYS C N     1 
ATOM   8445  C  CA    . LYS G 3 279 ? 28.038  64.227  117.271 1.00 119.58 ? 285  LYS C CA    1 
ATOM   8446  C  C     . LYS G 3 279 ? 27.179  64.728  118.420 1.00 119.58 ? 285  LYS C C     1 
ATOM   8447  O  O     . LYS G 3 279 ? 25.958  64.638  118.375 1.00 119.58 ? 285  LYS C O     1 
ATOM   8448  C  CB    . LYS G 3 279 ? 28.509  62.806  117.571 1.00 67.44  ? 285  LYS C CB    1 
ATOM   8449  N  N     . TYR G 3 280 ? 27.829  65.256  119.448 1.00 79.06  ? 286  TYR C N     1 
ATOM   8450  C  CA    . TYR G 3 280 ? 27.137  65.776  120.616 1.00 79.06  ? 286  TYR C CA    1 
ATOM   8451  C  C     . TYR G 3 280 ? 26.501  67.143  120.348 1.00 79.06  ? 286  TYR C C     1 
ATOM   8452  O  O     . TYR G 3 280 ? 27.125  68.045  119.782 1.00 79.06  ? 286  TYR C O     1 
ATOM   8453  C  CB    . TYR G 3 280 ? 28.113  65.852  121.789 1.00 79.52  ? 286  TYR C CB    1 
ATOM   8454  C  CG    . TYR G 3 280 ? 28.366  64.525  122.477 1.00 79.52  ? 286  TYR C CG    1 
ATOM   8455  C  CD1   . TYR G 3 280 ? 27.557  64.102  123.539 1.00 79.52  ? 286  TYR C CD1   1 
ATOM   8456  C  CD2   . TYR G 3 280 ? 29.432  63.704  122.093 1.00 79.52  ? 286  TYR C CD2   1 
ATOM   8457  C  CE1   . TYR G 3 280 ? 27.808  62.893  124.215 1.00 79.52  ? 286  TYR C CE1   1 
ATOM   8458  C  CE2   . TYR G 3 280 ? 29.692  62.489  122.759 1.00 79.52  ? 286  TYR C CE2   1 
ATOM   8459  C  CZ    . TYR G 3 280 ? 28.879  62.093  123.822 1.00 79.52  ? 286  TYR C CZ    1 
ATOM   8460  O  OH    . TYR G 3 280 ? 29.150  60.926  124.514 1.00 79.52  ? 286  TYR C OH    1 
ATOM   8461  N  N     . PRO G 3 281 ? 25.236  67.303  120.756 1.00 115.64 ? 287  PRO C N     1 
ATOM   8462  C  CA    . PRO G 3 281 ? 24.435  68.521  120.602 1.00 115.64 ? 287  PRO C CA    1 
ATOM   8463  C  C     . PRO G 3 281 ? 25.134  69.791  121.090 1.00 115.64 ? 287  PRO C C     1 
ATOM   8464  O  O     . PRO G 3 281 ? 25.648  69.838  122.209 1.00 115.64 ? 287  PRO C O     1 
ATOM   8465  C  CB    . PRO G 3 281 ? 23.178  68.195  121.402 1.00 102.22 ? 287  PRO C CB    1 
ATOM   8466  C  CG    . PRO G 3 281 ? 23.031  66.719  121.185 1.00 102.22 ? 287  PRO C CG    1 
ATOM   8467  C  CD    . PRO G 3 281 ? 24.442  66.232  121.384 1.00 102.22 ? 287  PRO C CD    1 
ATOM   8468  N  N     . ARG G 3 282 ? 25.142  70.820  120.246 1.00 81.35  ? 288  ARG C N     1 
ATOM   8469  C  CA    . ARG G 3 282 ? 25.782  72.088  120.590 1.00 81.35  ? 288  ARG C CA    1 
ATOM   8470  C  C     . ARG G 3 282 ? 25.231  72.636  121.899 1.00 81.35  ? 288  ARG C C     1 
ATOM   8471  O  O     . ARG G 3 282 ? 24.044  72.499  122.197 1.00 81.35  ? 288  ARG C O     1 
ATOM   8472  C  CB    . ARG G 3 282 ? 25.598  73.114  119.462 1.00 91.35  ? 288  ARG C CB    1 
ATOM   8473  N  N     . ILE G 3 283 ? 26.114  73.264  122.664 1.00 111.95 ? 289  ILE C N     1 
ATOM   8474  C  CA    . ILE G 3 283 ? 25.787  73.818  123.967 1.00 111.95 ? 289  ILE C CA    1 
ATOM   8475  C  C     . ILE G 3 283 ? 25.961  75.330  123.990 1.00 111.95 ? 289  ILE C C     1 
ATOM   8476  O  O     . ILE G 3 283 ? 26.219  75.943  122.957 1.00 111.95 ? 289  ILE C O     1 
ATOM   8477  C  CB    . ILE G 3 283 ? 26.720  73.211  124.999 1.00 80.97  ? 289  ILE C CB    1 
ATOM   8478  C  CG1   . ILE G 3 283 ? 28.082  72.980  124.337 1.00 80.97  ? 289  ILE C CG1   1 
ATOM   8479  C  CG2   . ILE G 3 283 ? 26.117  71.918  125.564 1.00 80.97  ? 289  ILE C CG2   1 
ATOM   8480  C  CD1   . ILE G 3 283 ? 29.137  72.453  125.269 1.00 80.97  ? 289  ILE C CD1   1 
ATOM   8481  N  N     . LYS G 3 284 ? 25.816  75.922  125.172 1.00 109.04 ? 290  LYS C N     1 
ATOM   8482  C  CA    . LYS G 3 284 ? 25.985  77.358  125.336 1.00 109.04 ? 290  LYS C CA    1 
ATOM   8483  C  C     . LYS G 3 284 ? 26.693  77.597  126.667 1.00 109.04 ? 290  LYS C C     1 
ATOM   8484  O  O     . LYS G 3 284 ? 26.103  77.435  127.731 1.00 109.04 ? 290  LYS C O     1 
ATOM   8485  C  CB    . LYS G 3 284 ? 24.629  78.077  125.307 1.00 57.48  ? 290  LYS C CB    1 
ATOM   8486  N  N     . THR G 3 285 ? 27.968  77.969  126.590 1.00 120.17 ? 291  THR C N     1 
ATOM   8487  C  CA    . THR G 3 285 ? 28.791  78.233  127.768 1.00 120.17 ? 291  THR C CA    1 
ATOM   8488  C  C     . THR G 3 285 ? 28.814  79.745  128.033 1.00 120.17 ? 291  THR C C     1 
ATOM   8489  O  O     . THR G 3 285 ? 29.474  80.490  127.309 1.00 120.17 ? 291  THR C O     1 
ATOM   8490  C  CB    . THR G 3 285 ? 30.257  77.758  127.527 1.00 64.55  ? 291  THR C CB    1 
ATOM   8491  O  OG1   . THR G 3 285 ? 30.271  76.626  126.648 1.00 64.55  ? 291  THR C OG1   1 
ATOM   8492  C  CG2   . THR G 3 285 ? 30.915  77.358  128.846 1.00 64.55  ? 291  THR C CG2   1 
ATOM   8493  N  N     . PRO G 3 286 ? 28.096  80.213  129.069 1.00 151.62 ? 292  PRO C N     1 
ATOM   8494  C  CA    . PRO G 3 286 ? 28.033  81.638  129.424 1.00 151.62 ? 292  PRO C CA    1 
ATOM   8495  C  C     . PRO G 3 286 ? 29.130  82.063  130.405 1.00 151.62 ? 292  PRO C C     1 
ATOM   8496  O  O     . PRO G 3 286 ? 29.719  81.156  131.029 1.00 151.62 ? 292  PRO C O     1 
ATOM   8497  C  CB    . PRO G 3 286 ? 26.642  81.758  130.032 1.00 113.02 ? 292  PRO C CB    1 
ATOM   8498  C  CG    . PRO G 3 286 ? 26.549  80.468  130.825 1.00 113.02 ? 292  PRO C CG    1 
ATOM   8499  C  CD    . PRO G 3 286 ? 27.158  79.422  129.893 1.00 113.02 ? 292  PRO C CD    1 
ATOM   8500  N  N     . VAL G 3 288 ? 29.304  85.455  133.881 1.00 128.52 ? 294  VAL C N     1 
ATOM   8501  C  CA    . VAL G 3 288 ? 27.940  85.317  134.467 1.00 128.52 ? 294  VAL C CA    1 
ATOM   8502  C  C     . VAL G 3 288 ? 27.861  84.145  135.443 1.00 128.52 ? 294  VAL C C     1 
ATOM   8503  O  O     . VAL G 3 288 ? 28.188  83.013  135.088 1.00 128.52 ? 294  VAL C O     1 
ATOM   8504  C  CB    . VAL G 3 288 ? 26.885  85.111  133.359 1.00 135.96 ? 294  VAL C CB    1 
ATOM   8505  C  CG1   . VAL G 3 288 ? 26.675  86.404  132.589 1.00 135.96 ? 294  VAL C CG1   1 
ATOM   8506  C  CG2   . VAL G 3 288 ? 27.342  84.024  132.413 1.00 135.96 ? 294  VAL C CG2   1 
ATOM   8507  N  N     . GLY G 3 289 ? 27.427  84.424  136.671 1.00 132.97 ? 295  GLY C N     1 
ATOM   8508  C  CA    . GLY G 3 289 ? 27.311  83.383  137.679 1.00 132.97 ? 295  GLY C CA    1 
ATOM   8509  C  C     . GLY G 3 289 ? 28.650  82.893  138.202 1.00 132.97 ? 295  GLY C C     1 
ATOM   8510  O  O     . GLY G 3 289 ? 29.282  82.041  137.542 1.00 132.97 ? 295  GLY C O     1 
ATOM   8511  N  N     . ASP G 3 310 ? 22.782  84.512  144.854 1.00 110.52 ? 316  ASP C N     1 
ATOM   8512  C  CA    . ASP G 3 310 ? 22.621  84.797  143.397 1.00 110.52 ? 316  ASP C CA    1 
ATOM   8513  C  C     . ASP G 3 310 ? 21.512  83.952  142.758 1.00 110.52 ? 316  ASP C C     1 
ATOM   8514  O  O     . ASP G 3 310 ? 21.701  82.758  142.521 1.00 110.52 ? 316  ASP C O     1 
ATOM   8515  C  CB    . ASP G 3 310 ? 23.951  84.512  142.679 1.00 107.18 ? 316  ASP C CB    1 
ATOM   8516  C  CG    . ASP G 3 310 ? 23.952  84.965  141.219 1.00 107.18 ? 316  ASP C CG    1 
ATOM   8517  O  OD1   . ASP G 3 310 ? 24.970  84.744  140.520 1.00 107.18 ? 316  ASP C OD1   1 
ATOM   8518  O  OD2   . ASP G 3 310 ? 22.940  85.544  140.766 1.00 107.18 ? 316  ASP C OD2   1 
ATOM   8519  N  N     . THR G 3 311 ? 20.365  84.567  142.477 1.00 144.93 ? 317  THR C N     1 
ATOM   8520  C  CA    . THR G 3 311 ? 19.259  83.862  141.835 1.00 144.93 ? 317  THR C CA    1 
ATOM   8521  C  C     . THR G 3 311 ? 19.694  83.638  140.384 1.00 144.93 ? 317  THR C C     1 
ATOM   8522  O  O     . THR G 3 311 ? 18.872  83.601  139.465 1.00 144.93 ? 317  THR C O     1 
ATOM   8523  C  CB    . THR G 3 311 ? 17.965  84.715  141.850 1.00 128.12 ? 317  THR C CB    1 
ATOM   8524  O  OG1   . THR G 3 311 ? 17.714  85.183  143.182 1.00 128.12 ? 317  THR C OG1   1 
ATOM   8525  C  CG2   . THR G 3 311 ? 16.765  83.891  141.370 1.00 128.12 ? 317  THR C CG2   1 
ATOM   8526  N  N     . ARG G 3 312 ? 21.005  83.499  140.196 1.00 108.73 ? 318  ARG C N     1 
ATOM   8527  C  CA    . ARG G 3 312 ? 21.595  83.298  138.878 1.00 108.73 ? 318  ARG C CA    1 
ATOM   8528  C  C     . ARG G 3 312 ? 21.097  82.040  138.200 1.00 108.73 ? 318  ARG C C     1 
ATOM   8529  O  O     . ARG G 3 312 ? 20.983  80.980  138.816 1.00 108.73 ? 318  ARG C O     1 
ATOM   8530  C  CB    . ARG G 3 312 ? 23.118  83.229  138.967 1.00 129.07 ? 318  ARG C CB    1 
ATOM   8531  N  N     . GLU G 3 313 ? 20.823  82.178  136.911 1.00 107.72 ? 319  GLU C N     1 
ATOM   8532  C  CA    . GLU G 3 313 ? 20.329  81.087  136.085 1.00 107.72 ? 319  GLU C CA    1 
ATOM   8533  C  C     . GLU G 3 313 ? 21.476  80.160  135.702 1.00 107.72 ? 319  GLU C C     1 
ATOM   8534  O  O     . GLU G 3 313 ? 21.297  78.946  135.635 1.00 107.72 ? 319  GLU C O     1 
ATOM   8535  C  CB    . GLU G 3 313 ? 19.700  81.650  134.800 1.00 127.88 ? 319  GLU C CB    1 
ATOM   8536  C  CG    . GLU G 3 313 ? 18.859  82.912  135.007 1.00 127.88 ? 319  GLU C CG    1 
ATOM   8537  C  CD    . GLU G 3 313 ? 18.884  83.844  133.801 1.00 127.88 ? 319  GLU C CD    1 
ATOM   8538  O  OE1   . GLU G 3 313 ? 18.349  84.972  133.903 1.00 127.88 ? 319  GLU C OE1   1 
ATOM   8539  O  OE2   . GLU G 3 313 ? 19.439  83.450  132.753 1.00 127.88 ? 319  GLU C OE2   1 
ATOM   8540  N  N     . TYR G 3 314 ? 22.654  80.736  135.456 1.00 119.02 ? 320  TYR C N     1 
ATOM   8541  C  CA    . TYR G 3 314 ? 23.822  79.959  135.040 1.00 119.02 ? 320  TYR C CA    1 
ATOM   8542  C  C     . TYR G 3 314 ? 25.071  80.112  135.889 1.00 119.02 ? 320  TYR C C     1 
ATOM   8543  O  O     . TYR G 3 314 ? 25.076  80.803  136.902 1.00 119.02 ? 320  TYR C O     1 
ATOM   8544  C  CB    . TYR G 3 314 ? 24.183  80.296  133.595 1.00 93.05  ? 320  TYR C CB    1 
ATOM   8545  C  CG    . TYR G 3 314 ? 23.107  79.901  132.636 1.00 93.05  ? 320  TYR C CG    1 
ATOM   8546  C  CD1   . TYR G 3 314 ? 22.927  78.567  132.280 1.00 93.05  ? 320  TYR C CD1   1 
ATOM   8547  C  CD2   . TYR G 3 314 ? 22.207  80.843  132.144 1.00 93.05  ? 320  TYR C CD2   1 
ATOM   8548  C  CE1   . TYR G 3 314 ? 21.869  78.177  131.460 1.00 93.05  ? 320  TYR C CE1   1 
ATOM   8549  C  CE2   . TYR G 3 314 ? 21.146  80.469  131.325 1.00 93.05  ? 320  TYR C CE2   1 
ATOM   8550  C  CZ    . TYR G 3 314 ? 20.980  79.134  130.986 1.00 93.05  ? 320  TYR C CZ    1 
ATOM   8551  O  OH    . TYR G 3 314 ? 19.928  78.754  130.179 1.00 93.05  ? 320  TYR C OH    1 
ATOM   8552  N  N     . VAL G 3 315 ? 26.134  79.460  135.428 1.00 115.64 ? 321  VAL C N     1 
ATOM   8553  C  CA    . VAL G 3 315 ? 27.443  79.432  136.090 1.00 115.64 ? 321  VAL C CA    1 
ATOM   8554  C  C     . VAL G 3 315 ? 28.539  79.451  135.028 1.00 115.64 ? 321  VAL C C     1 
ATOM   8555  O  O     . VAL G 3 315 ? 28.314  79.044  133.891 1.00 115.64 ? 321  VAL C O     1 
ATOM   8556  C  CB    . VAL G 3 315 ? 27.643  78.087  136.888 1.00 58.96  ? 321  VAL C CB    1 
ATOM   8557  C  CG1   . VAL G 3 315 ? 29.125  77.857  137.223 1.00 58.96  ? 321  VAL C CG1   1 
ATOM   8558  C  CG2   . VAL G 3 315 ? 26.794  78.083  138.144 1.00 58.96  ? 321  VAL C CG2   1 
ATOM   8559  N  N     . ALA G 3 316 ? 29.729  79.895  135.408 1.00 109.86 ? 322  ALA C N     1 
ATOM   8560  C  CA    . ALA G 3 316 ? 30.854  79.914  134.489 1.00 109.86 ? 322  ALA C CA    1 
ATOM   8561  C  C     . ALA G 3 316 ? 31.811  78.797  134.889 1.00 109.86 ? 322  ALA C C     1 
ATOM   8562  O  O     . ALA G 3 316 ? 31.698  78.359  136.057 1.00 109.86 ? 322  ALA C O     1 
ATOM   8563  C  CB    . ALA G 3 316 ? 31.557  81.257  134.554 1.00 87.86  ? 322  ALA C CB    1 
ATOM   8564  N  N     . ALA G 3 318 ? 30.500  76.390  133.099 1.00 91.60  ? 324  ALA C N     1 
ATOM   8565  C  CA    . ALA G 3 318 ? 29.392  75.417  133.342 1.00 91.60  ? 324  ALA C CA    1 
ATOM   8566  C  C     . ALA G 3 318 ? 28.444  75.385  132.147 1.00 91.60  ? 324  ALA C C     1 
ATOM   8567  O  O     . ALA G 3 318 ? 27.429  76.086  132.126 1.00 91.60  ? 324  ALA C O     1 
ATOM   8568  C  CB    . ALA G 3 318 ? 28.625  75.788  134.620 1.00 86.45  ? 324  ALA C CB    1 
ATOM   8569  N  N     . PRO G 3 319 ? 28.775  74.575  131.127 1.00 122.93 ? 325  PRO C N     1 
ATOM   8570  C  CA    . PRO G 3 319 ? 27.980  74.416  129.900 1.00 122.93 ? 325  PRO C CA    1 
ATOM   8571  C  C     . PRO G 3 319 ? 26.592  73.818  130.105 1.00 122.93 ? 325  PRO C C     1 
ATOM   8572  O  O     . PRO G 3 319 ? 26.275  73.316  131.176 1.00 122.93 ? 325  PRO C O     1 
ATOM   8573  C  CB    . PRO G 3 319 ? 28.863  73.521  129.024 1.00 61.61  ? 325  PRO C CB    1 
ATOM   8574  C  CG    . PRO G 3 319 ? 29.718  72.774  130.023 1.00 61.61  ? 325  PRO C CG    1 
ATOM   8575  C  CD    . PRO G 3 319 ? 30.057  73.855  131.010 1.00 61.61  ? 325  PRO C CD    1 
ATOM   8576  N  N     . TYR G 3 320 ? 25.770  73.876  129.065 1.00 92.82  ? 326  TYR C N     1 
ATOM   8577  C  CA    . TYR G 3 320 ? 24.424  73.326  129.129 1.00 92.82  ? 326  TYR C CA    1 
ATOM   8578  C  C     . TYR G 3 320 ? 23.791  73.339  127.742 1.00 92.82  ? 326  TYR C C     1 
ATOM   8579  O  O     . TYR G 3 320 ? 23.879  74.328  127.012 1.00 92.82  ? 326  TYR C O     1 
ATOM   8580  C  CB    . TYR G 3 320 ? 23.546  74.134  130.094 1.00 88.41  ? 326  TYR C CB    1 
ATOM   8581  C  CG    . TYR G 3 320 ? 23.011  75.426  129.503 1.00 88.41  ? 326  TYR C CG    1 
ATOM   8582  C  CD1   . TYR G 3 320 ? 23.865  76.495  129.218 1.00 88.41  ? 326  TYR C CD1   1 
ATOM   8583  C  CD2   . TYR G 3 320 ? 21.659  75.561  129.178 1.00 88.41  ? 326  TYR C CD2   1 
ATOM   8584  C  CE1   . TYR G 3 320 ? 23.386  77.661  128.620 1.00 88.41  ? 326  TYR C CE1   1 
ATOM   8585  C  CE2   . TYR G 3 320 ? 21.177  76.717  128.585 1.00 88.41  ? 326  TYR C CE2   1 
ATOM   8586  C  CZ    . TYR G 3 320 ? 22.045  77.759  128.309 1.00 88.41  ? 326  TYR C CZ    1 
ATOM   8587  O  OH    . TYR G 3 320 ? 21.574  78.902  127.722 1.00 88.41  ? 326  TYR C OH    1 
ATOM   8588  N  N     . THR G 3 321 ? 23.151  72.236  127.376 1.00 108.68 ? 327  THR C N     1 
ATOM   8589  C  CA    . THR G 3 321 ? 22.505  72.155  126.076 1.00 108.68 ? 327  THR C CA    1 
ATOM   8590  C  C     . THR G 3 321 ? 21.115  72.789  126.137 1.00 108.68 ? 327  THR C C     1 
ATOM   8591  O  O     . THR G 3 321 ? 20.265  72.394  126.939 1.00 108.68 ? 327  THR C O     1 
ATOM   8592  C  CB    . THR G 3 321 ? 22.383  70.688  125.583 1.00 81.72  ? 327  THR C CB    1 
ATOM   8593  O  OG1   . THR G 3 321 ? 23.687  70.102  125.450 1.00 81.72  ? 327  THR C OG1   1 
ATOM   8594  C  CG2   . THR G 3 321 ? 21.693  70.647  124.229 1.00 81.72  ? 327  THR C CG2   1 
ATOM   8595  N  N     . PRO G 3 322 ? 20.879  73.801  125.292 1.00 88.42  ? 328  PRO C N     1 
ATOM   8596  C  CA    . PRO G 3 322 ? 19.606  74.524  125.211 1.00 88.42  ? 328  PRO C CA    1 
ATOM   8597  C  C     . PRO G 3 322 ? 18.656  73.695  124.366 1.00 88.42  ? 328  PRO C C     1 
ATOM   8598  O  O     . PRO G 3 322 ? 18.987  73.342  123.237 1.00 88.42  ? 328  PRO C O     1 
ATOM   8599  C  CB    . PRO G 3 322 ? 20.006  75.814  124.522 1.00 66.29  ? 328  PRO C CB    1 
ATOM   8600  C  CG    . PRO G 3 322 ? 21.041  75.308  123.522 1.00 66.29  ? 328  PRO C CG    1 
ATOM   8601  C  CD    . PRO G 3 322 ? 21.867  74.346  124.341 1.00 66.29  ? 328  PRO C CD    1 
ATOM   8602  N  N     . VAL G 3 323 ? 17.482  73.377  124.891 1.00 79.53  ? 329  VAL C N     1 
ATOM   8603  C  CA    . VAL G 3 323 ? 16.563  72.567  124.117 1.00 79.53  ? 329  VAL C CA    1 
ATOM   8604  C  C     . VAL G 3 323 ? 15.198  73.186  123.924 1.00 79.53  ? 329  VAL C C     1 
ATOM   8605  O  O     . VAL G 3 323 ? 14.862  74.202  124.542 1.00 79.53  ? 329  VAL C O     1 
ATOM   8606  C  CB    . VAL G 3 323 ? 16.396  71.185  124.743 1.00 56.03  ? 329  VAL C CB    1 
ATOM   8607  C  CG1   . VAL G 3 323 ? 17.677  70.392  124.584 1.00 56.03  ? 329  VAL C CG1   1 
ATOM   8608  C  CG2   . VAL G 3 323 ? 16.038  71.327  126.215 1.00 56.03  ? 329  VAL C CG2   1 
ATOM   8609  N  N     . GLU G 3 324 ? 14.417  72.570  123.040 1.00 73.55  ? 330  GLU C N     1 
ATOM   8610  C  CA    . GLU G 3 324 ? 13.073  73.040  122.746 1.00 73.55  ? 330  GLU C CA    1 
ATOM   8611  C  C     . GLU G 3 324 ? 12.089  71.906  122.974 1.00 73.55  ? 330  GLU C C     1 
ATOM   8612  O  O     . GLU G 3 324 ? 12.409  70.733  122.784 1.00 73.55  ? 330  GLU C O     1 
ATOM   8613  C  CB    . GLU G 3 324 ? 12.977  73.528  121.295 1.00 95.38  ? 330  GLU C CB    1 
ATOM   8614  N  N     . HIS G 3 325 ? 10.896  72.274  123.416 1.00 52.20  ? 331  HIS C N     1 
ATOM   8615  C  CA    . HIS G 3 325 ? 9.823   71.327  123.664 1.00 52.20  ? 331  HIS C CA    1 
ATOM   8616  C  C     . HIS G 3 325 ? 9.050   71.265  122.349 1.00 52.20  ? 331  HIS C C     1 
ATOM   8617  O  O     . HIS G 3 325 ? 8.556   72.286  121.859 1.00 52.20  ? 331  HIS C O     1 
ATOM   8618  C  CB    . HIS G 3 325 ? 8.943   71.848  124.790 1.00 113.33 ? 331  HIS C CB    1 
ATOM   8619  C  CG    . HIS G 3 325 ? 7.743   71.005  125.054 1.00 113.33 ? 331  HIS C CG    1 
ATOM   8620  N  ND1   . HIS G 3 325 ? 6.830   71.308  126.039 1.00 113.33 ? 331  HIS C ND1   1 
ATOM   8621  C  CD2   . HIS G 3 325 ? 7.288   69.885  124.447 1.00 113.33 ? 331  HIS C CD2   1 
ATOM   8622  C  CE1   . HIS G 3 325 ? 5.861   70.410  126.025 1.00 113.33 ? 331  HIS C CE1   1 
ATOM   8623  N  NE2   . HIS G 3 325 ? 6.114   69.537  125.068 1.00 113.33 ? 331  HIS C NE2   1 
ATOM   8624  N  N     . VAL G 3 326 ? 8.947   70.065  121.782 1.00 70.06  ? 332  VAL C N     1 
ATOM   8625  C  CA    . VAL G 3 326 ? 8.284   69.884  120.495 1.00 70.06  ? 332  VAL C CA    1 
ATOM   8626  C  C     . VAL G 3 326 ? 7.127   68.883  120.455 1.00 70.06  ? 332  VAL C C     1 
ATOM   8627  O  O     . VAL G 3 326 ? 7.317   67.687  120.677 1.00 70.06  ? 332  VAL C O     1 
ATOM   8628  C  CB    . VAL G 3 326 ? 9.331   69.482  119.431 1.00 76.88  ? 332  VAL C CB    1 
ATOM   8629  C  CG1   . VAL G 3 326 ? 10.161  68.319  119.932 1.00 76.88  ? 332  VAL C CG1   1 
ATOM   8630  C  CG2   . VAL G 3 326 ? 8.649   69.114  118.135 1.00 76.88  ? 332  VAL C CG2   1 
ATOM   8631  N  N     . VAL G 3 327 ? 5.939   69.395  120.133 1.00 88.23  ? 333  VAL C N     1 
ATOM   8632  C  CA    . VAL G 3 327 ? 4.714   68.603  120.038 1.00 88.23  ? 333  VAL C CA    1 
ATOM   8633  C  C     . VAL G 3 327 ? 4.559   67.823  118.736 1.00 88.23  ? 333  VAL C C     1 
ATOM   8634  O  O     . VAL G 3 327 ? 4.717   68.374  117.648 1.00 88.23  ? 333  VAL C O     1 
ATOM   8635  C  CB    . VAL G 3 327 ? 3.486   69.496  120.184 1.00 57.17  ? 333  VAL C CB    1 
ATOM   8636  C  CG1   . VAL G 3 327 ? 2.292   68.871  119.467 1.00 57.17  ? 333  VAL C CG1   1 
ATOM   8637  C  CG2   . VAL G 3 327 ? 3.175   69.681  121.639 1.00 57.17  ? 333  VAL C CG2   1 
ATOM   8638  N  N     . PHE G 3 328 ? 4.208   66.546  118.858 1.00 91.53  ? 334  PHE C N     1 
ATOM   8639  C  CA    . PHE G 3 328 ? 4.023   65.676  117.703 1.00 91.53  ? 334  PHE C CA    1 
ATOM   8640  C  C     . PHE G 3 328 ? 3.235   66.395  116.628 1.00 91.53  ? 334  PHE C C     1 
ATOM   8641  O  O     . PHE G 3 328 ? 2.200   66.990  116.916 1.00 91.53  ? 334  PHE C O     1 
ATOM   8642  C  CB    . PHE G 3 328 ? 3.256   64.410  118.098 1.00 49.39  ? 334  PHE C CB    1 
ATOM   8643  C  CG    . PHE G 3 328 ? 3.142   63.412  116.991 1.00 49.39  ? 334  PHE C CG    1 
ATOM   8644  C  CD1   . PHE G 3 328 ? 4.234   62.650  116.611 1.00 49.39  ? 334  PHE C CD1   1 
ATOM   8645  C  CD2   . PHE G 3 328 ? 1.958   63.271  116.284 1.00 49.39  ? 334  PHE C CD2   1 
ATOM   8646  C  CE1   . PHE G 3 328 ? 4.148   61.763  115.536 1.00 49.39  ? 334  PHE C CE1   1 
ATOM   8647  C  CE2   . PHE G 3 328 ? 1.865   62.382  115.202 1.00 49.39  ? 334  PHE C CE2   1 
ATOM   8648  C  CZ    . PHE G 3 328 ? 2.962   61.634  114.833 1.00 49.39  ? 334  PHE C CZ    1 
ATOM   8649  N  N     . ASN G 3 329 ? 3.729   66.352  115.395 1.00 64.75  ? 335  ASN C N     1 
ATOM   8650  C  CA    . ASN G 3 329 ? 3.016   66.972  114.287 1.00 64.75  ? 335  ASN C CA    1 
ATOM   8651  C  C     . ASN G 3 329 ? 2.792   65.971  113.151 1.00 64.75  ? 335  ASN C C     1 
ATOM   8652  O  O     . ASN G 3 329 ? 3.701   65.647  112.403 1.00 64.75  ? 335  ASN C O     1 
ATOM   8653  C  CB    . ASN G 3 329 ? 3.759   68.195  113.773 1.00 115.69 ? 335  ASN C CB    1 
ATOM   8654  C  CG    . ASN G 3 329 ? 2.874   69.078  112.941 1.00 115.69 ? 335  ASN C CG    1 
ATOM   8655  O  OD1   . ASN G 3 329 ? 2.489   68.715  111.833 1.00 115.69 ? 335  ASN C OD1   1 
ATOM   8656  N  ND2   . ASN G 3 329 ? 2.515   70.236  113.482 1.00 115.69 ? 335  ASN C ND2   1 
ATOM   8657  N  N     . PRO G 3 330 ? 1.561   65.469  113.013 1.00 61.26  ? 336  PRO C N     1 
ATOM   8658  C  CA    . PRO G 3 330 ? 1.232   64.501  111.968 1.00 61.26  ? 336  PRO C CA    1 
ATOM   8659  C  C     . PRO G 3 330 ? 1.740   64.875  110.584 1.00 61.26  ? 336  PRO C C     1 
ATOM   8660  O  O     . PRO G 3 330 ? 1.987   64.001  109.756 1.00 61.26  ? 336  PRO C O     1 
ATOM   8661  C  CB    . PRO G 3 330 ? -0.292  64.441  112.024 1.00 70.17  ? 336  PRO C CB    1 
ATOM   8662  C  CG    . PRO G 3 330 ? -0.576  64.655  113.464 1.00 70.17  ? 336  PRO C CG    1 
ATOM   8663  C  CD    . PRO G 3 330 ? 0.359   65.804  113.797 1.00 70.17  ? 336  PRO C CD    1 
ATOM   8664  N  N     . SER G 3 331 ? 1.892   66.168  110.326 1.00 59.92  ? 337  SER C N     1 
ATOM   8665  C  CA    . SER G 3 331 ? 2.369   66.623  109.023 1.00 59.92  ? 337  SER C CA    1 
ATOM   8666  C  C     . SER G 3 331 ? 3.852   66.321  108.846 1.00 59.92  ? 337  SER C C     1 
ATOM   8667  O  O     . SER G 3 331 ? 4.295   66.037  107.735 1.00 59.92  ? 337  SER C O     1 
ATOM   8668  C  CB    . SER G 3 331 ? 2.160   68.132  108.856 1.00 94.79  ? 337  SER C CB    1 
ATOM   8669  O  OG    . SER G 3 331 ? 0.813   68.511  109.049 1.00 94.79  ? 337  SER C OG    1 
ATOM   8670  N  N     . SER G 3 332 ? 4.613   66.400  109.940 1.00 45.30  ? 338  SER C N     1 
ATOM   8671  C  CA    . SER G 3 332 ? 6.053   66.154  109.924 1.00 45.30  ? 338  SER C CA    1 
ATOM   8672  C  C     . SER G 3 332 ? 6.391   64.717  109.636 1.00 45.30  ? 338  SER C C     1 
ATOM   8673  O  O     . SER G 3 332 ? 6.161   63.847  110.465 1.00 45.30  ? 338  SER C O     1 
