data_1SL1
# 
_entry.id   1SL1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SL1         
NDB   PD0526       
RCSB  RCSB021803   
WWPDB D_1000021803 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1T7P 'T7 DNA POLYMERASE COMPLEXED TO DNA PRIMER/TEMPLATE, A NUCLEOSIDE TRIPHOSPHATE, AND ITS PROCESSIVITY FACTOR THIOREDOXIN' 
unspecified 
PDB 1SKR 'T7 DNA polymerase complexed primer/template DNA containing a cis-syn thymine dimer on the template' unspecified 
PDB 1SKS 
;Binary 3' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn thymine dimer on the template
;
unspecified 
PDB 1SKW 
;Binary 3' complex of T7 DNA polymerase with a DNA primer/template containing a disordered cis-syn thymine dimer on the template
;
unspecified 
PDB 1SL0 
;Ternary 3' complex of T7 DNA polymerase with a DNA primer/template containing a disordered cis-syn thymine dimer on the template and an incoming nucleotide
;
unspecified 
PDB 1SL2 
;Ternary 5' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn thymine dimer on the template and an incoming nucleotide
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SL1 
_pdbx_database_status.recvd_initial_deposition_date   2004-03-05 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, Y.'          1 
'Dutta, S.'       2 
'Doublie, S.'     3 
'Bdour, H.M.'     4 
'Taylor, J.S.'    5 
'Ellenberger, T.' 6 
# 
_citation.id                        primary 
_citation.title                     
'Nucleotide insertion opposite a cis-syn thymine dimer by a replicative DNA polymerase from bacteriophage T7.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            11 
_citation.page_first                784 
_citation.page_last                 790 
_citation.year                      2004 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15235589 
_citation.pdbx_database_id_DOI      10.1038/nsmb792 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, Y.'          1 
primary 'Dutta, S.'       2 
primary 'Doublie, S.'     3 
primary 'Bdour, H.M.'     4 
primary 'Taylor, J.S.'    5 
primary 'Ellenberger, T.' 6 
# 
_cell.entry_id           1SL1 
_cell.length_a           104.380 
_cell.length_b           214.775 
_cell.length_c           52.180 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SL1 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*CP*GP*AP*AP*AP*AP*CP*GP*AP*CP*GP*GP*CP*CP*AP*GP*TP*GP*CP*CP*TP*(2DA))-3'"         6739.383  1   ?       ? 
? 'DNA primer'   
2 polymer     syn "5'-D(*CP*CP*C*(TTD)P*AP*GP*GP*CP*AP*CP*TP*GP*GP*CP*CP*GP*TP*CP*GP*TP*TP*TP*TP*CP*G)-3'" 7922.077  1   ?       ? 
? 'DNA template' 
3 polymer     man 'DNA polymerase'                                                                         79089.789 1   2.7.7.7 
'DEL(118-123)' ? ?              
4 polymer     man 'Thioredoxin 1'                                                                          11687.388 1   ?       ? 
? ?              
5 non-polymer syn 'MAGNESIUM ION'                                                                          24.305    1   ?       ? 
? ?              
6 water       nat water                                                                                    18.015    239 ?       ? 
? ?              
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 'T7 DNA polymerase' 
4 'TRX1, TRX'         
# 
_entity_name_sys.entity_id   3 
_entity_name_sys.name        2.7.7.7 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes 
;(DC)(DG)(DA)(DA)(DA)(DA)(DC)(DG)(DA)(DC)(DG)(DG)(DC)(DC)(DA)(DG)(DT)(DG)(DC)(DC)
(DT)(2DA)
;
CGAAAACGACGGCCAGTGCCTA P ? 
2 polydeoxyribonucleotide no yes 
;(DC)(DC)(DC)(TTD)(DA)(DG)(DG)(DC)(DA)(DC)(DT)(DG)(DG)(DC)(DC)(DG)(DT)(DC)(DG)
(DT)(DT)(DT)(DT)(DC)(DG)
;
CCCTAGGCACTGGCCGTCGTTTTCG T ? 
3 'polypeptide(L)'        no no  
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFNEE
MMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIEELYVEL
AARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREYVAGAPY
TPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSAEGDKAW
LRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAH
FMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTPAIAALR
ESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKHGWDGDF
AYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFNEE
MMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIEELYVEL
AARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREYVAGAPY
TPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSAEGDKAW
LRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAH
FMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTPAIAALR
ESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKHGWDGDF
AYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
A ? 
4 'polypeptide(L)'        no no  
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DG  n 
1 3   DA  n 
1 4   DA  n 
1 5   DA  n 
1 6   DA  n 
1 7   DC  n 
1 8   DG  n 
1 9   DA  n 
1 10  DC  n 
1 11  DG  n 
1 12  DG  n 
1 13  DC  n 
1 14  DC  n 
1 15  DA  n 
1 16  DG  n 
1 17  DT  n 
1 18  DG  n 
1 19  DC  n 
1 20  DC  n 
1 21  DT  n 
1 22  2DA n 
2 1   DC  n 
2 2   DC  n 
2 3   DC  n 
2 4   TTD n 
2 5   DA  n 
2 6   DG  n 
2 7   DG  n 
2 8   DC  n 
2 9   DA  n 
2 10  DC  n 
2 11  DT  n 
2 12  DG  n 
2 13  DG  n 
2 14  DC  n 
2 15  DC  n 
2 16  DG  n 
2 17  DT  n 
2 18  DC  n 
2 19  DG  n 
2 20  DT  n 
2 21  DT  n 
2 22  DT  n 
2 23  DT  n 
2 24  DC  n 
2 25  DG  n 
3 1   MET n 
3 2   ILE n 
3 3   VAL n 
3 4   SER n 
3 5   ASP n 
3 6   ILE n 
3 7   GLU n 
3 8   ALA n 
3 9   ASN n 
3 10  ALA n 
3 11  LEU n 
3 12  LEU n 
3 13  GLU n 
3 14  SER n 
3 15  VAL n 
3 16  THR n 
3 17  LYS n 
3 18  PHE n 
3 19  HIS n 
3 20  CYS n 
3 21  GLY n 
3 22  VAL n 
3 23  ILE n 
3 24  TYR n 
3 25  ASP n 
3 26  TYR n 
3 27  SER n 
3 28  THR n 
3 29  ALA n 
3 30  GLU n 
3 31  TYR n 
3 32  VAL n 
3 33  SER n 
3 34  TYR n 
3 35  ARG n 
3 36  PRO n 
3 37  SER n 
3 38  ASP n 
3 39  PHE n 
3 40  GLY n 
3 41  ALA n 
3 42  TYR n 
3 43  LEU n 
3 44  ASP n 
3 45  ALA n 
3 46  LEU n 
3 47  GLU n 
3 48  ALA n 
3 49  GLU n 
3 50  VAL n 
3 51  ALA n 
3 52  ARG n 
3 53  GLY n 
3 54  GLY n 
3 55  LEU n 
3 56  ILE n 
3 57  VAL n 
3 58  PHE n 
3 59  HIS n 
3 60  ASN n 
3 61  GLY n 
3 62  HIS n 
3 63  LYS n 
3 64  TYR n 
3 65  ASP n 
3 66  VAL n 
3 67  PRO n 
3 68  ALA n 
3 69  LEU n 
3 70  THR n 
3 71  LYS n 
3 72  LEU n 
3 73  ALA n 
3 74  LYS n 
3 75  LEU n 
3 76  GLN n 
3 77  LEU n 
3 78  ASN n 
3 79  ARG n 
3 80  GLU n 
3 81  PHE n 
3 82  HIS n 
3 83  LEU n 
3 84  PRO n 
3 85  ARG n 
3 86  GLU n 
3 87  ASN n 
3 88  CYS n 
3 89  ILE n 
3 90  ASP n 
3 91  THR n 
3 92  LEU n 
3 93  VAL n 
3 94  LEU n 
3 95  SER n 
3 96  ARG n 
3 97  LEU n 
3 98  ILE n 
3 99  HIS n 
3 100 SER n 
3 101 ASN n 
3 102 LEU n 
3 103 LYS n 
3 104 ASP n 
3 105 THR n 
3 106 ASP n 
3 107 MET n 
3 108 GLY n 
3 109 LEU n 
3 110 LEU n 
3 111 ARG n 
3 112 SER n 
3 113 GLY n 
3 114 LYS n 
3 115 LEU n 
3 116 PRO n 
3 117 GLY n 
3 118 ALA n 
3 119 LEU n 
3 120 GLU n 
3 121 ALA n 
3 122 TRP n 
3 123 GLY n 
3 124 TYR n 
3 125 ARG n 
3 126 LEU n 
3 127 GLY n 
3 128 GLU n 
3 129 MET n 
3 130 LYS n 
3 131 GLY n 
3 132 GLU n 
3 133 TYR n 
3 134 LYS n 
3 135 ASP n 
3 136 ASP n 
3 137 PHE n 
3 138 LYS n 
3 139 ARG n 
3 140 MET n 
3 141 LEU n 
3 142 GLU n 
3 143 GLU n 
3 144 GLN n 
3 145 GLY n 
3 146 GLU n 
3 147 GLU n 
3 148 TYR n 
3 149 VAL n 
3 150 ASP n 
3 151 GLY n 
3 152 MET n 
3 153 GLU n 
3 154 TRP n 
3 155 TRP n 
3 156 ASN n 
3 157 PHE n 
3 158 ASN n 
3 159 GLU n 
3 160 GLU n 
3 161 MET n 
3 162 MET n 
3 163 ASP n 
3 164 TYR n 
3 165 ASN n 
3 166 VAL n 
3 167 GLN n 
3 168 ASP n 
3 169 VAL n 
3 170 VAL n 
3 171 VAL n 
3 172 THR n 
3 173 LYS n 
3 174 ALA n 
3 175 LEU n 
3 176 LEU n 
3 177 GLU n 
3 178 LYS n 
3 179 LEU n 
3 180 LEU n 
3 181 SER n 
3 182 ASP n 
3 183 LYS n 
3 184 HIS n 
3 185 TYR n 
3 186 PHE n 
3 187 PRO n 
3 188 PRO n 
3 189 GLU n 
3 190 ILE n 
3 191 ASP n 
3 192 PHE n 
3 193 THR n 
3 194 ASP n 
3 195 VAL n 
3 196 GLY n 
3 197 TYR n 
3 198 THR n 
3 199 THR n 
3 200 PHE n 
3 201 TRP n 
3 202 SER n 
3 203 GLU n 
3 204 SER n 
3 205 LEU n 
3 206 GLU n 
3 207 ALA n 
3 208 VAL n 
3 209 ASP n 
3 210 ILE n 
3 211 GLU n 
3 212 HIS n 
3 213 ARG n 
3 214 ALA n 
3 215 ALA n 
3 216 TRP n 
3 217 LEU n 
3 218 LEU n 
3 219 ALA n 
3 220 LYS n 
3 221 GLN n 
3 222 GLU n 
3 223 ARG n 
3 224 ASN n 
3 225 GLY n 
3 226 PHE n 
3 227 PRO n 
3 228 PHE n 
3 229 ASP n 
3 230 THR n 
3 231 LYS n 
3 232 ALA n 
3 233 ILE n 
3 234 GLU n 
3 235 GLU n 
3 236 LEU n 
3 237 TYR n 
3 238 VAL n 
3 239 GLU n 
3 240 LEU n 
3 241 ALA n 
3 242 ALA n 
3 243 ARG n 
3 244 ARG n 
3 245 SER n 
3 246 GLU n 
3 247 LEU n 
3 248 LEU n 
3 249 ARG n 
3 250 LYS n 
3 251 LEU n 
3 252 THR n 
3 253 GLU n 
3 254 THR n 
3 255 PHE n 
3 256 GLY n 
3 257 SER n 
3 258 TRP n 
3 259 TYR n 
3 260 GLN n 
3 261 PRO n 
3 262 LYS n 
3 263 GLY n 
3 264 GLY n 
3 265 THR n 
3 266 GLU n 
3 267 MET n 
3 268 PHE n 
3 269 CYS n 
3 270 HIS n 
3 271 PRO n 
3 272 ARG n 
3 273 THR n 
3 274 GLY n 
3 275 LYS n 
3 276 PRO n 
3 277 LEU n 
3 278 PRO n 
3 279 LYS n 
3 280 TYR n 
3 281 PRO n 
3 282 ARG n 
3 283 ILE n 
3 284 LYS n 
3 285 THR n 
3 286 PRO n 
3 287 LYS n 
3 288 VAL n 
3 289 GLY n 
3 290 GLY n 
3 291 ILE n 
3 292 PHE n 
3 293 LYS n 
3 294 LYS n 
3 295 PRO n 
3 296 LYS n 
3 297 ASN n 
3 298 LYS n 
3 299 ALA n 
3 300 GLN n 
3 301 ARG n 
3 302 GLU n 
3 303 GLY n 
3 304 ARG n 
3 305 GLU n 
3 306 PRO n 
3 307 CYS n 
3 308 GLU n 
3 309 LEU n 
3 310 ASP n 
3 311 THR n 
3 312 ARG n 
3 313 GLU n 
3 314 TYR n 
3 315 VAL n 
3 316 ALA n 
3 317 GLY n 
3 318 ALA n 
3 319 PRO n 
3 320 TYR n 
3 321 THR n 
3 322 PRO n 
3 323 VAL n 
3 324 GLU n 
3 325 HIS n 
3 326 VAL n 
3 327 VAL n 
3 328 PHE n 
3 329 ASN n 
3 330 PRO n 
3 331 SER n 
3 332 SER n 
3 333 ARG n 
3 334 ASP n 
3 335 HIS n 
3 336 ILE n 
3 337 GLN n 
3 338 LYS n 
3 339 LYS n 
3 340 LEU n 
3 341 GLN n 
3 342 GLU n 
3 343 ALA n 
3 344 GLY n 
3 345 TRP n 
3 346 VAL n 
3 347 PRO n 
3 348 THR n 
3 349 LYS n 
3 350 TYR n 
3 351 THR n 
3 352 ASP n 
3 353 LYS n 
3 354 GLY n 
3 355 ALA n 
3 356 PRO n 
3 357 VAL n 
3 358 VAL n 
3 359 ASP n 
3 360 ASP n 
3 361 GLU n 
3 362 VAL n 
3 363 LEU n 
3 364 GLU n 
3 365 GLY n 
3 366 VAL n 
3 367 ARG n 
3 368 VAL n 
3 369 ASP n 
3 370 ASP n 
3 371 PRO n 
3 372 GLU n 
3 373 LYS n 
3 374 GLN n 
3 375 ALA n 
3 376 ALA n 
3 377 ILE n 
3 378 ASP n 
3 379 LEU n 
3 380 ILE n 
3 381 LYS n 
3 382 GLU n 
3 383 TYR n 
3 384 LEU n 
3 385 MET n 
3 386 ILE n 
3 387 GLN n 
3 388 LYS n 
3 389 ARG n 
3 390 ILE n 
3 391 GLY n 
3 392 GLN n 
3 393 SER n 
3 394 ALA n 
3 395 GLU n 
3 396 GLY n 
3 397 ASP n 
3 398 LYS n 
3 399 ALA n 
3 400 TRP n 
3 401 LEU n 
3 402 ARG n 
3 403 TYR n 
3 404 VAL n 
3 405 ALA n 
3 406 GLU n 
3 407 ASP n 
3 408 GLY n 
3 409 LYS n 
3 410 ILE n 
3 411 HIS n 
3 412 GLY n 
3 413 SER n 
3 414 VAL n 
3 415 ASN n 
3 416 PRO n 
3 417 ASN n 
3 418 GLY n 
3 419 ALA n 
3 420 VAL n 
3 421 THR n 
3 422 GLY n 
3 423 ARG n 
3 424 ALA n 
3 425 THR n 
3 426 HIS n 
3 427 ALA n 
3 428 PHE n 
3 429 PRO n 
3 430 ASN n 
3 431 LEU n 
3 432 ALA n 
3 433 GLN n 
3 434 ILE n 
3 435 PRO n 
3 436 GLY n 
3 437 VAL n 
3 438 ARG n 
3 439 SER n 
3 440 PRO n 
3 441 TYR n 
3 442 GLY n 
3 443 GLU n 
3 444 GLN n 
3 445 CYS n 
3 446 ARG n 
3 447 ALA n 
3 448 ALA n 
3 449 PHE n 
3 450 GLY n 
3 451 ALA n 
3 452 GLU n 
3 453 HIS n 
3 454 HIS n 
3 455 LEU n 
3 456 ASP n 
3 457 GLY n 
3 458 ILE n 
3 459 THR n 
3 460 GLY n 
3 461 LYS n 
3 462 PRO n 
3 463 TRP n 
3 464 VAL n 
3 465 GLN n 
3 466 ALA n 
3 467 GLY n 
3 468 ILE n 
3 469 ASP n 
3 470 ALA n 
3 471 SER n 
3 472 GLY n 
3 473 LEU n 
3 474 GLU n 
3 475 LEU n 
3 476 ARG n 
3 477 CYS n 
3 478 LEU n 
3 479 ALA n 
3 480 HIS n 
3 481 PHE n 
3 482 MET n 
3 483 ALA n 
3 484 ARG n 
3 485 PHE n 
3 486 ASP n 
3 487 ASN n 
3 488 GLY n 
3 489 GLU n 
3 490 TYR n 
3 491 ALA n 
3 492 HIS n 
3 493 GLU n 
3 494 ILE n 
3 495 LEU n 
3 496 ASN n 
3 497 GLY n 
3 498 ASP n 
3 499 ILE n 
3 500 HIS n 
3 501 THR n 
3 502 LYS n 
3 503 ASN n 
3 504 GLN n 
3 505 ILE n 
3 506 ALA n 
3 507 ALA n 
3 508 GLU n 
3 509 LEU n 
3 510 PRO n 
3 511 THR n 
3 512 ARG n 
3 513 ASP n 
3 514 ASN n 
3 515 ALA n 
3 516 LYS n 
3 517 THR n 
3 518 PHE n 
3 519 ILE n 
3 520 TYR n 
3 521 GLY n 
3 522 PHE n 
3 523 LEU n 
3 524 TYR n 
3 525 GLY n 
3 526 ALA n 
3 527 GLY n 
3 528 ASP n 
3 529 GLU n 
3 530 LYS n 
3 531 ILE n 
3 532 GLY n 
3 533 GLN n 
3 534 ILE n 
3 535 VAL n 
3 536 GLY n 
3 537 ALA n 
3 538 GLY n 
3 539 LYS n 
3 540 GLU n 
3 541 ARG n 
3 542 GLY n 
3 543 LYS n 
3 544 GLU n 
3 545 LEU n 
3 546 LYS n 
3 547 LYS n 
3 548 LYS n 
3 549 PHE n 
3 550 LEU n 
3 551 GLU n 
3 552 ASN n 
3 553 THR n 
3 554 PRO n 
3 555 ALA n 
3 556 ILE n 
3 557 ALA n 
3 558 ALA n 
3 559 LEU n 
3 560 ARG n 
3 561 GLU n 
3 562 SER n 
3 563 ILE n 
3 564 GLN n 
3 565 GLN n 
3 566 THR n 
3 567 LEU n 
3 568 VAL n 
3 569 GLU n 
3 570 SER n 
3 571 SER n 
3 572 GLN n 
3 573 TRP n 
3 574 VAL n 
3 575 ALA n 
3 576 GLY n 
3 577 GLU n 
3 578 GLN n 
3 579 GLN n 
3 580 VAL n 
3 581 LYS n 
3 582 TRP n 
3 583 LYS n 
3 584 ARG n 
3 585 ARG n 
3 586 TRP n 
3 587 ILE n 
3 588 LYS n 
3 589 GLY n 
3 590 LEU n 
3 591 ASP n 
3 592 GLY n 
3 593 ARG n 
3 594 LYS n 
3 595 VAL n 
3 596 HIS n 
3 597 VAL n 
3 598 ARG n 
3 599 SER n 
3 600 PRO n 
3 601 HIS n 
3 602 ALA n 
3 603 ALA n 
3 604 LEU n 
3 605 ASN n 
3 606 THR n 
3 607 LEU n 
3 608 LEU n 
3 609 GLN n 
3 610 SER n 
3 611 ALA n 
3 612 GLY n 
3 613 ALA n 
3 614 LEU n 
3 615 ILE n 
3 616 CYS n 
3 617 LYS n 
3 618 LEU n 
3 619 TRP n 
3 620 ILE n 
3 621 ILE n 
3 622 LYS n 
3 623 THR n 
3 624 GLU n 
3 625 GLU n 
3 626 MET n 
3 627 LEU n 
3 628 VAL n 
3 629 GLU n 
3 630 LYS n 
3 631 GLY n 
3 632 LEU n 
3 633 LYS n 
3 634 HIS n 
3 635 GLY n 
3 636 TRP n 
3 637 ASP n 
3 638 GLY n 
3 639 ASP n 
3 640 PHE n 
3 641 ALA n 
3 642 TYR n 
3 643 MET n 
3 644 ALA n 
3 645 TRP n 
3 646 VAL n 
3 647 HIS n 
3 648 ASP n 
3 649 GLU n 
3 650 ILE n 
3 651 GLN n 
3 652 VAL n 
3 653 GLY n 
3 654 CYS n 
3 655 ARG n 
3 656 THR n 
3 657 GLU n 
3 658 GLU n 
3 659 ILE n 
3 660 ALA n 
3 661 GLN n 
3 662 VAL n 
3 663 VAL n 
3 664 ILE n 
3 665 GLU n 
3 666 THR n 
3 667 ALA n 
3 668 GLN n 
3 669 GLU n 
3 670 ALA n 
3 671 MET n 
3 672 ARG n 
3 673 TRP n 
3 674 VAL n 
3 675 GLY n 
3 676 ASP n 
3 677 HIS n 
3 678 TRP n 
3 679 ASN n 
3 680 PHE n 
3 681 ARG n 
3 682 CYS n 
3 683 LEU n 
3 684 LEU n 
3 685 ASP n 
3 686 THR n 
3 687 GLU n 
3 688 GLY n 
3 689 LYS n 
3 690 MET n 
3 691 GLY n 
3 692 PRO n 
3 693 ASN n 
3 694 TRP n 
3 695 ALA n 
3 696 ILE n 
3 697 CYS n 
3 698 HIS n 
4 1   SER n 
4 2   ASP n 
4 3   LYS n 
4 4   ILE n 
4 5   ILE n 
4 6   HIS n 
4 7   LEU n 
4 8   THR n 
4 9   ASP n 
4 10  ASP n 
4 11  SER n 
4 12  PHE n 
4 13  ASP n 
4 14  THR n 
4 15  ASP n 
4 16  VAL n 
4 17  LEU n 
4 18  LYS n 
4 19  ALA n 
4 20  ASP n 
4 21  GLY n 
4 22  ALA n 
4 23  ILE n 
4 24  LEU n 
4 25  VAL n 
4 26  ASP n 
4 27  PHE n 
4 28  TRP n 
4 29  ALA n 
4 30  GLU n 
4 31  TRP n 
4 32  CYS n 
4 33  GLY n 
4 34  PRO n 
4 35  CYS n 
4 36  LYS n 
4 37  MET n 
4 38  ILE n 
4 39  ALA n 
4 40  PRO n 
4 41  ILE n 
4 42  LEU n 
4 43  ASP n 
4 44  GLU n 
4 45  ILE n 
4 46  ALA n 
4 47  ASP n 
4 48  GLU n 
4 49  TYR n 
4 50  GLN n 
4 51  GLY n 
4 52  LYS n 
4 53  LEU n 
4 54  THR n 
4 55  VAL n 
4 56  ALA n 
4 57  LYS n 
4 58  LEU n 
4 59  ASN n 
4 60  ILE n 
4 61  ASP n 
4 62  GLN n 
4 63  ASN n 
4 64  PRO n 
4 65  GLY n 
4 66  THR n 
4 67  ALA n 
4 68  PRO n 
4 69  LYS n 
4 70  TYR n 
4 71  GLY n 
4 72  ILE n 
4 73  ARG n 
4 74  GLY n 
4 75  ILE n 
4 76  PRO n 
4 77  THR n 
4 78  LEU n 
4 79  LEU n 
4 80  LEU n 
4 81  PHE n 
4 82  LYS n 
4 83  ASN n 
4 84  GLY n 
4 85  GLU n 
4 86  VAL n 
4 87  ALA n 
4 88  ALA n 
4 89  THR n 
4 90  LYS n 
4 91  VAL n 
4 92  GLY n 
4 93  ALA n 
4 94  LEU n 
4 95  SER n 
4 96  LYS n 
4 97  GLY n 
4 98  GLN n 
4 99  LEU n 
4 100 LYS n 
4 101 GLU n 
4 102 PHE n 
4 103 LEU n 
4 104 ASP n 
4 105 ALA n 
4 106 ASN n 
4 107 LEU n 
4 108 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample ? ? ? ? 'T7-like viruses' 5 ? ? ? ? ? ? 'Enterobacteria phage T7' 10760 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? ? Escherichia       
'TRXA, TSNC, FIPA, B3781, C4701, Z5291, ECS4714, STM3915, STMD1.75, STY3639, T3381, SF3854, S3905' ? ? ? ? ? ? 'Escherichia coli' 
562   ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOL_BPT7  P00581 3 
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGKRFGSHALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEW
WNFNEEMMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIE
ELYVELAARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREY
VAGAPYTPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSA
EGDKAWLRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLE
LRCLAHFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTP
AIAALRESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKH
GWDGDFAYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
1 ? 
2 UNP THIO_ECOLI P0AA25 4 
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
1 ? 
3 PDB 1SL1       1SL1   1 ? ? ? 
4 PDB 1SL1       1SL1   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1SL1 A 1 ? 698 ? P00581 1 ? 704 ? 1 704 
2 2 1SL1 B 1 ? 108 ? P0AA25 1 ? 108 ? 1 108 
3 3 1SL1 P 1 ? 22  ? 1SL1   1 ? 22  ? 1 22  
4 4 1SL1 T 1 ? 25  ? 1SL1   2 ? 26  ? 2 26  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1SL1 ? A ? ? UNP P00581 LYS 118 DELETION ? 1 
1 1SL1 ? A ? ? UNP P00581 ARG 119 DELETION ? 2 
1 1SL1 ? A ? ? UNP P00581 PHE 120 DELETION ? 3 
1 1SL1 ? A ? ? UNP P00581 GLY 121 DELETION ? 4 
1 1SL1 ? A ? ? UNP P00581 SER 122 DELETION ? 5 
1 1SL1 ? A ? ? UNP P00581 HIS 123 DELETION ? 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2DA 'DNA linking'       n "2',3'-DIDEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O5 P'   315.222 
ALA 'L-peptide linking' y ALANINE                                   ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                  ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                           ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                  ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"      ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"       ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"      ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"              ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                                 ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                           ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                   ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                 ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                     ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                   ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                    ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                           ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                             ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                   ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                    ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                 ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                ? 'C11 H12 N2 O2'     204.225 
TTD 'DNA linking'       n 'CIS-SYN CYCLOBUTANE THYMINE DIMER'       
;[(3S,4S,9S,10R,12R,15AR,18BS,18CS)-3,7-DIHYDROXY-15A,15B-DIMETHYL-7-OXIDO-13,15,16,18-TETRAOXOHEXADECAHYDRO-1H-1,4-EPOXY-9,12-METHANO-6,8,11-TRIOXA-12A,14,17,18A-TETRAAZA-7-PHOSPHACYCLOHEXADECA[1,2,3,4-DEF]BIPHENYLEN-10-YL]METHYL DIHYDROGEN PHOSPHATE
;
'C20 H28 N4 O15 P2' 626.402 
TYR 'L-peptide linking' y TYROSINE                                  ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                    ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1SL1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.14 
_exptl_crystal.density_percent_sol   60.51 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'VAPOR DIFFUSION, HANGING DROP, pH 7.5' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2003-07-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             0.979 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1SL1 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   60347 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.068 
_reflns.pdbx_netI_over_sigmaI        36.1 
_reflns.B_iso_Wilson_estimate        27.0 
_reflns.pdbx_redundancy              25.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   99.4 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.309 
_reflns_shell.meanI_over_sigI_obs    6.69 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1SL1 
_refine.ls_number_reflns_obs                     59617 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    98.4 
_refine.ls_R_factor_obs                          0.242 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.242 
_refine.ls_R_factor_R_free                       0.262 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.7 
_refine.ls_number_reflns_R_free                  2814 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               40.0 
_refine.aniso_B[1][1]                            5.17 
_refine.aniso_B[2][2]                            -0.56 
_refine.aniso_B[3][3]                            -4.61 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.341313 
_refine.solvent_model_param_bsol                 38.0504 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1SL1 
_refine_analyze.Luzzati_coordinate_error_obs    0.29 
_refine_analyze.Luzzati_sigma_a_obs             0.16 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.34 
_refine_analyze.Luzzati_sigma_a_free            0.24 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6019 
_refine_hist.pdbx_number_atoms_nucleic_acid   395 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             239 
_refine_hist.number_atoms_total               6654 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      21.5  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.94  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.07  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.67  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             7.88  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            9.47  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.34 
_refine_ls_shell.number_reflns_R_work             8966 
_refine_ls_shell.R_factor_R_work                  0.252 
_refine_ls_shell.percent_reflns_obs               93.4 
_refine_ls_shell.R_factor_R_free                  0.285 
_refine_ls_shell.R_factor_R_free_error            0.016 
_refine_ls_shell.percent_reflns_R_free            3.4 
_refine_ls_shell.number_reflns_R_free             315 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1SL1 
_struct.title                     
;Binary 5' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn thymine dimer on the template
;
_struct.pdbx_descriptor           'DNA POLYMERASE (E.C.2.7.7.7)/THIOREDOXIN 1/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SL1 
_struct_keywords.pdbx_keywords   'TRANSFERASE/ELECTRON TRANSPORT/DNA' 
_struct_keywords.text            
'DNA polymerase, fidelity, lesion bypass, thymine dimer, open, close, TRANSFERASE-ELECTRON TRANSPORT-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU C 11  ? VAL C 15  ? LEU A 11  VAL A 15  5 ? 5  
HELX_P HELX_P2  2  ARG C 35  ? SER C 37  ? ARG A 35  SER A 37  5 ? 3  
HELX_P HELX_P3  3  ASP C 38  ? ARG C 52  ? ASP A 38  ARG A 52  1 ? 15 
HELX_P HELX_P4  4  TYR C 64  ? ASN C 78  ? TYR A 64  ASN A 78  1 ? 15 
HELX_P HELX_P5  5  PRO C 84  ? GLU C 86  ? PRO A 84  GLU A 86  5 ? 3  
HELX_P HELX_P6  6  THR C 91  ? HIS C 99  ? THR A 91  HIS A 99  1 ? 9  
HELX_P HELX_P7  7  ARG C 111 ? LEU C 115 ? ARG A 111 LEU A 115 5 ? 5  
HELX_P HELX_P8  8  GLU C 120 ? GLU C 143 ? GLU A 126 GLU A 149 1 ? 24 
HELX_P HELX_P9  9  GLY C 151 ? TRP C 155 ? GLY A 157 TRP A 161 5 ? 5  
HELX_P HELX_P10 10 ASN C 158 ? SER C 181 ? ASN A 164 SER A 187 1 ? 24 
HELX_P HELX_P11 11 GLY C 196 ? SER C 204 ? GLY A 202 SER A 210 1 ? 9  
HELX_P HELX_P12 12 LEU C 205 ? GLY C 225 ? LEU A 211 GLY A 231 1 ? 21 
HELX_P HELX_P13 13 ASP C 229 ? PHE C 255 ? ASP A 235 PHE A 261 1 ? 27 
HELX_P HELX_P14 14 SER C 332 ? GLU C 342 ? SER A 338 GLU A 348 1 ? 11 
HELX_P HELX_P15 15 ASP C 359 ? VAL C 366 ? ASP A 365 VAL A 372 1 ? 8  
HELX_P HELX_P16 16 ASP C 370 ? ALA C 394 ? ASP A 376 ALA A 400 1 ? 25 
HELX_P HELX_P17 17 ALA C 399 ? VAL C 404 ? ALA A 405 VAL A 410 1 ? 6  
HELX_P HELX_P18 18 TYR C 441 ? ALA C 448 ? TYR A 447 ALA A 454 1 ? 8  
HELX_P HELX_P19 19 PHE C 449 ? PHE C 449 ? PHE A 455 PHE A 455 5 ? 1  
HELX_P HELX_P20 20 GLY C 450 ? HIS C 454 ? GLY A 456 HIS A 460 5 ? 5  
HELX_P HELX_P21 21 GLY C 472 ? ASN C 487 ? GLY A 478 ASN A 493 1 ? 16 
HELX_P HELX_P22 22 GLY C 488 ? GLY C 497 ? GLY A 494 GLY A 503 1 ? 10 
HELX_P HELX_P23 23 ASP C 498 ? ALA C 506 ? ASP A 504 ALA A 512 1 ? 9  
HELX_P HELX_P24 24 THR C 511 ? TYR C 524 ? THR A 517 TYR A 530 1 ? 14 
HELX_P HELX_P25 25 GLY C 527 ? GLN C 533 ? GLY A 533 GLN A 539 1 ? 7  
HELX_P HELX_P26 26 GLU C 540 ? ASN C 552 ? GLU A 546 ASN A 558 1 ? 13 
HELX_P HELX_P27 27 THR C 553 ? VAL C 568 ? THR A 559 VAL A 574 1 ? 16 
HELX_P HELX_P28 28 SER C 599 ? HIS C 601 ? SER A 605 HIS A 607 5 ? 3  
HELX_P HELX_P29 29 ALA C 602 ? LYS C 630 ? ALA A 608 LYS A 636 1 ? 29 
HELX_P HELX_P30 30 THR C 656 ? TRP C 678 ? THR A 662 TRP A 684 1 ? 23 
HELX_P HELX_P31 31 THR D 8   ? VAL D 16  ? THR B 8   VAL B 16  1 ? 9  
HELX_P HELX_P32 32 CYS D 32  ? TYR D 49  ? CYS B 32  TYR B 49  1 ? 18 
HELX_P HELX_P33 33 THR D 66  ? GLY D 71  ? THR B 66  GLY B 71  5 ? 6  
HELX_P HELX_P34 34 SER D 95  ? LEU D 107 ? SER B 95  LEU B 107 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E MG  .  MG    ? ? ? 1_555 G HOH .  O   ? ? A MG  4003 A HOH 5268 1_555 ? ? ? ? ? ? ?            2.427 ? 
metalc2  metalc ? ? E MG  .  MG    ? ? ? 1_555 G HOH .  O   ? ? A MG  4003 A HOH 5029 1_555 ? ? ? ? ? ? ?            2.519 ? 
metalc3  metalc ? ? E MG  .  MG    ? ? ? 1_555 G HOH .  O   ? ? A MG  4003 A HOH 5012 1_555 ? ? ? ? ? ? ?            2.437 ? 
metalc4  metalc ? ? E MG  .  MG    ? ? ? 1_555 G HOH .  O   ? ? A MG  4003 A HOH 5001 1_555 ? ? ? ? ? ? ?            2.414 ? 
metalc5  metalc ? ? E MG  .  MG    ? ? ? 1_555 C ASP 5  OD1 ? ? A MG  4003 A ASP 5    1_555 ? ? ? ? ? ? ?            2.564 ? 
covale1  covale ? ? A DT  21 "O3'" ? ? ? 1_555 A 2DA 22 P   ? ? P DT  21   P 2DA 22   1_555 ? ? ? ? ? ? ?            1.614 ? 
covale2  covale ? ? B TTD 4  "O3'" ? ? ? 1_555 B DA  5  P   ? ? T TTD 5    T DA  6    1_555 ? ? ? ? ? ? ?            1.615 ? 
hydrog1  hydrog ? ? A DC  14 N3    ? ? ? 1_555 B DG  12 N1  ? ? P DC  14   T DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DC  14 N4    ? ? ? 1_555 B DG  12 O6  ? ? P DC  14   T DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DC  14 O2    ? ? ? 1_555 B DG  12 N2  ? ? P DC  14   T DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DA  15 N1    ? ? ? 1_555 B DT  11 N3  ? ? P DA  15   T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DA  15 N6    ? ? ? 1_555 B DT  11 O4  ? ? P DA  15   T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DG  16 N1    ? ? ? 1_555 B DC  10 N3  ? ? P DG  16   T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DG  16 N2    ? ? ? 1_555 B DC  10 O2  ? ? P DG  16   T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DG  16 O6    ? ? ? 1_555 B DC  10 N4  ? ? P DG  16   T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DT  17 N3    ? ? ? 1_555 B DA  9  N1  ? ? P DT  17   T DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DT  17 O4    ? ? ? 1_555 B DA  9  N6  ? ? P DT  17   T DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG  18 N1    ? ? ? 1_555 B DC  8  N3  ? ? P DG  18   T DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG  18 N2    ? ? ? 1_555 B DC  8  O2  ? ? P DG  18   T DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DG  18 O6    ? ? ? 1_555 B DC  8  N4  ? ? P DG  18   T DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DC  19 N3    ? ? ? 1_555 B DG  7  N1  ? ? P DC  19   T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DC  19 N4    ? ? ? 1_555 B DG  7  O6  ? ? P DC  19   T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DC  19 O2    ? ? ? 1_555 B DG  7  N2  ? ? P DC  19   T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DC  20 N3    ? ? ? 1_555 B DG  6  N1  ? ? P DC  20   T DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DC  20 N4    ? ? ? 1_555 B DG  6  O6  ? ? P DC  20   T DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DC  20 O2    ? ? ? 1_555 B DG  6  N2  ? ? P DC  20   T DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DT  21 N3    ? ? ? 1_555 B DA  5  N1  ? ? P DT  21   T DA  6    1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 428 C . ? PHE 434 A PRO 429 C ? PRO 435 A 1 -0.72 
2 ILE 75  D . ? ILE 75  B PRO 76  D ? PRO 76  B 1 0.20  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 3 ? 
D ? 2 ? 
E ? 2 ? 
F ? 4 ? 
G ? 2 ? 
H ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR C 31  ? TYR C 34  ? TYR A 31  TYR A 34  
A 2 PHE C 18  ? ASP C 25  ? PHE A 18  ASP A 25  
A 3 ILE C 2   ? ALA C 8   ? ILE A 2   ALA A 8   
A 4 ILE C 56  ? PHE C 58  ? ILE A 56  PHE A 58  
A 5 CYS C 88  ? ASP C 90  ? CYS A 88  ASP A 90  
B 1 PHE C 226 ? PRO C 227 ? PHE A 232 PRO A 233 
B 2 LYS C 409 ? ILE C 410 ? LYS A 415 ILE A 416 
C 1 TRP C 258 ? PRO C 261 ? TRP A 264 PRO A 267 
C 2 THR C 321 ? VAL C 326 ? THR A 327 VAL A 332 
C 3 GLY D 74  ? ILE D 75  ? GLY B 74  ILE B 75  
D 1 PHE C 268 ? CYS C 269 ? PHE A 274 CYS A 275 
D 2 PRO C 276 ? LEU C 277 ? PRO A 282 LEU A 283 
E 1 SER C 413 ? ASN C 415 ? SER A 419 ASN A 421 
E 2 THR C 425 ? ALA C 427 ? THR A 431 ALA A 433 
F 1 PHE C 640 ? VAL C 646 ? PHE A 646 VAL A 652 
F 2 GLU C 649 ? CYS C 654 ? GLU A 655 CYS A 660 
F 3 VAL C 464 ? ALA C 470 ? VAL A 470 ALA A 476 
F 4 THR C 686 ? GLY C 691 ? THR A 692 GLY A 697 
G 1 TRP C 586 ? LYS C 588 ? TRP A 592 LYS A 594 
G 2 LYS C 594 ? HIS C 596 ? LYS A 600 HIS A 602 
H 1 ILE D 5   ? HIS D 6   ? ILE B 5   HIS B 6   
H 2 THR D 54  ? ASN D 59  ? THR B 54  ASN B 59  
H 3 ALA D 22  ? TRP D 28  ? ALA B 22  TRP B 28  
H 4 THR D 77  ? LYS D 82  ? THR B 77  LYS B 82  
H 5 VAL D 86  ? VAL D 91  ? VAL B 86  VAL B 91  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR C 34  ? O TYR A 34  N GLY C 21  ? N GLY A 21  
A 2 3 O CYS C 20  ? O CYS A 20  N GLU C 7   ? N GLU A 7   
A 3 4 N SER C 4   ? N SER A 4   O VAL C 57  ? O VAL A 57  
A 4 5 N ILE C 56  ? N ILE A 56  O ILE C 89  ? O ILE A 89  
B 1 2 N PHE C 226 ? N PHE A 232 O ILE C 410 ? O ILE A 416 
C 1 2 N TRP C 258 ? N TRP A 264 O VAL C 326 ? O VAL A 332 
C 2 3 N THR C 321 ? N THR A 327 O ILE D 75  ? O ILE B 75  
D 1 2 N PHE C 268 ? N PHE A 274 O LEU C 277 ? O LEU A 283 
E 1 2 N SER C 413 ? N SER A 419 O ALA C 427 ? O ALA A 433 
F 1 2 N ALA C 641 ? N ALA A 647 O GLY C 653 ? O GLY A 659 
F 2 3 O CYS C 654 ? O CYS A 660 N VAL C 464 ? N VAL A 470 
F 3 4 N GLY C 467 ? N GLY A 473 O LYS C 689 ? O LYS A 695 
G 1 2 N ILE C 587 ? N ILE A 593 O VAL C 595 ? O VAL A 601 
H 1 2 N ILE D 5   ? N ILE B 5   O LYS D 57  ? O LYS B 57  
H 2 3 O ALA D 56  ? O ALA B 56  N LEU D 24  ? N LEU B 24  
H 3 4 N ILE D 23  ? N ILE B 23  O PHE D 81  ? O PHE B 81  
H 4 5 N LEU D 80  ? N LEU B 80  O ALA D 87  ? O ALA B 87  
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    5 
_struct_site.details              'BINDING SITE FOR RESIDUE MG A 4003' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 ASP C 5 ? ASP A 5    . ? 1_555 ? 
2 AC1 5 HOH G . ? HOH A 5001 . ? 1_555 ? 
3 AC1 5 HOH G . ? HOH A 5012 . ? 1_555 ? 
4 AC1 5 HOH G . ? HOH A 5029 . ? 1_555 ? 
5 AC1 5 HOH G . ? HOH A 5268 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1SL1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SL1 
_atom_sites.fract_transf_matrix[1][1]   0.009580 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004656 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019164 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    P  P     . DC  A 1 14  ? 60.389 43.006  20.616  1.00 73.75 ? 14   DC  P P     1 
ATOM   2    O  OP1   . DC  A 1 14  ? 61.512 44.038  20.583  1.00 72.65 ? 14   DC  P OP1   1 
ATOM   3    O  OP2   . DC  A 1 14  ? 60.231 42.333  21.972  1.00 72.82 ? 14   DC  P OP2   1 
ATOM   4    O  "O5'" . DC  A 1 14  ? 59.007 43.835  20.363  1.00 71.77 ? 14   DC  P "O5'" 1 
ATOM   5    C  "C5'" . DC  A 1 14  ? 58.499 44.743  21.360  1.00 69.62 ? 14   DC  P "C5'" 1 
ATOM   6    C  "C4'" . DC  A 1 14  ? 57.327 45.528  20.815  1.00 67.99 ? 14   DC  P "C4'" 1 
ATOM   7    O  "O4'" . DC  A 1 14  ? 57.732 46.303  19.658  1.00 67.87 ? 14   DC  P "O4'" 1 
ATOM   8    C  "C3'" . DC  A 1 14  ? 56.128 44.693  20.363  1.00 67.41 ? 14   DC  P "C3'" 1 
ATOM   9    O  "O3'" . DC  A 1 14  ? 54.922 45.385  20.694  1.00 67.15 ? 14   DC  P "O3'" 1 
ATOM   10   C  "C2'" . DC  A 1 14  ? 56.286 44.644  18.854  1.00 67.26 ? 14   DC  P "C2'" 1 
ATOM   11   C  "C1'" . DC  A 1 14  ? 56.863 46.019  18.568  1.00 66.63 ? 14   DC  P "C1'" 1 
ATOM   12   N  N1    . DC  A 1 14  ? 57.634 46.141  17.316  1.00 65.55 ? 14   DC  P N1    1 
ATOM   13   C  C2    . DC  A 1 14  ? 57.192 47.043  16.335  1.00 65.33 ? 14   DC  P C2    1 
ATOM   14   O  O2    . DC  A 1 14  ? 56.169 47.718  16.549  1.00 65.41 ? 14   DC  P O2    1 
ATOM   15   N  N3    . DC  A 1 14  ? 57.892 47.161  15.184  1.00 65.41 ? 14   DC  P N3    1 
ATOM   16   C  C4    . DC  A 1 14  ? 58.993 46.431  14.993  1.00 65.74 ? 14   DC  P C4    1 
ATOM   17   N  N4    . DC  A 1 14  ? 59.656 46.587  13.844  1.00 65.27 ? 14   DC  P N4    1 
ATOM   18   C  C5    . DC  A 1 14  ? 59.467 45.509  15.972  1.00 65.81 ? 14   DC  P C5    1 
ATOM   19   C  C6    . DC  A 1 14  ? 58.763 45.396  17.106  1.00 66.15 ? 14   DC  P C6    1 
ATOM   20   P  P     . DA  A 1 15  ? 53.521 44.600  20.683  1.00 68.90 ? 15   DA  P P     1 
ATOM   21   O  OP1   . DA  A 1 15  ? 53.053 44.465  22.088  1.00 68.11 ? 15   DA  P OP1   1 
ATOM   22   O  OP2   . DA  A 1 15  ? 53.671 43.387  19.836  1.00 68.57 ? 15   DA  P OP2   1 
ATOM   23   O  "O5'" . DA  A 1 15  ? 52.538 45.599  19.928  1.00 66.74 ? 15   DA  P "O5'" 1 
ATOM   24   C  "C5'" . DA  A 1 15  ? 52.312 46.914  20.427  1.00 63.49 ? 15   DA  P "C5'" 1 
ATOM   25   C  "C4'" . DA  A 1 15  ? 51.547 47.735  19.414  1.00 60.86 ? 15   DA  P "C4'" 1 
ATOM   26   O  "O4'" . DA  A 1 15  ? 52.365 47.938  18.236  1.00 60.65 ? 15   DA  P "O4'" 1 
ATOM   27   C  "C3'" . DA  A 1 15  ? 50.239 47.115  18.926  1.00 59.67 ? 15   DA  P "C3'" 1 
ATOM   28   O  "O3'" . DA  A 1 15  ? 49.240 48.136  18.809  1.00 59.91 ? 15   DA  P "O3'" 1 
ATOM   29   C  "C2'" . DA  A 1 15  ? 50.606 46.516  17.577  1.00 58.67 ? 15   DA  P "C2'" 1 
ATOM   30   C  "C1'" . DA  A 1 15  ? 51.715 47.432  17.077  1.00 58.25 ? 15   DA  P "C1'" 1 
ATOM   31   N  N9    . DA  A 1 15  ? 52.736 46.773  16.257  1.00 57.95 ? 15   DA  P N9    1 
ATOM   32   C  C8    . DA  A 1 15  ? 53.451 45.637  16.560  1.00 57.55 ? 15   DA  P C8    1 
ATOM   33   N  N7    . DA  A 1 15  ? 54.323 45.298  15.642  1.00 56.65 ? 15   DA  P N7    1 
ATOM   34   C  C5    . DA  A 1 15  ? 54.172 46.270  14.664  1.00 56.85 ? 15   DA  P C5    1 
ATOM   35   C  C6    . DA  A 1 15  ? 54.812 46.474  13.428  1.00 55.87 ? 15   DA  P C6    1 
ATOM   36   N  N6    . DA  A 1 15  ? 55.774 45.682  12.950  1.00 54.11 ? 15   DA  P N6    1 
ATOM   37   N  N1    . DA  A 1 15  ? 54.425 47.536  12.689  1.00 57.28 ? 15   DA  P N1    1 
ATOM   38   C  C2    . DA  A 1 15  ? 53.459 48.334  13.169  1.00 57.75 ? 15   DA  P C2    1 
ATOM   39   N  N3    . DA  A 1 15  ? 52.784 48.247  14.314  1.00 57.18 ? 15   DA  P N3    1 
ATOM   40   C  C4    . DA  A 1 15  ? 53.192 47.182  15.025  1.00 57.04 ? 15   DA  P C4    1 
ATOM   41   P  P     . DG  A 1 16  ? 47.703 47.732  18.556  1.00 59.75 ? 16   DG  P P     1 
ATOM   42   O  OP1   . DG  A 1 16  ? 46.838 48.752  19.205  1.00 60.46 ? 16   DG  P OP1   1 
ATOM   43   O  OP2   . DG  A 1 16  ? 47.519 46.293  18.888  1.00 59.17 ? 16   DG  P OP2   1 
ATOM   44   O  "O5'" . DG  A 1 16  ? 47.554 47.892  16.979  1.00 59.03 ? 16   DG  P "O5'" 1 
ATOM   45   C  "C5'" . DG  A 1 16  ? 47.828 49.144  16.355  1.00 56.73 ? 16   DG  P "C5'" 1 
ATOM   46   C  "C4'" . DG  A 1 16  ? 47.736 49.019  14.853  1.00 55.34 ? 16   DG  P "C4'" 1 
ATOM   47   O  "O4'" . DG  A 1 16  ? 48.926 48.393  14.308  1.00 54.89 ? 16   DG  P "O4'" 1 
ATOM   48   C  "C3'" . DG  A 1 16  ? 46.543 48.215  14.325  1.00 53.93 ? 16   DG  P "C3'" 1 
ATOM   49   O  "O3'" . DG  A 1 16  ? 45.971 48.922  13.221  1.00 52.51 ? 16   DG  P "O3'" 1 
ATOM   50   C  "C2'" . DG  A 1 16  ? 47.180 46.910  13.868  1.00 53.70 ? 16   DG  P "C2'" 1 
ATOM   51   C  "C1'" . DG  A 1 16  ? 48.536 47.397  13.381  1.00 53.70 ? 16   DG  P "C1'" 1 
ATOM   52   N  N9    . DG  A 1 16  ? 49.605 46.402  13.296  1.00 53.00 ? 16   DG  P N9    1 
ATOM   53   C  C8    . DG  A 1 16  ? 49.811 45.316  14.116  1.00 52.76 ? 16   DG  P C8    1 
ATOM   54   N  N7    . DG  A 1 16  ? 50.842 44.596  13.763  1.00 51.22 ? 16   DG  P N7    1 
ATOM   55   C  C5    . DG  A 1 16  ? 51.352 45.246  12.649  1.00 51.69 ? 16   DG  P C5    1 
ATOM   56   C  C6    . DG  A 1 16  ? 52.469 44.927  11.826  1.00 51.73 ? 16   DG  P C6    1 
ATOM   57   O  O6    . DG  A 1 16  ? 53.246 43.968  11.916  1.00 52.25 ? 16   DG  P O6    1 
ATOM   58   N  N1    . DG  A 1 16  ? 52.641 45.863  10.811  1.00 50.42 ? 16   DG  P N1    1 
ATOM   59   C  C2    . DG  A 1 16  ? 51.845 46.962  10.608  1.00 50.90 ? 16   DG  P C2    1 
ATOM   60   N  N2    . DG  A 1 16  ? 52.189 47.760  9.585   1.00 49.50 ? 16   DG  P N2    1 
ATOM   61   N  N3    . DG  A 1 16  ? 50.792 47.262  11.356  1.00 50.97 ? 16   DG  P N3    1 
ATOM   62   C  C4    . DG  A 1 16  ? 50.607 46.369  12.352  1.00 51.59 ? 16   DG  P C4    1 
ATOM   63   P  P     . DT  A 1 17  ? 44.524 48.509  12.653  1.00 53.27 ? 17   DT  P P     1 
ATOM   64   O  OP1   . DT  A 1 17  ? 43.742 49.756  12.469  1.00 52.67 ? 17   DT  P OP1   1 
ATOM   65   O  OP2   . DT  A 1 17  ? 43.956 47.394  13.457  1.00 51.90 ? 17   DT  P OP2   1 
ATOM   66   O  "O5'" . DT  A 1 17  ? 44.866 47.934  11.212  1.00 52.84 ? 17   DT  P "O5'" 1 
ATOM   67   C  "C5'" . DT  A 1 17  ? 46.130 47.331  10.976  1.00 52.72 ? 17   DT  P "C5'" 1 
ATOM   68   C  "C4'" . DT  A 1 17  ? 46.457 47.349  9.506   1.00 50.69 ? 17   DT  P "C4'" 1 
ATOM   69   O  "O4'" . DT  A 1 17  ? 47.795 46.825  9.355   1.00 51.59 ? 17   DT  P "O4'" 1 
ATOM   70   C  "C3'" . DT  A 1 17  ? 45.546 46.445  8.687   1.00 50.60 ? 17   DT  P "C3'" 1 
ATOM   71   O  "O3'" . DT  A 1 17  ? 45.265 47.015  7.411   1.00 49.38 ? 17   DT  P "O3'" 1 
ATOM   72   C  "C2'" . DT  A 1 17  ? 46.323 45.148  8.572   1.00 50.65 ? 17   DT  P "C2'" 1 
ATOM   73   C  "C1'" . DT  A 1 17  ? 47.780 45.575  8.684   1.00 50.82 ? 17   DT  P "C1'" 1 
ATOM   74   N  N1    . DT  A 1 17  ? 48.612 44.635  9.473   1.00 50.37 ? 17   DT  P N1    1 
ATOM   75   C  C2    . DT  A 1 17  ? 49.874 44.329  9.015   1.00 48.86 ? 17   DT  P C2    1 
ATOM   76   O  O2    . DT  A 1 17  ? 50.356 44.817  8.005   1.00 47.97 ? 17   DT  P O2    1 
ATOM   77   N  N3    . DT  A 1 17  ? 50.558 43.424  9.790   1.00 49.77 ? 17   DT  P N3    1 
ATOM   78   C  C4    . DT  A 1 17  ? 50.121 42.813  10.950  1.00 50.07 ? 17   DT  P C4    1 
ATOM   79   O  O4    . DT  A 1 17  ? 50.851 42.014  11.531  1.00 51.11 ? 17   DT  P O4    1 
ATOM   80   C  C5    . DT  A 1 17  ? 48.791 43.193  11.383  1.00 50.50 ? 17   DT  P C5    1 
ATOM   81   C  C7    . DT  A 1 17  ? 48.225 42.591  12.631  1.00 50.06 ? 17   DT  P C7    1 
ATOM   82   C  C6    . DT  A 1 17  ? 48.119 44.075  10.636  1.00 49.92 ? 17   DT  P C6    1 
ATOM   83   P  P     . DG  A 1 18  ? 44.313 46.228  6.386   1.00 50.51 ? 18   DG  P P     1 
ATOM   84   O  OP1   . DG  A 1 18  ? 43.445 47.223  5.705   1.00 51.15 ? 18   DG  P OP1   1 
ATOM   85   O  OP2   . DG  A 1 18  ? 43.693 45.081  7.099   1.00 47.38 ? 18   DG  P OP2   1 
ATOM   86   O  "O5'" . DG  A 1 18  ? 45.340 45.657  5.312   1.00 47.72 ? 18   DG  P "O5'" 1 
ATOM   87   C  "C5'" . DG  A 1 18  ? 46.164 46.547  4.554   1.00 46.15 ? 18   DG  P "C5'" 1 
ATOM   88   C  "C4'" . DG  A 1 18  ? 47.073 45.764  3.635   1.00 46.31 ? 18   DG  P "C4'" 1 
ATOM   89   O  "O4'" . DG  A 1 18  ? 47.986 44.958  4.418   1.00 44.52 ? 18   DG  P "O4'" 1 
ATOM   90   C  "C3'" . DG  A 1 18  ? 46.349 44.788  2.709   1.00 46.19 ? 18   DG  P "C3'" 1 
ATOM   91   O  "O3'" . DG  A 1 18  ? 47.098 44.676  1.498   1.00 48.75 ? 18   DG  P "O3'" 1 
ATOM   92   C  "C2'" . DG  A 1 18  ? 46.405 43.485  3.483   1.00 44.39 ? 18   DG  P "C2'" 1 
ATOM   93   C  "C1'" . DG  A 1 18  ? 47.775 43.584  4.130   1.00 45.33 ? 18   DG  P "C1'" 1 
ATOM   94   N  N9    . DG  A 1 18  ? 47.961 42.829  5.364   1.00 44.97 ? 18   DG  P N9    1 
ATOM   95   C  C8    . DG  A 1 18  ? 47.112 42.743  6.441   1.00 45.53 ? 18   DG  P C8    1 
ATOM   96   N  N7    . DG  A 1 18  ? 47.570 41.975  7.392   1.00 47.54 ? 18   DG  P N7    1 
ATOM   97   C  C5    . DG  A 1 18  ? 48.796 41.529  6.914   1.00 46.12 ? 18   DG  P C5    1 
ATOM   98   C  C6    . DG  A 1 18  ? 49.748 40.656  7.496   1.00 46.11 ? 18   DG  P C6    1 
ATOM   99   O  O6    . DG  A 1 18  ? 49.707 40.095  8.597   1.00 44.89 ? 18   DG  P O6    1 
ATOM   100  N  N1    . DG  A 1 18  ? 50.840 40.458  6.655   1.00 46.97 ? 18   DG  P N1    1 
ATOM   101  C  C2    . DG  A 1 18  ? 50.996 41.029  5.413   1.00 46.33 ? 18   DG  P C2    1 
ATOM   102  N  N2    . DG  A 1 18  ? 52.114 40.708  4.739   1.00 44.70 ? 18   DG  P N2    1 
ATOM   103  N  N3    . DG  A 1 18  ? 50.120 41.849  4.867   1.00 44.86 ? 18   DG  P N3    1 
ATOM   104  C  C4    . DG  A 1 18  ? 49.051 42.050  5.666   1.00 46.34 ? 18   DG  P C4    1 
ATOM   105  P  P     . DC  A 1 19  ? 46.376 44.197  0.145   1.00 51.69 ? 19   DC  P P     1 
ATOM   106  O  OP1   . DC  A 1 19  ? 46.017 45.424  -0.617  1.00 52.20 ? 19   DC  P OP1   1 
ATOM   107  O  OP2   . DC  A 1 19  ? 45.311 43.211  0.505   1.00 47.47 ? 19   DC  P OP2   1 
ATOM   108  O  "O5'" . DC  A 1 19  ? 47.537 43.450  -0.655  1.00 50.31 ? 19   DC  P "O5'" 1 
ATOM   109  C  "C5'" . DC  A 1 19  ? 48.578 42.774  0.053   1.00 49.99 ? 19   DC  P "C5'" 1 
ATOM   110  C  "C4'" . DC  A 1 19  ? 48.899 41.450  -0.600  1.00 48.10 ? 19   DC  P "C4'" 1 
ATOM   111  O  "O4'" . DC  A 1 19  ? 49.550 40.656  0.425   1.00 46.94 ? 19   DC  P "O4'" 1 
ATOM   112  C  "C3'" . DC  A 1 19  ? 47.657 40.664  -1.027  1.00 47.43 ? 19   DC  P "C3'" 1 
ATOM   113  O  "O3'" . DC  A 1 19  ? 47.821 39.955  -2.250  1.00 44.61 ? 19   DC  P "O3'" 1 
ATOM   114  C  "C2'" . DC  A 1 19  ? 47.433 39.668  0.085   1.00 48.32 ? 19   DC  P "C2'" 1 
ATOM   115  C  "C1'" . DC  A 1 19  ? 48.791 39.499  0.735   1.00 48.05 ? 19   DC  P "C1'" 1 
ATOM   116  N  N1    . DC  A 1 19  ? 48.614 39.427  2.197   1.00 49.01 ? 19   DC  P N1    1 
ATOM   117  C  C2    . DC  A 1 19  ? 49.370 38.514  2.936   1.00 48.39 ? 19   DC  P C2    1 
ATOM   118  O  O2    . DC  A 1 19  ? 50.284 37.895  2.376   1.00 48.43 ? 19   DC  P O2    1 
ATOM   119  N  N3    . DC  A 1 19  ? 49.082 38.336  4.249   1.00 49.14 ? 19   DC  P N3    1 
ATOM   120  C  C4    . DC  A 1 19  ? 48.103 39.047  4.820   1.00 49.81 ? 19   DC  P C4    1 
ATOM   121  N  N4    . DC  A 1 19  ? 47.801 38.798  6.093   1.00 48.42 ? 19   DC  P N4    1 
ATOM   122  C  C5    . DC  A 1 19  ? 47.377 40.038  4.105   1.00 49.39 ? 19   DC  P C5    1 
ATOM   123  C  C6    . DC  A 1 19  ? 47.668 40.202  2.816   1.00 47.75 ? 19   DC  P C6    1 
ATOM   124  P  P     . DC  A 1 20  ? 46.603 39.069  -2.816  1.00 42.25 ? 20   DC  P P     1 
ATOM   125  O  OP1   . DC  A 1 20  ? 46.462 39.352  -4.271  1.00 44.51 ? 20   DC  P OP1   1 
ATOM   126  O  OP2   . DC  A 1 20  ? 45.429 39.242  -1.923  1.00 45.02 ? 20   DC  P OP2   1 
ATOM   127  O  "O5'" . DC  A 1 20  ? 47.107 37.571  -2.628  1.00 42.04 ? 20   DC  P "O5'" 1 
ATOM   128  C  "C5'" . DC  A 1 20  ? 48.345 37.144  -3.192  1.00 40.79 ? 20   DC  P "C5'" 1 
ATOM   129  C  "C4'" . DC  A 1 20  ? 48.823 35.882  -2.514  1.00 39.40 ? 20   DC  P "C4'" 1 
ATOM   130  O  "O4'" . DC  A 1 20  ? 49.105 36.167  -1.124  1.00 38.60 ? 20   DC  P "O4'" 1 
ATOM   131  C  "C3'" . DC  A 1 20  ? 47.824 34.734  -2.484  1.00 40.36 ? 20   DC  P "C3'" 1 
ATOM   132  O  "O3'" . DC  A 1 20  ? 47.946 33.982  -3.689  1.00 40.55 ? 20   DC  P "O3'" 1 
ATOM   133  C  "C2'" . DC  A 1 20  ? 48.271 33.932  -1.266  1.00 39.19 ? 20   DC  P "C2'" 1 
ATOM   134  C  "C1'" . DC  A 1 20  ? 48.805 35.027  -0.339  1.00 40.62 ? 20   DC  P "C1'" 1 
ATOM   135  N  N1    . DC  A 1 20  ? 47.899 35.435  0.753   1.00 42.48 ? 20   DC  P N1    1 
ATOM   136  C  C2    . DC  A 1 20  ? 47.979 34.765  1.981   1.00 43.58 ? 20   DC  P C2    1 
ATOM   137  O  O2    . DC  A 1 20  ? 48.760 33.807  2.092   1.00 43.43 ? 20   DC  P O2    1 
ATOM   138  N  N3    . DC  A 1 20  ? 47.201 35.179  3.014   1.00 43.21 ? 20   DC  P N3    1 
ATOM   139  C  C4    . DC  A 1 20  ? 46.363 36.207  2.848   1.00 44.07 ? 20   DC  P C4    1 
ATOM   140  N  N4    . DC  A 1 20  ? 45.638 36.606  3.897   1.00 45.08 ? 20   DC  P N4    1 
ATOM   141  C  C5    . DC  A 1 20  ? 46.235 36.881  1.598   1.00 44.24 ? 20   DC  P C5    1 
ATOM   142  C  C6    . DC  A 1 20  ? 47.013 36.465  0.587   1.00 44.02 ? 20   DC  P C6    1 
ATOM   143  P  P     . DT  A 1 21  ? 46.640 33.336  -4.369  1.00 44.66 ? 21   DT  P P     1 
ATOM   144  O  OP1   . DT  A 1 21  ? 47.023 32.866  -5.729  1.00 45.52 ? 21   DT  P OP1   1 
ATOM   145  O  OP2   . DT  A 1 21  ? 45.499 34.275  -4.212  1.00 44.18 ? 21   DT  P OP2   1 
ATOM   146  O  "O5'" . DT  A 1 21  ? 46.338 32.060  -3.470  1.00 44.75 ? 21   DT  P "O5'" 1 
ATOM   147  C  "C5'" . DT  A 1 21  ? 47.187 30.920  -3.517  1.00 47.14 ? 21   DT  P "C5'" 1 
ATOM   148  C  "C4'" . DT  A 1 21  ? 46.863 29.991  -2.378  1.00 48.97 ? 21   DT  P "C4'" 1 
ATOM   149  O  "O4'" . DT  A 1 21  ? 47.162 30.663  -1.129  1.00 49.27 ? 21   DT  P "O4'" 1 
ATOM   150  C  "C3'" . DT  A 1 21  ? 45.397 29.606  -2.261  1.00 51.40 ? 21   DT  P "C3'" 1 
ATOM   151  O  "O3'" . DT  A 1 21  ? 45.107 28.499  -3.115  1.00 55.42 ? 21   DT  P "O3'" 1 
ATOM   152  C  "C2'" . DT  A 1 21  ? 45.280 29.243  -0.784  1.00 50.32 ? 21   DT  P "C2'" 1 
ATOM   153  C  "C1'" . DT  A 1 21  ? 46.236 30.252  -0.136  1.00 50.01 ? 21   DT  P "C1'" 1 
ATOM   154  N  N1    . DT  A 1 21  ? 45.580 31.459  0.430   1.00 48.43 ? 21   DT  P N1    1 
ATOM   155  C  C2    . DT  A 1 21  ? 45.573 31.607  1.803   1.00 47.55 ? 21   DT  P C2    1 
ATOM   156  O  O2    . DT  A 1 21  ? 46.054 30.786  2.569   1.00 48.44 ? 21   DT  P O2    1 
ATOM   157  N  N3    . DT  A 1 21  ? 44.973 32.757  2.251   1.00 47.90 ? 21   DT  P N3    1 
ATOM   158  C  C4    . DT  A 1 21  ? 44.380 33.748  1.487   1.00 49.50 ? 21   DT  P C4    1 
ATOM   159  O  O4    . DT  A 1 21  ? 43.884 34.731  2.037   1.00 50.37 ? 21   DT  P O4    1 
ATOM   160  C  C5    . DT  A 1 21  ? 44.402 33.518  0.056   1.00 48.62 ? 21   DT  P C5    1 
ATOM   161  C  C7    . DT  A 1 21  ? 43.758 34.518  -0.852  1.00 47.42 ? 21   DT  P C7    1 
ATOM   162  C  C6    . DT  A 1 21  ? 44.999 32.405  -0.392  1.00 48.31 ? 21   DT  P C6    1 
HETATM 163  P  P     . 2DA A 1 22  ? 44.135 28.691  -4.389  1.00 60.15 ? 22   2DA P P     1 
HETATM 164  O  OP1   . 2DA A 1 22  ? 44.493 27.649  -5.389  1.00 60.29 ? 22   2DA P OP1   1 
HETATM 165  O  OP2   . 2DA A 1 22  ? 44.158 30.125  -4.791  1.00 59.01 ? 22   2DA P OP2   1 
HETATM 166  O  "O5'" . 2DA A 1 22  ? 42.679 28.346  -3.833  1.00 60.78 ? 22   2DA P "O5'" 1 
HETATM 167  C  "C5'" . 2DA A 1 22  ? 41.849 29.355  -3.263  1.00 62.19 ? 22   2DA P "C5'" 1 
HETATM 168  C  "C4'" . 2DA A 1 22  ? 40.531 28.764  -2.820  1.00 63.94 ? 22   2DA P "C4'" 1 
HETATM 169  O  "O4'" . 2DA A 1 22  ? 40.782 27.631  -1.944  1.00 64.41 ? 22   2DA P "O4'" 1 
HETATM 170  C  "C3'" . 2DA A 1 22  ? 39.658 29.705  -2.005  1.00 64.68 ? 22   2DA P "C3'" 1 
HETATM 171  C  "C2'" . 2DA A 1 22  ? 38.830 28.741  -1.165  1.00 64.60 ? 22   2DA P "C2'" 1 
HETATM 172  C  "C1'" . 2DA A 1 22  ? 39.838 27.623  -0.889  1.00 63.63 ? 22   2DA P "C1'" 1 
HETATM 173  C  C4R   . TTD B 2 4   ? 41.590 37.170  4.304   1.00 77.04 ? 5    TTD T C4R   1 
HETATM 174  O  "O4'" . TTD B 2 4   ? 41.398 35.980  3.550   1.00 77.64 ? 5    TTD T "O4'" 1 
HETATM 175  C  C3R   . TTD B 2 4   ? 41.565 36.807  5.791   1.00 77.12 ? 5    TTD T C3R   1 
HETATM 176  O  O3R   . TTD B 2 4   ? 40.373 37.608  6.153   1.00 78.08 ? 5    TTD T O3R   1 
HETATM 177  C  "C2'" . TTD B 2 4   ? 41.400 35.263  5.643   1.00 76.78 ? 5    TTD T "C2'" 1 