ATOM   8674  C  CB    . SER G 3 332 ? 6.677   66.517  111.258 1.00 60.43  ? 338  SER C CB    1 
ATOM   8675  O  OG    . SER G 3 332 ? 7.986   65.988  111.321 1.00 60.43  ? 338  SER C OG    1 
ATOM   8676  N  N     . ARG G 3 333 ? 6.952   64.463  108.460 1.00 88.29  ? 339  ARG C N     1 
ATOM   8677  C  CA    . ARG G 3 333 ? 7.309   63.102  108.086 1.00 88.29  ? 339  ARG C CA    1 
ATOM   8678  C  C     . ARG G 3 333 ? 8.438   62.611  108.996 1.00 88.29  ? 339  ARG C C     1 
ATOM   8679  O  O     . ARG G 3 333 ? 8.705   61.410  109.094 1.00 88.29  ? 339  ARG C O     1 
ATOM   8680  C  CB    . ARG G 3 333 ? 7.729   63.060  106.614 1.00 63.61  ? 339  ARG C CB    1 
ATOM   8681  N  N     . ASP G 3 334 ? 9.083   63.559  109.674 1.00 80.47  ? 340  ASP C N     1 
ATOM   8682  C  CA    . ASP G 3 334 ? 10.175  63.259  110.589 1.00 80.47  ? 340  ASP C CA    1 
ATOM   8683  C  C     . ASP G 3 334 ? 9.557   62.633  111.835 1.00 80.47  ? 340  ASP C C     1 
ATOM   8684  O  O     . ASP G 3 334 ? 9.845   61.483  112.161 1.00 80.47  ? 340  ASP C O     1 
ATOM   8685  C  CB    . ASP G 3 334 ? 10.935  64.549  110.938 1.00 114.97 ? 340  ASP C CB    1 
ATOM   8686  C  CG    . ASP G 3 334 ? 12.373  64.292  111.394 1.00 114.97 ? 340  ASP C CG    1 
ATOM   8687  O  OD1   . ASP G 3 334 ? 13.089  63.512  110.729 1.00 114.97 ? 340  ASP C OD1   1 
ATOM   8688  O  OD2   . ASP G 3 334 ? 12.800  64.884  112.409 1.00 114.97 ? 340  ASP C OD2   1 
ATOM   8689  N  N     . HIS G 3 335 ? 8.701   63.388  112.522 1.00 54.99  ? 341  HIS C N     1 
ATOM   8690  C  CA    . HIS G 3 335 ? 8.027   62.881  113.720 1.00 54.99  ? 341  HIS C CA    1 
ATOM   8691  C  C     . HIS G 3 335 ? 7.429   61.501  113.430 1.00 54.99  ? 341  HIS C C     1 
ATOM   8692  O  O     . HIS G 3 335 ? 7.612   60.557  114.187 1.00 54.99  ? 341  HIS C O     1 
ATOM   8693  C  CB    . HIS G 3 335 ? 6.898   63.824  114.152 1.00 54.46  ? 341  HIS C CB    1 
ATOM   8694  C  CG    . HIS G 3 335 ? 7.346   65.218  114.458 1.00 54.46  ? 341  HIS C CG    1 
ATOM   8695  N  ND1   . HIS G 3 335 ? 6.465   66.218  114.811 1.00 54.46  ? 341  HIS C ND1   1 
ATOM   8696  C  CD2   . HIS G 3 335 ? 8.581   65.771  114.511 1.00 54.46  ? 341  HIS C CD2   1 
ATOM   8697  C  CE1   . HIS G 3 335 ? 7.138   67.325  115.074 1.00 54.46  ? 341  HIS C CE1   1 
ATOM   8698  N  NE2   . HIS G 3 335 ? 8.424   67.080  114.901 1.00 54.46  ? 341  HIS C NE2   1 
ATOM   8699  N  N     . ILE G 3 336 ? 6.711   61.385  112.325 1.00 48.43  ? 342  ILE C N     1 
ATOM   8700  C  CA    . ILE G 3 336 ? 6.105   60.116  111.973 1.00 48.43  ? 342  ILE C CA    1 
ATOM   8701  C  C     . ILE G 3 336 ? 7.150   58.995  111.946 1.00 48.43  ? 342  ILE C C     1 
ATOM   8702  O  O     . ILE G 3 336 ? 6.863   57.862  112.356 1.00 48.43  ? 342  ILE C O     1 
ATOM   8703  C  CB    . ILE G 3 336 ? 5.392   60.206  110.608 1.00 65.29  ? 342  ILE C CB    1 
ATOM   8704  C  CG1   . ILE G 3 336 ? 4.232   61.194  110.708 1.00 65.29  ? 342  ILE C CG1   1 
ATOM   8705  C  CG2   . ILE G 3 336 ? 4.875   58.835  110.185 1.00 65.29  ? 342  ILE C CG2   1 
ATOM   8706  C  CD1   . ILE G 3 336 ? 3.510   61.425  109.413 1.00 65.29  ? 342  ILE C CD1   1 
ATOM   8707  N  N     . GLN G 3 337 ? 8.356   59.322  111.470 1.00 67.67  ? 343  GLN C N     1 
ATOM   8708  C  CA    . GLN G 3 337 ? 9.480   58.376  111.388 1.00 67.67  ? 343  GLN C CA    1 
ATOM   8709  C  C     . GLN G 3 337 ? 10.052  58.099  112.777 1.00 67.67  ? 343  GLN C C     1 
ATOM   8710  O  O     . GLN G 3 337 ? 10.377  56.963  113.116 1.00 67.67  ? 343  GLN C O     1 
ATOM   8711  C  CB    . GLN G 3 337 ? 10.565  58.957  110.475 1.00 92.08  ? 343  GLN C CB    1 
ATOM   8712  C  CG    . GLN G 3 337 ? 11.914  58.248  110.502 1.00 92.08  ? 343  GLN C CG    1 
ATOM   8713  C  CD    . GLN G 3 337 ? 12.781  58.665  111.678 1.00 92.08  ? 343  GLN C CD    1 
ATOM   8714  O  OE1   . GLN G 3 337 ? 12.587  58.209  112.799 1.00 92.08  ? 343  GLN C OE1   1 
ATOM   8715  N  NE2   . GLN G 3 337 ? 13.742  59.546  111.424 1.00 92.08  ? 343  GLN C NE2   1 
ATOM   8716  N  N     . LYS G 3 338 ? 10.185  59.155  113.574 1.00 60.13  ? 344  LYS C N     1 
ATOM   8717  C  CA    . LYS G 3 338 ? 10.703  59.016  114.926 1.00 60.13  ? 344  LYS C CA    1 
ATOM   8718  C  C     . LYS G 3 338 ? 9.775   58.107  115.707 1.00 60.13  ? 344  LYS C C     1 
ATOM   8719  O  O     . LYS G 3 338 ? 10.018  56.912  115.815 1.00 60.13  ? 344  LYS C O     1 
ATOM   8720  C  CB    . LYS G 3 338 ? 10.808  60.378  115.625 1.00 89.97  ? 344  LYS C CB    1 
ATOM   8721  C  CG    . LYS G 3 338 ? 11.140  60.259  117.105 1.00 89.97  ? 344  LYS C CG    1 
ATOM   8722  C  CD    . LYS G 3 338 ? 11.642  61.555  117.713 1.00 89.97  ? 344  LYS C CD    1 
ATOM   8723  C  CE    . LYS G 3 338 ? 12.164  61.297  119.134 1.00 89.97  ? 344  LYS C CE    1 
ATOM   8724  N  NZ    . LYS G 3 338 ? 13.079  62.358  119.679 1.00 89.97  ? 344  LYS C NZ    1 
ATOM   8725  N  N     . LYS G 3 339 ? 8.707   58.687  116.235 1.00 51.84  ? 345  LYS C N     1 
ATOM   8726  C  CA    . LYS G 3 339 ? 7.718   57.959  117.005 1.00 51.84  ? 345  LYS C CA    1 
ATOM   8727  C  C     . LYS G 3 339 ? 7.494   56.540  116.482 1.00 51.84  ? 345  LYS C C     1 
ATOM   8728  O  O     . LYS G 3 339 ? 7.629   55.571  117.230 1.00 51.84  ? 345  LYS C O     1 
ATOM   8729  C  CB    . LYS G 3 339 ? 6.391   58.726  116.993 1.00 75.80  ? 345  LYS C CB    1 
ATOM   8730  C  CG    . LYS G 3 339 ? 6.405   60.073  117.719 1.00 75.80  ? 345  LYS C CG    1 
ATOM   8731  C  CD    . LYS G 3 339 ? 6.491   59.907  119.234 1.00 75.80  ? 345  LYS C CD    1 
ATOM   8732  C  CE    . LYS G 3 339 ? 6.316   61.232  119.968 1.00 75.80  ? 345  LYS C CE    1 
ATOM   8733  N  NZ    . LYS G 3 339 ? 6.285   61.093  121.458 1.00 75.80  ? 345  LYS C NZ    1 
ATOM   8734  N  N     . LEU G 3 340 ? 7.154   56.411  115.201 1.00 50.50  ? 346  LEU C N     1 
ATOM   8735  C  CA    . LEU G 3 340 ? 6.904   55.090  114.624 1.00 50.50  ? 346  LEU C CA    1 
ATOM   8736  C  C     . LEU G 3 340 ? 8.065   54.142  114.779 1.00 50.50  ? 346  LEU C C     1 
ATOM   8737  O  O     . LEU G 3 340 ? 7.861   52.936  114.894 1.00 50.50  ? 346  LEU C O     1 
ATOM   8738  C  CB    . LEU G 3 340 ? 6.588   55.178  113.133 1.00 53.48  ? 346  LEU C CB    1 
ATOM   8739  C  CG    . LEU G 3 340 ? 5.142   55.183  112.615 1.00 53.48  ? 346  LEU C CG    1 
ATOM   8740  C  CD1   . LEU G 3 340 ? 5.040   54.164  111.494 1.00 53.48  ? 346  LEU C CD1   1 
ATOM   8741  C  CD2   . LEU G 3 340 ? 4.140   54.850  113.721 1.00 53.48  ? 346  LEU C CD2   1 
ATOM   8742  N  N     . GLN G 3 341 ? 9.284   54.679  114.756 1.00 77.25  ? 347  GLN C N     1 
ATOM   8743  C  CA    . GLN G 3 341 ? 10.491  53.859  114.878 1.00 77.25  ? 347  GLN C CA    1 
ATOM   8744  C  C     . GLN G 3 341 ? 10.681  53.329  116.275 1.00 77.25  ? 347  GLN C C     1 
ATOM   8745  O  O     . GLN G 3 341 ? 11.101  52.188  116.442 1.00 77.25  ? 347  GLN C O     1 
ATOM   8746  C  CB    . GLN G 3 341 ? 11.744  54.645  114.473 1.00 82.98  ? 347  GLN C CB    1 
ATOM   8747  C  CG    . GLN G 3 341 ? 12.063  54.618  112.978 1.00 82.98  ? 347  GLN C CG    1 
ATOM   8748  C  CD    . GLN G 3 341 ? 13.441  54.055  112.684 1.00 82.98  ? 347  GLN C CD    1 
ATOM   8749  O  OE1   . GLN G 3 341 ? 13.730  52.908  113.011 1.00 82.98  ? 347  GLN C OE1   1 
ATOM   8750  N  NE2   . GLN G 3 341 ? 14.298  54.860  112.067 1.00 82.98  ? 347  GLN C NE2   1 
ATOM   8751  N  N     . GLU G 3 342 ? 10.381  54.162  117.272 1.00 82.29  ? 348  GLU C N     1 
ATOM   8752  C  CA    . GLU G 3 342 ? 10.506  53.780  118.680 1.00 82.29  ? 348  GLU C CA    1 
ATOM   8753  C  C     . GLU G 3 342 ? 9.436   52.742  119.017 1.00 82.29  ? 348  GLU C C     1 
ATOM   8754  O  O     . GLU G 3 342 ? 9.422   52.168  120.108 1.00 82.29  ? 348  GLU C O     1 
ATOM   8755  C  CB    . GLU G 3 342 ? 10.314  54.994  119.586 1.00 89.96  ? 348  GLU C CB    1 
ATOM   8756  C  CG    . GLU G 3 342 ? 11.103  56.208  119.187 1.00 89.96  ? 348  GLU C CG    1 
ATOM   8757  C  CD    . GLU G 3 342 ? 10.824  57.376  120.106 1.00 89.96  ? 348  GLU C CD    1 
ATOM   8758  O  OE1   . GLU G 3 342 ? 11.231  57.313  121.287 1.00 89.96  ? 348  GLU C OE1   1 
ATOM   8759  O  OE2   . GLU G 3 342 ? 10.188  58.353  119.655 1.00 89.96  ? 348  GLU C OE2   1 
ATOM   8760  N  N     . ALA G 3 343 ? 8.531   52.520  118.070 1.00 71.56  ? 349  ALA C N     1 
ATOM   8761  C  CA    . ALA G 3 343 ? 7.467   51.560  118.256 1.00 71.56  ? 349  ALA C CA    1 
ATOM   8762  C  C     . ALA G 3 343 ? 7.974   50.197  117.828 1.00 71.56  ? 349  ALA C C     1 
ATOM   8763  O  O     . ALA G 3 343 ? 7.320   49.182  118.059 1.00 71.56  ? 349  ALA C O     1 
ATOM   8764  C  CB    . ALA G 3 343 ? 6.263   51.956  117.442 1.00 97.13  ? 349  ALA C CB    1 
ATOM   8765  N  N     . GLY G 3 344 ? 9.148   50.176  117.208 1.00 111.57 ? 350  GLY C N     1 
ATOM   8766  C  CA    . GLY G 3 344 ? 9.727   48.916  116.785 1.00 111.57 ? 350  GLY C CA    1 
ATOM   8767  C  C     . GLY G 3 344 ? 9.679   48.703  115.291 1.00 111.57 ? 350  GLY C C     1 
ATOM   8768  O  O     . GLY G 3 344 ? 9.834   47.581  114.812 1.00 111.57 ? 350  GLY C O     1 
ATOM   8769  N  N     . TRP G 3 345 ? 9.456   49.778  114.548 1.00 97.44  ? 351  TRP C N     1 
ATOM   8770  C  CA    . TRP G 3 345 ? 9.403   49.681  113.100 1.00 97.44  ? 351  TRP C CA    1 
ATOM   8771  C  C     . TRP G 3 345 ? 10.825  49.616  112.560 1.00 97.44  ? 351  TRP C C     1 
ATOM   8772  O  O     . TRP G 3 345 ? 11.707  50.343  113.015 1.00 97.44  ? 351  TRP C O     1 
ATOM   8773  C  CB    . TRP G 3 345 ? 8.656   50.890  112.525 1.00 68.11  ? 351  TRP C CB    1 
ATOM   8774  C  CG    . TRP G 3 345 ? 8.748   51.048  111.018 1.00 68.11  ? 351  TRP C CG    1 
ATOM   8775  C  CD1   . TRP G 3 345 ? 8.517   50.089  110.057 1.00 68.11  ? 351  TRP C CD1   1 
ATOM   8776  C  CD2   . TRP G 3 345 ? 9.058   52.248  110.314 1.00 68.11  ? 351  TRP C CD2   1 
ATOM   8777  N  NE1   . TRP G 3 345 ? 8.667   50.627  108.804 1.00 68.11  ? 351  TRP C NE1   1 
ATOM   8778  C  CE2   . TRP G 3 345 ? 8.999   51.951  108.932 1.00 68.11  ? 351  TRP C CE2   1 
ATOM   8779  C  CE3   . TRP G 3 345 ? 9.382   53.550  110.715 1.00 68.11  ? 351  TRP C CE3   1 
ATOM   8780  C  CZ2   . TRP G 3 345 ? 9.252   52.917  107.949 1.00 68.11  ? 351  TRP C CZ2   1 
ATOM   8781  C  CZ3   . TRP G 3 345 ? 9.634   54.506  109.738 1.00 68.11  ? 351  TRP C CZ3   1 
ATOM   8782  C  CH2   . TRP G 3 345 ? 9.567   54.185  108.371 1.00 68.11  ? 351  TRP C CH2   1 
ATOM   8783  N  N     . VAL G 3 346 ? 11.051  48.717  111.611 1.00 80.02  ? 352  VAL C N     1 
ATOM   8784  C  CA    . VAL G 3 346 ? 12.365  48.586  111.007 1.00 80.02  ? 352  VAL C CA    1 
ATOM   8785  C  C     . VAL G 3 346 ? 12.270  49.123  109.589 1.00 80.02  ? 352  VAL C C     1 
ATOM   8786  O  O     . VAL G 3 346 ? 11.805  48.420  108.686 1.00 80.02  ? 352  VAL C O     1 
ATOM   8787  C  CB    . VAL G 3 346 ? 12.811  47.127  110.936 1.00 81.12  ? 352  VAL C CB    1 
ATOM   8788  C  CG1   . VAL G 3 346 ? 14.159  47.038  110.229 1.00 81.12  ? 352  VAL C CG1   1 
ATOM   8789  C  CG2   . VAL G 3 346 ? 12.894  46.542  112.333 1.00 81.12  ? 352  VAL C CG2   1 
ATOM   8790  N  N     . PRO G 3 347 ? 12.716  50.375  109.367 1.00 69.88  ? 353  PRO C N     1 
ATOM   8791  C  CA    . PRO G 3 347 ? 12.680  51.025  108.051 1.00 69.88  ? 353  PRO C CA    1 
ATOM   8792  C  C     . PRO G 3 347 ? 13.427  50.273  106.957 1.00 69.88  ? 353  PRO C C     1 
ATOM   8793  O  O     . PRO G 3 347 ? 14.638  50.072  107.033 1.00 69.88  ? 353  PRO C O     1 
ATOM   8794  C  CB    . PRO G 3 347 ? 13.313  52.394  108.306 1.00 49.19  ? 353  PRO C CB    1 
ATOM   8795  C  CG    . PRO G 3 347 ? 13.123  52.624  109.747 1.00 49.19  ? 353  PRO C CG    1 
ATOM   8796  C  CD    . PRO G 3 347 ? 13.380  51.249  110.344 1.00 49.19  ? 353  PRO C CD    1 
ATOM   8797  N  N     . THR G 3 348 ? 12.688  49.866  105.936 1.00 89.14  ? 354  THR C N     1 
ATOM   8798  C  CA    . THR G 3 348 ? 13.254  49.156  104.807 1.00 89.14  ? 354  THR C CA    1 
ATOM   8799  C  C     . THR G 3 348 ? 13.742  50.176  103.782 1.00 89.14  ? 354  THR C C     1 
ATOM   8800  O  O     . THR G 3 348 ? 14.931  50.476  103.709 1.00 89.14  ? 354  THR C O     1 
ATOM   8801  C  CB    . THR G 3 348 ? 12.196  48.239  104.168 1.00 105.76 ? 354  THR C CB    1 
ATOM   8802  O  OG1   . THR G 3 348 ? 11.911  47.156  105.064 1.00 105.76 ? 354  THR C OG1   1 
ATOM   8803  C  CG2   . THR G 3 348 ? 12.679  47.698  102.827 1.00 105.76 ? 354  THR C CG2   1 
ATOM   8804  N  N     . LYS G 3 349 ? 12.814  50.720  103.007 1.00 82.25  ? 355  LYS C N     1 
ATOM   8805  C  CA    . LYS G 3 349 ? 13.148  51.700  101.988 1.00 82.25  ? 355  LYS C CA    1 
ATOM   8806  C  C     . LYS G 3 349 ? 13.591  53.060  102.562 1.00 82.25  ? 355  LYS C C     1 
ATOM   8807  O  O     . LYS G 3 349 ? 12.839  53.706  103.292 1.00 82.25  ? 355  LYS C O     1 
ATOM   8808  C  CB    . LYS G 3 349 ? 11.936  51.879  101.072 1.00 37.46  ? 355  LYS C CB    1 
ATOM   8809  N  N     . TYR G 3 350 ? 14.816  53.478  102.239 1.00 86.48  ? 356  TYR C N     1 
ATOM   8810  C  CA    . TYR G 3 350 ? 15.350  54.766  102.693 1.00 86.48  ? 356  TYR C CA    1 
ATOM   8811  C  C     . TYR G 3 350 ? 15.640  55.654  101.469 1.00 86.48  ? 356  TYR C C     1 
ATOM   8812  O  O     . TYR G 3 350 ? 15.529  55.200  100.332 1.00 86.48  ? 356  TYR C O     1 
ATOM   8813  C  CB    . TYR G 3 350 ? 16.643  54.573  103.486 1.00 53.87  ? 356  TYR C CB    1 
ATOM   8814  C  CG    . TYR G 3 350 ? 16.505  54.023  104.896 1.00 53.87  ? 356  TYR C CG    1 
ATOM   8815  C  CD1   . TYR G 3 350 ? 16.249  52.671  105.123 1.00 53.87  ? 356  TYR C CD1   1 
ATOM   8816  C  CD2   . TYR G 3 350 ? 16.730  54.850  106.007 1.00 53.87  ? 356  TYR C CD2   1 
ATOM   8817  C  CE1   . TYR G 3 350 ? 16.232  52.146  106.415 1.00 53.87  ? 356  TYR C CE1   1 
ATOM   8818  C  CE2   . TYR G 3 350 ? 16.716  54.344  107.308 1.00 53.87  ? 356  TYR C CE2   1 
ATOM   8819  C  CZ    . TYR G 3 350 ? 16.469  52.982  107.513 1.00 53.87  ? 356  TYR C CZ    1 
ATOM   8820  O  OH    . TYR G 3 350 ? 16.470  52.468  108.810 1.00 53.87  ? 356  TYR C OH    1 
ATOM   8821  N  N     . THR G 3 351 ? 16.016  56.911  101.686 1.00 95.56  ? 357  THR C N     1 
ATOM   8822  C  CA    . THR G 3 351 ? 16.301  57.802  100.562 1.00 95.56  ? 357  THR C CA    1 
ATOM   8823  C  C     . THR G 3 351 ? 17.778  58.113  100.413 1.00 95.56  ? 357  THR C C     1 
ATOM   8824  O  O     . THR G 3 351 ? 18.517  58.156  101.400 1.00 95.56  ? 357  THR C O     1 
ATOM   8825  C  CB    . THR G 3 351 ? 15.579  59.171  100.694 1.00 86.90  ? 357  THR C CB    1 
ATOM   8826  O  OG1   . THR G 3 351 ? 15.770  59.690  102.018 1.00 86.90  ? 357  THR C OG1   1 
ATOM   8827  C  CG2   . THR G 3 351 ? 14.102  59.043  100.380 1.00 86.90  ? 357  THR C CG2   1 
ATOM   8828  N  N     . ASP G 3 352 ? 18.198  58.334  99.169  1.00 98.96  ? 358  ASP C N     1 
ATOM   8829  C  CA    . ASP G 3 352 ? 19.584  58.700  98.885  1.00 98.96  ? 358  ASP C CA    1 
ATOM   8830  C  C     . ASP G 3 352 ? 19.755  60.102  99.471  1.00 98.96  ? 358  ASP C C     1 
ATOM   8831  O  O     . ASP G 3 352 ? 19.830  61.101  98.751  1.00 98.96  ? 358  ASP C O     1 
ATOM   8832  C  CB    . ASP G 3 352 ? 19.857  58.713  97.370  1.00 143.46 ? 358  ASP C CB    1 
ATOM   8833  C  CG    . ASP G 3 352 ? 20.230  57.335  96.821  1.00 143.46 ? 358  ASP C CG    1 
ATOM   8834  O  OD1   . ASP G 3 352 ? 21.247  56.766  97.271  1.00 143.46 ? 358  ASP C OD1   1 
ATOM   8835  O  OD2   . ASP G 3 352 ? 19.513  56.821  95.934  1.00 143.46 ? 358  ASP C OD2   1 
ATOM   8836  N  N     . LYS G 3 353 ? 19.781  60.146  100.800 1.00 115.07 ? 359  LYS C N     1 
ATOM   8837  C  CA    . LYS G 3 353 ? 19.927  61.370  101.576 1.00 115.07 ? 359  LYS C CA    1 
ATOM   8838  C  C     . LYS G 3 353 ? 19.927  60.946  103.038 1.00 115.07 ? 359  LYS C C     1 
ATOM   8839  O  O     . LYS G 3 353 ? 19.875  61.778  103.942 1.00 115.07 ? 359  LYS C O     1 
ATOM   8840  C  CB    . LYS G 3 353 ? 18.754  62.320  101.313 1.00 92.24  ? 359  LYS C CB    1 
ATOM   8841  N  N     . GLY G 3 354 ? 19.956  59.632  103.247 1.00 138.97 ? 360  GLY C N     1 
ATOM   8842  C  CA    . GLY G 3 354 ? 19.992  59.070  104.587 1.00 138.97 ? 360  GLY C CA    1 
ATOM   8843  C  C     . GLY G 3 354 ? 18.721  59.064  105.416 1.00 138.97 ? 360  GLY C C     1 
ATOM   8844  O  O     . GLY G 3 354 ? 18.802  59.140  106.644 1.00 138.97 ? 360  GLY C O     1 
ATOM   8845  N  N     . ALA G 3 355 ? 17.555  58.967  104.778 1.00 100.80 ? 361  ALA C N     1 
ATOM   8846  C  CA    . ALA G 3 355 ? 16.300  58.949  105.527 1.00 100.80 ? 361  ALA C CA    1 
ATOM   8847  C  C     . ALA G 3 355 ? 15.320  57.904  105.008 1.00 100.80 ? 361  ALA C C     1 
ATOM   8848  O  O     . ALA G 3 355 ? 15.367  57.518  103.843 1.00 100.80 ? 361  ALA C O     1 
ATOM   8849  C  CB    . ALA G 3 355 ? 15.654  60.331  105.527 1.00 46.02  ? 361  ALA C CB    1 
ATOM   8850  N  N     . PRO G 3 356 ? 14.409  57.440  105.880 1.00 79.22  ? 362  PRO C N     1 
ATOM   8851  C  CA    . PRO G 3 356 ? 13.401  56.428  105.541 1.00 79.22  ? 362  PRO C CA    1 
ATOM   8852  C  C     . PRO G 3 356 ? 12.214  56.984  104.763 1.00 79.22  ? 362  PRO C C     1 
ATOM   8853  O  O     . PRO G 3 356 ? 11.681  58.042  105.107 1.00 79.22  ? 362  PRO C O     1 
ATOM   8854  C  CB    . PRO G 3 356 ? 12.958  55.894  106.911 1.00 67.32  ? 362  PRO C CB    1 
ATOM   8855  C  CG    . PRO G 3 356 ? 13.791  56.676  107.955 1.00 67.32  ? 362  PRO C CG    1 
ATOM   8856  C  CD    . PRO G 3 356 ? 14.214  57.922  107.260 1.00 67.32  ? 362  PRO C CD    1 
ATOM   8857  N  N     . VAL G 3 357 ? 11.800  56.276  103.717 1.00 64.71  ? 363  VAL C N     1 
ATOM   8858  C  CA    . VAL G 3 357 ? 10.641  56.716  102.937 1.00 64.71  ? 363  VAL C CA    1 
ATOM   8859  C  C     . VAL G 3 357 ? 9.363   56.455  103.745 1.00 64.71  ? 363  VAL C C     1 
ATOM   8860  O  O     . VAL G 3 357 ? 9.053   55.332  104.140 1.00 64.71  ? 363  VAL C O     1 
ATOM   8861  C  CB    . VAL G 3 357 ? 10.538  56.005  101.550 1.00 98.81  ? 363  VAL C CB    1 
ATOM   8862  C  CG1   . VAL G 3 357 ? 9.162   56.235  100.942 1.00 98.81  ? 363  VAL C CG1   1 
ATOM   8863  C  CG2   . VAL G 3 357 ? 11.589  56.559  100.599 1.00 98.81  ? 363  VAL C CG2   1 
ATOM   8864  N  N     . VAL G 3 358 ? 8.630   57.523  103.995 1.00 45.53  ? 364  VAL C N     1 
ATOM   8865  C  CA    . VAL G 3 358 ? 7.429   57.430  104.762 1.00 45.53  ? 364  VAL C CA    1 
ATOM   8866  C  C     . VAL G 3 358 ? 6.237   57.947  103.990 1.00 45.53  ? 364  VAL C C     1 
ATOM   8867  O  O     . VAL G 3 358 ? 5.505   58.812  104.457 1.00 45.53  ? 364  VAL C O     1 
ATOM   8868  C  CB    . VAL G 3 358 ? 7.592   58.181  106.074 1.00 44.04  ? 364  VAL C CB    1 
ATOM   8869  C  CG1   . VAL G 3 358 ? 6.390   57.920  106.970 1.00 44.04  ? 364  VAL C CG1   1 
ATOM   8870  C  CG2   . VAL G 3 358 ? 8.887   57.728  106.752 1.00 44.04  ? 364  VAL C CG2   1 
ATOM   8871  N  N     . ASP G 3 359 ? 6.057   57.422  102.784 1.00 58.28  ? 365  ASP C N     1 
ATOM   8872  C  CA    . ASP G 3 359 ? 4.896   57.801  102.005 1.00 58.28  ? 365  ASP C CA    1 
ATOM   8873  C  C     . ASP G 3 359 ? 3.771   56.852  102.450 1.00 58.28  ? 365  ASP C C     1 
ATOM   8874  O  O     . ASP G 3 359 ? 4.018   55.864  103.163 1.00 58.28  ? 365  ASP C O     1 
ATOM   8875  C  CB    . ASP G 3 359 ? 5.162   57.699  100.493 1.00 59.25  ? 365  ASP C CB    1 
ATOM   8876  C  CG    . ASP G 3 359 ? 5.609   56.319  100.055 1.00 59.25  ? 365  ASP C CG    1 
ATOM   8877  O  OD1   . ASP G 3 359 ? 5.329   55.332  100.784 1.00 59.25  ? 365  ASP C OD1   1 
ATOM   8878  O  OD2   . ASP G 3 359 ? 6.229   56.231  98.962  1.00 59.25  ? 365  ASP C OD2   1 
ATOM   8879  N  N     . ASP G 3 360 ? 2.537   57.150  102.056 1.00 99.83  ? 366  ASP C N     1 
ATOM   8880  C  CA    . ASP G 3 360 ? 1.437   56.305  102.475 1.00 99.83  ? 366  ASP C CA    1 
ATOM   8881  C  C     . ASP G 3 360 ? 1.717   54.848  102.191 1.00 99.83  ? 366  ASP C C     1 
ATOM   8882  O  O     . ASP G 3 360 ? 1.289   53.978  102.944 1.00 99.83  ? 366  ASP C O     1 
ATOM   8883  C  CB    . ASP G 3 360 ? 0.136   56.687  101.798 1.00 76.19  ? 366  ASP C CB    1 
ATOM   8884  C  CG    . ASP G 3 360 ? -1.046  55.973  102.414 1.00 76.19  ? 366  ASP C CG    1 
ATOM   8885  O  OD1   . ASP G 3 360 ? -1.284  56.187  103.619 1.00 76.19  ? 366  ASP C OD1   1 
ATOM   8886  O  OD2   . ASP G 3 360 ? -1.725  55.191  101.714 1.00 76.19  ? 366  ASP C OD2   1 
ATOM   8887  N  N     . GLU G 3 361 ? 2.434   54.582  101.104 1.00 94.34  ? 367  GLU C N     1 
ATOM   8888  C  CA    . GLU G 3 361 ? 2.767   53.212  100.744 1.00 94.34  ? 367  GLU C CA    1 
ATOM   8889  C  C     . GLU G 3 361 ? 3.382   52.494  101.936 1.00 94.34  ? 367  GLU C C     1 
ATOM   8890  O  O     . GLU G 3 361 ? 2.809   51.537  102.458 1.00 94.34  ? 367  GLU C O     1 
ATOM   8891  C  CB    . GLU G 3 361 ? 3.759   53.168  99.580  1.00 132.82 ? 367  GLU C CB    1 
ATOM   8892  C  CG    . GLU G 3 361 ? 4.173   51.746  99.211  1.00 132.82 ? 367  GLU C CG    1 
ATOM   8893  C  CD    . GLU G 3 361 ? 5.419   51.684  98.342  1.00 132.82 ? 367  GLU C CD    1 
ATOM   8894  O  OE1   . GLU G 3 361 ? 5.857   50.557  98.017  1.00 132.82 ? 367  GLU C OE1   1 
ATOM   8895  O  OE2   . GLU G 3 361 ? 5.963   52.753  97.988  1.00 132.82 ? 367  GLU C OE2   1 
ATOM   8896  N  N     . VAL G 3 362 ? 4.546   52.956  102.378 1.00 57.65  ? 368  VAL C N     1 
ATOM   8897  C  CA    . VAL G 3 362 ? 5.201   52.308  103.500 1.00 57.65  ? 368  VAL C CA    1 
ATOM   8898  C  C     . VAL G 3 362 ? 4.356   52.385  104.757 1.00 57.65  ? 368  VAL C C     1 
ATOM   8899  O  O     . VAL G 3 362 ? 4.265   51.410  105.501 1.00 57.65  ? 368  VAL C O     1 
ATOM   8900  C  CB    . VAL G 3 362 ? 6.608   52.895  103.735 1.00 52.09  ? 368  VAL C CB    1 
ATOM   8901  C  CG1   . VAL G 3 362 ? 6.661   54.319  103.238 1.00 52.09  ? 368  VAL C CG1   1 
ATOM   8902  C  CG2   . VAL G 3 362 ? 6.978   52.814  105.204 1.00 52.09  ? 368  VAL C CG2   1 