HETATM 178  C  "C1'" . TTD B 2 4   ? 40.549 35.179  4.408   1.00 75.83 ? 5    TTD T "C1'" 1 
HETATM 179  N  N1    . TTD B 2 4   ? 40.419 33.988  3.488   1.00 74.37 ? 5    TTD T N1    1 
HETATM 180  C  C2    . TTD B 2 4   ? 39.500 34.372  2.466   1.00 74.14 ? 5    TTD T C2    1 
HETATM 181  O  O2    . TTD B 2 4   ? 38.958 35.479  2.431   1.00 75.44 ? 5    TTD T O2    1 
HETATM 182  N  N3    . TTD B 2 4   ? 39.225 33.505  1.527   1.00 73.99 ? 5    TTD T N3    1 
HETATM 183  C  C4    . TTD B 2 4   ? 39.715 32.260  1.391   1.00 74.23 ? 5    TTD T C4    1 
HETATM 184  O  O4    . TTD B 2 4   ? 39.325 31.611  0.432   1.00 75.45 ? 5    TTD T O4    1 
HETATM 185  C  C5    . TTD B 2 4   ? 40.684 31.781  2.416   1.00 73.86 ? 5    TTD T C5    1 
HETATM 186  C  C5A   . TTD B 2 4   ? 41.926 31.528  1.425   1.00 73.17 ? 5    TTD T C5A   1 
HETATM 187  C  C6    . TTD B 2 4   ? 41.036 32.659  3.487   1.00 73.58 ? 5    TTD T C6    1 
HETATM 188  P  PB    . TTD B 2 4   ? 39.506 38.007  7.474   1.00 80.52 ? 5    TTD T PB    1 
HETATM 189  O  O5P   . TTD B 2 4   ? 39.939 37.830  8.855   1.00 80.33 ? 5    TTD T O5P   1 
HETATM 190  O  O4P   . TTD B 2 4   ? 38.105 38.179  6.909   1.00 79.82 ? 5    TTD T O4P   1 
HETATM 191  O  O5R   . TTD B 2 4   ? 39.019 36.471  7.718   1.00 77.16 ? 5    TTD T O5R   1 
HETATM 192  C  C5R   . TTD B 2 4   ? 39.828 35.468  8.390   1.00 74.40 ? 5    TTD T C5R   1 
HETATM 193  O  O4R   . TTD B 2 4   ? 39.195 33.789  6.764   1.00 72.60 ? 5    TTD T O4R   1 
HETATM 194  C  C2R   . TTD B 2 4   ? 40.629 32.221  7.696   1.00 71.68 ? 5    TTD T C2R   1 
HETATM 195  C  C1R   . TTD B 2 4   ? 39.422 32.438  6.824   1.00 71.98 ? 5    TTD T C1R   1 
HETATM 196  N  N1T   . TTD B 2 4   ? 39.568 31.645  5.531   1.00 72.68 ? 5    TTD T N1T   1 
HETATM 197  C  C2T   . TTD B 2 4   ? 38.406 30.948  5.258   1.00 72.39 ? 5    TTD T C2T   1 
HETATM 198  O  O2T   . TTD B 2 4   ? 37.411 30.992  5.952   1.00 73.12 ? 5    TTD T O2T   1 
HETATM 199  N  N3T   . TTD B 2 4   ? 38.383 30.167  4.158   1.00 72.65 ? 5    TTD T N3T   1 
HETATM 200  C  C4T   . TTD B 2 4   ? 39.419 29.977  3.261   1.00 73.32 ? 5    TTD T C4T   1 
HETATM 201  O  O4T   . TTD B 2 4   ? 39.148 29.207  2.347   1.00 73.98 ? 5    TTD T O4T   1 
HETATM 202  C  C5T   . TTD B 2 4   ? 40.691 30.725  3.556   1.00 73.36 ? 5    TTD T C5T   1 
HETATM 203  C  C5M   . TTD B 2 4   ? 41.882 29.681  3.419   1.00 73.53 ? 5    TTD T C5M   1 
HETATM 204  C  C6T   . TTD B 2 4   ? 40.709 31.514  4.618   1.00 73.29 ? 5    TTD T C6T   1 
HETATM 205  C  "C4'" . TTD B 2 4   ? 39.246 34.081  8.168   1.00 72.87 ? 5    TTD T "C4'" 1 
HETATM 206  C  "C3'" . TTD B 2 4   ? 40.196 33.087  8.837   1.00 71.67 ? 5    TTD T "C3'" 1 
HETATM 207  O  "O3'" . TTD B 2 4   ? 39.570 32.332  9.886   1.00 71.44 ? 5    TTD T "O3'" 1 
ATOM   208  P  P     . DA  B 2 5   ? 40.049 32.536  11.415  1.00 72.40 ? 6    DA  T P     1 
ATOM   209  O  OP1   . DA  B 2 5   ? 39.095 31.775  12.267  1.00 72.40 ? 6    DA  T OP1   1 
ATOM   210  O  OP2   . DA  B 2 5   ? 40.235 33.994  11.649  1.00 72.63 ? 6    DA  T OP2   1 
ATOM   211  O  "O5'" . DA  B 2 5   ? 41.486 31.839  11.504  1.00 70.69 ? 6    DA  T "O5'" 1 
ATOM   212  C  "C5'" . DA  B 2 5   ? 41.658 30.575  12.158  1.00 69.92 ? 6    DA  T "C5'" 1 
ATOM   213  C  "C4'" . DA  B 2 5   ? 42.766 29.783  11.498  1.00 69.17 ? 6    DA  T "C4'" 1 
ATOM   214  O  "O4'" . DA  B 2 5   ? 42.618 29.931  10.063  1.00 69.11 ? 6    DA  T "O4'" 1 
ATOM   215  C  "C3'" . DA  B 2 5   ? 44.198 30.212  11.804  1.00 69.14 ? 6    DA  T "C3'" 1 
ATOM   216  O  "O3'" . DA  B 2 5   ? 44.682 29.466  12.925  1.00 70.67 ? 6    DA  T "O3'" 1 
ATOM   217  C  "C2'" . DA  B 2 5   ? 44.940 29.797  10.539  1.00 68.46 ? 6    DA  T "C2'" 1 
ATOM   218  C  "C1'" . DA  B 2 5   ? 43.890 30.045  9.457   1.00 67.78 ? 6    DA  T "C1'" 1 
ATOM   219  N  N9    . DA  B 2 5   ? 43.976 31.362  8.823   1.00 66.98 ? 6    DA  T N9    1 
ATOM   220  C  C8    . DA  B 2 5   ? 43.789 32.602  9.388   1.00 65.33 ? 6    DA  T C8    1 
ATOM   221  N  N7    . DA  B 2 5   ? 43.909 33.593  8.538   1.00 64.86 ? 6    DA  T N7    1 
ATOM   222  C  C5    . DA  B 2 5   ? 44.204 32.965  7.334   1.00 64.80 ? 6    DA  T C5    1 
ATOM   223  C  C6    . DA  B 2 5   ? 44.445 33.462  6.042   1.00 64.50 ? 6    DA  T C6    1 
ATOM   224  N  N6    . DA  B 2 5   ? 44.425 34.759  5.732   1.00 62.84 ? 6    DA  T N6    1 
ATOM   225  N  N1    . DA  B 2 5   ? 44.712 32.570  5.066   1.00 63.88 ? 6    DA  T N1    1 
ATOM   226  C  C2    . DA  B 2 5   ? 44.732 31.269  5.376   1.00 64.49 ? 6    DA  T C2    1 
ATOM   227  N  N3    . DA  B 2 5   ? 44.520 30.679  6.549   1.00 65.01 ? 6    DA  T N3    1 
ATOM   228  C  C4    . DA  B 2 5   ? 44.257 31.594  7.497   1.00 65.02 ? 6    DA  T C4    1 
ATOM   229  P  P     . DG  B 2 6   ? 46.068 29.879  13.647  1.00 73.13 ? 7    DG  T P     1 
ATOM   230  O  OP1   . DG  B 2 6   ? 46.350 28.838  14.673  1.00 72.00 ? 7    DG  T OP1   1 
ATOM   231  O  OP2   . DG  B 2 6   ? 45.995 31.308  14.054  1.00 71.69 ? 7    DG  T OP2   1 
ATOM   232  O  "O5'" . DG  B 2 6   ? 47.183 29.730  12.515  1.00 70.84 ? 7    DG  T "O5'" 1 
ATOM   233  C  "C5'" . DG  B 2 6   ? 47.504 28.452  11.966  1.00 67.99 ? 7    DG  T "C5'" 1 
ATOM   234  C  "C4'" . DG  B 2 6   ? 48.319 28.610  10.701  1.00 66.78 ? 7    DG  T "C4'" 1 
ATOM   235  O  "O4'" . DG  B 2 6   ? 47.606 29.461  9.774   1.00 66.62 ? 7    DG  T "O4'" 1 
ATOM   236  C  "C3'" . DG  B 2 6   ? 49.685 29.264  10.846  1.00 65.99 ? 7    DG  T "C3'" 1 
ATOM   237  O  "O3'" . DG  B 2 6   ? 50.619 28.227  11.148  1.00 65.82 ? 7    DG  T "O3'" 1 
ATOM   238  C  "C2'" . DG  B 2 6   ? 49.944 29.837  9.450   1.00 65.52 ? 7    DG  T "C2'" 1 
ATOM   239  C  "C1'" . DG  B 2 6   ? 48.530 30.107  8.928   1.00 64.35 ? 7    DG  T "C1'" 1 
ATOM   240  N  N9    . DG  B 2 6   ? 48.140 31.506  8.760   1.00 63.03 ? 7    DG  T N9    1 
ATOM   241  C  C8    . DG  B 2 6   ? 47.696 32.395  9.716   1.00 61.17 ? 7    DG  T C8    1 
ATOM   242  N  N7    . DG  B 2 6   ? 47.371 33.560  9.219   1.00 60.32 ? 7    DG  T N7    1 
ATOM   243  C  C5    . DG  B 2 6   ? 47.624 33.435  7.857   1.00 61.30 ? 7    DG  T C5    1 
ATOM   244  C  C6    . DG  B 2 6   ? 47.449 34.364  6.786   1.00 61.06 ? 7    DG  T C6    1 
ATOM   245  O  O6    . DG  B 2 6   ? 46.994 35.514  6.825   1.00 61.06 ? 7    DG  T O6    1 
ATOM   246  N  N1    . DG  B 2 6   ? 47.857 33.825  5.569   1.00 59.11 ? 7    DG  T N1    1 
ATOM   247  C  C2    . DG  B 2 6   ? 48.351 32.559  5.394   1.00 58.84 ? 7    DG  T C2    1 
ATOM   248  N  N2    . DG  B 2 6   ? 48.702 32.226  4.151   1.00 58.20 ? 7    DG  T N2    1 
ATOM   249  N  N3    . DG  B 2 6   ? 48.497 31.681  6.369   1.00 60.91 ? 7    DG  T N3    1 
ATOM   250  C  C4    . DG  B 2 6   ? 48.119 32.182  7.564   1.00 61.71 ? 7    DG  T C4    1 
ATOM   251  P  P     . DG  B 2 7   ? 52.161 28.582  11.432  1.00 66.43 ? 8    DG  T P     1 
ATOM   252  O  OP1   . DG  B 2 7   ? 52.883 27.289  11.555  1.00 66.73 ? 8    DG  T OP1   1 
ATOM   253  O  OP2   . DG  B 2 7   ? 52.248 29.583  12.535  1.00 65.26 ? 8    DG  T OP2   1 
ATOM   254  O  "O5'" . DG  B 2 7   ? 52.655 29.283  10.092  1.00 62.71 ? 8    DG  T "O5'" 1 
ATOM   255  C  "C5'" . DG  B 2 7   ? 53.525 30.400  10.159  1.00 56.15 ? 8    DG  T "C5'" 1 
ATOM   256  C  "C4'" . DG  B 2 7   ? 53.998 30.797  8.783   1.00 51.73 ? 8    DG  T "C4'" 1 
ATOM   257  O  "O4'" . DG  B 2 7   ? 52.886 31.353  8.028   1.00 50.55 ? 8    DG  T "O4'" 1 
ATOM   258  C  "C3'" . DG  B 2 7   ? 55.034 31.912  8.903   1.00 49.55 ? 8    DG  T "C3'" 1 
ATOM   259  O  "O3'" . DG  B 2 7   ? 56.187 31.722  8.104   1.00 42.75 ? 8    DG  T "O3'" 1 
ATOM   260  C  "C2'" . DG  B 2 7   ? 54.317 33.160  8.451   1.00 49.86 ? 8    DG  T "C2'" 1 
ATOM   261  C  "C1'" . DG  B 2 7   ? 53.227 32.646  7.541   1.00 50.77 ? 8    DG  T "C1'" 1 
ATOM   262  N  N9    . DG  B 2 7   ? 52.079 33.535  7.688   1.00 51.78 ? 8    DG  T N9    1 
ATOM   263  C  C8    . DG  B 2 7   ? 51.369 33.782  8.841   1.00 51.21 ? 8    DG  T C8    1 
ATOM   264  N  N7    . DG  B 2 7   ? 50.513 34.756  8.714   1.00 51.56 ? 8    DG  T N7    1 
ATOM   265  C  C5    . DG  B 2 7   ? 50.634 35.148  7.389   1.00 51.69 ? 8    DG  T C5    1 
ATOM   266  C  C6    . DG  B 2 7   ? 49.971 36.171  6.679   1.00 51.33 ? 8    DG  T C6    1 
ATOM   267  O  O6    . DG  B 2 7   ? 49.139 36.976  7.101   1.00 52.50 ? 8    DG  T O6    1 
ATOM   268  N  N1    . DG  B 2 7   ? 50.372 36.216  5.348   1.00 49.44 ? 8    DG  T N1    1 
ATOM   269  C  C2    . DG  B 2 7   ? 51.303 35.389  4.777   1.00 49.73 ? 8    DG  T C2    1 
ATOM   270  N  N2    . DG  B 2 7   ? 51.540 35.584  3.470   1.00 48.49 ? 8    DG  T N2    1 
ATOM   271  N  N3    . DG  B 2 7   ? 51.949 34.438  5.436   1.00 50.17 ? 8    DG  T N3    1 
ATOM   272  C  C4    . DG  B 2 7   ? 51.566 34.375  6.730   1.00 50.54 ? 8    DG  T C4    1 
ATOM   273  P  P     . DC  B 2 8   ? 57.408 32.745  8.272   1.00 40.96 ? 9    DC  T P     1 
ATOM   274  O  OP1   . DC  B 2 8   ? 58.669 32.052  7.897   1.00 41.90 ? 9    DC  T OP1   1 
ATOM   275  O  OP2   . DC  B 2 8   ? 57.293 33.387  9.604   1.00 37.82 ? 9    DC  T OP2   1 
ATOM   276  O  "O5'" . DC  B 2 8   ? 57.099 33.869  7.188   1.00 37.19 ? 9    DC  T "O5'" 1 
ATOM   277  C  "C5'" . DC  B 2 8   ? 57.106 33.550  5.804   1.00 34.56 ? 9    DC  T "C5'" 1 
ATOM   278  C  "C4'" . DC  B 2 8   ? 57.129 34.811  4.976   1.00 30.79 ? 9    DC  T "C4'" 1 
ATOM   279  O  "O4'" . DC  B 2 8   ? 55.859 35.492  5.097   1.00 31.92 ? 9    DC  T "O4'" 1 
ATOM   280  C  "C3'" . DC  B 2 8   ? 58.205 35.828  5.351   1.00 30.77 ? 9    DC  T "C3'" 1 
ATOM   281  O  "O3'" . DC  B 2 8   ? 58.770 36.346  4.144   1.00 28.73 ? 9    DC  T "O3'" 1 
ATOM   282  C  "C2'" . DC  B 2 8   ? 57.442 36.881  6.144   1.00 30.31 ? 9    DC  T "C2'" 1 
ATOM   283  C  "C1'" . DC  B 2 8   ? 56.041 36.822  5.550   1.00 30.55 ? 9    DC  T "C1'" 1 
ATOM   284  N  N1    . DC  B 2 8   ? 54.932 37.128  6.479   1.00 34.93 ? 9    DC  T N1    1 
ATOM   285  C  C2    . DC  B 2 8   ? 53.956 38.078  6.101   1.00 34.97 ? 9    DC  T C2    1 
ATOM   286  O  O2    . DC  B 2 8   ? 54.055 38.651  5.008   1.00 35.03 ? 9    DC  T O2    1 
ATOM   287  N  N3    . DC  B 2 8   ? 52.932 38.341  6.942   1.00 36.95 ? 9    DC  T N3    1 
ATOM   288  C  C4    . DC  B 2 8   ? 52.852 37.708  8.115   1.00 37.51 ? 9    DC  T C4    1 
ATOM   289  N  N4    . DC  B 2 8   ? 51.819 37.994  8.908   1.00 37.58 ? 9    DC  T N4    1 
ATOM   290  C  C5    . DC  B 2 8   ? 53.826 36.750  8.526   1.00 36.40 ? 9    DC  T C5    1 
ATOM   291  C  C6    . DC  B 2 8   ? 54.837 36.493  7.689   1.00 34.85 ? 9    DC  T C6    1 
ATOM   292  P  P     . DA  B 2 9   ? 60.037 37.330  4.195   1.00 30.09 ? 10   DA  T P     1 
ATOM   293  O  OP1   . DA  B 2 9   ? 60.662 37.263  2.857   1.00 28.29 ? 10   DA  T OP1   1 
ATOM   294  O  OP2   . DA  B 2 9   ? 60.867 37.109  5.401   1.00 30.79 ? 10   DA  T OP2   1 
ATOM   295  O  "O5'" . DA  B 2 9   ? 59.338 38.751  4.314   1.00 32.31 ? 10   DA  T "O5'" 1 
ATOM   296  C  "C5'" . DA  B 2 9   ? 58.419 39.155  3.309   1.00 34.79 ? 10   DA  T "C5'" 1 
ATOM   297  C  "C4'" . DA  B 2 9   ? 57.859 40.519  3.618   1.00 36.74 ? 10   DA  T "C4'" 1 
ATOM   298  O  "O4'" . DA  B 2 9   ? 56.776 40.439  4.576   1.00 39.22 ? 10   DA  T "O4'" 1 
ATOM   299  C  "C3'" . DA  B 2 9   ? 58.868 41.523  4.172   1.00 38.60 ? 10   DA  T "C3'" 1 
ATOM   300  O  "O3'" . DA  B 2 9   ? 58.802 42.681  3.359   1.00 37.15 ? 10   DA  T "O3'" 1 
ATOM   301  C  "C2'" . DA  B 2 9   ? 58.380 41.783  5.592   1.00 38.83 ? 10   DA  T "C2'" 1 
ATOM   302  C  "C1'" . DA  B 2 9   ? 56.888 41.508  5.489   1.00 39.97 ? 10   DA  T "C1'" 1 
ATOM   303  N  N9    . DA  B 2 9   ? 56.221 41.105  6.730   1.00 42.43 ? 10   DA  T N9    1 
ATOM   304  C  C8    . DA  B 2 9   ? 56.652 40.202  7.672   1.00 41.57 ? 10   DA  T C8    1 
ATOM   305  N  N7    . DA  B 2 9   ? 55.829 40.054  8.680   1.00 43.71 ? 10   DA  T N7    1 
ATOM   306  C  C5    . DA  B 2 9   ? 54.780 40.917  8.386   1.00 44.63 ? 10   DA  T C5    1 
ATOM   307  C  C6    . DA  B 2 9   ? 53.582 41.228  9.069   1.00 44.98 ? 10   DA  T C6    1 
ATOM   308  N  N6    . DA  B 2 9   ? 53.220 40.675  10.230  1.00 45.20 ? 10   DA  T N6    1 
ATOM   309  N  N1    . DA  B 2 9   ? 52.757 42.137  8.506   1.00 44.36 ? 10   DA  T N1    1 
ATOM   310  C  C2    . DA  B 2 9   ? 53.113 42.687  7.336   1.00 43.92 ? 10   DA  T C2    1 
ATOM   311  N  N3    . DA  B 2 9   ? 54.203 42.475  6.600   1.00 42.86 ? 10   DA  T N3    1 
ATOM   312  C  C4    . DA  B 2 9   ? 55.007 41.570  7.187   1.00 42.99 ? 10   DA  T C4    1 
ATOM   313  P  P     . DC  B 2 10  ? 59.853 43.871  3.551   1.00 36.60 ? 11   DC  T P     1 
ATOM   314  O  OP1   . DC  B 2 10  ? 60.522 44.075  2.239   1.00 38.45 ? 11   DC  T OP1   1 
ATOM   315  O  OP2   . DC  B 2 10  ? 60.676 43.668  4.767   1.00 36.23 ? 11   DC  T OP2   1 
ATOM   316  O  "O5'" . DC  B 2 10  ? 58.859 45.088  3.774   1.00 38.81 ? 11   DC  T "O5'" 1 
ATOM   317  C  "C5'" . DC  B 2 10  ? 57.685 45.192  2.965   1.00 41.83 ? 11   DC  T "C5'" 1 
ATOM   318  C  "C4'" . DC  B 2 10  ? 56.776 46.270  3.495   1.00 44.63 ? 11   DC  T "C4'" 1 
ATOM   319  O  "O4'" . DC  B 2 10  ? 55.959 45.773  4.584   1.00 45.10 ? 11   DC  T "O4'" 1 
ATOM   320  C  "C3'" . DC  B 2 10  ? 57.551 47.469  4.030   1.00 46.68 ? 11   DC  T "C3'" 1 
ATOM   321  O  "O3'" . DC  B 2 10  ? 57.063 48.674  3.471   1.00 50.11 ? 11   DC  T "O3'" 1 
ATOM   322  C  "C2'" . DC  B 2 10  ? 57.353 47.410  5.535   1.00 46.28 ? 11   DC  T "C2'" 1 
ATOM   323  C  "C1'" . DC  B 2 10  ? 56.049 46.643  5.700   1.00 45.86 ? 11   DC  T "C1'" 1 
ATOM   324  N  N1    . DC  B 2 10  ? 55.980 45.821  6.928   1.00 46.55 ? 11   DC  T N1    1 
ATOM   325  C  C2    . DC  B 2 10  ? 54.875 45.961  7.782   1.00 47.33 ? 11   DC  T C2    1 
ATOM   326  O  O2    . DC  B 2 10  ? 53.972 46.754  7.479   1.00 49.51 ? 11   DC  T O2    1 
ATOM   327  N  N3    . DC  B 2 10  ? 54.821 45.228  8.918   1.00 45.95 ? 11   DC  T N3    1 
ATOM   328  C  C4    . DC  B 2 10  ? 55.812 44.386  9.218   1.00 45.20 ? 11   DC  T C4    1 
ATOM   329  N  N4    . DC  B 2 10  ? 55.724 43.699  10.357  1.00 45.18 ? 11   DC  T N4    1 
ATOM   330  C  C5    . DC  B 2 10  ? 56.938 44.213  8.365   1.00 45.67 ? 11   DC  T C5    1 
ATOM   331  C  C6    . DC  B 2 10  ? 56.980 44.940  7.240   1.00 46.85 ? 11   DC  T C6    1 
ATOM   332  P  P     . DT  B 2 11  ? 58.017 49.959  3.427   1.00 52.46 ? 12   DT  T P     1 
ATOM   333  O  OP1   . DT  B 2 11  ? 57.979 50.523  2.054   1.00 50.69 ? 12   DT  T OP1   1 
ATOM   334  O  OP2   . DT  B 2 11  ? 59.323 49.596  4.036   1.00 50.23 ? 12   DT  T OP2   1 
ATOM   335  O  "O5'" . DT  B 2 11  ? 57.275 50.959  4.420   1.00 51.33 ? 12   DT  T "O5'" 1 
ATOM   336  C  "C5'" . DT  B 2 11  ? 55.887 51.242  4.251   1.00 49.66 ? 12   DT  T "C5'" 1 
ATOM   337  C  "C4'" . DT  B 2 11  ? 55.324 51.888  5.495   1.00 49.14 ? 12   DT  T "C4'" 1 
ATOM   338  O  "O4'" . DT  B 2 11  ? 55.084 50.897  6.527   1.00 49.31 ? 12   DT  T "O4'" 1 
ATOM   339  C  "C3'" . DT  B 2 11  ? 56.209 52.970  6.121   1.00 48.80 ? 12   DT  T "C3'" 1 
ATOM   340  O  "O3'" . DT  B 2 11  ? 55.422 54.121  6.436   1.00 48.86 ? 12   DT  T "O3'" 1 
ATOM   341  C  "C2'" . DT  B 2 11  ? 56.744 52.309  7.380   1.00 48.18 ? 12   DT  T "C2'" 1 
ATOM   342  C  "C1'" . DT  B 2 11  ? 55.618 51.359  7.758   1.00 49.06 ? 12   DT  T "C1'" 1 
ATOM   343  N  N1    . DT  B 2 11  ? 56.019 50.177  8.570   1.00 49.17 ? 12   DT  T N1    1 
ATOM   344  C  C2    . DT  B 2 11  ? 55.159 49.745  9.569   1.00 49.17 ? 12   DT  T C2    1 
ATOM   345  O  O2    . DT  B 2 11  ? 54.088 50.274  9.814   1.00 48.47 ? 12   DT  T O2    1 
ATOM   346  N  N3    . DT  B 2 11  ? 55.606 48.656  10.275  1.00 49.46 ? 12   DT  T N3    1 
ATOM   347  C  C4    . DT  B 2 11  ? 56.789 47.969  10.094  1.00 48.79 ? 12   DT  T C4    1 
ATOM   348  O  O4    . DT  B 2 11  ? 57.045 47.005  10.805  1.00 48.61 ? 12   DT  T O4    1 
ATOM   349  C  C5    . DT  B 2 11  ? 57.642 48.474  9.039   1.00 49.11 ? 12   DT  T C5    1 
ATOM   350  C  C7    . DT  B 2 11  ? 58.953 47.800  8.777   1.00 51.05 ? 12   DT  T C7    1 
ATOM   351  C  C6    . DT  B 2 11  ? 57.219 49.533  8.338   1.00 49.26 ? 12   DT  T C6    1 
ATOM   352  P  P     . DG  B 2 12  ? 56.103 55.401  7.138   1.00 48.83 ? 13   DG  T P     1 
ATOM   353  O  OP1   . DG  B 2 12  ? 55.613 56.608  6.421   1.00 50.02 ? 13   DG  T OP1   1 
ATOM   354  O  OP2   . DG  B 2 12  ? 57.567 55.188  7.288   1.00 47.53 ? 13   DG  T OP2   1 
ATOM   355  O  "O5'" . DG  B 2 12  ? 55.450 55.379  8.587   1.00 48.20 ? 13   DG  T "O5'" 1 
ATOM   356  C  "C5'" . DG  B 2 12  ? 54.038 55.215  8.736   1.00 48.27 ? 13   DG  T "C5'" 1 
ATOM   357  C  "C4'" . DG  B 2 12  ? 53.665 55.144  10.197  1.00 47.41 ? 13   DG  T "C4'" 1 
ATOM   358  O  "O4'" . DG  B 2 12  ? 54.128 53.895  10.766  1.00 47.43 ? 13   DG  T "O4'" 1 
ATOM   359  C  "C3'" . DG  B 2 12  ? 54.262 56.255  11.058  1.00 46.68 ? 13   DG  T "C3'" 1 
ATOM   360  O  "O3'" . DG  B 2 12  ? 53.300 56.657  12.037  1.00 46.71 ? 13   DG  T "O3'" 1 
ATOM   361  C  "C2'" . DG  B 2 12  ? 55.474 55.593  11.693  1.00 46.78 ? 13   DG  T "C2'" 1 
ATOM   362  C  "C1'" . DG  B 2 12  ? 55.026 54.144  11.837  1.00 47.61 ? 13   DG  T "C1'" 1 
ATOM   363  N  N9    . DG  B 2 12  ? 56.097 53.154  11.755  1.00 49.36 ? 13   DG  T N9    1 
ATOM   364  C  C8    . DG  B 2 12  ? 57.108 53.090  10.821  1.00 48.98 ? 13   DG  T C8    1 
ATOM   365  N  N7    . DG  B 2 12  ? 57.911 52.077  11.006  1.00 49.12 ? 13   DG  T N7    1 
ATOM   366  C  C5    . DG  B 2 12  ? 57.403 51.435  12.127  1.00 49.75 ? 13   DG  T C5    1 
ATOM   367  C  C6    . DG  B 2 12  ? 57.857 50.274  12.805  1.00 50.33 ? 13   DG  T C6    1 
ATOM   368  O  O6    . DG  B 2 12  ? 58.835 49.561  12.544  1.00 51.40 ? 13   DG  T O6    1 
ATOM   369  N  N1    . DG  B 2 12  ? 57.047 49.968  13.893  1.00 51.30 ? 13   DG  T N1    1 
ATOM   370  C  C2    . DG  B 2 12  ? 55.943 50.687  14.284  1.00 51.54 ? 13   DG  T C2    1 
ATOM   371  N  N2    . DG  B 2 12  ? 55.282 50.223  15.357  1.00 51.96 ? 13   DG  T N2    1 
ATOM   372  N  N3    . DG  B 2 12  ? 55.516 51.777  13.667  1.00 50.16 ? 13   DG  T N3    1 
ATOM   373  C  C4    . DG  B 2 12  ? 56.286 52.089  12.603  1.00 48.93 ? 13   DG  T C4    1 
ATOM   374  P  P     . DG  B 2 13  ? 53.560 57.965  12.931  1.00 46.43 ? 14   DG  T P     1 
ATOM   375  O  OP1   . DG  B 2 13  ? 52.222 58.499  13.302  1.00 45.79 ? 14   DG  T OP1   1 
ATOM   376  O  OP2   . DG  B 2 13  ? 54.546 58.850  12.257  1.00 43.29 ? 14   DG  T OP2   1 
ATOM   377  O  "O5'" . DG  B 2 13  ? 54.275 57.384  14.233  1.00 49.63 ? 14   DG  T "O5'" 1 
ATOM   378  C  "C5'" . DG  B 2 13  ? 53.519 56.789  15.291  1.00 51.79 ? 14   DG  T "C5'" 1 
ATOM   379  C  "C4'" . DG  B 2 13  ? 54.416 56.476  16.469  1.00 55.20 ? 14   DG  T "C4'" 1 
ATOM   380  O  "O4'" . DG  B 2 13  ? 55.327 55.405  16.110  1.00 54.77 ? 14   DG  T "O4'" 1 
ATOM   381  C  "C3'" . DG  B 2 13  ? 55.292 57.638  16.957  1.00 55.50 ? 14   DG  T "C3'" 1 
ATOM   382  O  "O3'" . DG  B 2 13  ? 55.341 57.675  18.393  1.00 57.07 ? 14   DG  T "O3'" 1 
ATOM   383  C  "C2'" . DG  B 2 13  ? 56.663 57.307  16.396  1.00 54.50 ? 14   DG  T "C2'" 1 
ATOM   384  C  "C1'" . DG  B 2 13  ? 56.652 55.786  16.437  1.00 56.69 ? 14   DG  T "C1'" 1 
ATOM   385  N  N9    . DG  B 2 13  ? 57.568 55.102  15.524  1.00 58.17 ? 14   DG  T N9    1 
ATOM   386  C  C8    . DG  B 2 13  ? 58.135 55.600  14.373  1.00 59.40 ? 14   DG  T C8    1 
ATOM   387  N  N7    . DG  B 2 13  ? 58.949 54.757  13.795  1.00 60.30 ? 14   DG  T N7    1 
ATOM   388  C  C5    . DG  B 2 13  ? 58.911 53.630  14.605  1.00 60.01 ? 14   DG  T C5    1 
ATOM   389  C  C6    . DG  B 2 13  ? 59.596 52.390  14.490  1.00 60.81 ? 14   DG  T C6    1 
ATOM   390  O  O6    . DG  B 2 13  ? 60.399 52.027  13.617  1.00 60.47 ? 14   DG  T O6    1 
ATOM   391  N  N1    . DG  B 2 13  ? 59.267 51.526  15.530  1.00 60.49 ? 14   DG  T N1    1 
ATOM   392  C  C2    . DG  B 2 13  ? 58.394 51.812  16.550  1.00 60.21 ? 14   DG  T C2    1 
ATOM   393  N  N2    . DG  B 2 13  ? 58.213 50.842  17.463  1.00 59.69 ? 14   DG  T N2    1 
ATOM   394  N  N3    . DG  B 2 13  ? 57.749 52.962  16.669  1.00 59.49 ? 14   DG  T N3    1 
ATOM   395  C  C4    . DG  B 2 13  ? 58.055 53.820  15.670  1.00 58.96 ? 14   DG  T C4    1 
ATOM   396  N  N     . MET C 3 1   ? 78.454 4.819   7.457   1.00 30.92 ? 1    MET A N     1 
ATOM   397  C  CA    . MET C 3 1   ? 77.819 6.156   7.565   1.00 29.06 ? 1    MET A CA    1 
ATOM   398  C  C     . MET C 3 1   ? 78.818 7.174   8.077   1.00 28.35 ? 1    MET A C     1 
ATOM   399  O  O     . MET C 3 1   ? 79.523 6.925   9.050   1.00 29.87 ? 1    MET A O     1 
ATOM   400  C  CB    . MET C 3 1   ? 76.614 6.112   8.521   1.00 29.06 ? 1    MET A CB    1 
ATOM   401  C  CG    . MET C 3 1   ? 76.051 7.503   8.847   1.00 28.26 ? 1    MET A CG    1 
ATOM   402  S  SD    . MET C 3 1   ? 74.660 7.553   10.019  1.00 30.39 ? 1    MET A SD    1 
ATOM   403  C  CE    . MET C 3 1   ? 73.262 7.320   8.912   1.00 28.11 ? 1    MET A CE    1 
ATOM   404  N  N     . ILE C 3 2   ? 78.882 8.326   7.420   1.00 27.45 ? 2    ILE A N     1 
ATOM   405  C  CA    . ILE C 3 2   ? 79.785 9.371   7.866   1.00 26.89 ? 2    ILE A CA    1 
ATOM   406  C  C     . ILE C 3 2   ? 78.993 10.650  8.091   1.00 25.87 ? 2    ILE A C     1 
ATOM   407  O  O     . ILE C 3 2   ? 77.931 10.850  7.502   1.00 26.23 ? 2    ILE A O     1 
ATOM   408  C  CB    . ILE C 3 2   ? 80.922 9.634   6.840   1.00 27.15 ? 2    ILE A CB    1 
ATOM   409  C  CG1   . ILE C 3 2   ? 80.346 10.197  5.538   1.00 26.00 ? 2    ILE A CG1   1 
ATOM   410  C  CG2   . ILE C 3 2   ? 81.688 8.331   6.567   1.00 25.77 ? 2    ILE A CG2   1 
ATOM   411  C  CD1   . ILE C 3 2   ? 81.410 10.549  4.497   1.00 26.60 ? 2    ILE A CD1   1 
ATOM   412  N  N     . VAL C 3 3   ? 79.506 11.496  8.973   1.00 24.99 ? 3    VAL A N     1 
ATOM   413  C  CA    . VAL C 3 3   ? 78.881 12.769  9.296   1.00 24.89 ? 3    VAL A CA    1 
ATOM   414  C  C     . VAL C 3 3   ? 79.897 13.799  8.833   1.00 26.52 ? 3    VAL A C     1 
ATOM   415  O  O     . VAL C 3 3   ? 81.096 13.647  9.079   1.00 26.02 ? 3    VAL A O     1 
ATOM   416  C  CB    . VAL C 3 3   ? 78.651 12.903  10.817  1.00 24.56 ? 3    VAL A CB    1 
ATOM   417  C  CG1   . VAL C 3 3   ? 77.938 14.205  11.137  1.00 20.97 ? 3    VAL A CG1   1 
ATOM   418  C  CG2   . VAL C 3 3   ? 77.852 11.710  11.314  1.00 23.34 ? 3    VAL A CG2   1 
ATOM   419  N  N     . SER C 3 4   ? 79.436 14.851  8.170   1.00 26.26 ? 4    SER A N     1 
ATOM   420  C  CA    . SER C 3 4   ? 80.384 15.825  7.668   1.00 26.02 ? 4    SER A CA    1 
ATOM   421  C  C     . SER C 3 4   ? 79.885 17.258  7.655   1.00 26.21 ? 4    SER A C     1 
ATOM   422  O  O     . SER C 3 4   ? 78.707 17.541  7.901   1.00 27.42 ? 4    SER A O     1 
ATOM   423  C  CB    . SER C 3 4   ? 80.817 15.401  6.253   1.00 25.26 ? 4    SER A CB    1 
ATOM   424  O  OG    . SER C 3 4   ? 82.024 16.027  5.858   1.00 23.40 ? 4    SER A OG    1 
ATOM   425  N  N     . ASP C 3 5   ? 80.806 18.163  7.365   1.00 25.74 ? 5    ASP A N     1 
ATOM   426  C  CA    . ASP C 3 5   ? 80.519 19.589  7.289   1.00 27.63 ? 5    ASP A CA    1 
ATOM   427  C  C     . ASP C 3 5   ? 81.727 20.274  6.649   1.00 28.13 ? 5    ASP A C     1 
ATOM   428  O  O     . ASP C 3 5   ? 82.855 19.803  6.799   1.00 26.03 ? 5    ASP A O     1 
ATOM   429  C  CB    . ASP C 3 5   ? 80.302 20.162  8.689   1.00 25.78 ? 5    ASP A CB    1 
ATOM   430  C  CG    . ASP C 3 5   ? 80.022 21.644  8.667   1.00 27.84 ? 5    ASP A CG    1 
ATOM   431  O  OD1   . ASP C 3 5   ? 79.058 22.049  7.979   1.00 28.61 ? 5    ASP A OD1   1 
ATOM   432  O  OD2   . ASP C 3 5   ? 80.767 22.409  9.333   1.00 30.75 ? 5    ASP A OD2   1 
ATOM   433  N  N     . ILE C 3 6   ? 81.493 21.379  5.945   1.00 28.72 ? 6    ILE A N     1 
ATOM   434  C  CA    . ILE C 3 6   ? 82.586 22.117  5.314   1.00 29.00 ? 6    ILE A CA    1 
ATOM   435  C  C     . ILE C 3 6   ? 82.518 23.597  5.633   1.00 30.27 ? 6    ILE A C     1 
ATOM   436  O  O     . ILE C 3 6   ? 81.471 24.122  6.013   1.00 29.59 ? 6    ILE A O     1 
ATOM   437  C  CB    . ILE C 3 6   ? 82.559 22.001  3.774   1.00 28.27 ? 6    ILE A CB    1 
ATOM   438  C  CG1   . ILE C 3 6   ? 81.480 22.926  3.195   1.00 29.82 ? 6    ILE A CG1   1 
ATOM   439  C  CG2   . ILE C 3 6   ? 82.281 20.568  3.366   1.00 29.39 ? 6    ILE A CG2   1 
ATOM   440  C  CD1   . ILE C 3 6   ? 81.379 22.887  1.672   1.00 28.41 ? 6    ILE A CD1   1 
ATOM   441  N  N     . GLU C 3 7   ? 83.656 24.266  5.485   1.00 30.72 ? 7    GLU A N     1 
ATOM   442  C  CA    . GLU C 3 7   ? 83.732 25.698  5.689   1.00 29.94 ? 7    GLU A CA    1 
ATOM   443  C  C     . GLU C 3 7   ? 84.254 26.217  4.353   1.00 29.31 ? 7    GLU A C     1 
ATOM   444  O  O     . GLU C 3 7   ? 85.237 25.694  3.828   1.00 27.98 ? 7    GLU A O     1 
ATOM   445  C  CB    . GLU C 3 7   ? 84.723 26.042  6.804   1.00 31.34 ? 7    GLU A CB    1 
ATOM   446  C  CG    . GLU C 3 7   ? 84.444 25.374  8.143   1.00 33.73 ? 7    GLU A CG    1 
ATOM   447  C  CD    . GLU C 3 7   ? 83.056 25.668  8.666   1.00 35.38 ? 7    GLU A CD    1 
ATOM   448  O  OE1   . GLU C 3 7   ? 82.559 26.785  8.438   1.00 32.86 ? 7    GLU A OE1   1 
ATOM   449  O  OE2   . GLU C 3 7   ? 82.465 24.783  9.319   1.00 40.76 ? 7    GLU A OE2   1 
ATOM   450  N  N     . ALA C 3 8   ? 83.590 27.221  3.792   1.00 27.88 ? 8    ALA A N     1 
ATOM   451  C  CA    . ALA C 3 8   ? 84.014 27.786  2.517   1.00 27.94 ? 8    ALA A CA    1 
ATOM   452  C  C     . ALA C 3 8   ? 83.973 29.300  2.637   1.00 28.62 ? 8    ALA A C     1 
ATOM   453  O  O     . ALA C 3 8   ? 83.574 29.828  3.674   1.00 29.02 ? 8    ALA A O     1 
ATOM   454  C  CB    . ALA C 3 8   ? 83.100 27.298  1.383   1.00 26.63 ? 8    ALA A CB    1 
ATOM   455  N  N     . ASN C 3 9   ? 84.354 30.006  1.581   1.00 30.07 ? 9    ASN A N     1 
ATOM   456  C  CA    . ASN C 3 9   ? 84.415 31.460  1.654   1.00 30.05 ? 9    ASN A CA    1 
ATOM   457  C  C     . ASN C 3 9   ? 83.152 32.282  1.419   1.00 32.18 ? 9    ASN A C     1 
ATOM   458  O  O     . ASN C 3 9   ? 83.217 33.510  1.416   1.00 33.87 ? 9    ASN A O     1 
ATOM   459  C  CB    . ASN C 3 9   ? 85.533 31.962  0.734   1.00 29.52 ? 9    ASN A CB    1 
ATOM   460  C  CG    . ASN C 3 9   ? 85.158 31.912  -0.735  1.00 29.87 ? 9    ASN A CG    1 
ATOM   461  O  OD1   . ASN C 3 9   ? 84.312 31.123  -1.148  1.00 28.83 ? 9    ASN A OD1   1 
ATOM   462  N  ND2   . ASN C 3 9   ? 85.808 32.755  -1.541  1.00 30.47 ? 9    ASN A ND2   1 
ATOM   463  N  N     . ALA C 3 10  ? 82.002 31.643  1.237   1.00 32.94 ? 10   ALA A N     1 
ATOM   464  C  CA    . ALA C 3 10  ? 80.783 32.421  1.017   1.00 31.56 ? 10   ALA A CA    1 
ATOM   465  C  C     . ALA C 3 10  ? 79.530 31.566  0.910   1.00 31.24 ? 10   ALA A C     1 
ATOM   466  O  O     . ALA C 3 10  ? 79.592 30.344  1.015   1.00 29.67 ? 10   ALA A O     1 
ATOM   467  C  CB    . ALA C 3 10  ? 80.935 33.281  -0.247  1.00 29.83 ? 10   ALA A CB    1 
ATOM   468  N  N     . LEU C 3 11  ? 78.392 32.233  0.725   1.00 31.90 ? 11   LEU A N     1 
ATOM   469  C  CA    . LEU C 3 11  ? 77.115 31.558  0.568   1.00 32.15 ? 11   LEU A CA    1 
ATOM   470  C  C     . LEU C 3 11  ? 77.175 30.922  -0.814  1.00 31.64 ? 11   LEU A C     1 
ATOM   471  O  O     . LEU C 3 11  ? 77.940 31.375  -1.674  1.00 32.17 ? 11   LEU A O     1 
ATOM   472  C  CB    . LEU C 3 11  ? 75.948 32.556  0.645   1.00 31.91 ? 11   LEU A CB    1 
ATOM   473  C  CG    . LEU C 3 11  ? 75.745 33.346  1.947   1.00 33.98 ? 11   LEU A CG    1 
ATOM   474  C  CD1   . LEU C 3 11  ? 74.557 34.292  1.781   1.00 32.85 ? 11   LEU A CD1   1 
ATOM   475  C  CD2   . LEU C 3 11  ? 75.514 32.393  3.121   1.00 30.85 ? 11   LEU A CD2   1 
ATOM   476  N  N     . LEU C 3 12  ? 76.374 29.879  -1.016  1.00 30.40 ? 12   LEU A N     1 
ATOM   477  C  CA    . LEU C 3 12  ? 76.347 29.138  -2.278  1.00 30.02 ? 12   LEU A CA    1 
ATOM   478  C  C     . LEU C 3 12  ? 76.492 29.973  -3.534  1.00 28.99 ? 12   LEU A C     1 
ATOM   479  O  O     . LEU C 3 12  ? 77.314 29.662  -4.400  1.00 28.22 ? 12   LEU A O     1 
ATOM   480  C  CB    . LEU C 3 12  ? 75.051 28.322  -2.392  1.00 29.54 ? 12   LEU A CB    1 
ATOM   481  C  CG    . LEU C 3 12  ? 74.903 27.456  -3.652  1.00 30.45 ? 12   LEU A CG    1 
ATOM   482  C  CD1   . LEU C 3 12  ? 76.063 26.458  -3.717  1.00 29.15 ? 12   LEU A CD1   1 
ATOM   483  C  CD2   . LEU C 3 12  ? 73.548 26.711  -3.621  1.00 27.53 ? 12   LEU A CD2   1 
ATOM   484  N  N     . GLU C 3 13  ? 75.684 31.026  -3.624  1.00 27.96 ? 13   GLU A N     1 
ATOM   485  C  CA    . GLU C 3 13  ? 75.655 31.905  -4.787  1.00 29.48 ? 13   GLU A CA    1 
ATOM   486  C  C     . GLU C 3 13  ? 76.988 32.463  -5.284  1.00 30.96 ? 13   GLU A C     1 
ATOM   487  O  O     . GLU C 3 13  ? 77.183 32.610  -6.494  1.00 30.40 ? 13   GLU A O     1 
ATOM   488  C  CB    . GLU C 3 13  ? 74.691 33.070  -4.530  1.00 30.79 ? 13   GLU A CB    1 
ATOM   489  N  N     . SER C 3 14  ? 77.900 32.777  -4.370  1.00 30.47 ? 14   SER A N     1 
ATOM   490  C  CA    . SER C 3 14  ? 79.183 33.337  -4.781  1.00 31.09 ? 14   SER A CA    1 
ATOM   491  C  C     . SER C 3 14  ? 80.404 32.612  -4.230  1.00 31.28 ? 14   SER A C     1 
ATOM   492  O  O     . SER C 3 14  ? 81.520 33.115  -4.341  1.00 31.99 ? 14   SER A O     1 
ATOM   493  C  CB    . SER C 3 14  ? 79.246 34.824  -4.400  1.00 31.02 ? 14   SER A CB    1 
ATOM   494  O  OG    . SER C 3 14  ? 78.999 35.027  -3.016  1.00 31.48 ? 14   SER A OG    1 
ATOM   495  N  N     . VAL C 3 15  ? 80.207 31.427  -3.656  1.00 30.68 ? 15   VAL A N     1 
ATOM   496  C  CA    . VAL C 3 15  ? 81.329 30.680  -3.097  1.00 29.33 ? 15   VAL A CA    1 
ATOM   497  C  C     . VAL C 3 15  ? 82.355 30.320  -4.177  1.00 30.84 ? 15   VAL A C     1 
ATOM   498  O  O     . VAL C 3 15  ? 81.995 29.959  -5.302  1.00 30.56 ? 15   VAL A O     1 
ATOM   499  C  CB    . VAL C 3 15  ? 80.846 29.395  -2.380  1.00 29.42 ? 15   VAL A CB    1 
ATOM   500  C  CG1   . VAL C 3 15  ? 80.338 28.363  -3.393  1.00 27.08 ? 15   VAL A CG1   1 
ATOM   501  C  CG2   . VAL C 3 15  ? 81.971 28.830  -1.538  1.00 27.83 ? 15   VAL A CG2   1 
ATOM   502  N  N     . THR C 3 16  ? 83.635 30.433  -3.841  1.00 29.25 ? 16   THR A N     1 
ATOM   503  C  CA    . THR C 3 16  ? 84.686 30.126  -4.803  1.00 29.78 ? 16   THR A CA    1 
ATOM   504  C  C     . THR C 3 16  ? 85.827 29.366  -4.161  1.00 28.94 ? 16   THR A C     1 
ATOM   505  O  O     . THR C 3 16  ? 86.729 28.894  -4.848  1.00 29.06 ? 16   THR A O     1 
ATOM   506  C  CB    . THR C 3 16  ? 85.285 31.404  -5.420  1.00 30.44 ? 16   THR A CB    1 
ATOM   507  O  OG1   . THR C 3 16  ? 85.812 32.233  -4.374  1.00 34.13 ? 16   THR A OG1   1 
ATOM   508  C  CG2   . THR C 3 16  ? 84.231 32.178  -6.201  1.00 31.53 ? 16   THR A CG2   1 
ATOM   509  N  N     . LYS C 3 17  ? 85.790 29.228  -2.844  1.00 29.42 ? 17   LYS A N     1 
ATOM   510  C  CA    . LYS C 3 17  ? 86.883 28.548  -2.180  1.00 31.32 ? 17   LYS A CA    1 
ATOM   511  C  C     . LYS C 3 17  ? 86.512 27.663  -0.997  1.00 30.56 ? 17   LYS A C     1 
ATOM   512  O  O     . LYS C 3 17  ? 85.822 28.085  -0.063  1.00 30.18 ? 17   LYS A O     1 
ATOM   513  C  CB    . LYS C 3 17  ? 87.911 29.595  -1.738  1.00 34.82 ? 17   LYS A CB    1 
ATOM   514  C  CG    . LYS C 3 17  ? 89.264 29.045  -1.345  1.00 40.60 ? 17   LYS A CG    1 
ATOM   515  C  CD    . LYS C 3 17  ? 90.239 30.188  -1.035  1.00 45.13 ? 17   LYS A CD    1 
ATOM   516  C  CE    . LYS C 3 17  ? 90.340 31.181  -2.198  1.00 47.07 ? 17   LYS A CE    1 
ATOM   517  N  NZ    . LYS C 3 17  ? 91.283 32.315  -1.910  1.00 49.05 ? 17   LYS A NZ    1 
ATOM   518  N  N     . PHE C 3 18  ? 86.991 26.427  -1.061  1.00 30.17 ? 18   PHE A N     1 
ATOM   519  C  CA    . PHE C 3 18  ? 86.798 25.440  -0.013  1.00 30.08 ? 18   PHE A CA    1 
ATOM   520  C  C     . PHE C 3 18  ? 87.899 25.724  1.014   1.00 31.28 ? 18   PHE A C     1 
ATOM   521  O  O     . PHE C 3 18  ? 89.087 25.676  0.686   1.00 30.91 ? 18   PHE A O     1 
ATOM   522  C  CB    . PHE C 3 18  ? 86.983 24.042  -0.599  1.00 28.38 ? 18   PHE A CB    1 
ATOM   523  C  CG    . PHE C 3 18  ? 87.047 22.943  0.425   1.00 30.01 ? 18   PHE A CG    1 
ATOM   524  C  CD1   . PHE C 3 18  ? 85.891 22.284  0.835   1.00 29.22 ? 18   PHE A CD1   1 
ATOM   525  C  CD2   . PHE C 3 18  ? 88.274 22.539  0.953   1.00 30.69 ? 18   PHE A CD2   1 
ATOM   526  C  CE1   . PHE C 3 18  ? 85.950 21.234  1.753   1.00 28.28 ? 18   PHE A CE1   1 
ATOM   527  C  CE2   . PHE C 3 18  ? 88.346 21.493  1.871   1.00 32.70 ? 18   PHE A CE2   1 
ATOM   528  C  CZ    . PHE C 3 18  ? 87.176 20.835  2.274   1.00 30.63 ? 18   PHE A CZ    1 
ATOM   529  N  N     . HIS C 3 19  ? 87.517 26.039  2.246   1.00 30.58 ? 19   HIS A N     1 
ATOM   530  C  CA    . HIS C 3 19  ? 88.521 26.297  3.270   1.00 29.69 ? 19   HIS A CA    1 
ATOM   531  C  C     . HIS C 3 19  ? 88.905 24.998  3.957   1.00 30.29 ? 19   HIS A C     1 
ATOM   532  O  O     . HIS C 3 19  ? 90.086 24.658  4.043   1.00 30.57 ? 19   HIS A O     1 
ATOM   533  C  CB    . HIS C 3 19  ? 88.007 27.304  4.304   1.00 29.99 ? 19   HIS A CB    1 
ATOM   534  C  CG    . HIS C 3 19  ? 87.932 28.709  3.793   1.00 29.05 ? 19   HIS A CG    1 
ATOM   535  N  ND1   . HIS C 3 19  ? 88.941 29.284  3.050   1.00 28.89 ? 19   HIS A ND1   1 
ATOM   536  C  CD2   . HIS C 3 19  ? 86.996 29.673  3.962   1.00 29.54 ? 19   HIS A CD2   1 
ATOM   537  C  CE1   . HIS C 3 19  ? 88.631 30.541  2.788   1.00 27.98 ? 19   HIS A CE1   1 
ATOM   538  N  NE2   . HIS C 3 19  ? 87.457 30.803  3.331   1.00 29.64 ? 19   HIS A NE2   1 
ATOM   539  N  N     . CYS C 3 20  ? 87.911 24.265  4.447   1.00 29.97 ? 20   CYS A N     1 
ATOM   540  C  CA    . CYS C 3 20  ? 88.190 23.000  5.111   1.00 30.19 ? 20   CYS A CA    1 
ATOM   541  C  C     . CYS C 3 20  ? 86.951 22.145  5.285   1.00 29.29 ? 20   CYS A C     1 
ATOM   542  O  O     . CYS C 3 20  ? 85.833 22.584  5.035   1.00 29.40 ? 20   CYS A O     1 
ATOM   543  C  CB    . CYS C 3 20  ? 88.844 23.243  6.480   1.00 30.71 ? 20   CYS A CB    1 
ATOM   544  S  SG    . CYS C 3 20  ? 87.884 24.273  7.624   1.00 33.30 ? 20   CYS A SG    1 
ATOM   545  N  N     . GLY C 3 21  ? 87.165 20.910  5.712   1.00 29.65 ? 21   GLY A N     1 
ATOM   546  C  CA    . GLY C 3 21  ? 86.059 20.005  5.924   1.00 31.64 ? 21   GLY A CA    1 
ATOM   547  C  C     . GLY C 3 21  ? 86.428 19.005  6.995   1.00 32.23 ? 21   GLY A C     1 
ATOM   548  O  O     . GLY C 3 21  ? 87.609 18.783  7.264   1.00 33.15 ? 21   GLY A O     1 
ATOM   549  N  N     . VAL C 3 22  ? 85.422 18.401  7.613   1.00 30.43 ? 22   VAL A N     1 
ATOM   550  C  CA    . VAL C 3 22  ? 85.668 17.417  8.649   1.00 30.10 ? 22   VAL A CA    1 
ATOM   551  C  C     . VAL C 3 22  ? 84.784 16.206  8.414   1.00 30.70 ? 22   VAL A C     1 
ATOM   552  O  O     . VAL C 3 22  ? 83.627 16.335  8.008   1.00 31.23 ? 22   VAL A O     1 
ATOM   553  C  CB    . VAL C 3 22  ? 85.380 17.993  10.054  1.00 29.42 ? 22   VAL A CB    1 
ATOM   554  C  CG1   . VAL C 3 22  ? 85.484 16.887  11.105  1.00 29.45 ? 22   VAL A CG1   1 
ATOM   555  C  CG2   . VAL C 3 22  ? 86.367 19.115  10.366  1.00 27.73 ? 22   VAL A CG2   1 
ATOM   556  N  N     . ILE C 3 23  ? 85.335 15.025  8.654   1.00 29.92 ? 23   ILE A N     1 
ATOM   557  C  CA    . ILE C 3 23  ? 84.569 13.802  8.485   1.00 29.52 ? 23   ILE A CA    1 
ATOM   558  C  C     . ILE C 3 23  ? 84.678 12.912  9.713   1.00 30.74 ? 23   ILE A C     1 
ATOM   559  O  O     . ILE C 3 23  ? 85.771 12.676  10.233  1.00 31.00 ? 23   ILE A O     1 
ATOM   560  C  CB    . ILE C 3 23  ? 85.049 12.960  7.279   1.00 27.56 ? 23   ILE A CB    1 
ATOM   561  C  CG1   . ILE C 3 23  ? 84.799 13.703  5.965   1.00 29.12 ? 23   ILE A CG1   1 
ATOM   562  C  CG2   . ILE C 3 23  ? 84.306 11.626  7.248   1.00 28.14 ? 23   ILE A CG2   1 
ATOM   563  C  CD1   . ILE C 3 23  ? 85.314 12.942  4.741   1.00 25.56 ? 23   ILE A CD1   1 
ATOM   564  N  N     . TYR C 3 24  ? 83.532 12.455  10.201  1.00 30.55 ? 24   TYR A N     1 
ATOM   565  C  CA    . TYR C 3 24  ? 83.524 11.517  11.311  1.00 30.84 ? 24   TYR A CA    1 
ATOM   566  C  C     . TYR C 3 24  ? 82.988 10.264  10.666  1.00 30.96 ? 24   TYR A C     1 
ATOM   567  O  O     . TYR C 3 24  ? 81.915 10.285  10.058  1.00 32.47 ? 24   TYR A O     1 
ATOM   568  C  CB    . TYR C 3 24  ? 82.575 11.933  12.428  1.00 32.67 ? 24   TYR A CB    1 
ATOM   569  C  CG    . TYR C 3 24  ? 82.405 10.835  13.455  1.00 34.87 ? 24   TYR A CG    1 
ATOM   570  C  CD1   . TYR C 3 24  ? 83.368 10.618  14.441  1.00 36.49 ? 24   TYR A CD1   1 
ATOM   571  C  CD2   . TYR C 3 24  ? 81.290 9.998   13.430  1.00 34.38 ? 24   TYR A CD2   1 
ATOM   572  C  CE1   . TYR C 3 24  ? 83.222 9.599   15.383  1.00 36.43 ? 24   TYR A CE1   1 
ATOM   573  C  CE2   . TYR C 3 24  ? 81.134 8.977   14.361  1.00 36.87 ? 24   TYR A CE2   1 
ATOM   574  C  CZ    . TYR C 3 24  ? 82.104 8.784   15.340  1.00 37.46 ? 24   TYR A CZ    1 
ATOM   575  O  OH    . TYR C 3 24  ? 81.946 7.787   16.281  1.00 39.25 ? 24   TYR A OH    1 
ATOM   576  N  N     . ASP C 3 25  ? 83.735 9.177   10.772  1.00 31.78 ? 25   ASP A N     1 
ATOM   577  C  CA    . ASP C 3 25  ? 83.306 7.921   10.183  1.00 31.60 ? 25   ASP A CA    1 
ATOM   578  C  C     . ASP C 3 25  ? 82.833 6.988   11.298  1.00 32.95 ? 25   ASP A C     1 
ATOM   579  O  O     . ASP C 3 25  ? 83.592 6.702   12.225  1.00 32.33 ? 25   ASP A O     1 
ATOM   580  C  CB    . ASP C 3 25  ? 84.479 7.283   9.444   1.00 30.74 ? 25   ASP A CB    1 
ATOM   581  C  CG    . ASP C 3 25  ? 84.038 6.255   8.439   1.00 31.87 ? 25   ASP A CG    1 
ATOM   582  O  OD1   . ASP C 3 25  ? 83.054 5.535   8.710   1.00 32.65 ? 25   ASP A OD1   1 
ATOM   583  O  OD2   . ASP C 3 25  ? 84.677 6.165   7.373   1.00 33.18 ? 25   ASP A OD2   1 
ATOM   584  N  N     . TYR C 3 26  ? 81.590 6.515   11.224  1.00 33.65 ? 26   TYR A N     1 
ATOM   585  C  CA    . TYR C 3 26  ? 81.092 5.599   12.254  1.00 34.84 ? 26   TYR A CA    1 
ATOM   586  C  C     . TYR C 3 26  ? 81.860 4.278   12.262  1.00 36.36 ? 26   TYR A C     1 
ATOM   587  O  O     . TYR C 3 26  ? 81.972 3.624   13.299  1.00 36.59 ? 26   TYR A O     1 
ATOM   588  C  CB    . TYR C 3 26  ? 79.597 5.313   12.063  1.00 33.85 ? 26   TYR A CB    1 
ATOM   589  C  CG    . TYR C 3 26  ? 78.710 6.297   12.781  1.00 33.78 ? 26   TYR A CG    1 
ATOM   590  C  CD1   . TYR C 3 26  ? 78.534 6.226   14.166  1.00 33.29 ? 26   TYR A CD1   1 
ATOM   591  C  CD2   . TYR C 3 26  ? 78.099 7.345   12.091  1.00 32.39 ? 26   TYR A CD2   1 
ATOM   592  C  CE1   . TYR C 3 26  ? 77.771 7.182   14.844  1.00 33.74 ? 26   TYR A CE1   1 
ATOM   593  C  CE2   . TYR C 3 26  ? 77.343 8.300   12.754  1.00 31.90 ? 26   TYR A CE2   1 
ATOM   594  C  CZ    . TYR C 3 26  ? 77.181 8.216   14.128  1.00 31.87 ? 26   TYR A CZ    1 
ATOM   595  O  OH    . TYR C 3 26  ? 76.437 9.168   14.778  1.00 32.49 ? 26   TYR A OH    1 
ATOM   596  N  N     . SER C 3 27  ? 82.398 3.890   11.112  1.00 37.11 ? 27   SER A N     1 
ATOM   597  C  CA    . SER C 3 27  ? 83.135 2.634   11.022  1.00 38.94 ? 27   SER A CA    1 
ATOM   598  C  C     . SER C 3 27  ? 84.513 2.683   11.701  1.00 38.77 ? 27   SER A C     1 
ATOM   599  O  O     . SER C 3 27  ? 85.104 1.646   11.975  1.00 39.87 ? 27   SER A O     1 
ATOM   600  C  CB    . SER C 3 27  ? 83.296 2.221   9.554   1.00 38.97 ? 27   SER A CB    1 
ATOM   601  O  OG    . SER C 3 27  ? 84.210 3.077   8.892   1.00 43.09 ? 27   SER A OG    1 
ATOM   602  N  N     . THR C 3 28  ? 85.020 3.880   11.978  1.00 39.29 ? 28   THR A N     1 
ATOM   603  C  CA    . THR C 3 28  ? 86.327 4.012   12.627  1.00 38.83 ? 28   THR A CA    1 
ATOM   604  C  C     . THR C 3 28  ? 86.242 4.867   13.881  1.00 40.04 ? 28   THR A C     1 
ATOM   605  O  O     . THR C 3 28  ? 87.214 4.987   14.629  1.00 41.42 ? 28   THR A O     1 
ATOM   606  C  CB    . THR C 3 28  ? 87.358 4.678   11.699  1.00 38.01 ? 28   THR A CB    1 
ATOM   607  O  OG1   . THR C 3 28  ? 86.945 6.026   11.427  1.00 36.80 ? 28   THR A OG1   1 
ATOM   608  C  CG2   . THR C 3 28  ? 87.492 3.899   10.393  1.00 37.34 ? 28   THR A CG2   1 
ATOM   609  N  N     . ALA C 3 29  ? 85.082 5.476   14.099  1.00 39.69 ? 29   ALA A N     1 
ATOM   610  C  CA    . ALA C 3 29  ? 84.872 6.334   15.255  1.00 40.26 ? 29   ALA A CA    1 
ATOM   611  C  C     . ALA C 3 29  ? 85.931 7.431   15.329  1.00 41.14 ? 29   ALA A C     1 
ATOM   612  O  O     . ALA C 3 29  ? 86.329 7.854   16.419  1.00 41.67 ? 29   ALA A O     1 
ATOM   613  C  CB    . ALA C 3 29  ? 84.882 5.499   16.538  1.00 40.98 ? 29   ALA A CB    1 
ATOM   614  N  N     . GLU C 3 30  ? 86.380 7.907   14.171  1.00 41.87 ? 30   GLU A N     1 
ATOM   615  C  CA    . GLU C 3 30  ? 87.396 8.953   14.152  1.00 42.07 ? 30   GLU A CA    1 
ATOM   616  C  C     . GLU C 3 30  ? 87.067 10.193  13.324  1.00 40.49 ? 30   GLU A C     1 
ATOM   617  O  O     . GLU C 3 30  ? 86.418 10.114  12.279  1.00 38.39 ? 30   GLU A O     1 
ATOM   618  C  CB    . GLU C 3 30  ? 88.729 8.378   13.670  1.00 44.46 ? 30   GLU A CB    1 
ATOM   619  C  CG    . GLU C 3 30  ? 89.265 7.261   14.544  1.00 49.37 ? 30   GLU A CG    1 
ATOM   620  C  CD    . GLU C 3 30  ? 90.733 6.979   14.290  1.00 52.03 ? 30   GLU A CD    1 
ATOM   621  O  OE1   . GLU C 3 30  ? 91.551 7.913   14.468  1.00 53.54 ? 30   GLU A OE1   1 
ATOM   622  O  OE2   . GLU C 3 30  ? 91.067 5.829   13.918  1.00 53.05 ? 30   GLU A OE2   1 
ATOM   623  N  N     . TYR C 3 31  ? 87.523 11.339  13.818  1.00 39.14 ? 31   TYR A N     1 
ATOM   624  C  CA    . TYR C 3 31  ? 87.335 12.612  13.141  1.00 38.79 ? 31   TYR A CA    1 
ATOM   625  C  C     . TYR C 3 31  ? 88.586 12.903  12.319  1.00 38.81 ? 31   TYR A C     1 
ATOM   626  O  O     . TYR C 3 31  ? 89.706 12.773  12.816  1.00 39.82 ? 31   TYR A O     1 
ATOM   627  C  CB    . TYR C 3 31  ? 87.147 13.749  14.146  1.00 37.48 ? 31   TYR A CB    1 
ATOM   628  C  CG    . TYR C 3 31  ? 85.853 13.701  14.917  1.00 38.35 ? 31   TYR A CG    1 
ATOM   629  C  CD1   . TYR C 3 31  ? 85.706 12.860  16.016  1.00 38.44 ? 31   TYR A CD1   1 
ATOM   630  C  CD2   . TYR C 3 31  ? 84.772 14.503  14.548  1.00 37.77 ? 31   TYR A CD2   1 
ATOM   631  C  CE1   . TYR C 3 31  ? 84.515 12.817  16.735  1.00 39.21 ? 31   TYR A CE1   1 
ATOM   632  C  CE2   . TYR C 3 31  ? 83.576 14.467  15.257  1.00 37.81 ? 31   TYR A CE2   1 
ATOM   633  C  CZ    . TYR C 3 31  ? 83.456 13.621  16.350  1.00 38.30 ? 31   TYR A CZ    1 
ATOM   634  O  OH    . TYR C 3 31  ? 82.281 13.573  17.057  1.00 38.90 ? 31   TYR A OH    1 
ATOM   635  N  N     . VAL C 3 32  ? 88.394 13.299  11.067  1.00 37.53 ? 32   VAL A N     1 
ATOM   636  C  CA    . VAL C 3 32  ? 89.510 13.624  10.188  1.00 35.29 ? 32   VAL A CA    1 
ATOM   637  C  C     . VAL C 3 32  ? 89.300 15.018  9.624   1.00 36.09 ? 32   VAL A C     1 
ATOM   638  O  O     . VAL C 3 32  ? 88.239 15.320  9.067   1.00 35.20 ? 32   VAL A O     1 
ATOM   639  C  CB    . VAL C 3 32  ? 89.618 12.639  9.009   1.00 34.45 ? 32   VAL A CB    1 
ATOM   640  C  CG1   . VAL C 3 32  ? 90.726 13.085  8.071   1.00 33.58 ? 32   VAL A CG1   1 
ATOM   641  C  CG2   . VAL C 3 32  ? 89.898 11.236  9.519   1.00 34.04 ? 32   VAL A CG2   1 
ATOM   642  N  N     . SER C 3 33  ? 90.308 15.870  9.770   1.00 34.97 ? 33   SER A N     1 
ATOM   643  C  CA    . SER C 3 33  ? 90.211 17.223  9.266   1.00 34.21 ? 33   SER A CA    1 
ATOM   644  C  C     . SER C 3 33  ? 90.906 17.324  7.919   1.00 33.98 ? 33   SER A C     1 
ATOM   645  O  O     . SER C 3 33  ? 91.920 16.664  7.686   1.00 33.97 ? 33   SER A O     1 
ATOM   646  C  CB    . SER C 3 33  ? 90.852 18.202  10.249  1.00 35.40 ? 33   SER A CB    1 
ATOM   647  O  OG    . SER C 3 33  ? 90.136 18.250  11.462  1.00 36.37 ? 33   SER A OG    1 
ATOM   648  N  N     . TYR C 3 34  ? 90.345 18.140  7.033   1.00 32.88 ? 34   TYR A N     1 
ATOM   649  C  CA    . TYR C 3 34  ? 90.918 18.360  5.710   1.00 33.00 ? 34   TYR A CA    1 
ATOM   650  C  C     . TYR C 3 34  ? 91.085 19.857  5.551   1.00 34.06 ? 34   TYR A C     1 
ATOM   651  O  O     . TYR C 3 34  ? 90.107 20.607  5.614   1.00 33.87 ? 34   TYR A O     1 
ATOM   652  C  CB    . TYR C 3 34  ? 89.994 17.841  4.607   1.00 31.04 ? 34   TYR A CB    1 
ATOM   653  C  CG    . TYR C 3 34  ? 89.723 16.367  4.686   1.00 30.04 ? 34   TYR A CG    1 
ATOM   654  C  CD1   . TYR C 3 34  ? 88.882 15.847  5.669   1.00 27.87 ? 34   TYR A CD1   1 
ATOM   655  C  CD2   . TYR C 3 34  ? 90.297 15.486  3.774   1.00 29.57 ? 34   TYR A CD2   1 
ATOM   656  C  CE1   . TYR C 3 34  ? 88.615 14.488  5.739   1.00 28.24 ? 34   TYR A CE1   1 
ATOM   657  C  CE2   . TYR C 3 34  ? 90.036 14.122  3.835   1.00 28.77 ? 34   TYR A CE2   1 
ATOM   658  C  CZ    . TYR C 3 34  ? 89.194 13.631  4.817   1.00 28.79 ? 34   TYR A CZ    1 
ATOM   659  O  OH    . TYR C 3 34  ? 88.919 12.280  4.870   1.00 31.40 ? 34   TYR A OH    1 
ATOM   660  N  N     . ARG C 3 35  ? 92.323 20.296  5.358   1.00 34.43 ? 35   ARG A N     1 
ATOM   661  C  CA    . ARG C 3 35  ? 92.591 21.717  5.199   1.00 33.78 ? 35   ARG A CA    1 
ATOM   662  C  C     . ARG C 3 35  ? 92.505 22.090  3.726   1.00 32.24 ? 35   ARG A C     1 
ATOM   663  O  O     . ARG C 3 35  ? 92.205 21.242  2.900   1.00 31.08 ? 35   ARG A O     1 
ATOM   664  C  CB    . ARG C 3 35  ? 93.950 22.047  5.819   1.00 35.70 ? 35   ARG A CB    1 
ATOM   665  C  CG    . ARG C 3 35  ? 93.910 21.868  7.328   1.00 37.01 ? 35   ARG A CG    1 
ATOM   666  C  CD    . ARG C 3 35  ? 95.246 22.088  8.016   1.00 39.23 ? 35   ARG A CD    1 
ATOM   667  N  NE    . ARG C 3 35  ? 95.082 22.030  9.470   1.00 40.65 ? 35   ARG A NE    1 
ATOM   668  C  CZ    . ARG C 3 35  ? 94.755 20.931  10.147  1.00 40.23 ? 35   ARG A CZ    1 
ATOM   669  N  NH1   . ARG C 3 35  ? 94.559 19.784  9.507   1.00 41.85 ? 35   ARG A NH1   1 
ATOM   670  N  NH2   . ARG C 3 35  ? 94.618 20.980  11.467  1.00 41.28 ? 35   ARG A NH2   1 
ATOM   671  N  N     . PRO C 3 36  ? 92.764 23.360  3.379   1.00 32.63 ? 36   PRO A N     1 
ATOM   672  C  CA    . PRO C 3 36  ? 92.686 23.805  1.985   1.00 33.82 ? 36   PRO A CA    1 
ATOM   673  C  C     . PRO C 3 36  ? 93.310 22.924  0.910   1.00 34.21 ? 36   PRO A C     1 
ATOM   674  O  O     . PRO C 3 36  ? 92.706 22.708  -0.140  1.00 34.16 ? 36   PRO A O     1 
ATOM   675  C  CB    . PRO C 3 36  ? 93.314 25.192  2.037   1.00 34.28 ? 36   PRO A CB    1 
ATOM   676  C  CG    . PRO C 3 36  ? 92.892 25.677  3.386   1.00 32.33 ? 36   PRO A CG    1 
ATOM   677  C  CD    . PRO C 3 36  ? 93.163 24.477  4.254   1.00 31.79 ? 36   PRO A CD    1 
ATOM   678  N  N     . SER C 3 37  ? 94.505 22.406  1.166   1.00 33.93 ? 37   SER A N     1 
ATOM   679  C  CA    . SER C 3 37  ? 95.174 21.575  0.176   1.00 34.57 ? 37   SER A CA    1 
ATOM   680  C  C     . SER C 3 37  ? 94.716 20.117  0.166   1.00 34.17 ? 37   SER A C     1 
ATOM   681  O  O     . SER C 3 37  ? 95.258 19.302  -0.579  1.00 33.95 ? 37   SER A O     1 
ATOM   682  C  CB    . SER C 3 37  ? 96.700 21.662  0.356   1.00 33.95 ? 37   SER A CB    1 
ATOM   683  O  OG    . SER C 3 37  ? 97.088 21.409  1.697   1.00 37.20 ? 37   SER A OG    1 
ATOM   684  N  N     . ASP C 3 38  ? 93.712 19.790  0.980   1.00 33.39 ? 38   ASP A N     1 
ATOM   685  C  CA    . ASP C 3 38  ? 93.187 18.426  1.028   1.00 32.22 ? 38   ASP A CA    1 
ATOM   686  C  C     . ASP C 3 38  ? 91.801 18.325  0.366   1.00 32.73 ? 38   ASP A C     1 
ATOM   687  O  O     . ASP C 3 38  ? 91.158 17.277  0.423   1.00 31.31 ? 38   ASP A O     1 
ATOM   688  C  CB    . ASP C 3 38  ? 93.078 17.942  2.476   1.00 34.11 ? 38   ASP A CB    1 
ATOM   689  C  CG    . ASP C 3 38  ? 94.413 17.938  3.197   1.00 34.55 ? 38   ASP A CG    1 
ATOM   690  O  OD1   . ASP C 3 38  ? 95.345 17.250  2.728   1.00 37.64 ? 38   ASP A OD1   1 
ATOM   691  O  OD2   . ASP C 3 38  ? 94.526 18.621  4.234   1.00 34.32 ? 38   ASP A OD2   1 
ATOM   692  N  N     . PHE C 3 39  ? 91.350 19.410  -0.260  1.00 31.39 ? 39   PHE A N     1 
ATOM   693  C  CA    . PHE C 3 39  ? 90.039 19.427  -0.899  1.00 30.73 ? 39   PHE A CA    1 
ATOM   694  C  C     . PHE C 3 39  ? 89.820 18.152  -1.702  1.00 31.21 ? 39   PHE A C     1 
ATOM   695  O  O     . PHE C 3 39  ? 88.820 17.450  -1.507  1.00 30.87 ? 39   PHE A O     1 
ATOM   696  C  CB    . PHE C 3 39  ? 89.889 20.678  -1.785  1.00 28.83 ? 39   PHE A CB    1 
ATOM   697  C  CG    . PHE C 3 39  ? 88.521 20.838  -2.398  1.00 30.02 ? 39   PHE A CG    1 
ATOM   698  C  CD1   . PHE C 3 39  ? 87.388 20.308  -1.772  1.00 29.34 ? 39   PHE A CD1   1 
ATOM   699  C  CD2   . PHE C 3 39  ? 88.361 21.520  -3.598  1.00 29.16 ? 39   PHE A CD2   1 
ATOM   700  C  CE1   . PHE C 3 39  ? 86.115 20.455  -2.340  1.00 30.35 ? 39   PHE A CE1   1 
ATOM   701  C  CE2   . PHE C 3 39  ? 87.088 21.673  -4.176  1.00 30.50 ? 39   PHE A CE2   1 
ATOM   702  C  CZ    . PHE C 3 39  ? 85.966 21.137  -3.545  1.00 27.97 ? 39   PHE A CZ    1 
ATOM   703  N  N     . GLY C 3 40  ? 90.768 17.842  -2.581  1.00 31.02 ? 40   GLY A N     1 
ATOM   704  C  CA    . GLY C 3 40  ? 90.668 16.641  -3.389  1.00 31.00 ? 40   GLY A CA    1 
ATOM   705  C  C     . GLY C 3 40  ? 90.469 15.373  -2.575  1.00 31.80 ? 40   GLY A C     1 
ATOM   706  O  O     . GLY C 3 40  ? 89.623 14.537  -2.913  1.00 33.71 ? 40   GLY A O     1 
ATOM   707  N  N     . ALA C 3 41  ? 91.241 15.227  -1.502  1.00 30.36 ? 41   ALA A N     1 
ATOM   708  C  CA    . ALA C 3 41  ? 91.141 14.053  -0.641  1.00 30.59 ? 41   ALA A CA    1 
ATOM   709  C  C     . ALA C 3 41  ? 89.778 14.020  0.057   1.00 30.42 ? 41   ALA A C     1 
ATOM   710  O  O     . ALA C 3 41  ? 89.203 12.959  0.262   1.00 30.68 ? 41   ALA A O     1 
ATOM   711  C  CB    . ALA C 3 41  ? 92.259 14.066  0.393   1.00 30.22 ? 41   ALA A CB    1 
ATOM   712  N  N     . TYR C 3 42  ? 89.278 15.192  0.434   1.00 30.51 ? 42   TYR A N     1 
ATOM   713  C  CA    . TYR C 3 42  ? 87.978 15.288  1.086   1.00 29.04 ? 42   TYR A CA    1 
ATOM   714  C  C     . TYR C 3 42  ? 86.932 14.693  0.133   1.00 28.56 ? 42   TYR A C     1 
ATOM   715  O  O     . TYR C 3 42  ? 86.158 13.811  0.511   1.00 28.07 ? 42   TYR A O     1 
ATOM   716  C  CB    . TYR C 3 42  ? 87.650 16.755  1.401   1.00 28.32 ? 42   TYR A CB    1 
ATOM   717  C  CG    . TYR C 3 42  ? 86.271 16.952  1.985   1.00 28.64 ? 42   TYR A CG    1 
ATOM   718  C  CD1   . TYR C 3 42  ? 85.966 16.508  3.272   1.00 28.05 ? 42   TYR A CD1   1 
ATOM   719  C  CD2   . TYR C 3 42  ? 85.254 17.533  1.229   1.00 26.75 ? 42   TYR A CD2   1 
ATOM   720  C  CE1   . TYR C 3 42  ? 84.675 16.634  3.793   1.00 29.37 ? 42   TYR A CE1   1 
ATOM   721  C  CE2   . TYR C 3 42  ? 83.966 17.664  1.736   1.00 28.45 ? 42   TYR A CE2   1 
ATOM   722  C  CZ    . TYR C 3 42  ? 83.681 17.211  3.016   1.00 27.62 ? 42   TYR A CZ    1 
ATOM   723  O  OH    . TYR C 3 42  ? 82.404 17.311  3.501   1.00 27.38 ? 42   TYR A OH    1 
ATOM   724  N  N     . LEU C 3 43  ? 86.935 15.159  -1.113  1.00 28.03 ? 43   LEU A N     1 
ATOM   725  C  CA    . LEU C 3 43  ? 86.002 14.661  -2.118  1.00 27.05 ? 43   LEU A CA    1 
ATOM   726  C  C     . LEU C 3 43  ? 86.125 13.152  -2.298  1.00 27.30 ? 43   LEU A C     1 
ATOM   727  O  O     . LEU C 3 43  ? 85.113 12.448  -2.409  1.00 28.37 ? 43   LEU A O     1 
ATOM   728  C  CB    . LEU C 3 43  ? 86.248 15.355  -3.465  1.00 25.50 ? 43   LEU A CB    1 
ATOM   729  C  CG    . LEU C 3 43  ? 86.002 16.863  -3.501  1.00 25.29 ? 43   LEU A CG    1 
ATOM   730  C  CD1   . LEU C 3 43  ? 86.380 17.425  -4.875  1.00 22.04 ? 43   LEU A CD1   1 
ATOM   731  C  CD2   . LEU C 3 43  ? 84.530 17.135  -3.192  1.00 22.98 ? 43   LEU A CD2   1 
ATOM   732  N  N     . ASP C 3 44  ? 87.362 12.661  -2.347  1.00 28.44 ? 44   ASP A N     1 
ATOM   733  C  CA    . ASP C 3 44  ? 87.619 11.232  -2.515  1.00 28.23 ? 44   ASP A CA    1 
ATOM   734  C  C     . ASP C 3 44  ? 86.943 10.445  -1.382  1.00 27.37 ? 44   ASP A C     1 
ATOM   735  O  O     . ASP C 3 44  ? 86.352 9.398   -1.611  1.00 28.29 ? 44   ASP A O     1 
ATOM   736  C  CB    . ASP C 3 44  ? 89.130 10.929  -2.483  1.00 29.65 ? 44   ASP A CB    1 
ATOM   737  C  CG    . ASP C 3 44  ? 89.886 11.396  -3.748  1.00 30.65 ? 44   ASP A CG    1 
ATOM   738  O  OD1   . ASP C 3 44  ? 89.269 11.713  -4.788  1.00 27.61 ? 44   ASP A OD1   1 
ATOM   739  O  OD2   . ASP C 3 44  ? 91.135 11.423  -3.691  1.00 33.92 ? 44   ASP A OD2   1 
ATOM   740  N  N     . ALA C 3 45  ? 87.049 10.953  -0.159  1.00 26.82 ? 45   ALA A N     1 
ATOM   741  C  CA    . ALA C 3 45  ? 86.459 10.288  1.003   1.00 27.89 ? 45   ALA A CA    1 
ATOM   742  C  C     . ALA C 3 45  ? 84.933 10.204  0.889   1.00 29.22 ? 45   ALA A C     1 
ATOM   743  O  O     . ALA C 3 45  ? 84.341 9.170   1.177   1.00 29.04 ? 45   ALA A O     1 
ATOM   744  C  CB    . ALA C 3 45  ? 86.852 11.017  2.263   1.00 27.37 ? 45   ALA A CB    1 
ATOM   745  N  N     . LEU C 3 46  ? 84.299 11.291  0.465   1.00 29.25 ? 46   LEU A N     1 
ATOM   746  C  CA    . LEU C 3 46  ? 82.850 11.284  0.295   1.00 29.04 ? 46   LEU A CA    1 
ATOM   747  C  C     . LEU C 3 46  ? 82.458 10.257  -0.759  1.00 28.53 ? 46   LEU A C     1 
ATOM   748  O  O     . LEU C 3 46  ? 81.573 9.435   -0.528  1.00 31.44 ? 46   LEU A O     1 
ATOM   749  C  CB    . LEU C 3 46  ? 82.335 12.662  -0.133  1.00 26.55 ? 46   LEU A CB    1 
ATOM   750  C  CG    . LEU C 3 46  ? 82.545 13.786  0.882   1.00 28.42 ? 46   LEU A CG    1 
ATOM   751  C  CD1   . LEU C 3 46  ? 81.699 14.992  0.492   1.00 27.82 ? 46   LEU A CD1   1 
ATOM   752  C  CD2   . LEU C 3 46  ? 82.152 13.287  2.272   1.00 29.00 ? 46   LEU A CD2   1 
ATOM   753  N  N     . GLU C 3 47  ? 83.116 10.295  -1.913  1.00 28.53 ? 47   GLU A N     1 
ATOM   754  C  CA    . GLU C 3 47  ? 82.790 9.359   -2.982  1.00 29.00 ? 47   GLU A CA    1 
ATOM   755  C  C     . GLU C 3 47  ? 83.037 7.911   -2.585  1.00 28.80 ? 47   GLU A C     1 
ATOM   756  O  O     . GLU C 3 47  ? 82.375 7.014   -3.093  1.00 29.53 ? 47   GLU A O     1 
ATOM   757  C  CB    . GLU C 3 47  ? 83.571 9.692   -4.258  1.00 30.33 ? 47   GLU A CB    1 
ATOM   758  C  CG    . GLU C 3 47  ? 83.118 10.982  -4.912  1.00 33.05 ? 47   GLU A CG    1 
ATOM   759  C  CD    . GLU C 3 47  ? 83.770 11.237  -6.256  1.00 35.81 ? 47   GLU A CD    1 
ATOM   760  O  OE1   . GLU C 3 47  ? 85.010 11.114  -6.359  1.00 34.80 ? 47   GLU A OE1   1 
ATOM   761  O  OE2   . GLU C 3 47  ? 83.037 11.576  -7.211  1.00 38.16 ? 47   GLU A OE2   1 
ATOM   762  N  N     . ALA C 3 48  ? 83.987 7.684   -1.682  1.00 28.93 ? 48   ALA A N     1 
ATOM   763  C  CA    . ALA C 3 48  ? 84.275 6.329   -1.231  1.00 30.70 ? 48   ALA A CA    1 
ATOM   764  C  C     . ALA C 3 48  ? 83.092 5.845   -0.382  1.00 30.76 ? 48   ALA A C     1 
ATOM   765  O  O     . ALA C 3 48  ? 82.719 4.680   -0.444  1.00 31.19 ? 48   ALA A O     1 
ATOM   766  C  CB    . ALA C 3 48  ? 85.580 6.294   -0.417  1.00 31.75 ? 48   ALA A CB    1 
ATOM   767  N  N     . GLU C 3 49  ? 82.499 6.737   0.408   1.00 30.47 ? 49   GLU A N     1 
ATOM   768  C  CA    . GLU C 3 49  ? 81.342 6.337   1.206   1.00 30.80 ? 49   GLU A CA    1 
ATOM   769  C  C     . GLU C 3 49  ? 80.233 5.958   0.218   1.00 30.01 ? 49   GLU A C     1 
ATOM   770  O  O     . GLU C 3 49  ? 79.490 5.012   0.450   1.00 30.48 ? 49   GLU A O     1 
ATOM   771  C  CB    . GLU C 3 49  ? 80.884 7.479   2.123   1.00 32.02 ? 49   GLU A CB    1 
ATOM   772  C  CG    . GLU C 3 49  ? 79.661 7.161   2.994   1.00 33.63 ? 49   GLU A CG    1 
ATOM   773  C  CD    . GLU C 3 49  ? 79.878 5.986   3.950   1.00 36.77 ? 49   GLU A CD    1 
ATOM   774  O  OE1   . GLU C 3 49  ? 81.030 5.751   4.377   1.00 36.86 ? 49   GLU A OE1   1 
ATOM   775  O  OE2   . GLU C 3 49  ? 78.885 5.306   4.292   1.00 39.62 ? 49   GLU A OE2   1 
ATOM   776  N  N     . VAL C 3 50  ? 80.136 6.687   -0.892  1.00 30.14 ? 50   VAL A N     1 
ATOM   777  C  CA    . VAL C 3 50  ? 79.128 6.392   -1.920  1.00 30.24 ? 50   VAL A CA    1 
ATOM   778  C  C     . VAL C 3 50  ? 79.400 5.037   -2.586  1.00 30.78 ? 50   VAL A C     1 
ATOM   779  O  O     . VAL C 3 50  ? 78.482 4.247   -2.825  1.00 30.86 ? 50   VAL A O     1 
ATOM   780  C  CB    . VAL C 3 50  ? 79.098 7.477   -3.030  1.00 30.47 ? 50   VAL A CB    1 
ATOM   781  C  CG1   . VAL C 3 50  ? 78.150 7.059   -4.161  1.00 28.59 ? 50   VAL A CG1   1 
ATOM   782  C  CG2   . VAL C 3 50  ? 78.645 8.803   -2.443  1.00 29.49 ? 50   VAL A CG2   1 
ATOM   783  N  N     . ALA C 3 51  ? 80.665 4.772   -2.893  1.00 31.21 ? 51   ALA A N     1 
ATOM   784  C  CA    . ALA C 3 51  ? 81.039 3.504   -3.519  1.00 30.74 ? 51   ALA A CA    1 
ATOM   785  C  C     . ALA C 3 51  ? 80.592 2.326   -2.641  1.00 31.59 ? 51   ALA A C     1 
ATOM   786  O  O     . ALA C 3 51  ? 80.218 1.272   -3.139  1.00 32.64 ? 51   ALA A O     1 
ATOM   787  C  CB    . ALA C 3 51  ? 82.554 3.458   -3.733  1.00 32.90 ? 51   ALA A CB    1 
ATOM   788  N  N     . ARG C 3 52  ? 80.629 2.517   -1.327  1.00 32.38 ? 52   ARG A N     1 
ATOM   789  C  CA    . ARG C 3 52  ? 80.223 1.473   -0.395  1.00 32.88 ? 52   ARG A CA    1 
ATOM   790  C  C     . ARG C 3 52  ? 78.706 1.399   -0.228  1.00 32.57 ? 52   ARG A C     1 
ATOM   791  O  O     . ARG C 3 52  ? 78.199 0.592   0.553   1.00 33.97 ? 52   ARG A O     1 
ATOM   792  C  CB    . ARG C 3 52  ? 80.854 1.717   0.976   1.00 33.16 ? 52   ARG A CB    1 
ATOM   793  C  CG    . ARG C 3 52  ? 82.343 1.454   1.051   1.00 33.12 ? 52   ARG A CG    1 
ATOM   794  C  CD    . ARG C 3 52  ? 82.792 1.615   2.482   1.00 33.18 ? 52   ARG A CD    1 
ATOM   795  N  NE    . ARG C 3 52  ? 82.741 3.008   2.920   1.00 36.46 ? 52   ARG A NE    1 
ATOM   796  C  CZ    . ARG C 3 52  ? 83.720 3.890   2.732   1.00 37.11 ? 52   ARG A CZ    1 
ATOM   797  N  NH1   . ARG C 3 52  ? 84.837 3.527   2.110   1.00 38.76 ? 52   ARG A NH1   1 
ATOM   798  N  NH2   . ARG C 3 52  ? 83.588 5.136   3.173   1.00 39.05 ? 52   ARG A NH2   1 
ATOM   799  N  N     . GLY C 3 53  ? 77.980 2.223   -0.971  1.00 31.15 ? 53   GLY A N     1 
ATOM   800  C  CA    . GLY C 3 53  ? 76.538 2.234   -0.835  1.00 29.04 ? 53   GLY A CA    1 
ATOM   801  C  C     . GLY C 3 53  ? 76.200 2.777   0.542   1.00 28.91 ? 53   GLY A C     1 
ATOM   802  O  O     . GLY C 3 53  ? 75.211 2.374   1.155   1.00 31.52 ? 53   GLY A O     1 
ATOM   803  N  N     . GLY C 3 54  ? 77.031 3.696   1.029   1.00 27.13 ? 54   GLY A N     1 
ATOM   804  C  CA    . GLY C 3 54  ? 76.826 4.277   2.346   1.00 24.46 ? 54   GLY A CA    1 
ATOM   805  C  C     . GLY C 3 54  ? 75.999 5.554   2.399   1.00 24.24 ? 54   GLY A C     1 
ATOM   806  O  O     . GLY C 3 54  ? 75.278 5.893   1.462   1.00 24.16 ? 54   GLY A O     1 
ATOM   807  N  N     . LEU C 3 55  ? 76.128 6.272   3.507   1.00 22.01 ? 55   LEU A N     1 
ATOM   808  C  CA    . LEU C 3 55  ? 75.389 7.499   3.727   1.00 24.09 ? 55   LEU A CA    1 
ATOM   809  C  C     . LEU C 3 55  ? 76.272 8.641   4.207   1.00 22.60 ? 55   LEU A C     1 
ATOM   810  O  O     . LEU C 3 55  ? 77.222 8.426   4.943   1.00 24.15 ? 55   LEU A O     1 
ATOM   811  C  CB    . LEU C 3 55  ? 74.284 7.243   4.758   1.00 22.68 ? 55   LEU A CB    1 
ATOM   812  C  CG    . LEU C 3 55  ? 73.171 6.312   4.267   1.00 26.02 ? 55   LEU A CG    1 
ATOM   813  C  CD1   . LEU C 3 55  ? 72.467 5.646   5.446   1.00 22.99 ? 55   LEU A CD1   1 
ATOM   814  C  CD2   . LEU C 3 55  ? 72.191 7.119   3.411   1.00 22.27 ? 55   LEU A CD2   1 
ATOM   815  N  N     . ILE C 3 56  ? 75.945 9.855   3.781   1.00 21.10 ? 56   ILE A N     1 
ATOM   816  C  CA    . ILE C 3 56  ? 76.689 11.028  4.191   1.00 21.16 ? 56   ILE A CA    1 
ATOM   817  C  C     . ILE C 3 56  ? 75.715 11.970  4.895   1.00 21.85 ? 56   ILE A C     1 
ATOM   818  O  O     . ILE C 3 56  ? 74.673 12.344  4.330   1.00 20.38 ? 56   ILE A O     1 
ATOM   819  C  CB    . ILE C 3 56  ? 77.303 11.747  2.991   1.00 22.24 ? 56   ILE A CB    1 
ATOM   820  C  CG1   . ILE C 3 56  ? 78.064 10.742  2.122   1.00 23.18 ? 56   ILE A CG1   1 
ATOM   821  C  CG2   . ILE C 3 56  ? 78.235 12.852  3.473   1.00 20.05 ? 56   ILE A CG2   1 
ATOM   822  C  CD1   . ILE C 3 56  ? 78.612 11.342  0.868   1.00 27.23 ? 56   ILE A CD1   1 
ATOM   823  N  N     . VAL C 3 57  ? 76.045 12.338  6.130   1.00 19.67 ? 57   VAL A N     1 
ATOM   824  C  CA    . VAL C 3 57  ? 75.187 13.220  6.905   1.00 21.26 ? 57   VAL A CA    1 
ATOM   825  C  C     . VAL C 3 57  ? 75.711 14.634  7.046   1.00 23.59 ? 57   VAL A C     1 
ATOM   826  O  O     . VAL C 3 57  ? 76.821 14.846  7.527   1.00 24.93 ? 57   VAL A O     1 
ATOM   827  C  CB    . VAL C 3 57  ? 74.946 12.671  8.328   1.00 23.61 ? 57   VAL A CB    1 
ATOM   828  C  CG1   . VAL C 3 57  ? 74.043 13.629  9.111   1.00 22.09 ? 57   VAL A CG1   1 
ATOM   829  C  CG2   . VAL C 3 57  ? 74.322 11.289  8.257   1.00 21.09 ? 57   VAL A CG2   1 
ATOM   830  N  N     . PHE C 3 58  ? 74.901 15.604  6.628   1.00 23.75 ? 58   PHE A N     1 
ATOM   831  C  CA    . PHE C 3 58  ? 75.252 17.020  6.756   1.00 23.09 ? 58   PHE A CA    1 
ATOM   832  C  C     . PHE C 3 58  ? 74.102 17.696  7.495   1.00 23.91 ? 58   PHE A C     1 
ATOM   833  O  O     . PHE C 3 58  ? 73.011 17.132  7.611   1.00 23.43 ? 58   PHE A O     1 
ATOM   834  C  CB    . PHE C 3 58  ? 75.318 17.711  5.395   1.00 24.98 ? 58   PHE A CB    1 
ATOM   835  C  CG    . PHE C 3 58  ? 76.487 17.330  4.550   1.00 25.88 ? 58   PHE A CG    1 
ATOM   836  C  CD1   . PHE C 3 58  ? 77.746 17.871  4.799   1.00 22.47 ? 58   PHE A CD1   1 
ATOM   837  C  CD2   . PHE C 3 58  ? 76.315 16.492  3.451   1.00 24.57 ? 58   PHE A CD2   1 
ATOM   838  C  CE1   . PHE C 3 58  ? 78.812 17.588  3.963   1.00 21.78 ? 58   PHE A CE1   1 
ATOM   839  C  CE2   . PHE C 3 58  ? 77.387 16.204  2.603   1.00 26.84 ? 58   PHE A CE2   1 
ATOM   840  C  CZ    . PHE C 3 58  ? 78.634 16.757  2.861   1.00 21.58 ? 58   PHE A CZ    1 
ATOM   841  N  N     . HIS C 3 59  ? 74.346 18.905  7.989   1.00 22.99 ? 59   HIS A N     1 
ATOM   842  C  CA    . HIS C 3 59  ? 73.286 19.681  8.595   1.00 22.81 ? 59   HIS A CA    1 
ATOM   843  C  C     . HIS C 3 59  ? 73.066 20.784  7.555   1.00 22.68 ? 59   HIS A C     1 
ATOM   844  O  O     . HIS C 3 59  ? 73.908 21.658  7.402   1.00 22.92 ? 59   HIS A O     1 
ATOM   845  C  CB    . HIS C 3 59  ? 73.709 20.316  9.906   1.00 20.72 ? 59   HIS A CB    1 
ATOM   846  C  CG    . HIS C 3 59  ? 72.600 21.065  10.580  1.00 23.24 ? 59   HIS A CG    1 
ATOM   847  N  ND1   . HIS C 3 59  ? 71.511 20.431  11.147  1.00 23.07 ? 59   HIS A ND1   1 
ATOM   848  C  CD2   . HIS C 3 59  ? 72.409 22.392  10.776  1.00 21.99 ? 59   HIS A CD2   1 
ATOM   849  C  CE1   . HIS C 3 59  ? 70.701 21.338  11.667  1.00 22.90 ? 59   HIS A CE1   1 
ATOM   850  N  NE2   . HIS C 3 59  ? 71.223 22.536  11.456  1.00 24.45 ? 59   HIS A NE2   1 
ATOM   851  N  N     . ASN C 3 60  ? 71.945 20.726  6.840   1.00 23.15 ? 60   ASN A N     1 
ATOM   852  C  CA    . ASN C 3 60  ? 71.623 21.690  5.782   1.00 22.66 ? 60   ASN A CA    1 
ATOM   853  C  C     . ASN C 3 60  ? 72.524 21.443  4.562   1.00 23.93 ? 60   ASN A C     1 
ATOM   854  O  O     . ASN C 3 60  ? 72.821 22.351  3.778   1.00 23.86 ? 60   ASN A O     1 
ATOM   855  C  CB    . ASN C 3 60  ? 71.795 23.137  6.265   1.00 23.05 ? 60   ASN A CB    1 
ATOM   856  C  CG    . ASN C 3 60  ? 71.221 24.155  5.282   1.00 25.43 ? 60   ASN A CG    1 
ATOM   857  O  OD1   . ASN C 3 60  ? 70.058 24.057  4.874   1.00 25.91 ? 60   ASN A OD1   1 
ATOM   858  N  ND2   . ASN C 3 60  ? 72.033 25.140  4.902   1.00 22.90 ? 60   ASN A ND2   1 
ATOM   859  N  N     . GLY C 3 61  ? 72.942 20.199  4.403   1.00 22.71 ? 61   GLY A N     1 
ATOM   860  C  CA    . GLY C 3 61  ? 73.786 19.857  3.277   1.00 21.95 ? 61   GLY A CA    1 
ATOM   861  C  C     . GLY C 3 61  ? 73.011 19.882  1.972   1.00 22.07 ? 61   GLY A C     1 
ATOM   862  O  O     . GLY C 3 61  ? 73.600 20.135  0.924   1.00 20.73 ? 61   GLY A O     1 
ATOM   863  N  N     . HIS C 3 62  ? 71.699 19.628  2.026   1.00 20.06 ? 62   HIS A N     1 
ATOM   864  C  CA    . HIS C 3 62  ? 70.887 19.605  0.803   1.00 21.33 ? 62   HIS A CA    1 
ATOM   865  C  C     . HIS C 3 62  ? 70.870 20.940  0.074   1.00 21.20 ? 62   HIS A C     1 
ATOM   866  O  O     . HIS C 3 62  ? 70.919 20.976  -1.152  1.00 22.12 ? 62   HIS A O     1 
ATOM   867  C  CB    . HIS C 3 62  ? 69.451 19.163  1.114   1.00 22.34 ? 62   HIS A CB    1 
ATOM   868  C  CG    . HIS C 3 62  ? 69.271 17.678  1.131   1.00 21.52 ? 62   HIS A CG    1 
ATOM   869  N  ND1   . HIS C 3 62  ? 70.232 16.817  1.616   1.00 21.04 ? 62   HIS A ND1   1 
ATOM   870  C  CD2   . HIS C 3 62  ? 68.235 16.899  0.734   1.00 21.83 ? 62   HIS A CD2   1 
ATOM   871  C  CE1   . HIS C 3 62  ? 69.798 15.575  1.518   1.00 19.69 ? 62   HIS A CE1   1 
ATOM   872  N  NE2   . HIS C 3 62  ? 68.588 15.596  0.988   1.00 19.25 ? 62   HIS A NE2   1 
ATOM   873  N  N     . LYS C 3 63  ? 70.811 22.036  0.832   1.00 20.26 ? 63   LYS A N     1 
ATOM   874  C  CA    . LYS C 3 63  ? 70.793 23.363  0.248   1.00 21.28 ? 63   LYS A CA    1 
ATOM   875  C  C     . LYS C 3 63  ? 72.165 24.012  0.101   1.00 21.35 ? 63   LYS A C     1 
ATOM   876  O  O     . LYS C 3 63  ? 72.359 24.822  -0.801  1.00 21.40 ? 63   LYS A O     1 
ATOM   877  C  CB    . LYS C 3 63  ? 69.881 24.300  1.057   1.00 23.15 ? 63   LYS A CB    1 
ATOM   878  C  CG    . LYS C 3 63  ? 68.386 24.046  0.834   1.00 29.56 ? 63   LYS A CG    1 
ATOM   879  C  CD    . LYS C 3 63  ? 67.490 24.927  1.702   1.00 32.83 ? 63   LYS A CD    1 
ATOM   880  C  CE    . LYS C 3 63  ? 67.562 26.394  1.308   1.00 33.17 ? 63   LYS A CE    1 
ATOM   881  N  NZ    . LYS C 3 63  ? 66.477 27.171  1.987   1.00 36.86 ? 63   LYS A NZ    1 
ATOM   882  N  N     . TYR C 3 64  ? 73.115 23.668  0.971   1.00 20.68 ? 64   TYR A N     1 
ATOM   883  C  CA    . TYR C 3 64  ? 74.442 24.281  0.899   1.00 23.85 ? 64   TYR A CA    1 
ATOM   884  C  C     . TYR C 3 64  ? 75.621 23.349  0.566   1.00 25.11 ? 64   TYR A C     1 
ATOM   885  O  O     . TYR C 3 64  ? 76.106 23.335  -0.576  1.00 25.44 ? 64   TYR A O     1 
ATOM   886  C  CB    . TYR C 3 64  ? 74.759 25.038  2.206   1.00 24.33 ? 64   TYR A CB    1 
ATOM   887  C  CG    . TYR C 3 64  ? 76.064 25.804  2.138   1.00 25.31 ? 64   TYR A CG    1 
ATOM   888  C  CD1   . TYR C 3 64  ? 76.192 26.923  1.317   1.00 25.66 ? 64   TYR A CD1   1 
ATOM   889  C  CD2   . TYR C 3 64  ? 77.196 25.360  2.828   1.00 26.73 ? 64   TYR A CD2   1 
ATOM   890  C  CE1   . TYR C 3 64  ? 77.422 27.583  1.173   1.00 27.14 ? 64   TYR A CE1   1 
ATOM   891  C  CE2   . TYR C 3 64  ? 78.432 26.013  2.692   1.00 28.39 ? 64   TYR A CE2   1 
ATOM   892  C  CZ    . TYR C 3 64  ? 78.535 27.121  1.860   1.00 28.09 ? 64   TYR A CZ    1 
ATOM   893  O  OH    . TYR C 3 64  ? 79.755 27.746  1.687   1.00 29.24 ? 64   TYR A OH    1 
ATOM   894  N  N     . ASP C 3 65  ? 76.072 22.571  1.551   1.00 23.94 ? 65   ASP A N     1 
ATOM   895  C  CA    . ASP C 3 65  ? 77.219 21.669  1.368   1.00 23.05 ? 65   ASP A CA    1 
ATOM   896  C  C     . ASP C 3 65  ? 77.259 20.823  0.090   1.00 22.99 ? 65   ASP A C     1 
ATOM   897  O  O     . ASP C 3 65  ? 78.270 20.816  -0.625  1.00 21.32 ? 65   ASP A O     1 
ATOM   898  C  CB    . ASP C 3 65  ? 77.354 20.733  2.574   1.00 23.26 ? 65   ASP A CB    1 
ATOM   899  C  CG    . ASP C 3 65  ? 77.348 21.481  3.890   1.00 25.11 ? 65   ASP A CG    1 
ATOM   900  O  OD1   . ASP C 3 65  ? 76.294 22.067  4.230   1.00 25.99 ? 65   ASP A OD1   1 
ATOM   901  O  OD2   . ASP C 3 65  ? 78.395 21.497  4.574   1.00 25.40 ? 65   ASP A OD2   1 
ATOM   902  N  N     . VAL C 3 66  ? 76.187 20.090  -0.202  1.00 20.31 ? 66   VAL A N     1 
ATOM   903  C  CA    . VAL C 3 66  ? 76.210 19.249  -1.394  1.00 20.26 ? 66   VAL A CA    1 
ATOM   904  C  C     . VAL C 3 66  ? 76.364 20.048  -2.701  1.00 21.47 ? 66   VAL A C     1 
ATOM   905  O  O     . VAL C 3 66  ? 77.265 19.761  -3.503  1.00 24.50 ? 66   VAL A O     1 
ATOM   906  C  CB    . VAL C 3 66  ? 74.972 18.326  -1.456  1.00 21.77 ? 66   VAL A CB    1 
ATOM   907  C  CG1   . VAL C 3 66  ? 74.906 17.622  -2.801  1.00 19.75 ? 66   VAL A CG1   1 
ATOM   908  C  CG2   . VAL C 3 66  ? 75.050 17.295  -0.328  1.00 19.29 ? 66   VAL A CG2   1 
ATOM   909  N  N     . PRO C 3 67  ? 75.499 21.051  -2.938  1.00 20.23 ? 67   PRO A N     1 
ATOM   910  C  CA    . PRO C 3 67  ? 75.650 21.823  -4.183  1.00 20.90 ? 67   PRO A CA    1 
ATOM   911  C  C     . PRO C 3 67  ? 76.922 22.691  -4.209  1.00 22.52 ? 67   PRO A C     1 
ATOM   912  O  O     . PRO C 3 67  ? 77.493 22.941  -5.274  1.00 23.19 ? 67   PRO A O     1 
ATOM   913  C  CB    . PRO C 3 67  ? 74.368 22.658  -4.240  1.00 19.63 ? 67   PRO A CB    1 
ATOM   914  C  CG    . PRO C 3 67  ? 73.984 22.811  -2.779  1.00 21.65 ? 67   PRO A CG    1 
ATOM   915  C  CD    . PRO C 3 67  ? 74.258 21.419  -2.232  1.00 20.31 ? 67   PRO A CD    1 
ATOM   916  N  N     . ALA C 3 68  ? 77.376 23.139  -3.042  1.00 20.57 ? 68   ALA A N     1 
ATOM   917  C  CA    . ALA C 3 68  ? 78.586 23.952  -2.996  1.00 21.32 ? 68   ALA A CA    1 
ATOM   918  C  C     . ALA C 3 68  ? 79.802 23.103  -3.365  1.00 22.03 ? 68   ALA A C     1 
ATOM   919  O  O     . ALA C 3 68  ? 80.742 23.588  -4.018  1.00 21.84 ? 68   ALA A O     1 
ATOM   920  C  CB    . ALA C 3 68  ? 78.774 24.574  -1.609  1.00 17.48 ? 68   ALA A CB    1 
ATOM   921  N  N     . LEU C 3 69  ? 79.790 21.839  -2.950  1.00 22.18 ? 69   LEU A N     1 
ATOM   922  C  CA    . LEU C 3 69  ? 80.900 20.943  -3.267  1.00 22.36 ? 69   LEU A CA    1 
ATOM   923  C  C     . LEU C 3 69  ? 80.985 20.682  -4.779  1.00 24.15 ? 69   LEU A C     1 
ATOM   924  O  O     . LEU C 3 69  ? 82.078 20.593  -5.345  1.00 26.28 ? 69   LEU A O     1 
ATOM   925  C  CB    . LEU C 3 69  ? 80.761 19.628  -2.497  1.00 19.81 ? 69   LEU A CB    1 
ATOM   926  C  CG    . LEU C 3 69  ? 81.154 19.734  -1.016  1.00 22.33 ? 69   LEU A CG    1 
ATOM   927  C  CD1   . LEU C 3 69  ? 80.879 18.420  -0.298  1.00 16.89 ? 69   LEU A CD1   1 
ATOM   928  C  CD2   . LEU C 3 69  ? 82.637 20.109  -0.905  1.00 19.92 ? 69   LEU A CD2   1 
ATOM   929  N  N     . THR C 3 70  ? 79.834 20.555  -5.427  1.00 23.82 ? 70   THR A N     1 
ATOM   930  C  CA    . THR C 3 70  ? 79.787 20.343  -6.873  1.00 24.79 ? 70   THR A CA    1 
ATOM   931  C  C     . THR C 3 70  ? 80.360 21.597  -7.552  1.00 25.42 ? 70   THR A C     1 
ATOM   932  O  O     . THR C 3 70  ? 81.145 21.515  -8.494  1.00 26.44 ? 70   THR A O     1 
ATOM   933  C  CB    . THR C 3 70  ? 78.331 20.156  -7.354  1.00 25.00 ? 70   THR A CB    1 
ATOM   934  O  OG1   . THR C 3 70  ? 77.803 18.942  -6.807  1.00 26.53 ? 70   THR A OG1   1 
ATOM   935  C  CG2   . THR C 3 70  ? 78.263 20.117  -8.882  1.00 22.76 ? 70   THR A CG2   1 
ATOM   936  N  N     . LYS C 3 71  ? 79.954 22.758  -7.056  1.00 25.26 ? 71   LYS A N     1 
ATOM   937  C  CA    . LYS C 3 71  ? 80.413 24.024  -7.609  1.00 26.66 ? 71   LYS A CA    1 
ATOM   938  C  C     . LYS C 3 71  ? 81.922 24.192  -7.411  1.00 25.81 ? 71   LYS A C     1 
ATOM   939  O  O     . LYS C 3 71  ? 82.647 24.502  -8.357  1.00 26.06 ? 71   LYS A O     1 
ATOM   940  C  CB    . LYS C 3 71  ? 79.652 25.181  -6.951  1.00 27.36 ? 71   LYS A CB    1 
ATOM   941  C  CG    . LYS C 3 71  ? 79.981 26.557  -7.519  1.00 32.15 ? 71   LYS A CG    1 
ATOM   942  C  CD    . LYS C 3 71  ? 79.073 27.627  -6.929  1.00 32.94 ? 71   LYS A CD    1 
ATOM   943  C  CE    . LYS C 3 71  ? 79.457 29.009  -7.423  1.00 33.41 ? 71   LYS A CE    1 
ATOM   944  N  NZ    . LYS C 3 71  ? 78.615 30.078  -6.804  1.00 36.18 ? 71   LYS A NZ    1 
ATOM   945  N  N     . LEU C 3 72  ? 82.389 23.964  -6.187  1.00 24.49 ? 72   LEU A N     1 
ATOM   946  C  CA    . LEU C 3 72  ? 83.806 24.099  -5.860  1.00 25.92 ? 72   LEU A CA    1 
ATOM   947  C  C     . LEU C 3 72  ? 84.724 23.061  -6.512  1.00 26.49 ? 72   LEU A C     1 
ATOM   948  O  O     . LEU C 3 72  ? 85.854 23.381  -6.873  1.00 29.09 ? 72   LEU A O     1 
ATOM   949  C  CB    . LEU C 3 72  ? 83.996 24.088  -4.333  1.00 23.74 ? 72   LEU A CB    1 
ATOM   950  C  CG    . LEU C 3 72  ? 83.345 25.313  -3.667  1.00 25.67 ? 72   LEU A CG    1 
ATOM   951  C  CD1   . LEU C 3 72  ? 83.393 25.188  -2.148  1.00 24.82 ? 72   LEU A CD1   1 
ATOM   952  C  CD2   . LEU C 3 72  ? 84.067 26.582  -4.138  1.00 24.22 ? 72   LEU A CD2   1 
ATOM   953  N  N     . ALA C 3 73  ? 84.255 21.822  -6.655  1.00 26.66 ? 73   ALA A N     1 
ATOM   954  C  CA    . ALA C 3 73  ? 85.074 20.787  -7.289  1.00 27.71 ? 73   ALA A CA    1 
ATOM   955  C  C     . ALA C 3 73  ? 85.349 21.204  -8.735  1.00 27.48 ? 73   ALA A C     1 
ATOM   956  O  O     . ALA C 3 73  ? 86.451 21.028  -9.256  1.00 27.22 ? 73   ALA A O     1 
ATOM   957  C  CB    . ALA C 3 73  ? 84.353 19.438  -7.264  1.00 26.24 ? 73   ALA A CB    1 
ATOM   958  N  N     . LYS C 3 74  ? 84.335 21.756  -9.385  1.00 27.39 ? 74   LYS A N     1 
ATOM   959  C  CA    . LYS C 3 74  ? 84.499 22.190  -10.759 1.00 29.53 ? 74   LYS A CA    1 
ATOM   960  C  C     . LYS C 3 74  ? 85.442 23.399  -10.864 1.00 30.79 ? 74   LYS A C     1 
ATOM   961  O  O     . LYS C 3 74  ? 86.392 23.385  -11.653 1.00 31.46 ? 74   LYS A O     1 
ATOM   962  C  CB    . LYS C 3 74  ? 83.131 22.513  -11.367 1.00 30.40 ? 74   LYS A CB    1 
ATOM   963  C  CG    . LYS C 3 74  ? 83.189 23.152  -12.743 1.00 33.46 ? 74   LYS A CG    1 
ATOM   964  C  CD    . LYS C 3 74  ? 84.061 22.373  -13.703 1.00 35.98 ? 74   LYS A CD    1 
ATOM   965  C  CE    . LYS C 3 74  ? 83.537 20.970  -13.920 1.00 40.02 ? 74   LYS A CE    1 
ATOM   966  N  NZ    . LYS C 3 74  ? 84.366 20.239  -14.922 1.00 45.37 ? 74   LYS A NZ    1 
ATOM   967  N  N     . LEU C 3 75  ? 85.188 24.433  -10.064 1.00 30.49 ? 75   LEU A N     1 
ATOM   968  C  CA    . LEU C 3 75  ? 86.010 25.644  -10.082 1.00 30.30 ? 75   LEU A CA    1 
ATOM   969  C  C     . LEU C 3 75  ? 87.468 25.458  -9.652  1.00 30.28 ? 75   LEU A C     1 
ATOM   970  O  O     . LEU C 3 75  ? 88.377 25.948  -10.317 1.00 30.90 ? 75   LEU A O     1 
ATOM   971  C  CB    . LEU C 3 75  ? 85.397 26.733  -9.192  1.00 29.70 ? 75   LEU A CB    1 
ATOM   972  C  CG    . LEU C 3 75  ? 84.183 27.530  -9.677  1.00 34.47 ? 75   LEU A CG    1 
ATOM   973  C  CD1   . LEU C 3 75  ? 83.802 28.553  -8.611  1.00 32.44 ? 75   LEU A CD1   1 
ATOM   974  C  CD2   . LEU C 3 75  ? 84.512 28.242  -10.996 1.00 34.29 ? 75   LEU A CD2   1 
ATOM   975  N  N     . GLN C 3 76  ? 87.693 24.764  -8.541  1.00 29.41 ? 76   GLN A N     1 
ATOM   976  C  CA    . GLN C 3 76  ? 89.054 24.588  -8.041  1.00 28.80 ? 76   GLN A CA    1 
ATOM   977  C  C     . GLN C 3 76  ? 89.835 23.400  -8.582  1.00 29.68 ? 76   GLN A C     1 
ATOM   978  O  O     . GLN C 3 76  ? 91.063 23.451  -8.670  1.00 28.52 ? 76   GLN A O     1 
ATOM   979  C  CB    . GLN C 3 76  ? 89.049 24.493  -6.515  1.00 29.15 ? 76   GLN A CB    1 
ATOM   980  C  CG    . GLN C 3 76  ? 88.488 25.709  -5.795  1.00 31.93 ? 76   GLN A CG    1 
ATOM   981  C  CD    . GLN C 3 76  ? 88.662 25.613  -4.286  1.00 33.38 ? 76   GLN A CD    1 
ATOM   982  O  OE1   . GLN C 3 76  ? 89.782 25.649  -3.778  1.00 37.54 ? 76   GLN A OE1   1 
ATOM   983  N  NE2   . GLN C 3 76  ? 87.553 25.476  -3.564  1.00 33.21 ? 76   GLN A NE2   1 
ATOM   984  N  N     . LEU C 3 77  ? 89.140 22.330  -8.945  1.00 28.65 ? 77   LEU A N     1 
ATOM   985  C  CA    . LEU C 3 77  ? 89.831 21.137  -9.407  1.00 29.38 ? 77   LEU A CA    1 
ATOM   986  C  C     . LEU C 3 77  ? 89.443 20.679  -10.794 1.00 29.83 ? 77   LEU A C     1 
ATOM   987  O  O     . LEU C 3 77  ? 89.946 19.671  -11.273 1.00 28.71 ? 77   LEU A O     1 
ATOM   988  C  CB    . LEU C 3 77  ? 89.577 19.992  -8.419  1.00 29.29 ? 77   LEU A CB    1 
ATOM   989  C  CG    . LEU C 3 77  ? 90.012 20.249  -6.977  1.00 29.20 ? 77   LEU A CG    1 
ATOM   990  C  CD1   . LEU C 3 77  ? 89.565 19.087  -6.085  1.00 29.42 ? 77   LEU A CD1   1 
ATOM   991  C  CD2   . LEU C 3 77  ? 91.532 20.415  -6.936  1.00 30.56 ? 77   LEU A CD2   1 
ATOM   992  N  N     . ASN C 3 78  ? 88.555 21.417  -11.440 1.00 31.73 ? 78   ASN A N     1 
ATOM   993  C  CA    . ASN C 3 78  ? 88.085 21.027  -12.756 1.00 35.45 ? 78   ASN A CA    1 
ATOM   994  C  C     . ASN C 3 78  ? 87.555 19.592  -12.679 1.00 35.35 ? 78   ASN A C     1 
ATOM   995  O  O     . ASN C 3 78  ? 87.760 18.791  -13.597 1.00 37.31 ? 78   ASN A O     1 
ATOM   996  C  CB    . ASN C 3 78  ? 89.219 21.120  -13.783 1.00 37.53 ? 78   ASN A CB    1 
ATOM   997  C  CG    . ASN C 3 78  ? 88.711 21.002  -15.197 1.00 40.97 ? 78   ASN A CG    1 
ATOM   998  O  OD1   . ASN C 3 78  ? 87.570 21.378  -15.481 1.00 43.49 ? 78   ASN A OD1   1 
ATOM   999  N  ND2   . ASN C 3 78  ? 89.547 20.490  -16.100 1.00 43.30 ? 78   ASN A ND2   1 
ATOM   1000 N  N     . ARG C 3 79  ? 86.873 19.276  -11.576 1.00 33.89 ? 79   ARG A N     1 
ATOM   1001 C  CA    . ARG C 3 79  ? 86.319 17.938  -11.364 1.00 32.30 ? 79   ARG A CA    1 
ATOM   1002 C  C     . ARG C 3 79  ? 84.791 17.932  -11.295 1.00 31.12 ? 79   ARG A C     1 
ATOM   1003 O  O     . ARG C 3 79  ? 84.178 18.860  -10.771 1.00 30.73 ? 79   ARG A O     1 
ATOM   1004 C  CB    . ARG C 3 79  ? 86.857 17.320  -10.058 1.00 33.66 ? 79   ARG A CB    1 
ATOM   1005 C  CG    . ARG C 3 79  ? 86.386 15.869  -9.854  1.00 33.55 ? 79   ARG A CG    1 
ATOM   1006 C  CD    . ARG C 3 79  ? 86.313 15.388  -8.404  1.00 35.56 ? 79   ARG A CD    1 
ATOM   1007 N  NE    . ARG C 3 79  ? 87.595 15.338  -7.713  1.00 35.72 ? 79   ARG A NE    1 
ATOM   1008 C  CZ    . ARG C 3 79  ? 87.905 14.464  -6.755  1.00 32.32 ? 79   ARG A CZ    1 
ATOM   1009 N  NH1   . ARG C 3 79  ? 87.031 13.540  -6.363  1.00 29.86 ? 79   ARG A NH1   1 
ATOM   1010 N  NH2   . ARG C 3 79  ? 89.091 14.532  -6.167  1.00 29.64 ? 79   ARG A NH2   1 
ATOM   1011 N  N     . GLU C 3 80  ? 84.190 16.875  -11.836 1.00 30.21 ? 80   GLU A N     1 
ATOM   1012 C  CA    . GLU C 3 80  ? 82.744 16.682  -11.806 1.00 30.69 ? 80   GLU A CA    1 
ATOM   1013 C  C     . GLU C 3 80  ? 82.442 15.929  -10.502 1.00 30.28 ? 80   GLU A C     1 
ATOM   1014 O  O     . GLU C 3 80  ? 82.906 14.805  -10.312 1.00 31.07 ? 80   GLU A O     1 
ATOM   1015 C  CB    . GLU C 3 80  ? 82.288 15.827  -12.994 1.00 30.07 ? 80   GLU A CB    1 
ATOM   1016 C  CG    . GLU C 3 80  ? 82.426 16.485  -14.363 1.00 33.09 ? 80   GLU A CG    1 
ATOM   1017 C  CD    . GLU C 3 80  ? 81.599 17.747  -14.498 1.00 36.23 ? 80   GLU A CD    1 
ATOM   1018 O  OE1   . GLU C 3 80  ? 80.424 17.745  -14.070 1.00 36.64 ? 80   GLU A OE1   1 
ATOM   1019 O  OE2   . GLU C 3 80  ? 82.118 18.743  -15.044 1.00 39.86 ? 80   GLU A OE2   1 
ATOM   1020 N  N     . PHE C 3 81  ? 81.687 16.548  -9.600  1.00 28.81 ? 81   PHE A N     1 
ATOM   1021 C  CA    . PHE C 3 81  ? 81.353 15.919  -8.317  1.00 28.08 ? 81   PHE A CA    1 
ATOM   1022 C  C     . PHE C 3 81  ? 79.855 16.066  -8.096  1.00 27.60 ? 81   PHE A C     1 
ATOM   1023 O  O     . PHE C 3 81  ? 79.330 17.182  -8.051  1.00 28.22 ? 81   PHE A O     1 
ATOM   1024 C  CB    . PHE C 3 81  ? 82.123 16.606  -7.178  1.00 27.90 ? 81   PHE A CB    1 
ATOM   1025 C  CG    . PHE C 3 81  ? 81.857 16.028  -5.808  1.00 28.09 ? 81   PHE A CG    1 
ATOM   1026 C  CD1   . PHE C 3 81  ? 82.574 14.923  -5.347  1.00 25.90 ? 81   PHE A CD1   1 
ATOM   1027 C  CD2   . PHE C 3 81  ? 80.922 16.622  -4.959  1.00 26.34 ? 81   PHE A CD2   1 
ATOM   1028 C  CE1   . PHE C 3 81  ? 82.371 14.420  -4.057  1.00 26.65 ? 81   PHE A CE1   1 
ATOM   1029 C  CE2   . PHE C 3 81  ? 80.709 16.131  -3.671  1.00 26.12 ? 81   PHE A CE2   1 
ATOM   1030 C  CZ    . PHE C 3 81  ? 81.437 15.028  -3.215  1.00 26.72 ? 81   PHE A CZ    1 
ATOM   1031 N  N     . HIS C 3 82  ? 79.168 14.937  -7.963  1.00 27.07 ? 82   HIS A N     1 
ATOM   1032 C  CA    . HIS C 3 82  ? 77.722 14.946  -7.773  1.00 27.13 ? 82   HIS A CA    1 
ATOM   1033 C  C     . HIS C 3 82  ? 77.272 13.844  -6.827  1.00 26.93 ? 82   HIS A C     1 
ATOM   1034 O  O     . HIS C 3 82  ? 77.052 12.706  -7.247  1.00 27.11 ? 82   HIS A O     1 
ATOM   1035 C  CB    . HIS C 3 82  ? 77.029 14.760  -9.122  1.00 27.57 ? 82   HIS A CB    1 
ATOM   1036 C  CG    . HIS C 3 82  ? 77.513 15.698  -10.184 1.00 30.67 ? 82   HIS A CG    1 
ATOM   1037 N  ND1   . HIS C 3 82  ? 76.995 16.965  -10.354 1.00 30.47 ? 82   HIS A ND1   1 
ATOM   1038 C  CD2   . HIS C 3 82  ? 78.491 15.562  -11.112 1.00 29.29 ? 82   HIS A CD2   1 
ATOM   1039 C  CE1   . HIS C 3 82  ? 77.633 17.569  -11.342 1.00 28.49 ? 82   HIS A CE1   1 
ATOM   1040 N  NE2   . HIS C 3 82  ? 78.544 16.740  -11.819 1.00 29.17 ? 82   HIS A NE2   1 
ATOM   1041 N  N     . LEU C 3 83  ? 77.138 14.173  -5.549  1.00 25.73 ? 83   LEU A N     1 
ATOM   1042 C  CA    . LEU C 3 83  ? 76.686 13.182  -4.579  1.00 25.16 ? 83   LEU A CA    1 
ATOM   1043 C  C     . LEU C 3 83  ? 75.231 12.873  -4.915  1.00 24.56 ? 83   LEU A C     1 
ATOM   1044 O  O     . LEU C 3 83  ? 74.442 13.779  -5.136  1.00 23.51 ? 83   LEU A O     1 
ATOM   1045 C  CB    . LEU C 3 83  ? 76.783 13.737  -3.154  1.00 24.13 ? 83   LEU A CB    1 
ATOM   1046 C  CG    . LEU C 3 83  ? 78.196 14.034  -2.656  1.00 24.41 ? 83   LEU A CG    1 
ATOM   1047 C  CD1   . LEU C 3 83  ? 78.120 14.724  -1.309  1.00 25.58 ? 83   LEU A CD1   1 
ATOM   1048 C  CD2   . LEU C 3 83  ? 78.989 12.737  -2.550  1.00 24.20 ? 83   LEU A CD2   1 
ATOM   1049 N  N     . PRO C 3 84  ? 74.870 11.586  -4.994  1.00 25.50 ? 84   PRO A N     1 
ATOM   1050 C  CA    . PRO C 3 84  ? 73.486 11.218  -5.310  1.00 24.54 ? 84   PRO A CA    1 
ATOM   1051 C  C     . PRO C 3 84  ? 72.560 11.514  -4.139  1.00 24.70 ? 84   PRO A C     1 
ATOM   1052 O  O     . PRO C 3 84  ? 72.955 11.425  -2.973  1.00 23.82 ? 84   PRO A O     1 
ATOM   1053 C  CB    . PRO C 3 84  ? 73.574 9.718   -5.589  1.00 23.99 ? 84   PRO A CB    1 
ATOM   1054 C  CG    . PRO C 3 84  ? 75.028 9.535   -6.049  1.00 25.60 ? 84   PRO A CG    1 
ATOM   1055 C  CD    . PRO C 3 84  ? 75.763 10.416  -5.076  1.00 25.31 ? 84   PRO A CD    1 
ATOM   1056 N  N     . ARG C 3 85  ? 71.325 11.869  -4.462  1.00 24.86 ? 85   ARG A N     1 
ATOM   1057 C  CA    . ARG C 3 85  ? 70.316 12.164  -3.455  1.00 24.17 ? 85   ARG A CA    1 
ATOM   1058 C  C     . ARG C 3 85  ? 70.150 11.007  -2.464  1.00 23.60 ? 85   ARG A C     1 
ATOM   1059 O  O     . ARG C 3 85  ? 70.045 11.233  -1.254  1.00 23.16 ? 85   ARG A O     1 
ATOM   1060 C  CB    . ARG C 3 85  ? 68.984 12.444  -4.149  1.00 25.63 ? 85   ARG A CB    1 
ATOM   1061 C  CG    . ARG C 3 85  ? 67.865 12.914  -3.246  1.00 26.70 ? 85   ARG A CG    1 
ATOM   1062 C  CD    . ARG C 3 85  ? 66.658 12.053  -3.498  1.00 32.99 ? 85   ARG A CD    1 
ATOM   1063 N  NE    . ARG C 3 85  ? 66.688 10.862  -2.664  1.00 35.06 ? 85   ARG A NE    1 
ATOM   1064 C  CZ    . ARG C 3 85  ? 66.172 9.691   -3.007  1.00 32.12 ? 85   ARG A CZ    1 
ATOM   1065 N  NH1   . ARG C 3 85  ? 65.590 9.543   -4.184  1.00 33.37 ? 85   ARG A NH1   1 
ATOM   1066 N  NH2   . ARG C 3 85  ? 66.214 8.679   -2.155  1.00 32.09 ? 85   ARG A NH2   1 
ATOM   1067 N  N     . GLU C 3 86  ? 70.158 9.777   -2.978  1.00 23.87 ? 86   GLU A N     1 
ATOM   1068 C  CA    . GLU C 3 86  ? 69.984 8.573   -2.150  1.00 25.28 ? 86   GLU A CA    1 
ATOM   1069 C  C     . GLU C 3 86  ? 71.015 8.390   -1.047  1.00 24.68 ? 86   GLU A C     1 
ATOM   1070 O  O     . GLU C 3 86  ? 70.740 7.695   -0.065  1.00 23.27 ? 86   GLU A O     1 
ATOM   1071 C  CB    . GLU C 3 86  ? 70.031 7.284   -2.984  1.00 29.26 ? 86   GLU A CB    1 
ATOM   1072 C  CG    . GLU C 3 86  ? 69.319 7.286   -4.309  1.00 35.89 ? 86   GLU A CG    1 
ATOM   1073 C  CD    . GLU C 3 86  ? 70.138 7.919   -5.415  1.00 37.44 ? 86   GLU A CD    1 
ATOM   1074 O  OE1   . GLU C 3 86  ? 70.020 9.150   -5.604  1.00 37.21 ? 86   GLU A OE1   1 
ATOM   1075 O  OE2   . GLU C 3 86  ? 70.898 7.179   -6.086  1.00 39.51 ? 86   GLU A OE2   1 
ATOM   1076 N  N     . ASN C 3 87  ? 72.203 8.974   -1.214  1.00 23.21 ? 87   ASN A N     1 
ATOM   1077 C  CA    . ASN C 3 87  ? 73.259 8.813   -0.215  1.00 22.82 ? 87   ASN A CA    1 
ATOM   1078 C  C     . ASN C 3 87  ? 73.378 9.939   0.795   1.00 22.12 ? 87   ASN A C     1 
ATOM   1079 O  O     . ASN C 3 87  ? 74.276 9.910   1.639   1.00 21.89 ? 87   ASN A O     1 
ATOM   1080 C  CB    . ASN C 3 87  ? 74.625 8.650   -0.885  1.00 25.27 ? 87   ASN A CB    1 
ATOM   1081 C  CG    . ASN C 3 87  ? 74.655 7.511   -1.879  1.00 25.71 ? 87   ASN A CG    1 
ATOM   1082 O  OD1   . ASN C 3 87  ? 74.456 7.716   -3.068  1.00 26.97 ? 87   ASN A OD1   1 
ATOM   1083 N  ND2   . ASN C 3 87  ? 74.887 6.298   -1.390  1.00 26.72 ? 87   ASN A ND2   1 
ATOM   1084 N  N     . CYS C 3 88  ? 72.482 10.915  0.730   1.00 20.69 ? 88   CYS A N     1 
ATOM   1085 C  CA    . CYS C 3 88  ? 72.569 12.038  1.642   1.00 20.59 ? 88   CYS A CA    1 
ATOM   1086 C  C     . CYS C 3 88  ? 71.451 12.152  2.658   1.00 20.24 ? 88   CYS A C     1 
ATOM   1087 O  O     . CYS C 3 88  ? 70.286 11.898  2.371   1.00 21.94 ? 88   CYS A O     1 
ATOM   1088 C  CB    . CYS C 3 88  ? 72.674 13.338  0.846   1.00 21.01 ? 88   CYS A CB    1 
ATOM   1089 S  SG    . CYS C 3 88  ? 74.068 13.360  -0.329  1.00 26.45 ? 88   CYS A SG    1 
ATOM   1090 N  N     . ILE C 3 89  ? 71.845 12.531  3.863   1.00 21.24 ? 89   ILE A N     1 
ATOM   1091 C  CA    . ILE C 3 89  ? 70.933 12.731  4.976   1.00 22.31 ? 89   ILE A CA    1 
ATOM   1092 C  C     . ILE C 3 89  ? 71.184 14.162  5.461   1.00 22.37 ? 89   ILE A C     1 
ATOM   1093 O  O     . ILE C 3 89  ? 72.317 14.628  5.471   1.00 24.97 ? 89   ILE A O     1 
ATOM   1094 C  CB    . ILE C 3 89  ? 71.215 11.719  6.102   1.00 22.33 ? 89   ILE A CB    1 
ATOM   1095 C  CG1   . ILE C 3 89  ? 70.770 10.328  5.647   1.00 22.59 ? 89   ILE A CG1   1 
ATOM   1096 C  CG2   . ILE C 3 89  ? 70.506 12.142  7.385   1.00 22.62 ? 89   ILE A CG2   1 
ATOM   1097 C  CD1   . ILE C 3 89  ? 71.224 9.217   6.572   1.00 27.77 ? 89   ILE A CD1   1 
ATOM   1098 N  N     . ASP C 3 90  ? 70.124 14.855  5.849   1.00 22.41 ? 90   ASP A N     1 
ATOM   1099 C  CA    . ASP C 3 90  ? 70.236 16.237  6.292   1.00 22.59 ? 90   ASP A CA    1 
ATOM   1100 C  C     . ASP C 3 90  ? 69.575 16.357  7.663   1.00 22.01 ? 90   ASP A C     1 
ATOM   1101 O  O     . ASP C 3 90  ? 68.356 16.215  7.780   1.00 21.39 ? 90   ASP A O     1 
ATOM   1102 C  CB    . ASP C 3 90  ? 69.530 17.144  5.273   1.00 22.88 ? 90   ASP A CB    1 
ATOM   1103 C  CG    . ASP C 3 90  ? 69.801 18.617  5.505   1.00 24.48 ? 90   ASP A CG    1 
ATOM   1104 O  OD1   . ASP C 3 90  ? 69.801 19.051  6.679   1.00 28.29 ? 90   ASP A OD1   1 
ATOM   1105 O  OD2   . ASP C 3 90  ? 69.999 19.349  4.509   1.00 26.75 ? 90   ASP A OD2   1 
ATOM   1106 N  N     . THR C 3 91  ? 70.373 16.611  8.699   1.00 22.74 ? 91   THR A N     1 
ATOM   1107 C  CA    . THR C 3 91  ? 69.824 16.718  10.047  1.00 22.04 ? 91   THR A CA    1 
ATOM   1108 C  C     . THR C 3 91  ? 68.873 17.900  10.206  1.00 23.64 ? 91   THR A C     1 
ATOM   1109 O  O     . THR C 3 91  ? 67.980 17.873  11.053  1.00 25.12 ? 91   THR A O     1 
ATOM   1110 C  CB    . THR C 3 91  ? 70.944 16.748  11.118  1.00 24.54 ? 91   THR A CB    1 
ATOM   1111 O  OG1   . THR C 3 91  ? 71.929 17.737  10.781  1.00 23.56 ? 91   THR A OG1   1 
ATOM   1112 C  CG2   . THR C 3 91  ? 71.608 15.357  11.212  1.00 22.45 ? 91   THR A CG2   1 
ATOM   1113 N  N     . LEU C 3 92  ? 69.029 18.927  9.384   1.00 22.15 ? 92   LEU A N     1 
ATOM   1114 C  CA    . LEU C 3 92  ? 68.099 20.042  9.465   1.00 22.38 ? 92   LEU A CA    1 
ATOM   1115 C  C     . LEU C 3 92  ? 66.734 19.538  8.959   1.00 23.89 ? 92   LEU A C     1 
ATOM   1116 O  O     . LEU C 3 92  ? 65.704 19.776  9.589   1.00 23.38 ? 92   LEU A O     1 
ATOM   1117 C  CB    . LEU C 3 92  ? 68.568 21.212  8.607   1.00 23.38 ? 92   LEU A CB    1 
ATOM   1118 C  CG    . LEU C 3 92  ? 67.565 22.368  8.546   1.00 22.97 ? 92   LEU A CG    1 
ATOM   1119 C  CD1   . LEU C 3 92  ? 67.329 22.931  9.953   1.00 25.00 ? 92   LEU A CD1   1 
ATOM   1120 C  CD2   . LEU C 3 92  ? 68.096 23.452  7.634   1.00 27.62 ? 92   LEU A CD2   1 
ATOM   1121 N  N     . VAL C 3 93  ? 66.740 18.836  7.825   1.00 23.38 ? 93   VAL A N     1 
ATOM   1122 C  CA    . VAL C 3 93  ? 65.513 18.284  7.248   1.00 22.65 ? 93   VAL A CA    1 
ATOM   1123 C  C     . VAL C 3 93  ? 64.847 17.319  8.236   1.00 24.79 ? 93   VAL A C     1 
ATOM   1124 O  O     . VAL C 3 93  ? 63.623 17.319  8.399   1.00 25.14 ? 93   VAL A O     1 
ATOM   1125 C  CB    . VAL C 3 93  ? 65.805 17.523  5.922   1.00 23.56 ? 93   VAL A CB    1 
ATOM   1126 C  CG1   . VAL C 3 93  ? 64.521 16.869  5.389   1.00 21.31 ? 93   VAL A CG1   1 
ATOM   1127 C  CG2   . VAL C 3 93  ? 66.369 18.490  4.872   1.00 22.33 ? 93   VAL A CG2   1 
ATOM   1128 N  N     . LEU C 3 94  ? 65.653 16.490  8.891   1.00 24.04 ? 94   LEU A N     1 
ATOM   1129 C  CA    . LEU C 3 94  ? 65.124 15.543  9.861   1.00 24.09 ? 94   LEU A CA    1 
ATOM   1130 C  C     . LEU C 3 94  ? 64.525 16.248  11.073  1.00 23.86 ? 94   LEU A C     1 
ATOM   1131 O  O     . LEU C 3 94  ? 63.481 15.831  11.578  1.00 24.22 ? 94   LEU A O     1 
ATOM   1132 C  CB    . LEU C 3 94  ? 66.210 14.580  10.340  1.00 26.93 ? 94   LEU A CB    1 
ATOM   1133 C  CG    . LEU C 3 94  ? 66.259 13.186  9.715   1.00 30.35 ? 94   LEU A CG    1 
ATOM   1134 C  CD1   . LEU C 3 94  ? 67.260 12.349  10.510  1.00 30.43 ? 94   LEU A CD1   1 
ATOM   1135 C  CD2   . LEU C 3 94  ? 64.867 12.528  9.754   1.00 28.95 ? 94   LEU A CD2   1 
ATOM   1136 N  N     . SER C 3 95  ? 65.190 17.306  11.539  1.00 21.96 ? 95   SER A N     1 
ATOM   1137 C  CA    . SER C 3 95  ? 64.717 18.070  12.690  1.00 21.82 ? 95   SER A CA    1 
ATOM   1138 C  C     . SER C 3 95  ? 63.382 18.739  12.395  1.00 21.83 ? 95   SER A C     1 
ATOM   1139 O  O     . SER C 3 95  ? 62.491 18.784  13.244  1.00 22.31 ? 95   SER A O     1 
ATOM   1140 C  CB    . SER C 3 95  ? 65.730 19.156  13.071  1.00 21.43 ? 95   SER A CB    1 
ATOM   1141 O  OG    . SER C 3 95  ? 66.925 18.586  13.562  1.00 31.08 ? 95   SER A OG    1 
ATOM   1142 N  N     . ARG C 3 96  ? 63.260 19.282  11.192  1.00 21.92 ? 96   ARG A N     1 
ATOM   1143 C  CA    . ARG C 3 96  ? 62.040 19.955  10.802  1.00 22.70 ? 96   ARG A CA    1 
ATOM   1144 C  C     . ARG C 3 96  ? 60.884 18.971  10.686  1.00 24.74 ? 96   ARG A C     1 
ATOM   1145 O  O     . ARG C 3 96  ? 59.715 19.358  10.797  1.00 26.18 ? 96   ARG A O     1 
ATOM   1146 C  CB    . ARG C 3 96  ? 62.267 20.726  9.498   1.00 21.26 ? 96   ARG A CB    1 
ATOM   1147 C  CG    . ARG C 3 96  ? 63.044 22.034  9.746   1.00 21.42 ? 96   ARG A CG    1 
ATOM   1148 C  CD    . ARG C 3 96  ? 63.494 22.744  8.465   1.00 24.59 ? 96   ARG A CD    1 
ATOM   1149 N  NE    . ARG C 3 96  ? 63.996 24.088  8.768   1.00 24.74 ? 96   ARG A NE    1 
ATOM   1150 C  CZ    . ARG C 3 96  ? 64.515 24.935  7.881   1.00 25.73 ? 96   ARG A CZ    1 
ATOM   1151 N  NH1   . ARG C 3 96  ? 64.628 24.591  6.605   1.00 26.43 ? 96   ARG A NH1   1 
ATOM   1152 N  NH2   . ARG C 3 96  ? 64.887 26.153  8.269   1.00 25.47 ? 96   ARG A NH2   1 
ATOM   1153 N  N     . LEU C 3 97  ? 61.205 17.699  10.471  1.00 25.02 ? 97   LEU A N     1 
ATOM   1154 C  CA    . LEU C 3 97  ? 60.163 16.686  10.388  1.00 26.40 ? 97   LEU A CA    1 
ATOM   1155 C  C     . LEU C 3 97  ? 59.789 16.233  11.804  1.00 27.15 ? 97   LEU A C     1 
ATOM   1156 O  O     . LEU C 3 97  ? 58.632 16.295  12.200  1.00 28.48 ? 97   LEU A O     1 
ATOM   1157 C  CB    . LEU C 3 97  ? 60.630 15.474  9.579   1.00 25.37 ? 97   LEU A CB    1 
ATOM   1158 C  CG    . LEU C 3 97  ? 59.725 14.235  9.685   1.00 27.47 ? 97   LEU A CG    1 
ATOM   1159 C  CD1   . LEU C 3 97  ? 58.297 14.573  9.189   1.00 23.55 ? 97   LEU A CD1   1 
ATOM   1160 C  CD2   . LEU C 3 97  ? 60.323 13.092  8.867   1.00 26.17 ? 97   LEU A CD2   1 
ATOM   1161 N  N     . ILE C 3 98  ? 60.785 15.808  12.568  1.00 27.77 ? 98   ILE A N     1 
ATOM   1162 C  CA    . ILE C 3 98  ? 60.555 15.317  13.916  1.00 29.38 ? 98   ILE A CA    1 
ATOM   1163 C  C     . ILE C 3 98  ? 60.133 16.384  14.924  1.00 29.92 ? 98   ILE A C     1 
ATOM   1164 O  O     . ILE C 3 98  ? 59.276 16.128  15.765  1.00 27.57 ? 98   ILE A O     1 
ATOM   1165 C  CB    . ILE C 3 98  ? 61.797 14.543  14.410  1.00 31.21 ? 98   ILE A CB    1 
ATOM   1166 C  CG1   . ILE C 3 98  ? 62.000 13.319  13.507  1.00 32.48 ? 98   ILE A CG1   1 
ATOM   1167 C  CG2   . ILE C 3 98  ? 61.622 14.104  15.860  1.00 32.55 ? 98   ILE A CG2   1 
ATOM   1168 C  CD1   . ILE C 3 98  ? 63.162 12.436  13.898  1.00 32.98 ? 98   ILE A CD1   1 
ATOM   1169 N  N     . HIS C 3 99  ? 60.715 17.575  14.840  1.00 31.12 ? 99   HIS A N     1 
ATOM   1170 C  CA    . HIS C 3 99  ? 60.355 18.663  15.757  1.00 32.83 ? 99   HIS A CA    1 
ATOM   1171 C  C     . HIS C 3 99  ? 59.582 19.749  15.008  1.00 33.17 ? 99   HIS A C     1 
ATOM   1172 O  O     . HIS C 3 99  ? 59.839 20.946  15.184  1.00 33.18 ? 99   HIS A O     1 
ATOM   1173 C  CB    . HIS C 3 99  ? 61.617 19.263  16.373  1.00 33.76 ? 99   HIS A CB    1 
ATOM   1174 C  CG    . HIS C 3 99  ? 62.417 18.281  17.166  1.00 38.18 ? 99   HIS A CG    1 
ATOM   1175 N  ND1   . HIS C 3 99  ? 62.022 17.830  18.408  1.00 37.04 ? 99   HIS A ND1   1 
ATOM   1176 C  CD2   . HIS C 3 99  ? 63.560 17.617  16.870  1.00 38.78 ? 99   HIS A CD2   1 
ATOM   1177 C  CE1   . HIS C 3 99  ? 62.885 16.928  18.841  1.00 38.35 ? 99   HIS A CE1   1 
ATOM   1178 N  NE2   . HIS C 3 99  ? 63.827 16.780  17.926  1.00 39.68 ? 99   HIS A NE2   1 
ATOM   1179 N  N     . SER C 3 100 ? 58.638 19.322  14.175  1.00 33.22 ? 100  SER A N     1 
ATOM   1180 C  CA    . SER C 3 100 ? 57.838 20.234  13.362  1.00 34.07 ? 100  SER A CA    1 
ATOM   1181 C  C     . SER C 3 100 ? 57.009 21.238  14.163  1.00 36.63 ? 100  SER A C     1 
ATOM   1182 O  O     . SER C 3 100 ? 56.542 22.241  13.620  1.00 37.15 ? 100  SER A O     1 
ATOM   1183 C  CB    . SER C 3 100 ? 56.914 19.431  12.443  1.00 32.72 ? 100  SER A CB    1 
ATOM   1184 O  OG    . SER C 3 100 ? 56.092 18.555  13.197  1.00 32.64 ? 100  SER A OG    1 
ATOM   1185 N  N     . ASN C 3 101 ? 56.824 20.965  15.450  1.00 37.58 ? 101  ASN A N     1 
ATOM   1186 C  CA    . ASN C 3 101 ? 56.043 21.848  16.310  1.00 39.75 ? 101  ASN A CA    1 
ATOM   1187 C  C     . ASN C 3 101 ? 56.878 23.025  16.818  1.00 38.54 ? 101  ASN A C     1 
ATOM   1188 O  O     . ASN C 3 101 ? 56.362 23.925  17.470  1.00 39.01 ? 101  ASN A O     1 
ATOM   1189 C  CB    . ASN C 3 101 ? 55.484 21.054  17.495  1.00 39.17 ? 101  ASN A CB    1 
ATOM   1190 C  CG    . ASN C 3 101 ? 56.575 20.362  18.296  1.00 42.30 ? 101  ASN A CG    1 
ATOM   1191 O  OD1   . ASN C 3 101 ? 57.420 19.657  17.738  1.00 42.00 ? 101  ASN A OD1   1 
ATOM   1192 N  ND2   . ASN C 3 101 ? 56.558 20.555  19.612  1.00 43.55 ? 101  ASN A ND2   1 
ATOM   1193 N  N     . LEU C 3 102 ? 58.169 23.011  16.513  1.00 38.80 ? 102  LEU A N     1 
ATOM   1194 C  CA    . LEU C 3 102 ? 59.064 24.080  16.936  1.00 39.55 ? 102  LEU A CA    1 
ATOM   1195 C  C     . LEU C 3 102 ? 59.538 24.868  15.723  1.00 40.01 ? 102  LEU A C     1 
ATOM   1196 O  O     . LEU C 3 102 ? 59.499 24.370  14.598  1.00 39.51 ? 102  LEU A O     1 
ATOM   1197 C  CB    . LEU C 3 102 ? 60.292 23.505  17.646  1.00 39.45 ? 102  LEU A CB    1 
ATOM   1198 C  CG    . LEU C 3 102 ? 60.099 22.535  18.815  1.00 40.23 ? 102  LEU A CG    1 
ATOM   1199 C  CD1   . LEU C 3 102 ? 61.478 22.148  19.361  1.00 38.72 ? 102  LEU A CD1   1 
ATOM   1200 C  CD2   . LEU C 3 102 ? 59.244 23.180  19.905  1.00 37.56 ? 102  LEU A CD2   1 
ATOM   1201 N  N     . LYS C 3 103 ? 59.978 26.102  15.957  1.00 41.31 ? 103  LYS A N     1 
ATOM   1202 C  CA    . LYS C 3 103 ? 60.503 26.941  14.888  1.00 40.64 ? 103  LYS A CA    1 
ATOM   1203 C  C     . LYS C 3 103 ? 62.021 26.848  14.993  1.00 40.80 ? 103  LYS A C     1 
ATOM   1204 O  O     . LYS C 3 103 ? 62.543 26.233  15.925  1.00 39.21 ? 103  LYS A O     1 
ATOM   1205 C  CB    . LYS C 3 103 ? 60.060 28.398  15.073  1.00 41.97 ? 103  LYS A CB    1 
ATOM   1206 C  CG    . LYS C 3 103 ? 58.556 28.628  14.927  1.00 44.28 ? 103  LYS A CG    1 
ATOM   1207 C  CD    . LYS C 3 103 ? 58.066 28.204  13.547  1.00 46.43 ? 103  LYS A CD    1 
ATOM   1208 C  CE    . LYS C 3 103 ? 56.544 28.282  13.424  1.00 48.69 ? 103  LYS A CE    1 
ATOM   1209 N  NZ    . LYS C 3 103 ? 56.024 29.678  13.478  1.00 48.88 ? 103  LYS A NZ    1 
ATOM   1210 N  N     . ASP C 3 104 ? 62.725 27.427  14.025  1.00 40.42 ? 104  ASP A N     1 
ATOM   1211 C  CA    . ASP C 3 104 ? 64.186 27.450  14.038  1.00 40.36 ? 104  ASP A CA    1 
ATOM   1212 C  C     . ASP C 3 104 ? 64.614 28.749  13.363  1.00 40.07 ? 104  ASP A C     1 
ATOM   1213 O  O     . ASP C 3 104 ? 63.795 29.419  12.731  1.00 39.81 ? 104  ASP A O     1 
ATOM   1214 C  CB    . ASP C 3 104 ? 64.789 26.225  13.315  1.00 40.90 ? 104  ASP A CB    1 
ATOM   1215 C  CG    . ASP C 3 104 ? 64.386 26.136  11.846  1.00 40.43 ? 104  ASP A CG    1 
ATOM   1216 O  OD1   . ASP C 3 104 ? 64.550 27.136  11.118  1.00 41.08 ? 104  ASP A OD1   1 
ATOM   1217 O  OD2   . ASP C 3 104 ? 63.917 25.055  11.417  1.00 39.49 ? 104  ASP A OD2   1 
ATOM   1218 N  N     . THR C 3 105 ? 65.884 29.112  13.503  1.00 38.50 ? 105  THR A N     1 
ATOM   1219 C  CA    . THR C 3 105 ? 66.379 30.353  12.912  1.00 38.71 ? 105  THR A CA    1 