ATOM   8903  N  N     . LEU G 3 363 ? 3.724   53.532  104.993 1.00 73.66  ? 369  LEU C N     1 
ATOM   8904  C  CA    . LEU G 3 363 ? 2.874   53.691  106.173 1.00 73.66  ? 369  LEU C CA    1 
ATOM   8905  C  C     . LEU G 3 363 ? 1.810   52.596  106.224 1.00 73.66  ? 369  LEU C C     1 
ATOM   8906  O  O     . LEU G 3 363 ? 1.480   52.091  107.293 1.00 73.66  ? 369  LEU C O     1 
ATOM   8907  C  CB    . LEU G 3 363 ? 2.201   55.066  106.166 1.00 62.10  ? 369  LEU C CB    1 
ATOM   8908  C  CG    . LEU G 3 363 ? 3.114   56.248  106.466 1.00 62.10  ? 369  LEU C CG    1 
ATOM   8909  C  CD1   . LEU G 3 363 ? 2.528   57.527  105.896 1.00 62.10  ? 369  LEU C CD1   1 
ATOM   8910  C  CD2   . LEU G 3 363 ? 3.291   56.359  107.962 1.00 62.10  ? 369  LEU C CD2   1 
ATOM   8911  N  N     . GLU G 3 364 ? 1.273   52.226  105.068 1.00 77.32  ? 370  GLU C N     1 
ATOM   8912  C  CA    . GLU G 3 364 ? 0.258   51.192  105.046 1.00 77.32  ? 370  GLU C CA    1 
ATOM   8913  C  C     . GLU G 3 364 ? 0.902   49.894  105.521 1.00 77.32  ? 370  GLU C C     1 
ATOM   8914  O  O     . GLU G 3 364 ? 0.297   49.124  106.270 1.00 77.32  ? 370  GLU C O     1 
ATOM   8915  C  CB    . GLU G 3 364 ? -0.326  51.027  103.633 1.00 39.16  ? 370  GLU C CB    1 
ATOM   8916  N  N     . GLY G 3 365 ? 2.151   49.681  105.115 1.00 80.44  ? 371  GLY C N     1 
ATOM   8917  C  CA    . GLY G 3 365 ? 2.868   48.469  105.477 1.00 80.44  ? 371  GLY C CA    1 
ATOM   8918  C  C     . GLY G 3 365 ? 3.391   48.362  106.891 1.00 80.44  ? 371  GLY C C     1 
ATOM   8919  O  O     . GLY G 3 365 ? 3.454   47.265  107.425 1.00 80.44  ? 371  GLY C O     1 
ATOM   8920  N  N     . VAL G 3 366 ? 3.769   49.487  107.492 1.00 62.77  ? 372  VAL C N     1 
ATOM   8921  C  CA    . VAL G 3 366 ? 4.297   49.513  108.862 1.00 62.77  ? 372  VAL C CA    1 
ATOM   8922  C  C     . VAL G 3 366 ? 3.510   48.652  109.851 1.00 62.77  ? 372  VAL C C     1 
ATOM   8923  O  O     . VAL G 3 366 ? 2.284   48.677  109.873 1.00 62.77  ? 372  VAL C O     1 
ATOM   8924  C  CB    . VAL G 3 366 ? 4.310   50.948  109.427 1.00 95.97  ? 372  VAL C CB    1 
ATOM   8925  C  CG1   . VAL G 3 366 ? 4.949   50.953  110.811 1.00 95.97  ? 372  VAL C CG1   1 
ATOM   8926  C  CG2   . VAL G 3 366 ? 5.052   51.879  108.484 1.00 95.97  ? 372  VAL C CG2   1 
ATOM   8927  N  N     . ARG G 3 367 ? 4.216   47.903  110.689 1.00 97.27  ? 373  ARG C N     1 
ATOM   8928  C  CA    . ARG G 3 367 ? 3.540   47.053  111.658 1.00 97.27  ? 373  ARG C CA    1 
ATOM   8929  C  C     . ARG G 3 367 ? 4.225   47.070  113.025 1.00 97.27  ? 373  ARG C C     1 
ATOM   8930  O  O     . ARG G 3 367 ? 5.244   46.417  113.236 1.00 97.27  ? 373  ARG C O     1 
ATOM   8931  C  CB    . ARG G 3 367 ? 3.467   45.619  111.118 1.00 104.37 ? 373  ARG C CB    1 
ATOM   8932  C  CG    . ARG G 3 367 ? 2.982   45.515  109.669 1.00 104.37 ? 373  ARG C CG    1 
ATOM   8933  C  CD    . ARG G 3 367 ? 1.499   45.859  109.492 1.00 104.37 ? 373  ARG C CD    1 
ATOM   8934  N  NE    . ARG G 3 367 ? 1.166   46.117  108.088 1.00 104.37 ? 373  ARG C NE    1 
ATOM   8935  C  CZ    . ARG G 3 367 ? -0.061  46.056  107.574 1.00 104.37 ? 373  ARG C CZ    1 
ATOM   8936  N  NH1   . ARG G 3 367 ? -1.092  45.738  108.342 1.00 104.37 ? 373  ARG C NH1   1 
ATOM   8937  N  NH2   . ARG G 3 367 ? -0.261  46.321  106.288 1.00 104.37 ? 373  ARG C NH2   1 
ATOM   8938  N  N     . VAL G 3 368 ? 3.659   47.829  113.952 1.00 80.29  ? 374  VAL C N     1 
ATOM   8939  C  CA    . VAL G 3 368 ? 4.215   47.913  115.291 1.00 80.29  ? 374  VAL C CA    1 
ATOM   8940  C  C     . VAL G 3 368 ? 3.439   46.980  116.216 1.00 80.29  ? 374  VAL C C     1 
ATOM   8941  O  O     . VAL G 3 368 ? 2.424   46.397  115.812 1.00 80.29  ? 374  VAL C O     1 
ATOM   8942  C  CB    . VAL G 3 368 ? 4.147   49.371  115.839 1.00 59.49  ? 374  VAL C CB    1 
ATOM   8943  C  CG1   . VAL G 3 368 ? 5.035   50.268  115.013 1.00 59.49  ? 374  VAL C CG1   1 
ATOM   8944  C  CG2   . VAL G 3 368 ? 2.728   49.897  115.798 1.00 59.49  ? 374  VAL C CG2   1 
ATOM   8945  N  N     . ASP G 3 369 ? 3.916   46.853  117.453 1.00 84.47  ? 375  ASP C N     1 
ATOM   8946  C  CA    . ASP G 3 369 ? 3.308   45.984  118.457 1.00 84.47  ? 375  ASP C CA    1 
ATOM   8947  C  C     . ASP G 3 369 ? 2.178   46.631  119.261 1.00 84.47  ? 375  ASP C C     1 
ATOM   8948  O  O     . ASP G 3 369 ? 1.111   46.039  119.436 1.00 84.47  ? 375  ASP C O     1 
ATOM   8949  C  CB    . ASP G 3 369 ? 4.400   45.495  119.425 1.00 99.59  ? 375  ASP C CB    1 
ATOM   8950  C  CG    . ASP G 3 369 ? 5.048   44.181  118.982 1.00 99.59  ? 375  ASP C CG    1 
ATOM   8951  O  OD1   . ASP G 3 369 ? 5.221   43.967  117.762 1.00 99.59  ? 375  ASP C OD1   1 
ATOM   8952  O  OD2   . ASP G 3 369 ? 5.398   43.363  119.863 1.00 99.59  ? 375  ASP C OD2   1 
ATOM   8953  N  N     . ASP G 3 370 ? 2.423   47.835  119.770 1.00 72.27  ? 376  ASP C N     1 
ATOM   8954  C  CA    . ASP G 3 370 ? 1.411   48.531  120.562 1.00 72.27  ? 376  ASP C CA    1 
ATOM   8955  C  C     . ASP G 3 370 ? 0.169   48.787  119.722 1.00 72.27  ? 376  ASP C C     1 
ATOM   8956  O  O     . ASP G 3 370 ? 0.200   49.601  118.800 1.00 72.27  ? 376  ASP C O     1 
ATOM   8957  C  CB    . ASP G 3 370 ? 1.954   49.861  121.088 1.00 76.61  ? 376  ASP C CB    1 
ATOM   8958  C  CG    . ASP G 3 370 ? 0.939   50.613  121.937 1.00 76.61  ? 376  ASP C CG    1 
ATOM   8959  O  OD1   . ASP G 3 370 ? 1.356   51.417  122.798 1.00 76.61  ? 376  ASP C OD1   1 
ATOM   8960  O  OD2   . ASP G 3 370 ? -0.278  50.407  121.742 1.00 76.61  ? 376  ASP C OD2   1 
ATOM   8961  N  N     . PRO G 3 371 ? -0.951  48.113  120.050 1.00 83.20  ? 377  PRO C N     1 
ATOM   8962  C  CA    . PRO G 3 371 ? -2.232  48.235  119.342 1.00 83.20  ? 377  PRO C CA    1 
ATOM   8963  C  C     . PRO G 3 371 ? -2.765  49.655  119.127 1.00 83.20  ? 377  PRO C C     1 
ATOM   8964  O  O     . PRO G 3 371 ? -3.145  49.998  118.012 1.00 83.20  ? 377  PRO C O     1 
ATOM   8965  C  CB    . PRO G 3 371 ? -3.172  47.364  120.176 1.00 80.14  ? 377  PRO C CB    1 
ATOM   8966  C  CG    . PRO G 3 371 ? -2.590  47.449  121.552 1.00 80.14  ? 377  PRO C CG    1 
ATOM   8967  C  CD    . PRO G 3 371 ? -1.116  47.310  121.274 1.00 80.14  ? 377  PRO C CD    1 
ATOM   8968  N  N     . GLU G 3 372 ? -2.801  50.474  120.178 1.00 74.13  ? 378  GLU C N     1 
ATOM   8969  C  CA    . GLU G 3 372 ? -3.283  51.845  120.045 1.00 74.13  ? 378  GLU C CA    1 
ATOM   8970  C  C     . GLU G 3 372 ? -2.447  52.581  119.010 1.00 74.13  ? 378  GLU C C     1 
ATOM   8971  O  O     . GLU G 3 372 ? -2.977  53.372  118.231 1.00 74.13  ? 378  GLU C O     1 
ATOM   8972  C  CB    . GLU G 3 372 ? -3.200  52.598  121.376 1.00 90.02  ? 378  GLU C CB    1 
ATOM   8973  C  CG    . GLU G 3 372 ? -3.471  54.096  121.218 1.00 90.02  ? 378  GLU C CG    1 
ATOM   8974  C  CD    . GLU G 3 372 ? -3.286  54.905  122.500 1.00 90.02  ? 378  GLU C CD    1 
ATOM   8975  O  OE1   . GLU G 3 372 ? -2.292  54.660  123.221 1.00 90.02  ? 378  GLU C OE1   1 
ATOM   8976  O  OE2   . GLU G 3 372 ? -4.124  55.800  122.772 1.00 90.02  ? 378  GLU C OE2   1 
ATOM   8977  N  N     . LYS G 3 373 ? -1.144  52.304  119.005 1.00 69.89  ? 379  LYS C N     1 
ATOM   8978  C  CA    . LYS G 3 373 ? -0.201  52.938  118.088 1.00 69.89  ? 379  LYS C CA    1 
ATOM   8979  C  C     . LYS G 3 373 ? -0.397  52.574  116.620 1.00 69.89  ? 379  LYS C C     1 
ATOM   8980  O  O     . LYS G 3 373 ? -0.507  53.464  115.777 1.00 69.89  ? 379  LYS C O     1 
ATOM   8981  C  CB    . LYS G 3 373 ? 1.231   52.617  118.508 1.00 41.33  ? 379  LYS C CB    1 
ATOM   8982  N  N     . GLN G 3 374 ? -0.427  51.286  116.291 1.00 57.78  ? 380  GLN C N     1 
ATOM   8983  C  CA    . GLN G 3 374 ? -0.637  50.917  114.888 1.00 57.78  ? 380  GLN C CA    1 
ATOM   8984  C  C     . GLN G 3 374 ? -1.975  51.495  114.428 1.00 57.78  ? 380  GLN C C     1 
ATOM   8985  O  O     . GLN G 3 374 ? -2.178  51.738  113.239 1.00 57.78  ? 380  GLN C O     1 
ATOM   8986  C  CB    . GLN G 3 374 ? -0.637  49.390  114.683 1.00 45.40  ? 380  GLN C CB    1 
ATOM   8987  N  N     . ALA G 3 375 ? -2.885  51.715  115.376 1.00 72.48  ? 381  ALA C N     1 
ATOM   8988  C  CA    . ALA G 3 375 ? -4.193  52.278  115.052 1.00 72.48  ? 381  ALA C CA    1 
ATOM   8989  C  C     . ALA G 3 375 ? -3.990  53.704  114.589 1.00 72.48  ? 381  ALA C C     1 
ATOM   8990  O  O     . ALA G 3 375 ? -4.655  54.161  113.666 1.00 72.48  ? 381  ALA C O     1 
ATOM   8991  C  CB    . ALA G 3 375 ? -5.107  52.267  116.259 1.00 40.33  ? 381  ALA C CB    1 
ATOM   8992  N  N     . ALA G 3 376 ? -3.058  54.397  115.237 1.00 72.73  ? 382  ALA C N     1 
ATOM   8993  C  CA    . ALA G 3 376 ? -2.743  55.786  114.921 1.00 72.73  ? 382  ALA C CA    1 
ATOM   8994  C  C     . ALA G 3 376 ? -2.055  55.948  113.575 1.00 72.73  ? 382  ALA C C     1 
ATOM   8995  O  O     . ALA G 3 376 ? -1.980  57.053  113.047 1.00 72.73  ? 382  ALA C O     1 
ATOM   8996  C  CB    . ALA G 3 376 ? -1.868  56.376  116.012 1.00 70.44  ? 382  ALA C CB    1 
ATOM   8997  N  N     . ILE G 3 377 ? -1.531  54.859  113.027 1.00 54.05  ? 383  ILE C N     1 
ATOM   8998  C  CA    . ILE G 3 377 ? -0.875  54.942  111.736 1.00 54.05  ? 383  ILE C CA    1 
ATOM   8999  C  C     . ILE G 3 377 ? -1.948  55.240  110.715 1.00 54.05  ? 383  ILE C C     1 
ATOM   9000  O  O     . ILE G 3 377 ? -1.747  56.058  109.823 1.00 54.05  ? 383  ILE C O     1 
ATOM   9001  C  CB    . ILE G 3 377 ? -0.149  53.635  111.392 1.00 41.96  ? 383  ILE C CB    1 
ATOM   9002  C  CG1   . ILE G 3 377 ? 1.221   53.625  112.076 1.00 41.96  ? 383  ILE C CG1   1 
ATOM   9003  C  CG2   . ILE G 3 377 ? 0.020   53.502  109.913 1.00 41.96  ? 383  ILE C CG2   1 
ATOM   9004  C  CD1   . ILE G 3 377 ? 2.006   52.339  111.903 1.00 41.96  ? 383  ILE C CD1   1 
ATOM   9005  N  N     . ASP G 3 378 ? -3.100  54.593  110.854 1.00 70.69  ? 384  ASP C N     1 
ATOM   9006  C  CA    . ASP G 3 378 ? -4.202  54.827  109.926 1.00 70.69  ? 384  ASP C CA    1 
ATOM   9007  C  C     . ASP G 3 378 ? -4.762  56.235  110.078 1.00 70.69  ? 384  ASP C C     1 
ATOM   9008  O  O     . ASP G 3 378 ? -5.415  56.738  109.169 1.00 70.69  ? 384  ASP C O     1 
ATOM   9009  C  CB    . ASP G 3 378 ? -5.333  53.815  110.142 1.00 126.89 ? 384  ASP C CB    1 
ATOM   9010  C  CG    . ASP G 3 378 ? -5.209  52.599  109.242 1.00 126.89 ? 384  ASP C CG    1 
ATOM   9011  O  OD1   . ASP G 3 378 ? -5.026  52.787  108.022 1.00 126.89 ? 384  ASP C OD1   1 
ATOM   9012  O  OD2   . ASP G 3 378 ? -5.304  51.458  109.744 1.00 126.89 ? 384  ASP C OD2   1 
ATOM   9013  N  N     . LEU G 3 379 ? -4.511  56.869  111.223 1.00 45.17  ? 385  LEU C N     1 
ATOM   9014  C  CA    . LEU G 3 379 ? -5.014  58.220  111.464 1.00 45.17  ? 385  LEU C CA    1 
ATOM   9015  C  C     . LEU G 3 379 ? -4.080  59.240  110.891 1.00 45.17  ? 385  LEU C C     1 
ATOM   9016  O  O     . LEU G 3 379 ? -4.495  60.355  110.582 1.00 45.17  ? 385  LEU C O     1 
ATOM   9017  C  CB    . LEU G 3 379 ? -5.170  58.530  112.951 1.00 50.62  ? 385  LEU C CB    1 
ATOM   9018  C  CG    . LEU G 3 379 ? -6.296  57.848  113.728 1.00 50.62  ? 385  LEU C CG    1 
ATOM   9019  C  CD1   . LEU G 3 379 ? -6.355  58.459  115.129 1.00 50.62  ? 385  LEU C CD1   1 
ATOM   9020  C  CD2   . LEU G 3 379 ? -7.624  57.997  112.992 1.00 50.62  ? 385  LEU C CD2   1 
ATOM   9021  N  N     . ILE G 3 380 ? -2.807  58.882  110.766 1.00 79.46  ? 386  ILE C N     1 
ATOM   9022  C  CA    . ILE G 3 380 ? -1.860  59.821  110.198 1.00 79.46  ? 386  ILE C CA    1 
ATOM   9023  C  C     . ILE G 3 380 ? -2.051  59.793  108.711 1.00 79.46  ? 386  ILE C C     1 
ATOM   9024  O  O     . ILE G 3 380 ? -2.133  60.835  108.072 1.00 79.46  ? 386  ILE C O     1 
ATOM   9025  C  CB    . ILE G 3 380 ? -0.449  59.462  110.495 1.00 50.20  ? 386  ILE C CB    1 
ATOM   9026  C  CG1   . ILE G 3 380 ? -0.282  59.259  111.990 1.00 50.20  ? 386  ILE C CG1   1 
ATOM   9027  C  CG2   . ILE G 3 380 ? 0.433   60.583  110.061 1.00 50.20  ? 386  ILE C CG2   1 
ATOM   9028  C  CD1   . ILE G 3 380 ? 1.112   58.913  112.390 1.00 50.20  ? 386  ILE C CD1   1 
ATOM   9029  N  N     . LYS G 3 381 ? -2.130  58.590  108.162 1.00 104.59 ? 387  LYS C N     1 
ATOM   9030  C  CA    . LYS G 3 381 ? -2.355  58.441  106.741 1.00 104.59 ? 387  LYS C CA    1 
ATOM   9031  C  C     . LYS G 3 381 ? -3.503  59.385  106.383 1.00 104.59 ? 387  LYS C C     1 
ATOM   9032  O  O     . LYS G 3 381 ? -3.387  60.181  105.452 1.00 104.59 ? 387  LYS C O     1 
ATOM   9033  C  CB    . LYS G 3 381 ? -2.719  56.993  106.420 1.00 75.68  ? 387  LYS C CB    1 
ATOM   9034  C  CG    . LYS G 3 381 ? -1.574  56.010  106.616 1.00 75.68  ? 387  LYS C CG    1 
ATOM   9035  C  CD    . LYS G 3 381 ? -2.095  54.586  106.664 1.00 75.68  ? 387  LYS C CD    1 
ATOM   9036  C  CE    . LYS G 3 381 ? -2.816  54.175  105.383 1.00 75.68  ? 387  LYS C CE    1 
ATOM   9037  N  NZ    . LYS G 3 381 ? -1.880  53.816  104.279 1.00 75.68  ? 387  LYS C NZ    1 
ATOM   9038  N  N     . GLU G 3 382 ? -4.590  59.314  107.154 1.00 61.24  ? 388  GLU C N     1 
ATOM   9039  C  CA    . GLU G 3 382 ? -5.769  60.161  106.947 1.00 61.24  ? 388  GLU C CA    1 
ATOM   9040  C  C     . GLU G 3 382 ? -5.493  61.614  107.273 1.00 61.24  ? 388  GLU C C     1 
ATOM   9041  O  O     . GLU G 3 382 ? -6.062  62.513  106.655 1.00 61.24  ? 388  GLU C O     1 
ATOM   9042  C  CB    . GLU G 3 382 ? -6.944  59.692  107.819 1.00 83.51  ? 388  GLU C CB    1 
ATOM   9043  C  CG    . GLU G 3 382 ? -7.982  60.785  108.133 1.00 83.51  ? 388  GLU C CG    1 
ATOM   9044  C  CD    . GLU G 3 382 ? -9.212  60.255  108.863 1.00 83.51  ? 388  GLU C CD    1 
ATOM   9045  O  OE1   . GLU G 3 382 ? -9.048  59.451  109.804 1.00 83.51  ? 388  GLU C OE1   1 
ATOM   9046  O  OE2   . GLU G 3 382 ? -10.345 60.652  108.504 1.00 83.51  ? 388  GLU C OE2   1 
ATOM   9047  N  N     . TYR G 3 383 ? -4.637  61.847  108.260 1.00 63.17  ? 389  TYR C N     1 
ATOM   9048  C  CA    . TYR G 3 383 ? -4.323  63.218  108.635 1.00 63.17  ? 389  TYR C CA    1 
ATOM   9049  C  C     . TYR G 3 383 ? -3.540  63.898  107.536 1.00 63.17  ? 389  TYR C C     1 
ATOM   9050  O  O     . TYR G 3 383 ? -3.760  65.066  107.232 1.00 63.17  ? 389  TYR C O     1 
ATOM   9051  C  CB    . TYR G 3 383 ? -3.492  63.278  109.918 1.00 42.72  ? 389  TYR C CB    1 
ATOM   9052  C  CG    . TYR G 3 383 ? -3.129  64.699  110.341 1.00 42.72  ? 389  TYR C CG    1 
ATOM   9053  C  CD1   . TYR G 3 383 ? -2.288  65.492  109.569 1.00 42.72  ? 389  TYR C CD1   1 
ATOM   9054  C  CD2   . TYR G 3 383 ? -3.671  65.258  111.488 1.00 42.72  ? 389  TYR C CD2   1 
ATOM   9055  C  CE1   . TYR G 3 383 ? -2.006  66.804  109.929 1.00 42.72  ? 389  TYR C CE1   1 
ATOM   9056  C  CE2   . TYR G 3 383 ? -3.386  66.571  111.855 1.00 42.72  ? 389  TYR C CE2   1 
ATOM   9057  C  CZ    . TYR G 3 383 ? -2.556  67.339  111.078 1.00 42.72  ? 389  TYR C CZ    1 
ATOM   9058  O  OH    . TYR G 3 383 ? -2.266  68.629  111.467 1.00 42.72  ? 389  TYR C OH    1 
ATOM   9059  N  N     . LEU G 3 384 ? -2.600  63.171  106.956 1.00 62.40  ? 390  LEU C N     1 
ATOM   9060  C  CA    . LEU G 3 384 ? -1.794  63.744  105.907 1.00 62.40  ? 390  LEU C CA    1 
ATOM   9061  C  C     . LEU G 3 384 ? -2.665  64.117  104.722 1.00 62.40  ? 390  LEU C C     1 
ATOM   9062  O  O     . LEU G 3 384 ? -2.458  65.163  104.100 1.00 62.40  ? 390  LEU C O     1 
ATOM   9063  C  CB    . LEU G 3 384 ? -0.686  62.772  105.497 1.00 34.44  ? 390  LEU C CB    1 
ATOM   9064  C  CG    . LEU G 3 384 ? 0.457   62.635  106.514 1.00 34.44  ? 390  LEU C CG    1 
ATOM   9065  C  CD1   . LEU G 3 384 ? 1.456   61.552  106.095 1.00 34.44  ? 390  LEU C CD1   1 
ATOM   9066  C  CD2   . LEU G 3 384 ? 1.144   63.979  106.657 1.00 34.44  ? 390  LEU C CD2   1 
ATOM   9067  N  N     . MET G 3 385 ? -3.656  63.279  104.423 1.00 42.89  ? 391  MET C N     1 
ATOM   9068  C  CA    . MET G 3 385 ? -4.547  63.537  103.296 1.00 42.89  ? 391  MET C CA    1 
ATOM   9069  C  C     . MET G 3 385 ? -5.466  64.731  103.538 1.00 42.89  ? 391  MET C C     1 
ATOM   9070  O  O     . MET G 3 385 ? -5.629  65.580  102.659 1.00 42.89  ? 391  MET C O     1 
ATOM   9071  C  CB    . MET G 3 385 ? -5.362  62.284  102.967 1.00 60.52  ? 391  MET C CB    1 
ATOM   9072  C  CG    . MET G 3 385 ? -6.531  62.509  102.027 1.00 60.52  ? 391  MET C CG    1 
ATOM   9073  S  SD    . MET G 3 385 ? -8.115  62.621  102.915 1.00 60.52  ? 391  MET C SD    1 
ATOM   9074  C  CE    . MET G 3 385 ? -8.549  64.318  102.683 1.00 60.52  ? 391  MET C CE    1 
ATOM   9075  N  N     . ILE G 3 386 ? -6.063  64.799  104.727 1.00 54.77  ? 392  ILE C N     1 
ATOM   9076  C  CA    . ILE G 3 386 ? -6.944  65.911  105.053 1.00 54.77  ? 392  ILE C CA    1 
ATOM   9077  C  C     . ILE G 3 386 ? -6.196  67.193  104.787 1.00 54.77  ? 392  ILE C C     1 
ATOM   9078  O  O     . ILE G 3 386 ? -6.791  68.193  104.404 1.00 54.77  ? 392  ILE C O     1 
ATOM   9079  C  CB    . ILE G 3 386 ? -7.388  65.892  106.524 1.00 56.12  ? 392  ILE C CB    1 
ATOM   9080  C  CG1   . ILE G 3 386 ? -8.447  64.812  106.722 1.00 56.12  ? 392  ILE C CG1   1 
ATOM   9081  C  CG2   . ILE G 3 386 ? -7.974  67.227  106.917 1.00 56.12  ? 392  ILE C CG2   1 
ATOM   9082  C  CD1   . ILE G 3 386 ? -9.602  64.898  105.731 1.00 56.12  ? 392  ILE C CD1   1 
ATOM   9083  N  N     . GLN G 3 387 ? -4.881  67.157  104.982 1.00 41.74  ? 393  GLN C N     1 
ATOM   9084  C  CA    . GLN G 3 387 ? -4.048  68.319  104.756 1.00 41.74  ? 393  GLN C CA    1 
ATOM   9085  C  C     . GLN G 3 387 ? -3.788  68.562  103.279 1.00 41.74  ? 393  GLN C C     1 
ATOM   9086  O  O     . GLN G 3 387 ? -3.689  69.713  102.877 1.00 41.74  ? 393  GLN C O     1 
ATOM   9087  C  CB    . GLN G 3 387 ? -2.738  68.184  105.508 1.00 64.02  ? 393  GLN C CB    1 
ATOM   9088  C  CG    . GLN G 3 387 ? -2.830  68.491  106.987 1.00 64.02  ? 393  GLN C CG    1 
ATOM   9089  C  CD    . GLN G 3 387 ? -2.824  69.993  107.302 1.00 64.02  ? 393  GLN C CD    1 
ATOM   9090  O  OE1   . GLN G 3 387 ? -2.670  70.395  108.469 1.00 64.02  ? 393  GLN C OE1   1 
ATOM   9091  N  NE2   . GLN G 3 387 ? -2.992  70.827  106.267 1.00 64.02  ? 393  GLN C NE2   1 
ATOM   9092  N  N     . LYS G 3 388 ? -3.687  67.509  102.466 1.00 48.22  ? 394  LYS C N     1 
ATOM   9093  C  CA    . LYS G 3 388 ? -3.454  67.699  101.027 1.00 48.22  ? 394  LYS C CA    1 
ATOM   9094  C  C     . LYS G 3 388 ? -4.685  68.360  100.381 1.00 48.22  ? 394  LYS C C     1 
ATOM   9095  O  O     . LYS G 3 388 ? -4.636  68.854  99.242  1.00 48.22  ? 394  LYS C O     1 
ATOM   9096  C  CB    . LYS G 3 388 ? -3.179  66.357  100.340 1.00 57.22  ? 394  LYS C CB    1 
ATOM   9097  C  CG    . LYS G 3 388 ? -2.618  66.441  98.904  1.00 57.22  ? 394  LYS C CG    1 
ATOM   9098  C  CD    . LYS G 3 388 ? -1.123  66.747  98.922  1.00 57.22  ? 394  LYS C CD    1 
ATOM   9099  C  CE    . LYS G 3 388 ? -0.449  66.499  97.579  1.00 57.22  ? 394  LYS C CE    1 
ATOM   9100  N  NZ    . LYS G 3 388 ? -0.900  67.437  96.509  1.00 57.22  ? 394  LYS C NZ    1 
ATOM   9101  N  N     . ARG G 3 389 ? -5.790  68.354  101.123 1.00 51.37  ? 395  ARG C N     1 
ATOM   9102  C  CA    . ARG G 3 389 ? -7.034  68.937  100.662 1.00 51.37  ? 395  ARG C CA    1 
ATOM   9103  C  C     . ARG G 3 389 ? -7.180  70.317  101.248 1.00 51.37  ? 395  ARG C C     1 
ATOM   9104  O  O     . ARG G 3 389 ? -7.512  71.258  100.554 1.00 51.37  ? 395  ARG C O     1 
ATOM   9105  C  CB    . ARG G 3 389 ? -8.220  68.086  101.099 1.00 52.94  ? 395  ARG C CB    1 
ATOM   9106  C  CG    . ARG G 3 389 ? -8.299  66.723  100.467 1.00 52.94  ? 395  ARG C CG    1 
ATOM   9107  C  CD    . ARG G 3 389 ? -8.728  66.809  99.026  1.00 52.94  ? 395  ARG C CD    1 
ATOM   9108  N  NE    . ARG G 3 389 ? -8.909  65.481  98.449  1.00 52.94  ? 395  ARG C NE    1 
ATOM   9109  C  CZ    . ARG G 3 389 ? -7.952  64.562  98.376  1.00 52.94  ? 395  ARG C CZ    1 
ATOM   9110  N  NH1   . ARG G 3 389 ? -6.737  64.827  98.839  1.00 52.94  ? 395  ARG C NH1   1 
ATOM   9111  N  NH2   . ARG G 3 389 ? -8.208  63.366  97.858  1.00 52.94  ? 395  ARG C NH2   1 
ATOM   9112  N  N     . ILE G 3 390 ? -6.942  70.447  102.539 1.00 52.32  ? 396  ILE C N     1 
ATOM   9113  C  CA    . ILE G 3 390 ? -7.075  71.755  103.159 1.00 52.32  ? 396  ILE C CA    1 
ATOM   9114  C  C     . ILE G 3 390 ? -6.104  72.754  102.530 1.00 52.32  ? 396  ILE C C     1 
ATOM   9115  O  O     . ILE G 3 390 ? -6.336  73.969  102.561 1.00 52.32  ? 396  ILE C O     1 
ATOM   9116  C  CB    . ILE G 3 390 ? -6.814  71.687  104.680 1.00 56.37  ? 396  ILE C CB    1 
ATOM   9117  C  CG1   . ILE G 3 390 ? -7.895  70.844  105.358 1.00 56.37  ? 396  ILE C CG1   1 
ATOM   9118  C  CG2   . ILE G 3 390 ? -6.779  73.089  105.262 1.00 56.37  ? 396  ILE C CG2   1 
ATOM   9119  C  CD1   . ILE G 3 390 ? -7.736  70.731  106.856 1.00 56.37  ? 396  ILE C CD1   1 
ATOM   9120  N  N     . GLY G 3 391 ? -5.021  72.234  101.956 1.00 45.58  ? 397  GLY C N     1 
ATOM   9121  C  CA    . GLY G 3 391 ? -4.026  73.092  101.341 1.00 45.58  ? 397  GLY C CA    1 
ATOM   9122  C  C     . GLY G 3 391 ? -4.393  73.466  99.920  1.00 45.58  ? 397  GLY C C     1 
ATOM   9123  O  O     . GLY G 3 391 ? -4.263  74.611  99.508  1.00 45.58  ? 397  GLY C O     1 
ATOM   9124  N  N     . GLN G 3 392 ? -4.863  72.491  99.164  1.00 57.23  ? 398  GLN C N     1 
ATOM   9125  C  CA    . GLN G 3 392 ? -5.245  72.727  97.784  1.00 57.23  ? 398  GLN C CA    1 
ATOM   9126  C  C     . GLN G 3 392 ? -6.492  73.583  97.645  1.00 57.23  ? 398  GLN C C     1 
ATOM   9127  O  O     . GLN G 3 392 ? -6.673  74.266  96.651  1.00 57.23  ? 398  GLN C O     1 
ATOM   9128  C  CB    . GLN G 3 392 ? -5.449  71.390  97.074  1.00 64.81  ? 398  GLN C CB    1 
ATOM   9129  C  CG    . GLN G 3 392 ? -6.053  71.495  95.702  1.00 64.81  ? 398  GLN C CG    1 
ATOM   9130  C  CD    . GLN G 3 392 ? -6.061  70.166  94.989  1.00 64.81  ? 398  GLN C CD    1 
ATOM   9131  O  OE1   . GLN G 3 392 ? -6.123  69.106  95.624  1.00 64.81  ? 398  GLN C OE1   1 
ATOM   9132  N  NE2   . GLN G 3 392 ? -6.013  70.206  93.661  1.00 64.81  ? 398  GLN C NE2   1 
ATOM   9133  N  N     . SER G 3 393 ? -7.346  73.563  98.651  1.00 52.39  ? 399  SER C N     1 
ATOM   9134  C  CA    . SER G 3 393 ? -8.578  74.329  98.582  1.00 52.39  ? 399  SER C CA    1 
ATOM   9135  C  C     . SER G 3 393 ? -8.610  75.607  99.401  1.00 52.39  ? 399  SER C C     1 
ATOM   9136  O  O     . SER G 3 393 ? -9.098  76.624  98.931  1.00 52.39  ? 399  SER C O     1 
ATOM   9137  C  CB    . SER G 3 393 ? -9.769  73.451  98.991  1.00 58.48  ? 399  SER C CB    1 
ATOM   9138  O  OG    . SER G 3 393 ? -9.676  73.036  100.348 1.00 58.48  ? 399  SER C OG    1 
ATOM   9139  N  N     . ALA G 3 394 ? -8.079  75.581  100.612 1.00 43.71  ? 400  ALA C N     1 
ATOM   9140  C  CA    . ALA G 3 394 ? -8.177  76.771  101.414 1.00 43.71  ? 400  ALA C CA    1 
ATOM   9141  C  C     . ALA G 3 394 ? -6.933  77.465  101.917 1.00 43.71  ? 400  ALA C C     1 
ATOM   9142  O  O     . ALA G 3 394 ? -6.811  78.668  101.741 1.00 43.71  ? 400  ALA C O     1 
ATOM   9143  C  CB    . ALA G 3 394 ? -9.103  76.501  102.582 1.00 94.20  ? 400  ALA C CB    1 
ATOM   9144  N  N     . GLU G 3 395 ? -6.015  76.744  102.555 1.00 56.98  ? 401  GLU C N     1 
ATOM   9145  C  CA    . GLU G 3 395 ? -4.835  77.406  103.100 1.00 56.98  ? 401  GLU C CA    1 
ATOM   9146  C  C     . GLU G 3 395 ? -3.625  77.613  102.196 1.00 56.98  ? 401  GLU C C     1 
ATOM   9147  O  O     . GLU G 3 395 ? -2.877  78.571  102.389 1.00 56.98  ? 401  GLU C O     1 
ATOM   9148  C  CB    . GLU G 3 395 ? -4.402  76.708  104.384 1.00 65.98  ? 401  GLU C CB    1 
ATOM   9149  C  CG    . GLU G 3 395 ? -5.471  76.741  105.446 1.00 65.98  ? 401  GLU C CG    1 
ATOM   9150  C  CD    . GLU G 3 395 ? -5.084  75.986  106.692 1.00 65.98  ? 401  GLU C CD    1 
ATOM   9151  O  OE1   . GLU G 3 395 ? -4.630  74.830  106.559 1.00 65.98  ? 401  GLU C OE1   1 
ATOM   9152  O  OE2   . GLU G 3 395 ? -5.244  76.544  107.801 1.00 65.98  ? 401  GLU C OE2   1 
ATOM   9153  N  N     . GLY G 3 396 ? -3.420  76.746  101.213 1.00 62.69  ? 402  GLY C N     1 
ATOM   9154  C  CA    . GLY G 3 396 ? -2.269  76.917  100.341 1.00 62.69  ? 402  GLY C CA    1 
ATOM   9155  C  C     . GLY G 3 396 ? -2.155  78.309  99.733  1.00 62.69  ? 402  GLY C C     1 
ATOM   9156  O  O     . GLY G 3 396 ? -3.053  79.130  99.898  1.00 62.69  ? 402  GLY C O     1 
ATOM   9157  N  N     . ASP G 3 397 ? -1.053  78.572  99.029  1.00 55.57  ? 403  ASP C N     1 
ATOM   9158  C  CA    . ASP G 3 397 ? -0.816  79.856  98.385  1.00 55.57  ? 403  ASP C CA    1 
ATOM   9159  C  C     . ASP G 3 397 ? -1.604  79.935  97.106  1.00 55.57  ? 403  ASP C C     1 
ATOM   9160  O  O     . ASP G 3 397 ? -2.046  80.996  96.725  1.00 55.57  ? 403  ASP C O     1 
ATOM   9161  C  CB    . ASP G 3 397 ? 0.663   80.027  98.082  1.00 128.38 ? 403  ASP C CB    1 
ATOM   9162  C  CG    . ASP G 3 397 ? 1.512   79.941  99.323  1.00 128.38 ? 403  ASP C CG    1 
ATOM   9163  O  OD1   . ASP G 3 397 ? 1.359   78.954  100.079 1.00 128.38 ? 403  ASP C OD1   1 
ATOM   9164  O  OD2   . ASP G 3 397 ? 2.332   80.857  99.544  1.00 128.38 ? 403  ASP C OD2   1 
ATOM   9165  N  N     . LYS G 3 398 ? -1.781  78.815  96.430  1.00 63.76  ? 404  LYS C N     1 
ATOM   9166  C  CA    . LYS G 3 398 ? -2.541  78.814  95.189  1.00 63.76  ? 404  LYS C CA    1 
ATOM   9167  C  C     . LYS G 3 398 ? -3.877  78.156  95.472  1.00 63.76  ? 404  LYS C C     1 
ATOM   9168  O  O     . LYS G 3 398 ? -4.436  77.461  94.620  1.00 63.76  ? 404  LYS C O     1 
ATOM   9169  C  CB    . LYS G 3 398 ? -1.805  78.014  94.117  1.00 85.27  ? 404  LYS C CB    1 
ATOM   9170  C  CG    . LYS G 3 398 ? -0.380  78.450  93.871  1.00 85.27  ? 404  LYS C CG    1 
ATOM   9171  C  CD    . LYS G 3 398 ? -0.339  79.802  93.225  1.00 85.27  ? 404  LYS C CD    1 
ATOM   9172  C  CE    . LYS G 3 398 ? 1.072   80.285  93.189  1.00 85.27  ? 404  LYS C CE    1 
ATOM   9173  N  NZ    . LYS G 3 398 ? 1.620   80.279  94.571  1.00 85.27  ? 404  LYS C NZ    1 
ATOM   9174  N  N     . ALA G 3 399 ? -4.381  78.366  96.683  1.00 66.13  ? 405  ALA C N     1 
ATOM   9175  C  CA    . ALA G 3 399 ? -5.646  77.777  97.098  1.00 66.13  ? 405  ALA C CA    1 
ATOM   9176  C  C     . ALA G 3 399 ? -6.822  78.365  96.329  1.00 66.13  ? 405  ALA C C     1 
ATOM   9177  O  O     . ALA G 3 399 ? -6.839  79.559  96.036  1.00 66.13  ? 405  ALA C O     1 
ATOM   9178  C  CB    . ALA G 3 399 ? -5.845  77.991  98.587  1.00 87.95  ? 405  ALA C CB    1 
ATOM   9179  N  N     . TRP G 3 400 ? -7.806  77.523  96.014  1.00 58.33  ? 406  TRP C N     1 
ATOM   9180  C  CA    . TRP G 3 400 ? -8.992  77.970  95.291  1.00 58.33  ? 406  TRP C CA    1 
ATOM   9181  C  C     . TRP G 3 400 ? -9.608  79.189  95.966  1.00 58.33  ? 406  TRP C C     1 
ATOM   9182  O  O     . TRP G 3 400 ? -9.787  80.224  95.334  1.00 58.33  ? 406  TRP C O     1 
ATOM   9183  C  CB    . TRP G 3 400 ? -10.033 76.840  95.189  1.00 53.48  ? 406  TRP C CB    1 
ATOM   9184  C  CG    . TRP G 3 400 ? -9.456  75.568  94.632  1.00 53.48  ? 406  TRP C CG    1 
ATOM   9185  C  CD1   . TRP G 3 400 ? -8.341  75.458  93.864  1.00 53.48  ? 406  TRP C CD1   1 
ATOM   9186  C  CD2   . TRP G 3 400 ? -9.914  74.227  94.861  1.00 53.48  ? 406  TRP C CD2   1 
ATOM   9187  N  NE1   . TRP G 3 400 ? -8.065  74.142  93.609  1.00 53.48  ? 406  TRP C NE1   1 
ATOM   9188  C  CE2   . TRP G 3 400 ? -9.015  73.364  94.210  1.00 53.48  ? 406  TRP C CE2   1 
ATOM   9189  C  CE3   . TRP G 3 400 ? -10.990 73.671  95.561  1.00 53.48  ? 406  TRP C CE3   1 
ATOM   9190  C  CZ2   . TRP G 3 400 ? -9.154  71.970  94.238  1.00 53.48  ? 406  TRP C CZ2   1 
ATOM   9191  C  CZ3   . TRP G 3 400 ? -11.125 72.279  95.591  1.00 53.48  ? 406  TRP C CZ3   1 
ATOM   9192  C  CH2   . TRP G 3 400 ? -10.210 71.448  94.933  1.00 53.48  ? 406  TRP C CH2   1 
ATOM   9193  N  N     . LEU G 3 401 ? -9.903  79.074  97.257  1.00 52.34  ? 407  LEU C N     1 
ATOM   9194  C  CA    . LEU G 3 401 ? -10.522 80.162  98.000  1.00 52.34  ? 407  LEU C CA    1 
ATOM   9195  C  C     . LEU G 3 401 ? -9.767  81.463  97.927  1.00 52.34  ? 407  LEU C C     1 
ATOM   9196  O  O     . LEU G 3 401 ? -10.329 82.516  98.202  1.00 52.34  ? 407  LEU C O     1 
ATOM   9197  C  CB    . LEU G 3 401 ? -10.711 79.777  99.468  1.00 70.32  ? 407  LEU C CB    1 
ATOM   9198  C  CG    . LEU G 3 401 ? -11.659 78.601  99.721  1.00 70.32  ? 407  LEU C CG    1 
ATOM   9199  C  CD1   . LEU G 3 401 ? -11.777 78.335  101.216 1.00 70.32  ? 407  LEU C CD1   1 
ATOM   9200  C  CD2   . LEU G 3 401 ? -13.024 78.908  99.111  1.00 70.32  ? 407  LEU C CD2   1 
ATOM   9201  N  N     . ARG G 3 402 ? -8.498  81.405  97.553  1.00 44.99  ? 408  ARG C N     1 
ATOM   9202  C  CA    . ARG G 3 402 ? -7.689  82.614  97.478  1.00 44.99  ? 408  ARG C CA    1 
ATOM   9203  C  C     . ARG G 3 402 ? -7.758  83.164  96.071  1.00 44.99  ? 408  ARG C C     1 
ATOM   9204  O  O     . ARG G 3 402 ? -7.676  84.373  95.853  1.00 44.99  ? 408  ARG C O     1 
ATOM   9205  C  CB    . ARG G 3 402 ? -6.232  82.298  97.856  1.00 45.18  ? 408  ARG C CB    1 
ATOM   9206  N  N     . TYR G 3 403 ? -7.940  82.257  95.120  1.00 45.05  ? 409  TYR C N     1 
ATOM   9207  C  CA    . TYR G 3 403 ? -8.010  82.612  93.717  1.00 45.05  ? 409  TYR C CA    1 
ATOM   9208  C  C     . TYR G 3 403 ? -9.393  82.911  93.140  1.00 45.05  ? 409  TYR C C     1 
ATOM   9209  O  O     . TYR G 3 403 ? -9.487  83.253  91.981  1.00 45.05  ? 409  TYR C O     1 
ATOM   9210  C  CB    . TYR G 3 403 ? -7.354  81.512  92.878  1.00 62.59  ? 409  TYR C CB    1 
ATOM   9211  C  CG    . TYR G 3 403 ? -5.872  81.675  92.703  1.00 62.59  ? 409  TYR C CG    1 
ATOM   9212  C  CD1   . TYR G 3 403 ? -5.364  82.594  91.808  1.00 62.59  ? 409  TYR C CD1   1 
ATOM   9213  C  CD2   . TYR G 3 403 ? -4.981  80.965  93.480  1.00 62.59  ? 409  TYR C CD2   1 
ATOM   9214  C  CE1   . TYR G 3 403 ? -4.013  82.812  91.696  1.00 62.59  ? 409  TYR C CE1   1 
ATOM   9215  C  CE2   . TYR G 3 403 ? -3.618  81.178  93.376  1.00 62.59  ? 409  TYR C CE2   1 
ATOM   9216  C  CZ    . TYR G 3 403 ? -3.140  82.109  92.484  1.00 62.59  ? 409  TYR C CZ    1 
ATOM   9217  O  OH    . TYR G 3 403 ? -1.787  82.369  92.411  1.00 62.59  ? 409  TYR C OH    1 
ATOM   9218  N  N     . VAL G 3 404 ? -10.471 82.786  93.904  1.00 59.77  ? 410  VAL C N     1 
ATOM   9219  C  CA    . VAL G 3 404 ? -11.795 83.077  93.336  1.00 59.77  ? 410  VAL C CA    1 
ATOM   9220  C  C     . VAL G 3 404 ? -11.900 84.545  92.993  1.00 59.77  ? 410  VAL C C     1 
ATOM   9221  O  O     . VAL G 3 404 ? -11.564 85.401  93.816  1.00 59.77  ? 410  VAL C O     1 
ATOM   9222  C  CB    . VAL G 3 404 ? -12.952 82.783  94.312  1.00 69.39  ? 410  VAL C CB    1 
ATOM   9223  C  CG1   . VAL G 3 404 ? -12.936 81.343  94.733  1.00 69.39  ? 410  VAL C CG1   1 
ATOM   9224  C  CG2   . VAL G 3 404 ? -12.848 83.689  95.522  1.00 69.39  ? 410  VAL C CG2   1 
ATOM   9225  N  N     . ALA G 3 405 ? -12.392 84.840  91.795  1.00 77.35  ? 411  ALA C N     1 
ATOM   9226  C  CA    . ALA G 3 405 ? -12.539 86.225  91.357  1.00 77.35  ? 411  ALA C CA    1 
ATOM   9227  C  C     . ALA G 3 405 ? -13.818 86.884  91.887  1.00 77.35  ? 411  ALA C C     1 
ATOM   9228  O  O     . ALA G 3 405 ? -14.691 86.216  92.448  1.00 77.35  ? 411  ALA C O     1 
ATOM   9229  C  CB    . ALA G 3 405 ? -12.510 86.288  89.838  1.00 125.40 ? 411  ALA C CB    1 
ATOM   9230  N  N     . GLU G 3 406 ? -13.930 88.197  91.711  1.00 82.52  ? 412  GLU C N     1 
ATOM   9231  C  CA    . GLU G 3 406 ? -15.110 88.908  92.179  1.00 82.52  ? 412  GLU C CA    1 
ATOM   9232  C  C     . GLU G 3 406 ? -16.348 88.402  91.440  1.00 82.52  ? 412  GLU C C     1 
ATOM   9233  O  O     . GLU G 3 406 ? -17.451 88.388  91.991  1.00 82.52  ? 412  GLU C O     1 
ATOM   9234  C  CB    . GLU G 3 406 ? -14.937 90.415  91.952  1.00 115.19 ? 412  GLU C CB    1 
ATOM   9235  N  N     . ASP G 3 407 ? -16.160 87.984  90.191  1.00 84.02  ? 413  ASP C N     1 
ATOM   9236  C  CA    . ASP G 3 407 ? -17.272 87.484  89.395  1.00 84.02  ? 413  ASP C CA    1 
ATOM   9237  C  C     . ASP G 3 407 ? -17.605 86.021  89.700  1.00 84.02  ? 413  ASP C C     1 
ATOM   9238  O  O     . ASP G 3 407 ? -18.353 85.364  88.968  1.00 84.02  ? 413  ASP C O     1 
ATOM   9239  C  CB    . ASP G 3 407 ? -17.009 87.702  87.895  1.00 68.21  ? 413  ASP C CB    1 
ATOM   9240  C  CG    . ASP G 3 407 ? -15.859 86.884  87.360  1.00 68.21  ? 413  ASP C CG    1 
ATOM   9241  O  OD1   . ASP G 3 407 ? -16.040 85.666  87.182  1.00 68.21  ? 413  ASP C OD1   1 
ATOM   9242  O  OD2   . ASP G 3 407 ? -14.783 87.469  87.107  1.00 68.21  ? 413  ASP C OD2   1 
ATOM   9243  N  N     . GLY G 3 408 ? -17.061 85.526  90.807  1.00 75.69  ? 414  GLY C N     1 
ATOM   9244  C  CA    . GLY G 3 408 ? -17.336 84.163  91.221  1.00 75.69  ? 414  GLY C CA    1 
ATOM   9245  C  C     . GLY G 3 408 ? -16.881 83.087  90.262  1.00 75.69  ? 414  GLY C C     1 
ATOM   9246  O  O     . GLY G 3 408 ? -17.613 82.130  89.994  1.00 75.69  ? 414  GLY C O     1 
ATOM   9247  N  N     . LYS G 3 409 ? -15.668 83.250  89.750  1.00 77.08  ? 415  LYS C N     1 
ATOM   9248  C  CA    . LYS G 3 409 ? -15.074 82.291  88.828  1.00 77.08  ? 415  LYS C CA    1 
ATOM   9249  C  C     . LYS G 3 409 ? -13.578 82.234  89.130  1.00 77.08  ? 415  LYS C C     1 
ATOM   9250  O  O     . LYS G 3 409 ? -13.003 83.205  89.640  1.00 77.08  ? 415  LYS C O     1 
ATOM   9251  C  CB    . LYS G 3 409 ? -15.302 82.732  87.376  1.00 68.82  ? 415  LYS C CB    1 
ATOM   9252  C  CG    . LYS G 3 409 ? -16.773 82.825  86.962  1.00 68.82  ? 415  LYS C CG    1 
ATOM   9253  C  CD    . LYS G 3 409 ? -16.944 83.363  85.543  1.00 68.82  ? 415  LYS C CD    1 
ATOM   9254  C  CE    . LYS G 3 409 ? -18.416 83.455  85.110  1.00 68.82  ? 415  LYS C CE    1 
ATOM   9255  N  NZ    . LYS G 3 409 ? -19.225 84.508  85.812  1.00 68.82  ? 415  LYS C NZ    1 
ATOM   9256  N  N     . ILE G 3 410 ? -12.955 81.091  88.853  1.00 65.74  ? 416  ILE C N     1 
ATOM   9257  C  CA    . ILE G 3 410 ? -11.522 80.954  89.086  1.00 65.74  ? 416  ILE C CA    1 
ATOM   9258  C  C     . ILE G 3 410 ? -10.862 80.957  87.730  1.00 65.74  ? 416  ILE C C     1 
ATOM   9259  O  O     . ILE G 3 410 ? -11.127 80.073  86.910  1.00 65.74  ? 416  ILE C O     1 
ATOM   9260  C  CB    . ILE G 3 410 ? -11.138 79.628  89.797  1.00 67.43  ? 416  ILE C CB    1 
ATOM   9261  C  CG1   . ILE G 3 410 ? -11.748 79.577  91.191  1.00 67.43  ? 416  ILE C CG1   1 
ATOM   9262  C  CG2   . ILE G 3 410 ? -9.620  79.529  89.943  1.00 67.43  ? 416  ILE C CG2   1 
ATOM   9263  C  CD1   . ILE G 3 410 ? -11.335 78.360  91.978  1.00 67.43  ? 416  ILE C CD1   1 
ATOM   9264  N  N     . HIS G 3 411 ? -10.002 81.944  87.488  1.00 55.06  ? 417  HIS C N     1 
ATOM   9265  C  CA    . HIS G 3 411 ? -9.321  82.027  86.206  1.00 55.06  ? 417  HIS C CA    1 
ATOM   9266  C  C     . HIS G 3 411 ? -7.924  81.421  86.181  1.00 55.06  ? 417  HIS C C     1 
ATOM   9267  O  O     . HIS G 3 411 ? -6.959  82.114  85.865  1.00 55.06  ? 417  HIS C O     1 
ATOM   9268  C  CB    . HIS G 3 411 ? -9.264  83.478  85.741  1.00 68.05  ? 417  HIS C CB    1 
ATOM   9269  C  CG    . HIS G 3 411 ? -10.610 84.113  85.624  1.00 68.05  ? 417  HIS C CG    1 
ATOM   9270  N  ND1   . HIS G 3 411 ? -11.328 84.538  86.721  1.00 68.05  ? 417  HIS C ND1   1 
ATOM   9271  C  CD2   . HIS G 3 411 ? -11.393 84.350  84.548  1.00 68.05  ? 417  HIS C CD2   1 
ATOM   9272  C  CE1   . HIS G 3 411 ? -12.494 85.010  86.324  1.00 68.05  ? 417  HIS C CE1   1 
ATOM   9273  N  NE2   . HIS G 3 411 ? -12.559 84.906  85.011  1.00 68.05  ? 417  HIS C NE2   1 
ATOM   9274  N  N     . GLY G 3 412 ? -7.818  80.129  86.490  1.00 50.00  ? 418  GLY C N     1 
ATOM   9275  C  CA    . GLY G 3 412 ? -6.515  79.494  86.477  1.00 50.00  ? 418  GLY C CA    1 
ATOM   9276  C  C     . GLY G 3 412 ? -5.857  79.842  85.160  1.00 50.00  ? 418  GLY C C     1 
ATOM   9277  O  O     . GLY G 3 412 ? -6.565  80.035  84.181  1.00 50.00  ? 418  GLY C O     1 
ATOM   9278  N  N     . SER G 3 413 ? -4.532  79.940  85.113  1.00 52.61  ? 419  SER C N     1 
ATOM   9279  C  CA    . SER G 3 413 ? -3.882  80.291  83.854  1.00 52.61  ? 419  SER C CA    1 
ATOM   9280  C  C     . SER G 3 413 ? -3.540  79.019  83.131  1.00 52.61  ? 419  SER C C     1 
ATOM   9281  O  O     . SER G 3 413 ? -3.457  77.963  83.750  1.00 52.61  ? 419  SER C O     1 
ATOM   9282  C  CB    . SER G 3 413 ? -2.611  81.114  84.078  1.00 60.29  ? 419  SER C CB    1 
ATOM   9283  O  OG    . SER G 3 413 ? -1.466  80.287  84.116  1.00 60.29  ? 419  SER C OG    1 
ATOM   9284  N  N     . VAL G 3 414 ? -3.363  79.116  81.820  1.00 65.90  ? 420  VAL C N     1 
ATOM   9285  C  CA    . VAL G 3 414 ? -3.034  77.950  81.014  1.00 65.90  ? 420  VAL C CA    1 
ATOM   9286  C  C     . VAL G 3 414 ? -1.946  78.307  80.018  1.00 65.90  ? 420  VAL C C     1 
ATOM   9287  O  O     . VAL G 3 414 ? -2.012  79.343  79.359  1.00 65.90  ? 420  VAL C O     1 
ATOM   9288  C  CB    . VAL G 3 414 ? -4.257  77.439  80.204  1.00 33.77  ? 420  VAL C CB    1 
ATOM   9289  C  CG1   . VAL G 3 414 ? -4.058  75.984  79.819  1.00 33.77  ? 420  VAL C CG1   1 
ATOM   9290  C  CG2   . VAL G 3 414 ? -5.545  77.644  80.996  1.00 33.77  ? 420  VAL C CG2   1 
ATOM   9291  N  N     . ASN G 3 415 ? -0.939  77.448  79.931  1.00 50.23  ? 421  ASN C N     1 
ATOM   9292  C  CA    . ASN G 3 415 ? 0.161   77.619  78.992  1.00 50.23  ? 421  ASN C CA    1 
ATOM   9293  C  C     . ASN G 3 415 ? -0.149  76.618  77.903  1.00 50.23  ? 421  ASN C C     1 
ATOM   9294  O  O     . ASN G 3 415 ? -0.022  75.417  78.122  1.00 50.23  ? 421  ASN C O     1 
ATOM   9295  C  CB    . ASN G 3 415 ? 1.499   77.244  79.633  1.00 60.04  ? 421  ASN C CB    1 
ATOM   9296  C  CG    . ASN G 3 415 ? 2.637   77.183  78.621  1.00 60.04  ? 421  ASN C CG    1 
ATOM   9297  O  OD1   . ASN G 3 415 ? 2.459   76.712  77.503  1.00 60.04  ? 421  ASN C OD1   1 
ATOM   9298  N  ND2   . ASN G 3 415 ? 3.813   77.652  79.019  1.00 60.04  ? 421  ASN C ND2   1 
ATOM   9299  N  N     . PRO G 3 416 ? -0.540  77.091  76.712  1.00 41.84  ? 422  PRO C N     1 
ATOM   9300  C  CA    . PRO G 3 416 ? -0.867  76.171  75.625  1.00 41.84  ? 422  PRO C CA    1 
ATOM   9301  C  C     . PRO G 3 416 ? 0.283   75.268  75.194  1.00 41.84  ? 422  PRO C C     1 
ATOM   9302  O  O     . PRO G 3 416 ? 0.102   74.439  74.313  1.00 41.84  ? 422  PRO C O     1 
ATOM   9303  C  CB    . PRO G 3 416 ? -1.320  77.109  74.524  1.00 99.13  ? 422  PRO C CB    1 
ATOM   9304  C  CG    . PRO G 3 416 ? -0.387  78.249  74.711  1.00 99.13  ? 422  PRO C CG    1 
ATOM   9305  C  CD    . PRO G 3 416 ? -0.419  78.465  76.204  1.00 99.13  ? 422  PRO C CD    1 
ATOM   9306  N  N     . ASN G 3 417 ? 1.461   75.437  75.787  1.00 57.10  ? 423  ASN C N     1 
ATOM   9307  C  CA    . ASN G 3 417 ? 2.596   74.591  75.463  1.00 57.10  ? 423  ASN C CA    1 
ATOM   9308  C  C     . ASN G 3 417 ? 3.381   74.270  76.713  1.00 57.10  ? 423  ASN C C     1 
ATOM   9309  O  O     . ASN G 3 417 ? 2.950   73.448  77.521  1.00 57.10  ? 423  ASN C O     1 
ATOM   9310  C  CB    . ASN G 3 417 ? 3.503   75.238  74.441  1.00 56.89  ? 423  ASN C CB    1 
ATOM   9311  C  CG    . ASN G 3 417 ? 3.627   74.400  73.185  1.00 56.89  ? 423  ASN C CG    1 
ATOM   9312  O  OD1   . ASN G 3 417 ? 2.757   74.439  72.306  1.00 56.89  ? 423  ASN C OD1   1 
ATOM   9313  N  ND2   . ASN G 3 417 ? 4.696   73.611  73.100  1.00 56.89  ? 423  ASN C ND2   1 
ATOM   9314  N  N     . GLY G 3 418 ? 4.541   74.893  76.884  1.00 71.82  ? 424  GLY C N     1 
ATOM   9315  C  CA    . GLY G 3 418 ? 5.323   74.638  78.086  1.00 71.82  ? 424  GLY C CA    1 
ATOM   9316  C  C     . GLY G 3 418 ? 5.521   73.192  78.541  1.00 71.82  ? 424  GLY C C     1 
ATOM   9317  O  O     . GLY G 3 418 ? 6.064   72.961  79.618  1.00 71.82  ? 424  GLY C O     1 
ATOM   9318  N  N     . ALA G 3 419 ? 5.084   72.224  77.742  1.00 87.75  ? 425  ALA C N     1 
ATOM   9319  C  CA    . ALA G 3 419 ? 5.258   70.812  78.075  1.00 87.75  ? 425  ALA C CA    1 
ATOM   9320  C  C     . ALA G 3 419 ? 6.552   70.364  77.412  1.00 87.75  ? 425  ALA C C     1 
ATOM   9321  O  O     . ALA G 3 419 ? 7.565   70.195  78.080  1.00 87.75  ? 425  ALA C O     1 
ATOM   9322  C  CB    . ALA G 3 419 ? 4.093   69.993  77.536  1.00 51.62  ? 425  ALA C CB    1 
ATOM   9323  N  N     . VAL G 3 420 ? 6.479   70.185  76.093  1.00 81.58  ? 426  VAL C N     1 
ATOM   9324  C  CA    . VAL G 3 420 ? 7.571   69.777  75.173  1.00 81.58  ? 426  VAL C CA    1 
ATOM   9325  C  C     . VAL G 3 420 ? 7.007   68.785  74.187  1.00 81.58  ? 426  VAL C C     1 
ATOM   9326  O  O     . VAL G 3 420 ? 7.594   68.521  73.133  1.00 81.58  ? 426  VAL C O     1 
ATOM   9327  C  CB    . VAL G 3 420 ? 8.805   69.041  75.801  1.00 81.43  ? 426  VAL C CB    1 
ATOM   9328  C  CG1   . VAL G 3 420 ? 9.738   70.029  76.474  1.00 81.43  ? 426  VAL C CG1   1 
ATOM   9329  C  CG2   . VAL G 3 420 ? 8.345   67.930  76.730  1.00 81.43  ? 426  VAL C CG2   1 
ATOM   9330  N  N     . THR G 3 421 ? 5.854   68.246  74.545  1.00 67.90  ? 427  THR C N     1 
ATOM   9331  C  CA    . THR G 3 421 ? 5.197   67.258  73.741  1.00 67.90  ? 427  THR C CA    1 
ATOM   9332  C  C     . THR G 3 421 ? 3.999   67.896  73.072  1.00 67.90  ? 427  THR C C     1 
ATOM   9333  O  O     . THR G 3 421 ? 3.465   67.374  72.090  1.00 67.90  ? 427  THR C O     1 
ATOM   9334  C  CB    . THR G 3 421 ? 4.788   66.122  74.657  1.00 63.83  ? 427  THR C CB    1 
ATOM   9335  O  OG1   . THR G 3 421 ? 3.968   66.642  75.714  1.00 63.83  ? 427  THR C OG1   1 
ATOM   9336  C  CG2   . THR G 3 421 ? 6.030   65.497  75.292  1.00 63.83  ? 427  THR C CG2   1 
ATOM   9337  N  N     . GLY G 3 422 ? 3.591   69.045  73.601  1.00 52.13  ? 428  GLY C N     1 
ATOM   9338  C  CA    . GLY G 3 422 ? 2.446   69.754  73.047  1.00 52.13  ? 428  GLY C CA    1 
ATOM   9339  C  C     . GLY G 3 422 ? 1.401   69.997  74.117  1.00 52.13  ? 428  GLY C C     1 
ATOM   9340  O  O     . GLY G 3 422 ? 0.566   70.898  73.998  1.00 52.13  ? 428  GLY C O     1 
ATOM   9341  N  N     . ARG G 3 423 ? 1.456   69.172  75.164  1.00 54.54  ? 429  ARG C N     1 
ATOM   9342  C  CA    . ARG G 3 423 ? 0.548   69.262  76.301  1.00 54.54  ? 429  ARG C CA    1 
ATOM   9343  C  C     . ARG G 3 423 ? 0.696   70.634  76.912  1.00 54.54  ? 429  ARG C C     1 
ATOM   9344  O  O     . ARG G 3 423 ? 1.770   71.216  76.899  1.00 54.54  ? 429  ARG C O     1 
ATOM   9345  C  CB    . ARG G 3 423 ? 0.901   68.218  77.359  1.00 66.09  ? 429  ARG C CB    1 
ATOM   9346  C  CG    . ARG G 3 423 ? 0.204   66.883  77.217  1.00 66.09  ? 429  ARG C CG    1 
ATOM   9347  C  CD    . ARG G 3 423 ? 0.276   66.147  78.542  1.00 66.09  ? 429  ARG C CD    1 
ATOM   9348  N  NE    . ARG G 3 423 ? -0.681  65.050  78.613  1.00 66.09  ? 429  ARG C NE    1 
ATOM   9349  C  CZ    . ARG G 3 423 ? -0.902  64.332  79.706  1.00 66.09  ? 429  ARG C CZ    1 
ATOM   9350  N  NH1   . ARG G 3 423 ? -0.228  64.595  80.817  1.00 66.09  ? 429  ARG C NH1   1 
ATOM   9351  N  NH2   . ARG G 3 423 ? -1.809  63.366  79.696  1.00 66.09  ? 429  ARG C NH2   1 
ATOM   9352  N  N     . ALA G 3 424 ? -0.385  71.156  77.452  1.00 40.76  ? 430  ALA C N     1 
ATOM   9353  C  CA    . ALA G 3 424 ? -0.319  72.466  78.062  1.00 40.76  ? 430  ALA C CA    1 
ATOM   9354  C  C     . ALA G 3 424 ? 0.095   72.254  79.504  1.00 40.76  ? 430  ALA C C     1 
ATOM   9355  O  O     . ALA G 3 424 ? 0.235   71.116  79.932  1.00 40.76  ? 430  ALA C O     1 
ATOM   9356  C  CB    . ALA G 3 424 ? -1.682  73.151  77.995  1.00 62.08  ? 430  ALA C CB    1 
ATOM   9357  N  N     . THR G 3 425 ? 0.338   73.346  80.230  1.00 47.50  ? 431  THR C N     1 
ATOM   9358  C  CA    . THR G 3 425 ? 0.682   73.277  81.647  1.00 47.50  ? 431  THR C CA    1 
ATOM   9359  C  C     . THR G 3 425 ? -0.290  74.221  82.325  1.00 47.50  ? 431  THR C C     1 