ATOM   1220 C  C     . THR C 3 105 ? 66.689 30.240  11.417  1.00 39.28 ? 105  THR A C     1 
ATOM   1221 O  O     . THR C 3 105 ? 67.205 31.185  10.810  1.00 37.40 ? 105  THR A O     1 
ATOM   1222 C  CB    . THR C 3 105 ? 67.651 30.830  13.625  1.00 38.47 ? 105  THR A CB    1 
ATOM   1223 O  OG1   . THR C 3 105 ? 68.662 29.826  13.507  1.00 37.25 ? 105  THR A OG1   1 
ATOM   1224 C  CG2   . THR C 3 105 ? 67.372 31.097  15.100  1.00 38.69 ? 105  THR A CG2   1 
ATOM   1225 N  N     . ASP C 3 106 ? 66.373 29.090  10.828  1.00 38.53 ? 106  ASP A N     1 
ATOM   1226 C  CA    . ASP C 3 106 ? 66.637 28.867  9.412   1.00 39.15 ? 106  ASP A CA    1 
ATOM   1227 C  C     . ASP C 3 106 ? 68.114 29.170  9.156   1.00 38.82 ? 106  ASP A C     1 
ATOM   1228 O  O     . ASP C 3 106 ? 68.478 29.938  8.256   1.00 36.03 ? 106  ASP A O     1 
ATOM   1229 C  CB    . ASP C 3 106 ? 65.734 29.764  8.556   1.00 41.30 ? 106  ASP A CB    1 
ATOM   1230 C  CG    . ASP C 3 106 ? 65.921 29.529  7.067   1.00 44.76 ? 106  ASP A CG    1 
ATOM   1231 O  OD1   . ASP C 3 106 ? 66.308 28.399  6.684   1.00 43.85 ? 106  ASP A OD1   1 
ATOM   1232 O  OD2   . ASP C 3 106 ? 65.669 30.471  6.282   1.00 46.71 ? 106  ASP A OD2   1 
ATOM   1233 N  N     . MET C 3 107 ? 68.945 28.562  9.998   1.00 37.71 ? 107  MET A N     1 
ATOM   1234 C  CA    . MET C 3 107 ? 70.391 28.688  9.950   1.00 38.85 ? 107  MET A CA    1 
ATOM   1235 C  C     . MET C 3 107 ? 70.923 30.093  10.218  1.00 39.26 ? 107  MET A C     1 
ATOM   1236 O  O     . MET C 3 107 ? 71.877 30.534  9.577   1.00 38.53 ? 107  MET A O     1 
ATOM   1237 C  CB    . MET C 3 107 ? 70.914 28.159  8.612   1.00 39.32 ? 107  MET A CB    1 
ATOM   1238 C  CG    . MET C 3 107 ? 70.849 26.646  8.505   1.00 37.80 ? 107  MET A CG    1 
ATOM   1239 S  SD    . MET C 3 107 ? 71.766 25.869  9.858   1.00 38.13 ? 107  MET A SD    1 
ATOM   1240 C  CE    . MET C 3 107 ? 73.466 26.017  9.251   1.00 36.37 ? 107  MET A CE    1 
ATOM   1241 N  N     . GLY C 3 108 ? 70.302 30.786  11.170  1.00 39.52 ? 108  GLY A N     1 
ATOM   1242 C  CA    . GLY C 3 108 ? 70.746 32.122  11.526  1.00 41.20 ? 108  GLY A CA    1 
ATOM   1243 C  C     . GLY C 3 108 ? 70.216 33.282  10.702  1.00 42.58 ? 108  GLY A C     1 
ATOM   1244 O  O     . GLY C 3 108 ? 70.591 34.429  10.946  1.00 42.18 ? 108  GLY A O     1 
ATOM   1245 N  N     . LEU C 3 109 ? 69.355 33.008  9.727   1.00 42.37 ? 109  LEU A N     1 
ATOM   1246 C  CA    . LEU C 3 109 ? 68.803 34.084  8.905   1.00 42.84 ? 109  LEU A CA    1 
ATOM   1247 C  C     . LEU C 3 109 ? 67.768 34.892  9.681   1.00 43.13 ? 109  LEU A C     1 
ATOM   1248 O  O     . LEU C 3 109 ? 67.556 36.070  9.401   1.00 43.39 ? 109  LEU A O     1 
ATOM   1249 C  CB    . LEU C 3 109 ? 68.162 33.515  7.636   1.00 40.05 ? 109  LEU A CB    1 
ATOM   1250 C  CG    . LEU C 3 109 ? 69.134 32.812  6.685   1.00 41.45 ? 109  LEU A CG    1 
ATOM   1251 C  CD1   . LEU C 3 109 ? 68.371 32.225  5.504   1.00 39.68 ? 109  LEU A CD1   1 
ATOM   1252 C  CD2   . LEU C 3 109 ? 70.194 33.808  6.218   1.00 40.70 ? 109  LEU A CD2   1 
ATOM   1253 N  N     . LEU C 3 110 ? 67.132 34.246  10.654  1.00 43.43 ? 110  LEU A N     1 
ATOM   1254 C  CA    . LEU C 3 110 ? 66.104 34.873  11.478  1.00 43.68 ? 110  LEU A CA    1 
ATOM   1255 C  C     . LEU C 3 110 ? 66.603 35.037  12.908  1.00 44.98 ? 110  LEU A C     1 
ATOM   1256 O  O     . LEU C 3 110 ? 67.311 34.174  13.433  1.00 45.08 ? 110  LEU A O     1 
ATOM   1257 C  CB    . LEU C 3 110 ? 64.841 34.006  11.482  1.00 43.08 ? 110  LEU A CB    1 
ATOM   1258 C  CG    . LEU C 3 110 ? 64.263 33.623  10.115  1.00 42.27 ? 110  LEU A CG    1 
ATOM   1259 C  CD1   . LEU C 3 110 ? 63.225 32.520  10.279  1.00 41.90 ? 110  LEU A CD1   1 
ATOM   1260 C  CD2   . LEU C 3 110 ? 63.660 34.849  9.453   1.00 39.56 ? 110  LEU A CD2   1 
ATOM   1261 N  N     . ARG C 3 111 ? 66.230 36.146  13.537  1.00 47.40 ? 111  ARG A N     1 
ATOM   1262 C  CA    . ARG C 3 111 ? 66.640 36.406  14.912  1.00 49.10 ? 111  ARG A CA    1 
ATOM   1263 C  C     . ARG C 3 111 ? 65.860 35.498  15.852  1.00 48.91 ? 111  ARG A C     1 
ATOM   1264 O  O     . ARG C 3 111 ? 64.640 35.610  15.970  1.00 49.00 ? 111  ARG A O     1 
ATOM   1265 C  CB    . ARG C 3 111 ? 66.399 37.874  15.269  1.00 50.70 ? 111  ARG A CB    1 
ATOM   1266 C  CG    . ARG C 3 111 ? 67.268 38.836  14.478  1.00 52.80 ? 111  ARG A CG    1 
ATOM   1267 C  CD    . ARG C 3 111 ? 67.014 40.278  14.878  1.00 56.32 ? 111  ARG A CD    1 
ATOM   1268 N  NE    . ARG C 3 111 ? 65.613 40.658  14.712  1.00 58.78 ? 111  ARG A NE    1 
ATOM   1269 C  CZ    . ARG C 3 111 ? 64.942 40.582  13.566  1.00 59.80 ? 111  ARG A CZ    1 
ATOM   1270 N  NH1   . ARG C 3 111 ? 65.538 40.135  12.466  1.00 59.78 ? 111  ARG A NH1   1 
ATOM   1271 N  NH2   . ARG C 3 111 ? 63.668 40.956  13.519  1.00 60.53 ? 111  ARG A NH2   1 
ATOM   1272 N  N     . SER C 3 112 ? 66.574 34.588  16.509  1.00 49.75 ? 112  SER A N     1 
ATOM   1273 C  CA    . SER C 3 112 ? 65.950 33.646  17.430  1.00 48.23 ? 112  SER A CA    1 
ATOM   1274 C  C     . SER C 3 112 ? 65.016 34.362  18.394  1.00 48.36 ? 112  SER A C     1 
ATOM   1275 O  O     . SER C 3 112 ? 63.958 33.845  18.747  1.00 48.45 ? 112  SER A O     1 
ATOM   1276 C  CB    . SER C 3 112 ? 67.028 32.876  18.201  1.00 49.35 ? 112  SER A CB    1 
ATOM   1277 O  OG    . SER C 3 112 ? 68.012 33.749  18.736  1.00 51.07 ? 112  SER A OG    1 
ATOM   1278 N  N     . GLY C 3 113 ? 65.403 35.569  18.795  1.00 48.86 ? 113  GLY A N     1 
ATOM   1279 C  CA    . GLY C 3 113 ? 64.594 36.339  19.723  1.00 47.93 ? 113  GLY A CA    1 
ATOM   1280 C  C     . GLY C 3 113 ? 63.162 36.608  19.297  1.00 47.48 ? 113  GLY A C     1 
ATOM   1281 O  O     . GLY C 3 113 ? 62.274 36.712  20.143  1.00 46.68 ? 113  GLY A O     1 
ATOM   1282 N  N     . LYS C 3 114 ? 62.927 36.715  17.992  1.00 47.69 ? 114  LYS A N     1 
ATOM   1283 C  CA    . LYS C 3 114 ? 61.587 36.993  17.481  1.00 47.29 ? 114  LYS A CA    1 
ATOM   1284 C  C     . LYS C 3 114 ? 60.710 35.751  17.321  1.00 47.43 ? 114  LYS A C     1 
ATOM   1285 O  O     . LYS C 3 114 ? 59.491 35.863  17.169  1.00 47.13 ? 114  LYS A O     1 
ATOM   1286 C  CB    . LYS C 3 114 ? 61.682 37.718  16.135  1.00 49.41 ? 114  LYS A CB    1 
ATOM   1287 N  N     . LEU C 3 115 ? 61.329 34.575  17.361  1.00 46.45 ? 115  LEU A N     1 
ATOM   1288 C  CA    . LEU C 3 115 ? 60.601 33.317  17.204  1.00 45.78 ? 115  LEU A CA    1 
ATOM   1289 C  C     . LEU C 3 115 ? 59.807 32.941  18.453  1.00 45.77 ? 115  LEU A C     1 
ATOM   1290 O  O     . LEU C 3 115 ? 60.263 33.143  19.582  1.00 44.84 ? 115  LEU A O     1 
ATOM   1291 C  CB    . LEU C 3 115 ? 61.577 32.183  16.873  1.00 44.34 ? 115  LEU A CB    1 
ATOM   1292 C  CG    . LEU C 3 115 ? 62.496 32.406  15.670  1.00 45.16 ? 115  LEU A CG    1 
ATOM   1293 C  CD1   . LEU C 3 115 ? 63.546 31.307  15.622  1.00 43.73 ? 115  LEU A CD1   1 
ATOM   1294 C  CD2   . LEU C 3 115 ? 61.671 32.443  14.384  1.00 44.22 ? 115  LEU A CD2   1 
ATOM   1295 N  N     . PRO C 3 116 ? 58.595 32.398  18.263  1.00 45.63 ? 116  PRO A N     1 
ATOM   1296 C  CA    . PRO C 3 116 ? 57.758 31.995  19.399  1.00 45.53 ? 116  PRO A CA    1 
ATOM   1297 C  C     . PRO C 3 116 ? 58.187 30.616  19.916  1.00 45.03 ? 116  PRO A C     1 
ATOM   1298 O  O     . PRO C 3 116 ? 58.815 29.842  19.188  1.00 45.57 ? 116  PRO A O     1 
ATOM   1299 C  CB    . PRO C 3 116 ? 56.356 31.980  18.797  1.00 45.21 ? 116  PRO A CB    1 
ATOM   1300 C  CG    . PRO C 3 116 ? 56.621 31.496  17.389  1.00 46.08 ? 116  PRO A CG    1 
ATOM   1301 C  CD    . PRO C 3 116 ? 57.850 32.301  16.993  1.00 45.61 ? 116  PRO A CD    1 
ATOM   1302 N  N     . GLY C 3 117 ? 57.863 30.324  21.173  1.00 43.80 ? 117  GLY A N     1 
ATOM   1303 C  CA    . GLY C 3 117 ? 58.206 29.035  21.754  1.00 42.44 ? 117  GLY A CA    1 
ATOM   1304 C  C     . GLY C 3 117 ? 59.685 28.751  21.975  1.00 42.21 ? 117  GLY A C     1 
ATOM   1305 O  O     . GLY C 3 117 ? 60.526 29.652  21.939  1.00 42.18 ? 117  GLY A O     1 
ATOM   1306 N  N     . ALA C 3 118 ? 60.002 27.480  22.200  1.00 40.40 ? 124  ALA A N     1 
ATOM   1307 C  CA    . ALA C 3 118 ? 61.378 27.063  22.445  1.00 39.05 ? 124  ALA A CA    1 
ATOM   1308 C  C     . ALA C 3 118 ? 62.069 26.615  21.166  1.00 37.68 ? 124  ALA A C     1 
ATOM   1309 O  O     . ALA C 3 118 ? 61.426 26.425  20.138  1.00 37.41 ? 124  ALA A O     1 
ATOM   1310 C  CB    . ALA C 3 118 ? 61.398 25.929  23.462  1.00 37.78 ? 124  ALA A CB    1 
ATOM   1311 N  N     . LEU C 3 119 ? 63.385 26.444  21.241  1.00 35.08 ? 125  LEU A N     1 
ATOM   1312 C  CA    . LEU C 3 119 ? 64.163 25.991  20.094  1.00 33.98 ? 125  LEU A CA    1 
ATOM   1313 C  C     . LEU C 3 119 ? 65.024 24.802  20.501  1.00 33.65 ? 125  LEU A C     1 
ATOM   1314 O  O     . LEU C 3 119 ? 65.549 24.751  21.613  1.00 31.46 ? 125  LEU A O     1 
ATOM   1315 C  CB    . LEU C 3 119 ? 65.060 27.112  19.559  1.00 32.33 ? 125  LEU A CB    1 
ATOM   1316 C  CG    . LEU C 3 119 ? 64.360 28.397  19.101  1.00 32.64 ? 125  LEU A CG    1 
ATOM   1317 C  CD1   . LEU C 3 119 ? 65.401 29.408  18.626  1.00 30.86 ? 125  LEU A CD1   1 
ATOM   1318 C  CD2   . LEU C 3 119 ? 63.374 28.078  17.992  1.00 31.82 ? 125  LEU A CD2   1 
ATOM   1319 N  N     . GLU C 3 120 ? 65.156 23.843  19.591  1.00 33.86 ? 126  GLU A N     1 
ATOM   1320 C  CA    . GLU C 3 120 ? 65.950 22.650  19.843  1.00 33.71 ? 126  GLU A CA    1 
ATOM   1321 C  C     . GLU C 3 120 ? 67.416 23.066  20.008  1.00 33.07 ? 126  GLU A C     1 
ATOM   1322 O  O     . GLU C 3 120 ? 67.986 23.739  19.153  1.00 31.81 ? 126  GLU A O     1 
ATOM   1323 C  CB    . GLU C 3 120 ? 65.753 21.664  18.688  1.00 33.38 ? 126  GLU A CB    1 
ATOM   1324 C  CG    . GLU C 3 120 ? 66.270 20.273  18.952  1.00 33.78 ? 126  GLU A CG    1 
ATOM   1325 C  CD    . GLU C 3 120 ? 67.768 20.207  18.857  1.00 31.83 ? 126  GLU A CD    1 
ATOM   1326 O  OE1   . GLU C 3 120 ? 68.305 20.739  17.867  1.00 33.10 ? 126  GLU A OE1   1 
ATOM   1327 O  OE2   . GLU C 3 120 ? 68.404 19.631  19.760  1.00 32.45 ? 126  GLU A OE2   1 
ATOM   1328 N  N     . ALA C 3 121 ? 68.004 22.657  21.130  1.00 33.61 ? 127  ALA A N     1 
ATOM   1329 C  CA    . ALA C 3 121 ? 69.379 22.999  21.505  1.00 33.79 ? 127  ALA A CA    1 
ATOM   1330 C  C     . ALA C 3 121 ? 70.489 22.811  20.462  1.00 33.44 ? 127  ALA A C     1 
ATOM   1331 O  O     . ALA C 3 121 ? 71.179 23.763  20.108  1.00 33.67 ? 127  ALA A O     1 
ATOM   1332 C  CB    . ALA C 3 121 ? 69.750 22.256  22.806  1.00 30.52 ? 127  ALA A CB    1 
ATOM   1333 N  N     . TRP C 3 122 ? 70.679 21.589  19.984  1.00 34.12 ? 128  TRP A N     1 
ATOM   1334 C  CA    . TRP C 3 122 ? 71.727 21.336  19.004  1.00 35.79 ? 128  TRP A CA    1 
ATOM   1335 C  C     . TRP C 3 122 ? 71.497 22.155  17.734  1.00 34.69 ? 128  TRP A C     1 
ATOM   1336 O  O     . TRP C 3 122 ? 72.423 22.756  17.190  1.00 33.35 ? 128  TRP A O     1 
ATOM   1337 C  CB    . TRP C 3 122 ? 71.780 19.847  18.664  1.00 38.52 ? 128  TRP A CB    1 
ATOM   1338 C  CG    . TRP C 3 122 ? 72.072 18.957  19.843  1.00 41.85 ? 128  TRP A CG    1 
ATOM   1339 C  CD1   . TRP C 3 122 ? 71.329 17.894  20.266  1.00 42.58 ? 128  TRP A CD1   1 
ATOM   1340 C  CD2   . TRP C 3 122 ? 73.202 19.031  20.725  1.00 43.21 ? 128  TRP A CD2   1 
ATOM   1341 N  NE1   . TRP C 3 122 ? 71.922 17.299  21.352  1.00 44.70 ? 128  TRP A NE1   1 
ATOM   1342 C  CE2   . TRP C 3 122 ? 73.074 17.976  21.656  1.00 44.14 ? 128  TRP A CE2   1 
ATOM   1343 C  CE3   . TRP C 3 122 ? 74.310 19.885  20.817  1.00 44.42 ? 128  TRP A CE3   1 
ATOM   1344 C  CZ2   . TRP C 3 122 ? 74.013 17.749  22.671  1.00 44.40 ? 128  TRP A CZ2   1 
ATOM   1345 C  CZ3   . TRP C 3 122 ? 75.246 19.658  21.829  1.00 45.63 ? 128  TRP A CZ3   1 
ATOM   1346 C  CH2   . TRP C 3 122 ? 75.088 18.597  22.742  1.00 44.85 ? 128  TRP A CH2   1 
ATOM   1347 N  N     . GLY C 3 123 ? 70.253 22.173  17.271  1.00 34.52 ? 129  GLY A N     1 
ATOM   1348 C  CA    . GLY C 3 123 ? 69.917 22.921  16.076  1.00 33.65 ? 129  GLY A CA    1 
ATOM   1349 C  C     . GLY C 3 123 ? 70.203 24.397  16.262  1.00 33.55 ? 129  GLY A C     1 
ATOM   1350 O  O     . GLY C 3 123 ? 70.735 25.057  15.360  1.00 33.84 ? 129  GLY A O     1 
ATOM   1351 N  N     . TYR C 3 124 ? 69.856 24.929  17.429  1.00 32.92 ? 130  TYR A N     1 
ATOM   1352 C  CA    . TYR C 3 124 ? 70.106 26.346  17.690  1.00 34.19 ? 130  TYR A CA    1 
ATOM   1353 C  C     . TYR C 3 124 ? 71.603 26.653  17.560  1.00 33.27 ? 130  TYR A C     1 
ATOM   1354 O  O     . TYR C 3 124 ? 71.986 27.616  16.907  1.00 31.64 ? 130  TYR A O     1 
ATOM   1355 C  CB    . TYR C 3 124 ? 69.635 26.742  19.096  1.00 33.78 ? 130  TYR A CB    1 
ATOM   1356 C  CG    . TYR C 3 124 ? 70.073 28.138  19.501  1.00 36.35 ? 130  TYR A CG    1 
ATOM   1357 C  CD1   . TYR C 3 124 ? 69.346 29.268  19.111  1.00 36.97 ? 130  TYR A CD1   1 
ATOM   1358 C  CD2   . TYR C 3 124 ? 71.237 28.329  20.249  1.00 36.95 ? 130  TYR A CD2   1 
ATOM   1359 C  CE1   . TYR C 3 124 ? 69.775 30.561  19.460  1.00 38.27 ? 130  TYR A CE1   1 
ATOM   1360 C  CE2   . TYR C 3 124 ? 71.672 29.609  20.599  1.00 37.70 ? 130  TYR A CE2   1 
ATOM   1361 C  CZ    . TYR C 3 124 ? 70.941 30.717  20.202  1.00 39.14 ? 130  TYR A CZ    1 
ATOM   1362 O  OH    . TYR C 3 124 ? 71.395 31.976  20.536  1.00 41.70 ? 130  TYR A OH    1 
ATOM   1363 N  N     . ARG C 3 125 ? 72.438 25.831  18.190  1.00 34.26 ? 131  ARG A N     1 
ATOM   1364 C  CA    . ARG C 3 125 ? 73.885 26.025  18.146  1.00 36.65 ? 131  ARG A CA    1 
ATOM   1365 C  C     . ARG C 3 125 ? 74.442 26.069  16.721  1.00 36.17 ? 131  ARG A C     1 
ATOM   1366 O  O     . ARG C 3 125 ? 75.262 26.928  16.385  1.00 35.83 ? 131  ARG A O     1 
ATOM   1367 C  CB    . ARG C 3 125 ? 74.593 24.908  18.914  1.00 39.48 ? 131  ARG A CB    1 
ATOM   1368 C  CG    . ARG C 3 125 ? 74.189 24.789  20.370  1.00 45.91 ? 131  ARG A CG    1 
ATOM   1369 C  CD    . ARG C 3 125 ? 75.404 24.609  21.276  1.00 49.17 ? 131  ARG A CD    1 
ATOM   1370 N  NE    . ARG C 3 125 ? 75.938 25.894  21.732  1.00 54.39 ? 131  ARG A NE    1 
ATOM   1371 C  CZ    . ARG C 3 125 ? 76.496 26.811  20.944  1.00 56.26 ? 131  ARG A CZ    1 
ATOM   1372 N  NH1   . ARG C 3 125 ? 76.612 26.598  19.638  1.00 57.87 ? 131  ARG A NH1   1 
ATOM   1373 N  NH2   . ARG C 3 125 ? 76.925 27.956  21.461  1.00 57.12 ? 131  ARG A NH2   1 
ATOM   1374 N  N     . LEU C 3 126 ? 74.005 25.127  15.894  1.00 35.64 ? 132  LEU A N     1 
ATOM   1375 C  CA    . LEU C 3 126 ? 74.464 25.044  14.517  1.00 34.90 ? 132  LEU A CA    1 
ATOM   1376 C  C     . LEU C 3 126 ? 74.100 26.310  13.748  1.00 34.93 ? 132  LEU A C     1 
ATOM   1377 O  O     . LEU C 3 126 ? 74.917 26.847  13.001  1.00 33.20 ? 132  LEU A O     1 
ATOM   1378 C  CB    . LEU C 3 126 ? 73.860 23.803  13.847  1.00 34.23 ? 132  LEU A CB    1 
ATOM   1379 C  CG    . LEU C 3 126 ? 74.338 22.494  14.492  1.00 34.12 ? 132  LEU A CG    1 
ATOM   1380 C  CD1   . LEU C 3 126 ? 73.497 21.325  14.012  1.00 33.44 ? 132  LEU A CD1   1 
ATOM   1381 C  CD2   . LEU C 3 126 ? 75.813 22.268  14.163  1.00 34.84 ? 132  LEU A CD2   1 
ATOM   1382 N  N     . GLY C 3 127 ? 72.879 26.797  13.961  1.00 35.98 ? 133  GLY A N     1 
ATOM   1383 C  CA    . GLY C 3 127 ? 72.425 27.993  13.279  1.00 36.70 ? 133  GLY A CA    1 
ATOM   1384 C  C     . GLY C 3 127 ? 73.087 29.277  13.743  1.00 39.17 ? 133  GLY A C     1 
ATOM   1385 O  O     . GLY C 3 127 ? 73.034 30.287  13.036  1.00 38.35 ? 133  GLY A O     1 
ATOM   1386 N  N     . GLU C 3 128 ? 73.706 29.248  14.925  1.00 39.78 ? 134  GLU A N     1 
ATOM   1387 C  CA    . GLU C 3 128 ? 74.377 30.427  15.473  1.00 41.26 ? 134  GLU A CA    1 
ATOM   1388 C  C     . GLU C 3 128 ? 75.893 30.392  15.277  1.00 41.52 ? 134  GLU A C     1 
ATOM   1389 O  O     . GLU C 3 128 ? 76.584 31.366  15.579  1.00 41.08 ? 134  GLU A O     1 
ATOM   1390 C  CB    . GLU C 3 128 ? 74.102 30.558  16.977  1.00 42.35 ? 134  GLU A CB    1 
ATOM   1391 C  CG    . GLU C 3 128 ? 72.647 30.735  17.361  1.00 45.88 ? 134  GLU A CG    1 
ATOM   1392 C  CD    . GLU C 3 128 ? 71.987 31.900  16.646  1.00 46.13 ? 134  GLU A CD    1 
ATOM   1393 O  OE1   . GLU C 3 128 ? 72.647 32.945  16.469  1.00 47.36 ? 134  GLU A OE1   1 
ATOM   1394 O  OE2   . GLU C 3 128 ? 70.802 31.774  16.274  1.00 46.70 ? 134  GLU A OE2   1 
ATOM   1395 N  N     . MET C 3 129 ? 76.405 29.272  14.777  1.00 42.35 ? 135  MET A N     1 
ATOM   1396 C  CA    . MET C 3 129 ? 77.842 29.104  14.591  1.00 43.15 ? 135  MET A CA    1 
ATOM   1397 C  C     . MET C 3 129 ? 78.536 30.248  13.846  1.00 42.51 ? 135  MET A C     1 
ATOM   1398 O  O     . MET C 3 129 ? 79.476 30.843  14.373  1.00 41.55 ? 135  MET A O     1 
ATOM   1399 C  CB    . MET C 3 129 ? 78.125 27.767  13.898  1.00 44.78 ? 135  MET A CB    1 
ATOM   1400 C  CG    . MET C 3 129 ? 79.268 26.977  14.529  1.00 47.89 ? 135  MET A CG    1 
ATOM   1401 S  SD    . MET C 3 129 ? 79.032 26.573  16.297  1.00 52.20 ? 135  MET A SD    1 
ATOM   1402 C  CE    . MET C 3 129 ? 78.511 24.832  16.199  1.00 49.92 ? 135  MET A CE    1 
ATOM   1403 N  N     . LYS C 3 130 ? 78.078 30.560  12.637  1.00 42.34 ? 136  LYS A N     1 
ATOM   1404 C  CA    . LYS C 3 130 ? 78.681 31.636  11.850  1.00 43.22 ? 136  LYS A CA    1 
ATOM   1405 C  C     . LYS C 3 130 ? 78.790 32.940  12.642  1.00 43.79 ? 136  LYS A C     1 
ATOM   1406 O  O     . LYS C 3 130 ? 79.862 33.553  12.690  1.00 44.78 ? 136  LYS A O     1 
ATOM   1407 C  CB    . LYS C 3 130 ? 77.880 31.875  10.560  1.00 42.60 ? 136  LYS A CB    1 
ATOM   1408 C  CG    . LYS C 3 130 ? 77.961 30.714  9.576   1.00 42.53 ? 136  LYS A CG    1 
ATOM   1409 C  CD    . LYS C 3 130 ? 77.224 30.998  8.272   1.00 43.31 ? 136  LYS A CD    1 
ATOM   1410 C  CE    . LYS C 3 130 ? 77.888 32.100  7.454   1.00 43.99 ? 136  LYS A CE    1 
ATOM   1411 N  NZ    . LYS C 3 130 ? 77.192 32.289  6.146   1.00 43.15 ? 136  LYS A NZ    1 
ATOM   1412 N  N     . GLY C 3 131 ? 77.684 33.361  13.252  1.00 43.04 ? 137  GLY A N     1 
ATOM   1413 C  CA    . GLY C 3 131 ? 77.690 34.584  14.038  1.00 44.41 ? 137  GLY A CA    1 
ATOM   1414 C  C     . GLY C 3 131 ? 78.628 34.471  15.229  1.00 45.59 ? 137  GLY A C     1 
ATOM   1415 O  O     . GLY C 3 131 ? 79.251 35.449  15.644  1.00 46.41 ? 137  GLY A O     1 
ATOM   1416 N  N     . GLU C 3 132 ? 78.723 33.268  15.782  1.00 45.65 ? 138  GLU A N     1 
ATOM   1417 C  CA    . GLU C 3 132 ? 79.597 33.006  16.919  1.00 46.94 ? 138  GLU A CA    1 
ATOM   1418 C  C     . GLU C 3 132 ? 81.055 33.123  16.482  1.00 46.49 ? 138  GLU A C     1 
ATOM   1419 O  O     . GLU C 3 132 ? 81.871 33.748  17.161  1.00 45.50 ? 138  GLU A O     1 
ATOM   1420 C  CB    . GLU C 3 132 ? 79.329 31.601  17.463  1.00 49.40 ? 138  GLU A CB    1 
ATOM   1421 C  CG    . GLU C 3 132 ? 80.104 31.247  18.719  1.00 53.02 ? 138  GLU A CG    1 
ATOM   1422 C  CD    . GLU C 3 132 ? 79.668 29.912  19.305  1.00 56.36 ? 138  GLU A CD    1 
ATOM   1423 O  OE1   . GLU C 3 132 ? 78.459 29.761  19.595  1.00 55.98 ? 138  GLU A OE1   1 
ATOM   1424 O  OE2   . GLU C 3 132 ? 80.532 29.020  19.476  1.00 56.61 ? 138  GLU A OE2   1 
ATOM   1425 N  N     . TYR C 3 133 ? 81.373 32.508  15.346  1.00 44.83 ? 139  TYR A N     1 
ATOM   1426 C  CA    . TYR C 3 133 ? 82.722 32.540  14.796  1.00 44.36 ? 139  TYR A CA    1 
ATOM   1427 C  C     . TYR C 3 133 ? 83.114 33.988  14.506  1.00 45.44 ? 139  TYR A C     1 
ATOM   1428 O  O     . TYR C 3 133 ? 84.235 34.409  14.787  1.00 45.57 ? 139  TYR A O     1 
ATOM   1429 C  CB    . TYR C 3 133 ? 82.772 31.699  13.511  1.00 42.29 ? 139  TYR A CB    1 
ATOM   1430 C  CG    . TYR C 3 133 ? 84.006 31.897  12.656  1.00 40.93 ? 139  TYR A CG    1 
ATOM   1431 C  CD1   . TYR C 3 133 ? 85.279 31.557  13.125  1.00 41.24 ? 139  TYR A CD1   1 
ATOM   1432 C  CD2   . TYR C 3 133 ? 83.902 32.443  11.379  1.00 41.15 ? 139  TYR A CD2   1 
ATOM   1433 C  CE1   . TYR C 3 133 ? 86.413 31.762  12.340  1.00 40.14 ? 139  TYR A CE1   1 
ATOM   1434 C  CE2   . TYR C 3 133 ? 85.026 32.651  10.588  1.00 40.30 ? 139  TYR A CE2   1 
ATOM   1435 C  CZ    . TYR C 3 133 ? 86.276 32.313  11.072  1.00 40.69 ? 139  TYR A CZ    1 
ATOM   1436 O  OH    . TYR C 3 133 ? 87.383 32.549  10.291  1.00 39.95 ? 139  TYR A OH    1 
ATOM   1437 N  N     . LYS C 3 134 ? 82.172 34.747  13.956  1.00 46.52 ? 140  LYS A N     1 
ATOM   1438 C  CA    . LYS C 3 134 ? 82.398 36.149  13.624  1.00 48.78 ? 140  LYS A CA    1 
ATOM   1439 C  C     . LYS C 3 134 ? 82.709 36.979  14.867  1.00 50.13 ? 140  LYS A C     1 
ATOM   1440 O  O     . LYS C 3 134 ? 83.465 37.952  14.798  1.00 50.11 ? 140  LYS A O     1 
ATOM   1441 C  CB    . LYS C 3 134 ? 81.164 36.724  12.927  1.00 49.14 ? 140  LYS A CB    1 
ATOM   1442 C  CG    . LYS C 3 134 ? 81.242 38.217  12.644  1.00 51.29 ? 140  LYS A CG    1 
ATOM   1443 C  CD    . LYS C 3 134 ? 79.899 38.747  12.174  1.00 51.90 ? 140  LYS A CD    1 
ATOM   1444 C  CE    . LYS C 3 134 ? 79.950 40.239  11.907  1.00 53.64 ? 140  LYS A CE    1 
ATOM   1445 N  NZ    . LYS C 3 134 ? 78.610 40.764  11.512  1.00 54.55 ? 140  LYS A NZ    1 
ATOM   1446 N  N     . ASP C 3 135 ? 82.119 36.597  15.999  1.00 51.65 ? 141  ASP A N     1 
ATOM   1447 C  CA    . ASP C 3 135 ? 82.337 37.312  17.254  1.00 53.58 ? 141  ASP A CA    1 
ATOM   1448 C  C     . ASP C 3 135 ? 83.702 36.998  17.856  1.00 53.92 ? 141  ASP A C     1 
ATOM   1449 O  O     . ASP C 3 135 ? 84.289 37.836  18.543  1.00 54.62 ? 141  ASP A O     1 
ATOM   1450 C  CB    . ASP C 3 135 ? 81.225 36.985  18.259  1.00 54.19 ? 141  ASP A CB    1 
ATOM   1451 C  CG    . ASP C 3 135 ? 79.912 37.675  17.917  1.00 55.87 ? 141  ASP A CG    1 
ATOM   1452 O  OD1   . ASP C 3 135 ? 78.889 37.403  18.586  1.00 56.44 ? 141  ASP A OD1   1 
ATOM   1453 O  OD2   . ASP C 3 135 ? 79.905 38.500  16.976  1.00 56.62 ? 141  ASP A OD2   1 
ATOM   1454 N  N     . ASP C 3 136 ? 84.207 35.797  17.594  1.00 53.57 ? 142  ASP A N     1 
ATOM   1455 C  CA    . ASP C 3 136 ? 85.515 35.398  18.101  1.00 54.65 ? 142  ASP A CA    1 
ATOM   1456 C  C     . ASP C 3 136 ? 86.609 36.052  17.259  1.00 54.86 ? 142  ASP A C     1 
ATOM   1457 O  O     . ASP C 3 136 ? 87.669 36.427  17.771  1.00 54.97 ? 142  ASP A O     1 
ATOM   1458 C  CB    . ASP C 3 136 ? 85.660 33.879  18.043  1.00 55.70 ? 142  ASP A CB    1 
ATOM   1459 C  CG    . ASP C 3 136 ? 84.789 33.176  19.056  1.00 57.22 ? 142  ASP A CG    1 
ATOM   1460 O  OD1   . ASP C 3 136 ? 83.729 33.733  19.411  1.00 59.11 ? 142  ASP A OD1   1 
ATOM   1461 O  OD2   . ASP C 3 136 ? 85.157 32.062  19.491  1.00 58.40 ? 142  ASP A OD2   1 
ATOM   1462 N  N     . PHE C 3 137 ? 86.341 36.179  15.962  1.00 53.55 ? 143  PHE A N     1 
ATOM   1463 C  CA    . PHE C 3 137 ? 87.283 36.789  15.029  1.00 53.55 ? 143  PHE A CA    1 
ATOM   1464 C  C     . PHE C 3 137 ? 87.342 38.280  15.360  1.00 54.27 ? 143  PHE A C     1 
ATOM   1465 O  O     . PHE C 3 137 ? 88.417 38.849  15.538  1.00 55.17 ? 143  PHE A O     1 
ATOM   1466 C  CB    . PHE C 3 137 ? 86.789 36.590  13.591  1.00 50.84 ? 143  PHE A CB    1 
ATOM   1467 C  CG    . PHE C 3 137 ? 87.858 36.750  12.546  1.00 48.04 ? 143  PHE A CG    1 
ATOM   1468 C  CD1   . PHE C 3 137 ? 88.769 35.728  12.302  1.00 47.06 ? 143  PHE A CD1   1 
ATOM   1469 C  CD2   . PHE C 3 137 ? 87.951 37.923  11.800  1.00 47.66 ? 143  PHE A CD2   1 
ATOM   1470 C  CE1   . PHE C 3 137 ? 89.759 35.868  11.325  1.00 45.80 ? 143  PHE A CE1   1 
ATOM   1471 C  CE2   . PHE C 3 137 ? 88.936 38.074  10.822  1.00 46.87 ? 143  PHE A CE2   1 
ATOM   1472 C  CZ    . PHE C 3 137 ? 89.842 37.041  10.585  1.00 46.90 ? 143  PHE A CZ    1 
ATOM   1473 N  N     . LYS C 3 138 ? 86.168 38.900  15.442  1.00 55.33 ? 144  LYS A N     1 
ATOM   1474 C  CA    . LYS C 3 138 ? 86.051 40.316  15.765  1.00 56.79 ? 144  LYS A CA    1 
ATOM   1475 C  C     . LYS C 3 138 ? 86.849 40.651  17.023  1.00 57.88 ? 144  LYS A C     1 
ATOM   1476 O  O     . LYS C 3 138 ? 87.514 41.688  17.086  1.00 57.88 ? 144  LYS A O     1 
ATOM   1477 C  CB    . LYS C 3 138 ? 84.582 40.682  15.995  1.00 56.36 ? 144  LYS A CB    1 
ATOM   1478 C  CG    . LYS C 3 138 ? 83.956 41.563  14.925  1.00 56.47 ? 144  LYS A CG    1 
ATOM   1479 C  CD    . LYS C 3 138 ? 82.481 41.800  15.231  1.00 56.10 ? 144  LYS A CD    1 
ATOM   1480 C  CE    . LYS C 3 138 ? 81.845 42.770  14.251  1.00 55.73 ? 144  LYS A CE    1 
ATOM   1481 N  NZ    . LYS C 3 138 ? 82.435 44.134  14.361  1.00 55.20 ? 144  LYS A NZ    1 
ATOM   1482 N  N     . ARG C 3 139 ? 86.776 39.775  18.024  1.00 59.02 ? 145  ARG A N     1 
ATOM   1483 C  CA    . ARG C 3 139 ? 87.485 39.995  19.279  1.00 60.23 ? 145  ARG A CA    1 
ATOM   1484 C  C     . ARG C 3 139 ? 88.997 39.879  19.133  1.00 60.43 ? 145  ARG A C     1 
ATOM   1485 O  O     . ARG C 3 139 ? 89.727 40.797  19.508  1.00 60.85 ? 145  ARG A O     1 
ATOM   1486 C  CB    . ARG C 3 139 ? 87.006 39.019  20.360  1.00 61.29 ? 145  ARG A CB    1 
ATOM   1487 C  CG    . ARG C 3 139 ? 87.801 39.133  21.661  1.00 62.98 ? 145  ARG A CG    1 
ATOM   1488 C  CD    . ARG C 3 139 ? 87.238 38.286  22.802  1.00 64.62 ? 145  ARG A CD    1 
ATOM   1489 N  NE    . ARG C 3 139 ? 87.242 36.854  22.515  1.00 66.55 ? 145  ARG A NE    1 
ATOM   1490 C  CZ    . ARG C 3 139 ? 86.288 36.222  21.834  1.00 67.89 ? 145  ARG A CZ    1 
ATOM   1491 N  NH1   . ARG C 3 139 ? 85.243 36.895  21.365  1.00 68.09 ? 145  ARG A NH1   1 
ATOM   1492 N  NH2   . ARG C 3 139 ? 86.375 34.914  21.628  1.00 68.79 ? 145  ARG A NH2   1 
ATOM   1493 N  N     . MET C 3 140 ? 89.469 38.759  18.592  1.00 60.48 ? 146  MET A N     1 
ATOM   1494 C  CA    . MET C 3 140 ? 90.905 38.562  18.427  1.00 61.02 ? 146  MET A CA    1 
ATOM   1495 C  C     . MET C 3 140 ? 91.581 39.723  17.704  1.00 61.14 ? 146  MET A C     1 
ATOM   1496 O  O     . MET C 3 140 ? 92.750 40.021  17.957  1.00 60.52 ? 146  MET A O     1 
ATOM   1497 C  CB    . MET C 3 140 ? 91.189 37.254  17.692  1.00 60.85 ? 146  MET A CB    1 
ATOM   1498 C  CG    . MET C 3 140 ? 90.799 36.023  18.487  1.00 62.00 ? 146  MET A CG    1 
ATOM   1499 S  SD    . MET C 3 140 ? 91.867 34.606  18.145  1.00 65.27 ? 146  MET A SD    1 
ATOM   1500 C  CE    . MET C 3 140 ? 92.824 34.529  19.678  1.00 62.49 ? 146  MET A CE    1 
ATOM   1501 N  N     . LEU C 3 141 ? 90.848 40.374  16.806  1.00 61.57 ? 147  LEU A N     1 
ATOM   1502 C  CA    . LEU C 3 141 ? 91.388 41.515  16.076  1.00 62.58 ? 147  LEU A CA    1 
ATOM   1503 C  C     . LEU C 3 141 ? 91.340 42.750  16.969  1.00 63.03 ? 147  LEU A C     1 
ATOM   1504 O  O     . LEU C 3 141 ? 92.325 43.477  17.096  1.00 63.19 ? 147  LEU A O     1 
ATOM   1505 C  CB    . LEU C 3 141 ? 90.576 41.786  14.808  1.00 62.55 ? 147  LEU A CB    1 
ATOM   1506 C  CG    . LEU C 3 141 ? 90.654 40.787  13.654  1.00 62.80 ? 147  LEU A CG    1 
ATOM   1507 C  CD1   . LEU C 3 141 ? 89.735 41.257  12.537  1.00 62.29 ? 147  LEU A CD1   1 
ATOM   1508 C  CD2   . LEU C 3 141 ? 92.086 40.673  13.157  1.00 62.52 ? 147  LEU A CD2   1 
ATOM   1509 N  N     . GLU C 3 142 ? 90.180 42.974  17.581  1.00 63.29 ? 148  GLU A N     1 
ATOM   1510 C  CA    . GLU C 3 142 ? 89.973 44.114  18.462  1.00 63.73 ? 148  GLU A CA    1 
ATOM   1511 C  C     . GLU C 3 142 ? 90.940 44.076  19.640  1.00 64.03 ? 148  GLU A C     1 
ATOM   1512 O  O     . GLU C 3 142 ? 91.141 45.083  20.319  1.00 64.82 ? 148  GLU A O     1 
ATOM   1513 C  CB    . GLU C 3 142 ? 88.530 44.129  18.971  1.00 63.72 ? 148  GLU A CB    1 
ATOM   1514 N  N     . GLU C 3 143 ? 91.537 42.912  19.880  1.00 64.16 ? 149  GLU A N     1 
ATOM   1515 C  CA    . GLU C 3 143 ? 92.492 42.755  20.973  1.00 64.09 ? 149  GLU A CA    1 
ATOM   1516 C  C     . GLU C 3 143 ? 93.914 43.021  20.487  1.00 64.49 ? 149  GLU A C     1 
ATOM   1517 O  O     . GLU C 3 143 ? 94.809 43.305  21.286  1.00 64.60 ? 149  GLU A O     1 
ATOM   1518 C  CB    . GLU C 3 143 ? 92.415 41.342  21.558  1.00 64.07 ? 149  GLU A CB    1 
ATOM   1519 C  CG    . GLU C 3 143 ? 91.046 40.954  22.085  1.00 64.08 ? 149  GLU A CG    1 
ATOM   1520 C  CD    . GLU C 3 143 ? 91.052 39.614  22.800  1.00 64.84 ? 149  GLU A CD    1 
ATOM   1521 O  OE1   . GLU C 3 143 ? 91.572 38.632  22.225  1.00 64.99 ? 149  GLU A OE1   1 
ATOM   1522 O  OE2   . GLU C 3 143 ? 90.532 39.544  23.936  1.00 64.46 ? 149  GLU A OE2   1 
ATOM   1523 N  N     . GLN C 3 144 ? 94.114 42.925  19.175  1.00 64.30 ? 150  GLN A N     1 
ATOM   1524 C  CA    . GLN C 3 144 ? 95.426 43.150  18.576  1.00 64.61 ? 150  GLN A CA    1 
ATOM   1525 C  C     . GLN C 3 144 ? 95.506 44.502  17.871  1.00 64.70 ? 150  GLN A C     1 
ATOM   1526 O  O     . GLN C 3 144 ? 96.328 44.697  16.970  1.00 64.49 ? 150  GLN A O     1 
ATOM   1527 C  CB    . GLN C 3 144 ? 95.746 42.031  17.578  1.00 64.89 ? 150  GLN A CB    1 
ATOM   1528 C  CG    . GLN C 3 144 ? 95.791 40.651  18.205  1.00 64.18 ? 150  GLN A CG    1 
ATOM   1529 C  CD    . GLN C 3 144 ? 96.773 40.580  19.354  1.00 64.82 ? 150  GLN A CD    1 
ATOM   1530 O  OE1   . GLN C 3 144 ? 97.974 40.781  19.169  1.00 64.75 ? 150  GLN A OE1   1 
ATOM   1531 N  NE2   . GLN C 3 144 ? 96.267 40.301  20.552  1.00 64.00 ? 150  GLN A NE2   1 
ATOM   1532 N  N     . GLY C 3 145 ? 94.651 45.431  18.288  1.00 64.76 ? 151  GLY A N     1 
ATOM   1533 C  CA    . GLY C 3 145 ? 94.639 46.752  17.686  1.00 64.59 ? 151  GLY A CA    1 
ATOM   1534 C  C     . GLY C 3 145 ? 94.550 46.705  16.174  1.00 64.40 ? 151  GLY A C     1 
ATOM   1535 O  O     . GLY C 3 145 ? 95.222 47.467  15.479  1.00 64.71 ? 151  GLY A O     1 
ATOM   1536 N  N     . GLU C 3 146 ? 93.714 45.809  15.659  1.00 64.48 ? 152  GLU A N     1 
ATOM   1537 C  CA    . GLU C 3 146 ? 93.549 45.665  14.217  1.00 63.69 ? 152  GLU A CA    1 
ATOM   1538 C  C     . GLU C 3 146 ? 92.096 45.904  13.815  1.00 63.23 ? 152  GLU A C     1 
ATOM   1539 O  O     . GLU C 3 146 ? 91.174 45.415  14.472  1.00 63.49 ? 152  GLU A O     1 
ATOM   1540 C  CB    . GLU C 3 146 ? 93.989 44.268  13.787  1.00 63.84 ? 152  GLU A CB    1 
ATOM   1541 C  CG    . GLU C 3 146 ? 94.415 44.177  12.339  1.00 64.69 ? 152  GLU A CG    1 
ATOM   1542 C  CD    . GLU C 3 146 ? 94.947 42.806  11.993  1.00 65.52 ? 152  GLU A CD    1 
ATOM   1543 O  OE1   . GLU C 3 146 ? 95.787 42.290  12.763  1.00 65.30 ? 152  GLU A OE1   1 
ATOM   1544 O  OE2   . GLU C 3 146 ? 94.530 42.250  10.955  1.00 65.61 ? 152  GLU A OE2   1 
ATOM   1545 N  N     . GLU C 3 147 ? 91.900 46.656  12.736  1.00 62.13 ? 153  GLU A N     1 
ATOM   1546 C  CA    . GLU C 3 147 ? 90.561 46.976  12.249  1.00 61.22 ? 153  GLU A CA    1 
ATOM   1547 C  C     . GLU C 3 147 ? 89.829 45.750  11.712  1.00 60.93 ? 153  GLU A C     1 
ATOM   1548 O  O     . GLU C 3 147 ? 90.453 44.784  11.267  1.00 61.71 ? 153  GLU A O     1 
ATOM   1549 C  CB    . GLU C 3 147 ? 90.643 48.044  11.154  1.00 61.12 ? 153  GLU A CB    1 
ATOM   1550 N  N     . TYR C 3 148 ? 88.501 45.804  11.754  1.00 59.35 ? 154  TYR A N     1 
ATOM   1551 C  CA    . TYR C 3 148 ? 87.661 44.711  11.274  1.00 57.71 ? 154  TYR A CA    1 
ATOM   1552 C  C     . TYR C 3 148 ? 86.803 45.160  10.097  1.00 57.44 ? 154  TYR A C     1 
ATOM   1553 O  O     . TYR C 3 148 ? 86.290 46.279  10.086  1.00 57.23 ? 154  TYR A O     1 
ATOM   1554 C  CB    . TYR C 3 148 ? 86.740 44.217  12.393  1.00 56.27 ? 154  TYR A CB    1 
ATOM   1555 C  CG    . TYR C 3 148 ? 85.732 43.193  11.926  1.00 54.49 ? 154  TYR A CG    1 
ATOM   1556 C  CD1   . TYR C 3 148 ? 86.097 41.862  11.745  1.00 53.99 ? 154  TYR A CD1   1 
ATOM   1557 C  CD2   . TYR C 3 148 ? 84.422 43.565  11.620  1.00 53.79 ? 154  TYR A CD2   1 
ATOM   1558 C  CE1   . TYR C 3 148 ? 85.184 40.920  11.268  1.00 53.57 ? 154  TYR A CE1   1 
ATOM   1559 C  CE2   . TYR C 3 148 ? 83.500 42.633  11.139  1.00 53.70 ? 154  TYR A CE2   1 
ATOM   1560 C  CZ    . TYR C 3 148 ? 83.889 41.312  10.965  1.00 53.39 ? 154  TYR A CZ    1 
ATOM   1561 O  OH    . TYR C 3 148 ? 82.992 40.386  10.477  1.00 51.53 ? 154  TYR A OH    1 
ATOM   1562 N  N     . VAL C 3 149 ? 86.645 44.280  9.112   1.00 57.53 ? 155  VAL A N     1 
ATOM   1563 C  CA    . VAL C 3 149 ? 85.832 44.579  7.936   1.00 57.48 ? 155  VAL A CA    1 
ATOM   1564 C  C     . VAL C 3 149 ? 84.637 43.625  7.892   1.00 57.79 ? 155  VAL A C     1 
ATOM   1565 O  O     . VAL C 3 149 ? 84.799 42.407  7.981   1.00 57.11 ? 155  VAL A O     1 
ATOM   1566 C  CB    . VAL C 3 149 ? 86.650 44.439  6.636   1.00 57.50 ? 155  VAL A CB    1 
ATOM   1567 C  CG1   . VAL C 3 149 ? 85.786 44.797  5.435   1.00 57.49 ? 155  VAL A CG1   1 
ATOM   1568 C  CG2   . VAL C 3 149 ? 87.873 45.340  6.696   1.00 56.21 ? 155  VAL A CG2   1 
ATOM   1569 N  N     . ASP C 3 150 ? 83.447 44.202  7.750   1.00 58.24 ? 156  ASP A N     1 
ATOM   1570 C  CA    . ASP C 3 150 ? 82.180 43.471  7.720   1.00 58.70 ? 156  ASP A CA    1 
ATOM   1571 C  C     . ASP C 3 150 ? 82.234 41.941  7.724   1.00 57.81 ? 156  ASP A C     1 
ATOM   1572 O  O     . ASP C 3 150 ? 81.755 41.318  8.673   1.00 60.11 ? 156  ASP A O     1 
ATOM   1573 C  CB    . ASP C 3 150 ? 81.323 43.944  6.541   1.00 59.16 ? 156  ASP A CB    1 
ATOM   1574 C  CG    . ASP C 3 150 ? 79.894 43.417  6.611   1.00 61.45 ? 156  ASP A CG    1 
ATOM   1575 O  OD1   . ASP C 3 150 ? 79.212 43.666  7.632   1.00 61.11 ? 156  ASP A OD1   1 
ATOM   1576 O  OD2   . ASP C 3 150 ? 79.448 42.757  5.646   1.00 61.99 ? 156  ASP A OD2   1 
ATOM   1577 N  N     . GLY C 3 151 ? 82.802 41.328  6.684   1.00 55.11 ? 157  GLY A N     1 
ATOM   1578 C  CA    . GLY C 3 151 ? 82.845 39.871  6.651   1.00 52.23 ? 157  GLY A CA    1 
ATOM   1579 C  C     . GLY C 3 151 ? 84.179 39.205  6.348   1.00 49.97 ? 157  GLY A C     1 
ATOM   1580 O  O     . GLY C 3 151 ? 84.224 38.114  5.769   1.00 48.62 ? 157  GLY A O     1 
ATOM   1581 N  N     . MET C 3 152 ? 85.268 39.839  6.764   1.00 47.52 ? 158  MET A N     1 
ATOM   1582 C  CA    . MET C 3 152 ? 86.602 39.306  6.514   1.00 45.51 ? 158  MET A CA    1 
ATOM   1583 C  C     . MET C 3 152 ? 86.891 37.952  7.157   1.00 42.76 ? 158  MET A C     1 
ATOM   1584 O  O     . MET C 3 152 ? 87.831 37.267  6.755   1.00 41.78 ? 158  MET A O     1 
ATOM   1585 C  CB    . MET C 3 152 ? 87.662 40.313  6.967   1.00 45.37 ? 158  MET A CB    1 
ATOM   1586 C  CG    . MET C 3 152 ? 87.734 40.525  8.472   1.00 47.10 ? 158  MET A CG    1 
ATOM   1587 S  SD    . MET C 3 152 ? 88.884 41.861  8.917   1.00 50.85 ? 158  MET A SD    1 
ATOM   1588 C  CE    . MET C 3 152 ? 90.470 40.988  8.779   1.00 47.94 ? 158  MET A CE    1 
ATOM   1589 N  N     . GLU C 3 153 ? 86.098 37.559  8.150   1.00 40.25 ? 159  GLU A N     1 
ATOM   1590 C  CA    . GLU C 3 153 ? 86.335 36.282  8.818   1.00 38.30 ? 159  GLU A CA    1 
ATOM   1591 C  C     . GLU C 3 153 ? 86.247 35.087  7.863   1.00 37.99 ? 159  GLU A C     1 
ATOM   1592 O  O     . GLU C 3 153 ? 86.831 34.034  8.122   1.00 37.65 ? 159  GLU A O     1 
ATOM   1593 C  CB    . GLU C 3 153 ? 85.350 36.087  9.986   1.00 37.86 ? 159  GLU A CB    1 
ATOM   1594 C  CG    . GLU C 3 153 ? 83.894 35.904  9.580   1.00 37.73 ? 159  GLU A CG    1 
ATOM   1595 C  CD    . GLU C 3 153 ? 83.155 37.217  9.410   1.00 38.60 ? 159  GLU A CD    1 
ATOM   1596 O  OE1   . GLU C 3 153 ? 83.789 38.215  9.006   1.00 37.35 ? 159  GLU A OE1   1 
ATOM   1597 O  OE2   . GLU C 3 153 ? 81.930 37.244  9.668   1.00 39.55 ? 159  GLU A OE2   1 
ATOM   1598 N  N     . TRP C 3 154 ? 85.538 35.256  6.752   1.00 37.64 ? 160  TRP A N     1 
ATOM   1599 C  CA    . TRP C 3 154 ? 85.376 34.175  5.781   1.00 38.81 ? 160  TRP A CA    1 
ATOM   1600 C  C     . TRP C 3 154 ? 86.291 34.227  4.555   1.00 39.99 ? 160  TRP A C     1 
ATOM   1601 O  O     . TRP C 3 154 ? 86.178 33.385  3.663   1.00 37.86 ? 160  TRP A O     1 
ATOM   1602 C  CB    . TRP C 3 154 ? 83.922 34.129  5.309   1.00 38.85 ? 160  TRP A CB    1 
ATOM   1603 C  CG    . TRP C 3 154 ? 82.991 33.786  6.406   1.00 39.61 ? 160  TRP A CG    1 
ATOM   1604 C  CD1   . TRP C 3 154 ? 82.057 34.596  6.979   1.00 38.88 ? 160  TRP A CD1   1 
ATOM   1605 C  CD2   . TRP C 3 154 ? 82.938 32.545  7.111   1.00 39.93 ? 160  TRP A CD2   1 
ATOM   1606 N  NE1   . TRP C 3 154 ? 81.423 33.936  8.004   1.00 39.86 ? 160  TRP A NE1   1 
ATOM   1607 C  CE2   . TRP C 3 154 ? 81.944 32.674  8.107   1.00 39.72 ? 160  TRP A CE2   1 
ATOM   1608 C  CE3   . TRP C 3 154 ? 83.634 31.334  6.999   1.00 40.23 ? 160  TRP A CE3   1 
ATOM   1609 C  CZ2   . TRP C 3 154 ? 81.626 31.635  8.988   1.00 39.74 ? 160  TRP A CZ2   1 
ATOM   1610 C  CZ3   . TRP C 3 154 ? 83.320 30.301  7.873   1.00 40.96 ? 160  TRP A CZ3   1 
ATOM   1611 C  CH2   . TRP C 3 154 ? 82.322 30.461  8.857   1.00 41.06 ? 160  TRP A CH2   1 
ATOM   1612 N  N     . TRP C 3 155 ? 87.198 35.198  4.508   1.00 40.55 ? 161  TRP A N     1 
ATOM   1613 C  CA    . TRP C 3 155 ? 88.086 35.329  3.357   1.00 40.22 ? 161  TRP A CA    1 
ATOM   1614 C  C     . TRP C 3 155 ? 89.182 34.275  3.265   1.00 39.09 ? 161  TRP A C     1 
ATOM   1615 O  O     . TRP C 3 155 ? 89.491 33.792  2.177   1.00 37.69 ? 161  TRP A O     1 
ATOM   1616 C  CB    . TRP C 3 155 ? 88.724 36.719  3.335   1.00 42.60 ? 161  TRP A CB    1 
ATOM   1617 C  CG    . TRP C 3 155 ? 87.736 37.849  3.255   1.00 43.87 ? 161  TRP A CG    1 
ATOM   1618 C  CD1   . TRP C 3 155 ? 86.404 37.765  2.953   1.00 45.77 ? 161  TRP A CD1   1 
ATOM   1619 C  CD2   . TRP C 3 155 ? 88.016 39.238  3.445   1.00 45.51 ? 161  TRP A CD2   1 
ATOM   1620 N  NE1   . TRP C 3 155 ? 85.838 39.019  2.943   1.00 45.41 ? 161  TRP A NE1   1 
ATOM   1621 C  CE2   . TRP C 3 155 ? 86.806 39.942  3.241   1.00 45.85 ? 161  TRP A CE2   1 
ATOM   1622 C  CE3   . TRP C 3 155 ? 89.176 39.960  3.767   1.00 45.88 ? 161  TRP A CE3   1 
ATOM   1623 C  CZ2   . TRP C 3 155 ? 86.721 41.334  3.350   1.00 47.08 ? 161  TRP A CZ2   1 
ATOM   1624 C  CZ3   . TRP C 3 155 ? 89.093 41.345  3.876   1.00 47.55 ? 161  TRP A CZ3   1 
ATOM   1625 C  CH2   . TRP C 3 155 ? 87.870 42.016  3.668   1.00 48.42 ? 161  TRP A CH2   1 
ATOM   1626 N  N     . ASN C 3 156 ? 89.766 33.912  4.400   1.00 38.28 ? 162  ASN A N     1 
ATOM   1627 C  CA    . ASN C 3 156 ? 90.843 32.928  4.402   1.00 38.68 ? 162  ASN A CA    1 
ATOM   1628 C  C     . ASN C 3 156 ? 90.678 31.866  5.473   1.00 38.97 ? 162  ASN A C     1 
ATOM   1629 O  O     . ASN C 3 156 ? 90.014 32.086  6.486   1.00 38.83 ? 162  ASN A O     1 
ATOM   1630 C  CB    . ASN C 3 156 ? 92.197 33.626  4.603   1.00 39.52 ? 162  ASN A CB    1 
ATOM   1631 C  CG    . ASN C 3 156 ? 92.524 34.600  3.486   1.00 40.20 ? 162  ASN A CG    1 
ATOM   1632 O  OD1   . ASN C 3 156 ? 92.780 34.199  2.350   1.00 41.98 ? 162  ASN A OD1   1 
ATOM   1633 N  ND2   . ASN C 3 156 ? 92.501 35.889  3.802   1.00 41.64 ? 162  ASN A ND2   1 
ATOM   1634 N  N     . PHE C 3 157 ? 91.297 30.714  5.236   1.00 38.77 ? 163  PHE A N     1 
ATOM   1635 C  CA    . PHE C 3 157 ? 91.268 29.612  6.184   1.00 39.28 ? 163  PHE A CA    1 
ATOM   1636 C  C     . PHE C 3 157 ? 92.155 29.966  7.379   1.00 40.34 ? 163  PHE A C     1 
ATOM   1637 O  O     . PHE C 3 157 ? 93.130 30.701  7.241   1.00 39.65 ? 163  PHE A O     1 
ATOM   1638 C  CB    . PHE C 3 157 ? 91.810 28.349  5.525   1.00 37.83 ? 163  PHE A CB    1 
ATOM   1639 C  CG    . PHE C 3 157 ? 92.136 27.247  6.497   1.00 38.62 ? 163  PHE A CG    1 
ATOM   1640 C  CD1   . PHE C 3 157 ? 91.126 26.489  7.078   1.00 38.57 ? 163  PHE A CD1   1 
ATOM   1641 C  CD2   . PHE C 3 157 ? 93.460 26.961  6.822   1.00 38.52 ? 163  PHE A CD2   1 
ATOM   1642 C  CE1   . PHE C 3 157 ? 91.427 25.457  7.968   1.00 38.69 ? 163  PHE A CE1   1 
ATOM   1643 C  CE2   . PHE C 3 157 ? 93.775 25.931  7.712   1.00 38.17 ? 163  PHE A CE2   1 
ATOM   1644 C  CZ    . PHE C 3 157 ? 92.755 25.176  8.286   1.00 38.66 ? 163  PHE A CZ    1 
ATOM   1645 N  N     . ASN C 3 158 ? 91.800 29.456  8.552   1.00 40.46 ? 164  ASN A N     1 
ATOM   1646 C  CA    . ASN C 3 158 ? 92.590 29.677  9.761   1.00 42.06 ? 164  ASN A CA    1 
ATOM   1647 C  C     . ASN C 3 158 ? 92.196 28.611  10.777  1.00 41.42 ? 164  ASN A C     1 
ATOM   1648 O  O     . ASN C 3 158 ? 91.137 27.995  10.650  1.00 42.01 ? 164  ASN A O     1 
ATOM   1649 C  CB    . ASN C 3 158 ? 92.372 31.088  10.329  1.00 41.83 ? 164  ASN A CB    1 
ATOM   1650 C  CG    . ASN C 3 158 ? 90.959 31.322  10.804  1.00 42.16 ? 164  ASN A CG    1 
ATOM   1651 O  OD1   . ASN C 3 158 ? 90.214 32.115  10.224  1.00 41.89 ? 164  ASN A OD1   1 
ATOM   1652 N  ND2   . ASN C 3 158 ? 90.581 30.635  11.872  1.00 42.14 ? 164  ASN A ND2   1 
ATOM   1653 N  N     . GLU C 3 159 ? 93.047 28.387  11.773  1.00 41.04 ? 165  GLU A N     1 
ATOM   1654 C  CA    . GLU C 3 159 ? 92.789 27.364  12.782  1.00 40.75 ? 165  GLU A CA    1 
ATOM   1655 C  C     . GLU C 3 159 ? 91.529 27.532  13.623  1.00 38.96 ? 165  GLU A C     1 
ATOM   1656 O  O     . GLU C 3 159 ? 90.975 26.542  14.099  1.00 39.40 ? 165  GLU A O     1 
ATOM   1657 C  CB    . GLU C 3 159 ? 94.004 27.208  13.700  1.00 42.74 ? 165  GLU A CB    1 
ATOM   1658 C  CG    . GLU C 3 159 ? 95.203 26.559  13.019  1.00 45.58 ? 165  GLU A CG    1 
ATOM   1659 C  CD    . GLU C 3 159 ? 94.844 25.274  12.278  1.00 46.90 ? 165  GLU A CD    1 
ATOM   1660 O  OE1   . GLU C 3 159 ? 94.289 24.341  12.897  1.00 48.27 ? 165  GLU A OE1   1 
ATOM   1661 O  OE2   . GLU C 3 159 ? 95.125 25.196  11.067  1.00 48.46 ? 165  GLU A OE2   1 
ATOM   1662 N  N     . GLU C 3 160 ? 91.076 28.766  13.817  1.00 38.89 ? 166  GLU A N     1 
ATOM   1663 C  CA    . GLU C 3 160 ? 89.862 28.996  14.599  1.00 38.69 ? 166  GLU A CA    1 
ATOM   1664 C  C     . GLU C 3 160 ? 88.677 28.461  13.796  1.00 38.83 ? 166  GLU A C     1 
ATOM   1665 O  O     . GLU C 3 160 ? 87.739 27.880  14.353  1.00 39.74 ? 166  GLU A O     1 
ATOM   1666 C  CB    . GLU C 3 160 ? 89.667 30.492  14.873  1.00 39.14 ? 166  GLU A CB    1 
ATOM   1667 N  N     . MET C 3 161 ? 88.737 28.662  12.483  1.00 37.85 ? 167  MET A N     1 
ATOM   1668 C  CA    . MET C 3 161 ? 87.698 28.203  11.562  1.00 37.19 ? 167  MET A CA    1 
ATOM   1669 C  C     . MET C 3 161 ? 87.668 26.677  11.551  1.00 37.14 ? 167  MET A C     1 
ATOM   1670 O  O     . MET C 3 161 ? 86.597 26.057  11.575  1.00 36.82 ? 167  MET A O     1 
ATOM   1671 C  CB    . MET C 3 161 ? 87.987 28.707  10.151  1.00 36.50 ? 167  MET A CB    1 
ATOM   1672 C  CG    . MET C 3 161 ? 86.909 28.374  9.133   1.00 35.04 ? 167  MET A CG    1 
ATOM   1673 S  SD    . MET C 3 161 ? 87.413 28.834  7.474   1.00 35.87 ? 167  MET A SD    1 
ATOM   1674 C  CE    . MET C 3 161 ? 87.206 30.637  7.543   1.00 32.77 ? 167  MET A CE    1 
ATOM   1675 N  N     . MET C 3 162 ? 88.853 26.082  11.511  1.00 36.00 ? 168  MET A N     1 
ATOM   1676 C  CA    . MET C 3 162 ? 88.983 24.635  11.509  1.00 36.09 ? 168  MET A CA    1 
ATOM   1677 C  C     . MET C 3 162 ? 88.318 24.100  12.777  1.00 36.90 ? 168  MET A C     1 
ATOM   1678 O  O     . MET C 3 162 ? 87.553 23.140  12.722  1.00 36.51 ? 168  MET A O     1 
ATOM   1679 C  CB    . MET C 3 162 ? 90.466 24.252  11.483  1.00 35.28 ? 168  MET A CB    1 
ATOM   1680 C  CG    . MET C 3 162 ? 90.770 22.757  11.412  1.00 33.75 ? 168  MET A CG    1 
ATOM   1681 S  SD    . MET C 3 162 ? 90.670 22.011  9.762   1.00 36.52 ? 168  MET A SD    1 
ATOM   1682 C  CE    . MET C 3 162 ? 89.096 21.170  9.868   1.00 34.39 ? 168  MET A CE    1 
ATOM   1683 N  N     . ASP C 3 163 ? 88.602 24.731  13.916  1.00 37.58 ? 169  ASP A N     1 
ATOM   1684 C  CA    . ASP C 3 163 ? 88.020 24.300  15.189  1.00 38.02 ? 169  ASP A CA    1 
ATOM   1685 C  C     . ASP C 3 163 ? 86.494 24.347  15.181  1.00 37.08 ? 169  ASP A C     1 
ATOM   1686 O  O     . ASP C 3 163 ? 85.840 23.458  15.720  1.00 36.09 ? 169  ASP A O     1 
ATOM   1687 C  CB    . ASP C 3 163 ? 88.537 25.154  16.350  1.00 39.41 ? 169  ASP A CB    1 
ATOM   1688 C  CG    . ASP C 3 163 ? 90.011 24.935  16.626  1.00 42.48 ? 169  ASP A CG    1 
ATOM   1689 O  OD1   . ASP C 3 163 ? 90.499 23.801  16.422  1.00 42.47 ? 169  ASP A OD1   1 
ATOM   1690 O  OD2   . ASP C 3 163 ? 90.676 25.900  17.063  1.00 44.68 ? 169  ASP A OD2   1 
ATOM   1691 N  N     . TYR C 3 164 ? 85.932 25.399  14.595  1.00 37.15 ? 170  TYR A N     1 
ATOM   1692 C  CA    . TYR C 3 164 ? 84.486 25.526  14.510  1.00 37.24 ? 170  TYR A CA    1 
ATOM   1693 C  C     . TYR C 3 164 ? 83.940 24.404  13.622  1.00 37.16 ? 170  TYR A C     1 
ATOM   1694 O  O     . TYR C 3 164 ? 82.887 23.828  13.910  1.00 36.30 ? 170  TYR A O     1 
ATOM   1695 C  CB    . TYR C 3 164 ? 84.114 26.900  13.949  1.00 39.78 ? 170  TYR A CB    1 
ATOM   1696 C  CG    . TYR C 3 164 ? 83.835 27.937  15.017  1.00 42.33 ? 170  TYR A CG    1 
ATOM   1697 C  CD1   . TYR C 3 164 ? 82.627 27.928  15.719  1.00 44.91 ? 170  TYR A CD1   1 
ATOM   1698 C  CD2   . TYR C 3 164 ? 84.770 28.927  15.328  1.00 42.97 ? 170  TYR A CD2   1 
ATOM   1699 C  CE1   . TYR C 3 164 ? 82.353 28.878  16.703  1.00 45.45 ? 170  TYR A CE1   1 
ATOM   1700 C  CE2   . TYR C 3 164 ? 84.506 29.884  16.314  1.00 43.98 ? 170  TYR A CE2   1 
ATOM   1701 C  CZ    . TYR C 3 164 ? 83.294 29.851  16.994  1.00 45.50 ? 170  TYR A CZ    1 
ATOM   1702 O  OH    . TYR C 3 164 ? 83.009 30.788  17.955  1.00 47.41 ? 170  TYR A OH    1 
ATOM   1703 N  N     . ASN C 3 165 ? 84.675 24.086  12.556  1.00 35.46 ? 171  ASN A N     1 
ATOM   1704 C  CA    . ASN C 3 165 ? 84.290 23.020  11.631  1.00 35.50 ? 171  ASN A CA    1 
ATOM   1705 C  C     . ASN C 3 165 ? 84.168 21.705  12.406  1.00 35.77 ? 171  ASN A C     1 
ATOM   1706 O  O     . ASN C 3 165 ? 83.148 21.015  12.324  1.00 34.07 ? 171  ASN A O     1 
ATOM   1707 C  CB    . ASN C 3 165 ? 85.344 22.875  10.526  1.00 34.34 ? 171  ASN A CB    1 
ATOM   1708 C  CG    . ASN C 3 165 ? 84.849 22.053  9.340   1.00 36.77 ? 171  ASN A CG    1 
ATOM   1709 O  OD1   . ASN C 3 165 ? 85.580 21.840  8.369   1.00 33.67 ? 171  ASN A OD1   1 
ATOM   1710 N  ND2   . ASN C 3 165 ? 83.602 21.590  9.413   1.00 35.48 ? 171  ASN A ND2   1 
ATOM   1711 N  N     . VAL C 3 166 ? 85.209 21.362  13.161  1.00 36.16 ? 172  VAL A N     1 
ATOM   1712 C  CA    . VAL C 3 166 ? 85.195 20.134  13.953  1.00 35.55 ? 172  VAL A CA    1 
ATOM   1713 C  C     . VAL C 3 166 ? 84.029 20.159  14.946  1.00 37.08 ? 172  VAL A C     1 
ATOM   1714 O  O     . VAL C 3 166 ? 83.365 19.144  15.149  1.00 35.64 ? 172  VAL A O     1 
ATOM   1715 C  CB    . VAL C 3 166 ? 86.511 19.950  14.745  1.00 36.52 ? 172  VAL A CB    1 
ATOM   1716 C  CG1   . VAL C 3 166 ? 86.378 18.779  15.718  1.00 35.24 ? 172  VAL A CG1   1 
ATOM   1717 C  CG2   . VAL C 3 166 ? 87.665 19.694  13.791  1.00 34.32 ? 172  VAL A CG2   1 
ATOM   1718 N  N     . GLN C 3 167 ? 83.781 21.320  15.556  1.00 36.55 ? 173  GLN A N     1 
ATOM   1719 C  CA    . GLN C 3 167 ? 82.687 21.447  16.517  1.00 38.07 ? 173  GLN A CA    1 
ATOM   1720 C  C     . GLN C 3 167 ? 81.348 21.200  15.829  1.00 36.99 ? 173  GLN A C     1 
ATOM   1721 O  O     . GLN C 3 167 ? 80.426 20.636  16.424  1.00 36.86 ? 173  GLN A O     1 
ATOM   1722 C  CB    . GLN C 3 167 ? 82.668 22.838  17.166  1.00 38.81 ? 173  GLN A CB    1 
ATOM   1723 C  CG    . GLN C 3 167 ? 81.579 22.972  18.234  1.00 45.72 ? 173  GLN A CG    1 
ATOM   1724 C  CD    . GLN C 3 167 ? 81.374 24.389  18.734  1.00 48.06 ? 173  GLN A CD    1 
ATOM   1725 O  OE1   . GLN C 3 167 ? 80.900 25.257  18.001  1.00 52.69 ? 173  GLN A OE1   1 
ATOM   1726 N  NE2   . GLN C 3 167 ? 81.724 24.629  19.993  1.00 49.65 ? 173  GLN A NE2   1 
ATOM   1727 N  N     . ASP C 3 168 ? 81.243 21.636  14.576  1.00 35.89 ? 174  ASP A N     1 
ATOM   1728 C  CA    . ASP C 3 168 ? 80.024 21.456  13.788  1.00 33.60 ? 174  ASP A CA    1 
ATOM   1729 C  C     . ASP C 3 168 ? 79.676 19.980  13.656  1.00 31.03 ? 174  ASP A C     1 
ATOM   1730 O  O     . ASP C 3 168 ? 78.526 19.576  13.845  1.00 29.33 ? 174  ASP A O     1 
ATOM   1731 C  CB    . ASP C 3 168 ? 80.203 22.036  12.384  1.00 36.18 ? 174  ASP A CB    1 
ATOM   1732 C  CG    . ASP C 3 168 ? 79.842 23.500  12.302  1.00 40.81 ? 174  ASP A CG    1 
ATOM   1733 O  OD1   . ASP C 3 168 ? 80.159 24.132  11.265  1.00 43.35 ? 174  ASP A OD1   1 
ATOM   1734 O  OD2   . ASP C 3 168 ? 79.235 24.019  13.265  1.00 43.69 ? 174  ASP A OD2   1 
ATOM   1735 N  N     . VAL C 3 169 ? 80.680 19.180  13.319  1.00 29.21 ? 175  VAL A N     1 
ATOM   1736 C  CA    . VAL C 3 169 ? 80.481 17.753  13.141  1.00 28.25 ? 175  VAL A CA    1 
ATOM   1737 C  C     . VAL C 3 169 ? 80.169 17.045  14.459  1.00 29.77 ? 175  VAL A C     1 
ATOM   1738 O  O     . VAL C 3 169 ? 79.416 16.076  14.474  1.00 29.73 ? 175  VAL A O     1 
ATOM   1739 C  CB    . VAL C 3 169 ? 81.707 17.104  12.463  1.00 28.18 ? 175  VAL A CB    1 
ATOM   1740 C  CG1   . VAL C 3 169 ? 81.508 15.599  12.343  1.00 25.07 ? 175  VAL A CG1   1 