ATOM   9360  O  O     . THR G 3 425 ? -0.398  75.390  81.944  1.00 47.50  ? 431  THR C O     1 
ATOM   9361  C  CB    . THR G 3 425 ? 2.122   73.754  81.979  1.00 47.08  ? 431  THR C CB    1 
ATOM   9362  O  OG1   . THR G 3 425 ? 2.415   74.966  81.283  1.00 47.08  ? 431  THR C OG1   1 
ATOM   9363  C  CG2   . THR G 3 425 ? 3.123   72.702  81.629  1.00 47.08  ? 431  THR C CG2   1 
ATOM   9364  N  N     . HIS G 3 426 ? -1.023  73.720  83.311  1.00 48.18  ? 432  HIS C N     1 
ATOM   9365  C  CA    . HIS G 3 426 ? -1.968  74.581  83.993  1.00 48.18  ? 432  HIS C CA    1 
ATOM   9366  C  C     . HIS G 3 426 ? -1.343  75.129  85.287  1.00 48.18  ? 432  HIS C C     1 
ATOM   9367  O  O     . HIS G 3 426 ? -0.406  74.542  85.835  1.00 48.18  ? 432  HIS C O     1 
ATOM   9368  C  CB    . HIS G 3 426 ? -3.258  73.804  84.257  1.00 63.40  ? 432  HIS C CB    1 
ATOM   9369  N  N     . ALA G 3 427 ? -1.844  76.265  85.766  1.00 51.50  ? 433  ALA C N     1 
ATOM   9370  C  CA    . ALA G 3 427 ? -1.293  76.862  86.977  1.00 51.50  ? 433  ALA C CA    1 
ATOM   9371  C  C     . ALA G 3 427 ? -2.041  78.102  87.464  1.00 51.50  ? 433  ALA C C     1 
ATOM   9372  O  O     . ALA G 3 427 ? -2.790  78.727  86.715  1.00 51.50  ? 433  ALA C O     1 
ATOM   9373  C  CB    . ALA G 3 427 ? 0.173   77.205  86.745  1.00 51.64  ? 433  ALA C CB    1 
ATOM   9374  N  N     . PHE G 3 428 ? -1.835  78.418  88.743  1.00 40.79  ? 434  PHE C N     1 
ATOM   9375  C  CA    . PHE G 3 428 ? -2.413  79.588  89.409  1.00 40.79  ? 434  PHE C CA    1 
ATOM   9376  C  C     . PHE G 3 428 ? -3.924  79.744  89.339  1.00 40.79  ? 434  PHE C C     1 
ATOM   9377  O  O     . PHE G 3 428 ? -4.428  80.682  88.723  1.00 40.79  ? 434  PHE C O     1 
ATOM   9378  C  CB    . PHE G 3 428 ? -1.768  80.866  88.864  1.00 51.33  ? 434  PHE C CB    1 
ATOM   9379  C  CG    . PHE G 3 428 ? -0.270  80.891  88.981  1.00 51.33  ? 434  PHE C CG    1 
ATOM   9380  C  CD1   . PHE G 3 428 ? 0.344   81.354  90.127  1.00 51.33  ? 434  PHE C CD1   1 
ATOM   9381  C  CD2   . PHE G 3 428 ? 0.532   80.464  87.928  1.00 51.33  ? 434  PHE C CD2   1 
ATOM   9382  C  CE1   . PHE G 3 428 ? 1.739   81.396  90.218  1.00 51.33  ? 434  PHE C CE1   1 
ATOM   9383  C  CE2   . PHE G 3 428 ? 1.924   80.502  88.017  1.00 51.33  ? 434  PHE C CE2   1 
ATOM   9384  C  CZ    . PHE G 3 428 ? 2.524   80.969  89.160  1.00 51.33  ? 434  PHE C CZ    1 
ATOM   9385  N  N     . PRO G 3 429 ? -4.673  78.811  89.939  1.00 47.81  ? 435  PRO C N     1 
ATOM   9386  C  CA    . PRO G 3 429 ? -4.188  77.639  90.653  1.00 47.81  ? 435  PRO C CA    1 
ATOM   9387  C  C     . PRO G 3 429 ? -4.155  76.612  89.563  1.00 47.81  ? 435  PRO C C     1 
ATOM   9388  O  O     . PRO G 3 429 ? -4.663  76.871  88.484  1.00 47.81  ? 435  PRO C O     1 
ATOM   9389  C  CB    . PRO G 3 429 ? -5.307  77.366  91.637  1.00 48.67  ? 435  PRO C CB    1 
ATOM   9390  C  CG    . PRO G 3 429 ? -6.496  77.637  90.817  1.00 48.67  ? 435  PRO C CG    1 
ATOM   9391  C  CD    . PRO G 3 429 ? -6.126  78.950  90.139  1.00 48.67  ? 435  PRO C CD    1 
ATOM   9392  N  N     . ASN G 3 430 ? -3.575  75.453  89.807  1.00 68.45  ? 436  ASN C N     1 
ATOM   9393  C  CA    . ASN G 3 430 ? -3.545  74.447  88.760  1.00 68.45  ? 436  ASN C CA    1 
ATOM   9394  C  C     . ASN G 3 430 ? -4.880  73.703  88.731  1.00 68.45  ? 436  ASN C C     1 
ATOM   9395  O  O     . ASN G 3 430 ? -5.191  72.944  89.646  1.00 68.45  ? 436  ASN C O     1 
ATOM   9396  C  CB    . ASN G 3 430 ? -2.387  73.479  89.008  1.00 39.53  ? 436  ASN C CB    1 
ATOM   9397  C  CG    . ASN G 3 430 ? -2.377  72.322  88.045  1.00 39.53  ? 436  ASN C CG    1 
ATOM   9398  O  OD1   . ASN G 3 430 ? -3.409  71.963  87.475  1.00 39.53  ? 436  ASN C OD1   1 
ATOM   9399  N  ND2   . ASN G 3 430 ? -1.215  71.709  87.877  1.00 39.53  ? 436  ASN C ND2   1 
ATOM   9400  N  N     . LEU G 3 431 ? -5.674  73.928  87.692  1.00 58.11  ? 437  LEU C N     1 
ATOM   9401  C  CA    . LEU G 3 431 ? -6.949  73.244  87.593  1.00 58.11  ? 437  LEU C CA    1 
ATOM   9402  C  C     . LEU G 3 431 ? -6.865  71.957  86.797  1.00 58.11  ? 437  LEU C C     1 
ATOM   9403  O  O     . LEU G 3 431 ? -7.813  71.576  86.123  1.00 58.11  ? 437  LEU C O     1 
ATOM   9404  C  CB    . LEU G 3 431 ? -7.996  74.144  86.966  1.00 66.98  ? 437  LEU C CB    1 
ATOM   9405  C  CG    . LEU G 3 431 ? -8.379  75.287  87.881  1.00 66.98  ? 437  LEU C CG    1 
ATOM   9406  C  CD1   . LEU G 3 431 ? -7.417  76.428  87.663  1.00 66.98  ? 437  LEU C CD1   1 
ATOM   9407  C  CD2   . LEU G 3 431 ? -9.798  75.715  87.592  1.00 66.98  ? 437  LEU C CD2   1 
ATOM   9408  N  N     . ALA G 3 432 ? -5.729  71.285  86.865  1.00 69.98  ? 438  ALA C N     1 
ATOM   9409  C  CA    . ALA G 3 432 ? -5.560  70.030  86.146  1.00 69.98  ? 438  ALA C CA    1 
ATOM   9410  C  C     . ALA G 3 432 ? -5.114  68.992  87.164  1.00 69.98  ? 438  ALA C C     1 
ATOM   9411  O  O     . ALA G 3 432 ? -4.574  67.938  86.816  1.00 69.98  ? 438  ALA C O     1 
ATOM   9412  C  CB    . ALA G 3 432 ? -4.504  70.189  85.063  1.00 25.81  ? 438  ALA C CB    1 
ATOM   9413  N  N     . GLN G 3 433 ? -5.331  69.328  88.430  1.00 61.95  ? 439  GLN C N     1 
ATOM   9414  C  CA    . GLN G 3 433 ? -4.965  68.474  89.537  1.00 61.95  ? 439  GLN C CA    1 
ATOM   9415  C  C     . GLN G 3 433 ? -6.011  68.577  90.639  1.00 61.95  ? 439  GLN C C     1 
ATOM   9416  O  O     . GLN G 3 433 ? -5.693  68.551  91.827  1.00 61.95  ? 439  GLN C O     1 
ATOM   9417  C  CB    . GLN G 3 433 ? -3.586  68.867  90.071  1.00 63.25  ? 439  GLN C CB    1 
ATOM   9418  C  CG    . GLN G 3 433 ? -3.416  70.332  90.423  1.00 63.25  ? 439  GLN C CG    1 
ATOM   9419  C  CD    . GLN G 3 433 ? -2.068  70.622  91.103  1.00 63.25  ? 439  GLN C CD    1 
ATOM   9420  O  OE1   . GLN G 3 433 ? -1.768  71.765  91.475  1.00 63.25  ? 439  GLN C OE1   1 
ATOM   9421  N  NE2   . GLN G 3 433 ? -1.256  69.581  91.269  1.00 63.25  ? 439  GLN C NE2   1 
ATOM   9422  N  N     . ILE G 3 434 ? -7.268  68.717  90.240  1.00 44.06  ? 440  ILE C N     1 
ATOM   9423  C  CA    . ILE G 3 434 ? -8.338  68.779  91.208  1.00 44.06  ? 440  ILE C CA    1 
ATOM   9424  C  C     . ILE G 3 434 ? -8.495  67.312  91.553  1.00 44.06  ? 440  ILE C C     1 
ATOM   9425  O  O     . ILE G 3 434 ? -8.474  66.482  90.664  1.00 44.06  ? 440  ILE C O     1 
ATOM   9426  C  CB    . ILE G 3 434 ? -9.645  69.245  90.567  1.00 29.80  ? 440  ILE C CB    1 
ATOM   9427  C  CG1   . ILE G 3 434 ? -9.474  70.611  89.913  1.00 29.80  ? 440  ILE C CG1   1 
ATOM   9428  C  CG2   . ILE G 3 434 ? -10.741 69.295  91.622  1.00 29.80  ? 440  ILE C CG2   1 
ATOM   9429  C  CD1   . ILE G 3 434 ? -9.469  71.754  90.892  1.00 29.80  ? 440  ILE C CD1   1 
ATOM   9430  N  N     . PRO G 3 435 ? -8.635  66.959  92.832  1.00 51.54  ? 441  PRO C N     1 
ATOM   9431  C  CA    . PRO G 3 435 ? -8.788  65.522  93.081  1.00 51.54  ? 441  PRO C CA    1 
ATOM   9432  C  C     . PRO G 3 435 ? -9.976  65.006  92.260  1.00 51.54  ? 441  PRO C C     1 
ATOM   9433  O  O     . PRO G 3 435 ? -10.949 65.729  92.070  1.00 51.54  ? 441  PRO C O     1 
ATOM   9434  C  CB    . PRO G 3 435 ? -9.069  65.468  94.573  1.00 53.43  ? 441  PRO C CB    1 
ATOM   9435  C  CG    . PRO G 3 435 ? -8.409  66.731  95.098  1.00 53.43  ? 441  PRO C CG    1 
ATOM   9436  C  CD    . PRO G 3 435 ? -8.793  67.736  94.067  1.00 53.43  ? 441  PRO C CD    1 
ATOM   9437  N  N     . GLY G 3 436 ? -9.903  63.780  91.755  1.00 69.69  ? 442  GLY C N     1 
ATOM   9438  C  CA    . GLY G 3 436 ? -11.012 63.254  90.975  1.00 69.69  ? 442  GLY C CA    1 
ATOM   9439  C  C     . GLY G 3 436 ? -12.076 62.750  91.920  1.00 69.69  ? 442  GLY C C     1 
ATOM   9440  O  O     . GLY G 3 436 ? -11.871 62.774  93.136  1.00 69.69  ? 442  GLY C O     1 
ATOM   9441  N  N     . VAL G 3 437 ? -13.204 62.287  91.388  1.00 59.31  ? 443  VAL C N     1 
ATOM   9442  C  CA    . VAL G 3 437 ? -14.277 61.793  92.255  1.00 59.31  ? 443  VAL C CA    1 
ATOM   9443  C  C     . VAL G 3 437 ? -13.933 60.493  92.954  1.00 59.31  ? 443  VAL C C     1 
ATOM   9444  O  O     . VAL G 3 437 ? -14.533 60.149  93.974  1.00 59.31  ? 443  VAL C O     1 
ATOM   9445  C  CB    . VAL G 3 437 ? -15.584 61.598  91.493  1.00 52.92  ? 443  VAL C CB    1 
ATOM   9446  C  CG1   . VAL G 3 437 ? -16.448 62.837  91.638  1.00 52.92  ? 443  VAL C CG1   1 
ATOM   9447  C  CG2   . VAL G 3 437 ? -15.282 61.323  90.046  1.00 52.92  ? 443  VAL C CG2   1 
ATOM   9448  N  N     . ARG G 3 438 ? -12.971 59.767  92.405  1.00 114.06 ? 444  ARG C N     1 
ATOM   9449  C  CA    . ARG G 3 438 ? -12.554 58.514  93.005  1.00 114.06 ? 444  ARG C CA    1 
ATOM   9450  C  C     . ARG G 3 438 ? -11.452 58.808  94.022  1.00 114.06 ? 444  ARG C C     1 
ATOM   9451  O  O     . ARG G 3 438 ? -10.459 58.087  94.099  1.00 114.06 ? 444  ARG C O     1 
ATOM   9452  C  CB    . ARG G 3 438 ? -12.044 57.563  91.920  1.00 79.67  ? 444  ARG C CB    1 
ATOM   9453  N  N     . SER G 3 439 ? -11.640 59.873  94.800  1.00 68.50  ? 445  SER C N     1 
ATOM   9454  C  CA    . SER G 3 439 ? -10.660 60.287  95.806  1.00 68.50  ? 445  SER C CA    1 
ATOM   9455  C  C     . SER G 3 439 ? -11.310 61.004  96.977  1.00 68.50  ? 445  SER C C     1 
ATOM   9456  O  O     . SER G 3 439 ? -12.154 61.863  96.789  1.00 68.50  ? 445  SER C O     1 
ATOM   9457  C  CB    . SER G 3 439 ? -9.602  61.217  95.182  1.00 50.71  ? 445  SER C CB    1 
ATOM   9458  O  OG    . SER G 3 439 ? -8.483  60.490  94.690  1.00 50.71  ? 445  SER C OG    1 
ATOM   9459  N  N     . PRO G 3 440 ? -10.903 60.673  98.207  1.00 68.43  ? 446  PRO C N     1 
ATOM   9460  C  CA    . PRO G 3 440 ? -11.469 61.311  99.392  1.00 68.43  ? 446  PRO C CA    1 
ATOM   9461  C  C     . PRO G 3 440 ? -11.790 62.771  99.128  1.00 68.43  ? 446  PRO C C     1 
ATOM   9462  O  O     . PRO G 3 440 ? -10.897 63.548  98.834  1.00 68.43  ? 446  PRO C O     1 
ATOM   9463  C  CB    . PRO G 3 440 ? -10.356 61.159  100.413 1.00 58.43  ? 446  PRO C CB    1 
ATOM   9464  C  CG    . PRO G 3 440 ? -9.802  59.842  100.082 1.00 58.43  ? 446  PRO C CG    1 
ATOM   9465  C  CD    . PRO G 3 440 ? -9.715  59.886  98.574  1.00 58.43  ? 446  PRO C CD    1 
ATOM   9466  N  N     . TYR G 3 441 ? -13.066 63.131  99.238  1.00 49.88  ? 447  TYR C N     1 
ATOM   9467  C  CA    . TYR G 3 441 ? -13.539 64.496  99.011  1.00 49.88  ? 447  TYR C CA    1 
ATOM   9468  C  C     . TYR G 3 441 ? -13.408 64.940  97.570  1.00 49.88  ? 447  TYR C C     1 
ATOM   9469  O  O     . TYR G 3 441 ? -13.610 66.108  97.261  1.00 49.88  ? 447  TYR C O     1 
ATOM   9470  C  CB    . TYR G 3 441 ? -12.798 65.490  99.889  1.00 50.53  ? 447  TYR C CB    1 
ATOM   9471  C  CG    . TYR G 3 441 ? -12.840 65.159  101.348 1.00 50.53  ? 447  TYR C CG    1 
ATOM   9472  C  CD1   . TYR G 3 441 ? -13.419 66.030  102.255 1.00 50.53  ? 447  TYR C CD1   1 
ATOM   9473  C  CD2   . TYR G 3 441 ? -12.254 64.002  101.831 1.00 50.53  ? 447  TYR C CD2   1 
ATOM   9474  C  CE1   . TYR G 3 441 ? -13.410 65.759  103.607 1.00 50.53  ? 447  TYR C CE1   1 
ATOM   9475  C  CE2   . TYR G 3 441 ? -12.237 63.721  103.183 1.00 50.53  ? 447  TYR C CE2   1 
ATOM   9476  C  CZ    . TYR G 3 441 ? -12.820 64.603  104.070 1.00 50.53  ? 447  TYR C CZ    1 
ATOM   9477  O  OH    . TYR G 3 441 ? -12.849 64.307  105.416 1.00 50.53  ? 447  TYR C OH    1 
ATOM   9478  N  N     . GLY G 3 442 ? -13.067 64.010  96.692  1.00 76.10  ? 448  GLY C N     1 
ATOM   9479  C  CA    . GLY G 3 442 ? -12.934 64.349  95.293  1.00 76.10  ? 448  GLY C CA    1 
ATOM   9480  C  C     . GLY G 3 442 ? -14.306 64.433  94.664  1.00 76.10  ? 448  GLY C C     1 
ATOM   9481  O  O     . GLY G 3 442 ? -14.444 64.514  93.447  1.00 76.10  ? 448  GLY C O     1 
ATOM   9482  N  N     . GLU G 3 443 ? -15.336 64.397  95.498  1.00 72.34  ? 449  GLU C N     1 
ATOM   9483  C  CA    . GLU G 3 443 ? -16.702 64.483  95.001  1.00 72.34  ? 449  GLU C CA    1 
ATOM   9484  C  C     . GLU G 3 443 ? -17.231 65.869  95.296  1.00 72.34  ? 449  GLU C C     1 
ATOM   9485  O  O     . GLU G 3 443 ? -18.065 66.387  94.568  1.00 72.34  ? 449  GLU C O     1 
ATOM   9486  C  CB    . GLU G 3 443 ? -17.598 63.442  95.672  1.00 102.54 ? 449  GLU C CB    1 
ATOM   9487  N  N     . GLN G 3 444 ? -16.727 66.467  96.372  1.00 73.68  ? 450  GLN C N     1 
ATOM   9488  C  CA    . GLN G 3 444 ? -17.149 67.799  96.780  1.00 73.68  ? 450  GLN C CA    1 
ATOM   9489  C  C     . GLN G 3 444 ? -16.363 68.886  96.080  1.00 73.68  ? 450  GLN C C     1 
ATOM   9490  O  O     . GLN G 3 444 ? -16.888 69.969  95.843  1.00 73.68  ? 450  GLN C O     1 
ATOM   9491  C  CB    . GLN G 3 444 ? -16.998 67.966  98.285  1.00 55.13  ? 450  GLN C CB    1 
ATOM   9492  C  CG    . GLN G 3 444 ? -17.810 66.980  99.102  1.00 55.13  ? 450  GLN C CG    1 
ATOM   9493  C  CD    . GLN G 3 444 ? -17.941 67.425  100.547 1.00 55.13  ? 450  GLN C CD    1 
ATOM   9494  O  OE1   . GLN G 3 444 ? -17.478 66.737  101.469 1.00 55.13  ? 450  GLN C OE1   1 
ATOM   9495  N  NE2   . GLN G 3 444 ? -18.568 68.590  100.757 1.00 55.13  ? 450  GLN C NE2   1 
ATOM   9496  N  N     . CYS G 3 445 ? -15.105 68.588  95.760  1.00 48.85  ? 451  CYS C N     1 
ATOM   9497  C  CA    . CYS G 3 445 ? -14.220 69.527  95.079  1.00 48.85  ? 451  CYS C CA    1 
ATOM   9498  C  C     . CYS G 3 445 ? -14.690 69.690  93.657  1.00 48.85  ? 451  CYS C C     1 
ATOM   9499  O  O     . CYS G 3 445 ? -14.892 70.806  93.187  1.00 48.85  ? 451  CYS C O     1 
ATOM   9500  C  CB    . CYS G 3 445 ? -12.782 69.009  95.073  1.00 56.61  ? 451  CYS C CB    1 
ATOM   9501  S  SG    . CYS G 3 445 ? -12.003 68.957  96.704  1.00 56.61  ? 451  CYS C SG    1 
ATOM   9502  N  N     . ARG G 3 446 ? -14.876 68.566  92.978  1.00 58.44  ? 452  ARG C N     1 
ATOM   9503  C  CA    . ARG G 3 446 ? -15.313 68.586  91.598  1.00 58.44  ? 452  ARG C CA    1 
ATOM   9504  C  C     . ARG G 3 446 ? -16.696 69.233  91.469  1.00 58.44  ? 452  ARG C C     1 
ATOM   9505  O  O     . ARG G 3 446 ? -16.968 69.970  90.522  1.00 58.44  ? 452  ARG C O     1 
ATOM   9506  C  CB    . ARG G 3 446 ? -15.318 67.158  91.060  1.00 75.34  ? 452  ARG C CB    1 
ATOM   9507  C  CG    . ARG G 3 446 ? -14.562 66.953  89.749  1.00 75.34  ? 452  ARG C CG    1 
ATOM   9508  C  CD    . ARG G 3 446 ? -13.060 66.938  89.920  1.00 75.34  ? 452  ARG C CD    1 
ATOM   9509  N  NE    . ARG G 3 446 ? -12.434 66.173  88.840  1.00 75.34  ? 452  ARG C NE    1 
ATOM   9510  C  CZ    . ARG G 3 446 ? -11.125 66.144  88.589  1.00 75.34  ? 452  ARG C CZ    1 
ATOM   9511  N  NH1   . ARG G 3 446 ? -10.291 66.843  89.335  1.00 75.34  ? 452  ARG C NH1   1 
ATOM   9512  N  NH2   . ARG G 3 446 ? -10.640 65.406  87.596  1.00 75.34  ? 452  ARG C NH2   1 
ATOM   9513  N  N     . ALA G 3 447 ? -17.566 68.978  92.435  1.00 54.59  ? 453  ALA C N     1 
ATOM   9514  C  CA    . ALA G 3 447 ? -18.903 69.549  92.394  1.00 54.59  ? 453  ALA C CA    1 
ATOM   9515  C  C     . ALA G 3 447 ? -18.900 71.067  92.585  1.00 54.59  ? 453  ALA C C     1 
ATOM   9516  O  O     . ALA G 3 447 ? -19.912 71.720  92.375  1.00 54.59  ? 453  ALA C O     1 
ATOM   9517  C  CB    . ALA G 3 447 ? -19.771 68.901  93.445  1.00 84.03  ? 453  ALA C CB    1 
ATOM   9518  N  N     . ALA G 3 448 ? -17.767 71.639  92.968  1.00 70.39  ? 454  ALA C N     1 
ATOM   9519  C  CA    . ALA G 3 448 ? -17.709 73.081  93.185  1.00 70.39  ? 454  ALA C CA    1 
ATOM   9520  C  C     . ALA G 3 448 ? -17.297 73.845  91.941  1.00 70.39  ? 454  ALA C C     1 
ATOM   9521  O  O     . ALA G 3 448 ? -17.302 75.075  91.919  1.00 70.39  ? 454  ALA C O     1 
ATOM   9522  C  CB    . ALA G 3 448 ? -16.759 73.396  94.321  1.00 54.55  ? 454  ALA C CB    1 
ATOM   9523  N  N     . PHE G 3 449 ? -16.913 73.113  90.910  1.00 75.07  ? 455  PHE C N     1 
ATOM   9524  C  CA    . PHE G 3 449 ? -16.527 73.742  89.666  1.00 75.07  ? 455  PHE C CA    1 
ATOM   9525  C  C     . PHE G 3 449 ? -17.590 73.300  88.665  1.00 75.07  ? 455  PHE C C     1 
ATOM   9526  O  O     . PHE G 3 449 ? -17.618 72.142  88.248  1.00 75.07  ? 455  PHE C O     1 
ATOM   9527  C  CB    . PHE G 3 449 ? -15.128 73.277  89.246  1.00 53.21  ? 455  PHE C CB    1 
ATOM   9528  C  CG    . PHE G 3 449 ? -14.023 73.734  90.171  1.00 53.21  ? 455  PHE C CG    1 
ATOM   9529  C  CD1   . PHE G 3 449 ? -13.936 73.257  91.467  1.00 53.21  ? 455  PHE C CD1   1 
ATOM   9530  C  CD2   . PHE G 3 449 ? -13.066 74.647  89.737  1.00 53.21  ? 455  PHE C CD2   1 
ATOM   9531  C  CE1   . PHE G 3 449 ? -12.914 73.684  92.314  1.00 53.21  ? 455  PHE C CE1   1 
ATOM   9532  C  CE2   . PHE G 3 449 ? -12.042 75.078  90.583  1.00 53.21  ? 455  PHE C CE2   1 
ATOM   9533  C  CZ    . PHE G 3 449 ? -11.968 74.595  91.869  1.00 53.21  ? 455  PHE C CZ    1 
ATOM   9534  N  N     . GLY G 3 450 ? -18.492 74.207  88.303  1.00 47.70  ? 456  GLY C N     1 
ATOM   9535  C  CA    . GLY G 3 450 ? -19.530 73.828  87.366  1.00 47.70  ? 456  GLY C CA    1 
ATOM   9536  C  C     . GLY G 3 450 ? -20.328 74.969  86.772  1.00 47.70  ? 456  GLY C C     1 
ATOM   9537  O  O     . GLY G 3 450 ? -20.419 76.055  87.354  1.00 47.70  ? 456  GLY C O     1 
ATOM   9538  N  N     . ALA G 3 451 ? -20.907 74.708  85.601  1.00 41.97  ? 457  ALA C N     1 
ATOM   9539  C  CA    . ALA G 3 451 ? -21.701 75.694  84.905  1.00 41.97  ? 457  ALA C CA    1 
ATOM   9540  C  C     . ALA G 3 451 ? -22.814 76.145  85.818  1.00 41.97  ? 457  ALA C C     1 
ATOM   9541  O  O     . ALA G 3 451 ? -23.128 77.326  85.904  1.00 41.97  ? 457  ALA C O     1 
ATOM   9542  C  CB    . ALA G 3 451 ? -22.273 75.094  83.679  1.00 8.80   ? 457  ALA C CB    1 
ATOM   9543  N  N     . GLU G 3 452 ? -23.404 75.188  86.518  1.00 63.49  ? 458  GLU C N     1 
ATOM   9544  C  CA    . GLU G 3 452 ? -24.513 75.471  87.409  1.00 63.49  ? 458  GLU C CA    1 
ATOM   9545  C  C     . GLU G 3 452 ? -24.223 76.519  88.481  1.00 63.49  ? 458  GLU C C     1 
ATOM   9546  O  O     . GLU G 3 452 ? -25.112 76.906  89.228  1.00 63.49  ? 458  GLU C O     1 
ATOM   9547  C  CB    . GLU G 3 452 ? -24.975 74.188  88.085  1.00 72.56  ? 458  GLU C CB    1 
ATOM   9548  C  CG    . GLU G 3 452 ? -24.272 73.924  89.396  1.00 72.56  ? 458  GLU C CG    1 
ATOM   9549  C  CD    . GLU G 3 452 ? -25.075 73.017  90.284  1.00 72.56  ? 458  GLU C CD    1 
ATOM   9550  O  OE1   . GLU G 3 452 ? -26.324 73.183  90.287  1.00 72.56  ? 458  GLU C OE1   1 
ATOM   9551  O  OE2   . GLU G 3 452 ? -24.461 72.160  90.973  1.00 72.56  ? 458  GLU C OE2   1 
ATOM   9552  N  N     . HIS G 3 453 ? -22.987 76.975  88.576  1.00 58.90  ? 459  HIS C N     1 
ATOM   9553  C  CA    . HIS G 3 453 ? -22.673 77.969  89.581  1.00 58.90  ? 459  HIS C CA    1 
ATOM   9554  C  C     . HIS G 3 453 ? -22.648 79.355  88.961  1.00 58.90  ? 459  HIS C C     1 
ATOM   9555  O  O     . HIS G 3 453 ? -22.284 80.343  89.613  1.00 58.90  ? 459  HIS C O     1 
ATOM   9556  C  CB    . HIS G 3 453 ? -21.351 77.627  90.258  1.00 87.82  ? 459  HIS C CB    1 
ATOM   9557  C  CG    . HIS G 3 453 ? -21.348 76.271  90.886  1.00 87.82  ? 459  HIS C CG    1 
ATOM   9558  N  ND1   . HIS G 3 453 ? -22.376 75.826  91.689  1.00 87.82  ? 459  HIS C ND1   1 
ATOM   9559  C  CD2   . HIS G 3 453 ? -20.454 75.256  90.820  1.00 87.82  ? 459  HIS C CD2   1 
ATOM   9560  C  CE1   . HIS G 3 453 ? -22.116 74.594  92.090  1.00 87.82  ? 459  HIS C CE1   1 
ATOM   9561  N  NE2   . HIS G 3 453 ? -20.955 74.225  91.577  1.00 87.82  ? 459  HIS C NE2   1 
ATOM   9562  N  N     . HIS G 3 454 ? -23.050 79.414  87.691  1.00 59.78  ? 460  HIS C N     1 
ATOM   9563  C  CA    . HIS G 3 454 ? -23.134 80.672  86.953  1.00 59.78  ? 460  HIS C CA    1 
ATOM   9564  C  C     . HIS G 3 454 ? -24.577 80.936  86.550  1.00 59.78  ? 460  HIS C C     1 
ATOM   9565  O  O     . HIS G 3 454 ? -25.113 80.274  85.658  1.00 59.78  ? 460  HIS C O     1 
ATOM   9566  C  CB    . HIS G 3 454 ? -22.296 80.657  85.677  1.00 55.35  ? 460  HIS C CB    1 
ATOM   9567  C  CG    . HIS G 3 454 ? -22.415 81.927  84.890  1.00 55.35  ? 460  HIS C CG    1 
ATOM   9568  N  ND1   . HIS G 3 454 ? -21.850 83.116  85.305  1.00 55.35  ? 460  HIS C ND1   1 
ATOM   9569  C  CD2   . HIS G 3 454 ? -23.103 82.214  83.758  1.00 55.35  ? 460  HIS C CD2   1 
ATOM   9570  C  CE1   . HIS G 3 454 ? -22.185 84.079  84.464  1.00 55.35  ? 460  HIS C CE1   1 
ATOM   9571  N  NE2   . HIS G 3 454 ? -22.946 83.559  83.517  1.00 55.35  ? 460  HIS C NE2   1 
ATOM   9572  N  N     . LEU G 3 455 ? -25.198 81.904  87.215  1.00 93.98  ? 461  LEU C N     1 
ATOM   9573  C  CA    . LEU G 3 455 ? -26.574 82.270  86.932  1.00 93.98  ? 461  LEU C CA    1 
ATOM   9574  C  C     . LEU G 3 455 ? -26.549 83.226  85.726  1.00 93.98  ? 461  LEU C C     1 
ATOM   9575  O  O     . LEU G 3 455 ? -25.816 84.218  85.715  1.00 93.98  ? 461  LEU C O     1 
ATOM   9576  C  CB    . LEU G 3 455 ? -27.209 82.902  88.193  1.00 48.35  ? 461  LEU C CB    1 
ATOM   9577  N  N     . ASP G 3 456 ? -27.336 82.896  84.705  1.00 98.87  ? 462  ASP C N     1 
ATOM   9578  C  CA    . ASP G 3 456 ? -27.418 83.669  83.464  1.00 98.87  ? 462  ASP C CA    1 
ATOM   9579  C  C     . ASP G 3 456 ? -27.500 85.188  83.613  1.00 98.87  ? 462  ASP C C     1 
ATOM   9580  O  O     . ASP G 3 456 ? -28.093 85.702  84.557  1.00 98.87  ? 462  ASP C O     1 
ATOM   9581  C  CB    . ASP G 3 456 ? -28.627 83.204  82.659  1.00 74.22  ? 462  ASP C CB    1 
ATOM   9582  C  CG    . ASP G 3 456 ? -28.563 83.639  81.214  1.00 74.22  ? 462  ASP C CG    1 
ATOM   9583  O  OD1   . ASP G 3 456 ? -27.843 82.973  80.438  1.00 74.22  ? 462  ASP C OD1   1 
ATOM   9584  O  OD2   . ASP G 3 456 ? -29.218 84.646  80.861  1.00 74.22  ? 462  ASP C OD2   1 
ATOM   9585  N  N     . GLY G 3 457 ? -26.923 85.902  82.652  1.00 95.50  ? 463  GLY C N     1 
ATOM   9586  C  CA    . GLY G 3 457 ? -26.947 87.350  82.695  1.00 95.50  ? 463  GLY C CA    1 
ATOM   9587  C  C     . GLY G 3 457 ? -28.348 87.933  82.686  1.00 95.50  ? 463  GLY C C     1 
ATOM   9588  O  O     . GLY G 3 457 ? -28.648 88.815  83.493  1.00 95.50  ? 463  GLY C O     1 
ATOM   9589  N  N     . ILE G 3 458 ? -29.196 87.437  81.783  1.00 88.42  ? 464  ILE C N     1 
ATOM   9590  C  CA    . ILE G 3 458 ? -30.583 87.896  81.621  1.00 88.42  ? 464  ILE C CA    1 
ATOM   9591  C  C     . ILE G 3 458 ? -31.573 87.072  82.441  1.00 88.42  ? 464  ILE C C     1 
ATOM   9592  O  O     . ILE G 3 458 ? -32.084 87.504  83.477  1.00 88.42  ? 464  ILE C O     1 
ATOM   9593  C  CB    . ILE G 3 458 ? -31.034 87.756  80.148  1.00 84.33  ? 464  ILE C CB    1 
ATOM   9594  C  CG1   . ILE G 3 458 ? -30.087 88.518  79.224  1.00 84.33  ? 464  ILE C CG1   1 
ATOM   9595  C  CG2   . ILE G 3 458 ? -32.481 88.212  79.998  1.00 84.33  ? 464  ILE C CG2   1 
ATOM   9596  C  CD1   . ILE G 3 458 ? -30.170 90.014  79.357  1.00 84.33  ? 464  ILE C CD1   1 
ATOM   9597  N  N     . THR G 3 459 ? -31.844 85.877  81.927  1.00 61.95  ? 465  THR C N     1 
ATOM   9598  C  CA    . THR G 3 459 ? -32.770 84.940  82.535  1.00 61.95  ? 465  THR C CA    1 
ATOM   9599  C  C     . THR G 3 459 ? -32.438 84.661  83.995  1.00 61.95  ? 465  THR C C     1 
ATOM   9600  O  O     . THR G 3 459 ? -33.275 84.148  84.728  1.00 61.95  ? 465  THR C O     1 
ATOM   9601  C  CB    . THR G 3 459 ? -32.810 83.601  81.727  1.00 65.47  ? 465  THR C CB    1 
ATOM   9602  O  OG1   . THR G 3 459 ? -32.350 82.523  82.548  1.00 65.47  ? 465  THR C OG1   1 
ATOM   9603  C  CG2   . THR G 3 459 ? -31.920 83.687  80.470  1.00 65.47  ? 465  THR C CG2   1 
ATOM   9604  N  N     . GLY G 3 460 ? -31.227 85.015  84.416  1.00 70.42  ? 466  GLY C N     1 
ATOM   9605  C  CA    . GLY G 3 460 ? -30.808 84.781  85.788  1.00 70.42  ? 466  GLY C CA    1 
ATOM   9606  C  C     . GLY G 3 460 ? -30.810 83.307  86.190  1.00 70.42  ? 466  GLY C C     1 
ATOM   9607  O  O     . GLY G 3 460 ? -30.612 82.977  87.362  1.00 70.42  ? 466  GLY C O     1 
ATOM   9608  N  N     . LYS G 3 461 ? -31.029 82.415  85.226  1.00 72.32  ? 467  LYS C N     1 
ATOM   9609  C  CA    . LYS G 3 461 ? -31.072 80.978  85.504  1.00 72.32  ? 467  LYS C CA    1 
ATOM   9610  C  C     . LYS G 3 461 ? -29.734 80.296  85.286  1.00 72.32  ? 467  LYS C C     1 
ATOM   9611  O  O     . LYS G 3 461 ? -28.958 80.675  84.409  1.00 72.32  ? 467  LYS C O     1 
ATOM   9612  C  CB    . LYS G 3 461 ? -32.128 80.282  84.635  1.00 52.43  ? 467  LYS C CB    1 
ATOM   9613  N  N     . PRO G 3 462 ? -29.460 79.257  86.080  1.00 67.01  ? 468  PRO C N     1 
ATOM   9614  C  CA    . PRO G 3 462 ? -28.214 78.491  86.006  1.00 67.01  ? 468  PRO C CA    1 
ATOM   9615  C  C     . PRO G 3 462 ? -27.913 77.926  84.618  1.00 67.01  ? 468  PRO C C     1 
ATOM   9616  O  O     . PRO G 3 462 ? -28.818 77.597  83.854  1.00 67.01  ? 468  PRO C O     1 
ATOM   9617  C  CB    . PRO G 3 462 ? -28.424 77.407  87.061  1.00 58.07  ? 468  PRO C CB    1 
ATOM   9618  C  CG    . PRO G 3 462 ? -29.925 77.222  87.056  1.00 58.07  ? 468  PRO C CG    1 
ATOM   9619  C  CD    . PRO G 3 462 ? -30.416 78.627  87.009  1.00 58.07  ? 468  PRO C CD    1 
ATOM   9620  N  N     . TRP G 3 463 ? -26.630 77.847  84.292  1.00 64.17  ? 469  TRP C N     1 
ATOM   9621  C  CA    . TRP G 3 463 ? -26.209 77.305  83.018  1.00 64.17  ? 469  TRP C CA    1 
ATOM   9622  C  C     . TRP G 3 463 ? -26.080 75.793  83.203  1.00 64.17  ? 469  TRP C C     1 
ATOM   9623  O  O     . TRP G 3 463 ? -26.335 75.266  84.292  1.00 64.17  ? 469  TRP C O     1 
ATOM   9624  C  CB    . TRP G 3 463 ? -24.866 77.912  82.607  1.00 70.55  ? 469  TRP C CB    1 
ATOM   9625  C  CG    . TRP G 3 463 ? -24.979 79.161  81.788  1.00 70.55  ? 469  TRP C CG    1 
ATOM   9626  C  CD1   . TRP G 3 463 ? -25.813 80.211  82.009  1.00 70.55  ? 469  TRP C CD1   1 
ATOM   9627  C  CD2   . TRP G 3 463 ? -24.230 79.483  80.609  1.00 70.55  ? 469  TRP C CD2   1 
ATOM   9628  N  NE1   . TRP G 3 463 ? -25.640 81.168  81.040  1.00 70.55  ? 469  TRP C NE1   1 
ATOM   9629  C  CE2   . TRP G 3 463 ? -24.672 80.745  80.166  1.00 70.55  ? 469  TRP C CE2   1 
ATOM   9630  C  CE3   . TRP G 3 463 ? -23.225 78.827  79.882  1.00 70.55  ? 469  TRP C CE3   1 
ATOM   9631  C  CZ2   . TRP G 3 463 ? -24.147 81.366  79.022  1.00 70.55  ? 469  TRP C CZ2   1 
ATOM   9632  C  CZ3   . TRP G 3 463 ? -22.702 79.446  78.744  1.00 70.55  ? 469  TRP C CZ3   1 
ATOM   9633  C  CH2   . TRP G 3 463 ? -23.167 80.700  78.328  1.00 70.55  ? 469  TRP C CH2   1 
ATOM   9634  N  N     . VAL G 3 464 ? -25.680 75.107  82.136  1.00 58.15  ? 470  VAL C N     1 
ATOM   9635  C  CA    . VAL G 3 464 ? -25.513 73.662  82.134  1.00 58.15  ? 470  VAL C CA    1 
ATOM   9636  C  C     . VAL G 3 464 ? -24.121 73.375  81.592  1.00 58.15  ? 470  VAL C C     1 
ATOM   9637  O  O     . VAL G 3 464 ? -23.689 74.012  80.644  1.00 58.15  ? 470  VAL C O     1 
ATOM   9638  C  CB    . VAL G 3 464 ? -26.557 72.998  81.211  1.00 51.67  ? 470  VAL C CB    1 
ATOM   9639  C  CG1   . VAL G 3 464 ? -26.381 71.497  81.216  1.00 51.67  ? 470  VAL C CG1   1 
ATOM   9640  C  CG2   . VAL G 3 464 ? -27.955 73.363  81.658  1.00 51.67  ? 470  VAL C CG2   1 
ATOM   9641  N  N     . GLN G 3 465 ? -23.425 72.417  82.190  1.00 53.87  ? 471  GLN C N     1 
ATOM   9642  C  CA    . GLN G 3 465 ? -22.082 72.077  81.755  1.00 53.87  ? 471  GLN C CA    1 
ATOM   9643  C  C     . GLN G 3 465 ? -22.096 70.904  80.810  1.00 53.87  ? 471  GLN C C     1 
ATOM   9644  O  O     . GLN G 3 465 ? -22.962 70.054  80.898  1.00 53.87  ? 471  GLN C O     1 
ATOM   9645  C  CB    . GLN G 3 465 ? -21.196 71.742  82.962  1.00 56.89  ? 471  GLN C CB    1 
ATOM   9646  N  N     . ALA G 3 466 ? -21.123 70.856  79.908  1.00 66.36  ? 472  ALA C N     1 
ATOM   9647  C  CA    . ALA G 3 466 ? -21.012 69.758  78.944  1.00 66.36  ? 472  ALA C CA    1 
ATOM   9648  C  C     . ALA G 3 466 ? -19.586 69.211  78.904  1.00 66.36  ? 472  ALA C C     1 
ATOM   9649  O  O     . ALA G 3 466 ? -18.690 69.801  78.296  1.00 66.36  ? 472  ALA C O     1 
ATOM   9650  C  CB    . ALA G 3 466 ? -21.428 70.229  77.555  1.00 97.84  ? 472  ALA C CB    1 
ATOM   9651  N  N     . GLY G 3 467 ? -19.380 68.073  79.551  1.00 59.86  ? 473  GLY C N     1 
ATOM   9652  C  CA    . GLY G 3 467 ? -18.053 67.500  79.577  1.00 59.86  ? 473  GLY C CA    1 
ATOM   9653  C  C     . GLY G 3 467 ? -17.818 66.532  78.445  1.00 59.86  ? 473  GLY C C     1 
ATOM   9654  O  O     . GLY G 3 467 ? -18.438 65.464  78.391  1.00 59.86  ? 473  GLY C O     1 
ATOM   9655  N  N     . ILE G 3 468 ? -16.927 66.904  77.532  1.00 43.55  ? 474  ILE C N     1 
ATOM   9656  C  CA    . ILE G 3 468 ? -16.608 66.029  76.411  1.00 43.55  ? 474  ILE C CA    1 
ATOM   9657  C  C     . ILE G 3 468 ? -15.169 65.556  76.604  1.00 43.55  ? 474  ILE C C     1 
ATOM   9658  O  O     . ILE G 3 468 ? -14.326 66.335  77.017  1.00 43.55  ? 474  ILE C O     1 
ATOM   9659  C  CB    . ILE G 3 468 ? -16.755 66.778  75.064  1.00 63.38  ? 474  ILE C CB    1 
ATOM   9660  N  N     . ASP G 3 469 ? -14.900 64.285  76.319  1.00 85.59  ? 475  ASP C N     1 
ATOM   9661  C  CA    . ASP G 3 469 ? -13.560 63.724  76.480  1.00 85.59  ? 475  ASP C CA    1 
ATOM   9662  C  C     . ASP G 3 469 ? -13.230 62.726  75.374  1.00 85.59  ? 475  ASP C C     1 
ATOM   9663  O  O     . ASP G 3 469 ? -14.126 62.053  74.852  1.00 85.59  ? 475  ASP C O     1 
ATOM   9664  C  CB    . ASP G 3 469 ? -13.446 63.028  77.834  1.00 76.33  ? 475  ASP C CB    1 
ATOM   9665  N  N     . ALA G 3 470 ? -11.942 62.622  75.036  1.00 47.52  ? 476  ALA C N     1 
ATOM   9666  C  CA    . ALA G 3 470 ? -11.478 61.723  73.977  1.00 47.52  ? 476  ALA C CA    1 
ATOM   9667  C  C     . ALA G 3 470 ? -11.340 60.284  74.444  1.00 47.52  ? 476  ALA C C     1 
ATOM   9668  O  O     . ALA G 3 470 ? -10.593 60.007  75.367  1.00 47.52  ? 476  ALA C O     1 
ATOM   9669  C  CB    . ALA G 3 470 ? -10.159 62.214  73.445  1.00 19.07  ? 476  ALA C CB    1 
ATOM   9670  N  N     . SER G 3 471 ? -12.049 59.376  73.778  1.00 61.11  ? 477  SER C N     1 
ATOM   9671  C  CA    . SER G 3 471 ? -12.044 57.948  74.105  1.00 61.11  ? 477  SER C CA    1 
ATOM   9672  C  C     . SER G 3 471 ? -10.758 57.235  73.710  1.00 61.11  ? 477  SER C C     1 
ATOM   9673  O  O     . SER G 3 471 ? -10.420 57.178  72.535  1.00 61.11  ? 477  SER C O     1 
ATOM   9674  C  CB    . SER G 3 471 ? -13.213 57.240  73.394  1.00 95.60  ? 477  SER C CB    1 
ATOM   9675  O  OG    . SER G 3 471 ? -14.481 57.761  73.760  1.00 95.60  ? 477  SER C OG    1 
ATOM   9676  N  N     . GLY G 3 472 ? -10.054 56.684  74.693  1.00 83.19  ? 478  GLY C N     1 
ATOM   9677  C  CA    . GLY G 3 472 ? -8.824  55.939  74.439  1.00 83.19  ? 478  GLY C CA    1 
ATOM   9678  C  C     . GLY G 3 472 ? -7.770  56.540  73.530  1.00 83.19  ? 478  GLY C C     1 
ATOM   9679  O  O     . GLY G 3 472 ? -6.950  55.824  72.957  1.00 83.19  ? 478  GLY C O     1 
ATOM   9680  N  N     . LEU G 3 473 ? -7.779  57.859  73.415  1.00 60.79  ? 479  LEU C N     1 
ATOM   9681  C  CA    . LEU G 3 473 ? -6.830  58.556  72.568  1.00 60.79  ? 479  LEU C CA    1 
ATOM   9682  C  C     . LEU G 3 473 ? -5.398  58.007  72.681  1.00 60.79  ? 479  LEU C C     1 
ATOM   9683  O  O     . LEU G 3 473 ? -4.623  58.072  71.737  1.00 60.79  ? 479  LEU C O     1 
ATOM   9684  C  CB    . LEU G 3 473 ? -6.875  60.050  72.900  1.00 50.18  ? 479  LEU C CB    1 
ATOM   9685  C  CG    . LEU G 3 473 ? -6.085  60.966  71.971  1.00 50.18  ? 479  LEU C CG    1 
ATOM   9686  C  CD1   . LEU G 3 473 ? -6.406  60.642  70.522  1.00 50.18  ? 479  LEU C CD1   1 
ATOM   9687  C  CD2   . LEU G 3 473 ? -6.423  62.404  72.281  1.00 50.18  ? 479  LEU C CD2   1 
ATOM   9688  N  N     . GLU G 3 474 ? -5.050  57.450  73.832  1.00 69.75  ? 480  GLU C N     1 
ATOM   9689  C  CA    . GLU G 3 474 ? -3.711  56.916  74.017  1.00 69.75  ? 480  GLU C CA    1 
ATOM   9690  C  C     . GLU G 3 474 ? -3.483  55.659  73.202  1.00 69.75  ? 480  GLU C C     1 
ATOM   9691  O  O     . GLU G 3 474 ? -2.721  55.668  72.239  1.00 69.75  ? 480  GLU C O     1 
ATOM   9692  C  CB    . GLU G 3 474 ? -3.446  56.597  75.489  1.00 122.04 ? 480  GLU C CB    1 
ATOM   9693  C  CG    . GLU G 3 474 ? -2.503  57.563  76.168  1.00 122.04 ? 480  GLU C CG    1 
ATOM   9694  C  CD    . GLU G 3 474 ? -3.168  58.877  76.492  1.00 122.04 ? 480  GLU C CD    1 
ATOM   9695  O  OE1   . GLU G 3 474 ? -4.023  58.887  77.407  1.00 122.04 ? 480  GLU C OE1   1 
ATOM   9696  O  OE2   . GLU G 3 474 ? -2.842  59.890  75.828  1.00 122.04 ? 480  GLU C OE2   1 
ATOM   9697  N  N     . LEU G 3 475 ? -4.138  54.572  73.598  1.00 63.99  ? 481  LEU C N     1 
ATOM   9698  C  CA    . LEU G 3 475 ? -3.980  53.300  72.911  1.00 63.99  ? 481  LEU C CA    1 
ATOM   9699  C  C     . LEU G 3 475 ? -4.157  53.482  71.406  1.00 63.99  ? 481  LEU C C     1 
ATOM   9700  O  O     . LEU G 3 475 ? -3.519  52.794  70.619  1.00 63.99  ? 481  LEU C O     1 
ATOM   9701  C  CB    . LEU G 3 475 ? -4.978  52.271  73.460  1.00 70.56  ? 481  LEU C CB    1 
ATOM   9702  N  N     . ARG G 3 476 ? -5.006  54.426  71.012  1.00 55.00  ? 482  ARG C N     1 
ATOM   9703  C  CA    . ARG G 3 476 ? -5.254  54.694  69.598  1.00 55.00  ? 482  ARG C CA    1 
ATOM   9704  C  C     . ARG G 3 476 ? -4.043  55.298  68.895  1.00 55.00  ? 482  ARG C C     1 
ATOM   9705  O  O     . ARG G 3 476 ? -3.729  54.914  67.774  1.00 55.00  ? 482  ARG C O     1 
ATOM   9706  C  CB    . ARG G 3 476 ? -6.466  55.612  69.427  1.00 53.79  ? 482  ARG C CB    1 
ATOM   9707  C  CG    . ARG G 3 476 ? -7.690  55.127  70.170  1.00 53.79  ? 482  ARG C CG    1 
ATOM   9708  C  CD    . ARG G 3 476 ? -8.977  55.438  69.455  1.00 53.79  ? 482  ARG C CD    1 
ATOM   9709  N  NE    . ARG G 3 476 ? -10.105 55.072  70.301  1.00 53.79  ? 482  ARG C NE    1 
ATOM   9710  C  CZ    . ARG G 3 476 ? -11.376 55.004  69.904  1.00 53.79  ? 482  ARG C CZ    1 
ATOM   9711  N  NH1   . ARG G 3 476 ? -11.715 55.278  68.643  1.00 53.79  ? 482  ARG C NH1   1 
ATOM   9712  N  NH2   . ARG G 3 476 ? -12.316 54.658  70.784  1.00 53.79  ? 482  ARG C NH2   1 
ATOM   9713  N  N     . CYS G 3 477 ? -3.363  56.241  69.538  1.00 79.73  ? 483  CYS C N     1 
ATOM   9714  C  CA    . CYS G 3 477 ? -2.172  56.835  68.932  1.00 79.73  ? 483  CYS C CA    1 
ATOM   9715  C  C     . CYS G 3 477 ? -1.160  55.734  68.618  1.00 79.73  ? 483  CYS C C     1 
ATOM   9716  O  O     . CYS G 3 477 ? -0.350  55.866  67.700  1.00 79.73  ? 483  CYS C O     1 
ATOM   9717  C  CB    . CYS G 3 477 ? -1.509  57.836  69.881  1.00 63.73  ? 483  CYS C CB    1 
ATOM   9718  S  SG    . CYS G 3 477 ? -2.443  59.319  70.206  1.00 63.73  ? 483  CYS C SG    1 
ATOM   9719  N  N     . LEU G 3 478 ? -1.195  54.658  69.398  1.00 68.07  ? 484  LEU C N     1 
ATOM   9720  C  CA    . LEU G 3 478 ? -0.277  53.554  69.183  1.00 68.07  ? 484  LEU C CA    1 
ATOM   9721  C  C     . LEU G 3 478 ? -0.777  52.725  68.011  1.00 68.07  ? 484  LEU C C     1 
ATOM   9722  O  O     . LEU G 3 478 ? 0.000   52.353  67.140  1.00 68.07  ? 484  LEU C O     1 
ATOM   9723  C  CB    . LEU G 3 478 ? -0.165  52.694  70.444  1.00 53.87  ? 484  LEU C CB    1 
ATOM   9724  C  CG    . LEU G 3 478 ? 0.834   51.525  70.431  1.00 53.87  ? 484  LEU C CG    1 
ATOM   9725  C  CD1   . LEU G 3 478 ? 2.267   52.007  70.238  1.00 53.87  ? 484  LEU C CD1   1 
ATOM   9726  C  CD2   . LEU G 3 478 ? 0.721   50.788  71.746  1.00 53.87  ? 484  LEU C CD2   1 
ATOM   9727  N  N     . ALA G 3 479 ? -2.078  52.446  67.990  1.00 72.13  ? 485  ALA C N     1 
ATOM   9728  C  CA    . ALA G 3 479 ? -2.692  51.666  66.918  1.00 72.13  ? 485  ALA C CA    1 
ATOM   9729  C  C     . ALA G 3 479 ? -2.222  52.272  65.620  1.00 72.13  ? 485  ALA C C     1 
ATOM   9730  O  O     . ALA G 3 479 ? -1.454  51.664  64.878  1.00 72.13  ? 485  ALA C O     1 
ATOM   9731  C  CB    . ALA G 3 479 ? -4.205  51.752  67.012  1.00 69.59  ? 485  ALA C CB    1 
ATOM   9732  N  N     . HIS G 3 480 ? -2.698  53.488  65.378  1.00 83.79  ? 486  HIS C N     1 
ATOM   9733  C  CA    . HIS G 3 480 ? -2.362  54.282  64.201  1.00 83.79  ? 486  HIS C CA    1 
ATOM   9734  C  C     . HIS G 3 480 ? -0.889  54.107  63.832  1.00 83.79  ? 486  HIS C C     1 
ATOM   9735  O  O     . HIS G 3 480 ? -0.559  53.546  62.786  1.00 83.79  ? 486  HIS C O     1 
ATOM   9736  C  CB    . HIS G 3 480 ? -2.673  55.749  64.524  1.00 77.62  ? 486  HIS C CB    1 
ATOM   9737  C  CG    . HIS G 3 480 ? -2.048  56.742  63.595  1.00 77.62  ? 486  HIS C CG    1 
ATOM   9738  N  ND1   . HIS G 3 480 ? -2.496  56.947  62.307  1.00 77.62  ? 486  HIS C ND1   1 
ATOM   9739  C  CD2   . HIS G 3 480 ? -1.034  57.619  63.787  1.00 77.62  ? 486  HIS C CD2   1 
ATOM   9740  C  CE1   . HIS G 3 480 ? -1.787  57.911  61.748  1.00 77.62  ? 486  HIS C CE1   1 
ATOM   9741  N  NE2   . HIS G 3 480 ? -0.894  58.335  62.625  1.00 77.62  ? 486  HIS C NE2   1 
ATOM   9742  N  N     . PHE G 3 481 ? -0.011  54.577  64.709  1.00 60.53  ? 487  PHE C N     1 
ATOM   9743  C  CA    . PHE G 3 481 ? 1.427   54.490  64.479  1.00 60.53  ? 487  PHE C CA    1 
ATOM   9744  C  C     . PHE G 3 481 ? 1.977   53.102  64.199  1.00 60.53  ? 487  PHE C C     1 
ATOM   9745  O  O     . PHE G 3 481 ? 2.944   52.963  63.448  1.00 60.53  ? 487  PHE C O     1 
ATOM   9746  C  CB    . PHE G 3 481 ? 2.214   55.122  65.648  1.00 57.86  ? 487  PHE C CB    1 
ATOM   9747  C  CG    . PHE G 3 481 ? 2.210   56.638  65.632  1.00 57.86  ? 487  PHE C CG    1 
ATOM   9748  C  CD1   . PHE G 3 481 ? 2.265   57.334  64.428  1.00 57.86  ? 487  PHE C CD1   1 
ATOM   9749  C  CD2   . PHE G 3 481 ? 2.163   57.362  66.806  1.00 57.86  ? 487  PHE C CD2   1 
ATOM   9750  C  CE1   . PHE G 3 481 ? 2.273   58.708  64.403  1.00 57.86  ? 487  PHE C CE1   1 
ATOM   9751  C  CE2   . PHE G 3 481 ? 2.173   58.748  66.783  1.00 57.86  ? 487  PHE C CE2   1 
ATOM   9752  C  CZ    . PHE G 3 481 ? 2.228   59.417  65.582  1.00 57.86  ? 487  PHE C CZ    1 
ATOM   9753  N  N     . MET G 3 482 ? 1.386   52.073  64.791  1.00 61.46  ? 488  MET C N     1 
ATOM   9754  C  CA    . MET G 3 482 ? 1.889   50.742  64.532  1.00 61.46  ? 488  MET C CA    1 
ATOM   9755  C  C     . MET G 3 482 ? 1.040   49.990  63.519  1.00 61.46  ? 488  MET C C     1 
ATOM   9756  O  O     . MET G 3 482 ? 1.033   48.763  63.492  1.00 61.46  ? 488  MET C O     1 
ATOM   9757  C  CB    . MET G 3 482 ? 2.041   49.941  65.833  1.00 77.99  ? 488  MET C CB    1 
ATOM   9758  C  CG    . MET G 3 482 ? 0.787   49.776  66.677  1.00 77.99  ? 488  MET C CG    1 
ATOM   9759  S  SD    . MET G 3 482 ? 0.990   48.528  67.991  1.00 77.99  ? 488  MET C SD    1 
ATOM   9760  C  CE    . MET G 3 482 ? -0.411  47.425  67.686  1.00 77.99  ? 488  MET C CE    1 
ATOM   9761  N  N     . ALA G 3 483 ? 0.343   50.743  62.671  1.00 76.37  ? 489  ALA C N     1 
ATOM   9762  C  CA    . ALA G 3 483 ? -0.504  50.175  61.623  1.00 76.37  ? 489  ALA C CA    1 
ATOM   9763  C  C     . ALA G 3 483 ? 0.340   49.988  60.358  1.00 76.37  ? 489  ALA C C     1 
ATOM   9764  O  O     . ALA G 3 483 ? 0.036   49.150  59.511  1.00 76.37  ? 489  ALA C O     1 
ATOM   9765  C  CB    . ALA G 3 483 ? -1.696  51.108  61.358  1.00 56.56  ? 489  ALA C CB    1 
ATOM   9766  N  N     . ARG G 3 484 ? 1.407   50.775  60.248  1.00 54.13  ? 490  ARG C N     1 
ATOM   9767  C  CA    . ARG G 3 484 ? 2.304   50.675  59.109  1.00 54.13  ? 490  ARG C CA    1 
ATOM   9768  C  C     . ARG G 3 484 ? 3.100   49.392  59.302  1.00 54.13  ? 490  ARG C C     1 
ATOM   9769  O  O     . ARG G 3 484 ? 4.080   49.127  58.605  1.00 54.13  ? 490  ARG C O     1 
ATOM   9770  C  CB    . ARG G 3 484 ? 3.231   51.898  59.024  1.00 84.64  ? 490  ARG C CB    1 
ATOM   9771  C  CG    . ARG G 3 484 ? 4.510   51.850  59.849  1.00 84.64  ? 490  ARG C CG    1 
ATOM   9772  C  CD    . ARG G 3 484 ? 5.734   51.848  58.929  1.00 84.64  ? 490  ARG C CD    1 
ATOM   9773  N  NE    . ARG G 3 484 ? 6.868   52.588  59.486  1.00 84.64  ? 490  ARG C NE    1 
ATOM   9774  C  CZ    . ARG G 3 484 ? 6.898   53.911  59.643  1.00 84.64  ? 490  ARG C CZ    1 
ATOM   9775  N  NH1   . ARG G 3 484 ? 5.861   54.649  59.286  1.00 84.64  ? 490  ARG C NH1   1 
ATOM   9776  N  NH2   . ARG G 3 484 ? 7.968   54.501  60.155  1.00 84.64  ? 490  ARG C NH2   1 
ATOM   9777  N  N     . PHE G 3 485 ? 2.643   48.601  60.266  1.00 58.76  ? 491  PHE C N     1 
ATOM   9778  C  CA    . PHE G 3 485 ? 3.237   47.318  60.584  1.00 58.76  ? 491  PHE C CA    1 
ATOM   9779  C  C     . PHE G 3 485 ? 2.120   46.282  60.778  1.00 58.76  ? 491  PHE C C     1 
ATOM   9780  O  O     . PHE G 3 485 ? 2.197   45.180  60.249  1.00 58.76  ? 491  PHE C O     1 
ATOM   9781  C  CB    . PHE G 3 485 ? 4.061   47.424  61.859  1.00 75.70  ? 491  PHE C CB    1 
ATOM   9782  C  CG    . PHE G 3 485 ? 5.322   48.238  61.717  1.00 75.70  ? 491  PHE C CG    1 
ATOM   9783  C  CD1   . PHE G 3 485 ? 6.347   47.828  60.864  1.00 75.70  ? 491  PHE C CD1   1 
ATOM   9784  C  CD2   . PHE G 3 485 ? 5.521   49.383  62.494  1.00 75.70  ? 491  PHE C CD2   1 
ATOM   9785  C  CE1   . PHE G 3 485 ? 7.560   48.548  60.792  1.00 75.70  ? 491  PHE C CE1   1 
ATOM   9786  C  CE2   . PHE G 3 485 ? 6.730   50.103  62.426  1.00 75.70  ? 491  PHE C CE2   1 
ATOM   9787  C  CZ    . PHE G 3 485 ? 7.747   49.683  61.575  1.00 75.70  ? 491  PHE C CZ    1 
ATOM   9788  N  N     . ASP G 3 486 ? 1.084   46.647  61.536  1.00 72.00  ? 492  ASP C N     1 
ATOM   9789  C  CA    . ASP G 3 486 ? -0.053  45.760  61.821  1.00 72.00  ? 492  ASP C CA    1 
ATOM   9790  C  C     . ASP G 3 486 ? -1.074  45.797  60.700  1.00 72.00  ? 492  ASP C C     1 
ATOM   9791  O  O     . ASP G 3 486 ? -1.877  44.883  60.571  1.00 72.00  ? 492  ASP C O     1 
ATOM   9792  C  CB    . ASP G 3 486 ? -0.744  46.154  63.147  1.00 34.09  ? 492  ASP C CB    1 
ATOM   9793  N  N     . ASN G 3 487 ? -1.033  46.859  59.897  1.00 72.16  ? 493  ASN C N     1 
ATOM   9794  C  CA    . ASN G 3 487 ? -1.947  47.055  58.771  1.00 72.16  ? 493  ASN C CA    1 
ATOM   9795  C  C     . ASN G 3 487 ? -3.421  47.006  59.196  1.00 72.16  ? 493  ASN C C     1 
ATOM   9796  O  O     . ASN G 3 487 ? -4.261  46.397  58.532  1.00 72.16  ? 493  ASN C O     1 
ATOM   9797  C  CB    . ASN G 3 487 ? -1.657  46.021  57.670  1.00 80.66  ? 493  ASN C CB    1 
ATOM   9798  N  N     . GLY G 3 488 ? -3.723  47.647  60.321  1.00 77.40  ? 494  GLY C N     1 
ATOM   9799  C  CA    . GLY G 3 488 ? -5.093  47.702  60.803  1.00 77.40  ? 494  GLY C CA    1 
ATOM   9800  C  C     . GLY G 3 488 ? -5.431  46.791  61.962  1.00 77.40  ? 494  GLY C C     1 
ATOM   9801  O  O     . GLY G 3 488 ? -6.557  46.810  62.456  1.00 77.40  ? 494  GLY C O     1 
ATOM   9802  N  N     . GLU G 3 489 ? -4.455  46.009  62.408  1.00 68.91  ? 495  GLU C N     1 
ATOM   9803  C  CA    . GLU G 3 489 ? -4.660  45.055  63.499  1.00 68.91  ? 495  GLU C CA    1 
ATOM   9804  C  C     . GLU G 3 489 ? -5.277  45.664  64.747  1.00 68.91  ? 495  GLU C C     1 
ATOM   9805  O  O     . GLU G 3 489 ? -6.493  45.592  64.952  1.00 68.91  ? 495  GLU C O     1 
ATOM   9806  C  CB    . GLU G 3 489 ? -3.335  44.379  63.865  1.00 108.32 ? 495  GLU C CB    1 
ATOM   9807  N  N     . TYR G 3 490 ? -4.427  46.250  65.583  1.00 76.06  ? 496  TYR C N     1 
ATOM   9808  C  CA    . TYR G 3 490 ? -4.878  46.874  66.815  1.00 76.06  ? 496  TYR C CA    1 
ATOM   9809  C  C     . TYR G 3 490 ? -5.944  47.914  66.478  1.00 76.06  ? 496  TYR C C     1 
ATOM   9810  O  O     . TYR G 3 490 ? -6.941  48.052  67.192  1.00 76.06  ? 496  TYR C O     1 
ATOM   9811  C  CB    . TYR G 3 490 ? -3.694  47.533  67.536  1.00 77.65  ? 496  TYR C CB    1 
ATOM   9812  N  N     . ALA G 3 491 ? -5.730  48.638  65.383  1.00 70.03  ? 497  ALA C N     1 
ATOM   9813  C  CA    . ALA G 3 491 ? -6.676  49.652  64.943  1.00 70.03  ? 497  ALA C CA    1 
ATOM   9814  C  C     . ALA G 3 491 ? -8.099  49.083  64.977  1.00 70.03  ? 497  ALA C C     1 
ATOM   9815  O  O     . ALA G 3 491 ? -8.973  49.610  65.673  1.00 70.03  ? 497  ALA C O     1 
ATOM   9816  C  CB    . ALA G 3 491 ? -6.317  50.117  63.534  1.00 80.52  ? 497  ALA C CB    1 
ATOM   9817  N  N     . HIS G 3 492 ? -8.320  48.000  64.232  1.00 90.72  ? 498  HIS C N     1 