ATOM   1741 C  CG2   . VAL C 3 169 ? 81.906 17.707  11.070  1.00 27.67 ? 175  VAL A CG2   1 
ATOM   1742 N  N     . VAL C 3 170 ? 80.734 17.520  15.567  1.00 30.86 ? 176  VAL A N     1 
ATOM   1743 C  CA    . VAL C 3 170 ? 80.444 16.884  16.846  1.00 31.94 ? 176  VAL A CA    1 
ATOM   1744 C  C     . VAL C 3 170 ? 78.989 17.177  17.222  1.00 30.10 ? 176  VAL A C     1 
ATOM   1745 O  O     . VAL C 3 170 ? 78.279 16.299  17.685  1.00 31.08 ? 176  VAL A O     1 
ATOM   1746 C  CB    . VAL C 3 170 ? 81.387 17.370  17.992  1.00 32.35 ? 176  VAL A CB    1 
ATOM   1747 C  CG1   . VAL C 3 170 ? 82.849 17.160  17.608  1.00 33.59 ? 176  VAL A CG1   1 
ATOM   1748 C  CG2   . VAL C 3 170 ? 81.129 18.813  18.310  1.00 37.33 ? 176  VAL A CG2   1 
ATOM   1749 N  N     . VAL C 3 171 ? 78.548 18.413  17.011  1.00 30.93 ? 177  VAL A N     1 
ATOM   1750 C  CA    . VAL C 3 171 ? 77.176 18.793  17.321  1.00 29.66 ? 177  VAL A CA    1 
ATOM   1751 C  C     . VAL C 3 171 ? 76.168 18.130  16.368  1.00 30.07 ? 177  VAL A C     1 
ATOM   1752 O  O     . VAL C 3 171 ? 75.056 17.791  16.778  1.00 30.73 ? 177  VAL A O     1 
ATOM   1753 C  CB    . VAL C 3 171 ? 76.989 20.321  17.248  1.00 31.63 ? 177  VAL A CB    1 
ATOM   1754 C  CG1   . VAL C 3 171 ? 75.520 20.677  17.500  1.00 33.05 ? 177  VAL A CG1   1 
ATOM   1755 C  CG2   . VAL C 3 171 ? 77.888 21.006  18.271  1.00 31.44 ? 177  VAL A CG2   1 
ATOM   1756 N  N     . THR C 3 172 ? 76.553 17.950  15.105  1.00 26.14 ? 178  THR A N     1 
ATOM   1757 C  CA    . THR C 3 172 ? 75.672 17.323  14.119  1.00 25.37 ? 178  THR A CA    1 
ATOM   1758 C  C     . THR C 3 172 ? 75.525 15.845  14.420  1.00 27.44 ? 178  THR A C     1 
ATOM   1759 O  O     . THR C 3 172 ? 74.448 15.272  14.246  1.00 25.57 ? 178  THR A O     1 
ATOM   1760 C  CB    . THR C 3 172 ? 76.205 17.492  12.679  1.00 23.25 ? 178  THR A CB    1 
ATOM   1761 O  OG1   . THR C 3 172 ? 76.260 18.885  12.358  1.00 22.50 ? 178  THR A OG1   1 
ATOM   1762 C  CG2   . THR C 3 172 ? 75.287 16.790  11.677  1.00 21.35 ? 178  THR A CG2   1 
ATOM   1763 N  N     . LYS C 3 173 ? 76.615 15.223  14.858  1.00 28.75 ? 179  LYS A N     1 
ATOM   1764 C  CA    . LYS C 3 173 ? 76.575 13.813  15.221  1.00 28.91 ? 179  LYS A CA    1 
ATOM   1765 C  C     . LYS C 3 173 ? 75.607 13.661  16.407  1.00 29.20 ? 179  LYS A C     1 
ATOM   1766 O  O     . LYS C 3 173 ? 74.769 12.765  16.424  1.00 28.18 ? 179  LYS A O     1 
ATOM   1767 C  CB    . LYS C 3 173 ? 77.971 13.336  15.625  1.00 29.31 ? 179  LYS A CB    1 
ATOM   1768 C  CG    . LYS C 3 173 ? 78.059 11.875  16.054  1.00 30.70 ? 179  LYS A CG    1 
ATOM   1769 C  CD    . LYS C 3 173 ? 79.474 11.575  16.590  1.00 33.69 ? 179  LYS A CD    1 
ATOM   1770 C  CE    . LYS C 3 173 ? 79.615 10.145  17.101  1.00 34.65 ? 179  LYS A CE    1 
ATOM   1771 N  NZ    . LYS C 3 173 ? 78.705 9.871   18.244  1.00 34.92 ? 179  LYS A NZ    1 
ATOM   1772 N  N     . ALA C 3 174 ? 75.727 14.547  17.392  1.00 28.88 ? 180  ALA A N     1 
ATOM   1773 C  CA    . ALA C 3 174 ? 74.850 14.504  18.564  1.00 30.25 ? 180  ALA A CA    1 
ATOM   1774 C  C     . ALA C 3 174 ? 73.383 14.689  18.159  1.00 30.65 ? 180  ALA A C     1 
ATOM   1775 O  O     . ALA C 3 174 ? 72.493 13.985  18.644  1.00 30.61 ? 180  ALA A O     1 
ATOM   1776 C  CB    . ALA C 3 174 ? 75.255 15.591  19.563  1.00 29.55 ? 180  ALA A CB    1 
ATOM   1777 N  N     . LEU C 3 175 ? 73.140 15.644  17.269  1.00 29.24 ? 181  LEU A N     1 
ATOM   1778 C  CA    . LEU C 3 175 ? 71.788 15.919  16.807  1.00 28.62 ? 181  LEU A CA    1 
ATOM   1779 C  C     . LEU C 3 175 ? 71.239 14.682  16.122  1.00 28.03 ? 181  LEU A C     1 
ATOM   1780 O  O     . LEU C 3 175 ? 70.128 14.237  16.415  1.00 27.56 ? 181  LEU A O     1 
ATOM   1781 C  CB    . LEU C 3 175 ? 71.791 17.073  15.801  1.00 27.76 ? 181  LEU A CB    1 
ATOM   1782 C  CG    . LEU C 3 175 ? 70.558 17.971  15.704  1.00 28.59 ? 181  LEU A CG    1 
ATOM   1783 C  CD1   . LEU C 3 175 ? 70.602 18.688  14.371  1.00 26.34 ? 181  LEU A CD1   1 
ATOM   1784 C  CD2   . LEU C 3 175 ? 69.277 17.187  15.848  1.00 28.14 ? 181  LEU A CD2   1 
ATOM   1785 N  N     . LEU C 3 176 ? 72.030 14.141  15.199  1.00 26.61 ? 182  LEU A N     1 
ATOM   1786 C  CA    . LEU C 3 176 ? 71.641 12.962  14.439  1.00 27.34 ? 182  LEU A CA    1 
ATOM   1787 C  C     . LEU C 3 176 ? 71.193 11.812  15.331  1.00 28.26 ? 182  LEU A C     1 
ATOM   1788 O  O     . LEU C 3 176 ? 70.116 11.253  15.138  1.00 28.26 ? 182  LEU A O     1 
ATOM   1789 C  CB    . LEU C 3 176 ? 72.805 12.487  13.564  1.00 26.39 ? 182  LEU A CB    1 
ATOM   1790 C  CG    . LEU C 3 176 ? 72.571 11.162  12.828  1.00 26.36 ? 182  LEU A CG    1 
ATOM   1791 C  CD1   . LEU C 3 176 ? 71.582 11.358  11.684  1.00 25.91 ? 182  LEU A CD1   1 
ATOM   1792 C  CD2   . LEU C 3 176 ? 73.894 10.647  12.297  1.00 25.86 ? 182  LEU A CD2   1 
ATOM   1793 N  N     . GLU C 3 177 ? 72.031 11.448  16.296  1.00 27.84 ? 183  GLU A N     1 
ATOM   1794 C  CA    . GLU C 3 177 ? 71.703 10.350  17.191  1.00 29.18 ? 183  GLU A CA    1 
ATOM   1795 C  C     . GLU C 3 177 ? 70.458 10.667  18.015  1.00 29.73 ? 183  GLU A C     1 
ATOM   1796 O  O     . GLU C 3 177 ? 69.685 9.776   18.346  1.00 30.29 ? 183  GLU A O     1 
ATOM   1797 C  CB    . GLU C 3 177 ? 72.910 10.023  18.075  1.00 29.70 ? 183  GLU A CB    1 
ATOM   1798 C  CG    . GLU C 3 177 ? 74.086 9.485   17.238  1.00 32.83 ? 183  GLU A CG    1 
ATOM   1799 C  CD    . GLU C 3 177 ? 75.352 9.219   18.040  1.00 34.34 ? 183  GLU A CD    1 
ATOM   1800 O  OE1   . GLU C 3 177 ? 75.497 9.788   19.144  1.00 36.41 ? 183  GLU A OE1   1 
ATOM   1801 O  OE2   . GLU C 3 177 ? 76.212 8.454   17.551  1.00 34.87 ? 183  GLU A OE2   1 
ATOM   1802 N  N     . LYS C 3 178 ? 70.249 11.943  18.317  1.00 29.14 ? 184  LYS A N     1 
ATOM   1803 C  CA    . LYS C 3 178 ? 69.073 12.348  19.068  1.00 30.50 ? 184  LYS A CA    1 
ATOM   1804 C  C     . LYS C 3 178 ? 67.849 12.128  18.182  1.00 30.27 ? 184  LYS A C     1 
ATOM   1805 O  O     . LYS C 3 178 ? 66.838 11.594  18.628  1.00 30.31 ? 184  LYS A O     1 
ATOM   1806 C  CB    . LYS C 3 178 ? 69.184 13.822  19.465  1.00 33.92 ? 184  LYS A CB    1 
ATOM   1807 C  CG    . LYS C 3 178 ? 67.973 14.386  20.209  1.00 38.41 ? 184  LYS A CG    1 
ATOM   1808 C  CD    . LYS C 3 178 ? 68.229 15.844  20.627  1.00 39.87 ? 184  LYS A CD    1 
ATOM   1809 C  CE    . LYS C 3 178 ? 67.027 16.453  21.334  1.00 40.96 ? 184  LYS A CE    1 
ATOM   1810 N  NZ    . LYS C 3 178 ? 67.312 17.822  21.867  1.00 42.88 ? 184  LYS A NZ    1 
ATOM   1811 N  N     . LEU C 3 179 ? 67.948 12.538  16.921  1.00 29.54 ? 185  LEU A N     1 
ATOM   1812 C  CA    . LEU C 3 179 ? 66.846 12.375  15.980  1.00 27.22 ? 185  LEU A CA    1 
ATOM   1813 C  C     . LEU C 3 179 ? 66.549 10.896  15.747  1.00 26.36 ? 185  LEU A C     1 
ATOM   1814 O  O     . LEU C 3 179 ? 65.385 10.484  15.708  1.00 25.29 ? 185  LEU A O     1 
ATOM   1815 C  CB    . LEU C 3 179 ? 67.178 13.071  14.653  1.00 25.89 ? 185  LEU A CB    1 
ATOM   1816 C  CG    . LEU C 3 179 ? 67.207 14.601  14.774  1.00 26.93 ? 185  LEU A CG    1 
ATOM   1817 C  CD1   . LEU C 3 179 ? 67.749 15.233  13.497  1.00 24.80 ? 185  LEU A CD1   1 
ATOM   1818 C  CD2   . LEU C 3 179 ? 65.793 15.109  15.079  1.00 25.50 ? 185  LEU A CD2   1 
ATOM   1819 N  N     . LEU C 3 180 ? 67.605 10.101  15.616  1.00 23.82 ? 186  LEU A N     1 
ATOM   1820 C  CA    . LEU C 3 180 ? 67.471 8.666   15.390  1.00 25.98 ? 186  LEU A CA    1 
ATOM   1821 C  C     . LEU C 3 180 ? 66.953 7.907   16.627  1.00 27.33 ? 186  LEU A C     1 
ATOM   1822 O  O     . LEU C 3 180 ? 66.542 6.746   16.517  1.00 26.00 ? 186  LEU A O     1 
ATOM   1823 C  CB    . LEU C 3 180 ? 68.818 8.070   14.962  1.00 26.64 ? 186  LEU A CB    1 
ATOM   1824 C  CG    . LEU C 3 180 ? 69.441 8.525   13.640  1.00 28.09 ? 186  LEU A CG    1 
ATOM   1825 C  CD1   . LEU C 3 180 ? 70.809 7.868   13.463  1.00 28.20 ? 186  LEU A CD1   1 
ATOM   1826 C  CD2   . LEU C 3 180 ? 68.513 8.158   12.491  1.00 29.08 ? 186  LEU A CD2   1 
ATOM   1827 N  N     . SER C 3 181 ? 66.980 8.547   17.794  1.00 26.78 ? 187  SER A N     1 
ATOM   1828 C  CA    . SER C 3 181 ? 66.488 7.898   19.008  1.00 29.17 ? 187  SER A CA    1 
ATOM   1829 C  C     . SER C 3 181 ? 64.954 7.973   19.079  1.00 30.05 ? 187  SER A C     1 
ATOM   1830 O  O     . SER C 3 181 ? 64.336 7.439   20.000  1.00 28.62 ? 187  SER A O     1 
ATOM   1831 C  CB    . SER C 3 181 ? 67.107 8.537   20.265  1.00 27.75 ? 187  SER A CB    1 
ATOM   1832 O  OG    . SER C 3 181 ? 66.515 9.791   20.574  1.00 31.78 ? 187  SER A OG    1 
ATOM   1833 N  N     . ASP C 3 182 ? 64.340 8.631   18.100  1.00 30.18 ? 188  ASP A N     1 
ATOM   1834 C  CA    . ASP C 3 182 ? 62.887 8.728   18.077  1.00 29.51 ? 188  ASP A CA    1 
ATOM   1835 C  C     . ASP C 3 182 ? 62.306 7.477   17.421  1.00 29.69 ? 188  ASP A C     1 
ATOM   1836 O  O     . ASP C 3 182 ? 62.320 7.344   16.200  1.00 28.57 ? 188  ASP A O     1 
ATOM   1837 C  CB    . ASP C 3 182 ? 62.427 9.961   17.300  1.00 30.11 ? 188  ASP A CB    1 
ATOM   1838 C  CG    . ASP C 3 182 ? 60.938 10.210  17.459  1.00 31.20 ? 188  ASP A CG    1 
ATOM   1839 O  OD1   . ASP C 3 182 ? 60.158 9.258   17.268  1.00 33.67 ? 188  ASP A OD1   1 
ATOM   1840 O  OD2   . ASP C 3 182 ? 60.548 11.342  17.782  1.00 31.94 ? 188  ASP A OD2   1 
ATOM   1841 N  N     . LYS C 3 183 ? 61.786 6.572   18.249  1.00 29.66 ? 189  LYS A N     1 
ATOM   1842 C  CA    . LYS C 3 183 ? 61.210 5.305   17.803  1.00 30.27 ? 189  LYS A CA    1 
ATOM   1843 C  C     . LYS C 3 183 ? 60.029 5.395   16.833  1.00 31.05 ? 189  LYS A C     1 
ATOM   1844 O  O     . LYS C 3 183 ? 59.766 4.451   16.080  1.00 30.79 ? 189  LYS A O     1 
ATOM   1845 C  CB    . LYS C 3 183 ? 60.786 4.484   19.026  1.00 33.37 ? 189  LYS A CB    1 
ATOM   1846 N  N     . HIS C 3 184 ? 59.299 6.506   16.862  1.00 29.84 ? 190  HIS A N     1 
ATOM   1847 C  CA    . HIS C 3 184 ? 58.169 6.662   15.953  1.00 28.98 ? 190  HIS A CA    1 
ATOM   1848 C  C     . HIS C 3 184 ? 58.650 6.688   14.497  1.00 26.67 ? 190  HIS A C     1 
ATOM   1849 O  O     . HIS C 3 184 ? 57.979 6.178   13.606  1.00 26.45 ? 190  HIS A O     1 
ATOM   1850 C  CB    . HIS C 3 184 ? 57.412 7.957   16.252  1.00 29.02 ? 190  HIS A CB    1 
ATOM   1851 C  CG    . HIS C 3 184 ? 56.216 8.174   15.374  1.00 30.39 ? 190  HIS A CG    1 
ATOM   1852 N  ND1   . HIS C 3 184 ? 54.964 7.687   15.683  1.00 30.31 ? 190  HIS A ND1   1 
ATOM   1853 C  CD2   . HIS C 3 184 ? 56.087 8.812   14.185  1.00 30.43 ? 190  HIS A CD2   1 
ATOM   1854 C  CE1   . HIS C 3 184 ? 54.115 8.020   14.726  1.00 31.89 ? 190  HIS A CE1   1 
ATOM   1855 N  NE2   . HIS C 3 184 ? 54.772 8.703   13.804  1.00 28.37 ? 190  HIS A NE2   1 
ATOM   1856 N  N     . TYR C 3 185 ? 59.820 7.276   14.263  1.00 25.54 ? 191  TYR A N     1 
ATOM   1857 C  CA    . TYR C 3 185 ? 60.357 7.382   12.907  1.00 23.73 ? 191  TYR A CA    1 
ATOM   1858 C  C     . TYR C 3 185 ? 61.438 6.351   12.582  1.00 24.47 ? 191  TYR A C     1 
ATOM   1859 O  O     . TYR C 3 185 ? 61.704 6.060   11.421  1.00 25.23 ? 191  TYR A O     1 
ATOM   1860 C  CB    . TYR C 3 185 ? 60.903 8.796   12.675  1.00 23.13 ? 191  TYR A CB    1 
ATOM   1861 C  CG    . TYR C 3 185 ? 59.862 9.888   12.849  1.00 23.26 ? 191  TYR A CG    1 
ATOM   1862 C  CD1   . TYR C 3 185 ? 59.513 10.355  14.120  1.00 23.38 ? 191  TYR A CD1   1 
ATOM   1863 C  CD2   . TYR C 3 185 ? 59.192 10.423  11.746  1.00 23.96 ? 191  TYR A CD2   1 
ATOM   1864 C  CE1   . TYR C 3 185 ? 58.522 11.324  14.286  1.00 23.69 ? 191  TYR A CE1   1 
ATOM   1865 C  CE2   . TYR C 3 185 ? 58.190 11.396  11.903  1.00 23.12 ? 191  TYR A CE2   1 
ATOM   1866 C  CZ    . TYR C 3 185 ? 57.862 11.842  13.174  1.00 25.08 ? 191  TYR A CZ    1 
ATOM   1867 O  OH    . TYR C 3 185 ? 56.881 12.814  13.338  1.00 25.89 ? 191  TYR A OH    1 
ATOM   1868 N  N     . PHE C 3 186 ? 62.055 5.785   13.607  1.00 25.26 ? 192  PHE A N     1 
ATOM   1869 C  CA    . PHE C 3 186 ? 63.103 4.797   13.380  1.00 27.89 ? 192  PHE A CA    1 
ATOM   1870 C  C     . PHE C 3 186 ? 62.935 3.604   14.317  1.00 28.85 ? 192  PHE A C     1 
ATOM   1871 O  O     . PHE C 3 186 ? 63.130 3.727   15.526  1.00 28.23 ? 192  PHE A O     1 
ATOM   1872 C  CB    . PHE C 3 186 ? 64.478 5.446   13.596  1.00 26.05 ? 192  PHE A CB    1 
ATOM   1873 C  CG    . PHE C 3 186 ? 64.776 6.568   12.638  1.00 25.21 ? 192  PHE A CG    1 
ATOM   1874 C  CD1   . PHE C 3 186 ? 65.146 6.301   11.321  1.00 26.65 ? 192  PHE A CD1   1 
ATOM   1875 C  CD2   . PHE C 3 186 ? 64.689 7.891   13.051  1.00 26.32 ? 192  PHE A CD2   1 
ATOM   1876 C  CE1   . PHE C 3 186 ? 65.427 7.345   10.420  1.00 26.96 ? 192  PHE A CE1   1 
ATOM   1877 C  CE2   . PHE C 3 186 ? 64.967 8.944   12.163  1.00 26.27 ? 192  PHE A CE2   1 
ATOM   1878 C  CZ    . PHE C 3 186 ? 65.335 8.665   10.844  1.00 25.46 ? 192  PHE A CZ    1 
ATOM   1879 N  N     . PRO C 3 187 ? 62.543 2.437   13.771  1.00 31.48 ? 193  PRO A N     1 
ATOM   1880 C  CA    . PRO C 3 187 ? 62.367 1.245   14.614  1.00 33.70 ? 193  PRO A CA    1 
ATOM   1881 C  C     . PRO C 3 187 ? 63.593 1.036   15.513  1.00 35.65 ? 193  PRO A C     1 
ATOM   1882 O  O     . PRO C 3 187 ? 64.731 1.115   15.058  1.00 37.50 ? 193  PRO A O     1 
ATOM   1883 C  CB    . PRO C 3 187 ? 62.182 0.130   13.589  1.00 33.42 ? 193  PRO A CB    1 
ATOM   1884 C  CG    . PRO C 3 187 ? 61.411 0.823   12.506  1.00 33.88 ? 193  PRO A CG    1 
ATOM   1885 C  CD    . PRO C 3 187 ? 62.150 2.157   12.377  1.00 30.99 ? 193  PRO A CD    1 
ATOM   1886 N  N     . PRO C 3 188 ? 63.368 0.787   16.808  1.00 37.20 ? 194  PRO A N     1 
ATOM   1887 C  CA    . PRO C 3 188 ? 64.430 0.569   17.798  1.00 38.35 ? 194  PRO A CA    1 
ATOM   1888 C  C     . PRO C 3 188 ? 65.334 -0.635  17.512  1.00 39.15 ? 194  PRO A C     1 
ATOM   1889 O  O     . PRO C 3 188 ? 66.499 -0.654  17.916  1.00 39.46 ? 194  PRO A O     1 
ATOM   1890 C  CB    . PRO C 3 188 ? 63.653 0.389   19.105  1.00 38.84 ? 194  PRO A CB    1 
ATOM   1891 C  CG    . PRO C 3 188 ? 62.400 1.170   18.873  1.00 38.18 ? 194  PRO A CG    1 
ATOM   1892 C  CD    . PRO C 3 188 ? 62.046 0.797   17.457  1.00 38.01 ? 194  PRO A CD    1 
ATOM   1893 N  N     . GLU C 3 189 ? 64.795 -1.629  16.814  1.00 39.38 ? 195  GLU A N     1 
ATOM   1894 C  CA    . GLU C 3 189 ? 65.538 -2.846  16.503  1.00 40.09 ? 195  GLU A CA    1 
ATOM   1895 C  C     . GLU C 3 189 ? 66.611 -2.685  15.434  1.00 39.43 ? 195  GLU A C     1 
ATOM   1896 O  O     . GLU C 3 189 ? 67.344 -3.629  15.139  1.00 39.81 ? 195  GLU A O     1 
ATOM   1897 C  CB    . GLU C 3 189 ? 64.574 -3.962  16.077  1.00 41.79 ? 195  GLU A CB    1 
ATOM   1898 C  CG    . GLU C 3 189 ? 63.630 -3.578  14.944  1.00 46.75 ? 195  GLU A CG    1 
ATOM   1899 C  CD    . GLU C 3 189 ? 62.344 -2.928  15.440  1.00 49.35 ? 195  GLU A CD    1 
ATOM   1900 O  OE1   . GLU C 3 189 ? 62.412 -2.081  16.359  1.00 50.48 ? 195  GLU A OE1   1 
ATOM   1901 O  OE2   . GLU C 3 189 ? 61.263 -3.259  14.903  1.00 51.67 ? 195  GLU A OE2   1 
ATOM   1902 N  N     . ILE C 3 190 ? 66.714 -1.497  14.854  1.00 37.83 ? 196  ILE A N     1 
ATOM   1903 C  CA    . ILE C 3 190 ? 67.699 -1.267  13.808  1.00 34.94 ? 196  ILE A CA    1 
ATOM   1904 C  C     . ILE C 3 190 ? 68.660 -0.153  14.192  1.00 34.82 ? 196  ILE A C     1 
ATOM   1905 O  O     . ILE C 3 190 ? 68.239 0.900   14.668  1.00 34.07 ? 196  ILE A O     1 
ATOM   1906 C  CB    . ILE C 3 190 ? 67.018 -0.880  12.482  1.00 35.34 ? 196  ILE A CB    1 
ATOM   1907 C  CG1   . ILE C 3 190 ? 65.993 -1.946  12.095  1.00 36.30 ? 196  ILE A CG1   1 
ATOM   1908 C  CG2   . ILE C 3 190 ? 68.062 -0.732  11.371  1.00 30.63 ? 196  ILE A CG2   1 
ATOM   1909 C  CD1   . ILE C 3 190 ? 65.139 -1.556  10.908  1.00 36.51 ? 196  ILE A CD1   1 
ATOM   1910 N  N     . ASP C 3 191 ? 69.952 -0.396  14.002  1.00 33.56 ? 197  ASP A N     1 
ATOM   1911 C  CA    . ASP C 3 191 ? 70.953 0.623   14.290  1.00 33.11 ? 197  ASP A CA    1 
ATOM   1912 C  C     . ASP C 3 191 ? 71.099 1.382   12.978  1.00 31.49 ? 197  ASP A C     1 
ATOM   1913 O  O     . ASP C 3 191 ? 71.787 0.918   12.068  1.00 30.86 ? 197  ASP A O     1 
ATOM   1914 C  CB    . ASP C 3 191 ? 72.298 -0.008  14.650  1.00 34.71 ? 197  ASP A CB    1 
ATOM   1915 C  CG    . ASP C 3 191 ? 73.371 1.038   14.948  1.00 36.58 ? 197  ASP A CG    1 
ATOM   1916 O  OD1   . ASP C 3 191 ? 73.139 2.239   14.662  1.00 33.51 ? 197  ASP A OD1   1 
ATOM   1917 O  OD2   . ASP C 3 191 ? 74.444 0.656   15.465  1.00 37.32 ? 197  ASP A OD2   1 
ATOM   1918 N  N     . PHE C 3 192 ? 70.464 2.541   12.874  1.00 30.34 ? 198  PHE A N     1 
ATOM   1919 C  CA    . PHE C 3 192 ? 70.528 3.293   11.625  1.00 30.67 ? 198  PHE A CA    1 
ATOM   1920 C  C     . PHE C 3 192 ? 71.860 3.970   11.332  1.00 30.13 ? 198  PHE A C     1 
ATOM   1921 O  O     . PHE C 3 192 ? 72.032 4.564   10.275  1.00 31.08 ? 198  PHE A O     1 
ATOM   1922 C  CB    . PHE C 3 192 ? 69.376 4.304   11.546  1.00 26.09 ? 198  PHE A CB    1 
ATOM   1923 C  CG    . PHE C 3 192 ? 68.044 3.666   11.248  1.00 29.82 ? 198  PHE A CG    1 
ATOM   1924 C  CD1   . PHE C 3 192 ? 67.282 3.098   12.265  1.00 28.61 ? 198  PHE A CD1   1 
ATOM   1925 C  CD2   . PHE C 3 192 ? 67.582 3.571   9.935   1.00 28.64 ? 198  PHE A CD2   1 
ATOM   1926 C  CE1   . PHE C 3 192 ? 66.087 2.442   11.980  1.00 28.37 ? 198  PHE A CE1   1 
ATOM   1927 C  CE2   . PHE C 3 192 ? 66.387 2.915   9.638   1.00 28.90 ? 198  PHE A CE2   1 
ATOM   1928 C  CZ    . PHE C 3 192 ? 65.640 2.350   10.660  1.00 29.78 ? 198  PHE A CZ    1 
ATOM   1929 N  N     . THR C 3 193 ? 72.807 3.874   12.256  1.00 31.14 ? 199  THR A N     1 
ATOM   1930 C  CA    . THR C 3 193 ? 74.119 4.467   12.025  1.00 30.77 ? 199  THR A CA    1 
ATOM   1931 C  C     . THR C 3 193 ? 75.020 3.366   11.503  1.00 30.55 ? 199  THR A C     1 
ATOM   1932 O  O     . THR C 3 193 ? 76.226 3.563   11.355  1.00 32.38 ? 199  THR A O     1 
ATOM   1933 C  CB    . THR C 3 193 ? 74.754 5.024   13.317  1.00 32.36 ? 199  THR A CB    1 
ATOM   1934 O  OG1   . THR C 3 193 ? 75.018 3.947   14.226  1.00 34.25 ? 199  THR A OG1   1 
ATOM   1935 C  CG2   . THR C 3 193 ? 73.831 6.041   13.977  1.00 31.61 ? 199  THR A CG2   1 
ATOM   1936 N  N     . ASP C 3 194 ? 74.427 2.211   11.205  1.00 30.26 ? 200  ASP A N     1 
ATOM   1937 C  CA    . ASP C 3 194 ? 75.193 1.065   10.729  1.00 30.15 ? 200  ASP A CA    1 
ATOM   1938 C  C     . ASP C 3 194 ? 74.496 0.303   9.607   1.00 29.34 ? 200  ASP A C     1 
ATOM   1939 O  O     . ASP C 3 194 ? 74.571 -0.925  9.538   1.00 31.86 ? 200  ASP A O     1 
ATOM   1940 C  CB    . ASP C 3 194 ? 75.482 0.118   11.912  1.00 34.20 ? 200  ASP A CB    1 
ATOM   1941 C  CG    . ASP C 3 194 ? 76.435 -1.026  11.543  1.00 38.39 ? 200  ASP A CG    1 
ATOM   1942 O  OD1   . ASP C 3 194 ? 77.398 -0.780  10.786  1.00 40.15 ? 200  ASP A OD1   1 
ATOM   1943 O  OD2   . ASP C 3 194 ? 76.224 -2.168  12.020  1.00 39.19 ? 200  ASP A OD2   1 
ATOM   1944 N  N     . VAL C 3 195 ? 73.823 1.028   8.722   1.00 26.58 ? 201  VAL A N     1 
ATOM   1945 C  CA    . VAL C 3 195 ? 73.133 0.404   7.598   1.00 27.14 ? 201  VAL A CA    1 
ATOM   1946 C  C     . VAL C 3 195 ? 73.435 1.127   6.291   1.00 27.01 ? 201  VAL A C     1 
ATOM   1947 O  O     . VAL C 3 195 ? 73.870 2.278   6.299   1.00 27.68 ? 201  VAL A O     1 
ATOM   1948 C  CB    . VAL C 3 195 ? 71.589 0.418   7.791   1.00 27.92 ? 201  VAL A CB    1 
ATOM   1949 C  CG1   . VAL C 3 195 ? 71.207 -0.312  9.082   1.00 27.25 ? 201  VAL A CG1   1 
ATOM   1950 C  CG2   . VAL C 3 195 ? 71.080 1.855   7.812   1.00 26.02 ? 201  VAL A CG2   1 
ATOM   1951 N  N     . GLY C 3 196 ? 73.186 0.444   5.178   1.00 26.40 ? 202  GLY A N     1 
ATOM   1952 C  CA    . GLY C 3 196 ? 73.388 1.034   3.866   1.00 27.35 ? 202  GLY A CA    1 
ATOM   1953 C  C     . GLY C 3 196 ? 72.224 1.969   3.558   1.00 28.76 ? 202  GLY A C     1 
ATOM   1954 O  O     . GLY C 3 196 ? 71.191 1.938   4.244   1.00 26.71 ? 202  GLY A O     1 
ATOM   1955 N  N     . TYR C 3 197 ? 72.366 2.780   2.514   1.00 27.59 ? 203  TYR A N     1 
ATOM   1956 C  CA    . TYR C 3 197 ? 71.331 3.746   2.169   1.00 29.02 ? 203  TYR A CA    1 
ATOM   1957 C  C     . TYR C 3 197 ? 69.978 3.146   1.810   1.00 29.93 ? 203  TYR A C     1 
ATOM   1958 O  O     . TYR C 3 197 ? 68.946 3.675   2.215   1.00 30.06 ? 203  TYR A O     1 
ATOM   1959 C  CB    . TYR C 3 197 ? 71.809 4.671   1.036   1.00 26.15 ? 203  TYR A CB    1 
ATOM   1960 C  CG    . TYR C 3 197 ? 71.712 4.098   -0.359  1.00 26.46 ? 203  TYR A CG    1 
ATOM   1961 C  CD1   . TYR C 3 197 ? 70.499 4.092   -1.050  1.00 28.60 ? 203  TYR A CD1   1 
ATOM   1962 C  CD2   . TYR C 3 197 ? 72.839 3.579   -1.001  1.00 28.83 ? 203  TYR A CD2   1 
ATOM   1963 C  CE1   . TYR C 3 197 ? 70.405 3.588   -2.349  1.00 28.97 ? 203  TYR A CE1   1 
ATOM   1964 C  CE2   . TYR C 3 197 ? 72.760 3.069   -2.299  1.00 30.14 ? 203  TYR A CE2   1 
ATOM   1965 C  CZ    . TYR C 3 197 ? 71.542 3.079   -2.966  1.00 30.66 ? 203  TYR A CZ    1 
ATOM   1966 O  OH    . TYR C 3 197 ? 71.459 2.592   -4.246  1.00 31.34 ? 203  TYR A OH    1 
ATOM   1967 N  N     . THR C 3 198 ? 69.968 2.054   1.053   1.00 30.40 ? 204  THR A N     1 
ATOM   1968 C  CA    . THR C 3 198 ? 68.693 1.460   0.678   1.00 32.36 ? 204  THR A CA    1 
ATOM   1969 C  C     . THR C 3 198 ? 67.912 1.016   1.923   1.00 30.79 ? 204  THR A C     1 
ATOM   1970 O  O     . THR C 3 198 ? 66.705 1.226   2.007   1.00 31.00 ? 204  THR A O     1 
ATOM   1971 C  CB    . THR C 3 198 ? 68.882 0.273   -0.295  1.00 33.38 ? 204  THR A CB    1 
ATOM   1972 O  OG1   . THR C 3 198 ? 67.596 -0.277  -0.622  1.00 38.31 ? 204  THR A OG1   1 
ATOM   1973 C  CG2   . THR C 3 198 ? 69.736 -0.807  0.336   1.00 38.90 ? 204  THR A CG2   1 
ATOM   1974 N  N     . THR C 3 199 ? 68.608 0.435   2.897   1.00 28.62 ? 205  THR A N     1 
ATOM   1975 C  CA    . THR C 3 199 ? 67.975 -0.006  4.139   1.00 27.85 ? 205  THR A CA    1 
ATOM   1976 C  C     . THR C 3 199 ? 67.499 1.186   4.987   1.00 27.31 ? 205  THR A C     1 
ATOM   1977 O  O     . THR C 3 199 ? 66.442 1.131   5.618   1.00 28.94 ? 205  THR A O     1 
ATOM   1978 C  CB    . THR C 3 199 ? 68.956 -0.845  5.002   1.00 27.23 ? 205  THR A CB    1 
ATOM   1979 O  OG1   . THR C 3 199 ? 69.256 -2.078  4.338   1.00 26.74 ? 205  THR A OG1   1 
ATOM   1980 C  CG2   . THR C 3 199 ? 68.348 -1.148  6.359   1.00 25.89 ? 205  THR A CG2   1 
ATOM   1981 N  N     . PHE C 3 200 ? 68.289 2.255   5.012   1.00 27.12 ? 206  PHE A N     1 
ATOM   1982 C  CA    . PHE C 3 200 ? 67.941 3.439   5.795   1.00 27.23 ? 206  PHE A CA    1 
ATOM   1983 C  C     . PHE C 3 200 ? 66.588 4.012   5.358   1.00 27.22 ? 206  PHE A C     1 
ATOM   1984 O  O     . PHE C 3 200 ? 65.735 4.292   6.198   1.00 27.18 ? 206  PHE A O     1 
ATOM   1985 C  CB    . PHE C 3 200 ? 69.051 4.507   5.668   1.00 26.38 ? 206  PHE A CB    1 
ATOM   1986 C  CG    . PHE C 3 200 ? 68.788 5.761   6.457   1.00 26.22 ? 206  PHE A CG    1 
ATOM   1987 C  CD1   . PHE C 3 200 ? 67.925 6.738   5.975   1.00 26.72 ? 206  PHE A CD1   1 
ATOM   1988 C  CD2   . PHE C 3 200 ? 69.388 5.957   7.697   1.00 26.94 ? 206  PHE A CD2   1 
ATOM   1989 C  CE1   . PHE C 3 200 ? 67.662 7.888   6.718   1.00 26.25 ? 206  PHE A CE1   1 
ATOM   1990 C  CE2   . PHE C 3 200 ? 69.133 7.101   8.443   1.00 26.84 ? 206  PHE A CE2   1 
ATOM   1991 C  CZ    . PHE C 3 200 ? 68.264 8.070   7.950   1.00 27.68 ? 206  PHE A CZ    1 
ATOM   1992 N  N     . TRP C 3 201 ? 66.396 4.183   4.051   1.00 25.44 ? 207  TRP A N     1 
ATOM   1993 C  CA    . TRP C 3 201 ? 65.139 4.722   3.531   1.00 27.21 ? 207  TRP A CA    1 
ATOM   1994 C  C     . TRP C 3 201 ? 63.984 3.720   3.640   1.00 28.50 ? 207  TRP A C     1 
ATOM   1995 O  O     . TRP C 3 201 ? 62.867 4.087   4.002   1.00 27.76 ? 207  TRP A O     1 
ATOM   1996 C  CB    . TRP C 3 201 ? 65.287 5.129   2.053   1.00 27.22 ? 207  TRP A CB    1 
ATOM   1997 C  CG    . TRP C 3 201 ? 66.387 6.119   1.786   1.00 28.19 ? 207  TRP A CG    1 
ATOM   1998 C  CD1   . TRP C 3 201 ? 67.442 5.961   0.925   1.00 27.79 ? 207  TRP A CD1   1 
ATOM   1999 C  CD2   . TRP C 3 201 ? 66.558 7.403   2.397   1.00 26.02 ? 207  TRP A CD2   1 
ATOM   2000 N  NE1   . TRP C 3 201 ? 68.255 7.064   0.966   1.00 28.94 ? 207  TRP A NE1   1 
ATOM   2001 C  CE2   . TRP C 3 201 ? 67.740 7.965   1.861   1.00 28.04 ? 207  TRP A CE2   1 
ATOM   2002 C  CE3   . TRP C 3 201 ? 65.831 8.135   3.346   1.00 26.14 ? 207  TRP A CE3   1 
ATOM   2003 C  CZ2   . TRP C 3 201 ? 68.212 9.225   2.245   1.00 27.67 ? 207  TRP A CZ2   1 
ATOM   2004 C  CZ3   . TRP C 3 201 ? 66.302 9.390   3.727   1.00 27.85 ? 207  TRP A CZ3   1 
ATOM   2005 C  CH2   . TRP C 3 201 ? 67.481 9.921   3.177   1.00 26.63 ? 207  TRP A CH2   1 
ATOM   2006 N  N     . SER C 3 202 ? 64.256 2.455   3.333   1.00 28.09 ? 208  SER A N     1 
ATOM   2007 C  CA    . SER C 3 202 ? 63.218 1.428   3.367   1.00 30.69 ? 208  SER A CA    1 
ATOM   2008 C  C     . SER C 3 202 ? 62.722 1.020   4.753   1.00 28.74 ? 208  SER A C     1 
ATOM   2009 O  O     . SER C 3 202 ? 61.556 0.679   4.907   1.00 29.70 ? 208  SER A O     1 
ATOM   2010 C  CB    . SER C 3 202 ? 63.690 0.175   2.620   1.00 29.83 ? 208  SER A CB    1 
ATOM   2011 O  OG    . SER C 3 202 ? 64.744 -0.456  3.330   1.00 37.09 ? 208  SER A OG    1 
ATOM   2012 N  N     . GLU C 3 203 ? 63.594 1.055   5.756   1.00 29.53 ? 209  GLU A N     1 
ATOM   2013 C  CA    . GLU C 3 203 ? 63.214 0.648   7.110   1.00 29.76 ? 209  GLU A CA    1 
ATOM   2014 C  C     . GLU C 3 203 ? 62.734 1.776   8.023   1.00 28.96 ? 209  GLU A C     1 
ATOM   2015 O  O     . GLU C 3 203 ? 62.213 1.509   9.106   1.00 27.40 ? 209  GLU A O     1 
ATOM   2016 C  CB    . GLU C 3 203 ? 64.390 -0.069  7.781   1.00 34.96 ? 209  GLU A CB    1 
ATOM   2017 C  CG    . GLU C 3 203 ? 64.929 -1.263  6.994   1.00 39.41 ? 209  GLU A CG    1 
ATOM   2018 C  CD    . GLU C 3 203 ? 64.032 -2.474  7.090   1.00 43.30 ? 209  GLU A CD    1 
ATOM   2019 O  OE1   . GLU C 3 203 ? 63.867 -3.000  8.209   1.00 45.97 ? 209  GLU A OE1   1 
ATOM   2020 O  OE2   . GLU C 3 203 ? 63.487 -2.899  6.051   1.00 48.16 ? 209  GLU A OE2   1 
ATOM   2021 N  N     . SER C 3 204 ? 62.933 3.030   7.617   1.00 26.17 ? 210  SER A N     1 
ATOM   2022 C  CA    . SER C 3 204 ? 62.491 4.167   8.426   1.00 23.77 ? 210  SER A CA    1 
ATOM   2023 C  C     . SER C 3 204 ? 61.084 4.559   7.995   1.00 22.99 ? 210  SER A C     1 
ATOM   2024 O  O     . SER C 3 204 ? 60.617 4.146   6.941   1.00 23.79 ? 210  SER A O     1 
ATOM   2025 C  CB    . SER C 3 204 ? 63.427 5.370   8.245   1.00 23.58 ? 210  SER A CB    1 
ATOM   2026 O  OG    . SER C 3 204 ? 63.469 5.777   6.888   1.00 23.96 ? 210  SER A OG    1 
ATOM   2027 N  N     . LEU C 3 205 ? 60.410 5.356   8.812   1.00 25.40 ? 211  LEU A N     1 
ATOM   2028 C  CA    . LEU C 3 205 ? 59.051 5.796   8.490   1.00 26.24 ? 211  LEU A CA    1 
ATOM   2029 C  C     . LEU C 3 205 ? 59.082 6.474   7.119   1.00 26.01 ? 211  LEU A C     1 
ATOM   2030 O  O     . LEU C 3 205 ? 60.024 7.201   6.808   1.00 26.23 ? 211  LEU A O     1 
ATOM   2031 C  CB    . LEU C 3 205 ? 58.548 6.783   9.546   1.00 26.09 ? 211  LEU A CB    1 
ATOM   2032 C  CG    . LEU C 3 205 ? 57.038 7.034   9.547   1.00 26.97 ? 211  LEU A CG    1 
ATOM   2033 C  CD1   . LEU C 3 205 ? 56.311 5.755   9.972   1.00 26.90 ? 211  LEU A CD1   1 
ATOM   2034 C  CD2   . LEU C 3 205 ? 56.707 8.169   10.499  1.00 27.48 ? 211  LEU A CD2   1 
ATOM   2035 N  N     . GLU C 3 206 ? 58.060 6.229   6.304   1.00 25.55 ? 212  GLU A N     1 
ATOM   2036 C  CA    . GLU C 3 206 ? 57.988 6.812   4.970   1.00 26.54 ? 212  GLU A CA    1 
ATOM   2037 C  C     . GLU C 3 206 ? 58.259 8.325   4.931   1.00 24.34 ? 212  GLU A C     1 
ATOM   2038 O  O     . GLU C 3 206 ? 58.885 8.817   3.994   1.00 22.95 ? 212  GLU A O     1 
ATOM   2039 C  CB    . GLU C 3 206 ? 56.625 6.508   4.335   1.00 26.17 ? 212  GLU A CB    1 
ATOM   2040 C  CG    . GLU C 3 206 ? 56.354 7.319   3.072   1.00 28.93 ? 212  GLU A CG    1 
ATOM   2041 C  CD    . GLU C 3 206 ? 55.073 6.918   2.356   1.00 29.92 ? 212  GLU A CD    1 
ATOM   2042 O  OE1   . GLU C 3 206 ? 54.094 6.520   3.027   1.00 31.18 ? 212  GLU A OE1   1 
ATOM   2043 O  OE2   . GLU C 3 206 ? 55.046 7.017   1.117   1.00 30.57 ? 212  GLU A OE2   1 
ATOM   2044 N  N     . ALA C 3 207 ? 57.788 9.054   5.944   1.00 23.53 ? 213  ALA A N     1 
ATOM   2045 C  CA    . ALA C 3 207 ? 57.997 10.503  6.022   1.00 22.81 ? 213  ALA A CA    1 
ATOM   2046 C  C     . ALA C 3 207 ? 59.468 10.904  5.929   1.00 22.60 ? 213  ALA A C     1 
ATOM   2047 O  O     . ALA C 3 207 ? 59.781 11.993  5.454   1.00 23.42 ? 213  ALA A O     1 
ATOM   2048 C  CB    . ALA C 3 207 ? 57.417 11.053  7.318   1.00 21.29 ? 213  ALA A CB    1 
ATOM   2049 N  N     . VAL C 3 208 ? 60.369 10.050  6.407   1.00 20.74 ? 214  VAL A N     1 
ATOM   2050 C  CA    . VAL C 3 208 ? 61.796 10.367  6.361   1.00 20.52 ? 214  VAL A CA    1 
ATOM   2051 C  C     . VAL C 3 208 ? 62.285 10.472  4.913   1.00 20.44 ? 214  VAL A C     1 
ATOM   2052 O  O     . VAL C 3 208 ? 63.002 11.403  4.550   1.00 22.34 ? 214  VAL A O     1 
ATOM   2053 C  CB    . VAL C 3 208 ? 62.632 9.306   7.133   1.00 21.77 ? 214  VAL A CB    1 
ATOM   2054 C  CG1   . VAL C 3 208 ? 64.144 9.587   6.974   1.00 20.87 ? 214  VAL A CG1   1 
ATOM   2055 C  CG2   . VAL C 3 208 ? 62.266 9.349   8.616   1.00 18.92 ? 214  VAL A CG2   1 
ATOM   2056 N  N     . ASP C 3 209 ? 61.860 9.535   4.079   1.00 20.35 ? 215  ASP A N     1 
ATOM   2057 C  CA    . ASP C 3 209 ? 62.234 9.524   2.670   1.00 19.98 ? 215  ASP A CA    1 
ATOM   2058 C  C     . ASP C 3 209 ? 61.575 10.707  1.945   1.00 21.02 ? 215  ASP A C     1 
ATOM   2059 O  O     . ASP C 3 209 ? 62.229 11.438  1.200   1.00 23.55 ? 215  ASP A O     1 
ATOM   2060 C  CB    . ASP C 3 209 ? 61.795 8.187   2.048   1.00 22.73 ? 215  ASP A CB    1 
ATOM   2061 C  CG    . ASP C 3 209 ? 62.223 8.031   0.589   1.00 25.27 ? 215  ASP A CG    1 
ATOM   2062 O  OD1   . ASP C 3 209 ? 63.344 8.452   0.237   1.00 26.36 ? 215  ASP A OD1   1 
ATOM   2063 O  OD2   . ASP C 3 209 ? 61.437 7.461   -0.204  1.00 27.60 ? 215  ASP A OD2   1 
ATOM   2064 N  N     . ILE C 3 210 ? 60.283 10.908  2.176   1.00 19.60 ? 216  ILE A N     1 
ATOM   2065 C  CA    . ILE C 3 210 ? 59.569 12.003  1.530   1.00 20.20 ? 216  ILE A CA    1 
ATOM   2066 C  C     . ILE C 3 210 ? 60.190 13.369  1.829   1.00 21.12 ? 216  ILE A C     1 
ATOM   2067 O  O     . ILE C 3 210 ? 60.373 14.165  0.923   1.00 19.70 ? 216  ILE A O     1 
ATOM   2068 C  CB    . ILE C 3 210 ? 58.069 12.009  1.927   1.00 22.20 ? 216  ILE A CB    1 
ATOM   2069 C  CG1   . ILE C 3 210 ? 57.362 10.831  1.240   1.00 22.56 ? 216  ILE A CG1   1 
ATOM   2070 C  CG2   . ILE C 3 210 ? 57.420 13.349  1.557   1.00 23.59 ? 216  ILE A CG2   1 
ATOM   2071 C  CD1   . ILE C 3 210 ? 55.891 10.686  1.585   1.00 22.43 ? 216  ILE A CD1   1 
ATOM   2072 N  N     . GLU C 3 211 ? 60.525 13.641  3.091   1.00 20.05 ? 217  GLU A N     1 
ATOM   2073 C  CA    . GLU C 3 211 ? 61.120 14.934  3.415   1.00 20.48 ? 217  GLU A CA    1 
ATOM   2074 C  C     . GLU C 3 211 ? 62.488 15.167  2.767   1.00 21.35 ? 217  GLU A C     1 
ATOM   2075 O  O     . GLU C 3 211 ? 62.808 16.293  2.377   1.00 22.24 ? 217  GLU A O     1 
ATOM   2076 C  CB    . GLU C 3 211 ? 61.223 15.115  4.929   1.00 23.06 ? 217  GLU A CB    1 
ATOM   2077 C  CG    . GLU C 3 211 ? 59.884 15.436  5.598   1.00 22.86 ? 217  GLU A CG    1 
ATOM   2078 C  CD    . GLU C 3 211 ? 59.216 16.682  5.024   1.00 25.34 ? 217  GLU A CD    1 
ATOM   2079 O  OE1   . GLU C 3 211 ? 59.875 17.745  4.970   1.00 27.66 ? 217  GLU A OE1   1 
ATOM   2080 O  OE2   . GLU C 3 211 ? 58.031 16.603  4.631   1.00 24.00 ? 217  GLU A OE2   1 
ATOM   2081 N  N     . HIS C 3 212 ? 63.304 14.119  2.655   1.00 21.59 ? 218  HIS A N     1 
ATOM   2082 C  CA    . HIS C 3 212 ? 64.608 14.295  2.028   1.00 21.49 ? 218  HIS A CA    1 
ATOM   2083 C  C     . HIS C 3 212 ? 64.441 14.536  0.532   1.00 21.62 ? 218  HIS A C     1 
ATOM   2084 O  O     . HIS C 3 212 ? 65.128 15.370  -0.042  1.00 21.54 ? 218  HIS A O     1 
ATOM   2085 C  CB    . HIS C 3 212 ? 65.526 13.090  2.303   1.00 22.04 ? 218  HIS A CB    1 
ATOM   2086 C  CG    . HIS C 3 212 ? 66.215 13.162  3.633   1.00 21.39 ? 218  HIS A CG    1 
ATOM   2087 N  ND1   . HIS C 3 212 ? 65.638 12.703  4.799   1.00 22.57 ? 218  HIS A ND1   1 
ATOM   2088 C  CD2   . HIS C 3 212 ? 67.392 13.729  3.994   1.00 20.59 ? 218  HIS A CD2   1 
ATOM   2089 C  CE1   . HIS C 3 212 ? 66.430 12.986  5.819   1.00 22.96 ? 218  HIS A CE1   1 
ATOM   2090 N  NE2   . HIS C 3 212 ? 67.499 13.612  5.358   1.00 21.97 ? 218  HIS A NE2   1 
ATOM   2091 N  N     . ARG C 3 213 ? 63.519 13.818  -0.091  1.00 21.54 ? 219  ARG A N     1 
ATOM   2092 C  CA    . ARG C 3 213 ? 63.263 14.006  -1.515  1.00 23.48 ? 219  ARG A CA    1 
ATOM   2093 C  C     . ARG C 3 213 ? 62.700 15.412  -1.763  1.00 23.58 ? 219  ARG A C     1 
ATOM   2094 O  O     . ARG C 3 213 ? 63.133 16.102  -2.681  1.00 21.32 ? 219  ARG A O     1 
ATOM   2095 C  CB    . ARG C 3 213 ? 62.283 12.943  -2.028  1.00 25.42 ? 219  ARG A CB    1 
ATOM   2096 C  CG    . ARG C 3 213 ? 62.912 11.544  -2.141  1.00 28.01 ? 219  ARG A CG    1 
ATOM   2097 C  CD    . ARG C 3 213 ? 61.888 10.415  -1.956  1.00 32.61 ? 219  ARG A CD    1 
ATOM   2098 N  NE    . ARG C 3 213 ? 61.014 10.199  -3.109  1.00 36.25 ? 219  ARG A NE    1 
ATOM   2099 C  CZ    . ARG C 3 213 ? 59.851 9.542   -3.053  1.00 37.11 ? 219  ARG A CZ    1 
ATOM   2100 N  NH1   . ARG C 3 213 ? 59.412 9.042   -1.896  1.00 36.56 ? 219  ARG A NH1   1 
ATOM   2101 N  NH2   . ARG C 3 213 ? 59.134 9.356   -4.155  1.00 37.28 ? 219  ARG A NH2   1 
ATOM   2102 N  N     . ALA C 3 214 ? 61.748 15.845  -0.939  1.00 21.22 ? 220  ALA A N     1 
ATOM   2103 C  CA    . ALA C 3 214 ? 61.183 17.176  -1.128  1.00 22.86 ? 220  ALA A CA    1 
ATOM   2104 C  C     . ALA C 3 214 ? 62.276 18.246  -0.989  1.00 22.46 ? 220  ALA A C     1 
ATOM   2105 O  O     . ALA C 3 214 ? 62.378 19.154  -1.814  1.00 23.85 ? 220  ALA A O     1 
ATOM   2106 C  CB    . ALA C 3 214 ? 60.051 17.426  -0.117  1.00 20.72 ? 220  ALA A CB    1 
ATOM   2107 N  N     . ALA C 3 215 ? 63.107 18.117  0.040   1.00 22.30 ? 221  ALA A N     1 
ATOM   2108 C  CA    . ALA C 3 215 ? 64.181 19.082  0.280   1.00 21.75 ? 221  ALA A CA    1 
ATOM   2109 C  C     . ALA C 3 215 ? 65.210 19.118  -0.855  1.00 20.63 ? 221  ALA A C     1 
ATOM   2110 O  O     . ALA C 3 215 ? 65.730 20.178  -1.207  1.00 21.96 ? 221  ALA A O     1 
ATOM   2111 C  CB    . ALA C 3 215 ? 64.876 18.763  1.611   1.00 20.60 ? 221  ALA A CB    1 
ATOM   2112 N  N     . TRP C 3 216 ? 65.503 17.960  -1.428  1.00 19.07 ? 222  TRP A N     1 
ATOM   2113 C  CA    . TRP C 3 216 ? 66.473 17.892  -2.514  1.00 18.58 ? 222  TRP A CA    1 
ATOM   2114 C  C     . TRP C 3 216 ? 65.901 18.602  -3.740  1.00 19.22 ? 222  TRP A C     1 
ATOM   2115 O  O     . TRP C 3 216 ? 66.562 19.431  -4.347  1.00 20.21 ? 222  TRP A O     1 
ATOM   2116 C  CB    . TRP C 3 216 ? 66.793 16.427  -2.824  1.00 19.36 ? 222  TRP A CB    1 
ATOM   2117 C  CG    . TRP C 3 216 ? 67.917 16.211  -3.808  1.00 19.83 ? 222  TRP A CG    1 
ATOM   2118 C  CD1   . TRP C 3 216 ? 67.818 16.158  -5.169  1.00 18.07 ? 222  TRP A CD1   1 
ATOM   2119 C  CD2   . TRP C 3 216 ? 69.298 15.965  -3.494  1.00 20.40 ? 222  TRP A CD2   1 
ATOM   2120 N  NE1   . TRP C 3 216 ? 69.048 15.886  -5.725  1.00 20.23 ? 222  TRP A NE1   1 
ATOM   2121 C  CE2   . TRP C 3 216 ? 69.974 15.762  -4.718  1.00 19.86 ? 222  TRP A CE2   1 
ATOM   2122 C  CE3   . TRP C 3 216 ? 70.026 15.890  -2.296  1.00 23.60 ? 222  TRP A CE3   1 
ATOM   2123 C  CZ2   . TRP C 3 216 ? 71.350 15.488  -4.783  1.00 22.16 ? 222  TRP A CZ2   1 
ATOM   2124 C  CZ3   . TRP C 3 216 ? 71.404 15.615  -2.359  1.00 22.52 ? 222  TRP A CZ3   1 
ATOM   2125 C  CH2   . TRP C 3 216 ? 72.045 15.418  -3.594  1.00 21.38 ? 222  TRP A CH2   1 
ATOM   2126 N  N     . LEU C 3 217 ? 64.654 18.290  -4.080  1.00 20.45 ? 223  LEU A N     1 
ATOM   2127 C  CA    . LEU C 3 217 ? 64.001 18.904  -5.224  1.00 21.09 ? 223  LEU A CA    1 
ATOM   2128 C  C     . LEU C 3 217 ? 63.807 20.414  -5.048  1.00 21.45 ? 223  LEU A C     1 
ATOM   2129 O  O     . LEU C 3 217 ? 64.036 21.177  -5.978  1.00 22.86 ? 223  LEU A O     1 
ATOM   2130 C  CB    . LEU C 3 217 ? 62.649 18.234  -5.474  1.00 21.85 ? 223  LEU A CB    1 
ATOM   2131 C  CG    . LEU C 3 217 ? 61.729 18.879  -6.520  1.00 23.11 ? 223  LEU A CG    1 
ATOM   2132 C  CD1   . LEU C 3 217 ? 62.406 18.873  -7.877  1.00 18.98 ? 223  LEU A CD1   1 
ATOM   2133 C  CD2   . LEU C 3 217 ? 60.397 18.106  -6.578  1.00 22.93 ? 223  LEU A CD2   1 
ATOM   2134 N  N     . LEU C 3 218 ? 63.393 20.842  -3.860  1.00 20.95 ? 224  LEU A N     1 
ATOM   2135 C  CA    . LEU C 3 218 ? 63.184 22.263  -3.617  1.00 20.35 ? 224  LEU A CA    1 
ATOM   2136 C  C     . LEU C 3 218 ? 64.496 23.046  -3.575  1.00 19.56 ? 224  LEU A C     1 
ATOM   2137 O  O     . LEU C 3 218 ? 64.529 24.221  -3.931  1.00 18.55 ? 224  LEU A O     1 
ATOM   2138 C  CB    . LEU C 3 218 ? 62.363 22.469  -2.338  1.00 20.18 ? 224  LEU A CB    1 
ATOM   2139 C  CG    . LEU C 3 218 ? 60.925 21.970  -2.564  1.00 24.12 ? 224  LEU A CG    1 
ATOM   2140 C  CD1   . LEU C 3 218 ? 60.193 21.768  -1.240  1.00 25.23 ? 224  LEU A CD1   1 
ATOM   2141 C  CD2   . LEU C 3 218 ? 60.196 22.968  -3.437  1.00 23.23 ? 224  LEU A CD2   1 
ATOM   2142 N  N     . ALA C 3 219 ? 65.576 22.402  -3.150  1.00 19.15 ? 225  ALA A N     1 
ATOM   2143 C  CA    . ALA C 3 219 ? 66.874 23.070  -3.147  1.00 17.76 ? 225  ALA A CA    1 
ATOM   2144 C  C     . ALA C 3 219 ? 67.191 23.337  -4.622  1.00 19.71 ? 225  ALA A C     1 
ATOM   2145 O  O     . ALA C 3 219 ? 67.680 24.406  -4.989  1.00 21.73 ? 225  ALA A O     1 
ATOM   2146 C  CB    . ALA C 3 219 ? 67.937 22.177  -2.536  1.00 16.85 ? 225  ALA A CB    1 
ATOM   2147 N  N     . LYS C 3 220 ? 66.914 22.350  -5.467  1.00 20.60 ? 226  LYS A N     1 
ATOM   2148 C  CA    . LYS C 3 220 ? 67.134 22.506  -6.898  1.00 22.25 ? 226  LYS A CA    1 
ATOM   2149 C  C     . LYS C 3 220 ? 66.216 23.629  -7.411  1.00 22.85 ? 226  LYS A C     1 
ATOM   2150 O  O     . LYS C 3 220 ? 66.620 24.427  -8.249  1.00 23.68 ? 226  LYS A O     1 
ATOM   2151 C  CB    . LYS C 3 220 ? 66.819 21.200  -7.631  1.00 20.81 ? 226  LYS A CB    1 
ATOM   2152 C  CG    . LYS C 3 220 ? 66.882 21.297  -9.156  1.00 24.69 ? 226  LYS A CG    1 
ATOM   2153 C  CD    . LYS C 3 220 ? 68.232 21.811  -9.629  1.00 26.01 ? 226  LYS A CD    1 
ATOM   2154 C  CE    . LYS C 3 220 ? 68.320 21.855  -11.152 1.00 28.82 ? 226  LYS A CE    1 
ATOM   2155 N  NZ    . LYS C 3 220 ? 68.874 20.610  -11.756 1.00 27.91 ? 226  LYS A NZ    1 
ATOM   2156 N  N     . GLN C 3 221 ? 64.988 23.698  -6.900  1.00 22.71 ? 227  GLN A N     1 
ATOM   2157 C  CA    . GLN C 3 221 ? 64.080 24.752  -7.347  1.00 24.06 ? 227  GLN A CA    1 
ATOM   2158 C  C     . GLN C 3 221 ? 64.628 26.135  -6.996  1.00 23.67 ? 227  GLN A C     1 
ATOM   2159 O  O     . GLN C 3 221 ? 64.531 27.066  -7.797  1.00 22.18 ? 227  GLN A O     1 
ATOM   2160 C  CB    . GLN C 3 221 ? 62.693 24.580  -6.734  1.00 23.55 ? 227  GLN A CB    1 
ATOM   2161 C  CG    . GLN C 3 221 ? 61.744 25.711  -7.100  1.00 25.92 ? 227  GLN A CG    1 
ATOM   2162 C  CD    . GLN C 3 221 ? 60.318 25.444  -6.667  1.00 29.08 ? 227  GLN A CD    1 
ATOM   2163 O  OE1   . GLN C 3 221 ? 59.588 24.692  -7.315  1.00 31.05 ? 227  GLN A OE1   1 
ATOM   2164 N  NE2   . GLN C 3 221 ? 59.915 26.052  -5.558  1.00 28.25 ? 227  GLN A NE2   1 
ATOM   2165 N  N     . GLU C 3 222 ? 65.195 26.267  -5.797  1.00 23.54 ? 228  GLU A N     1 
ATOM   2166 C  CA    . GLU C 3 222 ? 65.776 27.534  -5.364  1.00 22.29 ? 228  GLU A CA    1 
ATOM   2167 C  C     . GLU C 3 222 ? 66.923 27.945  -6.290  1.00 21.85 ? 228  GLU A C     1 
ATOM   2168 O  O     . GLU C 3 222 ? 67.011 29.106  -6.690  1.00 21.20 ? 228  GLU A O     1 
ATOM   2169 C  CB    . GLU C 3 222 ? 66.306 27.428  -3.933  1.00 23.78 ? 228  GLU A CB    1 
ATOM   2170 C  CG    . GLU C 3 222 ? 65.254 27.473  -2.863  1.00 25.13 ? 228  GLU A CG    1 
ATOM   2171 C  CD    . GLU C 3 222 ? 65.863 27.568  -1.468  1.00 27.71 ? 228  GLU A CD    1 
ATOM   2172 O  OE1   . GLU C 3 222 ? 67.005 28.061  -1.343  1.00 29.59 ? 228  GLU A OE1   1 
ATOM   2173 O  OE2   . GLU C 3 222 ? 65.195 27.167  -0.504  1.00 25.01 ? 228  GLU A OE2   1 
ATOM   2174 N  N     . ARG C 3 223 ? 67.801 26.994  -6.615  1.00 19.69 ? 229  ARG A N     1 
ATOM   2175 C  CA    . ARG C 3 223 ? 68.931 27.260  -7.511  1.00 21.46 ? 229  ARG A CA    1 
ATOM   2176 C  C     . ARG C 3 223 ? 68.430 27.654  -8.899  1.00 21.80 ? 229  ARG A C     1 
ATOM   2177 O  O     . ARG C 3 223 ? 69.053 28.471  -9.565  1.00 20.90 ? 229  ARG A O     1 
ATOM   2178 C  CB    . ARG C 3 223 ? 69.826 26.026  -7.661  1.00 23.01 ? 229  ARG A CB    1 
ATOM   2179 C  CG    . ARG C 3 223 ? 70.986 25.924  -6.674  1.00 27.04 ? 229  ARG A CG    1 
ATOM   2180 C  CD    . ARG C 3 223 ? 71.659 24.551  -6.792  1.00 27.28 ? 229  ARG A CD    1 
ATOM   2181 N  NE    . ARG C 3 223 ? 71.229 23.763  -5.662  1.00 30.87 ? 229  ARG A NE    1 
ATOM   2182 C  CZ    . ARG C 3 223 ? 70.794 22.515  -5.698  1.00 27.14 ? 229  ARG A CZ    1 
ATOM   2183 N  NH1   . ARG C 3 223 ? 70.716 21.841  -6.836  1.00 28.96 ? 229  ARG A NH1   1 
ATOM   2184 N  NH2   . ARG C 3 223 ? 70.412 21.960  -4.563  1.00 28.39 ? 229  ARG A NH2   1 
ATOM   2185 N  N     . ASN C 3 224 ? 67.323 27.045  -9.336  1.00 20.71 ? 230  ASN A N     1 
ATOM   2186 C  CA    . ASN C 3 224 ? 66.733 27.368  -10.636 1.00 21.32 ? 230  ASN A CA    1 
ATOM   2187 C  C     . ASN C 3 224 ? 66.329 28.842  -10.640 1.00 22.20 ? 230  ASN A C     1 
ATOM   2188 O  O     . ASN C 3 224 ? 66.684 29.603  -11.547 1.00 24.97 ? 230  ASN A O     1 
ATOM   2189 C  CB    . ASN C 3 224 ? 65.469 26.537  -10.901 1.00 22.54 ? 230  ASN A CB    1 
ATOM   2190 C  CG    . ASN C 3 224 ? 65.766 25.093  -11.257 1.00 22.64 ? 230  ASN A CG    1 
ATOM   2191 O  OD1   . ASN C 3 224 ? 66.883 24.746  -11.641 1.00 26.03 ? 230  ASN A OD1   1 
ATOM   2192 N  ND2   . ASN C 3 224 ? 64.749 24.244  -11.154 1.00 24.71 ? 230  ASN A ND2   1 
ATOM   2193 N  N     . GLY C 3 225 ? 65.582 29.229  -9.611  1.00 23.34 ? 231  GLY A N     1 
ATOM   2194 C  CA    . GLY C 3 225 ? 65.098 30.589  -9.498  1.00 21.59 ? 231  GLY A CA    1 
ATOM   2195 C  C     . GLY C 3 225 ? 63.872 30.769  -10.381 1.00 23.70 ? 231  GLY A C     1 
ATOM   2196 O  O     . GLY C 3 225 ? 63.522 29.874  -11.165 1.00 23.68 ? 231  GLY A O     1 
ATOM   2197 N  N     . PHE C 3 226 ? 63.219 31.923  -10.259 1.00 22.17 ? 232  PHE A N     1 
ATOM   2198 C  CA    . PHE C 3 226 ? 62.038 32.247  -11.061 1.00 21.99 ? 232  PHE A CA    1 
ATOM   2199 C  C     . PHE C 3 226 ? 62.433 33.401  -11.991 1.00 20.66 ? 232  PHE A C     1 
ATOM   2200 O  O     . PHE C 3 226 ? 62.708 34.492  -11.522 1.00 22.03 ? 232  PHE A O     1 
ATOM   2201 C  CB    . PHE C 3 226 ? 60.889 32.701  -10.143 1.00 22.17 ? 232  PHE A CB    1 
ATOM   2202 C  CG    . PHE C 3 226 ? 59.517 32.408  -10.686 1.00 20.93 ? 232  PHE A CG    1 
ATOM   2203 C  CD1   . PHE C 3 226 ? 59.229 32.588  -12.040 1.00 21.13 ? 232  PHE A CD1   1 
ATOM   2204 C  CD2   . PHE C 3 226 ? 58.516 31.933  -9.845  1.00 19.81 ? 232  PHE A CD2   1 
ATOM   2205 C  CE1   . PHE C 3 226 ? 57.964 32.292  -12.545 1.00 22.21 ? 232  PHE A CE1   1 
ATOM   2206 C  CE2   . PHE C 3 226 ? 57.251 31.634  -10.334 1.00 21.82 ? 232  PHE A CE2   1 
ATOM   2207 C  CZ    . PHE C 3 226 ? 56.971 31.814  -11.693 1.00 22.04 ? 232  PHE A CZ    1 
ATOM   2208 N  N     . PRO C 3 227 ? 62.482 33.170  -13.319 1.00 22.07 ? 233  PRO A N     1 
ATOM   2209 C  CA    . PRO C 3 227 ? 62.853 34.243  -14.260 1.00 21.92 ? 233  PRO A CA    1 
ATOM   2210 C  C     . PRO C 3 227 ? 62.015 35.484  -13.967 1.00 22.19 ? 233  PRO A C     1 
ATOM   2211 O  O     . PRO C 3 227 ? 60.799 35.402  -13.884 1.00 20.98 ? 233  PRO A O     1 
ATOM   2212 C  CB    . PRO C 3 227 ? 62.556 33.623  -15.626 1.00 21.90 ? 233  PRO A CB    1 
ATOM   2213 C  CG    . PRO C 3 227 ? 62.878 32.184  -15.400 1.00 21.35 ? 233  PRO A CG    1 
ATOM   2214 C  CD    . PRO C 3 227 ? 62.220 31.915  -14.042 1.00 21.67 ? 233  PRO A CD    1 
ATOM   2215 N  N     . PHE C 3 228 ? 62.679 36.631  -13.836 1.00 24.57 ? 234  PHE A N     1 
ATOM   2216 C  CA    . PHE C 3 228 ? 62.022 37.880  -13.457 1.00 25.22 ? 234  PHE A CA    1 
ATOM   2217 C  C     . PHE C 3 228 ? 62.234 39.042  -14.427 1.00 25.26 ? 234  PHE A C     1 
ATOM   2218 O  O     . PHE C 3 228 ? 63.366 39.351  -14.797 1.00 25.63 ? 234  PHE A O     1 
ATOM   2219 C  CB    . PHE C 3 228 ? 62.547 38.267  -12.075 1.00 23.89 ? 234  PHE A CB    1 
ATOM   2220 C  CG    . PHE C 3 228 ? 61.917 39.493  -11.486 1.00 25.25 ? 234  PHE A CG    1 
ATOM   2221 C  CD1   . PHE C 3 228 ? 60.628 39.449  -10.960 1.00 23.94 ? 234  PHE A CD1   1 
ATOM   2222 C  CD2   . PHE C 3 228 ? 62.648 40.678  -11.386 1.00 24.66 ? 234  PHE A CD2   1 
ATOM   2223 C  CE1   . PHE C 3 228 ? 60.079 40.572  -10.329 1.00 24.78 ? 234  PHE A CE1   1 
ATOM   2224 C  CE2   . PHE C 3 228 ? 62.110 41.796  -10.765 1.00 22.11 ? 234  PHE A CE2   1 
ATOM   2225 C  CZ    . PHE C 3 228 ? 60.820 41.742  -10.231 1.00 23.74 ? 234  PHE A CZ    1 
ATOM   2226 N  N     . ASP C 3 229 ? 61.139 39.702  -14.803 1.00 25.82 ? 235  ASP A N     1 
ATOM   2227 C  CA    . ASP C 3 229 ? 61.191 40.843  -15.732 1.00 26.72 ? 235  ASP A CA    1 
ATOM   2228 C  C     . ASP C 3 229 ? 61.573 42.125  -14.983 1.00 26.47 ? 235  ASP A C     1 
ATOM   2229 O  O     . ASP C 3 229 ? 60.722 42.959  -14.693 1.00 26.55 ? 235  ASP A O     1 
ATOM   2230 C  CB    . ASP C 3 229 ? 59.821 41.028  -16.400 1.00 25.28 ? 235  ASP A CB    1 
ATOM   2231 C  CG    . ASP C 3 229 ? 59.869 41.971  -17.605 1.00 27.93 ? 235  ASP A CG    1 
ATOM   2232 O  OD1   . ASP C 3 229 ? 60.843 42.737  -17.727 1.00 26.66 ? 235  ASP A OD1   1 
ATOM   2233 O  OD2   . ASP C 3 229 ? 58.917 41.949  -18.425 1.00 28.01 ? 235  ASP A OD2   1 
ATOM   2234 N  N     . THR C 3 230 ? 62.853 42.276  -14.668 1.00 28.31 ? 236  THR A N     1 
ATOM   2235 C  CA    . THR C 3 230 ? 63.326 43.452  -13.944 1.00 30.74 ? 236  THR A CA    1 
ATOM   2236 C  C     . THR C 3 230 ? 62.833 44.774  -14.551 1.00 31.39 ? 236  THR A C     1 
ATOM   2237 O  O     . THR C 3 230 ? 62.224 45.607  -13.859 1.00 30.23 ? 236  THR A O     1 
ATOM   2238 C  CB    . THR C 3 230 ? 64.865 43.478  -13.893 1.00 31.41 ? 236  THR A CB    1 
ATOM   2239 O  OG1   . THR C 3 230 ? 65.338 42.280  -13.265 1.00 32.89 ? 236  THR A OG1   1 
ATOM   2240 C  CG2   . THR C 3 230 ? 65.360 44.698  -13.102 1.00 32.44 ? 236  THR A CG2   1 
ATOM   2241 N  N     . LYS C 3 231 ? 63.095 44.963  -15.842 1.00 31.01 ? 237  LYS A N     1 
ATOM   2242 C  CA    . LYS C 3 231 ? 62.690 46.190  -16.530 1.00 29.95 ? 237  LYS A CA    1 
ATOM   2243 C  C     . LYS C 3 231 ? 61.208 46.526  -16.372 1.00 28.91 ? 237  LYS A C     1 
ATOM   2244 O  O     . LYS C 3 231 ? 60.863 47.676  -16.135 1.00 29.57 ? 237  LYS A O     1 
ATOM   2245 C  CB    . LYS C 3 231 ? 63.041 46.103  -18.019 1.00 31.20 ? 237  LYS A CB    1 
ATOM   2246 C  CG    . LYS C 3 231 ? 62.737 47.366  -18.812 1.00 35.08 ? 237  LYS A CG    1 
ATOM   2247 N  N     . ALA C 3 232 ? 60.327 45.535  -16.498 1.00 28.84 ? 238  ALA A N     1 
ATOM   2248 C  CA    . ALA C 3 232 ? 58.896 45.794  -16.361 1.00 27.85 ? 238  ALA A CA    1 
ATOM   2249 C  C     . ALA C 3 232 ? 58.521 46.251  -14.952 1.00 28.61 ? 238  ALA A C     1 
ATOM   2250 O  O     . ALA C 3 232 ? 57.648 47.112  -14.778 1.00 27.76 ? 238  ALA A O     1 
ATOM   2251 C  CB    . ALA C 3 232 ? 58.093 44.552  -16.725 1.00 29.30 ? 238  ALA A CB    1 
ATOM   2252 N  N     . ILE C 3 233 ? 59.159 45.669  -13.944 1.00 28.52 ? 239  ILE A N     1 
ATOM   2253 C  CA    . ILE C 3 233 ? 58.857 46.055  -12.576 1.00 29.43 ? 239  ILE A CA    1 
ATOM   2254 C  C     . ILE C 3 233 ? 59.391 47.446  -12.264 1.00 30.00 ? 239  ILE A C     1 
ATOM   2255 O  O     . ILE C 3 233 ? 58.801 48.170  -11.471 1.00 28.76 ? 239  ILE A O     1 
ATOM   2256 C  CB    . ILE C 3 233 ? 59.403 45.033  -11.572 1.00 29.39 ? 239  ILE A CB    1 
ATOM   2257 C  CG1   . ILE C 3 233 ? 58.615 43.732  -11.726 1.00 29.81 ? 239  ILE A CG1   1 
ATOM   2258 C  CG2   . ILE C 3 233 ? 59.272 45.564  -10.138 1.00 28.47 ? 239  ILE A CG2   1 
ATOM   2259 C  CD1   . ILE C 3 233 ? 57.110 43.910  -11.554 1.00 26.84 ? 239  ILE A CD1   1 
ATOM   2260 N  N     . GLU C 3 234 ? 60.500 47.817  -12.895 1.00 31.56 ? 240  GLU A N     1 
ATOM   2261 C  CA    . GLU C 3 234 ? 61.064 49.149  -12.712 1.00 33.96 ? 240  GLU A CA    1 
ATOM   2262 C  C     . GLU C 3 234 ? 60.099 50.182  -13.307 1.00 33.84 ? 240  GLU A C     1 