ATOM   9818  C  CA    . HIS G 3 492 ? -9.630  47.358  64.185  1.00 90.72  ? 498  HIS C CA    1 
ATOM   9819  C  C     . HIS G 3 492 ? -9.960  46.735  65.539  1.00 90.72  ? 498  HIS C C     1 
ATOM   9820  O  O     . HIS G 3 492 ? -11.077 46.886  66.043  1.00 90.72  ? 498  HIS C O     1 
ATOM   9821  C  CB    . HIS G 3 492 ? -9.678  46.282  63.084  1.00 91.11  ? 498  HIS C CB    1 
ATOM   9822  N  N     . GLU G 3 493 ? -8.995  46.040  66.133  1.00 91.50  ? 499  GLU C N     1 
ATOM   9823  C  CA    . GLU G 3 493 ? -9.235  45.429  67.430  1.00 91.50  ? 499  GLU C CA    1 
ATOM   9824  C  C     . GLU G 3 493 ? -9.819  46.479  68.368  1.00 91.50  ? 499  GLU C C     1 
ATOM   9825  O  O     . GLU G 3 493 ? -10.929 46.317  68.868  1.00 91.50  ? 499  GLU C O     1 
ATOM   9826  C  CB    . GLU G 3 493 ? -7.937  44.876  68.022  1.00 56.99  ? 499  GLU C CB    1 
ATOM   9827  N  N     . ILE G 3 494 ? -9.083  47.568  68.581  1.00 79.50  ? 500  ILE C N     1 
ATOM   9828  C  CA    . ILE G 3 494 ? -9.536  48.633  69.475  1.00 79.50  ? 500  ILE C CA    1 
ATOM   9829  C  C     . ILE G 3 494 ? -10.936 49.158  69.166  1.00 79.50  ? 500  ILE C C     1 
ATOM   9830  O  O     . ILE G 3 494 ? -11.593 49.696  70.048  1.00 79.50  ? 500  ILE C O     1 
ATOM   9831  C  CB    . ILE G 3 494 ? -8.544  49.847  69.509  1.00 20.78  ? 500  ILE C CB    1 
ATOM   9832  N  N     . LEU G 3 495 ? -11.414 48.983  67.941  1.00 79.29  ? 501  LEU C N     1 
ATOM   9833  C  CA    . LEU G 3 495 ? -12.736 49.496  67.605  1.00 79.29  ? 501  LEU C CA    1 
ATOM   9834  C  C     . LEU G 3 495 ? -13.832 48.462  67.329  1.00 79.29  ? 501  LEU C C     1 
ATOM   9835  O  O     . LEU G 3 495 ? -14.794 48.362  68.089  1.00 79.29  ? 501  LEU C O     1 
ATOM   9836  C  CB    . LEU G 3 495 ? -12.625 50.462  66.416  1.00 63.78  ? 501  LEU C CB    1 
ATOM   9837  N  N     . ASN G 3 496 ? -13.689 47.698  66.250  1.00 117.54 ? 502  ASN C N     1 
ATOM   9838  C  CA    . ASN G 3 496 ? -14.695 46.706  65.868  1.00 117.54 ? 502  ASN C CA    1 
ATOM   9839  C  C     . ASN G 3 496 ? -14.674 45.384  66.645  1.00 117.54 ? 502  ASN C C     1 
ATOM   9840  O  O     . ASN G 3 496 ? -15.255 44.390  66.199  1.00 117.54 ? 502  ASN C O     1 
ATOM   9841  C  CB    . ASN G 3 496 ? -14.586 46.420  64.368  1.00 58.97  ? 502  ASN C CB    1 
ATOM   9842  N  N     . GLY G 3 497 ? -14.018 45.376  67.803  1.00 88.75  ? 503  GLY C N     1 
ATOM   9843  C  CA    . GLY G 3 497 ? -13.950 44.169  68.619  1.00 88.75  ? 503  GLY C CA    1 
ATOM   9844  C  C     . GLY G 3 497 ? -13.523 44.492  70.043  1.00 88.75  ? 503  GLY C C     1 
ATOM   9845  O  O     . GLY G 3 497 ? -14.216 45.229  70.750  1.00 88.75  ? 503  GLY C O     1 
ATOM   9846  N  N     . ASP G 3 498 ? -12.397 43.930  70.475  1.00 121.49 ? 504  ASP C N     1 
ATOM   9847  C  CA    . ASP G 3 498 ? -11.865 44.213  71.809  1.00 121.49 ? 504  ASP C CA    1 
ATOM   9848  C  C     . ASP G 3 498 ? -10.354 44.363  71.726  1.00 121.49 ? 504  ASP C C     1 
ATOM   9849  O  O     . ASP G 3 498 ? -9.705  43.761  70.862  1.00 121.49 ? 504  ASP C O     1 
ATOM   9850  C  CB    . ASP G 3 498 ? -12.200 43.111  72.818  1.00 146.94 ? 504  ASP C CB    1 
ATOM   9851  C  CG    . ASP G 3 498 ? -11.664 43.426  74.216  1.00 146.94 ? 504  ASP C CG    1 
ATOM   9852  O  OD1   . ASP G 3 498 ? -12.129 44.412  74.832  1.00 146.94 ? 504  ASP C OD1   1 
ATOM   9853  O  OD2   . ASP G 3 498 ? -10.769 42.699  74.696  1.00 146.94 ? 504  ASP C OD2   1 
ATOM   9854  N  N     . ILE G 3 499 ? -9.797  45.165  72.630  1.00 119.69 ? 505  ILE C N     1 
ATOM   9855  C  CA    . ILE G 3 499 ? -8.360  45.405  72.639  1.00 119.69 ? 505  ILE C CA    1 
ATOM   9856  C  C     . ILE G 3 499 ? -7.633  44.787  73.825  1.00 119.69 ? 505  ILE C C     1 
ATOM   9857  O  O     . ILE G 3 499 ? -6.655  44.065  73.651  1.00 119.69 ? 505  ILE C O     1 
ATOM   9858  C  CB    . ILE G 3 499 ? -8.040  46.934  72.605  1.00 70.02  ? 505  ILE C CB    1 
ATOM   9859  C  CG1   . ILE G 3 499 ? -6.526  47.160  72.535  1.00 70.02  ? 505  ILE C CG1   1 
ATOM   9860  C  CG2   . ILE G 3 499 ? -8.595  47.619  73.835  1.00 70.02  ? 505  ILE C CG2   1 
ATOM   9861  C  CD1   . ILE G 3 499 ? -5.880  46.677  71.243  1.00 70.02  ? 505  ILE C CD1   1 
ATOM   9862  N  N     . HIS G 3 500 ? -8.120  45.055  75.029  1.00 86.16  ? 506  HIS C N     1 
ATOM   9863  C  CA    . HIS G 3 500 ? -7.466  44.560  76.234  1.00 86.16  ? 506  HIS C CA    1 
ATOM   9864  C  C     . HIS G 3 500 ? -7.267  43.047  76.320  1.00 86.16  ? 506  HIS C C     1 
ATOM   9865  O  O     . HIS G 3 500 ? -6.172  42.592  76.653  1.00 86.16  ? 506  HIS C O     1 
ATOM   9866  C  CB    . HIS G 3 500 ? -8.197  45.102  77.472  1.00 79.52  ? 506  HIS C CB    1 
ATOM   9867  C  CG    . HIS G 3 500 ? -8.213  46.604  77.548  1.00 79.52  ? 506  HIS C CG    1 
ATOM   9868  N  ND1   . HIS G 3 500 ? -7.061  47.363  77.529  1.00 79.52  ? 506  HIS C ND1   1 
ATOM   9869  C  CD2   . HIS G 3 500 ? -9.241  47.485  77.607  1.00 79.52  ? 506  HIS C CD2   1 
ATOM   9870  C  CE1   . HIS G 3 500 ? -7.380  48.646  77.572  1.00 79.52  ? 506  HIS C CE1   1 
ATOM   9871  N  NE2   . HIS G 3 500 ? -8.696  48.747  77.620  1.00 79.52  ? 506  HIS C NE2   1 
ATOM   9872  N  N     . THR G 3 501 ? -8.296  42.264  76.015  1.00 74.91  ? 507  THR C N     1 
ATOM   9873  C  CA    . THR G 3 501 ? -8.140  40.816  76.065  1.00 74.91  ? 507  THR C CA    1 
ATOM   9874  C  C     . THR G 3 501 ? -6.968  40.396  75.164  1.00 74.91  ? 507  THR C C     1 
ATOM   9875  O  O     . THR G 3 501 ? -6.196  39.504  75.521  1.00 74.91  ? 507  THR C O     1 
ATOM   9876  C  CB    . THR G 3 501 ? -9.427  40.086  75.609  1.00 114.47 ? 507  THR C CB    1 
ATOM   9877  O  OG1   . THR G 3 501 ? -9.724  40.431  74.250  1.00 114.47 ? 507  THR C OG1   1 
ATOM   9878  C  CG2   . THR G 3 501 ? -10.600 40.470  76.502  1.00 114.47 ? 507  THR C CG2   1 
ATOM   9879  N  N     . LYS G 3 502 ? -6.843  41.036  73.999  1.00 75.16  ? 508  LYS C N     1 
ATOM   9880  C  CA    . LYS G 3 502 ? -5.746  40.730  73.083  1.00 75.16  ? 508  LYS C CA    1 
ATOM   9881  C  C     . LYS G 3 502 ? -4.457  40.989  73.846  1.00 75.16  ? 508  LYS C C     1 
ATOM   9882  O  O     . LYS G 3 502 ? -3.490  40.235  73.742  1.00 75.16  ? 508  LYS C O     1 
ATOM   9883  C  CB    . LYS G 3 502 ? -5.780  41.632  71.837  1.00 73.71  ? 508  LYS C CB    1 
ATOM   9884  C  CG    . LYS G 3 502 ? -4.478  41.587  71.004  1.00 73.71  ? 508  LYS C CG    1 
ATOM   9885  C  CD    . LYS G 3 502 ? -4.483  42.499  69.762  1.00 73.71  ? 508  LYS C CD    1 
ATOM   9886  C  CE    . LYS G 3 502 ? -5.315  41.939  68.595  1.00 73.71  ? 508  LYS C CE    1 
ATOM   9887  N  NZ    . LYS G 3 502 ? -4.788  40.667  67.979  1.00 73.71  ? 508  LYS C NZ    1 
ATOM   9888  N  N     . ASN G 3 503 ? -4.449  42.072  74.614  1.00 76.12  ? 509  ASN C N     1 
ATOM   9889  C  CA    . ASN G 3 503 ? -3.286  42.422  75.399  1.00 76.12  ? 509  ASN C CA    1 
ATOM   9890  C  C     . ASN G 3 503 ? -3.129  41.377  76.492  1.00 76.12  ? 509  ASN C C     1 
ATOM   9891  O  O     . ASN G 3 503 ? -2.062  40.772  76.640  1.00 76.12  ? 509  ASN C O     1 
ATOM   9892  C  CB    . ASN G 3 503 ? -3.461  43.812  76.014  1.00 90.96  ? 509  ASN C CB    1 
ATOM   9893  C  CG    . ASN G 3 503 ? -3.426  44.929  74.973  1.00 90.96  ? 509  ASN C CG    1 
ATOM   9894  O  OD1   . ASN G 3 503 ? -2.448  45.086  74.241  1.00 90.96  ? 509  ASN C OD1   1 
ATOM   9895  N  ND2   . ASN G 3 503 ? -4.493  45.718  74.917  1.00 90.96  ? 509  ASN C ND2   1 
ATOM   9896  N  N     . GLN G 3 504 ? -4.206  41.154  77.244  1.00 69.37  ? 510  GLN C N     1 
ATOM   9897  C  CA    . GLN G 3 504 ? -4.186  40.179  78.334  1.00 69.37  ? 510  GLN C CA    1 
ATOM   9898  C  C     . GLN G 3 504 ? -3.611  38.866  77.840  1.00 69.37  ? 510  GLN C C     1 
ATOM   9899  O  O     . GLN G 3 504 ? -2.949  38.155  78.596  1.00 69.37  ? 510  GLN C O     1 
ATOM   9900  C  CB    . GLN G 3 504 ? -5.590  39.925  78.890  1.00 73.25  ? 510  GLN C CB    1 
ATOM   9901  C  CG    . GLN G 3 504 ? -5.580  39.026  80.128  1.00 73.25  ? 510  GLN C CG    1 
ATOM   9902  C  CD    . GLN G 3 504 ? -6.771  38.082  80.199  1.00 73.25  ? 510  GLN C CD    1 
ATOM   9903  O  OE1   . GLN G 3 504 ? -6.778  37.130  80.989  1.00 73.25  ? 510  GLN C OE1   1 
ATOM   9904  N  NE2   . GLN G 3 504 ? -7.782  38.337  79.373  1.00 73.25  ? 510  GLN C NE2   1 
ATOM   9905  N  N     . ILE G 3 505 ? -3.882  38.547  76.574  1.00 65.19  ? 511  ILE C N     1 
ATOM   9906  C  CA    . ILE G 3 505 ? -3.383  37.324  75.950  1.00 65.19  ? 511  ILE C CA    1 
ATOM   9907  C  C     . ILE G 3 505 ? -1.990  37.612  75.447  1.00 65.19  ? 511  ILE C C     1 
ATOM   9908  O  O     . ILE G 3 505 ? -1.090  36.786  75.561  1.00 65.19  ? 511  ILE C O     1 
ATOM   9909  C  CB    . ILE G 3 505 ? -4.227  36.899  74.731  1.00 120.32 ? 511  ILE C CB    1 
ATOM   9910  C  CG1   . ILE G 3 505 ? -5.624  36.459  75.181  1.00 120.32 ? 511  ILE C CG1   1 
ATOM   9911  C  CG2   . ILE G 3 505 ? -3.504  35.791  73.968  1.00 120.32 ? 511  ILE C CG2   1 
ATOM   9912  C  CD1   . ILE G 3 505 ? -6.560  36.067  74.036  1.00 120.32 ? 511  ILE C CD1   1 
ATOM   9913  N  N     . ALA G 3 506 ? -1.829  38.797  74.875  1.00 81.30  ? 512  ALA C N     1 
ATOM   9914  C  CA    . ALA G 3 506 ? -0.545  39.216  74.344  1.00 81.30  ? 512  ALA C CA    1 
ATOM   9915  C  C     . ALA G 3 506 ? 0.511   38.838  75.367  1.00 81.30  ? 512  ALA C C     1 
ATOM   9916  O  O     . ALA G 3 506 ? 1.350   37.960  75.132  1.00 81.30  ? 512  ALA C O     1 
ATOM   9917  C  CB    . ALA G 3 506 ? -0.550  40.721  74.106  1.00 130.78 ? 512  ALA C CB    1 
ATOM   9918  N  N     . ALA G 3 507 ? 0.457   39.506  76.509  1.00 75.83  ? 513  ALA C N     1 
ATOM   9919  C  CA    . ALA G 3 507 ? 1.386   39.221  77.585  1.00 75.83  ? 513  ALA C CA    1 
ATOM   9920  C  C     . ALA G 3 507 ? 0.756   38.090  78.379  1.00 75.83  ? 513  ALA C C     1 
ATOM   9921  O  O     . ALA G 3 507 ? -0.435  38.133  78.658  1.00 75.83  ? 513  ALA C O     1 
ATOM   9922  C  CB    . ALA G 3 507 ? 1.556   40.445  78.465  1.00 109.77 ? 513  ALA C CB    1 
ATOM   9923  N  N     . GLU G 3 508 ? 1.543   37.077  78.723  1.00 157.03 ? 514  GLU C N     1 
ATOM   9924  C  CA    . GLU G 3 508 ? 1.041   35.945  79.495  1.00 157.03 ? 514  GLU C CA    1 
ATOM   9925  C  C     . GLU G 3 508 ? 0.534   36.472  80.846  1.00 157.03 ? 514  GLU C C     1 
ATOM   9926  O  O     . GLU G 3 508 ? 1.268   36.440  81.836  1.00 157.03 ? 514  GLU C O     1 
ATOM   9927  C  CB    . GLU G 3 508 ? 2.182   34.943  79.731  1.00 89.35  ? 514  GLU C CB    1 
ATOM   9928  C  CG    . GLU G 3 508 ? 3.177   34.818  78.569  1.00 89.35  ? 514  GLU C CG    1 
ATOM   9929  C  CD    . GLU G 3 508 ? 2.761   33.801  77.506  1.00 89.35  ? 514  GLU C CD    1 
ATOM   9930  O  OE1   . GLU G 3 508 ? 1.613   33.863  77.021  1.00 89.35  ? 514  GLU C OE1   1 
ATOM   9931  O  OE2   . GLU G 3 508 ? 3.594   32.940  77.145  1.00 89.35  ? 514  GLU C OE2   1 
ATOM   9932  N  N     . LEU G 3 509 ? -0.708  36.958  80.881  1.00 93.54  ? 515  LEU C N     1 
ATOM   9933  C  CA    . LEU G 3 509 ? -1.309  37.506  82.104  1.00 93.54  ? 515  LEU C CA    1 
ATOM   9934  C  C     . LEU G 3 509 ? -2.529  36.733  82.555  1.00 93.54  ? 515  LEU C C     1 
ATOM   9935  O  O     . LEU G 3 509 ? -3.114  35.977  81.783  1.00 93.54  ? 515  LEU C O     1 
ATOM   9936  C  CB    . LEU G 3 509 ? -1.751  38.962  81.908  1.00 109.13 ? 515  LEU C CB    1 
ATOM   9937  C  CG    . LEU G 3 509 ? -0.741  40.103  82.017  1.00 109.13 ? 515  LEU C CG    1 
ATOM   9938  C  CD1   . LEU G 3 509 ? -1.491  41.430  82.000  1.00 109.13 ? 515  LEU C CD1   1 
ATOM   9939  C  CD2   . LEU G 3 509 ? 0.064   39.963  83.302  1.00 109.13 ? 515  LEU C CD2   1 
ATOM   9940  N  N     . PRO G 3 510 ? -2.940  36.935  83.818  1.00 79.61  ? 516  PRO C N     1 
ATOM   9941  C  CA    . PRO G 3 510 ? -4.096  36.288  84.443  1.00 79.61  ? 516  PRO C CA    1 
ATOM   9942  C  C     . PRO G 3 510 ? -5.415  37.016  84.185  1.00 79.61  ? 516  PRO C C     1 
ATOM   9943  O  O     . PRO G 3 510 ? -6.250  36.550  83.408  1.00 79.61  ? 516  PRO C O     1 
ATOM   9944  C  CB    . PRO G 3 510 ? -3.719  36.295  85.917  1.00 92.67  ? 516  PRO C CB    1 
ATOM   9945  C  CG    . PRO G 3 510 ? -3.018  37.609  86.059  1.00 92.67  ? 516  PRO C CG    1 
ATOM   9946  C  CD    . PRO G 3 510 ? -2.130  37.638  84.834  1.00 92.67  ? 516  PRO C CD    1 
ATOM   9947  N  N     . THR G 3 511 ? -5.592  38.161  84.842  1.00 93.71  ? 517  THR C N     1 
ATOM   9948  C  CA    . THR G 3 511 ? -6.808  38.963  84.703  1.00 93.71  ? 517  THR C CA    1 
ATOM   9949  C  C     . THR G 3 511 ? -6.719  40.086  83.662  1.00 93.71  ? 517  THR C C     1 
ATOM   9950  O  O     . THR G 3 511 ? -5.643  40.632  83.393  1.00 93.71  ? 517  THR C O     1 
ATOM   9951  C  CB    . THR G 3 511 ? -7.223  39.597  86.063  1.00 116.95 ? 517  THR C CB    1 
ATOM   9952  O  OG1   . THR G 3 511 ? -8.333  40.482  85.868  1.00 116.95 ? 517  THR C OG1   1 
ATOM   9953  C  CG2   . THR G 3 511 ? -6.075  40.379  86.666  1.00 116.95 ? 517  THR C CG2   1 
ATOM   9954  N  N     . ARG G 3 512 ? -7.873  40.418  83.087  1.00 97.50  ? 518  ARG C N     1 
ATOM   9955  C  CA    . ARG G 3 512 ? -7.988  41.474  82.088  1.00 97.50  ? 518  ARG C CA    1 
ATOM   9956  C  C     . ARG G 3 512 ? -7.591  42.824  82.672  1.00 97.50  ? 518  ARG C C     1 
ATOM   9957  O  O     . ARG G 3 512 ? -6.703  43.500  82.152  1.00 97.50  ? 518  ARG C O     1 
ATOM   9958  C  CB    . ARG G 3 512 ? -9.432  41.551  81.581  1.00 91.69  ? 518  ARG C CB    1 
ATOM   9959  C  CG    . ARG G 3 512 ? -9.729  42.741  80.683  1.00 91.69  ? 518  ARG C CG    1 
ATOM   9960  C  CD    . ARG G 3 512 ? -11.123 42.640  80.103  1.00 91.69  ? 518  ARG C CD    1 
ATOM   9961  N  NE    . ARG G 3 512 ? -11.333 43.560  78.985  1.00 91.69  ? 518  ARG C NE    1 
ATOM   9962  C  CZ    . ARG G 3 512 ? -11.801 44.802  79.096  1.00 91.69  ? 518  ARG C CZ    1 
ATOM   9963  N  NH1   . ARG G 3 512 ? -12.118 45.294  80.287  1.00 91.69  ? 518  ARG C NH1   1 
ATOM   9964  N  NH2   . ARG G 3 512 ? -11.963 45.550  78.009  1.00 91.69  ? 518  ARG C NH2   1 
ATOM   9965  N  N     . ASP G 3 513 ? -8.257  43.217  83.753  1.00 72.87  ? 519  ASP C N     1 
ATOM   9966  C  CA    . ASP G 3 513 ? -7.967  44.496  84.384  1.00 72.87  ? 519  ASP C CA    1 
ATOM   9967  C  C     . ASP G 3 513 ? -6.481  44.657  84.700  1.00 72.87  ? 519  ASP C C     1 
ATOM   9968  O  O     . ASP G 3 513 ? -5.988  45.781  84.853  1.00 72.87  ? 519  ASP C O     1 
ATOM   9969  C  CB    . ASP G 3 513 ? -8.831  44.692  85.635  1.00 111.83 ? 519  ASP C CB    1 
ATOM   9970  C  CG    . ASP G 3 513 ? -9.851  45.822  85.465  1.00 111.83 ? 519  ASP C CG    1 
ATOM   9971  O  OD1   . ASP G 3 513 ? -9.451  47.007  85.493  1.00 111.83 ? 519  ASP C OD1   1 
ATOM   9972  O  OD2   . ASP G 3 513 ? -11.054 45.533  85.288  1.00 111.83 ? 519  ASP C OD2   1 
ATOM   9973  N  N     . ASN G 3 514 ? -5.766  43.536  84.782  1.00 85.86  ? 520  ASN C N     1 
ATOM   9974  C  CA    . ASN G 3 514 ? -4.329  43.579  85.035  1.00 85.86  ? 520  ASN C CA    1 
ATOM   9975  C  C     . ASN G 3 514 ? -3.698  44.102  83.748  1.00 85.86  ? 520  ASN C C     1 
ATOM   9976  O  O     . ASN G 3 514 ? -2.832  44.976  83.764  1.00 85.86  ? 520  ASN C O     1 
ATOM   9977  C  CB    . ASN G 3 514 ? -3.796  42.175  85.347  1.00 128.90 ? 520  ASN C CB    1 
ATOM   9978  C  CG    . ASN G 3 514 ? -3.293  42.038  86.781  1.00 128.90 ? 520  ASN C CG    1 
ATOM   9979  O  OD1   . ASN G 3 514 ? -4.015  42.325  87.740  1.00 128.90 ? 520  ASN C OD1   1 
ATOM   9980  N  ND2   . ASN G 3 514 ? -2.049  41.589  86.930  1.00 128.90 ? 520  ASN C ND2   1 
ATOM   9981  N  N     . ALA G 3 515 ? -4.160  43.558  82.631  1.00 82.99  ? 521  ALA C N     1 
ATOM   9982  C  C     . ALA G 3 515 ? -3.961  45.427  81.066  1.00 82.99  ? 521  ALA C C     1 
ATOM   9983  O  O     . ALA G 3 515 ? -3.169  46.116  80.423  1.00 82.99  ? 521  ALA C O     1 
ATOM   9984  C  CB    . ALA G 3 515 ? -4.314  43.092  80.255  1.00 78.67  ? 521  ALA C CB    1 
ATOM   9985  N  N     . LYS G 3 516 ? -5.100  45.903  81.569  1.00 88.68  ? 522  LYS C N     1 
ATOM   9986  C  CA    . LYS G 3 516 ? -5.497  47.300  81.394  1.00 88.68  ? 522  LYS C CA    1 
ATOM   9987  C  C     . LYS G 3 516 ? -4.489  48.234  82.084  1.00 88.68  ? 522  LYS C C     1 
ATOM   9988  O  O     . LYS G 3 516 ? -4.335  49.403  81.719  1.00 88.68  ? 522  LYS C O     1 
ATOM   9989  C  CB    . LYS G 3 516 ? -6.915  47.511  81.949  1.00 41.37  ? 522  LYS C CB    1 
ATOM   9990  N  N     . THR G 3 517 ? -3.799  47.698  83.082  1.00 103.02 ? 523  THR C N     1 
ATOM   9991  C  CA    . THR G 3 517 ? -2.794  48.452  83.816  1.00 103.02 ? 523  THR C CA    1 
ATOM   9992  C  C     . THR G 3 517 ? -1.465  48.265  83.093  1.00 103.02 ? 523  THR C C     1 
ATOM   9993  O  O     . THR G 3 517 ? -0.791  49.233  82.748  1.00 103.02 ? 523  THR C O     1 
ATOM   9994  C  CB    . THR G 3 517 ? -2.665  47.935  85.277  1.00 91.10  ? 523  THR C CB    1 
ATOM   9995  O  OG1   . THR G 3 517 ? -3.921  48.076  85.954  1.00 91.10  ? 523  THR C OG1   1 
ATOM   9996  C  CG2   . THR G 3 517 ? -1.615  48.718  86.036  1.00 91.10  ? 523  THR C CG2   1 
ATOM   9997  N  N     . PHE G 3 518 ? -1.108  47.008  82.848  1.00 89.62  ? 524  PHE C N     1 
ATOM   9998  C  CA    . PHE G 3 518 ? 0.138   46.687  82.178  1.00 89.62  ? 524  PHE C CA    1 
ATOM   9999  C  C     . PHE G 3 518 ? 0.383   47.533  80.942  1.00 89.62  ? 524  PHE C C     1 
ATOM   10000 O  O     . PHE G 3 518 ? 1.493   48.023  80.736  1.00 89.62  ? 524  PHE C O     1 
ATOM   10001 C  CB    . PHE G 3 518 ? 0.175   45.210  81.805  1.00 71.32  ? 524  PHE C CB    1 
ATOM   10002 C  CG    . PHE G 3 518 ? 1.393   44.822  81.019  1.00 71.32  ? 524  PHE C CG    1 
ATOM   10003 C  CD1   . PHE G 3 518 ? 2.564   45.582  81.098  1.00 71.32  ? 524  PHE C CD1   1 
ATOM   10004 C  CD2   . PHE G 3 518 ? 1.377   43.701  80.201  1.00 71.32  ? 524  PHE C CD2   1 
ATOM   10005 C  CE1   . PHE G 3 518 ? 3.697   45.237  80.372  1.00 71.32  ? 524  PHE C CE1   1 
ATOM   10006 C  CE2   . PHE G 3 518 ? 2.504   43.345  79.472  1.00 71.32  ? 524  PHE C CE2   1 
ATOM   10007 C  CZ    . PHE G 3 518 ? 3.669   44.117  79.557  1.00 71.32  ? 524  PHE C CZ    1 
ATOM   10008 N  N     . ILE G 3 519 ? -0.651  47.703  80.124  1.00 109.55 ? 525  ILE C N     1 
ATOM   10009 C  CA    . ILE G 3 519 ? -0.534  48.490  78.905  1.00 109.55 ? 525  ILE C CA    1 
ATOM   10010 C  C     . ILE G 3 519 ? -0.443  49.985  79.163  1.00 109.55 ? 525  ILE C C     1 
ATOM   10011 O  O     . ILE G 3 519 ? 0.603   50.601  78.940  1.00 109.55 ? 525  ILE C O     1 
ATOM   10012 C  CB    . ILE G 3 519 ? -1.724  48.248  77.961  1.00 85.37  ? 525  ILE C CB    1 
ATOM   10013 C  CG1   . ILE G 3 519 ? -1.614  49.184  76.765  1.00 85.37  ? 525  ILE C CG1   1 
ATOM   10014 C  CG2   . ILE G 3 519 ? -3.039  48.490  78.680  1.00 85.37  ? 525  ILE C CG2   1 
ATOM   10015 C  CD1   . ILE G 3 519 ? -0.304  49.051  76.027  1.00 85.37  ? 525  ILE C CD1   1 
ATOM   10016 N  N     . TYR G 3 520 ? -1.546  50.563  79.633  1.00 90.03  ? 526  TYR C N     1 
ATOM   10017 C  CA    . TYR G 3 520 ? -1.620  51.998  79.906  1.00 90.03  ? 526  TYR C CA    1 
ATOM   10018 C  C     . TYR G 3 520 ? -0.468  52.485  80.789  1.00 90.03  ? 526  TYR C C     1 
ATOM   10019 O  O     . TYR G 3 520 ? -0.387  53.666  81.132  1.00 90.03  ? 526  TYR C O     1 
ATOM   10020 C  CB    . TYR G 3 520 ? -2.973  52.347  80.550  1.00 97.98  ? 526  TYR C CB    1 
ATOM   10021 N  N     . GLY G 3 521 ? 0.419   51.566  81.147  1.00 81.10  ? 527  GLY C N     1 
ATOM   10022 C  CA    . GLY G 3 521 ? 1.554   51.918  81.965  1.00 81.10  ? 527  GLY C CA    1 
ATOM   10023 C  C     . GLY G 3 521 ? 2.814   51.366  81.339  1.00 81.10  ? 527  GLY C C     1 
ATOM   10024 O  O     . GLY G 3 521 ? 3.456   50.483  81.908  1.00 81.10  ? 527  GLY C O     1 
ATOM   10025 N  N     . PHE G 3 522 ? 3.166   51.873  80.158  1.00 91.56  ? 528  PHE C N     1 
ATOM   10026 C  CA    . PHE G 3 522 ? 4.367   51.416  79.459  1.00 91.56  ? 528  PHE C CA    1 
ATOM   10027 C  C     . PHE G 3 522 ? 4.530   52.108  78.099  1.00 91.56  ? 528  PHE C C     1 
ATOM   10028 O  O     . PHE G 3 522 ? 5.515   52.861  77.917  1.00 91.56  ? 528  PHE C O     1 
ATOM   10029 C  CB    . PHE G 3 522 ? 4.318   49.883  79.283  1.00 128.64 ? 528  PHE C CB    1 
ATOM   10030 C  CG    . PHE G 3 522 ? 4.157   49.426  77.855  1.00 128.64 ? 528  PHE C CG    1 
ATOM   10031 C  CD1   . PHE G 3 522 ? 5.039   48.495  77.316  1.00 128.64 ? 528  PHE C CD1   1 
ATOM   10032 C  CD2   . PHE G 3 522 ? 3.139   49.930  77.045  1.00 128.64 ? 528  PHE C CD2   1 
ATOM   10033 C  CE1   . PHE G 3 522 ? 4.915   48.075  75.995  1.00 128.64 ? 528  PHE C CE1   1 
ATOM   10034 C  CE2   . PHE G 3 522 ? 3.009   49.517  75.724  1.00 128.64 ? 528  PHE C CE2   1 
ATOM   10035 C  CZ    . PHE G 3 522 ? 3.900   48.588  75.197  1.00 128.64 ? 528  PHE C CZ    1 
ATOM   10036 N  N     . LYS G 3 530 ? 8.396   48.341  88.416  1.00 129.93 ? 536  LYS C N     1 
ATOM   10037 C  CA    . LYS G 3 530 ? 6.991   48.549  88.885  1.00 129.93 ? 536  LYS C CA    1 
ATOM   10038 C  C     . LYS G 3 530 ? 6.020   47.676  88.094  1.00 129.93 ? 536  LYS C C     1 
ATOM   10039 O  O     . LYS G 3 530 ? 4.818   47.659  88.368  1.00 129.93 ? 536  LYS C O     1 
ATOM   10040 C  CB    . LYS G 3 530 ? 6.588   50.028  88.744  1.00 76.59  ? 536  LYS C CB    1 
ATOM   10041 N  N     . ILE G 3 531 ? 6.548   46.950  87.114  1.00 131.81 ? 537  ILE C N     1 
ATOM   10042 C  CA    . ILE G 3 531 ? 5.727   46.078  86.284  1.00 131.81 ? 537  ILE C CA    1 
ATOM   10043 C  C     . ILE G 3 531 ? 5.504   44.746  86.990  1.00 131.81 ? 537  ILE C C     1 
ATOM   10044 O  O     . ILE G 3 531 ? 4.367   44.386  87.309  1.00 131.81 ? 537  ILE C O     1 
ATOM   10045 C  CB    . ILE G 3 531 ? 6.396   45.823  84.914  1.00 78.88  ? 537  ILE C CB    1 
ATOM   10046 N  N     . GLY G 3 532 ? 6.597   44.022  87.230  1.00 127.45 ? 538  GLY C N     1 