ATOM   2263 O  O     . GLU C 3 234 ? 59.933 51.268  -12.761 1.00 35.01 ? 240  GLU A O     1 
ATOM   2264 C  CB    . GLU C 3 234 ? 62.424 49.256  -13.404 1.00 34.24 ? 240  GLU A CB    1 
ATOM   2265 C  CG    . GLU C 3 234 ? 63.463 48.324  -12.822 1.00 38.11 ? 240  GLU A CG    1 
ATOM   2266 C  CD    . GLU C 3 234 ? 64.828 48.510  -13.446 1.00 40.02 ? 240  GLU A CD    1 
ATOM   2267 O  OE1   . GLU C 3 234 ? 64.903 48.634  -14.686 1.00 42.50 ? 240  GLU A OE1   1 
ATOM   2268 O  OE2   . GLU C 3 234 ? 65.828 48.517  -12.701 1.00 42.48 ? 240  GLU A OE2   1 
ATOM   2269 N  N     . GLU C 3 235 ? 59.460 49.836  -14.423 1.00 34.29 ? 241  GLU A N     1 
ATOM   2270 C  CA    . GLU C 3 235 ? 58.511 50.741  -15.061 1.00 34.91 ? 241  GLU A CA    1 
ATOM   2271 C  C     . GLU C 3 235 ? 57.258 50.803  -14.202 1.00 34.86 ? 241  GLU A C     1 
ATOM   2272 O  O     . GLU C 3 235 ? 56.598 51.841  -14.122 1.00 35.62 ? 241  GLU A O     1 
ATOM   2273 C  CB    . GLU C 3 235 ? 58.171 50.260  -16.478 1.00 35.72 ? 241  GLU A CB    1 
ATOM   2274 C  CG    . GLU C 3 235 ? 59.399 50.177  -17.386 1.00 40.45 ? 241  GLU A CG    1 
ATOM   2275 C  CD    . GLU C 3 235 ? 59.109 49.583  -18.762 1.00 42.77 ? 241  GLU A CD    1 
ATOM   2276 O  OE1   . GLU C 3 235 ? 58.102 48.851  -18.911 1.00 43.81 ? 241  GLU A OE1   1 
ATOM   2277 O  OE2   . GLU C 3 235 ? 59.909 49.836  -19.691 1.00 43.75 ? 241  GLU A OE2   1 
ATOM   2278 N  N     . LEU C 3 236 ? 56.930 49.692  -13.552 1.00 33.85 ? 242  LEU A N     1 
ATOM   2279 C  CA    . LEU C 3 236 ? 55.765 49.667  -12.681 1.00 33.86 ? 242  LEU A CA    1 
ATOM   2280 C  C     . LEU C 3 236 ? 56.070 50.550  -11.478 1.00 33.72 ? 242  LEU A C     1 
ATOM   2281 O  O     . LEU C 3 236 ? 55.195 51.255  -10.968 1.00 35.13 ? 242  LEU A O     1 
ATOM   2282 C  CB    . LEU C 3 236 ? 55.463 48.249  -12.198 1.00 33.45 ? 242  LEU A CB    1 
ATOM   2283 C  CG    . LEU C 3 236 ? 54.316 48.201  -11.184 1.00 35.53 ? 242  LEU A CG    1 
ATOM   2284 C  CD1   . LEU C 3 236 ? 53.035 48.648  -11.860 1.00 33.78 ? 242  LEU A CD1   1 
ATOM   2285 C  CD2   . LEU C 3 236 ? 54.160 46.799  -10.623 1.00 35.26 ? 242  LEU A CD2   1 
ATOM   2286 N  N     . TYR C 3 237 ? 57.322 50.505  -11.034 1.00 33.01 ? 243  TYR A N     1 
ATOM   2287 C  CA    . TYR C 3 237 ? 57.763 51.298  -9.903  1.00 33.08 ? 243  TYR A CA    1 
ATOM   2288 C  C     . TYR C 3 237 ? 57.630 52.798  -10.215 1.00 34.60 ? 243  TYR A C     1 
ATOM   2289 O  O     . TYR C 3 237 ? 57.118 53.567  -9.398  1.00 34.42 ? 243  TYR A O     1 
ATOM   2290 C  CB    . TYR C 3 237 ? 59.207 50.930  -9.556  1.00 32.23 ? 243  TYR A CB    1 
ATOM   2291 C  CG    . TYR C 3 237 ? 59.801 51.716  -8.408  1.00 32.68 ? 243  TYR A CG    1 
ATOM   2292 C  CD1   . TYR C 3 237 ? 59.013 52.133  -7.331  1.00 31.91 ? 243  TYR A CD1   1 
ATOM   2293 C  CD2   . TYR C 3 237 ? 61.157 52.024  -8.387  1.00 32.63 ? 243  TYR A CD2   1 
ATOM   2294 C  CE1   . TYR C 3 237 ? 59.572 52.839  -6.262  1.00 32.06 ? 243  TYR A CE1   1 
ATOM   2295 C  CE2   . TYR C 3 237 ? 61.723 52.723  -7.328  1.00 33.39 ? 243  TYR A CE2   1 
ATOM   2296 C  CZ    . TYR C 3 237 ? 60.928 53.126  -6.273  1.00 32.24 ? 243  TYR A CZ    1 
ATOM   2297 O  OH    . TYR C 3 237 ? 61.503 53.799  -5.224  1.00 36.52 ? 243  TYR A OH    1 
ATOM   2298 N  N     . VAL C 3 238 ? 58.077 53.212  -11.397 1.00 35.06 ? 244  VAL A N     1 
ATOM   2299 C  CA    . VAL C 3 238 ? 57.965 54.617  -11.789 1.00 36.29 ? 244  VAL A CA    1 
ATOM   2300 C  C     . VAL C 3 238 ? 56.498 55.046  -11.771 1.00 36.97 ? 244  VAL A C     1 
ATOM   2301 O  O     . VAL C 3 238 ? 56.152 56.106  -11.241 1.00 37.95 ? 244  VAL A O     1 
ATOM   2302 C  CB    . VAL C 3 238 ? 58.536 54.854  -13.205 1.00 37.35 ? 244  VAL A CB    1 
ATOM   2303 C  CG1   . VAL C 3 238 ? 58.204 56.271  -13.674 1.00 38.43 ? 244  VAL A CG1   1 
ATOM   2304 C  CG2   . VAL C 3 238 ? 60.047 54.645  -13.194 1.00 35.84 ? 244  VAL A CG2   1 
ATOM   2305 N  N     . GLU C 3 239 ? 55.637 54.215  -12.349 1.00 35.99 ? 245  GLU A N     1 
ATOM   2306 C  CA    . GLU C 3 239 ? 54.211 54.503  -12.389 1.00 37.23 ? 245  GLU A CA    1 
ATOM   2307 C  C     . GLU C 3 239 ? 53.595 54.628  -10.991 1.00 37.16 ? 245  GLU A C     1 
ATOM   2308 O  O     . GLU C 3 239 ? 52.824 55.554  -10.727 1.00 38.12 ? 245  GLU A O     1 
ATOM   2309 C  CB    . GLU C 3 239 ? 53.475 53.413  -13.167 1.00 37.65 ? 245  GLU A CB    1 
ATOM   2310 C  CG    . GLU C 3 239 ? 51.967 53.455  -13.006 1.00 42.40 ? 245  GLU A CG    1 
ATOM   2311 C  CD    . GLU C 3 239 ? 51.261 52.352  -13.776 1.00 45.83 ? 245  GLU A CD    1 
ATOM   2312 O  OE1   . GLU C 3 239 ? 50.051 52.139  -13.541 1.00 46.60 ? 245  GLU A OE1   1 
ATOM   2313 O  OE2   . GLU C 3 239 ? 51.915 51.704  -14.621 1.00 48.44 ? 245  GLU A OE2   1 
ATOM   2314 N  N     . LEU C 3 240 ? 53.916 53.682  -10.110 1.00 36.00 ? 246  LEU A N     1 
ATOM   2315 C  CA    . LEU C 3 240 ? 53.388 53.686  -8.749  1.00 34.68 ? 246  LEU A CA    1 
ATOM   2316 C  C     . LEU C 3 240 ? 53.863 54.902  -7.959  1.00 34.16 ? 246  LEU A C     1 
ATOM   2317 O  O     . LEU C 3 240 ? 53.082 55.516  -7.241  1.00 34.43 ? 246  LEU A O     1 
ATOM   2318 C  CB    . LEU C 3 240 ? 53.805 52.413  -8.006  1.00 34.05 ? 246  LEU A CB    1 
ATOM   2319 C  CG    . LEU C 3 240 ? 53.250 51.087  -8.531  1.00 34.89 ? 246  LEU A CG    1 
ATOM   2320 C  CD1   . LEU C 3 240 ? 53.884 49.926  -7.786  1.00 33.67 ? 246  LEU A CD1   1 
ATOM   2321 C  CD2   . LEU C 3 240 ? 51.740 51.076  -8.372  1.00 35.01 ? 246  LEU A CD2   1 
ATOM   2322 N  N     . ALA C 3 241 ? 55.140 55.241  -8.095  1.00 33.06 ? 247  ALA A N     1 
ATOM   2323 C  CA    . ALA C 3 241 ? 55.708 56.378  -7.383  1.00 35.66 ? 247  ALA A CA    1 
ATOM   2324 C  C     . ALA C 3 241 ? 55.046 57.692  -7.797  1.00 36.65 ? 247  ALA A C     1 
ATOM   2325 O  O     . ALA C 3 241 ? 54.804 58.563  -6.960  1.00 37.57 ? 247  ALA A O     1 
ATOM   2326 C  CB    . ALA C 3 241 ? 57.215 56.449  -7.621  1.00 32.01 ? 247  ALA A CB    1 
ATOM   2327 N  N     . ALA C 3 242 ? 54.763 57.832  -9.089  1.00 36.99 ? 248  ALA A N     1 
ATOM   2328 C  CA    . ALA C 3 242 ? 54.118 59.036  -9.602  1.00 36.43 ? 248  ALA A CA    1 
ATOM   2329 C  C     . ALA C 3 242 ? 52.721 59.143  -8.986  1.00 36.76 ? 248  ALA A C     1 
ATOM   2330 O  O     . ALA C 3 242 ? 52.330 60.193  -8.480  1.00 36.76 ? 248  ALA A O     1 
ATOM   2331 C  CB    . ALA C 3 242 ? 54.029 58.974  -11.132 1.00 35.57 ? 248  ALA A CB    1 
ATOM   2332 N  N     . ARG C 3 243 ? 51.969 58.051  -9.023  1.00 36.40 ? 249  ARG A N     1 
ATOM   2333 C  CA    . ARG C 3 243 ? 50.639 58.067  -8.441  1.00 37.11 ? 249  ARG A CA    1 
ATOM   2334 C  C     . ARG C 3 243 ? 50.704 58.305  -6.925  1.00 37.27 ? 249  ARG A C     1 
ATOM   2335 O  O     . ARG C 3 243 ? 49.784 58.893  -6.350  1.00 38.34 ? 249  ARG A O     1 
ATOM   2336 C  CB    . ARG C 3 243 ? 49.912 56.758  -8.742  1.00 37.13 ? 249  ARG A CB    1 
ATOM   2337 C  CG    . ARG C 3 243 ? 48.492 56.695  -8.192  1.00 37.56 ? 249  ARG A CG    1 
ATOM   2338 C  CD    . ARG C 3 243 ? 47.623 57.851  -8.697  1.00 37.12 ? 249  ARG A CD    1 
ATOM   2339 N  NE    . ARG C 3 243 ? 46.239 57.715  -8.246  1.00 37.69 ? 249  ARG A NE    1 
ATOM   2340 C  CZ    . ARG C 3 243 ? 45.293 58.632  -8.425  1.00 37.79 ? 249  ARG A CZ    1 
ATOM   2341 N  NH1   . ARG C 3 243 ? 45.574 59.773  -9.051  1.00 36.79 ? 249  ARG A NH1   1 
ATOM   2342 N  NH2   . ARG C 3 243 ? 44.064 58.408  -7.977  1.00 36.19 ? 249  ARG A NH2   1 
ATOM   2343 N  N     . ARG C 3 244 ? 51.787 57.862  -6.285  1.00 35.42 ? 250  ARG A N     1 
ATOM   2344 C  CA    . ARG C 3 244 ? 51.941 58.058  -4.846  1.00 35.75 ? 250  ARG A CA    1 
ATOM   2345 C  C     . ARG C 3 244 ? 52.108 59.542  -4.538  1.00 36.78 ? 250  ARG A C     1 
ATOM   2346 O  O     . ARG C 3 244 ? 51.440 60.071  -3.653  1.00 38.23 ? 250  ARG A O     1 
ATOM   2347 C  CB    . ARG C 3 244 ? 53.149 57.277  -4.295  1.00 32.81 ? 250  ARG A CB    1 
ATOM   2348 C  CG    . ARG C 3 244 ? 53.481 57.638  -2.845  1.00 33.43 ? 250  ARG A CG    1 
ATOM   2349 C  CD    . ARG C 3 244 ? 54.501 56.706  -2.192  1.00 30.23 ? 250  ARG A CD    1 
ATOM   2350 N  NE    . ARG C 3 244 ? 55.797 56.737  -2.854  1.00 31.29 ? 250  ARG A NE    1 
ATOM   2351 C  CZ    . ARG C 3 244 ? 56.808 55.929  -2.545  1.00 31.63 ? 250  ARG A CZ    1 
ATOM   2352 N  NH1   . ARG C 3 244 ? 56.666 55.027  -1.580  1.00 28.28 ? 250  ARG A NH1   1 
ATOM   2353 N  NH2   . ARG C 3 244 ? 57.959 56.022  -3.205  1.00 30.41 ? 250  ARG A NH2   1 
ATOM   2354 N  N     . SER C 3 245 ? 53.004 60.207  -5.263  1.00 38.21 ? 251  SER A N     1 
ATOM   2355 C  CA    . SER C 3 245 ? 53.233 61.633  -5.071  1.00 40.69 ? 251  SER A CA    1 
ATOM   2356 C  C     . SER C 3 245 ? 51.925 62.407  -5.253  1.00 42.19 ? 251  SER A C     1 
ATOM   2357 O  O     . SER C 3 245 ? 51.518 63.168  -4.378  1.00 42.90 ? 251  SER A O     1 
ATOM   2358 C  CB    . SER C 3 245 ? 54.262 62.153  -6.081  1.00 42.42 ? 251  SER A CB    1 
ATOM   2359 O  OG    . SER C 3 245 ? 55.545 61.590  -5.866  1.00 45.88 ? 251  SER A OG    1 
ATOM   2360 N  N     . GLU C 3 246 ? 51.267 62.199  -6.391  1.00 42.03 ? 252  GLU A N     1 
ATOM   2361 C  CA    . GLU C 3 246 ? 50.015 62.887  -6.689  1.00 42.13 ? 252  GLU A CA    1 
ATOM   2362 C  C     . GLU C 3 246 ? 48.977 62.685  -5.589  1.00 42.26 ? 252  GLU A C     1 
ATOM   2363 O  O     . GLU C 3 246 ? 48.268 63.621  -5.219  1.00 41.08 ? 252  GLU A O     1 
ATOM   2364 C  CB    . GLU C 3 246 ? 49.464 62.408  -8.035  1.00 43.01 ? 252  GLU A CB    1 
ATOM   2365 C  CG    . GLU C 3 246 ? 48.177 63.096  -8.504  1.00 45.71 ? 252  GLU A CG    1 
ATOM   2366 C  CD    . GLU C 3 246 ? 48.274 64.620  -8.531  1.00 46.34 ? 252  GLU A CD    1 
ATOM   2367 O  OE1   . GLU C 3 246 ? 49.381 65.157  -8.757  1.00 45.89 ? 252  GLU A OE1   1 
ATOM   2368 O  OE2   . GLU C 3 246 ? 47.228 65.279  -8.341  1.00 46.81 ? 252  GLU A OE2   1 
ATOM   2369 N  N     . LEU C 3 247 ? 48.881 61.464  -5.070  1.00 41.70 ? 253  LEU A N     1 
ATOM   2370 C  CA    . LEU C 3 247 ? 47.926 61.185  -4.009  1.00 40.57 ? 253  LEU A CA    1 
ATOM   2371 C  C     . LEU C 3 247 ? 48.350 61.925  -2.748  1.00 39.63 ? 253  LEU A C     1 
ATOM   2372 O  O     . LEU C 3 247 ? 47.507 62.391  -1.986  1.00 39.43 ? 253  LEU A O     1 
ATOM   2373 C  CB    . LEU C 3 247 ? 47.841 59.677  -3.742  1.00 41.23 ? 253  LEU A CB    1 
ATOM   2374 C  CG    . LEU C 3 247 ? 47.141 58.832  -4.817  1.00 41.45 ? 253  LEU A CG    1 
ATOM   2375 C  CD1   . LEU C 3 247 ? 47.250 57.353  -4.478  1.00 40.33 ? 253  LEU A CD1   1 
ATOM   2376 C  CD2   . LEU C 3 247 ? 45.675 59.243  -4.916  1.00 41.97 ? 253  LEU A CD2   1 
ATOM   2377 N  N     . LEU C 3 248 ? 49.660 62.044  -2.540  1.00 39.26 ? 254  LEU A N     1 
ATOM   2378 C  CA    . LEU C 3 248 ? 50.186 62.743  -1.374  1.00 38.58 ? 254  LEU A CA    1 
ATOM   2379 C  C     . LEU C 3 248 ? 49.885 64.233  -1.500  1.00 39.19 ? 254  LEU A C     1 
ATOM   2380 O  O     . LEU C 3 248 ? 49.424 64.868  -0.547  1.00 39.21 ? 254  LEU A O     1 
ATOM   2381 C  CB    . LEU C 3 248 ? 51.701 62.541  -1.258  1.00 37.68 ? 254  LEU A CB    1 
ATOM   2382 C  CG    . LEU C 3 248 ? 52.391 63.135  -0.022  1.00 37.39 ? 254  LEU A CG    1 
ATOM   2383 C  CD1   . LEU C 3 248 ? 51.758 62.560  1.239   1.00 35.32 ? 254  LEU A CD1   1 
ATOM   2384 C  CD2   . LEU C 3 248 ? 53.888 62.827  -0.059  1.00 37.06 ? 254  LEU A CD2   1 
ATOM   2385 N  N     . ARG C 3 249 ? 50.148 64.781  -2.683  1.00 39.32 ? 255  ARG A N     1 
ATOM   2386 C  CA    . ARG C 3 249 ? 49.902 66.196  -2.944  1.00 42.12 ? 255  ARG A CA    1 
ATOM   2387 C  C     . ARG C 3 249 ? 48.456 66.554  -2.623  1.00 41.93 ? 255  ARG A C     1 
ATOM   2388 O  O     . ARG C 3 249 ? 48.198 67.539  -1.939  1.00 42.27 ? 255  ARG A O     1 
ATOM   2389 C  CB    . ARG C 3 249 ? 50.197 66.530  -4.409  1.00 43.01 ? 255  ARG A CB    1 
ATOM   2390 C  CG    . ARG C 3 249 ? 50.193 68.027  -4.723  1.00 45.11 ? 255  ARG A CG    1 
ATOM   2391 C  CD    . ARG C 3 249 ? 50.353 68.277  -6.213  1.00 46.44 ? 255  ARG A CD    1 
ATOM   2392 N  NE    . ARG C 3 249 ? 49.197 67.798  -6.969  1.00 48.26 ? 255  ARG A NE    1 
ATOM   2393 C  CZ    . ARG C 3 249 ? 47.987 68.339  -6.898  1.00 49.34 ? 255  ARG A CZ    1 
ATOM   2394 N  NH1   . ARG C 3 249 ? 47.771 69.381  -6.104  1.00 52.61 ? 255  ARG A NH1   1 
ATOM   2395 N  NH2   . ARG C 3 249 ? 46.990 67.839  -7.618  1.00 49.93 ? 255  ARG A NH2   1 
ATOM   2396 N  N     . LYS C 3 250 ? 47.519 65.750  -3.118  1.00 42.77 ? 256  LYS A N     1 
ATOM   2397 C  CA    . LYS C 3 250 ? 46.100 65.978  -2.874  1.00 43.31 ? 256  LYS A CA    1 
ATOM   2398 C  C     . LYS C 3 250 ? 45.736 65.889  -1.395  1.00 44.55 ? 256  LYS A C     1 
ATOM   2399 O  O     . LYS C 3 250 ? 45.136 66.809  -0.840  1.00 45.51 ? 256  LYS A O     1 
ATOM   2400 C  CB    . LYS C 3 250 ? 45.252 64.968  -3.647  1.00 42.56 ? 256  LYS A CB    1 
ATOM   2401 C  CG    . LYS C 3 250 ? 45.174 65.218  -5.144  1.00 45.18 ? 256  LYS A CG    1 
ATOM   2402 C  CD    . LYS C 3 250 ? 44.212 64.237  -5.800  1.00 47.86 ? 256  LYS A CD    1 
ATOM   2403 C  CE    . LYS C 3 250 ? 43.933 64.614  -7.246  1.00 48.35 ? 256  LYS A CE    1 
ATOM   2404 N  NZ    . LYS C 3 250 ? 43.317 65.969  -7.350  1.00 51.20 ? 256  LYS A NZ    1 
ATOM   2405 N  N     . LEU C 3 251 ? 46.091 64.772  -0.766  1.00 44.48 ? 257  LEU A N     1 
ATOM   2406 C  CA    . LEU C 3 251 ? 45.791 64.554  0.644   1.00 43.60 ? 257  LEU A CA    1 
ATOM   2407 C  C     . LEU C 3 251 ? 46.423 65.571  1.591   1.00 43.61 ? 257  LEU A C     1 
ATOM   2408 O  O     . LEU C 3 251 ? 45.832 65.907  2.614   1.00 43.47 ? 257  LEU A O     1 
ATOM   2409 C  CB    . LEU C 3 251 ? 46.214 63.144  1.061   1.00 42.03 ? 257  LEU A CB    1 
ATOM   2410 C  CG    . LEU C 3 251 ? 45.391 62.005  0.457   1.00 41.54 ? 257  LEU A CG    1 
ATOM   2411 C  CD1   . LEU C 3 251 ? 45.994 60.662  0.852   1.00 40.09 ? 257  LEU A CD1   1 
ATOM   2412 C  CD2   . LEU C 3 251 ? 43.957 62.114  0.929   1.00 38.77 ? 257  LEU A CD2   1 
ATOM   2413 N  N     . THR C 3 252 ? 47.622 66.046  1.267   1.00 44.07 ? 258  THR A N     1 
ATOM   2414 C  CA    . THR C 3 252 ? 48.287 67.021  2.121   1.00 45.32 ? 258  THR A CA    1 
ATOM   2415 C  C     . THR C 3 252 ? 47.615 68.379  1.967   1.00 47.73 ? 258  THR A C     1 
ATOM   2416 O  O     . THR C 3 252 ? 47.673 69.219  2.862   1.00 48.18 ? 258  THR A O     1 
ATOM   2417 C  CB    . THR C 3 252 ? 49.791 67.160  1.786   1.00 44.20 ? 258  THR A CB    1 
ATOM   2418 O  OG1   . THR C 3 252 ? 49.955 67.357  0.380   1.00 45.15 ? 258  THR A OG1   1 
ATOM   2419 C  CG2   . THR C 3 252 ? 50.556 65.922  2.215   1.00 43.75 ? 258  THR A CG2   1 
ATOM   2420 N  N     . GLU C 3 253 ? 46.970 68.595  0.829   1.00 49.25 ? 259  GLU A N     1 
ATOM   2421 C  CA    . GLU C 3 253 ? 46.285 69.853  0.603   1.00 50.25 ? 259  GLU A CA    1 
ATOM   2422 C  C     . GLU C 3 253 ? 45.003 69.782  1.425   1.00 49.40 ? 259  GLU A C     1 
ATOM   2423 O  O     . GLU C 3 253 ? 44.683 70.707  2.169   1.00 51.08 ? 259  GLU A O     1 
ATOM   2424 C  CB    . GLU C 3 253 ? 45.967 70.030  -0.885  1.00 52.75 ? 259  GLU A CB    1 
ATOM   2425 C  CG    . GLU C 3 253 ? 46.056 71.470  -1.381  1.00 55.78 ? 259  GLU A CG    1 
ATOM   2426 C  CD    . GLU C 3 253 ? 45.013 72.379  -0.752  1.00 59.09 ? 259  GLU A CD    1 
ATOM   2427 O  OE1   . GLU C 3 253 ? 43.806 72.160  -1.002  1.00 59.81 ? 259  GLU A OE1   1 
ATOM   2428 O  OE2   . GLU C 3 253 ? 45.402 73.312  -0.008  1.00 59.47 ? 259  GLU A OE2   1 
ATOM   2429 N  N     . THR C 3 254 ? 44.287 68.668  1.302   1.00 47.51 ? 260  THR A N     1 
ATOM   2430 C  CA    . THR C 3 254 ? 43.043 68.460  2.038   1.00 47.53 ? 260  THR A CA    1 
ATOM   2431 C  C     . THR C 3 254 ? 43.263 68.473  3.552   1.00 48.10 ? 260  THR A C     1 
ATOM   2432 O  O     . THR C 3 254 ? 42.528 69.129  4.289   1.00 48.30 ? 260  THR A O     1 
ATOM   2433 C  CB    . THR C 3 254 ? 42.389 67.118  1.654   1.00 46.76 ? 260  THR A CB    1 
ATOM   2434 O  OG1   . THR C 3 254 ? 42.060 67.126  0.259   1.00 45.37 ? 260  THR A OG1   1 
ATOM   2435 C  CG2   . THR C 3 254 ? 41.124 66.887  2.468   1.00 46.52 ? 260  THR A CG2   1 
ATOM   2436 N  N     . PHE C 3 255 ? 44.268 67.735  4.014   1.00 48.43 ? 261  PHE A N     1 
ATOM   2437 C  CA    . PHE C 3 255 ? 44.585 67.673  5.439   1.00 47.63 ? 261  PHE A CA    1 
ATOM   2438 C  C     . PHE C 3 255 ? 45.915 68.376  5.635   1.00 47.16 ? 261  PHE A C     1 
ATOM   2439 O  O     . PHE C 3 255 ? 46.952 67.870  5.219   1.00 47.33 ? 261  PHE A O     1 
ATOM   2440 C  CB    . PHE C 3 255 ? 44.704 66.221  5.903   1.00 46.58 ? 261  PHE A CB    1 
ATOM   2441 C  CG    . PHE C 3 255 ? 43.496 65.384  5.599   1.00 46.37 ? 261  PHE A CG    1 
ATOM   2442 C  CD1   . PHE C 3 255 ? 42.267 65.671  6.184   1.00 46.29 ? 261  PHE A CD1   1 
ATOM   2443 C  CD2   . PHE C 3 255 ? 43.588 64.302  4.728   1.00 45.66 ? 261  PHE A CD2   1 
ATOM   2444 C  CE1   . PHE C 3 255 ? 41.145 64.889  5.906   1.00 46.65 ? 261  PHE A CE1   1 
ATOM   2445 C  CE2   . PHE C 3 255 ? 42.475 63.514  4.444   1.00 44.92 ? 261  PHE A CE2   1 
ATOM   2446 C  CZ    . PHE C 3 255 ? 41.252 63.804  5.031   1.00 45.33 ? 261  PHE A CZ    1 
ATOM   2447 N  N     . GLY C 3 256 ? 45.887 69.542  6.268   1.00 47.13 ? 262  GLY A N     1 
ATOM   2448 C  CA    . GLY C 3 256 ? 47.113 70.291  6.472   1.00 46.63 ? 262  GLY A CA    1 
ATOM   2449 C  C     . GLY C 3 256 ? 47.914 69.871  7.685   1.00 46.16 ? 262  GLY A C     1 
ATOM   2450 O  O     . GLY C 3 256 ? 47.445 69.104  8.525   1.00 46.72 ? 262  GLY A O     1 
ATOM   2451 N  N     . SER C 3 257 ? 49.130 70.391  7.776   1.00 45.32 ? 263  SER A N     1 
ATOM   2452 C  CA    . SER C 3 257 ? 50.019 70.078  8.882   1.00 46.64 ? 263  SER A CA    1 
ATOM   2453 C  C     . SER C 3 257 ? 49.528 70.683  10.193  1.00 46.99 ? 263  SER A C     1 
ATOM   2454 O  O     . SER C 3 257 ? 48.587 71.478  10.214  1.00 47.61 ? 263  SER A O     1 
ATOM   2455 C  CB    . SER C 3 257 ? 51.422 70.596  8.577   1.00 47.23 ? 263  SER A CB    1 
ATOM   2456 O  OG    . SER C 3 257 ? 51.409 72.005  8.437   1.00 49.13 ? 263  SER A OG    1 
ATOM   2457 N  N     . TRP C 3 258 ? 50.175 70.297  11.286  1.00 46.61 ? 264  TRP A N     1 
ATOM   2458 C  CA    . TRP C 3 258 ? 49.820 70.792  12.610  1.00 47.50 ? 264  TRP A CA    1 
ATOM   2459 C  C     . TRP C 3 258 ? 51.031 70.669  13.520  1.00 46.74 ? 264  TRP A C     1 
ATOM   2460 O  O     . TRP C 3 258 ? 52.087 70.202  13.095  1.00 47.49 ? 264  TRP A O     1 
ATOM   2461 C  CB    . TRP C 3 258 ? 48.647 69.985  13.178  1.00 48.80 ? 264  TRP A CB    1 
ATOM   2462 C  CG    . TRP C 3 258 ? 48.958 68.535  13.431  1.00 51.06 ? 264  TRP A CG    1 
ATOM   2463 C  CD1   . TRP C 3 258 ? 49.454 67.991  14.582  1.00 52.24 ? 264  TRP A CD1   1 
ATOM   2464 C  CD2   . TRP C 3 258 ? 48.805 67.446  12.508  1.00 50.91 ? 264  TRP A CD2   1 
ATOM   2465 N  NE1   . TRP C 3 258 ? 49.618 66.633  14.434  1.00 52.61 ? 264  TRP A NE1   1 
ATOM   2466 C  CE2   . TRP C 3 258 ? 49.227 66.273  13.171  1.00 51.56 ? 264  TRP A CE2   1 
ATOM   2467 C  CE3   . TRP C 3 258 ? 48.352 67.350  11.185  1.00 50.76 ? 264  TRP A CE3   1 
ATOM   2468 C  CZ2   . TRP C 3 258 ? 49.211 65.015  12.555  1.00 51.06 ? 264  TRP A CZ2   1 
ATOM   2469 C  CZ3   . TRP C 3 258 ? 48.337 66.098  10.572  1.00 50.59 ? 264  TRP A CZ3   1 
ATOM   2470 C  CH2   . TRP C 3 258 ? 48.764 64.949  11.260  1.00 50.72 ? 264  TRP A CH2   1 
ATOM   2471 N  N     . TYR C 3 259 ? 50.887 71.094  14.767  1.00 45.17 ? 265  TYR A N     1 
ATOM   2472 C  CA    . TYR C 3 259 ? 51.991 71.003  15.706  1.00 43.86 ? 265  TYR A CA    1 
ATOM   2473 C  C     . TYR C 3 259 ? 51.709 69.963  16.777  1.00 43.12 ? 265  TYR A C     1 
ATOM   2474 O  O     . TYR C 3 259 ? 50.554 69.687  17.103  1.00 41.31 ? 265  TYR A O     1 
ATOM   2475 C  CB    . TYR C 3 259 ? 52.269 72.364  16.353  1.00 44.65 ? 265  TYR A CB    1 
ATOM   2476 C  CG    . TYR C 3 259 ? 52.988 73.326  15.436  1.00 44.49 ? 265  TYR A CG    1 
ATOM   2477 C  CD1   . TYR C 3 259 ? 52.283 74.183  14.588  1.00 44.20 ? 265  TYR A CD1   1 
ATOM   2478 C  CD2   . TYR C 3 259 ? 54.379 73.350  15.388  1.00 44.29 ? 265  TYR A CD2   1 
ATOM   2479 C  CE1   . TYR C 3 259 ? 52.957 75.042  13.713  1.00 44.53 ? 265  TYR A CE1   1 
ATOM   2480 C  CE2   . TYR C 3 259 ? 55.059 74.199  14.520  1.00 45.15 ? 265  TYR A CE2   1 
ATOM   2481 C  CZ    . TYR C 3 259 ? 54.346 75.041  13.687  1.00 45.37 ? 265  TYR A CZ    1 
ATOM   2482 O  OH    . TYR C 3 259 ? 55.034 75.875  12.833  1.00 47.01 ? 265  TYR A OH    1 
ATOM   2483 N  N     . GLN C 3 260 ? 52.779 69.378  17.306  1.00 42.33 ? 266  GLN A N     1 
ATOM   2484 C  CA    . GLN C 3 260 ? 52.674 68.363  18.348  1.00 43.16 ? 266  GLN A CA    1 
ATOM   2485 C  C     . GLN C 3 260 ? 53.818 68.519  19.336  1.00 41.94 ? 266  GLN A C     1 
ATOM   2486 O  O     . GLN C 3 260 ? 54.934 68.866  18.953  1.00 39.96 ? 266  GLN A O     1 
ATOM   2487 C  CB    . GLN C 3 260 ? 52.753 66.958  17.752  1.00 45.10 ? 266  GLN A CB    1 
ATOM   2488 C  CG    . GLN C 3 260 ? 51.547 66.511  16.962  1.00 47.47 ? 266  GLN A CG    1 
ATOM   2489 C  CD    . GLN C 3 260 ? 51.699 65.081  16.469  1.00 49.00 ? 266  GLN A CD    1 
ATOM   2490 O  OE1   . GLN C 3 260 ? 50.778 64.510  15.886  1.00 49.83 ? 266  GLN A OE1   1 
ATOM   2491 N  NE2   . GLN C 3 260 ? 52.874 64.495  16.705  1.00 49.81 ? 266  GLN A NE2   1 
ATOM   2492 N  N     . PRO C 3 261 ? 53.556 68.252  20.622  1.00 42.59 ? 267  PRO A N     1 
ATOM   2493 C  CA    . PRO C 3 261 ? 54.599 68.370  21.643  1.00 44.28 ? 267  PRO A CA    1 
ATOM   2494 C  C     . PRO C 3 261 ? 55.733 67.394  21.359  1.00 45.97 ? 267  PRO A C     1 
ATOM   2495 O  O     . PRO C 3 261 ? 55.496 66.281  20.888  1.00 47.00 ? 267  PRO A O     1 
ATOM   2496 C  CB    . PRO C 3 261 ? 53.852 68.053  22.935  1.00 43.18 ? 267  PRO A CB    1 
ATOM   2497 C  CG    . PRO C 3 261 ? 52.760 67.137  22.482  1.00 43.34 ? 267  PRO A CG    1 
ATOM   2498 C  CD    . PRO C 3 261 ? 52.289 67.796  21.215  1.00 42.29 ? 267  PRO A CD    1 
ATOM   2499 N  N     . LYS C 3 262 ? 56.962 67.821  21.634  1.00 47.91 ? 268  LYS A N     1 
ATOM   2500 C  CA    . LYS C 3 262 ? 58.133 66.985  21.396  1.00 49.37 ? 268  LYS A CA    1 
ATOM   2501 C  C     . LYS C 3 262 ? 59.379 67.553  22.060  1.00 50.75 ? 268  LYS A C     1 
ATOM   2502 O  O     . LYS C 3 262 ? 59.747 68.702  21.822  1.00 51.95 ? 268  LYS A O     1 
ATOM   2503 C  CB    . LYS C 3 262 ? 58.381 66.852  19.890  1.00 49.42 ? 268  LYS A CB    1 
ATOM   2504 C  CG    . LYS C 3 262 ? 59.677 66.138  19.524  1.00 48.07 ? 268  LYS A CG    1 
ATOM   2505 N  N     . GLY C 3 263 ? 60.028 66.745  22.891  1.00 52.55 ? 269  GLY A N     1 
ATOM   2506 C  CA    . GLY C 3 263 ? 61.239 67.195  23.556  1.00 53.66 ? 269  GLY A CA    1 
ATOM   2507 C  C     . GLY C 3 263 ? 61.042 67.672  24.980  1.00 54.33 ? 269  GLY A C     1 
ATOM   2508 O  O     . GLY C 3 263 ? 61.981 68.153  25.613  1.00 55.63 ? 269  GLY A O     1 
ATOM   2509 N  N     . GLY C 3 264 ? 59.820 67.553  25.487  1.00 54.80 ? 270  GLY A N     1 
ATOM   2510 C  CA    . GLY C 3 264 ? 59.557 67.979  26.848  1.00 54.68 ? 270  GLY A CA    1 
ATOM   2511 C  C     . GLY C 3 264 ? 60.255 67.034  27.803  1.00 55.16 ? 270  GLY A C     1 
ATOM   2512 O  O     . GLY C 3 264 ? 60.217 65.820  27.603  1.00 54.97 ? 270  GLY A O     1 
ATOM   2513 N  N     . THR C 3 265 ? 60.898 67.581  28.832  1.00 55.30 ? 271  THR A N     1 
ATOM   2514 C  CA    . THR C 3 265 ? 61.609 66.760  29.805  1.00 55.32 ? 271  THR A CA    1 
ATOM   2515 C  C     . THR C 3 265 ? 61.212 67.086  31.237  1.00 55.14 ? 271  THR A C     1 
ATOM   2516 O  O     . THR C 3 265 ? 61.860 66.633  32.178  1.00 56.05 ? 271  THR A O     1 
ATOM   2517 C  CB    . THR C 3 265 ? 63.136 66.948  29.694  1.00 56.03 ? 271  THR A CB    1 
ATOM   2518 O  OG1   . THR C 3 265 ? 63.465 68.321  29.943  1.00 55.70 ? 271  THR A OG1   1 
ATOM   2519 C  CG2   . THR C 3 265 ? 63.629 66.549  28.312  1.00 55.22 ? 271  THR A CG2   1 
ATOM   2520 N  N     . GLU C 3 266 ? 60.158 67.875  31.409  1.00 54.63 ? 272  GLU A N     1 
ATOM   2521 C  CA    . GLU C 3 266 ? 59.724 68.232  32.752  1.00 54.62 ? 272  GLU A CA    1 
ATOM   2522 C  C     . GLU C 3 266 ? 58.219 68.118  32.929  1.00 54.54 ? 272  GLU A C     1 
ATOM   2523 O  O     . GLU C 3 266 ? 57.438 68.588  32.099  1.00 55.16 ? 272  GLU A O     1 
ATOM   2524 C  CB    . GLU C 3 266 ? 60.170 69.654  33.092  1.00 55.79 ? 272  GLU A CB    1 
ATOM   2525 C  CG    . GLU C 3 266 ? 61.639 69.918  32.814  1.00 56.24 ? 272  GLU A CG    1 
ATOM   2526 C  CD    . GLU C 3 266 ? 62.053 71.330  33.169  1.00 57.17 ? 272  GLU A CD    1 
ATOM   2527 O  OE1   . GLU C 3 266 ? 63.151 71.750  32.741  1.00 56.43 ? 272  GLU A OE1   1 
ATOM   2528 O  OE2   . GLU C 3 266 ? 61.284 72.018  33.879  1.00 57.08 ? 272  GLU A OE2   1 
ATOM   2529 N  N     . MET C 3 267 ? 57.822 67.484  34.022  1.00 54.11 ? 273  MET A N     1 
ATOM   2530 C  CA    . MET C 3 267 ? 56.416 67.301  34.348  1.00 53.62 ? 273  MET A CA    1 
ATOM   2531 C  C     . MET C 3 267 ? 55.774 68.673  34.526  1.00 52.54 ? 273  MET A C     1 
ATOM   2532 O  O     . MET C 3 267 ? 56.370 69.565  35.140  1.00 52.69 ? 273  MET A O     1 
ATOM   2533 C  CB    . MET C 3 267 ? 56.294 66.508  35.654  1.00 54.99 ? 273  MET A CB    1 
ATOM   2534 C  CG    . MET C 3 267 ? 54.870 66.250  36.127  1.00 56.47 ? 273  MET A CG    1 
ATOM   2535 S  SD    . MET C 3 267 ? 54.016 65.011  35.141  1.00 59.66 ? 273  MET A SD    1 
ATOM   2536 C  CE    . MET C 3 267 ? 54.485 63.510  35.998  1.00 56.90 ? 273  MET A CE    1 
ATOM   2537 N  N     . PHE C 3 268 ? 54.573 68.855  33.984  1.00 50.94 ? 274  PHE A N     1 
ATOM   2538 C  CA    . PHE C 3 268 ? 53.894 70.131  34.152  1.00 49.58 ? 274  PHE A CA    1 
ATOM   2539 C  C     . PHE C 3 268 ? 53.121 70.065  35.459  1.00 50.01 ? 274  PHE A C     1 
ATOM   2540 O  O     . PHE C 3 268 ? 52.324 69.153  35.676  1.00 48.98 ? 274  PHE A O     1 
ATOM   2541 C  CB    . PHE C 3 268 ? 52.923 70.423  33.002  1.00 48.25 ? 274  PHE A CB    1 
ATOM   2542 C  CG    . PHE C 3 268 ? 52.234 71.759  33.129  1.00 47.18 ? 274  PHE A CG    1 
ATOM   2543 C  CD1   . PHE C 3 268 ? 52.966 72.944  33.053  1.00 46.55 ? 274  PHE A CD1   1 
ATOM   2544 C  CD2   . PHE C 3 268 ? 50.869 71.834  33.385  1.00 47.06 ? 274  PHE A CD2   1 
ATOM   2545 C  CE1   . PHE C 3 268 ? 52.348 74.183  33.235  1.00 46.20 ? 274  PHE A CE1   1 
ATOM   2546 C  CE2   . PHE C 3 268 ? 50.240 73.072  33.569  1.00 46.87 ? 274  PHE A CE2   1 
ATOM   2547 C  CZ    . PHE C 3 268 ? 50.983 74.246  33.494  1.00 46.42 ? 274  PHE A CZ    1 
ATOM   2548 N  N     . CYS C 3 269 ? 53.359 71.034  36.332  1.00 51.82 ? 275  CYS A N     1 
ATOM   2549 C  CA    . CYS C 3 269 ? 52.683 71.060  37.620  1.00 53.67 ? 275  CYS A CA    1 
ATOM   2550 C  C     . CYS C 3 269 ? 51.857 72.326  37.791  1.00 54.62 ? 275  CYS A C     1 
ATOM   2551 O  O     . CYS C 3 269 ? 52.296 73.424  37.442  1.00 55.46 ? 275  CYS A O     1 
ATOM   2552 C  CB    . CYS C 3 269 ? 53.712 70.942  38.749  1.00 54.39 ? 275  CYS A CB    1 
ATOM   2553 S  SG    . CYS C 3 269 ? 54.776 69.465  38.612  1.00 56.53 ? 275  CYS A SG    1 
ATOM   2554 N  N     . HIS C 3 270 ? 50.652 72.161  38.323  1.00 55.48 ? 276  HIS A N     1 
ATOM   2555 C  CA    . HIS C 3 270 ? 49.756 73.284  38.544  1.00 57.22 ? 276  HIS A CA    1 
ATOM   2556 C  C     . HIS C 3 270 ? 50.446 74.325  39.428  1.00 57.69 ? 276  HIS A C     1 
ATOM   2557 O  O     . HIS C 3 270 ? 50.695 74.078  40.604  1.00 58.67 ? 276  HIS A O     1 
ATOM   2558 C  CB    . HIS C 3 270 ? 48.470 72.780  39.202  1.00 58.25 ? 276  HIS A CB    1 
ATOM   2559 C  CG    . HIS C 3 270 ? 47.384 73.805  39.277  1.00 59.69 ? 276  HIS A CG    1 
ATOM   2560 N  ND1   . HIS C 3 270 ? 46.071 73.476  39.537  1.00 60.79 ? 276  HIS A ND1   1 
ATOM   2561 C  CD2   . HIS C 3 270 ? 47.413 75.151  39.132  1.00 60.73 ? 276  HIS A CD2   1 
ATOM   2562 C  CE1   . HIS C 3 270 ? 45.338 74.574  39.548  1.00 61.56 ? 276  HIS A CE1   1 
ATOM   2563 N  NE2   . HIS C 3 270 ? 46.128 75.605  39.305  1.00 61.59 ? 276  HIS A NE2   1 
ATOM   2564 N  N     . PRO C 3 271 ? 50.768 75.505  38.865  1.00 58.00 ? 277  PRO A N     1 
ATOM   2565 C  CA    . PRO C 3 271 ? 51.437 76.599  39.585  1.00 58.62 ? 277  PRO A CA    1 
ATOM   2566 C  C     . PRO C 3 271 ? 50.784 76.944  40.922  1.00 59.00 ? 277  PRO A C     1 
ATOM   2567 O  O     . PRO C 3 271 ? 51.456 77.369  41.864  1.00 58.69 ? 277  PRO A O     1 
ATOM   2568 C  CB    . PRO C 3 271 ? 51.357 77.760  38.597  1.00 58.34 ? 277  PRO A CB    1 
ATOM   2569 C  CG    . PRO C 3 271 ? 51.416 77.072  37.276  1.00 58.82 ? 277  PRO A CG    1 
ATOM   2570 C  CD    . PRO C 3 271 ? 50.475 75.906  37.478  1.00 58.05 ? 277  PRO A CD    1 
ATOM   2571 N  N     . ARG C 3 272 ? 49.470 76.764  40.989  1.00 58.87 ? 278  ARG A N     1 
ATOM   2572 C  CA    . ARG C 3 272 ? 48.712 77.054  42.199  1.00 59.64 ? 278  ARG A CA    1 
ATOM   2573 C  C     . ARG C 3 272 ? 49.125 76.096  43.311  1.00 59.02 ? 278  ARG A C     1 
ATOM   2574 O  O     . ARG C 3 272 ? 49.772 76.493  44.281  1.00 58.76 ? 278  ARG A O     1 
ATOM   2575 C  CB    . ARG C 3 272 ? 47.211 76.911  41.914  1.00 60.62 ? 278  ARG A CB    1 
ATOM   2576 C  CG    . ARG C 3 272 ? 46.275 77.354  43.036  1.00 61.30 ? 278  ARG A CG    1 
ATOM   2577 C  CD    . ARG C 3 272 ? 44.835 76.959  42.707  1.00 60.81 ? 278  ARG A CD    1 
ATOM   2578 N  NE    . ARG C 3 272 ? 44.395 77.505  41.421  1.00 61.48 ? 278  ARG A NE    1 
ATOM   2579 C  CZ    . ARG C 3 272 ? 43.494 76.927  40.628  1.00 61.29 ? 278  ARG A CZ    1 
ATOM   2580 N  NH1   . ARG C 3 272 ? 42.933 75.779  40.985  1.00 61.70 ? 278  ARG A NH1   1 
ATOM   2581 N  NH2   . ARG C 3 272 ? 43.156 77.490  39.475  1.00 61.27 ? 278  ARG A NH2   1 
ATOM   2582 N  N     . THR C 3 273 ? 48.763 74.827  43.150  1.00 58.44 ? 279  THR A N     1 
ATOM   2583 C  CA    . THR C 3 273 ? 49.071 73.806  44.139  1.00 58.69 ? 279  THR A CA    1 
ATOM   2584 C  C     . THR C 3 273 ? 50.462 73.193  43.993  1.00 58.52 ? 279  THR A C     1 
ATOM   2585 O  O     . THR C 3 273 ? 51.223 73.121  44.958  1.00 59.77 ? 279  THR A O     1 
ATOM   2586 C  CB    . THR C 3 273 ? 48.025 72.670  44.096  1.00 59.49 ? 279  THR A CB    1 
ATOM   2587 O  OG1   . THR C 3 273 ? 47.932 72.148  42.764  1.00 58.85 ? 279  THR A OG1   1 
ATOM   2588 C  CG2   . THR C 3 273 ? 46.661 73.189  44.523  1.00 60.25 ? 279  THR A CG2   1 
ATOM   2589 N  N     . GLY C 3 274 ? 50.796 72.766  42.782  1.00 57.49 ? 280  GLY A N     1 
ATOM   2590 C  CA    . GLY C 3 274 ? 52.082 72.138  42.539  1.00 55.92 ? 280  GLY A CA    1 
ATOM   2591 C  C     . GLY C 3 274 ? 51.758 70.719  42.130  1.00 55.06 ? 280  GLY A C     1 
ATOM   2592 O  O     . GLY C 3 274 ? 52.632 69.878  41.912  1.00 54.78 ? 280  GLY A O     1 
ATOM   2593 N  N     . LYS C 3 275 ? 50.458 70.469  42.033  1.00 54.87 ? 281  LYS A N     1 
ATOM   2594 C  CA    . LYS C 3 275 ? 49.923 69.172  41.654  1.00 55.14 ? 281  LYS A CA    1 
ATOM   2595 C  C     . LYS C 3 275 ? 50.491 68.732  40.307  1.00 54.91 ? 281  LYS A C     1 
ATOM   2596 O  O     . LYS C 3 275 ? 50.378 69.448  39.313  1.00 55.28 ? 281  LYS A O     1 
ATOM   2597 C  CB    . LYS C 3 275 ? 48.399 69.272  41.577  1.00 54.49 ? 281  LYS A CB    1 
ATOM   2598 C  CG    . LYS C 3 275 ? 47.672 68.008  41.172  1.00 54.90 ? 281  LYS A CG    1 
ATOM   2599 C  CD    . LYS C 3 275 ? 46.180 68.289  41.095  1.00 53.96 ? 281  LYS A CD    1 
ATOM   2600 C  CE    . LYS C 3 275 ? 45.405 67.098  40.585  1.00 54.67 ? 281  LYS A CE    1 
ATOM   2601 N  NZ    . LYS C 3 275 ? 43.960 67.434  40.463  1.00 55.58 ? 281  LYS A NZ    1 
ATOM   2602 N  N     . PRO C 3 276 ? 51.136 67.556  40.264  1.00 54.85 ? 282  PRO A N     1 
ATOM   2603 C  CA    . PRO C 3 276 ? 51.696 67.083  38.996  1.00 54.58 ? 282  PRO A CA    1 
ATOM   2604 C  C     . PRO C 3 276 ? 50.580 66.832  37.993  1.00 54.88 ? 282  PRO A C     1 
ATOM   2605 O  O     . PRO C 3 276 ? 49.500 66.356  38.355  1.00 53.39 ? 282  PRO A O     1 
ATOM   2606 C  CB    . PRO C 3 276 ? 52.412 65.797  39.395  1.00 54.51 ? 282  PRO A CB    1 
ATOM   2607 C  CG    . PRO C 3 276 ? 52.861 66.096  40.797  1.00 55.31 ? 282  PRO A CG    1 
ATOM   2608 C  CD    . PRO C 3 276 ? 51.620 66.732  41.386  1.00 55.14 ? 282  PRO A CD    1 
ATOM   2609 N  N     . LEU C 3 277 ? 50.838 67.170  36.735  1.00 55.31 ? 283  LEU A N     1 
ATOM   2610 C  CA    . LEU C 3 277 ? 49.856 66.973  35.679  1.00 55.77 ? 283  LEU A CA    1 
ATOM   2611 C  C     . LEU C 3 277 ? 50.510 66.152  34.569  1.00 56.20 ? 283  LEU A C     1 
ATOM   2612 O  O     . LEU C 3 277 ? 50.934 66.690  33.546  1.00 56.75 ? 283  LEU A O     1 
ATOM   2613 C  CB    . LEU C 3 277 ? 49.376 68.331  35.150  1.00 55.52 ? 283  LEU A CB    1 
ATOM   2614 C  CG    . LEU C 3 277 ? 48.699 69.254  36.175  1.00 55.39 ? 283  LEU A CG    1 
ATOM   2615 C  CD1   . LEU C 3 277 ? 48.248 70.541  35.501  1.00 55.39 ? 283  LEU A CD1   1 
ATOM   2616 C  CD2   . LEU C 3 277 ? 47.502 68.550  36.794  1.00 55.62 ? 283  LEU A CD2   1 
ATOM   2617 N  N     . PRO C 3 278 ? 50.613 64.826  34.774  1.00 56.49 ? 284  PRO A N     1 
ATOM   2618 C  CA    . PRO C 3 278 ? 51.214 63.888  33.818  1.00 55.89 ? 284  PRO A CA    1 
ATOM   2619 C  C     . PRO C 3 278 ? 50.500 63.859  32.471  1.00 55.08 ? 284  PRO A C     1 
ATOM   2620 O  O     . PRO C 3 278 ? 51.095 63.506  31.452  1.00 54.59 ? 284  PRO A O     1 
ATOM   2621 C  CB    . PRO C 3 278 ? 51.116 62.544  34.542  1.00 56.02 ? 284  PRO A CB    1 
ATOM   2622 C  CG    . PRO C 3 278 ? 51.142 62.934  35.993  1.00 56.92 ? 284  PRO A CG    1 
ATOM   2623 C  CD    . PRO C 3 278 ? 50.223 64.125  36.010  1.00 56.73 ? 284  PRO A CD    1 
ATOM   2624 N  N     . LYS C 3 279 ? 49.221 64.223  32.479  1.00 54.12 ? 285  LYS A N     1 
ATOM   2625 C  CA    . LYS C 3 279 ? 48.417 64.240  31.260  1.00 53.48 ? 285  LYS A CA    1 
ATOM   2626 C  C     . LYS C 3 279 ? 48.846 65.380  30.336  1.00 52.94 ? 285  LYS A C     1 
ATOM   2627 O  O     . LYS C 3 279 ? 48.892 65.216  29.118  1.00 52.39 ? 285  LYS A O     1 
ATOM   2628 C  CB    . LYS C 3 279 ? 46.934 64.377  31.613  1.00 54.27 ? 285  LYS A CB    1 
ATOM   2629 N  N     . TYR C 3 280 ? 49.148 66.538  30.918  1.00 51.80 ? 286  TYR A N     1 
ATOM   2630 C  CA    . TYR C 3 280 ? 49.597 67.683  30.135  1.00 50.75 ? 286  TYR A CA    1 
ATOM   2631 C  C     . TYR C 3 280 ? 50.939 67.316  29.511  1.00 50.80 ? 286  TYR A C     1 
ATOM   2632 O  O     . TYR C 3 280 ? 51.743 66.615  30.127  1.00 51.23 ? 286  TYR A O     1 
ATOM   2633 C  CB    . TYR C 3 280 ? 49.773 68.915  31.032  1.00 50.40 ? 286  TYR A CB    1 
ATOM   2634 C  CG    . TYR C 3 280 ? 48.552 69.802  31.134  1.00 49.91 ? 286  TYR A CG    1 
ATOM   2635 C  CD1   . TYR C 3 280 ? 48.323 70.819  30.204  1.00 50.03 ? 286  TYR A CD1   1 
ATOM   2636 C  CD2   . TYR C 3 280 ? 47.613 69.613  32.147  1.00 49.22 ? 286  TYR A CD2   1 
ATOM   2637 C  CE1   . TYR C 3 280 ? 47.183 71.628  30.285  1.00 49.62 ? 286  TYR A CE1   1 
ATOM   2638 C  CE2   . TYR C 3 280 ? 46.476 70.411  32.236  1.00 49.44 ? 286  TYR A CE2   1 
ATOM   2639 C  CZ    . TYR C 3 280 ? 46.266 71.414  31.304  1.00 49.01 ? 286  TYR A CZ    1 
ATOM   2640 O  OH    . TYR C 3 280 ? 45.132 72.186  31.388  1.00 50.31 ? 286  TYR A OH    1 
ATOM   2641 N  N     . PRO C 3 281 ? 51.196 67.775  28.276  1.00 50.67 ? 287  PRO A N     1 
ATOM   2642 C  CA    . PRO C 3 281 ? 52.472 67.457  27.628  1.00 50.50 ? 287  PRO A CA    1 
ATOM   2643 C  C     . PRO C 3 281 ? 53.659 68.013  28.409  1.00 50.76 ? 287  PRO A C     1 
ATOM   2644 O  O     . PRO C 3 281 ? 53.528 68.989  29.153  1.00 49.97 ? 287  PRO A O     1 
ATOM   2645 C  CB    . PRO C 3 281 ? 52.326 68.089  26.243  1.00 49.76 ? 287  PRO A CB    1 
ATOM   2646 C  CG    . PRO C 3 281 ? 51.386 69.228  26.487  1.00 50.40 ? 287  PRO A CG    1 
ATOM   2647 C  CD    . PRO C 3 281 ? 50.360 68.618  27.403  1.00 49.35 ? 287  PRO A CD    1 
ATOM   2648 N  N     . ARG C 3 282 ? 54.815 67.379  28.240  1.00 51.29 ? 288  ARG A N     1 
ATOM   2649 C  CA    . ARG C 3 282 ? 56.026 67.801  28.931  1.00 51.61 ? 288  ARG A CA    1 
ATOM   2650 C  C     . ARG C 3 282 ? 56.490 69.185  28.492  1.00 51.29 ? 288  ARG A C     1 
ATOM   2651 O  O     . ARG C 3 282 ? 56.341 69.575  27.332  1.00 51.37 ? 288  ARG A O     1 
ATOM   2652 C  CB    . ARG C 3 282 ? 57.139 66.771  28.717  1.00 53.42 ? 288  ARG A CB    1 
ATOM   2653 C  CG    . ARG C 3 282 ? 57.284 65.752  29.851  1.00 56.09 ? 288  ARG A CG    1 
ATOM   2654 C  CD    . ARG C 3 282 ? 55.960 65.089  30.195  1.00 58.38 ? 288  ARG A CD    1 
ATOM   2655 N  NE    . ARG C 3 282 ? 56.063 64.188  31.343  1.00 59.33 ? 288  ARG A NE    1 
ATOM   2656 C  CZ    . ARG C 3 282 ? 55.020 63.600  31.923  1.00 59.83 ? 288  ARG A CZ    1 
ATOM   2657 N  NH1   . ARG C 3 282 ? 53.794 63.821  31.463  1.00 59.69 ? 288  ARG A NH1   1 
ATOM   2658 N  NH2   . ARG C 3 282 ? 55.199 62.788  32.958  1.00 58.69 ? 288  ARG A NH2   1 
ATOM   2659 N  N     . ILE C 3 283 ? 57.051 69.923  29.441  1.00 49.34 ? 289  ILE A N     1 
ATOM   2660 C  CA    . ILE C 3 283 ? 57.531 71.273  29.195  1.00 48.87 ? 289  ILE A CA    1 
ATOM   2661 C  C     . ILE C 3 283 ? 59.030 71.364  29.442  1.00 48.80 ? 289  ILE A C     1 
ATOM   2662 O  O     . ILE C 3 283 ? 59.673 70.395  29.849  1.00 49.55 ? 289  ILE A O     1 
ATOM   2663 C  CB    . ILE C 3 283 ? 56.848 72.278  30.142  1.00 48.34 ? 289  ILE A CB    1 
ATOM   2664 C  CG1   . ILE C 3 283 ? 57.173 71.909  31.596  1.00 48.04 ? 289  ILE A CG1   1 
ATOM   2665 C  CG2   . ILE C 3 283 ? 55.347 72.271  29.917  1.00 47.43 ? 289  ILE A CG2   1 
ATOM   2666 C  CD1   . ILE C 3 283 ? 56.610 72.856  32.631  1.00 49.33 ? 289  ILE A CD1   1 
ATOM   2667 N  N     . LYS C 3 284 ? 59.575 72.544  29.194  1.00 48.11 ? 290  LYS A N     1 
ATOM   2668 C  CA    . LYS C 3 284 ? 60.984 72.804  29.421  1.00 48.91 ? 290  LYS A CA    1 
ATOM   2669 C  C     . LYS C 3 284 ? 61.023 74.158  30.108  1.00 49.71 ? 290  LYS A C     1 
ATOM   2670 O  O     . LYS C 3 284 ? 60.250 75.052  29.757  1.00 49.50 ? 290  LYS A O     1 
ATOM   2671 C  CB    . LYS C 3 284 ? 61.746 72.862  28.096  1.00 48.19 ? 290  LYS A CB    1 
ATOM   2672 N  N     . THR C 3 285 ? 61.890 74.303  31.104  1.00 50.74 ? 291  THR A N     1 
ATOM   2673 C  CA    . THR C 3 285 ? 62.012 75.571  31.814  1.00 52.11 ? 291  THR A CA    1 
ATOM   2674 C  C     . THR C 3 285 ? 63.427 76.103  31.618  1.00 53.56 ? 291  THR A C     1 
ATOM   2675 O  O     . THR C 3 285 ? 64.384 75.576  32.182  1.00 53.89 ? 291  THR A O     1 
ATOM   2676 C  CB    . THR C 3 285 ? 61.735 75.419  33.333  1.00 51.68 ? 291  THR A CB    1 
ATOM   2677 O  OG1   . THR C 3 285 ? 62.694 74.525  33.912  1.00 53.44 ? 291  THR A OG1   1 
ATOM   2678 C  CG2   . THR C 3 285 ? 60.340 74.873  33.574  1.00 50.21 ? 291  THR A CG2   1 
ATOM   2679 N  N     . PRO C 3 286 ? 63.575 77.161  30.806  1.00 54.82 ? 292  PRO A N     1 
ATOM   2680 C  CA    . PRO C 3 286 ? 64.891 77.752  30.548  1.00 55.66 ? 292  PRO A CA    1 
ATOM   2681 C  C     . PRO C 3 286 ? 65.580 78.218  31.831  1.00 56.75 ? 292  PRO A C     1 
ATOM   2682 O  O     . PRO C 3 286 ? 64.950 78.822  32.709  1.00 55.77 ? 292  PRO A O     1 
ATOM   2683 C  CB    . PRO C 3 286 ? 64.568 78.904  29.599  1.00 55.97 ? 292  PRO A CB    1 
ATOM   2684 C  CG    . PRO C 3 286 ? 63.184 79.311  30.030  1.00 55.30 ? 292  PRO A CG    1 
ATOM   2685 C  CD    . PRO C 3 286 ? 62.505 77.976  30.203  1.00 54.74 ? 292  PRO A CD    1 
ATOM   2686 N  N     . LYS C 3 287 ? 66.874 77.927  31.934  1.00 57.48 ? 293  LYS A N     1 
ATOM   2687 C  CA    . LYS C 3 287 ? 67.658 78.306  33.105  1.00 58.98 ? 293  LYS A CA    1 
ATOM   2688 C  C     . LYS C 3 287 ? 68.274 79.687  32.922  1.00 59.33 ? 293  LYS A C     1 
ATOM   2689 O  O     . LYS C 3 287 ? 68.518 80.399  33.896  1.00 59.68 ? 293  LYS A O     1 
ATOM   2690 C  CB    . LYS C 3 287 ? 68.765 77.277  33.356  1.00 58.48 ? 293  LYS A CB    1 
ATOM   2691 N  N     . VAL C 3 288 ? 68.525 80.061  31.671  1.00 60.37 ? 294  VAL A N     1 
ATOM   2692 C  CA    . VAL C 3 288 ? 69.112 81.363  31.370  1.00 61.49 ? 294  VAL A CA    1 
ATOM   2693 C  C     . VAL C 3 288 ? 68.196 82.222  30.494  1.00 62.11 ? 294  VAL A C     1 
ATOM   2694 O  O     . VAL C 3 288 ? 67.212 81.734  29.934  1.00 62.74 ? 294  VAL A O     1 
ATOM   2695 C  CB    . VAL C 3 288 ? 70.480 81.212  30.660  1.00 60.97 ? 294  VAL A CB    1 
ATOM   2696 C  CG1   . VAL C 3 288 ? 71.408 80.351  31.503  1.00 61.15 ? 294  VAL A CG1   1 
ATOM   2697 C  CG2   . VAL C 3 288 ? 70.290 80.605  29.279  1.00 61.26 ? 294  VAL A CG2   1 
ATOM   2698 N  N     . GLY C 3 289 ? 68.529 83.505  30.387  1.00 62.12 ? 295  GLY A N     1 
ATOM   2699 C  CA    . GLY C 3 289 ? 67.737 84.415  29.582  1.00 60.63 ? 295  GLY A CA    1 
ATOM   2700 C  C     . GLY C 3 289 ? 67.004 85.447  30.416  1.00 60.35 ? 295  GLY A C     1 
ATOM   2701 O  O     . GLY C 3 289 ? 66.570 85.166  31.534  1.00 59.77 ? 295  GLY A O     1 
ATOM   2702 N  N     . GLY C 3 290 ? 66.872 86.649  29.865  1.00 59.35 ? 296  GLY A N     1 
ATOM   2703 C  CA    . GLY C 3 290 ? 66.181 87.718  30.557  1.00 58.82 ? 296  GLY A CA    1 
ATOM   2704 C  C     . GLY C 3 290 ? 65.684 88.759  29.572  1.00 59.14 ? 296  GLY A C     1 
ATOM   2705 O  O     . GLY C 3 290 ? 66.020 88.712  28.388  1.00 58.29 ? 296  GLY A O     1 
ATOM   2706 N  N     . ILE C 3 291 ? 64.873 89.695  30.053  1.00 59.32 ? 297  ILE A N     1 
ATOM   2707 C  CA    . ILE C 3 291 ? 64.349 90.750  29.197  1.00 60.07 ? 297  ILE A CA    1 
ATOM   2708 C  C     . ILE C 3 291 ? 65.529 91.588  28.716  1.00 61.21 ? 297  ILE A C     1 
ATOM   2709 O  O     . ILE C 3 291 ? 65.692 91.820  27.517  1.00 61.35 ? 297  ILE A O     1 
ATOM   2710 C  CB    . ILE C 3 291 ? 63.358 91.655  29.966  1.00 60.28 ? 297  ILE A CB    1 
ATOM   2711 C  CG1   . ILE C 3 291 ? 62.207 90.812  30.525  1.00 59.30 ? 297  ILE A CG1   1 
ATOM   2712 C  CG2   . ILE C 3 291 ? 62.814 92.740  29.042  1.00 59.50 ? 297  ILE A CG2   1 
ATOM   2713 N  N     . PHE C 3 292 ? 66.353 92.030  29.663  1.00 62.33 ? 298  PHE A N     1 
ATOM   2714 C  CA    . PHE C 3 292 ? 67.533 92.834  29.353  1.00 63.55 ? 298  PHE A CA    1 
ATOM   2715 C  C     . PHE C 3 292 ? 68.769 92.127  29.902  1.00 64.28 ? 298  PHE A C     1 
ATOM   2716 O  O     . PHE C 3 292 ? 68.978 92.093  31.115  1.00 65.12 ? 298  PHE A O     1 
ATOM   2717 C  CB    . PHE C 3 292 ? 67.404 94.227  29.976  1.00 63.39 ? 298  PHE A CB    1 
ATOM   2718 N  N     . LYS C 3 293 ? 69.580 91.565  29.005  1.00 64.59 ? 299  LYS A N     1 
ATOM   2719 C  CA    . LYS C 3 293 ? 70.788 90.835  29.391  1.00 64.14 ? 299  LYS A CA    1 
ATOM   2720 C  C     . LYS C 3 293 ? 71.630 91.514  30.474  1.00 63.68 ? 299  LYS A C     1 
ATOM   2721 O  O     . LYS C 3 293 ? 71.579 92.736  30.656  1.00 63.48 ? 299  LYS A O     1 
ATOM   2722 C  CB    . LYS C 3 293 ? 71.659 90.549  28.159  1.00 63.96 ? 299  LYS A CB    1 
ATOM   2723 C  CG    . LYS C 3 293 ? 72.077 91.775  27.361  1.00 64.35 ? 299  LYS A CG    1 
ATOM   2724 C  CD    . LYS C 3 293 ? 72.935 91.370  26.168  1.00 64.32 ? 299  LYS A CD    1 
ATOM   2725 C  CE    . LYS C 3 293 ? 73.300 92.565  25.305  1.00 64.53 ? 299  LYS A CE    1 
ATOM   2726 N  NZ    . LYS C 3 293 ? 74.119 92.167  24.122  1.00 64.70 ? 299  LYS A NZ    1 
ATOM   2727 N  N     . LYS C 3 294 ? 72.405 90.694  31.182  1.00 63.54 ? 300  LYS A N     1 
ATOM   2728 C  CA    . LYS C 3 294 ? 73.265 91.138  32.278  1.00 63.51 ? 300  LYS A CA    1 
ATOM   2729 C  C     . LYS C 3 294 ? 74.137 92.359  31.979  1.00 63.10 ? 300  LYS A C     1 
ATOM   2730 O  O     . LYS C 3 294 ? 74.792 92.435  30.937  1.00 62.69 ? 300  LYS A O     1 
ATOM   2731 C  CB    . LYS C 3 294 ? 74.157 89.978  32.734  1.00 63.65 ? 300  LYS A CB    1 
ATOM   2732 N  N     . PRO C 3 295 ? 74.168 93.325  32.912  1.00 63.17 ? 301  PRO A N     1 
ATOM   2733 C  CA    . PRO C 3 295 ? 74.955 94.554  32.772  1.00 63.33 ? 301  PRO A CA    1 
ATOM   2734 C  C     . PRO C 3 295 ? 76.458 94.290  32.848  1.00 63.47 ? 301  PRO A C     1 
ATOM   2735 O  O     . PRO C 3 295 ? 77.148 94.621  31.858  1.00 64.24 ? 301  PRO A O     1 
ATOM   2736 C  CB    . PRO C 3 295 ? 74.458 95.406  33.935  1.00 63.20 ? 301  PRO A CB    1 
ATOM   2737 C  CG    . PRO C 3 295 ? 74.207 94.379  34.991  1.00 63.88 ? 301  PRO A CG    1 
ATOM   2738 C  CD    . PRO C 3 295 ? 73.488 93.287  34.219  1.00 63.29 ? 301  PRO A CD    1 
ATOM   2739 N  N     . GLU C 3 305 ? 71.766 104.062 34.088  1.00 66.86 ? 311  GLU A N     1 
ATOM   2740 C  CA    . GLU C 3 305 ? 72.103 103.609 32.705  1.00 67.46 ? 311  GLU A CA    1 
ATOM   2741 C  C     . GLU C 3 305 ? 71.369 102.316 32.343  1.00 67.54 ? 311  GLU A C     1 
ATOM   2742 O  O     . GLU C 3 305 ? 71.721 101.235 32.824  1.00 67.31 ? 311  GLU A O     1 
ATOM   2743 C  CB    . GLU C 3 305 ? 73.612 103.392 32.576  1.00 67.35 ? 311  GLU A CB    1 
ATOM   2744 N  N     . PRO C 3 306 ? 70.338 102.413 31.484  1.00 67.20 ? 312  PRO A N     1 
ATOM   2745 C  CA    . PRO C 3 306 ? 69.555 101.246 31.059  1.00 67.22 ? 312  PRO A CA    1 
ATOM   2746 C  C     . PRO C 3 306 ? 70.378 100.183 30.329  1.00 66.82 ? 312  PRO A C     1 
ATOM   2747 O  O     . PRO C 3 306 ? 71.074 100.476 29.354  1.00 67.01 ? 312  PRO A O     1 
ATOM   2748 C  CB    . PRO C 3 306 ? 68.470 101.861 30.173  1.00 66.80 ? 312  PRO A CB    1 
ATOM   2749 C  CG    . PRO C 3 306 ? 69.147 103.077 29.607  1.00 66.97 ? 312  PRO A CG    1 
ATOM   2750 C  CD    . PRO C 3 306 ? 69.857 103.636 30.816  1.00 66.79 ? 312  PRO A CD    1 
ATOM   2751 N  N     . CYS C 3 307 ? 70.286 98.948  30.816  1.00 67.03 ? 313  CYS A N     1 
ATOM   2752 C  CA    . CYS C 3 307 ? 71.010 97.815  30.246  1.00 66.34 ? 313  CYS A CA    1 
ATOM   2753 C  C     . CYS C 3 307 ? 70.688 97.586  28.773  1.00 65.48 ? 313  CYS A C     1 
ATOM   2754 O  O     . CYS C 3 307 ? 69.937 98.347  28.158  1.00 65.43 ? 313  CYS A O     1 
ATOM   2755 C  CB    . CYS C 3 307 ? 70.683 96.540  31.027  1.00 67.02 ? 313  CYS A CB    1 
ATOM   2756 S  SG    . CYS C 3 307 ? 70.930 96.666  32.813  1.00 69.47 ? 313  CYS A SG    1 
ATOM   2757 N  N     . GLU C 3 308 ? 71.264 96.523  28.218  1.00 64.69 ? 314  GLU A N     1 
ATOM   2758 C  CA    . GLU C 3 308 ? 71.046 96.159  26.824  1.00 63.33 ? 314  GLU A CA    1 
ATOM   2759 C  C     . GLU C 3 308 ? 69.995 95.055  26.739  1.00 62.77 ? 314  GLU A C     1 
ATOM   2760 O  O     . GLU C 3 308 ? 70.059 94.066  27.472  1.00 62.37 ? 314  GLU A O     1 
ATOM   2761 C  CB    . GLU C 3 308 ? 72.354 95.676  26.193  1.00 63.23 ? 314  GLU A CB    1 
ATOM   2762 N  N     . LEU C 3 309 ? 69.027 95.230  25.846  1.00 62.47 ? 315  LEU A N     1 
ATOM   2763 C  CA    . LEU C 3 309 ? 67.967 94.245  25.672  1.00 62.15 ? 315  LEU A CA    1 
ATOM   2764 C  C     . LEU C 3 309 ? 68.551 92.895  25.269  1.00 61.93 ? 315  LEU A C     1 
ATOM   2765 O  O     . LEU C 3 309 ? 69.458 92.823  24.436  1.00 62.00 ? 315  LEU A O     1 
ATOM   2766 C  CB    . LEU C 3 309 ? 66.971 94.721  24.608  1.00 61.85 ? 315  LEU A CB    1 
ATOM   2767 N  N     . ASP C 3 310 ? 68.034 91.829  25.871  1.00 61.70 ? 316  ASP A N     1 
ATOM   2768 C  CA    . ASP C 3 310 ? 68.498 90.482  25.567  1.00 60.93 ? 316  ASP A CA    1 
ATOM   2769 C  C     . ASP C 3 310 ? 67.784 89.968  24.324  1.00 60.92 ? 316  ASP A C     1 
ATOM   2770 O  O     . ASP C 3 310 ? 66.569 89.772  24.328  1.00 60.98 ? 316  ASP A O     1 
ATOM   2771 C  CB    . ASP C 3 310 ? 68.230 89.545  26.747  1.00 61.01 ? 316  ASP A CB    1 
ATOM   2772 C  CG    . ASP C 3 310 ? 68.789 88.150  26.523  1.00 60.73 ? 316  ASP A CG    1 
ATOM   2773 O  OD1   . ASP C 3 310 ? 68.706 87.318  27.453  1.00 60.17 ? 316  ASP A OD1   1 
ATOM   2774 O  OD2   . ASP C 3 310 ? 69.311 87.887  25.418  1.00 60.73 ? 316  ASP A OD2   1 
ATOM   2775 N  N     . THR C 3 311 ? 68.558 89.751  23.266  1.00 61.46 ? 317  THR A N     1 
ATOM   2776 C  CA    . THR C 3 311 ? 68.036 89.273  21.989  1.00 61.22 ? 317  THR A CA    1 
ATOM   2777 C  C     . THR C 3 311 ? 67.624 87.795  22.005  1.00 60.75 ? 317  THR A C     1 
ATOM   2778 O  O     . THR C 3 311 ? 67.147 87.266  20.998  1.00 60.96 ? 317  THR A O     1 
ATOM   2779 C  CB    . THR C 3 311 ? 69.086 89.491  20.873  1.00 61.36 ? 317  THR A CB    1 
ATOM   2780 O  OG1   . THR C 3 311 ? 68.592 88.979  19.630  1.00 61.13 ? 317  THR A OG1   1 
ATOM   2781 C  CG2   . THR C 3 311 ? 70.390 88.791  21.232  1.00 61.85 ? 317  THR A CG2   1 
ATOM   2782 N  N     . ARG C 3 312 ? 67.803 87.134  23.146  1.00 59.77 ? 318  ARG A N     1 
ATOM   2783 C  CA    . ARG C 3 312 ? 67.455 85.721  23.280  1.00 59.39 ? 318  ARG A CA    1 
ATOM   2784 C  C     . ARG C 3 312 ? 65.945 85.510  23.384  1.00 58.81 ? 318  ARG A C     1 
ATOM   2785 O  O     . ARG C 3 312 ? 65.215 86.370  23.878  1.00 58.67 ? 318  ARG A O     1 
ATOM   2786 C  CB    . ARG C 3 312 ? 68.145 85.120  24.509  1.00 59.15 ? 318  ARG A CB    1 
ATOM   2787 N  N     . GLU C 3 313 ? 65.487 84.349  22.927  1.00 58.55 ? 319  GLU A N     1 
ATOM   2788 C  CA    . GLU C 3 313 ? 64.067 84.015  22.942  1.00 57.92 ? 319  GLU A CA    1 
ATOM   2789 C  C     . GLU C 3 313 ? 63.513 83.559  24.283  1.00 57.52 ? 319  GLU A C     1 
ATOM   2790 O  O     . GLU C 3 313 ? 62.297 83.564  24.483  1.00 57.51 ? 319  GLU A O     1 
ATOM   2791 C  CB    . GLU C 3 313 ? 63.777 82.925  21.914  1.00 58.72 ? 319  GLU A CB    1 
ATOM   2792 C  CG    . GLU C 3 313 ? 63.652 83.414  20.488  1.00 60.29 ? 319  GLU A CG    1 
ATOM   2793 C  CD    . GLU C 3 313 ? 63.426 82.272  19.517  1.00 61.89 ? 319  GLU A CD    1 
ATOM   2794 O  OE1   . GLU C 3 313 ? 62.991 82.535  18.375  1.00 61.74 ? 319  GLU A OE1   1 
ATOM   2795 O  OE2   . GLU C 3 313 ? 63.694 81.109  19.897  1.00 61.86 ? 319  GLU A OE2   1 
ATOM   2796 N  N     . TYR C 3 314 ? 64.386 83.166  25.203  1.00 56.58 ? 320  TYR A N     1 
ATOM   2797 C  CA    . TYR C 3 314 ? 63.913 82.682  26.490  1.00 55.47 ? 320  TYR A CA    1 
ATOM   2798 C  C     . TYR C 3 314 ? 64.125 83.610  27.674  1.00 54.56 ? 320  TYR A C     1 
ATOM   2799 O  O     . TYR C 3 314 ? 64.838 84.609  27.592  1.00 54.13 ? 320  TYR A O     1 
ATOM   2800 C  CB    . TYR C 3 314 ? 64.544 81.322  26.780  1.00 57.04 ? 320  TYR A CB    1 
ATOM   2801 C  CG    . TYR C 3 314 ? 64.279 80.309  25.692  1.00 58.25 ? 320  TYR A CG    1 
ATOM   2802 C  CD1   . TYR C 3 314 ? 62.975 79.946  25.357  1.00 59.51 ? 320  TYR A CD1   1 
ATOM   2803 C  CD2   . TYR C 3 314 ? 65.326 79.735  24.975  1.00 58.97 ? 320  TYR A CD2   1 
ATOM   2804 C  CE1   . TYR C 3 314 ? 62.718 79.039  24.332  1.00 59.88 ? 320  TYR A CE1   1 
ATOM   2805 C  CE2   . TYR C 3 314 ? 65.081 78.825  23.945  1.00 60.08 ? 320  TYR A CE2   1 
ATOM   2806 C  CZ    . TYR C 3 314 ? 63.774 78.482  23.629  1.00 60.66 ? 320  TYR A CZ    1 
ATOM   2807 O  OH    . TYR C 3 314 ? 63.517 77.591  22.609  1.00 60.96 ? 320  TYR A OH    1 
ATOM   2808 N  N     . VAL C 3 315 ? 63.470 83.266  28.775  1.00 53.78 ? 321  VAL A N     1 
ATOM   2809 C  CA    . VAL C 3 315 ? 63.563 84.022  30.014  1.00 53.79 ? 321  VAL A CA    1 
ATOM   2810 C  C     . VAL C 3 315 ? 63.534 83.017  31.167  1.00 53.74 ? 321  VAL A C     1 
ATOM   2811 O  O     . VAL C 3 315 ? 62.550 82.292  31.367  1.00 53.17 ? 321  VAL A O     1 
ATOM   2812 C  CB    . VAL C 3 315 ? 62.399 85.045  30.140  1.00 53.32 ? 321  VAL A CB    1 
ATOM   2813 C  CG1   . VAL C 3 315 ? 61.071 84.358  29.916  1.00 54.61 ? 321  VAL A CG1   1 
ATOM   2814 C  CG2   . VAL C 3 315 ? 62.431 85.709  31.504  1.00 52.90 ? 321  VAL A CG2   1 
ATOM   2815 N  N     . ALA C 3 316 ? 64.642 82.965  31.899  1.00 52.89 ? 322  ALA A N     1 
ATOM   2816 C  CA    . ALA C 3 316 ? 64.799 82.050  33.023  1.00 51.51 ? 322  ALA A CA    1 
ATOM   2817 C  C     . ALA C 3 316 ? 63.530 81.858  33.849  1.00 50.55 ? 322  ALA A C     1 
ATOM   2818 O  O     . ALA C 3 316 ? 62.916 82.826  34.305  1.00 50.79 ? 322  ALA A O     1 
ATOM   2819 C  CB    . ALA C 3 316 ? 65.939 82.532  33.921  1.00 51.42 ? 322  ALA A CB    1 
ATOM   2820 N  N     . GLY C 3 317 ? 63.138 80.601  34.033  1.00 49.57 ? 323  GLY A N     1 
ATOM   2821 C  CA    . GLY C 3 317 ? 61.960 80.306  34.829  1.00 48.11 ? 323  GLY A CA    1 
ATOM   2822 C  C     . GLY C 3 317 ? 60.628 80.294  34.105  1.00 47.44 ? 323  GLY A C     1 
ATOM   2823 O  O     . GLY C 3 317 ? 59.653 79.748  34.625  1.00 46.62 ? 323  GLY A O     1 
ATOM   2824 N  N     . ALA C 3 318 ? 60.567 80.903  32.923  1.00 46.38 ? 324  ALA A N     1 
ATOM   2825 C  CA    . ALA C 3 318 ? 59.322 80.928  32.160  1.00 45.22 ? 324  ALA A CA    1 
ATOM   2826 C  C     . ALA C 3 318 ? 59.262 79.660  31.307  1.00 43.94 ? 324  ALA A C     1 
ATOM   2827 O  O     . ALA C 3 318 ? 59.981 79.528  30.317  1.00 43.13 ? 324  ALA A O     1 
ATOM   2828 C  CB    . ALA C 3 318 ? 59.264 82.174  31.278  1.00 45.19 ? 324  ALA A CB    1 
ATOM   2829 N  N     . PRO C 3 319 ? 58.391 78.713  31.683  1.00 42.94 ? 325  PRO A N     1 
ATOM   2830 C  CA    . PRO C 3 319 ? 58.244 77.449  30.960  1.00 43.08 ? 325  PRO A CA    1 
ATOM   2831 C  C     . PRO C 3 319 ? 57.465 77.549  29.652  1.00 43.41 ? 325  PRO A C     1 
ATOM   2832 O  O     . PRO C 3 319 ? 56.678 78.474  29.447  1.00 43.04 ? 325  PRO A O     1 
ATOM   2833 C  CB    . PRO C 3 319 ? 57.527 76.574  31.972  1.00 42.64 ? 325  PRO A CB    1 
ATOM   2834 C  CG    . PRO C 3 319 ? 56.567 77.543  32.576  1.00 43.73 ? 325  PRO A CG    1 
ATOM   2835 C  CD    . PRO C 3 319 ? 57.435 78.780  32.805  1.00 43.59 ? 325  PRO A CD    1 
ATOM   2836 N  N     . TYR C 3 320 ? 57.690 76.573  28.780  1.00 43.61 ? 326  TYR A N     1 
ATOM   2837 C  CA    . TYR C 3 320 ? 57.005 76.501  27.498  1.00 43.73 ? 326  TYR A CA    1 
ATOM   2838 C  C     . TYR C 3 320 ? 56.986 75.050  27.048  1.00 43.02 ? 326  TYR A C     1 
ATOM   2839 O  O     . TYR C 3 320 ? 57.783 74.241  27.515  1.00 43.03 ? 326  TYR A O     1 
ATOM   2840 C  CB    . TYR C 3 320 ? 57.728 77.342  26.448  1.00 43.96 ? 326  TYR A CB    1 
ATOM   2841 C  CG    . TYR C 3 320 ? 59.105 76.835  26.095  1.00 44.62 ? 326  TYR A CG    1 
ATOM   2842 C  CD1   . TYR C 3 320 ? 60.189 77.035  26.953  1.00 45.35 ? 326  TYR A CD1   1 
ATOM   2843 C  CD2   . TYR C 3 320 ? 59.328 76.158  24.898  1.00 44.28 ? 326  TYR A CD2   1 
ATOM   2844 C  CE1   . TYR C 3 320 ? 61.465 76.573  26.623  1.00 44.68 ? 326  TYR A CE1   1 
ATOM   2845 C  CE2   . TYR C 3 320 ? 60.596 75.690  24.558  1.00 45.26 ? 326  TYR A CE2   1 
ATOM   2846 C  CZ    . TYR C 3 320 ? 61.658 75.900  25.422  1.00 45.57 ? 326  TYR A CZ    1 
ATOM   2847 O  OH    . TYR C 3 320 ? 62.908 75.432  25.084  1.00 45.65 ? 326  TYR A OH    1 
ATOM   2848 N  N     . THR C 3 321 ? 56.078 74.720  26.139  1.00 42.18 ? 327  THR A N     1 
ATOM   2849 C  CA    . THR C 3 321 ? 55.995 73.362  25.635  1.00 40.43 ? 327  THR A CA    1 
ATOM   2850 C  C     . THR C 3 321 ? 56.666 73.285  24.271  1.00 40.70 ? 327  THR A C     1 
ATOM   2851 O  O     . THR C 3 321 ? 56.211 73.904  23.311  1.00 40.84 ? 327  THR A O     1 
ATOM   2852 C  CB    . THR C 3 321 ? 54.537 72.899  25.485  1.00 40.23 ? 327  THR A CB    1 
ATOM   2853 O  OG1   . THR C 3 321 ? 53.852 73.028  26.739  1.00 39.87 ? 327  THR A OG1   1 
ATOM   2854 C  CG2   . THR C 3 321 ? 54.493 71.445  25.037  1.00 39.81 ? 327  THR A CG2   1 
ATOM   2855 N  N     . PRO C 3 322 ? 57.780 72.542  24.173  1.00 40.81 ? 328  PRO A N     1 
ATOM   2856 C  CA    . PRO C 3 322 ? 58.485 72.407  22.895  1.00 40.63 ? 328  PRO A CA    1 
ATOM   2857 C  C     . PRO C 3 322 ? 57.619 71.590  21.943  1.00 40.56 ? 328  PRO A C     1 
ATOM   2858 O  O     . PRO C 3 322 ? 57.016 70.594  22.345  1.00 40.62 ? 328  PRO A O     1 
ATOM   2859 C  CB    . PRO C 3 322 ? 59.778 71.688  23.287  1.00 41.10 ? 328  PRO A CB    1 
ATOM   2860 C  CG    . PRO C 3 322 ? 59.348 70.846  24.456  1.00 41.07 ? 328  PRO A CG    1 
ATOM   2861 C  CD    . PRO C 3 322 ? 58.477 71.807  25.244  1.00 41.21 ? 328  PRO A CD    1 
ATOM   2862 N  N     . VAL C 3 323 ? 57.552 72.014  20.686  1.00 40.38 ? 329  VAL A N     1 
ATOM   2863 C  CA    . VAL C 3 323 ? 56.726 71.329  19.698  1.00 40.83 ? 329  VAL A CA    1 
ATOM   2864 C  C     . VAL C 3 323 ? 57.407 71.188  18.341  1.00 41.68 ? 329  VAL A C     1 
ATOM   2865 O  O     . VAL C 3 323 ? 58.339 71.924  18.021  1.00 40.73 ? 329  VAL A O     1 
ATOM   2866 C  CB    . VAL C 3 323 ? 55.404 72.091  19.465  1.00 40.38 ? 329  VAL A CB    1 
ATOM   2867 C  CG1   . VAL C 3 323 ? 54.633 72.221  20.766  1.00 39.95 ? 329  VAL A CG1   1 
ATOM   2868 C  CG2   . VAL C 3 323 ? 55.703 73.463  18.881  1.00 39.36 ? 329  VAL A CG2   1 
ATOM   2869 N  N     . GLU C 3 324 ? 56.926 70.242  17.542  1.00 42.54 ? 330  GLU A N     1 
ATOM   2870 C  CA    . GLU C 3 324 ? 57.475 70.034  16.210  1.00 44.81 ? 330  GLU A CA    1 
ATOM   2871 C  C     . GLU C 3 324 ? 56.351 70.070  15.170  1.00 44.84 ? 330  GLU A C     1 
ATOM   2872 O  O     . GLU C 3 324 ? 55.218 69.668  15.442  1.00 44.05 ? 330  GLU A O     1 
ATOM   2873 C  CB    . GLU C 3 324 ? 58.222 68.697  16.133  1.00 46.96 ? 330  GLU A CB    1 
ATOM   2874 C  CG    . GLU C 3 324 ? 57.344 67.462  16.208  1.00 50.48 ? 330  GLU A CG    1 
ATOM   2875 C  CD    . GLU C 3 324 ? 58.136 66.182  15.992  1.00 53.94 ? 330  GLU A CD    1 
ATOM   2876 O  OE1   . GLU C 3 324 ? 58.841 66.085  14.963  1.00 56.33 ? 330  GLU A OE1   1 
ATOM   2877 O  OE2   . GLU C 3 324 ? 58.054 65.272  16.845  1.00 54.84 ? 330  GLU A OE2   1 
ATOM   2878 N  N     . HIS C 3 325 ? 56.668 70.566  13.981  1.00 45.90 ? 331  HIS A N     1 
ATOM   2879 C  CA    . HIS C 3 325 ? 55.680 70.653  12.917  1.00 46.86 ? 331  HIS A CA    1 
ATOM   2880 C  C     . HIS C 3 325 ? 55.538 69.285  12.257  1.00 47.14 ? 331  HIS A C     1 
ATOM   2881 O  O     . HIS C 3 325 ? 56.532 68.632  11.941  1.00 46.25 ? 331  HIS A O     1 
ATOM   2882 C  CB    . HIS C 3 325 ? 56.116 71.683  11.876  1.00 48.42 ? 331  HIS A CB    1 
ATOM   2883 C  CG    . HIS C 3 325 ? 54.998 72.176  11.011  1.00 49.83 ? 331  HIS A CG    1 
ATOM   2884 N  ND1   . HIS C 3 325 ? 55.210 72.746  9.775   1.00 50.37 ? 331  HIS A ND1   1 
ATOM   2885 C  CD2   . HIS C 3 325 ? 53.660 72.224  11.224  1.00 50.33 ? 331  HIS A CD2   1 
ATOM   2886 C  CE1   . HIS C 3 325 ? 54.053 73.127  9.263   1.00 50.99 ? 331  HIS A CE1   1 
ATOM   2887 N  NE2   . HIS C 3 325 ? 53.097 72.822  10.122  1.00 50.09 ? 331  HIS A NE2   1 
ATOM   2888 N  N     . VAL C 3 326 ? 54.304 68.849  12.050  1.00 47.61 ? 332  VAL A N     1 
ATOM   2889 C  CA    . VAL C 3 326 ? 54.074 67.551  11.434  1.00 48.19 ? 332  VAL A CA    1 
ATOM   2890 C  C     . VAL C 3 326 ? 53.153 67.630  10.228  1.00 47.60 ? 332  VAL A C     1 
ATOM   2891 O  O     . VAL C 3 326 ? 52.094 68.254  10.277  1.00 47.61 ? 332  VAL A O     1 
ATOM   2892 C  CB    . VAL C 3 326 ? 53.482 66.562  12.449  1.00 49.08 ? 332  VAL A CB    1 
ATOM   2893 C  CG1   . VAL C 3 326 ? 52.321 67.203  13.167  1.00 51.74 ? 332  VAL A CG1   1 
ATOM   2894 C  CG2   . VAL C 3 326 ? 53.033 65.296  11.742  1.00 50.26 ? 332  VAL A CG2   1 
ATOM   2895 N  N     . VAL C 3 327 ? 53.572 66.981  9.146   1.00 46.53 ? 333  VAL A N     1 
ATOM   2896 C  CA    . VAL C 3 327 ? 52.815 66.955  7.905   1.00 45.39 ? 333  VAL A CA    1 
ATOM   2897 C  C     . VAL C 3 327 ? 52.012 65.666  7.820   1.00 45.03 ? 333  VAL A C     1 
ATOM   2898 O  O     . VAL C 3 327 ? 52.488 64.607  8.225   1.00 46.18 ? 333  VAL A O     1 
ATOM   2899 C  CB    . VAL C 3 327 ? 53.759 67.041  6.693   1.00 46.65 ? 333  VAL A CB    1 
ATOM   2900 C  CG1   . VAL C 3 327 ? 52.960 67.008  5.398   1.00 47.27 ? 333  VAL A CG1   1 
ATOM   2901 C  CG2   . VAL C 3 327 ? 54.588 68.312  6.779   1.00 46.74 ? 333  VAL A CG2   1 
ATOM   2902 N  N     . PHE C 3 328 ? 50.792 65.759  7.298   1.00 42.76 ? 334  PHE A N     1 
ATOM   2903 C  CA    . PHE C 3 328 ? 49.922 64.597  7.159   1.00 41.69 ? 334  PHE A CA    1 
ATOM   2904 C  C     . PHE C 3 328 ? 50.631 63.478  6.396   1.00 41.33 ? 334  PHE A C     1 
ATOM   2905 O  O     . PHE C 3 328 ? 51.194 63.707  5.325   1.00 40.35 ? 334  PHE A O     1 
ATOM   2906 C  CB    . PHE C 3 328 ? 48.643 64.988  6.415   1.00 40.53 ? 334  PHE A CB    1 
ATOM   2907 C  CG    . PHE C 3 328 ? 47.684 63.848  6.209   1.00 39.99 ? 334  PHE A CG    1 
ATOM   2908 C  CD1   . PHE C 3 328 ? 46.956 63.329  7.274   1.00 40.29 ? 334  PHE A CD1   1 
ATOM   2909 C  CD2   . PHE C 3 328 ? 47.502 63.297  4.941   1.00 39.37 ? 334  PHE A CD2   1 
ATOM   2910 C  CE1   . PHE C 3 328 ? 46.056 62.276  7.079   1.00 39.24 ? 334  PHE A CE1   1 
ATOM   2911 C  CE2   . PHE C 3 328 ? 46.611 62.249  4.737   1.00 38.49 ? 334  PHE A CE2   1 
ATOM   2912 C  CZ    . PHE C 3 328 ? 45.886 61.737  5.806   1.00 38.92 ? 334  PHE A CZ    1 
ATOM   2913 N  N     . ASN C 3 329 ? 50.599 62.272  6.955   1.00 42.20 ? 335  ASN A N     1 
ATOM   2914 C  CA    . ASN C 3 329 ? 51.226 61.103  6.333   1.00 41.54 ? 335  ASN A CA    1 
ATOM   2915 C  C     . ASN C 3 329 ? 50.135 60.076  6.074   1.00 41.28 ? 335  ASN A C     1 
ATOM   2916 O  O     . ASN C 3 329 ? 49.600 59.480  7.008   1.00 42.26 ? 335  ASN A O     1 
ATOM   2917 C  CB    . ASN C 3 329 ? 52.278 60.497  7.264   1.00 42.83 ? 335  ASN A CB    1 
ATOM   2918 C  CG    . ASN C 3 329 ? 53.073 59.375  6.603   1.00 43.03 ? 335  ASN A CG    1 
ATOM   2919 O  OD1   . ASN C 3 329 ? 52.677 58.837  5.564   1.00 41.14 ? 335  ASN A OD1   1 
ATOM   2920 N  ND2   . ASN C 3 329 ? 54.196 59.012  7.215   1.00 40.41 ? 335  ASN A ND2   1 
ATOM   2921 N  N     . PRO C 3 330 ? 49.791 59.850  4.799   1.00 40.82 ? 336  PRO A N     1 
ATOM   2922 C  CA    . PRO C 3 330 ? 48.747 58.884  4.442   1.00 41.80 ? 336  PRO A CA    1 
ATOM   2923 C  C     . PRO C 3 330 ? 49.028 57.456  4.924   1.00 41.84 ? 336  PRO A C     1 
ATOM   2924 O  O     . PRO C 3 330 ? 48.115 56.637  5.014   1.00 41.35 ? 336  PRO A O     1 
ATOM   2925 C  CB    . PRO C 3 330 ? 48.690 58.983  2.916   1.00 41.76 ? 336  PRO A CB    1 
ATOM   2926 C  CG    . PRO C 3 330 ? 49.180 60.383  2.640   1.00 41.30 ? 336  PRO A CG    1 
ATOM   2927 C  CD    . PRO C 3 330 ? 50.336 60.497  3.596   1.00 40.31 ? 336  PRO A CD    1 
ATOM   2928 N  N     . SER C 3 331 ? 50.289 57.160  5.227   1.00 41.86 ? 337  SER A N     1 
ATOM   2929 C  CA    . SER C 3 331 ? 50.652 55.827  5.698   1.00 43.92 ? 337  SER A CA    1 
ATOM   2930 C  C     . SER C 3 331 ? 50.504 55.679  7.208   1.00 45.35 ? 337  SER A C     1 
ATOM   2931 O  O     . SER C 3 331 ? 50.542 54.566  7.728   1.00 45.90 ? 337  SER A O     1 
ATOM   2932 C  CB    . SER C 3 331 ? 52.088 55.485  5.295   1.00 41.98 ? 337  SER A CB    1 
ATOM   2933 O  OG    . SER C 3 331 ? 52.186 55.287  3.900   1.00 41.87 ? 337  SER A OG    1 
ATOM   2934 N  N     . SER C 3 332 ? 50.341 56.794  7.913   1.00 45.65 ? 338  SER A N     1 
ATOM   2935 C  CA    . SER C 3 332 ? 50.191 56.743  9.362   1.00 46.46 ? 338  SER A CA    1 
ATOM   2936 C  C     . SER C 3 332 ? 48.740 56.567  9.778   1.00 46.47 ? 338  SER A C     1 
ATOM   2937 O  O     . SER C 3 332 ? 47.909 57.440  9.536   1.00 46.94 ? 338  SER A O     1 
ATOM   2938 C  CB    . SER C 3 332 ? 50.742 58.015  10.005  1.00 47.60 ? 338  SER A CB    1 
ATOM   2939 O  OG    . SER C 3 332 ? 50.379 58.069  11.377  1.00 47.96 ? 338  SER A OG    1 
ATOM   2940 N  N     . ARG C 3 333 ? 48.447 55.435  10.410  1.00 47.31 ? 339  ARG A N     1 
ATOM   2941 C  CA    . ARG C 3 333 ? 47.101 55.128  10.882  1.00 47.95 ? 339  ARG A CA    1 
ATOM   2942 C  C     . ARG C 3 333 ? 46.722 56.117  11.985  1.00 47.65 ? 339  ARG A C     1 
ATOM   2943 O  O     . ARG C 3 333 ? 45.542 56.385  12.214  1.00 47.91 ? 339  ARG A O     1 
ATOM   2944 C  CB    . ARG C 3 333 ? 47.054 53.706  11.446  1.00 50.60 ? 339  ARG A CB    1 
ATOM   2945 C  CG    . ARG C 3 333 ? 47.630 52.628  10.530  1.00 52.13 ? 339  ARG A CG    1 
ATOM   2946 C  CD    . ARG C 3 333 ? 46.653 52.215  9.449   1.00 53.55 ? 339  ARG A CD    1 
ATOM   2947 N  NE    . ARG C 3 333 ? 47.249 51.250  8.529   1.00 54.17 ? 339  ARG A NE    1 
ATOM   2948 C  CZ    . ARG C 3 333 ? 46.578 50.613  7.575   1.00 55.51 ? 339  ARG A CZ    1 
ATOM   2949 N  NH1   . ARG C 3 333 ? 45.279 50.832  7.415   1.00 55.35 ? 339  ARG A NH1   1 
ATOM   2950 N  NH2   . ARG C 3 333 ? 47.207 49.766  6.771   1.00 56.76 ? 339  ARG A NH2   1 
ATOM   2951 N  N     . ASP C 3 334 ? 47.731 56.646  12.674  1.00 47.79 ? 340  ASP A N     1 
ATOM   2952 C  CA    . ASP C 3 334 ? 47.506 57.611  13.747  1.00 47.26 ? 340  ASP A CA    1 
ATOM   2953 C  C     . ASP C 3 334 ? 47.020 58.932  13.146  1.00 45.40 ? 340  ASP A C     1 
ATOM   2954 O  O     . ASP C 3 334 ? 46.072 59.536  13.642  1.00 45.82 ? 340  ASP A O     1 
ATOM   2955 C  CB    . ASP C 3 334 ? 48.799 57.836  14.538  1.00 49.08 ? 340  ASP A CB    1 
ATOM   2956 C  CG    . ASP C 3 334 ? 48.618 58.807  15.703  1.00 52.49 ? 340  ASP A CG    1 
ATOM   2957 O  OD1   . ASP C 3 334 ? 47.725 58.571  16.545  1.00 52.62 ? 340  ASP A OD1   1 
ATOM   2958 O  OD2   . ASP C 3 334 ? 49.375 59.802  15.780  1.00 54.06 ? 340  ASP A OD2   1 
ATOM   2959 N  N     . HIS C 3 335 ? 47.668 59.366  12.069  1.00 42.83 ? 341  HIS A N     1 
ATOM   2960 C  CA    . HIS C 3 335 ? 47.294 60.605  11.398  1.00 40.87 ? 341  HIS A CA    1 
ATOM   2961 C  C     . HIS C 3 335 ? 45.904 60.524  10.790  1.00 41.99 ? 341  HIS A C     1 
ATOM   2962 O  O     . HIS C 3 335 ? 45.116 61.466  10.889  1.00 42.50 ? 341  HIS A O     1 
ATOM   2963 C  CB    . HIS C 3 335 ? 48.298 60.944  10.301  1.00 37.01 ? 341  HIS A CB    1 
ATOM   2964 C  CG    . HIS C 3 335 ? 49.627 61.393  10.817  1.00 32.92 ? 341  HIS A CG    1 
ATOM   2965 N  ND1   . HIS C 3 335 ? 50.560 62.019  10.019  1.00 31.48 ? 341  HIS A ND1   1 
ATOM   2966 C  CD2   . HIS C 3 335 ? 50.176 61.322  12.053  1.00 32.64 ? 341  HIS A CD2   1 
ATOM   2967 C  CE1   . HIS C 3 335 ? 51.625 62.319  10.741  1.00 31.62 ? 341  HIS A CE1   1 
ATOM   2968 N  NE2   . HIS C 3 335 ? 51.418 61.906  11.979  1.00 32.69 ? 341  HIS A NE2   1 
ATOM   2969 N  N     . ILE C 3 336 ? 45.609 59.396  10.152  1.00 42.72 ? 342  ILE A N     1 
ATOM   2970 C  CA    . ILE C 3 336 ? 44.312 59.194  9.522   1.00 42.98 ? 342  ILE A CA    1 
ATOM   2971 C  C     . ILE C 3 336 ? 43.228 59.262  10.585  1.00 44.19 ? 342  ILE A C     1 
ATOM   2972 O  O     . ILE C 3 336 ? 42.227 59.963  10.426  1.00 45.21 ? 342  ILE A O     1 
ATOM   2973 C  CB    . ILE C 3 336 ? 44.241 57.826  8.822   1.00 41.49 ? 342  ILE A CB    1 
ATOM   2974 C  CG1   . ILE C 3 336 ? 45.356 57.718  7.779   1.00 41.27 ? 342  ILE A CG1   1 
ATOM   2975 C  CG2   . ILE C 3 336 ? 42.889 57.655  8.149   1.00 41.24 ? 342  ILE A CG2   1 
ATOM   2976 C  CD1   . ILE C 3 336 ? 45.576 56.308  7.278   1.00 38.11 ? 342  ILE A CD1   1 
ATOM   2977 N  N     . GLN C 3 337 ? 43.437 58.526  11.669  1.00 43.98 ? 343  GLN A N     1 
ATOM   2978 C  CA    . GLN C 3 337 ? 42.492 58.500  12.773  1.00 44.14 ? 343  GLN A CA    1 
ATOM   2979 C  C     . GLN C 3 337 ? 42.305 59.909  13.343  1.00 44.83 ? 343  GLN A C     1 
ATOM   2980 O  O     . GLN C 3 337 ? 41.189 60.328  13.635  1.00 44.10 ? 343  GLN A O     1 
ATOM   2981 C  CB    . GLN C 3 337 ? 42.998 57.540  13.854  1.00 45.46 ? 343  GLN A CB    1 
ATOM   2982 C  CG    . GLN C 3 337 ? 42.325 57.681  15.198  1.00 47.52 ? 343  GLN A CG    1 
ATOM   2983 C  CD    . GLN C 3 337 ? 42.850 58.868  15.984  1.00 48.14 ? 343  GLN A CD    1 
ATOM   2984 O  OE1   . GLN C 3 337 ? 44.026 58.913  16.354  1.00 48.62 ? 343  GLN A OE1   1 
ATOM   2985 N  NE2   . GLN C 3 337 ? 41.980 59.840  16.238  1.00 47.96 ? 343  GLN A NE2   1 
ATOM   2986 N  N     . LYS C 3 338 ? 43.403 60.639  13.492  1.00 43.97 ? 344  LYS A N     1 
ATOM   2987 C  CA    . LYS C 3 338 ? 43.335 61.988  14.027  1.00 46.09 ? 344  LYS A CA    1 
ATOM   2988 C  C     . LYS C 3 338 ? 42.486 62.904  13.136  1.00 47.41 ? 344  LYS A C     1 
ATOM   2989 O  O     . LYS C 3 338 ? 41.588 63.601  13.620  1.00 47.60 ? 344  LYS A O     1 
ATOM   2990 C  CB    . LYS C 3 338 ? 44.750 62.560  14.172  1.00 46.29 ? 344  LYS A CB    1 
ATOM   2991 C  CG    . LYS C 3 338 ? 44.816 63.933  14.829  1.00 47.40 ? 344  LYS A CG    1 
ATOM   2992 C  CD    . LYS C 3 338 ? 46.255 64.396  15.002  1.00 47.98 ? 344  LYS A CD    1 
ATOM   2993 C  CE    . LYS C 3 338 ? 46.321 65.720  15.749  1.00 51.16 ? 344  LYS A CE    1 
ATOM   2994 N  NZ    . LYS C 3 338 ? 45.661 65.625  17.090  1.00 51.47 ? 344  LYS A NZ    1 
ATOM   2995 N  N     . LYS C 3 339 ? 42.758 62.885  11.834  1.00 47.28 ? 345  LYS A N     1 
ATOM   2996 C  CA    . LYS C 3 339 ? 42.033 63.733  10.892  1.00 47.05 ? 345  LYS A CA    1 
ATOM   2997 C  C     . LYS C 3 339 ? 40.563 63.391  10.673  1.00 47.15 ? 345  LYS A C     1 
ATOM   2998 O  O     . LYS C 3 339 ? 39.743 64.287  10.467  1.00 47.87 ? 345  LYS A O     1 
ATOM   2999 C  CB    . LYS C 3 339 ? 42.754 63.747  9.544   1.00 45.60 ? 345  LYS A CB    1 
ATOM   3000 C  CG    . LYS C 3 339 ? 44.072 64.502  9.553   1.00 45.53 ? 345  LYS A CG    1 
ATOM   3001 C  CD    . LYS C 3 339 ? 43.851 65.988  9.797   1.00 46.08 ? 345  LYS A CD    1 
ATOM   3002 C  CE    . LYS C 3 339 ? 45.155 66.766  9.717   1.00 47.57 ? 345  LYS A CE    1 
ATOM   3003 N  NZ    . LYS C 3 339 ? 44.961 68.245  9.818   1.00 49.23 ? 345  LYS A NZ    1 
ATOM   3004 N  N     . LEU C 3 340 ? 40.221 62.108  10.714  1.00 47.60 ? 346  LEU A N     1 
ATOM   3005 C  CA    . LEU C 3 340 ? 38.836 61.705  10.494  1.00 48.43 ? 346  LEU A CA    1 
ATOM   3006 C  C     . LEU C 3 340 ? 37.889 61.961  11.669  1.00 50.05 ? 346  LEU A C     1 
ATOM   3007 O  O     . LEU C 3 340 ? 36.727 62.311  11.460  1.00 51.18 ? 346  LEU A O     1 
ATOM   3008 C  CB    . LEU C 3 340 ? 38.765 60.229  10.083  1.00 46.82 ? 346  LEU A CB    1 
ATOM   3009 C  CG    . LEU C 3 340 ? 39.457 59.864  8.762   1.00 45.25 ? 346  LEU A CG    1 
ATOM   3010 C  CD1   . LEU C 3 340 ? 39.044 58.461  8.336   1.00 42.09 ? 346  LEU A CD1   1 
ATOM   3011 C  CD2   . LEU C 3 340 ? 39.079 60.872  7.689   1.00 43.85 ? 346  LEU A CD2   1 
ATOM   3012 N  N     . GLN C 3 341 ? 38.360 61.776  12.899  1.00 51.38 ? 347  GLN A N     1 
ATOM   3013 C  CA    . GLN C 3 341 ? 37.493 62.026  14.046  1.00 52.27 ? 347  GLN A CA    1 
ATOM   3014 C  C     . GLN C 3 341 ? 37.180 63.516  14.098  1.00 53.16 ? 347  GLN A C     1 
ATOM   3015 O  O     . GLN C 3 341 ? 36.070 63.920  14.452  1.00 53.94 ? 347  GLN A O     1 
ATOM   3016 C  CB    . GLN C 3 341 ? 38.160 61.568  15.348  1.00 53.19 ? 347  GLN A CB    1 
ATOM   3017 C  CG    . GLN C 3 341 ? 38.039 60.070  15.594  1.00 54.13 ? 347  GLN A CG    1 
ATOM   3018 C  CD    . GLN C 3 341 ? 38.473 59.662  16.990  1.00 55.29 ? 347  GLN A CD    1 
ATOM   3019 O  OE1   . GLN C 3 341 ? 39.659 59.682  17.320  1.00 54.99 ? 347  GLN A OE1   1 
ATOM   3020 N  NE2   . GLN C 3 341 ? 37.504 59.294  17.823  1.00 55.63 ? 347  GLN A NE2   1 
ATOM   3021 N  N     . GLU C 3 342 ? 38.164 64.326  13.720  1.00 52.45 ? 348  GLU A N     1 
ATOM   3022 C  CA    . GLU C 3 342 ? 38.011 65.773  13.692  1.00 52.37 ? 348  GLU A CA    1 
ATOM   3023 C  C     . GLU C 3 342 ? 37.073 66.160  12.556  1.00 52.56 ? 348  GLU A C     1 
ATOM   3024 O  O     . GLU C 3 342 ? 36.869 67.343  12.287  1.00 52.70 ? 348  GLU A O     1 
ATOM   3025 C  CB    . GLU C 3 342 ? 39.363 66.447  13.464  1.00 51.58 ? 348  GLU A CB    1 
ATOM   3026 C  CG    . GLU C 3 342 ? 40.403 66.163  14.522  1.00 53.43 ? 348  GLU A CG    1 
ATOM   3027 C  CD    . GLU C 3 342 ? 41.732 66.820  14.203  1.00 54.55 ? 348  GLU A CD    1 
ATOM   3028 O  OE1   . GLU C 3 342 ? 42.683 66.676  15.003  1.00 55.50 ? 348  GLU A OE1   1 
ATOM   3029 O  OE2   . GLU C 3 342 ? 41.825 67.483  13.147  1.00 54.79 ? 348  GLU A OE2   1 
ATOM   3030 N  N     . ALA C 3 343 ? 36.515 65.159  11.884  1.00 52.61 ? 349  ALA A N     1 
ATOM   3031 C  CA    . ALA C 3 343 ? 35.598 65.394  10.773  1.00 52.70 ? 349  ALA A CA    1 
ATOM   3032 C  C     . ALA C 3 343 ? 34.194 64.911  11.125  1.00 52.86 ? 349  ALA A C     1 
ATOM   3033 O  O     . ALA C 3 343 ? 33.237 65.167  10.393  1.00 53.16 ? 349  ALA A O     1 
ATOM   3034 C  CB    . ALA C 3 343 ? 36.098 64.684  9.526   1.00 52.09 ? 349  ALA A CB    1 
ATOM   3035 N  N     . GLY C 3 344 ? 34.077 64.205  12.246  1.00 52.93 ? 350  GLY A N     1 
ATOM   3036 C  CA    . GLY C 3 344 ? 32.779 63.712  12.671  1.00 53.61 ? 350  GLY A CA    1 
ATOM   3037 C  C     . GLY C 3 344 ? 32.648 62.203  12.651  1.00 54.26 ? 350  GLY A C     1 
ATOM   3038 O  O     . GLY C 3 344 ? 31.536 61.671  12.671  1.00 54.89 ? 350  GLY A O     1 
ATOM   3039 N  N     . TRP C 3 345 ? 33.778 61.504  12.605  1.00 53.89 ? 351  TRP A N     1 
ATOM   3040 C  CA    . TRP C 3 345 ? 33.754 60.050  12.593  1.00 53.12 ? 351  TRP A CA    1 
ATOM   3041 C  C     . TRP C 3 345 ? 33.783 59.521  14.018  1.00 53.30 ? 351  TRP A C     1 
ATOM   3042 O  O     . TRP C 3 345 ? 34.635 59.909  14.817  1.00 52.30 ? 351  TRP A O     1 
ATOM   3043 C  CB    . TRP C 3 345 ? 34.950 59.502  11.806  1.00 53.81 ? 351  TRP A CB    1 
ATOM   3044 C  CG    . TRP C 3 345 ? 35.152 58.025  11.980  1.00 52.68 ? 351  TRP A CG    1 
ATOM   3045 C  CD1   . TRP C 3 345 ? 34.212 57.045  11.832  1.00 52.68 ? 351  TRP A CD1   1 
ATOM   3046 C  CD2   . TRP C 3 345 ? 36.363 57.365  12.371  1.00 52.39 ? 351  TRP A CD2   1 
ATOM   3047 N  NE1   . TRP C 3 345 ? 34.761 55.816  12.112  1.00 52.51 ? 351  TRP A NE1   1 
ATOM   3048 C  CE2   . TRP C 3 345 ? 36.079 55.983  12.446  1.00 52.23 ? 351  TRP A CE2   1 
ATOM   3049 C  CE3   . TRP C 3 345 ? 37.661 57.808  12.667  1.00 51.78 ? 351  TRP A CE3   1 
ATOM   3050 C  CZ2   . TRP C 3 345 ? 37.046 55.038  12.807  1.00 52.88 ? 351  TRP A CZ2   1 
ATOM   3051 C  CZ3   . TRP C 3 345 ? 38.621 56.871  13.025  1.00 52.46 ? 351  TRP A CZ3   1 
ATOM   3052 C  CH2   . TRP C 3 345 ? 38.307 55.499  13.092  1.00 53.23 ? 351  TRP A CH2   1 
ATOM   3053 N  N     . VAL C 3 346 ? 32.845 58.635  14.333  1.00 53.61 ? 352  VAL A N     1 
ATOM   3054 C  CA    . VAL C 3 346 ? 32.771 58.053  15.665  1.00 55.90 ? 352  VAL A CA    1 
ATOM   3055 C  C     . VAL C 3 346 ? 33.303 56.623  15.663  1.00 57.00 ? 352  VAL A C     1 
ATOM   3056 O  O     . VAL C 3 346 ? 32.615 55.697  15.227  1.00 57.73 ? 352  VAL A O     1 
ATOM   3057 C  CB    . VAL C 3 346 ? 31.320 58.037  16.185  1.00 56.39 ? 352  VAL A CB    1 
ATOM   3058 N  N     . PRO C 3 347 ? 34.537 56.422  16.154  1.00 57.91 ? 353  PRO A N     1 
ATOM   3059 C  CA    . PRO C 3 347 ? 35.151 55.089  16.202  1.00 59.39 ? 353  PRO A CA    1 
ATOM   3060 C  C     . PRO C 3 347 ? 34.257 54.053  16.885  1.00 60.44 ? 353  PRO A C     1 
ATOM   3061 O  O     . PRO C 3 347 ? 33.857 54.226  18.038  1.00 61.27 ? 353  PRO A O     1 
ATOM   3062 C  CB    . PRO C 3 347 ? 36.446 55.335  16.973  1.00 59.27 ? 353  PRO A CB    1 
ATOM   3063 C  CG    . PRO C 3 347 ? 36.793 56.737  16.594  1.00 58.73 ? 353  PRO A CG    1 
ATOM   3064 C  CD    . PRO C 3 347 ? 35.456 57.438  16.696  1.00 58.17 ? 353  PRO A CD    1 
ATOM   3065 N  N     . THR C 3 348 ? 33.949 52.978  16.167  1.00 61.05 ? 354  THR A N     1 
ATOM   3066 C  CA    . THR C 3 348 ? 33.100 51.914  16.695  1.00 61.22 ? 354  THR A CA    1 
ATOM   3067 C  C     . THR C 3 348 ? 33.914 50.760  17.285  1.00 61.82 ? 354  THR A C     1 
ATOM   3068 O  O     . THR C 3 348 ? 33.523 50.162  18.289  1.00 61.86 ? 354  THR A O     1 
ATOM   3069 C  CB    . THR C 3 348 ? 32.169 51.356  15.593  1.00 61.07 ? 354  THR A CB    1 
ATOM   3070 O  OG1   . THR C 3 348 ? 31.215 52.359  15.221  1.00 61.64 ? 354  THR A OG1   1 
ATOM   3071 C  CG2   . THR C 3 348 ? 31.430 50.109  16.083  1.00 61.08 ? 354  THR A CG2   1 
ATOM   3072 N  N     . LYS C 3 349 ? 35.044 50.452  16.660  1.00 61.91 ? 355  LYS A N     1 
ATOM   3073 C  CA    . LYS C 3 349 ? 35.896 49.364  17.123  1.00 62.08 ? 355  LYS A CA    1 
ATOM   3074 C  C     . LYS C 3 349 ? 37.320 49.830  17.399  1.00 61.96 ? 355  LYS A C     1 
ATOM   3075 O  O     . LYS C 3 349 ? 37.933 50.511  16.577  1.00 62.89 ? 355  LYS A O     1 
ATOM   3076 C  CB    . LYS C 3 349 ? 35.902 48.241  16.082  1.00 61.46 ? 355  LYS A CB    1 
ATOM   3077 C  CG    . LYS C 3 349 ? 36.247 48.710  14.675  1.00 61.87 ? 355  LYS A CG    1 
ATOM   3078 C  CD    . LYS C 3 349 ? 35.888 47.666  13.623  1.00 61.88 ? 355  LYS A CD    1 
ATOM   3079 C  CE    . LYS C 3 349 ? 36.671 46.377  13.806  1.00 62.28 ? 355  LYS A CE    1 
ATOM   3080 N  NZ    . LYS C 3 349 ? 36.298 45.364  12.781  1.00 62.68 ? 355  LYS A NZ    1 
ATOM   3081 N  N     . TYR C 3 350 ? 37.836 49.469  18.570  1.00 61.88 ? 356  TYR A N     1 
ATOM   3082 C  CA    . TYR C 3 350 ? 39.193 49.836  18.955  1.00 62.36 ? 356  TYR A CA    1 
ATOM   3083 C  C     . TYR C 3 350 ? 40.038 48.575  19.076  1.00 62.94 ? 356  TYR A C     1 
ATOM   3084 O  O     . TYR C 3 350 ? 39.528 47.463  18.942  1.00 62.59 ? 356  TYR A O     1 
ATOM   3085 C  CB    . TYR C 3 350 ? 39.193 50.585  20.293  1.00 62.40 ? 356  TYR A CB    1 
ATOM   3086 C  CG    . TYR C 3 350 ? 38.520 51.941  20.251  1.00 62.47 ? 356  TYR A CG    1 
ATOM   3087 C  CD1   . TYR C 3 350 ? 37.153 52.058  19.995  1.00 62.54 ? 356  TYR A CD1   1 
ATOM   3088 C  CD2   . TYR C 3 350 ? 39.253 53.110  20.467  1.00 62.65 ? 356  TYR A CD2   1 
ATOM   3089 C  CE1   . TYR C 3 350 ? 36.531 53.307  19.955  1.00 62.29 ? 356  TYR A CE1   1 
ATOM   3090 C  CE2   . TYR C 3 350 ? 38.640 54.364  20.429  1.00 62.32 ? 356  TYR A CE2   1 
ATOM   3091 C  CZ    . TYR C 3 350 ? 37.280 54.453  20.172  1.00 62.26 ? 356  TYR A CZ    1 
ATOM   3092 O  OH    . TYR C 3 350 ? 36.671 55.686  20.133  1.00 61.91 ? 356  TYR A OH    1 
ATOM   3093 N  N     . THR C 3 351 ? 41.331 48.751  19.319  1.00 63.71 ? 357  THR A N     1 
ATOM   3094 C  CA    . THR C 3 351 ? 42.239 47.621  19.457  1.00 64.53 ? 357  THR A CA    1 
ATOM   3095 C  C     . THR C 3 351 ? 42.406 47.263  20.930  1.00 65.28 ? 357  THR A C     1 
ATOM   3096 O  O     . THR C 3 351 ? 41.851 47.929  21.807  1.00 65.64 ? 357  THR A O     1 
ATOM   3097 C  CB    . THR C 3 351 ? 43.628 47.948  18.868  1.00 64.29 ? 357  THR A CB    1 
ATOM   3098 O  OG1   . THR C 3 351 ? 44.190 49.070  19.559  1.00 64.46 ? 357  THR A OG1   1 
ATOM   3099 C  CG2   . THR C 3 351 ? 43.514 48.279  17.387  1.00 64.20 ? 357  THR A CG2   1 
ATOM   3100 N  N     . ASP C 3 352 ? 43.165 46.203  21.194  1.00 65.74 ? 358  ASP A N     1 
ATOM   3101 C  CA    . ASP C 3 352 ? 43.416 45.764  22.561  1.00 65.75 ? 358  ASP A CA    1 
ATOM   3102 C  C     . ASP C 3 352 ? 44.351 46.756  23.249  1.00 65.60 ? 358  ASP A C     1 
ATOM   3103 O  O     . ASP C 3 352 ? 44.145 47.115  24.410  1.00 65.40 ? 358  ASP A O     1 
ATOM   3104 C  CB    . ASP C 3 352 ? 44.049 44.369  22.565  1.00 65.72 ? 358  ASP A CB    1 
ATOM   3105 N  N     . LYS C 3 353 ? 45.377 47.201  22.529  1.00 65.32 ? 359  LYS A N     1 
ATOM   3106 C  CA    . LYS C 3 353 ? 46.329 48.156  23.084  1.00 65.23 ? 359  LYS A CA    1 
ATOM   3107 C  C     . LYS C 3 353 ? 45.673 49.530  23.203  1.00 65.29 ? 359  LYS A C     1 
ATOM   3108 O  O     . LYS C 3 353 ? 46.352 50.545  23.385  1.00 64.77 ? 359  LYS A O     1 
ATOM   3109 C  CB    . LYS C 3 353 ? 47.571 48.257  22.196  1.00 65.07 ? 359  LYS A CB    1 
ATOM   3110 C  CG    . LYS C 3 353 ? 48.728 49.002  22.853  1.00 65.81 ? 359  LYS A CG    1 
ATOM   3111 C  CD    . LYS C 3 353 ? 49.858 49.263  21.874  1.00 65.99 ? 359  LYS A CD    1 
ATOM   3112 C  CE    . LYS C 3 353 ? 51.068 49.868  22.572  1.00 66.36 ? 359  LYS A CE    1 
ATOM   3113 N  NZ    . LYS C 3 353 ? 51.668 48.917  23.553  1.00 66.60 ? 359  LYS A NZ    1 
ATOM   3114 N  N     . GLY C 3 354 ? 44.348 49.553  23.099  1.00 64.91 ? 360  GLY A N     1 
ATOM   3115 C  CA    . GLY C 3 354 ? 43.619 50.803  23.197  1.00 65.06 ? 360  GLY A CA    1 
ATOM   3116 C  C     . GLY C 3 354 ? 44.019 51.769  22.100  1.00 65.27 ? 360  GLY A C     1 
ATOM   3117 O  O     . GLY C 3 354 ? 45.033 52.464  22.215  1.00 66.51 ? 360  GLY A O     1 
ATOM   3118 N  N     . ALA C 3 355 ? 43.220 51.808  21.036  1.00 63.75 ? 361  ALA A N     1 
ATOM   3119 C  CA    . ALA C 3 355 ? 43.478 52.683  19.897  1.00 62.13 ? 361  ALA A CA    1 
ATOM   3120 C  C     . ALA C 3 355 ? 42.462 52.421  18.791  1.00 60.94 ? 361  ALA A C     1 
ATOM   3121 O  O     . ALA C 3 355 ? 42.061 51.279  18.561  1.00 61.02 ? 361  ALA A O     1 
ATOM   3122 C  CB    . ALA C 3 355 ? 44.890 52.454  19.367  1.00 62.95 ? 361  ALA A CB    1 
ATOM   3123 N  N     . PRO C 3 356 ? 42.033 53.479  18.088  1.00 59.68 ? 362  PRO A N     1 
ATOM   3124 C  CA    . PRO C 3 356 ? 41.056 53.346  17.003  1.00 59.17 ? 362  PRO A CA    1 
ATOM   3125 C  C     . PRO C 3 356 ? 41.520 52.394  15.906  1.00 58.55 ? 362  PRO A C     1 
ATOM   3126 O  O     . PRO C 3 356 ? 42.652 52.487  15.427  1.00 59.13 ? 362  PRO A O     1 
ATOM   3127 C  CB    . PRO C 3 356 ? 40.911 54.778  16.492  1.00 58.45 ? 362  PRO A CB    1 
ATOM   3128 C  CG    . PRO C 3 356 ? 41.171 55.596  17.720  1.00 59.37 ? 362  PRO A CG    1 
ATOM   3129 C  CD    . PRO C 3 356 ? 42.365 54.894  18.320  1.00 59.54 ? 362  PRO A CD    1 
ATOM   3130 N  N     . VAL C 3 357 ? 40.639 51.479  15.514  1.00 57.99 ? 363  VAL A N     1 
ATOM   3131 C  CA    . VAL C 3 357 ? 40.950 50.519  14.463  1.00 57.78 ? 363  VAL A CA    1 
ATOM   3132 C  C     . VAL C 3 357 ? 40.707 51.193  13.118  1.00 57.52 ? 363  VAL A C     1 
ATOM   3133 O  O     . VAL C 3 357 ? 39.591 51.625  12.824  1.00 58.22 ? 363  VAL A O     1 
ATOM   3134 C  CB    . VAL C 3 357 ? 40.059 49.267  14.574  1.00 57.96 ? 363  VAL A CB    1 
ATOM   3135 C  CG1   . VAL C 3 357 ? 40.413 48.272  13.480  1.00 57.57 ? 363  VAL A CG1   1 
ATOM   3136 C  CG2   . VAL C 3 357 ? 40.232 48.635  15.938  1.00 58.06 ? 363  VAL A CG2   1 
ATOM   3137 N  N     . VAL C 3 358 ? 41.750 51.281  12.302  1.00 57.23 ? 364  VAL A N     1 
ATOM   3138 C  CA    . VAL C 3 358 ? 41.634 51.933  11.005  1.00 56.82 ? 364  VAL A CA    1 
ATOM   3139 C  C     . VAL C 3 358 ? 42.099 51.114  9.801   1.00 56.12 ? 364  VAL A C     1 
ATOM   3140 O  O     . VAL C 3 358 ? 42.825 51.620  8.946   1.00 56.07 ? 364  VAL A O     1 
ATOM   3141 C  CB    . VAL C 3 358 ? 42.398 53.267  11.008  1.00 56.42 ? 364  VAL A CB    1 
ATOM   3142 C  CG1   . VAL C 3 358 ? 41.772 54.221  12.011  1.00 57.29 ? 364  VAL A CG1   1 
ATOM   3143 C  CG2   . VAL C 3 358 ? 43.850 53.023  11.364  1.00 58.47 ? 364  VAL A CG2   1 
ATOM   3144 N  N     . ASP C 3 359 ? 41.687 49.855  9.723   1.00 56.02 ? 365  ASP A N     1 
ATOM   3145 C  CA    . ASP C 3 359 ? 42.070 49.043  8.577   1.00 55.71 ? 365  ASP A CA    1 
ATOM   3146 C  C     . ASP C 3 359 ? 41.173 49.451  7.412   1.00 56.10 ? 365  ASP A C     1 
ATOM   3147 O  O     . ASP C 3 359 ? 40.298 50.303  7.569   1.00 56.41 ? 365  ASP A O     1 
ATOM   3148 C  CB    . ASP C 3 359 ? 41.911 47.550  8.876   1.00 55.09 ? 365  ASP A CB    1 
ATOM   3149 C  CG    . ASP C 3 359 ? 40.545 47.201  9.429   1.00 55.01 ? 365  ASP A CG    1 
ATOM   3150 O  OD1   . ASP C 3 359 ? 39.548 47.846  9.037   1.00 54.64 ? 365  ASP A OD1   1 
ATOM   3151 O  OD2   . ASP C 3 359 ? 40.469 46.260  10.248  1.00 55.34 ? 365  ASP A OD2   1 
ATOM   3152 N  N     . ASP C 3 360 ? 41.388 48.850  6.247   1.00 55.79 ? 366  ASP A N     1 
ATOM   3153 C  CA    . ASP C 3 360 ? 40.592 49.181  5.072   1.00 56.18 ? 366  ASP A CA    1 
ATOM   3154 C  C     . ASP C 3 360 ? 39.101 48.930  5.285   1.00 55.81 ? 366  ASP A C     1 
ATOM   3155 O  O     . ASP C 3 360 ? 38.266 49.627  4.709   1.00 54.87 ? 366  ASP A O     1 
ATOM   3156 C  CB    . ASP C 3 360 ? 41.070 48.380  3.860   1.00 57.27 ? 366  ASP A CB    1 
ATOM   3157 C  CG    . ASP C 3 360 ? 40.472 48.885  2.559   1.00 58.19 ? 366  ASP A CG    1 
ATOM   3158 O  OD1   . ASP C 3 360 ? 40.825 50.009  2.140   1.00 59.03 ? 366  ASP A OD1   1 
ATOM   3159 O  OD2   . ASP C 3 360 ? 39.645 48.164  1.960   1.00 59.15 ? 366  ASP A OD2   1 
ATOM   3160 N  N     . GLU C 3 361 ? 38.768 47.933  6.104   1.00 56.53 ? 367  GLU A N     1 
ATOM   3161 C  CA    . GLU C 3 361 ? 37.371 47.608  6.377   1.00 57.71 ? 367  GLU A CA    1 
ATOM   3162 C  C     . GLU C 3 361 ? 36.631 48.810  6.945   1.00 57.66 ? 367  GLU A C     1 
ATOM   3163 O  O     . GLU C 3 361 ? 35.630 49.257  6.380   1.00 58.40 ? 367  GLU A O     1 
ATOM   3164 C  CB    . GLU C 3 361 ? 37.259 46.459  7.380   1.00 59.74 ? 367  GLU A CB    1 
ATOM   3165 C  CG    . GLU C 3 361 ? 37.819 45.128  6.922   1.00 62.10 ? 367  GLU A CG    1 
ATOM   3166 C  CD    . GLU C 3 361 ? 37.446 44.005  7.876   1.00 63.94 ? 367  GLU A CD    1 
ATOM   3167 O  OE1   . GLU C 3 361 ? 37.942 42.868  7.695   1.00 64.20 ? 367  GLU A OE1   1 
ATOM   3168 O  OE2   . GLU C 3 361 ? 36.647 44.264  8.806   1.00 63.79 ? 367  GLU A OE2   1 
ATOM   3169 N  N     . VAL C 3 362 ? 37.125 49.323  8.071   1.00 56.50 ? 368  VAL A N     1 
ATOM   3170 C  CA    . VAL C 3 362 ? 36.506 50.470  8.724   1.00 56.80 ? 368  VAL A CA    1 
ATOM   3171 C  C     . VAL C 3 362 ? 36.491 51.713  7.840   1.00 56.76 ? 368  VAL A C     1 
ATOM   3172 O  O     . VAL C 3 362 ? 35.484 52.418  7.777   1.00 57.55 ? 368  VAL A O     1 
ATOM   3173 C  CB    . VAL C 3 362 ? 37.214 50.816  10.059  1.00 56.16 ? 368  VAL A CB    1 
ATOM   3174 C  CG1   . VAL C 3 362 ? 37.164 49.623  10.994  1.00 55.78 ? 368  VAL A CG1   1 
ATOM   3175 C  CG2   . VAL C 3 362 ? 38.651 51.229  9.804   1.00 56.67 ? 368  VAL A CG2   1 
ATOM   3176 N  N     . LEU C 3 363 ? 37.598 51.978  7.153   1.00 56.53 ? 369  LEU A N     1 
ATOM   3177 C  CA    . LEU C 3 363 ? 37.681 53.143  6.280   1.00 55.45 ? 369  LEU A CA    1 
ATOM   3178 C  C     . LEU C 3 363 ? 36.568 53.140  5.241   1.00 55.97 ? 369  LEU A C     1 
ATOM   3179 O  O     . LEU C 3 363 ? 36.185 54.191  4.732   1.00 55.39 ? 369  LEU A O     1 
ATOM   3180 C  CB    . LEU C 3 363 ? 39.039 53.192  5.575   1.00 54.35 ? 369  LEU A CB    1 
ATOM   3181 C  CG    . LEU C 3 363 ? 40.271 53.390  6.460   1.00 53.98 ? 369  LEU A CG    1 
ATOM   3182 C  CD1   . LEU C 3 363 ? 41.525 53.388  5.592   1.00 53.57 ? 369  LEU A CD1   1 
ATOM   3183 C  CD2   . LEU C 3 363 ? 40.153 54.700  7.229   1.00 53.22 ? 369  LEU A CD2   1 
ATOM   3184 N  N     . GLU C 3 364 ? 36.049 51.956  4.935   1.00 56.43 ? 370  GLU A N     1 
ATOM   3185 C  CA    . GLU C 3 364 ? 34.979 51.828  3.954   1.00 57.90 ? 370  GLU A CA    1 
ATOM   3186 C  C     . GLU C 3 364 ? 33.621 52.180  4.553   1.00 58.18 ? 370  GLU A C     1 
ATOM   3187 O  O     . GLU C 3 364 ? 32.729 52.658  3.854   1.00 57.86 ? 370  GLU A O     1 
ATOM   3188 C  CB    . GLU C 3 364 ? 34.942 50.402  3.393   1.00 59.40 ? 370  GLU A CB    1 
ATOM   3189 C  CG    . GLU C 3 364 ? 33.791 50.143  2.429   1.00 60.92 ? 370  GLU A CG    1 
ATOM   3190 C  CD    . GLU C 3 364 ? 33.638 51.249  1.398   1.00 63.78 ? 370  GLU A CD    1 
ATOM   3191 O  OE1   . GLU C 3 364 ? 34.624 51.540  0.683   1.00 63.95 ? 370  GLU A OE1   1 
ATOM   3192 O  OE2   . GLU C 3 364 ? 32.531 51.831  1.305   1.00 63.60 ? 370  GLU A OE2   1 
ATOM   3193 N  N     . GLY C 3 365 ? 33.471 51.945  5.852   1.00 58.48 ? 371  GLY A N     1 
ATOM   3194 C  CA    . GLY C 3 365 ? 32.213 52.242  6.511   1.00 58.42 ? 371  GLY A CA    1 
ATOM   3195 C  C     . GLY C 3 365 ? 32.152 53.650  7.069   1.00 58.81 ? 371  GLY A C     1 
ATOM   3196 O  O     . GLY C 3 365 ? 31.079 54.130  7.439   1.00 58.88 ? 371  GLY A O     1 
ATOM   3197 N  N     . VAL C 3 366 ? 33.301 54.317  7.127   1.00 58.11 ? 372  VAL A N     1 
ATOM   3198 C  CA    . VAL C 3 366 ? 33.368 55.675  7.652   1.00 58.04 ? 372  VAL A CA    1 
ATOM   3199 C  C     . VAL C 3 366 ? 32.578 56.674  6.811   1.00 58.50 ? 372  VAL A C     1 
ATOM   3200 O  O     . VAL C 3 366 ? 32.656 56.675  5.583   1.00 58.03 ? 372  VAL A O     1 
ATOM   3201 C  CB    . VAL C 3 366 ? 34.828 56.164  7.753   1.00 57.00 ? 372  VAL A CB    1 
ATOM   3202 C  CG1   . VAL C 3 366 ? 34.863 57.631  8.141   1.00 57.57 ? 372  VAL A CG1   1 
ATOM   3203 C  CG2   . VAL C 3 366 ? 35.576 55.342  8.784   1.00 56.32 ? 372  VAL A CG2   1 
ATOM   3204 N  N     . ARG C 3 367 ? 31.814 57.523  7.491   1.00 59.40 ? 373  ARG A N     1 
ATOM   3205 C  CA    . ARG C 3 367 ? 31.011 58.547  6.833   1.00 59.43 ? 373  ARG A CA    1 
ATOM   3206 C  C     . ARG C 3 367 ? 31.192 59.877  7.562   1.00 59.00 ? 373  ARG A C     1 
ATOM   3207 O  O     . ARG C 3 367 ? 31.065 59.943  8.785   1.00 59.50 ? 373  ARG A O     1 
ATOM   3208 C  CB    . ARG C 3 367 ? 29.525 58.160  6.849   1.00 60.15 ? 373  ARG A CB    1 
ATOM   3209 C  CG    . ARG C 3 367 ? 29.180 56.865  6.118   1.00 59.68 ? 373  ARG A CG    1 
ATOM   3210 C  CD    . ARG C 3 367 ? 29.334 57.005  4.610   1.00 59.90 ? 373  ARG A CD    1 
ATOM   3211 N  NE    . ARG C 3 367 ? 28.912 55.797  3.901   1.00 60.54 ? 373  ARG A NE    1 
ATOM   3212 C  CZ    . ARG C 3 367 ? 29.539 54.624  3.967   1.00 59.86 ? 373  ARG A CZ    1 
ATOM   3213 N  NH1   . ARG C 3 367 ? 30.630 54.489  4.710   1.00 58.92 ? 373  ARG A NH1   1 
ATOM   3214 N  NH2   . ARG C 3 367 ? 29.070 53.581  3.293   1.00 59.34 ? 373  ARG A NH2   1 
ATOM   3215 N  N     . VAL C 3 368 ? 31.504 60.927  6.808   1.00 59.06 ? 374  VAL A N     1 
ATOM   3216 C  CA    . VAL C 3 368 ? 31.685 62.262  7.373   1.00 58.41 ? 374  VAL A CA    1 
ATOM   3217 C  C     . VAL C 3 368 ? 30.876 63.257  6.546   1.00 58.32 ? 374  VAL A C     1 
ATOM   3218 O  O     . VAL C 3 368 ? 30.643 63.035  5.356   1.00 59.41 ? 374  VAL A O     1 
ATOM   3219 C  CB    . VAL C 3 368 ? 33.172 62.689  7.375   1.00 57.40 ? 374  VAL A CB    1 
ATOM   3220 C  CG1   . VAL C 3 368 ? 33.968 61.779  8.286   1.00 56.93 ? 374  VAL A CG1   1 
ATOM   3221 C  CG2   . VAL C 3 368 ? 33.730 62.659  5.963   1.00 57.51 ? 374  VAL A CG2   1 
ATOM   3222 N  N     . ASP C 3 369 ? 30.450 64.350  7.172   1.00 57.69 ? 375  ASP A N     1 
ATOM   3223 C  CA    . ASP C 3 369 ? 29.652 65.353  6.476   1.00 57.76 ? 375  ASP A CA    1 
ATOM   3224 C  C     . ASP C 3 369 ? 30.399 66.039  5.345   1.00 57.28 ? 375  ASP A C     1 
ATOM   3225 O  O     . ASP C 3 369 ? 29.891 66.117  4.229   1.00 58.14 ? 375  ASP A O     1 
ATOM   3226 C  CB    . ASP C 3 369 ? 29.137 66.406  7.456   1.00 57.91 ? 375  ASP A CB    1 
ATOM   3227 C  CG    . ASP C 3 369 ? 28.264 65.813  8.535   1.00 57.48 ? 375  ASP A CG    1 
ATOM   3228 O  OD1   . ASP C 3 369 ? 27.477 64.894  8.221   1.00 56.60 ? 375  ASP A OD1   1 
ATOM   3229 O  OD2   . ASP C 3 369 ? 28.360 66.272  9.692   1.00 58.11 ? 375  ASP A OD2   1 
ATOM   3230 N  N     . ASP C 3 370 ? 31.596 66.544  5.627   1.00 56.82 ? 376  ASP A N     1 
ATOM   3231 C  CA    . ASP C 3 370 ? 32.381 67.212  4.597   1.00 56.19 ? 376  ASP A CA    1 
ATOM   3232 C  C     . ASP C 3 370 ? 32.551 66.262  3.415   1.00 55.76 ? 376  ASP A C     1 
ATOM   3233 O  O     . ASP C 3 370 ? 33.158 65.199  3.548   1.00 55.93 ? 376  ASP A O     1 
ATOM   3234 C  CB    . ASP C 3 370 ? 33.756 67.601  5.136   1.00 56.88 ? 376  ASP A CB    1 
ATOM   3235 C  CG    . ASP C 3 370 ? 34.611 68.291  4.092   1.00 57.60 ? 376  ASP A CG    1 
ATOM   3236 O  OD1   . ASP C 3 370 ? 34.653 67.809  2.942   1.00 60.06 ? 376  ASP A OD1   1 
ATOM   3237 O  OD2   . ASP C 3 370 ? 35.248 69.310  4.415   1.00 58.20 ? 376  ASP A OD2   1 
ATOM   3238 N  N     . PRO C 3 371 ? 32.019 66.636  2.239   1.00 54.78 ? 377  PRO A N     1 
ATOM   3239 C  CA    . PRO C 3 371 ? 32.116 65.803  1.037   1.00 53.43 ? 377  PRO A CA    1 
ATOM   3240 C  C     . PRO C 3 371 ? 33.545 65.548  0.554   1.00 52.68 ? 377  PRO A C     1 
ATOM   3241 O  O     . PRO C 3 371 ? 33.870 64.437  0.128   1.00 52.67 ? 377  PRO A O     1 
ATOM   3242 C  CB    . PRO C 3 371 ? 31.275 66.570  0.018   1.00 53.39 ? 377  PRO A CB    1 
ATOM   3243 C  CG    . PRO C 3 371 ? 31.439 67.995  0.452   1.00 53.81 ? 377  PRO A CG    1 
ATOM   3244 C  CD    . PRO C 3 371 ? 31.297 67.887  1.950   1.00 54.99 ? 377  PRO A CD    1 
ATOM   3245 N  N     . GLU C 3 372 ? 34.397 66.565  0.621   1.00 50.93 ? 378  GLU A N     1 
ATOM   3246 C  CA    . GLU C 3 372 ? 35.780 66.408  0.183   1.00 50.08 ? 378  GLU A CA    1 
ATOM   3247 C  C     . GLU C 3 372 ? 36.569 65.443  1.072   1.00 49.15 ? 378  GLU A C     1 
ATOM   3248 O  O     . GLU C 3 372 ? 37.371 64.651  0.577   1.00 47.05 ? 378  GLU A O     1 
ATOM   3249 C  CB    . GLU C 3 372 ? 36.483 67.764  0.136   1.00 48.83 ? 378  GLU A CB    1 
ATOM   3250 C  CG    . GLU C 3 372 ? 37.980 67.661  -0.111  1.00 51.41 ? 378  GLU A CG    1 
ATOM   3251 C  CD    . GLU C 3 372 ? 38.622 69.003  -0.380  1.00 52.38 ? 378  GLU A CD    1 
ATOM   3252 O  OE1   . GLU C 3 372 ? 38.135 70.011  0.174   1.00 53.63 ? 378  GLU A OE1   1 
ATOM   3253 O  OE2   . GLU C 3 372 ? 39.620 69.052  -1.134  1.00 55.48 ? 378  GLU A OE2   1 
ATOM   3254 N  N     . LYS C 3 373 ? 36.344 65.512  2.380   1.00 49.45 ? 379  LYS A N     1 
ATOM   3255 C  CA    . LYS C 3 373 ? 37.040 64.629  3.311   1.00 50.61 ? 379  LYS A CA    1 
ATOM   3256 C  C     . LYS C 3 373 ? 36.509 63.209  3.169   1.00 50.67 ? 379  LYS A C     1 
ATOM   3257 O  O     . LYS C 3 373 ? 37.224 62.237  3.422   1.00 51.38 ? 379  LYS A O     1 
ATOM   3258 C  CB    . LYS C 3 373 ? 36.853 65.107  4.752   1.00 50.45 ? 379  LYS A CB    1 
ATOM   3259 C  CG    . LYS C 3 373 ? 37.504 66.444  5.056   1.00 49.79 ? 379  LYS A CG    1 
ATOM   3260 C  CD    . LYS C 3 373 ? 37.239 66.861  6.493   1.00 50.74 ? 379  LYS A CD    1 
ATOM   3261 C  CE    . LYS C 3 373 ? 37.923 68.175  6.816   1.00 51.15 ? 379  LYS A CE    1 
ATOM   3262 N  NZ    . LYS C 3 373 ? 39.364 68.120  6.454   1.00 52.07 ? 379  LYS A NZ    1 
ATOM   3263 N  N     . GLN C 3 374 ? 35.249 63.095  2.766   1.00 49.76 ? 380  GLN A N     1 
ATOM   3264 C  CA    . GLN C 3 374 ? 34.630 61.795  2.576   1.00 49.12 ? 380  GLN A CA    1 
ATOM   3265 C  C     . GLN C 3 374 ? 35.251 61.123  1.353   1.00 48.81 ? 380  GLN A C     1 
ATOM   3266 O  O     . GLN C 3 374 ? 35.477 59.911  1.343   1.00 49.07 ? 380  GLN A O     1 
ATOM   3267 C  CB    . GLN C 3 374 ? 33.126 61.954  2.368   1.00 50.99 ? 380  GLN A CB    1 
ATOM   3268 C  CG    . GLN C 3 374 ? 32.382 60.642  2.168   1.00 52.24 ? 380  GLN A CG    1 
ATOM   3269 C  CD    . GLN C 3 374 ? 32.429 59.755  3.396   1.00 53.95 ? 380  GLN A CD    1 
ATOM   3270 O  OE1   . GLN C 3 374 ? 32.058 60.179  4.493   1.00 54.97 ? 380  GLN A OE1   1 
ATOM   3271 N  NE2   . GLN C 3 374 ? 32.884 58.515  3.222   1.00 52.79 ? 380  GLN A NE2   1 
ATOM   3272 N  N     . ALA C 3 375 ? 35.525 61.918  0.323   1.00 47.61 ? 381  ALA A N     1 
ATOM   3273 C  CA    . ALA C 3 375 ? 36.124 61.400  -0.901  1.00 46.41 ? 381  ALA A CA    1 
ATOM   3274 C  C     . ALA C 3 375 ? 37.616 61.127  -0.715  1.00 45.62 ? 381  ALA A C     1 
ATOM   3275 O  O     . ALA C 3 375 ? 38.187 60.260  -1.380  1.00 45.63 ? 381  ALA A O     1 
ATOM   3276 C  CB    . ALA C 3 375 ? 35.915 62.382  -2.037  1.00 44.26 ? 381  ALA A CB    1 
ATOM   3277 N  N     . ALA C 3 376 ? 38.242 61.874  0.189   1.00 44.27 ? 382  ALA A N     1 
ATOM   3278 C  CA    . ALA C 3 376 ? 39.666 61.717  0.464   1.00 43.73 ? 382  ALA A CA    1 
ATOM   3279 C  C     . ALA C 3 376 ? 39.962 60.347  1.061   1.00 44.23 ? 382  ALA A C     1 
ATOM   3280 O  O     . ALA C 3 376 ? 41.084 59.844  0.964   1.00 44.66 ? 382  ALA A O     1 
ATOM   3281 C  CB    . ALA C 3 376 ? 40.138 62.815  1.416   1.00 41.67 ? 382  ALA A CB    1 
ATOM   3282 N  N     . ILE C 3 377 ? 38.955 59.745  1.684   1.00 44.46 ? 383  ILE A N     1 
ATOM   3283 C  CA    . ILE C 3 377 ? 39.130 58.439  2.292   1.00 44.15 ? 383  ILE A CA    1 
ATOM   3284 C  C     . ILE C 3 377 ? 39.518 57.413  1.236   1.00 44.73 ? 383  ILE A C     1 
ATOM   3285 O  O     . ILE C 3 377 ? 40.359 56.552  1.483   1.00 44.90 ? 383  ILE A O     1 
ATOM   3286 C  CB    . ILE C 3 377 ? 37.852 57.990  3.017   1.00 44.77 ? 383  ILE A CB    1 
ATOM   3287 C  CG1   . ILE C 3 377 ? 37.567 58.947  4.182   1.00 45.03 ? 383  ILE A CG1   1 
ATOM   3288 C  CG2   . ILE C 3 377 ? 38.008 56.560  3.525   1.00 43.43 ? 383  ILE A CG2   1 
ATOM   3289 C  CD1   . ILE C 3 377 ? 36.339 58.593  4.999   1.00 45.88 ? 383  ILE A CD1   1 
ATOM   3290 N  N     . ASP C 3 378 ? 38.912 57.504  0.056   1.00 44.93 ? 384  ASP A N     1 
ATOM   3291 C  CA    . ASP C 3 378 ? 39.243 56.570  -1.012  1.00 44.22 ? 384  ASP A CA    1 
ATOM   3292 C  C     . ASP C 3 378 ? 40.661 56.810  -1.500  1.00 43.48 ? 384  ASP A C     1 
ATOM   3293 O  O     . ASP C 3 378 ? 41.338 55.880  -1.935  1.00 43.05 ? 384  ASP A O     1 
ATOM   3294 C  CB    . ASP C 3 378 ? 38.270 56.702  -2.182  1.00 45.54 ? 384  ASP A CB    1 
ATOM   3295 C  CG    . ASP C 3 378 ? 36.900 56.170  -1.848  1.00 47.83 ? 384  ASP A CG    1 
ATOM   3296 O  OD1   . ASP C 3 378 ? 36.823 55.176  -1.094  1.00 50.31 ? 384  ASP A OD1   1 
ATOM   3297 O  OD2   . ASP C 3 378 ? 35.903 56.733  -2.343  1.00 48.95 ? 384  ASP A OD2   1 
ATOM   3298 N  N     . LEU C 3 379 ? 41.104 58.061  -1.431  1.00 42.05 ? 385  LEU A N     1 
ATOM   3299 C  CA    . LEU C 3 379 ? 42.451 58.404  -1.859  1.00 41.97 ? 385  LEU A CA    1 
ATOM   3300 C  C     . LEU C 3 379 ? 43.437 57.810  -0.858  1.00 41.77 ? 385  LEU A C     1 
ATOM   3301 O  O     . LEU C 3 379 ? 44.535 57.385  -1.222  1.00 41.28 ? 385  LEU A O     1 
ATOM   3302 C  CB    . LEU C 3 379 ? 42.631 59.920  -1.914  1.00 42.53 ? 385  LEU A CB    1 
ATOM   3303 C  CG    . LEU C 3 379 ? 41.701 60.711  -2.830  1.00 43.35 ? 385  LEU A CG    1 
ATOM   3304 C  CD1   . LEU C 3 379 ? 42.146 62.160  -2.838  1.00 43.17 ? 385  LEU A CD1   1 