ATOM   10047 C  CA    . GLY G 3 532 ? 6.504   42.743  87.908  1.00 127.45 ? 538  GLY C CA    1 
ATOM   10048 C  C     . GLY G 3 532 ? 5.610   42.887  89.118  1.00 127.45 ? 538  GLY C C     1 
ATOM   10049 O  O     . GLY G 3 532 ? 4.674   42.111  89.305  1.00 127.45 ? 538  GLY C O     1 
ATOM   10050 N  N     . GLN G 3 533 ? 5.894   43.896  89.935  1.00 126.41 ? 539  GLN C N     1 
ATOM   10051 C  CA    . GLN G 3 533 ? 5.100   44.152  91.128  1.00 126.41 ? 539  GLN C CA    1 
ATOM   10052 C  C     . GLN G 3 533 ? 3.621   44.158  90.768  1.00 126.41 ? 539  GLN C C     1 
ATOM   10053 O  O     . GLN G 3 533 ? 2.826   43.440  91.370  1.00 126.41 ? 539  GLN C O     1 
ATOM   10054 C  CB    . GLN G 3 533 ? 5.475   45.503  91.739  1.00 116.07 ? 539  GLN C CB    1 
ATOM   10055 N  N     . ILE G 3 534 ? 3.265   44.966  89.773  1.00 166.67 ? 540  ILE C N     1 
ATOM   10056 C  CA    . ILE G 3 534 ? 1.883   45.093  89.312  1.00 166.67 ? 540  ILE C CA    1 
ATOM   10057 C  C     . ILE G 3 534 ? 1.196   43.755  89.044  1.00 166.67 ? 540  ILE C C     1 
ATOM   10058 O  O     . ILE G 3 534 ? -0.032  43.684  88.968  1.00 166.67 ? 540  ILE C O     1 
ATOM   10059 C  CB    . ILE G 3 534 ? 1.804   45.933  88.016  1.00 125.90 ? 540  ILE C CB    1 
ATOM   10060 N  N     . VAL G 3 535 ? 1.990   42.700  88.902  1.00 122.19 ? 541  VAL C N     1 
ATOM   10061 C  CA    . VAL G 3 535 ? 1.455   41.368  88.635  1.00 122.19 ? 541  VAL C CA    1 
ATOM   10062 C  C     . VAL G 3 535 ? 1.570   40.446  89.846  1.00 122.19 ? 541  VAL C C     1 
ATOM   10063 O  O     . VAL G 3 535 ? 0.799   39.495  89.994  1.00 122.19 ? 541  VAL C O     1 
ATOM   10064 C  CB    . VAL G 3 535 ? 2.198   40.713  87.465  1.00 112.22 ? 541  VAL C CB    1 
ATOM   10065 N  N     . GLY G 3 536 ? 2.544   40.735  90.702  1.00 107.74 ? 542  GLY C N     1 
ATOM   10066 C  CA    . GLY G 3 536 ? 2.767   39.933  91.891  1.00 107.74 ? 542  GLY C CA    1 
ATOM   10067 C  C     . GLY G 3 536 ? 4.219   39.998  92.323  1.00 107.74 ? 542  GLY C C     1 
ATOM   10068 O  O     . GLY G 3 536 ? 4.524   40.521  93.395  1.00 107.74 ? 542  GLY C O     1 
ATOM   10069 N  N     . ALA G 3 537 ? 5.114   39.482  91.478  1.00 121.65 ? 543  ALA C N     1 
ATOM   10070 C  CA    . ALA G 3 537 ? 6.555   39.464  91.760  1.00 121.65 ? 543  ALA C CA    1 
ATOM   10071 C  C     . ALA G 3 537 ? 7.161   40.860  91.914  1.00 121.65 ? 543  ALA C C     1 
ATOM   10072 O  O     . ALA G 3 537 ? 6.560   41.746  92.522  1.00 121.65 ? 543  ALA C O     1 
ATOM   10073 C  CB    . ALA G 3 537 ? 7.305   38.681  90.664  1.00 65.12  ? 543  ALA C CB    1 
ATOM   10074 N  N     . GLY G 3 538 ? 8.357   41.052  91.366  1.00 120.29 ? 544  GLY C N     1 
ATOM   10075 C  CA    . GLY G 3 538 ? 9.003   42.348  91.478  1.00 120.29 ? 544  GLY C CA    1 
ATOM   10076 C  C     . GLY G 3 538 ? 10.131  42.638  90.498  1.00 120.29 ? 544  GLY C C     1 
ATOM   10077 O  O     . GLY G 3 538 ? 10.644  43.764  90.464  1.00 120.29 ? 544  GLY C O     1 
ATOM   10078 N  N     . LYS G 3 539 ? 10.528  41.643  89.705  1.00 96.84  ? 545  LYS C N     1 
ATOM   10079 C  CA    . LYS G 3 539 ? 11.600  41.840  88.739  1.00 96.84  ? 545  LYS C CA    1 
ATOM   10080 C  C     . LYS G 3 539 ? 11.526  40.877  87.559  1.00 96.84  ? 545  LYS C C     1 
ATOM   10081 O  O     . LYS G 3 539 ? 11.084  41.264  86.479  1.00 96.84  ? 545  LYS C O     1 
ATOM   10082 C  CB    . LYS G 3 539 ? 12.958  41.712  89.428  1.00 56.87  ? 545  LYS C CB    1 
ATOM   10083 N  N     . GLU G 3 540 ? 11.956  39.630  87.764  1.00 134.81 ? 546  GLU C N     1 
ATOM   10084 C  CA    . GLU G 3 540 ? 11.950  38.612  86.704  1.00 134.81 ? 546  GLU C CA    1 
ATOM   10085 C  C     . GLU G 3 540 ? 10.648  38.542  85.909  1.00 134.81 ? 546  GLU C C     1 
ATOM   10086 O  O     . GLU G 3 540 ? 10.653  38.754  84.697  1.00 134.81 ? 546  GLU C O     1 
ATOM   10087 C  CB    . GLU G 3 540 ? 12.267  37.218  87.282  1.00 119.11 ? 546  GLU C CB    1 
ATOM   10088 C  CG    . GLU G 3 540 ? 11.327  36.072  86.819  1.00 119.11 ? 546  GLU C CG    1 
ATOM   10089 C  CD    . GLU G 3 540 ? 11.546  35.605  85.372  1.00 119.11 ? 546  GLU C CD    1 
ATOM   10090 O  OE1   . GLU G 3 540 ? 11.725  36.461  84.475  1.00 119.11 ? 546  GLU C OE1   1 
ATOM   10091 O  OE2   . GLU G 3 540 ? 11.520  34.373  85.130  1.00 119.11 ? 546  GLU C OE2   1 
ATOM   10092 N  N     . ARG G 3 541 ? 9.544   38.233  86.586  1.00 130.24 ? 547  ARG C N     1 
ATOM   10093 C  CA    . ARG G 3 541 ? 8.245   38.131  85.927  1.00 130.24 ? 547  ARG C CA    1 
ATOM   10094 C  C     . ARG G 3 541 ? 7.915   39.417  85.169  1.00 130.24 ? 547  ARG C C     1 
ATOM   10095 O  O     . ARG G 3 541 ? 7.330   39.379  84.079  1.00 130.24 ? 547  ARG C O     1 
ATOM   10096 C  CB    . ARG G 3 541 ? 7.156   37.844  86.962  1.00 98.39  ? 547  ARG C CB    1 
ATOM   10097 N  N     . GLY G 3 542 ? 8.283   40.555  85.753  1.00 126.80 ? 548  GLY C N     1 
ATOM   10098 C  CA    . GLY G 3 542 ? 8.037   41.826  85.097  1.00 126.80 ? 548  GLY C CA    1 
ATOM   10099 C  C     . GLY G 3 542 ? 8.875   41.894  83.833  1.00 126.80 ? 548  GLY C C     1 
ATOM   10100 O  O     . GLY G 3 542 ? 8.349   42.099  82.737  1.00 126.80 ? 548  GLY C O     1 
ATOM   10101 N  N     . LYS G 3 543 ? 10.184  41.702  83.996  1.00 93.57  ? 549  LYS C N     1 
ATOM   10102 C  CA    . LYS G 3 543 ? 11.149  41.720  82.895  1.00 93.57  ? 549  LYS C CA    1 
ATOM   10103 C  C     . LYS G 3 543 ? 11.120  40.405  82.121  1.00 93.57  ? 549  LYS C C     1 
ATOM   10104 O  O     . LYS G 3 543 ? 12.153  39.907  81.675  1.00 93.57  ? 549  LYS C O     1 
ATOM   10105 C  CB    . LYS G 3 543 ? 12.560  41.956  83.440  1.00 87.94  ? 549  LYS C CB    1 
ATOM   10106 N  N     . GLU G 3 544 ? 9.921   39.848  81.988  1.00 167.78 ? 550  GLU C N     1 
ATOM   10107 C  CA    . GLU G 3 544 ? 9.688   38.601  81.264  1.00 167.78 ? 550  GLU C CA    1 
ATOM   10108 C  C     . GLU G 3 544 ? 8.382   38.802  80.514  1.00 167.78 ? 550  GLU C C     1 
ATOM   10109 O  O     . GLU G 3 544 ? 8.179   38.262  79.426  1.00 167.78 ? 550  GLU C O     1 
ATOM   10110 C  CB    . GLU G 3 544 ? 9.541   37.423  82.231  1.00 103.83 ? 550  GLU C CB    1 
ATOM   10111 N  N     . LEU G 3 545 ? 7.500   39.588  81.121  1.00 142.62 ? 551  LEU C N     1 
ATOM   10112 C  CA    . LEU G 3 545 ? 6.207   39.905  80.537  1.00 142.62 ? 551  LEU C CA    1 
ATOM   10113 C  C     . LEU G 3 545 ? 6.439   40.794  79.316  1.00 142.62 ? 551  LEU C C     1 
ATOM   10114 O  O     . LEU G 3 545 ? 5.921   40.527  78.228  1.00 142.62 ? 551  LEU C O     1 
ATOM   10115 C  CB    . LEU G 3 545 ? 5.332   40.634  81.567  1.00 107.88 ? 551  LEU C CB    1 
ATOM   10116 N  N     . LYS G 3 546 ? 7.223   41.853  79.506  1.00 162.71 ? 552  LYS C N     1 
ATOM   10117 C  CA    . LYS G 3 546 ? 7.536   42.767  78.415  1.00 162.71 ? 552  LYS C CA    1 
ATOM   10118 C  C     . LYS G 3 546 ? 8.003   41.917  77.247  1.00 162.71 ? 552  LYS C C     1 
ATOM   10119 O  O     . LYS G 3 546 ? 7.776   42.252  76.086  1.00 162.71 ? 552  LYS C O     1 
ATOM   10120 C  CB    . LYS G 3 546 ? 8.655   43.736  78.818  1.00 44.20  ? 552  LYS C CB    1 
ATOM   10121 N  N     . LYS G 3 547 ? 8.652   40.806  77.573  1.00 87.99  ? 553  LYS C N     1 
ATOM   10122 C  CA    . LYS G 3 547 ? 9.160   39.884  76.567  1.00 87.99  ? 553  LYS C CA    1 
ATOM   10123 C  C     . LYS G 3 547 ? 8.010   39.224  75.813  1.00 87.99  ? 553  LYS C C     1 
ATOM   10124 O  O     . LYS G 3 547 ? 7.847   39.426  74.611  1.00 87.99  ? 553  LYS C O     1 
ATOM   10125 C  CB    . LYS G 3 547 ? 10.030  38.810  77.231  1.00 95.93  ? 553  LYS C CB    1 
ATOM   10126 N  N     . LYS G 3 548 ? 7.212   38.444  76.536  1.00 152.18 ? 554  LYS C N     1 
ATOM   10127 C  CA    . LYS G 3 548 ? 6.072   37.739  75.956  1.00 152.18 ? 554  LYS C CA    1 
ATOM   10128 C  C     . LYS G 3 548 ? 5.086   38.694  75.293  1.00 152.18 ? 554  LYS C C     1 
ATOM   10129 O  O     . LYS G 3 548 ? 4.418   38.331  74.322  1.00 152.18 ? 554  LYS C O     1 
ATOM   10130 C  CB    . LYS G 3 548 ? 5.353   36.930  77.041  1.00 124.16 ? 554  LYS C CB    1 
ATOM   10131 N  N     . PHE G 3 549 ? 4.990   39.910  75.826  1.00 108.77 ? 555  PHE C N     1 
ATOM   10132 C  CA    . PHE G 3 549 ? 4.085   40.904  75.266  1.00 108.77 ? 555  PHE C CA    1 
ATOM   10133 C  C     . PHE G 3 549 ? 4.668   41.519  74.008  1.00 108.77 ? 555  PHE C C     1 
ATOM   10134 O  O     . PHE G 3 549 ? 3.987   41.633  72.992  1.00 108.77 ? 555  PHE C O     1 
ATOM   10135 C  CB    . PHE G 3 549 ? 3.803   42.025  76.253  1.00 84.40  ? 555  PHE C CB    1 
ATOM   10136 C  CG    . PHE G 3 549 ? 2.854   43.054  75.717  1.00 84.40  ? 555  PHE C CG    1 
ATOM   10137 C  CD1   . PHE G 3 549 ? 1.557   42.694  75.353  1.00 84.40  ? 555  PHE C CD1   1 
ATOM   10138 C  CD2   . PHE G 3 549 ? 3.253   44.375  75.552  1.00 84.40  ? 555  PHE C CD2   1 
ATOM   10139 C  CE1   . PHE G 3 549 ? 0.666   43.637  74.829  1.00 84.40  ? 555  PHE C CE1   1 
ATOM   10140 C  CE2   . PHE G 3 549 ? 2.369   45.327  75.030  1.00 84.40  ? 555  PHE C CE2   1 
ATOM   10141 C  CZ    . PHE G 3 549 ? 1.073   44.953  74.668  1.00 84.40  ? 555  PHE C CZ    1 
ATOM   10142 N  N     . LEU G 3 550 ? 5.925   41.937  74.091  1.00 113.20 ? 556  LEU C N     1 
ATOM   10143 C  CA    . LEU G 3 550 ? 6.606   42.524  72.947  1.00 113.20 ? 556  LEU C CA    1 
ATOM   10144 C  C     . LEU G 3 550 ? 7.181   41.362  72.100  1.00 113.20 ? 556  LEU C C     1 
ATOM   10145 O  O     . LEU G 3 550 ? 8.208   41.497  71.424  1.00 113.20 ? 556  LEU C O     1 
ATOM   10146 C  CB    . LEU G 3 550 ? 7.707   43.507  73.435  1.00 25.40  ? 556  LEU C CB    1 
ATOM   10147 N  N     . GLU G 3 551 ? 6.485   40.222  72.150  1.00 103.83 ? 557  GLU C N     1 
ATOM   10148 C  CA    . GLU G 3 551 ? 6.857   39.008  71.416  1.00 103.83 ? 557  GLU C CA    1 
ATOM   10149 C  C     . GLU G 3 551 ? 5.657   38.495  70.631  1.00 103.83 ? 557  GLU C C     1 
ATOM   10150 O  O     . GLU G 3 551 ? 5.782   38.089  69.478  1.00 103.83 ? 557  GLU C O     1 
ATOM   10151 C  CB    . GLU G 3 551 ? 7.308   37.913  72.384  1.00 88.31  ? 557  GLU C CB    1 
ATOM   10152 N  N     . ASN G 3 552 ? 4.498   38.503  71.280  1.00 91.17  ? 558  ASN C N     1 
ATOM   10153 C  CA    . ASN G 3 552 ? 3.254   38.058  70.662  1.00 91.17  ? 558  ASN C CA    1 
ATOM   10154 C  C     . ASN G 3 552 ? 2.553   39.263  70.018  1.00 91.17  ? 558  ASN C C     1 
ATOM   10155 O  O     . ASN G 3 552 ? 1.443   39.153  69.481  1.00 91.17  ? 558  ASN C O     1 
ATOM   10156 C  CB    . ASN G 3 552 ? 2.351   37.422  71.722  1.00 85.87  ? 558  ASN C CB    1 
ATOM   10157 N  N     . THR G 3 553 ? 3.219   40.414  70.096  1.00 76.25  ? 559  THR C N     1 
ATOM   10158 C  CA    . THR G 3 553 ? 2.735   41.671  69.529  1.00 76.25  ? 559  THR C CA    1 
ATOM   10159 C  C     . THR G 3 553 ? 3.976   42.328  68.928  1.00 76.25  ? 559  THR C C     1 
ATOM   10160 O  O     . THR G 3 553 ? 4.522   43.284  69.491  1.00 76.25  ? 559  THR C O     1 
ATOM   10161 C  CB    . THR G 3 553 ? 2.142   42.606  70.622  1.00 55.78  ? 559  THR C CB    1 
ATOM   10162 N  N     . PRO G 3 554 ? 4.436   41.815  67.772  1.00 81.40  ? 560  PRO C N     1 
ATOM   10163 C  CA    . PRO G 3 554 ? 5.617   42.310  67.057  1.00 81.40  ? 560  PRO C CA    1 
ATOM   10164 C  C     . PRO G 3 554 ? 5.451   43.723  66.498  1.00 81.40  ? 560  PRO C C     1 
ATOM   10165 O  O     . PRO G 3 554 ? 6.433   44.389  66.193  1.00 81.40  ? 560  PRO C O     1 
ATOM   10166 C  CB    . PRO G 3 554 ? 5.805   41.262  65.966  1.00 91.24  ? 560  PRO C CB    1 
ATOM   10167 C  CG    . PRO G 3 554 ? 4.381   40.913  65.620  1.00 91.24  ? 560  PRO C CG    1 
ATOM   10168 C  CD    . PRO G 3 554 ? 3.728   40.793  66.975  1.00 91.24  ? 560  PRO C CD    1 
ATOM   10169 N  N     . ALA G 3 555 ? 4.206   44.170  66.362  1.00 65.74  ? 561  ALA C N     1 
ATOM   10170 C  CA    . ALA G 3 555 ? 3.918   45.509  65.853  1.00 65.74  ? 561  ALA C CA    1 
ATOM   10171 C  C     . ALA G 3 555 ? 4.490   46.610  66.763  1.00 65.74  ? 561  ALA C C     1 
ATOM   10172 O  O     . ALA G 3 555 ? 5.117   47.546  66.271  1.00 65.74  ? 561  ALA C O     1 
ATOM   10173 C  CB    . ALA G 3 555 ? 2.414   45.690  65.691  1.00 99.76  ? 561  ALA C CB    1 
ATOM   10174 N  N     . ILE G 3 556 ? 4.263   46.502  68.077  1.00 59.76  ? 562  ILE C N     1 
ATOM   10175 C  CA    . ILE G 3 556 ? 4.782   47.485  69.039  1.00 59.76  ? 562  ILE C CA    1 
ATOM   10176 C  C     . ILE G 3 556 ? 6.294   47.359  69.022  1.00 59.76  ? 562  ILE C C     1 
ATOM   10177 O  O     . ILE G 3 556 ? 7.035   48.313  69.287  1.00 59.76  ? 562  ILE C O     1 
ATOM   10178 C  CB    . ILE G 3 556 ? 4.325   47.209  70.505  1.00 52.77  ? 562  ILE C CB    1 
ATOM   10179 C  CG1   . ILE G 3 556 ? 2.804   47.248  70.623  1.00 52.77  ? 562  ILE C CG1   1 
ATOM   10180 C  CG2   . ILE G 3 556 ? 4.915   48.234  71.437  1.00 52.77  ? 562  ILE C CG2   1 
ATOM   10181 C  CD1   . ILE G 3 556 ? 2.129   45.944  70.171  1.00 52.77  ? 562  ILE C CD1   1 
ATOM   10182 N  N     . ALA G 3 557 ? 6.741   46.147  68.725  1.00 73.27  ? 563  ALA C N     1 
ATOM   10183 C  CA    . ALA G 3 557 ? 8.159   45.860  68.658  1.00 73.27  ? 563  ALA C CA    1 
ATOM   10184 C  C     . ALA G 3 557 ? 8.690   46.482  67.381  1.00 73.27  ? 563  ALA C C     1 
ATOM   10185 O  O     . ALA G 3 557 ? 9.810   46.976  67.344  1.00 73.27  ? 563  ALA C O     1 
ATOM   10186 C  CB    . ALA G 3 557 ? 8.385   44.356  68.647  1.00 131.56 ? 563  ALA C CB    1 
ATOM   10187 N  N     . ALA G 3 558 ? 7.865   46.454  66.339  1.00 88.03  ? 564  ALA C N     1 
ATOM   10188 C  CA    . ALA G 3 558 ? 8.228   47.007  65.046  1.00 88.03  ? 564  ALA C CA    1 
ATOM   10189 C  C     . ALA G 3 558 ? 8.387   48.508  65.182  1.00 88.03  ? 564  ALA C C     1 
ATOM   10190 O  O     . ALA G 3 558 ? 9.415   49.070  64.809  1.00 88.03  ? 564  ALA C O     1 
ATOM   10191 C  CB    . ALA G 3 558 ? 7.162   46.688  64.040  1.00 69.50  ? 564  ALA C CB    1 
ATOM   10192 N  N     . LEU G 3 559 ? 7.353   49.151  65.718  1.00 61.36  ? 565  LEU C N     1 
ATOM   10193 C  CA    . LEU G 3 559 ? 7.350   50.594  65.939  1.00 61.36  ? 565  LEU C CA    1 
ATOM   10194 C  C     . LEU G 3 559 ? 8.647   50.972  66.642  1.00 61.36  ? 565  LEU C C     1 
ATOM   10195 O  O     . LEU G 3 559 ? 9.494   51.652  66.077  1.00 61.36  ? 565  LEU C O     1 
ATOM   10196 C  CB    . LEU G 3 559 ? 6.158   50.965  66.823  1.00 100.46 ? 565  LEU C CB    1 
ATOM   10197 C  CG    . LEU G 3 559 ? 5.736   52.421  66.992  1.00 100.46 ? 565  LEU C CG    1 
ATOM   10198 C  CD1   . LEU G 3 559 ? 4.943   52.880  65.776  1.00 100.46 ? 565  LEU C CD1   1 
ATOM   10199 C  CD2   . LEU G 3 559 ? 4.865   52.530  68.221  1.00 100.46 ? 565  LEU C CD2   1 
ATOM   10200 N  N     . ARG G 3 560 ? 8.790   50.493  67.874  1.00 70.38  ? 566  ARG C N     1 
ATOM   10201 C  CA    . ARG G 3 560 ? 9.963   50.754  68.708  1.00 70.38  ? 566  ARG C CA    1 
ATOM   10202 C  C     . ARG G 3 560 ? 11.309  50.701  67.948  1.00 70.38  ? 566  ARG C C     1 
ATOM   10203 O  O     . ARG G 3 560 ? 12.178  51.567  68.122  1.00 70.38  ? 566  ARG C O     1 
ATOM   10204 C  CB    . ARG G 3 560 ? 9.966   49.770  69.893  1.00 17.55  ? 566  ARG C CB    1 
ATOM   10205 N  N     . GLU G 3 561 ? 11.470  49.681  67.109  1.00 115.32 ? 567  GLU C N     1 
ATOM   10206 C  CA    . GLU G 3 561 ? 12.691  49.517  66.334  1.00 115.32 ? 567  GLU C CA    1 
ATOM   10207 C  C     . GLU G 3 561 ? 12.827  50.595  65.273  1.00 115.32 ? 567  GLU C C     1 
ATOM   10208 O  O     . GLU G 3 561 ? 13.890  51.193  65.130  1.00 115.32 ? 567  GLU C O     1 
ATOM   10209 C  CB    . GLU G 3 561 ? 12.732  48.143  65.652  1.00 111.68 ? 567  GLU C CB    1 
ATOM   10210 C  CG    . GLU G 3 561 ? 13.534  47.083  66.394  1.00 111.68 ? 567  GLU C CG    1 
ATOM   10211 C  CD    . GLU G 3 561 ? 12.762  46.446  67.525  1.00 111.68 ? 567  GLU C CD    1 
ATOM   10212 O  OE1   . GLU G 3 561 ? 11.761  45.756  67.242  1.00 111.68 ? 567  GLU C OE1   1 
ATOM   10213 O  OE2   . GLU G 3 561 ? 13.151  46.631  68.696  1.00 111.68 ? 567  GLU C OE2   1 
ATOM   10214 N  N     . SER G 3 562 ? 11.751  50.840  64.532  1.00 88.05  ? 568  SER C N     1 
ATOM   10215 C  CA    . SER G 3 562 ? 11.763  51.836  63.464  1.00 88.05  ? 568  SER C CA    1 
ATOM   10216 C  C     . SER G 3 562 ? 12.171  53.214  63.954  1.00 88.05  ? 568  SER C C     1 
ATOM   10217 O  O     . SER G 3 562 ? 12.770  53.985  63.209  1.00 88.05  ? 568  SER C O     1 
ATOM   10218 C  CB    . SER G 3 562 ? 10.392  51.920  62.805  1.00 103.69 ? 568  SER C CB    1 
ATOM   10219 O  OG    . SER G 3 562 ? 9.401   52.234  63.764  1.00 103.69 ? 568  SER C OG    1 
ATOM   10220 N  N     . ILE G 3 563 ? 11.845  53.517  65.206  1.00 82.23  ? 569  ILE C N     1 
ATOM   10221 C  CA    . ILE G 3 563 ? 12.178  54.803  65.813  1.00 82.23  ? 569  ILE C CA    1 
ATOM   10222 C  C     . ILE G 3 563 ? 13.654  54.891  66.152  1.00 82.23  ? 569  ILE C C     1 
ATOM   10223 O  O     . ILE G 3 563 ? 14.354  55.793  65.698  1.00 82.23  ? 569  ILE C O     1 
ATOM   10224 C  CB    . ILE G 3 563 ? 11.387  55.010  67.098  1.00 50.06  ? 569  ILE C CB    1 
ATOM   10225 C  CG1   . ILE G 3 563 ? 9.981   55.509  66.756  1.00 50.06  ? 569  ILE C CG1   1 
ATOM   10226 C  CG2   . ILE G 3 563 ? 12.117  55.952  68.001  1.00 50.06  ? 569  ILE C CG2   1 
ATOM   10227 C  CD1   . ILE G 3 563 ? 9.025   55.561  67.941  1.00 50.06  ? 569  ILE C CD1   1 
ATOM   10228 N  N     . GLN G 3 564 ? 14.121  53.964  66.979  1.00 93.70  ? 570  GLN C N     1 
ATOM   10229 C  CA    . GLN G 3 564 ? 15.528  53.947  67.351  1.00 93.70  ? 570  GLN C CA    1 
ATOM   10230 C  C     . GLN G 3 564 ? 16.336  54.116  66.073  1.00 93.70  ? 570  GLN C C     1 
ATOM   10231 O  O     . GLN G 3 564 ? 17.370  54.779  66.070  1.00 93.70  ? 570  GLN C O     1 
ATOM   10232 C  CB    . GLN G 3 564 ? 15.885  52.625  68.026  1.00 98.77  ? 570  GLN C CB    1 
ATOM   10233 C  CG    . GLN G 3 564 ? 15.248  52.456  69.387  1.00 98.77  ? 570  GLN C CG    1 
ATOM   10234 C  CD    . GLN G 3 564 ? 15.893  53.344  70.421  1.00 98.77  ? 570  GLN C CD    1 
ATOM   10235 O  OE1   . GLN G 3 564 ? 17.070  53.175  70.744  1.00 98.77  ? 570  GLN C OE1   1 
ATOM   10236 N  NE2   . GLN G 3 564 ? 15.134  54.303  70.945  1.00 98.77  ? 570  GLN C NE2   1 
ATOM   10237 N  N     . GLN G 3 565 ? 15.837  53.531  64.985  1.00 109.25 ? 571  GLN C N     1 
ATOM   10238 C  CA    . GLN G 3 565 ? 16.495  53.604  63.682  1.00 109.25 ? 571  GLN C CA    1 
ATOM   10239 C  C     . GLN G 3 565 ? 16.563  55.030  63.154  1.00 109.25 ? 571  GLN C C     1 
ATOM   10240 O  O     . GLN G 3 565 ? 17.488  55.389  62.421  1.00 109.25 ? 571  GLN C O     1 
ATOM   10241 C  CB    . GLN G 3 565 ? 15.755  52.733  62.663  1.00 102.41 ? 571  GLN C CB    1 
ATOM   10242 N  N     . THR G 3 566 ? 15.580  55.836  63.539  1.00 93.56  ? 572  THR C N     1 
ATOM   10243 C  CA    . THR G 3 566 ? 15.483  57.226  63.114  1.00 93.56  ? 572  THR C CA    1 
ATOM   10244 C  C     . THR G 3 566 ? 15.782  58.184  64.262  1.00 93.56  ? 572  THR C C     1 
ATOM   10245 O  O     . THR G 3 566 ? 14.946  59.009  64.619  1.00 93.56  ? 572  THR C O     1 
ATOM   10246 C  CB    . THR G 3 566 ? 14.068  57.501  62.581  1.00 63.24  ? 572  THR C CB    1 
ATOM   10247 O  OG1   . THR G 3 566 ? 13.808  56.610  61.490  1.00 63.24  ? 572  THR C OG1   1 
ATOM   10248 C  CG2   . THR G 3 566 ? 13.925  58.941  62.116  1.00 63.24  ? 572  THR C CG2   1 
ATOM   10249 N  N     . LEU G 3 567 ? 16.971  58.068  64.839  1.00 68.52  ? 573  LEU C N     1 
ATOM   10250 C  CA    . LEU G 3 567 ? 17.384  58.923  65.952  1.00 68.52  ? 573  LEU C CA    1 
ATOM   10251 C  C     . LEU G 3 567 ? 18.721  58.415  66.482  1.00 68.52  ? 573  LEU C C     1 
ATOM   10252 O  O     . LEU G 3 567 ? 19.606  59.201  66.816  1.00 68.52  ? 573  LEU C O     1 
ATOM   10253 C  CB    . LEU G 3 567 ? 16.334  58.912  67.088  1.00 49.98  ? 573  LEU C CB    1 
ATOM   10254 N  N     . VAL G 3 568 ? 18.862  57.094  66.545  1.00 158.91 ? 574  VAL C N     1 
ATOM   10255 C  CA    . VAL G 3 568 ? 20.092  56.470  67.029  1.00 158.91 ? 574  VAL C CA    1 
ATOM   10256 C  C     . VAL G 3 568 ? 21.006  56.017  65.893  1.00 158.91 ? 574  VAL C C     1 
ATOM   10257 O  O     . VAL G 3 568 ? 20.546  55.459  64.891  1.00 158.91 ? 574  VAL C O     1 
ATOM   10258 C  CB    . VAL G 3 568 ? 19.789  55.246  67.946  1.00 144.68 ? 574  VAL C CB    1 
ATOM   10259 C  CG1   . VAL G 3 568 ? 20.919  54.223  67.867  1.00 144.68 ? 574  VAL C CG1   1 
ATOM   10260 C  CG2   . VAL G 3 568 ? 19.632  55.708  69.389  1.00 144.68 ? 574  VAL C CG2   1 
ATOM   10261 N  N     . GLU G 3 569 ? 22.304  56.268  66.066  1.00 93.23  ? 575  GLU C N     1 
ATOM   10262 C  CA    . GLU G 3 569 ? 23.331  55.890  65.091  1.00 93.23  ? 575  GLU C CA    1 
ATOM   10263 C  C     . GLU G 3 569 ? 24.723  56.255  65.604  1.00 93.23  ? 575  GLU C C     1 
ATOM   10264 O  O     . GLU G 3 569 ? 25.107  55.739  66.677  1.00 93.23  ? 575  GLU C O     1 
ATOM   10265 C  CB    . GLU G 3 569 ? 23.089  56.588  63.748  1.00 79.63  ? 575  GLU C CB    1 
ATOM   10266 N  N     . LYS G 3 581 ? 25.343  59.345  70.509  1.00 115.08 ? 587  LYS C N     1 
ATOM   10267 C  CA    . LYS G 3 581 ? 25.441  58.887  69.092  1.00 115.08 ? 587  LYS C CA    1 
ATOM   10268 C  C     . LYS G 3 581 ? 24.167  59.242  68.325  1.00 115.08 ? 587  LYS C C     1 
ATOM   10269 O  O     . LYS G 3 581 ? 23.587  58.397  67.638  1.00 115.08 ? 587  LYS C O     1 
ATOM   10270 C  CB    . LYS G 3 581 ? 25.658  57.373  69.053  1.00 101.19 ? 587  LYS C CB    1 
ATOM   10271 N  N     . TRP G 3 582 ? 23.751  60.501  68.426  1.00 85.58  ? 588  TRP C N     1 
ATOM   10272 C  CA    . TRP G 3 582 ? 22.526  60.959  67.783  1.00 85.58  ? 588  TRP C CA    1 
ATOM   10273 C  C     . TRP G 3 582 ? 22.583  61.435  66.334  1.00 85.58  ? 588  TRP C C     1 
ATOM   10274 O  O     . TRP G 3 582 ? 23.618  61.880  65.836  1.00 85.58  ? 588  TRP C O     1 
ATOM   10275 C  CB    . TRP G 3 582 ? 21.899  62.073  68.617  1.0