ATOM   3305 C  CD2   . LEU C 3 379 ? 41.726 60.138  -4.239  1.00 42.72 ? 385  LEU A CD2   1 
ATOM   3306 N  N     . ILE C 3 380 ? 43.035 57.796  0.408   1.00 39.66 ? 386  ILE A N     1 
ATOM   3307 C  CA    . ILE C 3 380 ? 43.870 57.245  1.459   1.00 39.76 ? 386  ILE A CA    1 
ATOM   3308 C  C     . ILE C 3 380 ? 43.944 55.733  1.271   1.00 40.57 ? 386  ILE A C     1 
ATOM   3309 O  O     . ILE C 3 380 ? 45.018 55.140  1.365   1.00 40.19 ? 386  ILE A O     1 
ATOM   3310 C  CB    . ILE C 3 380 ? 43.297 57.584  2.849   1.00 39.60 ? 386  ILE A CB    1 
ATOM   3311 C  CG1   . ILE C 3 380 ? 43.452 59.089  3.106   1.00 37.92 ? 386  ILE A CG1   1 
ATOM   3312 C  CG2   . ILE C 3 380 ? 44.014 56.763  3.931   1.00 39.87 ? 386  ILE A CG2   1 
ATOM   3313 C  CD1   . ILE C 3 380 ? 42.607 59.613  4.253   1.00 37.69 ? 386  ILE A CD1   1 
ATOM   3314 N  N     . LYS C 3 381 ? 42.801 55.114  0.998   1.00 40.55 ? 387  LYS A N     1 
ATOM   3315 C  CA    . LYS C 3 381 ? 42.769 53.678  0.774   1.00 40.57 ? 387  LYS A CA    1 
ATOM   3316 C  C     . LYS C 3 381 ? 43.690 53.331  -0.396  1.00 39.86 ? 387  LYS A C     1 
ATOM   3317 O  O     . LYS C 3 381 ? 44.487 52.399  -0.312  1.00 40.63 ? 387  LYS A O     1 
ATOM   3318 C  CB    . LYS C 3 381 ? 41.342 53.210  0.473   1.00 40.38 ? 387  LYS A CB    1 
ATOM   3319 C  CG    . LYS C 3 381 ? 40.425 53.169  1.685   1.00 40.04 ? 387  LYS A CG    1 
ATOM   3320 C  CD    . LYS C 3 381 ? 39.036 52.676  1.315   1.00 40.71 ? 387  LYS A CD    1 
ATOM   3321 N  N     . GLU C 3 382 ? 43.588 54.087  -1.485  1.00 38.23 ? 388  GLU A N     1 
ATOM   3322 C  CA    . GLU C 3 382 ? 44.428 53.835  -2.650  1.00 38.57 ? 388  GLU A CA    1 
ATOM   3323 C  C     . GLU C 3 382 ? 45.905 54.079  -2.344  1.00 37.50 ? 388  GLU A C     1 
ATOM   3324 O  O     . GLU C 3 382 ? 46.781 53.394  -2.873  1.00 39.42 ? 388  GLU A O     1 
ATOM   3325 C  CB    . GLU C 3 382 ? 43.989 54.715  -3.829  1.00 39.55 ? 388  GLU A CB    1 
ATOM   3326 C  CG    . GLU C 3 382 ? 44.956 54.689  -5.016  1.00 41.69 ? 388  GLU A CG    1 
ATOM   3327 C  CD    . GLU C 3 382 ? 44.465 55.510  -6.205  1.00 44.21 ? 388  GLU A CD    1 
ATOM   3328 O  OE1   . GLU C 3 382 ? 43.964 56.640  -5.994  1.00 46.50 ? 388  GLU A OE1   1 
ATOM   3329 O  OE2   . GLU C 3 382 ? 44.590 55.032  -7.353  1.00 45.57 ? 388  GLU A OE2   1 
ATOM   3330 N  N     . TYR C 3 383 ? 46.187 55.059  -1.496  1.00 36.07 ? 389  TYR A N     1 
ATOM   3331 C  CA    . TYR C 3 383 ? 47.565 55.355  -1.146  1.00 35.20 ? 389  TYR A CA    1 
ATOM   3332 C  C     . TYR C 3 383 ? 48.182 54.195  -0.361  1.00 35.02 ? 389  TYR A C     1 
ATOM   3333 O  O     . TYR C 3 383 ? 49.325 53.822  -0.606  1.00 34.63 ? 389  TYR A O     1 
ATOM   3334 C  CB    . TYR C 3 383 ? 47.644 56.653  -0.333  1.00 35.28 ? 389  TYR A CB    1 
ATOM   3335 C  CG    . TYR C 3 383 ? 49.057 57.109  -0.009  1.00 32.86 ? 389  TYR A CG    1 
ATOM   3336 C  CD1   . TYR C 3 383 ? 49.761 56.565  1.065   1.00 32.74 ? 389  TYR A CD1   1 
ATOM   3337 C  CD2   . TYR C 3 383 ? 49.674 58.100  -0.758  1.00 33.43 ? 389  TYR A CD2   1 
ATOM   3338 C  CE1   . TYR C 3 383 ? 51.044 57.005  1.387   1.00 31.52 ? 389  TYR A CE1   1 
ATOM   3339 C  CE2   . TYR C 3 383 ? 50.959 58.548  -0.448  1.00 32.24 ? 389  TYR A CE2   1 
ATOM   3340 C  CZ    . TYR C 3 383 ? 51.635 57.994  0.629   1.00 31.57 ? 389  TYR A CZ    1 
ATOM   3341 O  OH    . TYR C 3 383 ? 52.900 58.430  0.942   1.00 30.83 ? 389  TYR A OH    1 
ATOM   3342 N  N     . LEU C 3 384 ? 47.420 53.618  0.565   1.00 36.04 ? 390  LEU A N     1 
ATOM   3343 C  CA    . LEU C 3 384 ? 47.912 52.503  1.373   1.00 36.57 ? 390  LEU A CA    1 
ATOM   3344 C  C     . LEU C 3 384 ? 48.187 51.250  0.535   1.00 36.75 ? 390  LEU A C     1 
ATOM   3345 O  O     . LEU C 3 384 ? 49.154 50.534  0.775   1.00 37.34 ? 390  LEU A O     1 
ATOM   3346 C  CB    . LEU C 3 384 ? 46.909 52.184  2.485   1.00 36.70 ? 390  LEU A CB    1 
ATOM   3347 C  CG    . LEU C 3 384 ? 46.785 53.301  3.532   1.00 39.21 ? 390  LEU A CG    1 
ATOM   3348 C  CD1   . LEU C 3 384 ? 45.590 53.054  4.434   1.00 37.57 ? 390  LEU A CD1   1 
ATOM   3349 C  CD2   . LEU C 3 384 ? 48.074 53.378  4.343   1.00 36.81 ? 390  LEU A CD2   1 
ATOM   3350 N  N     . MET C 3 385 ? 47.329 50.997  -0.448  1.00 36.92 ? 391  MET A N     1 
ATOM   3351 C  CA    . MET C 3 385 ? 47.468 49.846  -1.333  1.00 36.90 ? 391  MET A CA    1 
ATOM   3352 C  C     . MET C 3 385 ? 48.696 50.032  -2.226  1.00 37.62 ? 391  MET A C     1 
ATOM   3353 O  O     . MET C 3 385 ? 49.506 49.115  -2.392  1.00 38.62 ? 391  MET A O     1 
ATOM   3354 C  CB    . MET C 3 385 ? 46.188 49.692  -2.171  1.00 38.08 ? 391  MET A CB    1 
ATOM   3355 C  CG    . MET C 3 385 ? 46.221 48.605  -3.241  1.00 38.69 ? 391  MET A CG    1 
ATOM   3356 S  SD    . MET C 3 385 ? 47.019 49.161  -4.755  1.00 38.25 ? 391  MET A SD    1 
ATOM   3357 C  CE    . MET C 3 385 ? 45.703 50.271  -5.430  1.00 39.02 ? 391  MET A CE    1 
ATOM   3358 N  N     . ILE C 3 386 ? 48.836 51.228  -2.789  1.00 36.54 ? 392  ILE A N     1 
ATOM   3359 C  CA    . ILE C 3 386 ? 49.972 51.545  -3.641  1.00 35.61 ? 392  ILE A CA    1 
ATOM   3360 C  C     . ILE C 3 386 ? 51.274 51.473  -2.853  1.00 35.46 ? 392  ILE A C     1 
ATOM   3361 O  O     . ILE C 3 386 ? 52.310 51.065  -3.378  1.00 35.00 ? 392  ILE A O     1 
ATOM   3362 C  CB    . ILE C 3 386 ? 49.820 52.957  -4.255  1.00 35.92 ? 392  ILE A CB    1 
ATOM   3363 C  CG1   . ILE C 3 386 ? 48.817 52.902  -5.410  1.00 36.72 ? 392  ILE A CG1   1 
ATOM   3364 C  CG2   . ILE C 3 386 ? 51.174 53.497  -4.714  1.00 33.11 ? 392  ILE A CG2   1 
ATOM   3365 C  CD1   . ILE C 3 386 ? 48.543 54.242  -6.033  1.00 35.52 ? 392  ILE A CD1   1 
ATOM   3366 N  N     . GLN C 3 387 ? 51.219 51.879  -1.589  1.00 36.09 ? 393  GLN A N     1 
ATOM   3367 C  CA    . GLN C 3 387 ? 52.397 51.850  -0.732  1.00 36.83 ? 393  GLN A CA    1 
ATOM   3368 C  C     . GLN C 3 387 ? 52.788 50.377  -0.547  1.00 36.06 ? 393  GLN A C     1 
ATOM   3369 O  O     . GLN C 3 387 ? 53.970 50.024  -0.526  1.00 35.46 ? 393  GLN A O     1 
ATOM   3370 C  CB    . GLN C 3 387 ? 52.067 52.486  0.622   1.00 37.89 ? 393  GLN A CB    1 
ATOM   3371 C  CG    . GLN C 3 387 ? 53.271 52.791  1.488   1.00 40.08 ? 393  GLN A CG    1 
ATOM   3372 C  CD    . GLN C 3 387 ? 54.074 53.983  0.983   1.00 42.35 ? 393  GLN A CD    1 
ATOM   3373 O  OE1   . GLN C 3 387 ? 54.592 53.975  -0.137  1.00 40.43 ? 393  GLN A OE1   1 
ATOM   3374 N  NE2   . GLN C 3 387 ? 54.186 55.018  1.819   1.00 41.91 ? 393  GLN A NE2   1 
ATOM   3375 N  N     . LYS C 3 388 ? 51.770 49.530  -0.430  1.00 35.60 ? 394  LYS A N     1 
ATOM   3376 C  CA    . LYS C 3 388 ? 51.951 48.095  -0.254  1.00 35.57 ? 394  LYS A CA    1 
ATOM   3377 C  C     . LYS C 3 388 ? 52.680 47.490  -1.464  1.00 35.19 ? 394  LYS A C     1 
ATOM   3378 O  O     . LYS C 3 388 ? 53.623 46.716  -1.306  1.00 33.59 ? 394  LYS A O     1 
ATOM   3379 C  CB    . LYS C 3 388 ? 50.584 47.418  -0.096  1.00 37.32 ? 394  LYS A CB    1 
ATOM   3380 C  CG    . LYS C 3 388 ? 50.628 46.080  0.609   1.00 38.89 ? 394  LYS A CG    1 
ATOM   3381 C  CD    . LYS C 3 388 ? 50.918 46.273  2.095   1.00 40.48 ? 394  LYS A CD    1 
ATOM   3382 C  CE    . LYS C 3 388 ? 51.185 44.945  2.780   1.00 40.53 ? 394  LYS A CE    1 
ATOM   3383 N  NZ    . LYS C 3 388 ? 50.088 43.985  2.506   1.00 40.22 ? 394  LYS A NZ    1 
ATOM   3384 N  N     . ARG C 3 389 ? 52.238 47.859  -2.666  1.00 33.49 ? 395  ARG A N     1 
ATOM   3385 C  CA    . ARG C 3 389 ? 52.825 47.353  -3.906  1.00 32.74 ? 395  ARG A CA    1 
ATOM   3386 C  C     . ARG C 3 389 ? 54.263 47.809  -4.115  1.00 31.69 ? 395  ARG A C     1 
ATOM   3387 O  O     . ARG C 3 389 ? 55.085 47.068  -4.647  1.00 32.53 ? 395  ARG A O     1 
ATOM   3388 C  CB    . ARG C 3 389 ? 51.980 47.791  -5.103  1.00 30.56 ? 395  ARG A CB    1 
ATOM   3389 C  CG    . ARG C 3 389 ? 50.588 47.218  -5.112  1.00 30.59 ? 395  ARG A CG    1 
ATOM   3390 C  CD    . ARG C 3 389 ? 50.577 45.735  -5.428  1.00 31.15 ? 395  ARG A CD    1 
ATOM   3391 N  NE    . ARG C 3 389 ? 49.207 45.242  -5.435  1.00 34.53 ? 395  ARG A NE    1 
ATOM   3392 C  CZ    . ARG C 3 389 ? 48.479 45.044  -4.340  1.00 34.31 ? 395  ARG A CZ    1 
ATOM   3393 N  NH1   . ARG C 3 389 ? 48.998 45.281  -3.141  1.00 33.64 ? 395  ARG A NH1   1 
ATOM   3394 N  NH2   . ARG C 3 389 ? 47.217 44.653  -4.445  1.00 36.34 ? 395  ARG A NH2   1 
ATOM   3395 N  N     . ILE C 3 390 ? 54.555 49.036  -3.702  1.00 31.45 ? 396  ILE A N     1 
ATOM   3396 C  CA    . ILE C 3 390 ? 55.891 49.611  -3.838  1.00 29.41 ? 396  ILE A CA    1 
ATOM   3397 C  C     . ILE C 3 390 ? 56.880 48.961  -2.874  1.00 29.30 ? 396  ILE A C     1 
ATOM   3398 O  O     . ILE C 3 390 ? 58.023 48.677  -3.239  1.00 29.20 ? 396  ILE A O     1 
ATOM   3399 C  CB    . ILE C 3 390 ? 55.851 51.140  -3.577  1.00 30.66 ? 396  ILE A CB    1 
ATOM   3400 C  CG1   . ILE C 3 390 ? 55.091 51.840  -4.713  1.00 30.52 ? 396  ILE A CG1   1 
ATOM   3401 C  CG2   . ILE C 3 390 ? 57.258 51.687  -3.426  1.00 31.30 ? 396  ILE A CG2   1 
ATOM   3402 C  CD1   . ILE C 3 390 ? 55.000 53.362  -4.555  1.00 30.96 ? 396  ILE A CD1   1 
ATOM   3403 N  N     . GLY C 3 391 ? 56.443 48.738  -1.639  1.00 29.45 ? 397  GLY A N     1 
ATOM   3404 C  CA    . GLY C 3 391 ? 57.317 48.115  -0.663  1.00 28.42 ? 397  GLY A CA    1 
ATOM   3405 C  C     . GLY C 3 391 ? 57.692 46.709  -1.104  1.00 28.22 ? 397  GLY A C     1 
ATOM   3406 O  O     . GLY C 3 391 ? 58.851 46.306  -1.032  1.00 27.70 ? 397  GLY A O     1 
ATOM   3407 N  N     . GLN C 3 392 ? 56.700 45.969  -1.578  1.00 28.05 ? 398  GLN A N     1 
ATOM   3408 C  CA    . GLN C 3 392 ? 56.902 44.602  -2.034  1.00 29.34 ? 398  GLN A CA    1 
ATOM   3409 C  C     . GLN C 3 392 ? 57.760 44.465  -3.292  1.00 28.94 ? 398  GLN A C     1 
ATOM   3410 O  O     . GLN C 3 392 ? 58.603 43.576  -3.384  1.00 29.11 ? 398  GLN A O     1 
ATOM   3411 C  CB    . GLN C 3 392 ? 55.538 43.941  -2.260  1.00 29.75 ? 398  GLN A CB    1 
ATOM   3412 C  CG    . GLN C 3 392 ? 55.614 42.589  -2.939  1.00 31.35 ? 398  GLN A CG    1 
ATOM   3413 C  CD    . GLN C 3 392 ? 54.389 41.730  -2.706  1.00 31.57 ? 398  GLN A CD    1 
ATOM   3414 O  OE1   . GLN C 3 392 ? 53.251 42.198  -2.797  1.00 35.16 ? 398  GLN A OE1   1 
ATOM   3415 N  NE2   . GLN C 3 392 ? 54.617 40.453  -2.422  1.00 32.12 ? 398  GLN A NE2   1 
ATOM   3416 N  N     . SER C 3 393 ? 57.570 45.357  -4.253  1.00 29.58 ? 399  SER A N     1 
ATOM   3417 C  CA    . SER C 3 393 ? 58.316 45.272  -5.504  1.00 30.48 ? 399  SER A CA    1 
ATOM   3418 C  C     . SER C 3 393 ? 59.620 46.059  -5.601  1.00 30.15 ? 399  SER A C     1 
ATOM   3419 O  O     . SER C 3 393 ? 60.528 45.661  -6.339  1.00 29.36 ? 399  SER A O     1 
ATOM   3420 C  CB    . SER C 3 393 ? 57.421 45.702  -6.671  1.00 31.48 ? 399  SER A CB    1 
ATOM   3421 O  OG    . SER C 3 393 ? 57.178 47.098  -6.623  1.00 31.42 ? 399  SER A OG    1 
ATOM   3422 N  N     . ALA C 3 394 ? 59.742 47.157  -4.860  1.00 30.18 ? 400  ALA A N     1 
ATOM   3423 C  CA    . ALA C 3 394 ? 60.945 47.960  -5.010  1.00 31.96 ? 400  ALA A CA    1 
ATOM   3424 C  C     . ALA C 3 394 ? 61.656 48.546  -3.797  1.00 32.40 ? 400  ALA A C     1 
ATOM   3425 O  O     . ALA C 3 394 ? 62.884 48.538  -3.759  1.00 31.55 ? 400  ALA A O     1 
ATOM   3426 C  CB    . ALA C 3 394 ? 60.654 49.092  -6.012  1.00 32.71 ? 400  ALA A CB    1 
ATOM   3427 N  N     . GLU C 3 395 ? 60.905 49.048  -2.816  1.00 33.35 ? 401  GLU A N     1 
ATOM   3428 C  CA    . GLU C 3 395 ? 61.524 49.697  -1.661  1.00 33.12 ? 401  GLU A CA    1 
ATOM   3429 C  C     . GLU C 3 395 ? 61.686 48.892  -0.374  1.00 33.29 ? 401  GLU A C     1 
ATOM   3430 O  O     . GLU C 3 395 ? 62.552 49.202  0.436   1.00 34.73 ? 401  GLU A O     1 
ATOM   3431 C  CB    . GLU C 3 395 ? 60.784 51.011  -1.358  1.00 32.64 ? 401  GLU A CB    1 
ATOM   3432 C  CG    . GLU C 3 395 ? 60.693 51.949  -2.572  1.00 35.88 ? 401  GLU A CG    1 
ATOM   3433 C  CD    . GLU C 3 395 ? 60.127 53.329  -2.243  1.00 36.65 ? 401  GLU A CD    1 
ATOM   3434 O  OE1   . GLU C 3 395 ? 59.295 53.443  -1.320  1.00 36.14 ? 401  GLU A OE1   1 
ATOM   3435 O  OE2   . GLU C 3 395 ? 60.505 54.300  -2.927  1.00 36.91 ? 401  GLU A OE2   1 
ATOM   3436 N  N     . GLY C 3 396 ? 60.865 47.871  -0.170  1.00 33.94 ? 402  GLY A N     1 
ATOM   3437 C  CA    . GLY C 3 396 ? 61.001 47.079  1.040   1.00 33.24 ? 402  GLY A CA    1 
ATOM   3438 C  C     . GLY C 3 396 ? 62.383 46.459  1.137   1.00 33.17 ? 402  GLY A C     1 
ATOM   3439 O  O     . GLY C 3 396 ? 63.106 46.404  0.143   1.00 33.34 ? 402  GLY A O     1 
ATOM   3440 N  N     . ASP C 3 397 ? 62.761 46.009  2.334   1.00 32.86 ? 403  ASP A N     1 
ATOM   3441 C  CA    . ASP C 3 397 ? 64.058 45.371  2.544   1.00 33.69 ? 403  ASP A CA    1 
ATOM   3442 C  C     . ASP C 3 397 ? 64.130 44.064  1.742   1.00 32.53 ? 403  ASP A C     1 
ATOM   3443 O  O     . ASP C 3 397 ? 65.206 43.622  1.340   1.00 31.74 ? 403  ASP A O     1 
ATOM   3444 C  CB    . ASP C 3 397 ? 64.267 45.052  4.035   1.00 37.56 ? 403  ASP A CB    1 
ATOM   3445 C  CG    . ASP C 3 397 ? 64.700 46.274  4.858   1.00 41.32 ? 403  ASP A CG    1 
ATOM   3446 O  OD1   . ASP C 3 397 ? 64.899 46.115  6.082   1.00 43.29 ? 403  ASP A OD1   1 
ATOM   3447 O  OD2   . ASP C 3 397 ? 64.850 47.382  4.294   1.00 42.83 ? 403  ASP A OD2   1 
ATOM   3448 N  N     . LYS C 3 398 ? 62.968 43.460  1.518   1.00 31.94 ? 404  LYS A N     1 
ATOM   3449 C  CA    . LYS C 3 398 ? 62.861 42.201  0.789   1.00 31.24 ? 404  LYS A CA    1 
ATOM   3450 C  C     . LYS C 3 398 ? 62.231 42.421  -0.588  1.00 28.62 ? 404  LYS A C     1 
ATOM   3451 O  O     . LYS C 3 398 ? 61.644 41.501  -1.154  1.00 27.93 ? 404  LYS A O     1 
ATOM   3452 C  CB    . LYS C 3 398 ? 61.985 41.223  1.578   1.00 32.69 ? 404  LYS A CB    1 
ATOM   3453 C  CG    . LYS C 3 398 ? 62.321 41.089  3.068   1.00 35.11 ? 404  LYS A CG    1 
ATOM   3454 C  CD    . LYS C 3 398 ? 63.540 40.224  3.308   1.00 38.05 ? 404  LYS A CD    1 
ATOM   3455 C  CE    . LYS C 3 398 ? 63.832 40.083  4.798   1.00 39.84 ? 404  LYS A CE    1 
ATOM   3456 N  NZ    . LYS C 3 398 ? 62.680 39.497  5.550   1.00 42.81 ? 404  LYS A NZ    1 
ATOM   3457 N  N     . ALA C 3 399 ? 62.354 43.634  -1.121  1.00 24.94 ? 405  ALA A N     1 
ATOM   3458 C  CA    . ALA C 3 399 ? 61.758 43.965  -2.412  1.00 24.74 ? 405  ALA A CA    1 
ATOM   3459 C  C     . ALA C 3 399 ? 62.244 43.070  -3.551  1.00 22.91 ? 405  ALA A C     1 
ATOM   3460 O  O     . ALA C 3 399 ? 63.372 42.604  -3.535  1.00 26.48 ? 405  ALA A O     1 
ATOM   3461 C  CB    . ALA C 3 399 ? 62.033 45.430  -2.748  1.00 24.75 ? 405  ALA A CB    1 
ATOM   3462 N  N     . TRP C 3 400 ? 61.392 42.841  -4.544  1.00 22.94 ? 406  TRP A N     1 
ATOM   3463 C  CA    . TRP C 3 400 ? 61.788 42.007  -5.678  1.00 24.68 ? 406  TRP A CA    1 
ATOM   3464 C  C     . TRP C 3 400 ? 63.010 42.574  -6.392  1.00 26.92 ? 406  TRP A C     1 
ATOM   3465 O  O     . TRP C 3 400 ? 63.930 41.829  -6.733  1.00 28.96 ? 406  TRP A O     1 
ATOM   3466 C  CB    . TRP C 3 400 ? 60.659 41.872  -6.701  1.00 22.54 ? 406  TRP A CB    1 
ATOM   3467 C  CG    . TRP C 3 400 ? 59.379 41.334  -6.151  1.00 23.13 ? 406  TRP A CG    1 
ATOM   3468 C  CD1   . TRP C 3 400 ? 59.230 40.425  -5.144  1.00 23.25 ? 406  TRP A CD1   1 
ATOM   3469 C  CD2   . TRP C 3 400 ? 58.063 41.649  -6.608  1.00 23.61 ? 406  TRP A CD2   1 
ATOM   3470 N  NE1   . TRP C 3 400 ? 57.897 40.155  -4.945  1.00 22.74 ? 406  TRP A NE1   1 
ATOM   3471 C  CE2   . TRP C 3 400 ? 57.158 40.892  -5.832  1.00 24.44 ? 406  TRP A CE2   1 
ATOM   3472 C  CE3   . TRP C 3 400 ? 57.557 42.503  -7.600  1.00 26.22 ? 406  TRP A CE3   1 
ATOM   3473 C  CZ2   . TRP C 3 400 ? 55.769 40.961  -6.017  1.00 26.01 ? 406  TRP A CZ2   1 
ATOM   3474 C  CZ3   . TRP C 3 400 ? 56.172 42.573  -7.783  1.00 26.08 ? 406  TRP A CZ3   1 
ATOM   3475 C  CH2   . TRP C 3 400 ? 55.297 41.804  -6.993  1.00 25.07 ? 406  TRP A CH2   1 
ATOM   3476 N  N     . LEU C 3 401 ? 63.017 43.886  -6.627  1.00 27.63 ? 407  LEU A N     1 
ATOM   3477 C  CA    . LEU C 3 401 ? 64.136 44.525  -7.315  1.00 29.32 ? 407  LEU A CA    1 
ATOM   3478 C  C     . LEU C 3 401 ? 65.444 44.455  -6.531  1.00 30.46 ? 407  LEU A C     1 
ATOM   3479 O  O     . LEU C 3 401 ? 66.516 44.718  -7.082  1.00 30.17 ? 407  LEU A O     1 
ATOM   3480 C  CB    . LEU C 3 401 ? 63.807 45.989  -7.646  1.00 28.94 ? 407  LEU A CB    1 
ATOM   3481 C  CG    . LEU C 3 401 ? 62.782 46.234  -8.764  1.00 31.13 ? 407  LEU A CG    1 
ATOM   3482 C  CD1   . LEU C 3 401 ? 62.457 47.732  -8.842  1.00 30.29 ? 407  LEU A CD1   1 
ATOM   3483 C  CD2   . LEU C 3 401 ? 63.334 45.733  -10.105 1.00 28.34 ? 407  LEU A CD2   1 
ATOM   3484 N  N     . ARG C 3 402 ? 65.363 44.110  -5.248  1.00 31.33 ? 408  ARG A N     1 
ATOM   3485 C  CA    . ARG C 3 402 ? 66.571 43.990  -4.430  1.00 31.14 ? 408  ARG A CA    1 
ATOM   3486 C  C     . ARG C 3 402 ? 67.064 42.547  -4.460  1.00 30.19 ? 408  ARG A C     1 
ATOM   3487 O  O     . ARG C 3 402 ? 68.212 42.263  -4.135  1.00 30.86 ? 408  ARG A O     1 
ATOM   3488 C  CB    . ARG C 3 402 ? 66.294 44.383  -2.975  1.00 33.62 ? 408  ARG A CB    1 
ATOM   3489 C  CG    . ARG C 3 402 ? 66.036 45.861  -2.741  1.00 34.94 ? 408  ARG A CG    1 
ATOM   3490 C  CD    . ARG C 3 402 ? 65.822 46.124  -1.251  1.00 38.09 ? 408  ARG A CD    1 
ATOM   3491 N  NE    . ARG C 3 402 ? 65.205 47.425  -0.992  1.00 40.31 ? 408  ARG A NE    1 
ATOM   3492 C  CZ    . ARG C 3 402 ? 65.808 48.600  -1.162  1.00 42.48 ? 408  ARG A CZ    1 
ATOM   3493 N  NH1   . ARG C 3 402 ? 67.062 48.654  -1.598  1.00 41.63 ? 408  ARG A NH1   1 
ATOM   3494 N  NH2   . ARG C 3 402 ? 65.153 49.727  -0.892  1.00 40.92 ? 408  ARG A NH2   1 
ATOM   3495 N  N     . TYR C 3 403 ? 66.184 41.632  -4.847  1.00 30.89 ? 409  TYR A N     1 
ATOM   3496 C  CA    . TYR C 3 403 ? 66.549 40.223  -4.902  1.00 31.35 ? 409  TYR A CA    1 
ATOM   3497 C  C     . TYR C 3 403 ? 66.913 39.661  -6.274  1.00 30.62 ? 409  TYR A C     1 
ATOM   3498 O  O     . TYR C 3 403 ? 67.495 38.583  -6.344  1.00 31.88 ? 409  TYR A O     1 
ATOM   3499 C  CB    . TYR C 3 403 ? 65.443 39.371  -4.279  1.00 30.61 ? 409  TYR A CB    1 
ATOM   3500 C  CG    . TYR C 3 403 ? 65.606 39.173  -2.789  1.00 31.17 ? 409  TYR A CG    1 
ATOM   3501 C  CD1   . TYR C 3 403 ? 66.675 38.426  -2.277  1.00 30.58 ? 409  TYR A CD1   1 
ATOM   3502 C  CD2   . TYR C 3 403 ? 64.708 39.738  -1.889  1.00 31.67 ? 409  TYR A CD2   1 
ATOM   3503 C  CE1   . TYR C 3 403 ? 66.845 38.249  -0.910  1.00 30.07 ? 409  TYR A CE1   1 
ATOM   3504 C  CE2   . TYR C 3 403 ? 64.868 39.565  -0.510  1.00 33.31 ? 409  TYR A CE2   1 
ATOM   3505 C  CZ    . TYR C 3 403 ? 65.940 38.823  -0.031  1.00 33.35 ? 409  TYR A CZ    1 
ATOM   3506 O  OH    . TYR C 3 403 ? 66.113 38.674  1.326   1.00 34.88 ? 409  TYR A OH    1 
ATOM   3507 N  N     . VAL C 3 404 ? 66.596 40.366  -7.359  1.00 30.02 ? 410  VAL A N     1 
ATOM   3508 C  CA    . VAL C 3 404 ? 66.940 39.833  -8.684  1.00 30.41 ? 410  VAL A CA    1 
ATOM   3509 C  C     . VAL C 3 404 ? 68.435 39.581  -8.744  1.00 29.89 ? 410  VAL A C     1 
ATOM   3510 O  O     . VAL C 3 404 ? 69.225 40.497  -8.523  1.00 28.92 ? 410  VAL A O     1 
ATOM   3511 C  CB    . VAL C 3 404 ? 66.623 40.800  -9.848  1.00 32.06 ? 410  VAL A CB    1 
ATOM   3512 C  CG1   . VAL C 3 404 ? 66.260 39.983  -11.099 1.00 29.50 ? 410  VAL A CG1   1 
ATOM   3513 C  CG2   . VAL C 3 404 ? 65.530 41.762  -9.471  1.00 32.51 ? 410  VAL A CG2   1 
ATOM   3514 N  N     . ALA C 3 405 ? 68.828 38.345  -9.040  1.00 30.23 ? 411  ALA A N     1 
ATOM   3515 C  CA    . ALA C 3 405 ? 70.243 38.009  -9.127  1.00 30.34 ? 411  ALA A CA    1 
ATOM   3516 C  C     . ALA C 3 405 ? 70.791 38.370  -10.503 1.00 31.68 ? 411  ALA A C     1 
ATOM   3517 O  O     . ALA C 3 405 ? 70.071 38.889  -11.351 1.00 32.47 ? 411  ALA A O     1 
ATOM   3518 C  CB    . ALA C 3 405 ? 70.450 36.524  -8.859  1.00 27.66 ? 411  ALA A CB    1 
ATOM   3519 N  N     . GLU C 3 406 ? 72.069 38.069  -10.713 1.00 34.07 ? 412  GLU A N     1 
ATOM   3520 C  CA    . GLU C 3 406 ? 72.760 38.349  -11.970 1.00 35.94 ? 412  GLU A CA    1 
ATOM   3521 C  C     . GLU C 3 406 ? 72.189 37.561  -13.160 1.00 34.50 ? 412  GLU A C     1 
ATOM   3522 O  O     . GLU C 3 406 ? 72.228 38.025  -14.300 1.00 34.91 ? 412  GLU A O     1 
ATOM   3523 C  CB    . GLU C 3 406 ? 74.248 38.025  -11.805 1.00 39.26 ? 412  GLU A CB    1 
ATOM   3524 C  CG    . GLU C 3 406 ? 75.197 38.956  -12.547 1.00 43.16 ? 412  GLU A CG    1 
ATOM   3525 C  CD    . GLU C 3 406 ? 76.658 38.536  -12.414 1.00 46.46 ? 412  GLU A CD    1 
ATOM   3526 O  OE1   . GLU C 3 406 ? 77.543 39.322  -12.820 1.00 47.98 ? 412  GLU A OE1   1 
ATOM   3527 O  OE2   . GLU C 3 406 ? 76.924 37.417  -11.911 1.00 46.74 ? 412  GLU A OE2   1 
ATOM   3528 N  N     . ASP C 3 407 ? 71.661 36.371  -12.895 1.00 33.55 ? 413  ASP A N     1 
ATOM   3529 C  CA    . ASP C 3 407 ? 71.090 35.547  -13.957 1.00 31.51 ? 413  ASP A CA    1 
ATOM   3530 C  C     . ASP C 3 407 ? 69.665 35.969  -14.348 1.00 30.63 ? 413  ASP A C     1 
ATOM   3531 O  O     . ASP C 3 407 ? 68.976 35.251  -15.074 1.00 29.73 ? 413  ASP A O     1 
ATOM   3532 C  CB    . ASP C 3 407 ? 71.103 34.065  -13.552 1.00 31.46 ? 413  ASP A CB    1 
ATOM   3533 C  CG    . ASP C 3 407 ? 70.432 33.804  -12.195 1.00 33.34 ? 413  ASP A CG    1 
ATOM   3534 O  OD1   . ASP C 3 407 ? 69.711 34.682  -11.665 1.00 33.47 ? 413  ASP A OD1   1 
ATOM   3535 O  OD2   . ASP C 3 407 ? 70.625 32.696  -11.662 1.00 32.94 ? 413  ASP A OD2   1 
ATOM   3536 N  N     . GLY C 3 408 ? 69.228 37.127  -13.860 1.00 29.10 ? 414  GLY A N     1 
ATOM   3537 C  CA    . GLY C 3 408 ? 67.897 37.629  -14.186 1.00 27.33 ? 414  GLY A CA    1 
ATOM   3538 C  C     . GLY C 3 408 ? 66.742 36.872  -13.551 1.00 27.93 ? 414  GLY A C     1 
ATOM   3539 O  O     . GLY C 3 408 ? 65.607 36.906  -14.044 1.00 28.09 ? 414  GLY A O     1 
ATOM   3540 N  N     . LYS C 3 409 ? 67.025 36.182  -12.453 1.00 26.09 ? 415  LYS A N     1 
ATOM   3541 C  CA    . LYS C 3 409 ? 66.004 35.409  -11.765 1.00 25.22 ? 415  LYS A CA    1 
ATOM   3542 C  C     . LYS C 3 409 ? 66.000 35.724  -10.278 1.00 24.40 ? 415  LYS A C     1 
ATOM   3543 O  O     . LYS C 3 409 ? 67.000 36.188  -9.736  1.00 24.53 ? 415  LYS A O     1 
ATOM   3544 C  CB    . LYS C 3 409 ? 66.280 33.913  -11.960 1.00 25.54 ? 415  LYS A CB    1 
ATOM   3545 C  CG    . LYS C 3 409 ? 66.289 33.471  -13.426 1.00 25.59 ? 415  LYS A CG    1 
ATOM   3546 C  CD    . LYS C 3 409 ? 67.170 32.261  -13.643 1.00 27.87 ? 415  LYS A CD    1 
ATOM   3547 C  CE    . LYS C 3 409 ? 67.096 31.756  -15.085 1.00 29.21 ? 415  LYS A CE    1 
ATOM   3548 N  NZ    . LYS C 3 409 ? 67.451 32.797  -16.094 1.00 31.60 ? 415  LYS A NZ    1 
ATOM   3549 N  N     . ILE C 3 410 ? 64.873 35.465  -9.628  1.00 22.20 ? 416  ILE A N     1 
ATOM   3550 C  CA    . ILE C 3 410 ? 64.759 35.662  -8.190  1.00 24.24 ? 416  ILE A CA    1 
ATOM   3551 C  C     . ILE C 3 410 ? 64.799 34.262  -7.580  1.00 24.93 ? 416  ILE A C     1 
ATOM   3552 O  O     . ILE C 3 410 ? 64.040 33.373  -7.969  1.00 25.81 ? 416  ILE A O     1 
ATOM   3553 C  CB    . ILE C 3 410 ? 63.439 36.388  -7.812  1.00 23.62 ? 416  ILE A CB    1 
ATOM   3554 C  CG1   . ILE C 3 410 ? 63.536 37.860  -8.234  1.00 21.46 ? 416  ILE A CG1   1 
ATOM   3555 C  CG2   . ILE C 3 410 ? 63.168 36.262  -6.312  1.00 23.39 ? 416  ILE A CG2   1 
ATOM   3556 C  CD1   . ILE C 3 410 ? 62.251 38.645  -8.073  1.00 19.67 ? 416  ILE A CD1   1 
ATOM   3557 N  N     . HIS C 3 411 ? 65.712 34.070  -6.639  1.00 25.25 ? 417  HIS A N     1 
ATOM   3558 C  CA    . HIS C 3 411 ? 65.891 32.785  -5.986  1.00 26.28 ? 417  HIS A CA    1 
ATOM   3559 C  C     . HIS C 3 411 ? 65.317 32.825  -4.570  1.00 26.77 ? 417  HIS A C     1 
ATOM   3560 O  O     . HIS C 3 411 ? 66.060 32.892  -3.592  1.00 26.34 ? 417  HIS A O     1 
ATOM   3561 C  CB    . HIS C 3 411 ? 67.382 32.463  -5.964  1.00 26.49 ? 417  HIS A CB    1 
ATOM   3562 C  CG    . HIS C 3 411 ? 68.002 32.450  -7.324  1.00 26.87 ? 417  HIS A CG    1 
ATOM   3563 N  ND1   . HIS C 3 411 ? 68.210 31.287  -8.037  1.00 27.18 ? 417  HIS A ND1   1 
ATOM   3564 C  CD2   . HIS C 3 411 ? 68.409 33.463  -8.129  1.00 25.32 ? 417  HIS A CD2   1 
ATOM   3565 C  CE1   . HIS C 3 411 ? 68.718 31.585  -9.221  1.00 26.60 ? 417  HIS A CE1   1 
ATOM   3566 N  NE2   . HIS C 3 411 ? 68.848 32.898  -9.303  1.00 27.50 ? 417  HIS A NE2   1 
ATOM   3567 N  N     . GLY C 3 412 ? 63.988 32.798  -4.479  1.00 25.88 ? 418  GLY A N     1 
ATOM   3568 C  CA    . GLY C 3 412 ? 63.326 32.831  -3.187  1.00 25.21 ? 418  GLY A CA    1 
ATOM   3569 C  C     . GLY C 3 412 ? 63.596 31.568  -2.386  1.00 26.82 ? 418  GLY A C     1 
ATOM   3570 O  O     . GLY C 3 412 ? 63.742 30.482  -2.947  1.00 25.13 ? 418  GLY A O     1 
ATOM   3571 N  N     . SER C 3 413 ? 63.672 31.704  -1.067  1.00 25.85 ? 419  SER A N     1 
ATOM   3572 C  CA    . SER C 3 413 ? 63.932 30.555  -0.217  1.00 24.75 ? 419  SER A CA    1 
ATOM   3573 C  C     . SER C 3 413 ? 62.652 29.799  0.135   1.00 26.16 ? 419  SER A C     1 
ATOM   3574 O  O     . SER C 3 413 ? 61.558 30.370  0.173   1.00 24.58 ? 419  SER A O     1 
ATOM   3575 C  CB    . SER C 3 413 ? 64.643 31.004  1.058   1.00 25.90 ? 419  SER A CB    1 
ATOM   3576 O  OG    . SER C 3 413 ? 64.818 29.914  1.943   1.00 30.82 ? 419  SER A OG    1 
ATOM   3577 N  N     . VAL C 3 414 ? 62.787 28.502  0.379   1.00 24.53 ? 420  VAL A N     1 
ATOM   3578 C  CA    . VAL C 3 414 ? 61.637 27.692  0.732   1.00 25.36 ? 420  VAL A CA    1 
ATOM   3579 C  C     . VAL C 3 414 ? 61.979 26.767  1.889   1.00 25.66 ? 420  VAL A C     1 
ATOM   3580 O  O     . VAL C 3 414 ? 62.982 26.060  1.836   1.00 26.61 ? 420  VAL A O     1 
ATOM   3581 C  CB    . VAL C 3 414 ? 61.166 26.807  -0.470  1.00 26.78 ? 420  VAL A CB    1 
ATOM   3582 C  CG1   . VAL C 3 414 ? 60.156 25.785  0.005   1.00 26.49 ? 420  VAL A CG1   1 
ATOM   3583 C  CG2   . VAL C 3 414 ? 60.555 27.675  -1.575  1.00 27.35 ? 420  VAL A CG2   1 
ATOM   3584 N  N     . ASN C 3 415 ? 61.171 26.795  2.945   1.00 24.38 ? 421  ASN A N     1 
ATOM   3585 C  CA    . ASN C 3 415 ? 61.371 25.872  4.060   1.00 25.18 ? 421  ASN A CA    1 
ATOM   3586 C  C     . ASN C 3 415 ? 60.317 24.818  3.728   1.00 25.63 ? 421  ASN A C     1 
ATOM   3587 O  O     . ASN C 3 415 ? 59.130 25.031  3.962   1.00 25.88 ? 421  ASN A O     1 
ATOM   3588 C  CB    . ASN C 3 415 ? 61.046 26.516  5.405   1.00 23.88 ? 421  ASN A CB    1 
ATOM   3589 C  CG    . ASN C 3 415 ? 61.142 25.518  6.561   1.00 25.52 ? 421  ASN A CG    1 
ATOM   3590 O  OD1   . ASN C 3 415 ? 60.927 24.325  6.371   1.00 21.61 ? 421  ASN A OD1   1 
ATOM   3591 N  ND2   . ASN C 3 415 ? 61.451 26.011  7.761   1.00 24.74 ? 421  ASN A ND2   1 
ATOM   3592 N  N     . PRO C 3 416 ? 60.743 23.669  3.180   1.00 25.59 ? 422  PRO A N     1 
ATOM   3593 C  CA    . PRO C 3 416 ? 59.879 22.550  2.778   1.00 25.71 ? 422  PRO A CA    1 
ATOM   3594 C  C     . PRO C 3 416 ? 58.884 22.038  3.814   1.00 26.91 ? 422  PRO A C     1 
ATOM   3595 O  O     . PRO C 3 416 ? 57.825 21.517  3.458   1.00 26.43 ? 422  PRO A O     1 
ATOM   3596 C  CB    . PRO C 3 416 ? 60.874 21.463  2.367   1.00 25.75 ? 422  PRO A CB    1 
ATOM   3597 C  CG    . PRO C 3 416 ? 62.111 22.224  2.005   1.00 25.91 ? 422  PRO A CG    1 
ATOM   3598 C  CD    . PRO C 3 416 ? 62.162 23.290  3.070   1.00 25.03 ? 422  PRO A CD    1 
ATOM   3599 N  N     . ASN C 3 417 ? 59.222 22.168  5.090   1.00 25.55 ? 423  ASN A N     1 
ATOM   3600 C  CA    . ASN C 3 417 ? 58.328 21.688  6.132   1.00 27.32 ? 423  ASN A CA    1 
ATOM   3601 C  C     . ASN C 3 417 ? 58.217 22.753  7.208   1.00 27.96 ? 423  ASN A C     1 
ATOM   3602 O  O     . ASN C 3 417 ? 58.396 22.475  8.391   1.00 28.29 ? 423  ASN A O     1 
ATOM   3603 C  CB    . ASN C 3 417 ? 58.866 20.376  6.724   1.00 25.34 ? 423  ASN A CB    1 
ATOM   3604 C  CG    . ASN C 3 417 ? 57.763 19.496  7.278   1.00 26.74 ? 423  ASN A CG    1 
ATOM   3605 O  OD1   . ASN C 3 417 ? 56.889 19.054  6.539   1.00 24.81 ? 423  ASN A OD1   1 
ATOM   3606 N  ND2   . ASN C 3 417 ? 57.792 19.248  8.585   1.00 25.25 ? 423  ASN A ND2   1 
ATOM   3607 N  N     . GLY C 3 418 ? 57.911 23.975  6.781   1.00 27.71 ? 424  GLY A N     1 
ATOM   3608 C  CA    . GLY C 3 418 ? 57.800 25.087  7.707   1.00 28.76 ? 424  GLY A CA    1 
ATOM   3609 C  C     . GLY C 3 418 ? 56.545 25.139  8.558   1.00 29.94 ? 424  GLY A C     1 
ATOM   3610 O  O     . GLY C 3 418 ? 56.461 25.939  9.487   1.00 30.99 ? 424  GLY A O     1 
ATOM   3611 N  N     . ALA C 3 419 ? 55.562 24.308  8.239   1.00 29.95 ? 425  ALA A N     1 
ATOM   3612 C  CA    . ALA C 3 419 ? 54.322 24.269  9.008   1.00 30.00 ? 425  ALA A CA    1 
ATOM   3613 C  C     . ALA C 3 419 ? 54.194 22.869  9.575   1.00 30.33 ? 425  ALA A C     1 
ATOM   3614 O  O     . ALA C 3 419 ? 54.606 21.900  8.937   1.00 29.96 ? 425  ALA A O     1 
ATOM   3615 C  CB    . ALA C 3 419 ? 53.132 24.599  8.113   1.00 29.93 ? 425  ALA A CB    1 
ATOM   3616 N  N     . VAL C 3 420 ? 53.621 22.755  10.770  1.00 31.08 ? 426  VAL A N     1 
ATOM   3617 C  CA    . VAL C 3 420 ? 53.486 21.458  11.414  1.00 30.84 ? 426  VAL A CA    1 
ATOM   3618 C  C     . VAL C 3 420 ? 52.665 20.439  10.619  1.00 31.22 ? 426  VAL A C     1 
ATOM   3619 O  O     . VAL C 3 420 ? 52.832 19.230  10.790  1.00 32.70 ? 426  VAL A O     1 
ATOM   3620 C  CB    . VAL C 3 420 ? 52.888 21.606  12.829  1.00 33.38 ? 426  VAL A CB    1 
ATOM   3621 C  CG1   . VAL C 3 420 ? 51.417 22.029  12.750  1.00 33.42 ? 426  VAL A CG1   1 
ATOM   3622 C  CG2   . VAL C 3 420 ? 53.052 20.304  13.585  1.00 32.04 ? 426  VAL A CG2   1 
ATOM   3623 N  N     . THR C 3 421 ? 51.790 20.929  9.748   1.00 30.66 ? 427  THR A N     1 
ATOM   3624 C  CA    . THR C 3 421 ? 50.946 20.069  8.913   1.00 28.98 ? 427  THR A CA    1 
ATOM   3625 C  C     . THR C 3 421 ? 51.730 19.441  7.759   1.00 28.82 ? 427  THR A C     1 
ATOM   3626 O  O     . THR C 3 421 ? 51.257 18.511  7.110   1.00 28.84 ? 427  THR A O     1 
ATOM   3627 C  CB    . THR C 3 421 ? 49.828 20.878  8.270   1.00 29.07 ? 427  THR A CB    1 
ATOM   3628 O  OG1   . THR C 3 421 ? 50.405 22.050  7.678   1.00 27.89 ? 427  THR A OG1   1 
ATOM   3629 C  CG2   . THR C 3 421 ? 48.784 21.283  9.301   1.00 28.88 ? 427  THR A CG2   1 
ATOM   3630 N  N     . GLY C 3 422 ? 52.920 19.963  7.493   1.00 27.55 ? 428  GLY A N     1 
ATOM   3631 C  CA    . GLY C 3 422 ? 53.702 19.436  6.389   1.00 26.26 ? 428  GLY A CA    1 
ATOM   3632 C  C     . GLY C 3 422 ? 53.709 20.424  5.242   1.00 25.81 ? 428  GLY A C     1 
ATOM   3633 O  O     . GLY C 3 422 ? 54.281 20.172  4.187   1.00 24.82 ? 428  GLY A O     1 
ATOM   3634 N  N     . ARG C 3 423 ? 53.043 21.552  5.458   1.00 25.59 ? 429  ARG A N     1 
ATOM   3635 C  CA    . ARG C 3 423 ? 52.969 22.623  4.474   1.00 27.00 ? 429  ARG A CA    1 
ATOM   3636 C  C     . ARG C 3 423 ? 54.324 23.337  4.470   1.00 26.42 ? 429  ARG A C     1 
ATOM   3637 O  O     . ARG C 3 423 ? 55.002 23.401  5.496   1.00 24.36 ? 429  ARG A O     1 
ATOM   3638 C  CB    . ARG C 3 423 ? 51.875 23.622  4.884   1.00 30.95 ? 429  ARG A CB    1 
ATOM   3639 C  CG    . ARG C 3 423 ? 50.965 24.062  3.757   1.00 34.40 ? 429  ARG A CG    1 
ATOM   3640 C  CD    . ARG C 3 423 ? 49.781 23.135  3.594   1.00 36.31 ? 429  ARG A CD    1 
ATOM   3641 N  NE    . ARG C 3 423 ? 49.456 22.929  2.185   1.00 37.15 ? 429  ARG A NE    1 
ATOM   3642 C  CZ    . ARG C 3 423 ? 48.342 22.356  1.745   1.00 37.59 ? 429  ARG A CZ    1 
ATOM   3643 N  NH1   . ARG C 3 423 ? 47.421 21.931  2.606   1.00 38.79 ? 429  ARG A NH1   1 
ATOM   3644 N  NH2   . ARG C 3 423 ? 48.154 22.194  0.442   1.00 35.08 ? 429  ARG A NH2   1 
ATOM   3645 N  N     . ALA C 3 424 ? 54.726 23.866  3.321   1.00 27.03 ? 430  ALA A N     1 
ATOM   3646 C  CA    . ALA C 3 424 ? 55.995 24.578  3.227   1.00 27.65 ? 430  ALA A CA    1 
ATOM   3647 C  C     . ALA C 3 424 ? 55.770 26.071  3.466   1.00 27.49 ? 430  ALA A C     1 
ATOM   3648 O  O     . ALA C 3 424 ? 54.637 26.540  3.428   1.00 28.31 ? 430  ALA A O     1 
ATOM   3649 C  CB    . ALA C 3 424 ? 56.616 24.361  1.850   1.00 27.31 ? 430  ALA A CB    1 
ATOM   3650 N  N     . THR C 3 425 ? 56.847 26.806  3.738   1.00 26.51 ? 431  THR A N     1 
ATOM   3651 C  CA    . THR C 3 425 ? 56.768 28.254  3.929   1.00 26.12 ? 431  THR A CA    1 
ATOM   3652 C  C     . THR C 3 425 ? 57.741 28.878  2.929   1.00 25.07 ? 431  THR A C     1 
ATOM   3653 O  O     . THR C 3 425 ? 58.681 28.217  2.488   1.00 22.53 ? 431  THR A O     1 
ATOM   3654 C  CB    . THR C 3 425 ? 57.174 28.674  5.354   1.00 28.99 ? 431  THR A CB    1 
ATOM   3655 O  OG1   . THR C 3 425 ? 58.460 28.116  5.671   1.00 29.58 ? 431  THR A OG1   1 
ATOM   3656 C  CG2   . THR C 3 425 ? 56.122 28.195  6.369   1.00 29.97 ? 431  THR A CG2   1 
ATOM   3657 N  N     . HIS C 3 426 ? 57.523 30.141  2.580   1.00 25.16 ? 432  HIS A N     1 
ATOM   3658 C  CA    . HIS C 3 426 ? 58.371 30.836  1.605   1.00 24.89 ? 432  HIS A CA    1 
ATOM   3659 C  C     . HIS C 3 426 ? 58.863 32.176  2.137   1.00 25.67 ? 432  HIS A C     1 
ATOM   3660 O  O     . HIS C 3 426 ? 58.116 32.895  2.810   1.00 25.96 ? 432  HIS A O     1 
ATOM   3661 C  CB    . HIS C 3 426 ? 57.589 31.102  0.316   1.00 26.13 ? 432  HIS A CB    1 
ATOM   3662 C  CG    . HIS C 3 426 ? 57.009 29.874  -0.314  1.00 26.16 ? 432  HIS A CG    1 
ATOM   3663 N  ND1   . HIS C 3 426 ? 56.057 29.096  0.306   1.00 28.55 ? 432  HIS A ND1   1 
ATOM   3664 C  CD2   . HIS C 3 426 ? 57.242 29.296  -1.516  1.00 27.86 ? 432  HIS A CD2   1 
ATOM   3665 C  CE1   . HIS C 3 426 ? 55.728 28.091  -0.486  1.00 27.99 ? 432  HIS A CE1   1 
ATOM   3666 N  NE2   . HIS C 3 426 ? 56.433 28.188  -1.597  1.00 27.86 ? 432  HIS A NE2   1 
ATOM   3667 N  N     . ALA C 3 427 ? 60.102 32.532  1.802   1.00 23.76 ? 433  ALA A N     1 
ATOM   3668 C  CA    . ALA C 3 427 ? 60.672 33.796  2.258   1.00 23.04 ? 433  ALA A CA    1 
ATOM   3669 C  C     . ALA C 3 427 ? 61.906 34.195  1.458   1.00 21.70 ? 433  ALA A C     1 
ATOM   3670 O  O     . ALA C 3 427 ? 62.478 33.384  0.741   1.00 23.13 ? 433  ALA A O     1 
ATOM   3671 C  CB    . ALA C 3 427 ? 61.037 33.691  3.750   1.00 21.43 ? 433  ALA A CB    1 
ATOM   3672 N  N     . PHE C 3 428 ? 62.285 35.462  1.583   1.00 23.73 ? 434  PHE A N     1 
ATOM   3673 C  CA    . PHE C 3 428 ? 63.477 36.024  0.949   1.00 24.27 ? 434  PHE A CA    1 
ATOM   3674 C  C     . PHE C 3 428 ? 63.587 36.006  -0.577  1.00 23.52 ? 434  PHE A C     1 
ATOM   3675 O  O     . PHE C 3 428 ? 64.563 35.503  -1.121  1.00 23.44 ? 434  PHE A O     1 
ATOM   3676 C  CB    . PHE C 3 428 ? 64.730 35.357  1.535   1.00 25.65 ? 434  PHE A CB    1 
ATOM   3677 C  CG    . PHE C 3 428 ? 64.727 35.263  3.038   1.00 30.73 ? 434  PHE A CG    1 
ATOM   3678 C  CD1   . PHE C 3 428 ? 64.550 36.402  3.824   1.00 34.88 ? 434  PHE A CD1   1 
ATOM   3679 C  CD2   . PHE C 3 428 ? 64.913 34.037  3.671   1.00 32.85 ? 434  PHE A CD2   1 
ATOM   3680 C  CE1   . PHE C 3 428 ? 64.560 36.318  5.229   1.00 35.85 ? 434  PHE A CE1   1 
ATOM   3681 C  CE2   . PHE C 3 428 ? 64.925 33.940  5.064   1.00 35.37 ? 434  PHE A CE2   1 
ATOM   3682 C  CZ    . PHE C 3 428 ? 64.748 35.084  5.847   1.00 34.90 ? 434  PHE A CZ    1 
ATOM   3683 N  N     . PRO C 3 429 ? 62.582 36.526  -1.292  1.00 24.54 ? 435  PRO A N     1 
ATOM   3684 C  CA    . PRO C 3 429 ? 61.343 37.117  -0.781  1.00 25.05 ? 435  PRO A CA    1 
ATOM   3685 C  C     . PRO C 3 429 ? 60.296 36.010  -0.726  1.00 24.92 ? 435  PRO A C     1 
ATOM   3686 O  O     . PRO C 3 429 ? 60.552 34.894  -1.184  1.00 23.35 ? 435  PRO A O     1 
ATOM   3687 C  CB    . PRO C 3 429 ? 61.016 38.176  -1.828  1.00 26.17 ? 435  PRO A CB    1 
ATOM   3688 C  CG    . PRO C 3 429 ? 61.455 37.498  -3.097  1.00 26.02 ? 435  PRO A CG    1 
ATOM   3689 C  CD    . PRO C 3 429 ? 62.790 36.894  -2.704  1.00 24.10 ? 435  PRO A CD    1 
ATOM   3690 N  N     . ASN C 3 430 ? 59.135 36.309  -0.155  1.00 24.77 ? 436  ASN A N     1 
ATOM   3691 C  CA    . ASN C 3 430 ? 58.059 35.330  -0.063  1.00 24.67 ? 436  ASN A CA    1 
ATOM   3692 C  C     . ASN C 3 430 ? 57.300 35.251  -1.399  1.00 26.88 ? 436  ASN A C     1 
ATOM   3693 O  O     . ASN C 3 430 ? 56.392 36.042  -1.650  1.00 25.93 ? 436  ASN A O     1 
ATOM   3694 C  CB    . ASN C 3 430 ? 57.085 35.721  1.052   1.00 23.73 ? 436  ASN A CB    1 
ATOM   3695 C  CG    . ASN C 3 430 ? 55.977 34.714  1.222   1.00 24.25 ? 436  ASN A CG    1 
ATOM   3696 O  OD1   . ASN C 3 430 ? 55.755 33.880  0.347   1.00 26.67 ? 436  ASN A OD1   1 
ATOM   3697 N  ND2   . ASN C 3 430 ? 55.265 34.786  2.345   1.00 24.25 ? 436  ASN A ND2   1 
ATOM   3698 N  N     . LEU C 3 431 ? 57.665 34.281  -2.234  1.00 26.43 ? 437  LEU A N     1 
ATOM   3699 C  CA    . LEU C 3 431 ? 57.051 34.108  -3.545  1.00 28.41 ? 437  LEU A CA    1 
ATOM   3700 C  C     . LEU C 3 431 ? 55.654 33.500  -3.525  1.00 30.34 ? 437  LEU A C     1 
ATOM   3701 O  O     . LEU C 3 431 ? 55.093 33.194  -4.580  1.00 30.26 ? 437  LEU A O     1 
ATOM   3702 C  CB    . LEU C 3 431 ? 57.965 33.262  -4.437  1.00 29.93 ? 437  LEU A CB    1 
ATOM   3703 C  CG    . LEU C 3 431 ? 59.386 33.813  -4.609  1.00 32.29 ? 437  LEU A CG    1 
ATOM   3704 C  CD1   . LEU C 3 431 ? 60.203 32.878  -5.503  1.00 35.12 ? 437  LEU A CD1   1 
ATOM   3705 C  CD2   . LEU C 3 431 ? 59.331 35.208  -5.200  1.00 33.36 ? 437  LEU A CD2   1 
ATOM   3706 N  N     . ALA C 3 432 ? 55.101 33.316  -2.326  1.00 30.86 ? 438  ALA A N     1 
ATOM   3707 C  CA    . ALA C 3 432 ? 53.761 32.767  -2.179  1.00 29.66 ? 438  ALA A CA    1 
ATOM   3708 C  C     . ALA C 3 432 ? 52.791 33.885  -1.807  1.00 30.53 ? 438  ALA A C     1 
ATOM   3709 O  O     . ALA C 3 432 ? 51.635 33.619  -1.481  1.00 30.83 ? 438  ALA A O     1 
ATOM   3710 C  CB    . ALA C 3 432 ? 53.745 31.679  -1.099  1.00 30.36 ? 438  ALA A CB    1 
ATOM   3711 N  N     . GLN C 3 433 ? 53.266 35.131  -1.842  1.00 30.57 ? 439  GLN A N     1 
ATOM   3712 C  CA    . GLN C 3 433 ? 52.418 36.278  -1.511  1.00 29.73 ? 439  GLN A CA    1 
ATOM   3713 C  C     . GLN C 3 433 ? 52.413 37.355  -2.604  1.00 28.28 ? 439  GLN A C     1 
ATOM   3714 O  O     . GLN C 3 433 ? 52.095 38.511  -2.344  1.00 29.00 ? 439  GLN A O     1 
ATOM   3715 C  CB    . GLN C 3 433 ? 52.827 36.903  -0.155  1.00 28.77 ? 439  GLN A CB    1 
ATOM   3716 C  CG    . GLN C 3 433 ? 54.222 37.531  -0.105  1.00 28.91 ? 439  GLN A CG    1 
ATOM   3717 C  CD    . GLN C 3 433 ? 54.581 38.099  1.278   1.00 29.95 ? 439  GLN A CD    1 
ATOM   3718 O  OE1   . GLN C 3 433 ? 55.690 38.596  1.485   1.00 28.46 ? 439  GLN A OE1   1 
ATOM   3719 N  NE2   . GLN C 3 433 ? 53.641 38.030  2.222   1.00 27.68 ? 439  GLN A NE2   1 
ATOM   3720 N  N     . ILE C 3 434 ? 52.778 36.974  -3.822  1.00 27.35 ? 440  ILE A N     1 
ATOM   3721 C  CA    . ILE C 3 434 ? 52.771 37.913  -4.939  1.00 28.17 ? 440  ILE A CA    1 
ATOM   3722 C  C     . ILE C 3 434 ? 51.312 38.273  -5.245  1.00 27.13 ? 440  ILE A C     1 
ATOM   3723 O  O     . ILE C 3 434 ? 50.444 37.407  -5.261  1.00 25.47 ? 440  ILE A O     1 
ATOM   3724 C  CB    . ILE C 3 434 ? 53.392 37.297  -6.208  1.00 29.11 ? 440  ILE A CB    1 
ATOM   3725 C  CG1   . ILE C 3 434 ? 54.868 36.983  -5.963  1.00 27.25 ? 440  ILE A CG1   1 
ATOM   3726 C  CG2   . ILE C 3 434 ? 53.253 38.269  -7.380  1.00 28.14 ? 440  ILE A CG2   1 
ATOM   3727 C  CD1   . ILE C 3 434 ? 55.529 36.321  -7.143  1.00 31.50 ? 440  ILE A CD1   1 
ATOM   3728 N  N     . PRO C 3 435 ? 51.027 39.559  -5.467  1.00 27.77 ? 441  PRO A N     1 
ATOM   3729 C  CA    . PRO C 3 435 ? 49.655 39.992  -5.766  1.00 29.26 ? 441  PRO A CA    1 
ATOM   3730 C  C     . PRO C 3 435 ? 48.978 39.174  -6.867  1.00 30.51 ? 441  PRO A C     1 
ATOM   3731 O  O     . PRO C 3 435 ? 49.560 38.954  -7.930  1.00 29.83 ? 441  PRO A O     1 
ATOM   3732 C  CB    . PRO C 3 435 ? 49.843 41.456  -6.158  1.00 27.98 ? 441  PRO A CB    1 
ATOM   3733 C  CG    . PRO C 3 435 ? 50.952 41.889  -5.236  1.00 28.12 ? 441  PRO A CG    1 
ATOM   3734 C  CD    . PRO C 3 435 ? 51.929 40.718  -5.321  1.00 28.30 ? 441  PRO A CD    1 
ATOM   3735 N  N     . GLY C 3 436 ? 47.753 38.724  -6.605  1.00 31.39 ? 442  GLY A N     1 
ATOM   3736 C  CA    . GLY C 3 436 ? 47.018 37.946  -7.594  1.00 33.06 ? 442  GLY A CA    1 
ATOM   3737 C  C     . GLY C 3 436 ? 46.524 38.806  -8.746  1.00 34.01 ? 442  GLY A C     1 
ATOM   3738 O  O     . GLY C 3 436 ? 46.431 40.024  -8.614  1.00 32.89 ? 442  GLY A O     1 
ATOM   3739 N  N     . VAL C 3 437 ? 46.207 38.184  -9.881  1.00 35.88 ? 443  VAL A N     1 
ATOM   3740 C  CA    . VAL C 3 437 ? 45.732 38.940  -11.039 1.00 37.66 ? 443  VAL A CA    1 
ATOM   3741 C  C     . VAL C 3 437 ? 44.459 39.724  -10.727 1.00 39.75 ? 443  VAL A C     1 
ATOM   3742 O  O     . VAL C 3 437 ? 44.188 40.741  -11.364 1.00 39.31 ? 443  VAL A O     1 
ATOM   3743 C  CB    . VAL C 3 437 ? 45.464 38.025  -12.266 1.00 37.10 ? 443  VAL A CB    1 
ATOM   3744 C  CG1   . VAL C 3 437 ? 46.757 37.376  -12.724 1.00 36.17 ? 443  VAL A CG1   1 
ATOM   3745 C  CG2   . VAL C 3 437 ? 44.423 36.970  -11.926 1.00 38.46 ? 443  VAL A CG2   1 
ATOM   3746 N  N     . ARG C 3 438 ? 43.690 39.259  -9.744  1.00 42.40 ? 444  ARG A N     1 
ATOM   3747 C  CA    . ARG C 3 438 ? 42.446 39.928  -9.355  1.00 45.49 ? 444  ARG A CA    1 
ATOM   3748 C  C     . ARG C 3 438 ? 42.661 41.166  -8.490  1.00 44.83 ? 444  ARG A C     1 
ATOM   3749 O  O     . ARG C 3 438 ? 41.715 41.907  -8.214  1.00 45.79 ? 444  ARG A O     1 
ATOM   3750 C  CB    . ARG C 3 438 ? 41.525 38.960  -8.602  1.00 48.91 ? 444  ARG A CB    1 
ATOM   3751 C  CG    . ARG C 3 438 ? 40.720 38.018  -9.491  1.00 53.61 ? 444  ARG A CG    1 
ATOM   3752 C  CD    . ARG C 3 438 ? 39.793 38.792  -10.422 1.00 57.60 ? 444  ARG A CD    1 
ATOM   3753 N  NE    . ARG C 3 438 ? 38.485 38.152  -10.554 1.00 61.48 ? 444  ARG A NE    1 
ATOM   3754 C  CZ    . ARG C 3 438 ? 38.282 36.949  -11.086 1.00 62.77 ? 444  ARG A CZ    1 
ATOM   3755 N  NH1   . ARG C 3 438 ? 39.304 36.238  -11.548 1.00 62.99 ? 444  ARG A NH1   1 
ATOM   3756 N  NH2   . ARG C 3 438 ? 37.050 36.456  -11.158 1.00 63.26 ? 444  ARG A NH2   1 
ATOM   3757 N  N     . SER C 3 439 ? 43.896 41.385  -8.052  1.00 43.04 ? 445  SER A N     1 
ATOM   3758 C  CA    . SER C 3 439 ? 44.212 42.540  -7.218  1.00 41.16 ? 445  SER A CA    1 
ATOM   3759 C  C     . SER C 3 439 ? 44.755 43.681  -8.051  1.00 40.11 ? 445  SER A C     1 
ATOM   3760 O  O     . SER C 3 439 ? 45.270 43.473  -9.146  1.00 41.03 ? 445  SER A O     1 
ATOM   3761 C  CB    . SER C 3 439 ? 45.250 42.171  -6.156  1.00 39.10 ? 445  SER A CB    1 
ATOM   3762 O  OG    . SER C 3 439 ? 44.735 41.214  -5.253  1.00 42.56 ? 445  SER A OG    1 
ATOM   3763 N  N     . PRO C 3 440 ? 44.648 44.913  -7.538  1.00 39.36 ? 446  PRO A N     1 
ATOM   3764 C  CA    . PRO C 3 440 ? 45.155 46.066  -8.278  1.00 38.34 ? 446  PRO A CA    1 
ATOM   3765 C  C     . PRO C 3 440 ? 46.634 45.866  -8.574  1.00 38.23 ? 446  PRO A C     1 
ATOM   3766 O  O     . PRO C 3 440 ? 47.423 45.595  -7.664  1.00 36.92 ? 446  PRO A O     1 
ATOM   3767 C  CB    . PRO C 3 440 ? 44.910 47.221  -7.315  1.00 37.91 ? 446  PRO A CB    1 
ATOM   3768 C  CG    . PRO C 3 440 ? 43.658 46.793  -6.613  1.00 39.10 ? 446  PRO A CG    1 
ATOM   3769 C  CD    . PRO C 3 440 ? 43.947 45.341  -6.314  1.00 38.61 ? 446  PRO A CD    1 
ATOM   3770 N  N     . TYR C 3 441 ? 46.992 45.994  -9.847  1.00 37.07 ? 447  TYR A N     1 
ATOM   3771 C  CA    . TYR C 3 441 ? 48.366 45.836  -10.305 1.00 37.02 ? 447  TYR A CA    1 
ATOM   3772 C  C     . TYR C 3 441 ? 48.834 44.378  -10.279 1.00 36.16 ? 447  TYR A C     1 
ATOM   3773 O  O     . TYR C 3 441 ? 49.975 44.076  -10.622 1.00 35.93 ? 447  TYR A O     1 
ATOM   3774 C  CB    . TYR C 3 441 ? 49.295 46.713  -9.464  1.00 38.12 ? 447  TYR A CB    1 
ATOM   3775 C  CG    . TYR C 3 441 ? 48.966 48.190  -9.551  1.00 40.05 ? 447  TYR A CG    1 
ATOM   3776 C  CD1   . TYR C 3 441 ? 49.332 48.944  -10.665 1.00 39.97 ? 447  TYR A CD1   1 
ATOM   3777 C  CD2   . TYR C 3 441 ? 48.279 48.831  -8.521  1.00 41.51 ? 447  TYR A CD2   1 
ATOM   3778 C  CE1   . TYR C 3 441 ? 49.025 50.297  -10.752 1.00 39.99 ? 447  TYR A CE1   1 
ATOM   3779 C  CE2   . TYR C 3 441 ? 47.963 50.188  -8.598  1.00 40.86 ? 447  TYR A CE2   1 
ATOM   3780 C  CZ    . TYR C 3 441 ? 48.339 50.913  -9.714  1.00 41.15 ? 447  TYR A CZ    1 
ATOM   3781 O  OH    . TYR C 3 441 ? 48.028 52.252  -9.789  1.00 42.52 ? 447  TYR A OH    1 
ATOM   3782 N  N     . GLY C 3 442 ? 47.938 43.478  -9.884  1.00 36.41 ? 448  GLY A N     1 
ATOM   3783 C  CA    . GLY C 3 442 ? 48.272 42.069  -9.828  1.00 36.35 ? 448  GLY A CA    1 
ATOM   3784 C  C     . GLY C 3 442 ? 48.713 41.491  -11.161 1.00 37.08 ? 448  GLY A C     1 
ATOM   3785 O  O     . GLY C 3 442 ? 49.658 40.698  -11.215 1.00 36.05 ? 448  GLY A O     1 
ATOM   3786 N  N     . GLU C 3 443 ? 48.040 41.884  -12.241 1.00 37.70 ? 449  GLU A N     1 
ATOM   3787 C  CA    . GLU C 3 443 ? 48.373 41.373  -13.569 1.00 38.04 ? 449  GLU A CA    1 
ATOM   3788 C  C     . GLU C 3 443 ? 49.810 41.703  -13.970 1.00 36.12 ? 449  GLU A C     1 
ATOM   3789 O  O     . GLU C 3 443 ? 50.513 40.863  -14.539 1.00 34.49 ? 449  GLU A O     1 
ATOM   3790 C  CB    . GLU C 3 443 ? 47.404 41.929  -14.618 1.00 42.21 ? 449  GLU A CB    1 
ATOM   3791 C  CG    . GLU C 3 443 ? 47.442 41.165  -15.940 1.00 49.15 ? 449  GLU A CG    1 
ATOM   3792 C  CD    . GLU C 3 443 ? 46.581 41.798  -17.023 1.00 52.82 ? 449  GLU A CD    1 
ATOM   3793 O  OE1   . GLU C 3 443 ? 46.397 41.159  -18.082 1.00 56.18 ? 449  GLU A OE1   1 
ATOM   3794 O  OE2   . GLU C 3 443 ? 46.096 42.934  -16.825 1.00 54.22 ? 449  GLU A OE2   1 
ATOM   3795 N  N     . GLN C 3 444 ? 50.246 42.922  -13.678 1.00 33.44 ? 450  GLN A N     1 
ATOM   3796 C  CA    . GLN C 3 444 ? 51.603 43.334  -14.001 1.00 34.24 ? 450  GLN A CA    1 
ATOM   3797 C  C     . GLN C 3 444 ? 52.615 42.633  -13.097 1.00 33.27 ? 450  GLN A C     1 
ATOM   3798 O  O     . GLN C 3 444 ? 53.713 42.280  -13.532 1.00 31.85 ? 450  GLN A O     1 
ATOM   3799 C  CB    . GLN C 3 444 ? 51.754 44.850  -13.851 1.00 36.24 ? 450  GLN A CB    1 
ATOM   3800 C  CG    . GLN C 3 444 ? 51.203 45.649  -15.023 1.00 38.37 ? 450  GLN A CG    1 
ATOM   3801 C  CD    . GLN C 3 444 ? 51.106 47.130  -14.713 1.00 40.04 ? 450  GLN A CD    1 
ATOM   3802 O  OE1   . GLN C 3 444 ? 50.173 47.573  -14.042 1.00 39.66 ? 450  GLN A OE1   1 
ATOM   3803 N  NE2   . GLN C 3 444 ? 52.082 47.901  -15.185 1.00 41.37 ? 450  GLN A NE2   1 
ATOM   3804 N  N     . CYS C 3 445 ? 52.245 42.441  -11.836 1.00 31.58 ? 451  CYS A N     1 
ATOM   3805 C  CA    . CYS C 3 445 ? 53.133 41.776  -10.894 1.00 31.38 ? 451  CYS A CA    1 
ATOM   3806 C  C     . CYS C 3 445 ? 53.357 40.330  -11.311 1.00 29.57 ? 451  CYS A C     1 
ATOM   3807 O  O     . CYS C 3 445 ? 54.494 39.883  -11.414 1.00 29.62 ? 451  CYS A O     1 
ATOM   3808 C  CB    . CYS C 3 445 ? 52.546 41.816  -9.477  1.00 30.86 ? 451  CYS A CB    1 
ATOM   3809 S  SG    . CYS C 3 445 ? 52.578 43.448  -8.678  1.00 32.12 ? 451  CYS A SG    1 
ATOM   3810 N  N     . ARG C 3 446 ? 52.269 39.611  -11.566 1.00 30.10 ? 452  ARG A N     1 
ATOM   3811 C  CA    . ARG C 3 446 ? 52.347 38.207  -11.951 1.00 30.40 ? 452  ARG A CA    1 
ATOM   3812 C  C     . ARG C 3 446 ? 53.000 37.965  -13.307 1.00 28.78 ? 452  ARG A C     1 
ATOM   3813 O  O     . ARG C 3 446 ? 53.723 36.992  -13.478 1.00 29.45 ? 452  ARG A O     1 
ATOM   3814 C  CB    . ARG C 3 446 ? 50.954 37.575  -11.943 1.00 32.21 ? 452  ARG A CB    1 
ATOM   3815 C  CG    . ARG C 3 446 ? 50.228 37.687  -10.609 1.00 35.86 ? 452  ARG A CG    1 
ATOM   3816 C  CD    . ARG C 3 446 ? 50.951 36.966  -9.469  1.00 37.04 ? 452  ARG A CD    1 
ATOM   3817 N  NE    . ARG C 3 446 ? 50.605 35.555  -9.382  1.00 35.25 ? 452  ARG A NE    1 
ATOM   3818 C  CZ    . ARG C 3 446 ? 50.093 34.967  -8.301  1.00 36.62 ? 452  ARG A CZ    1 
ATOM   3819 N  NH1   . ARG C 3 446 ? 49.859 35.661  -7.196  1.00 35.38 ? 452  ARG A NH1   1 
ATOM   3820 N  NH2   . ARG C 3 446 ? 49.806 33.673  -8.330  1.00 36.14 ? 452  ARG A NH2   1 
ATOM   3821 N  N     . ALA C 3 447 ? 52.757 38.848  -14.267 1.00 25.96 ? 453  ALA A N     1 
ATOM   3822 C  CA    . ALA C 3 447 ? 53.341 38.688  -15.589 1.00 26.33 ? 453  ALA A CA    1 
ATOM   3823 C  C     . ALA C 3 447 ? 54.851 38.877  -15.546 1.00 26.57 ? 453  ALA A C     1 
ATOM   3824 O  O     . ALA C 3 447 ? 55.560 38.439  -16.448 1.00 27.82 ? 453  ALA A O     1 
ATOM   3825 C  CB    . ALA C 3 447 ? 52.705 39.689  -16.583 1.00 27.22 ? 453  ALA A CB    1 
ATOM   3826 N  N     . ALA C 3 448 ? 55.344 39.525  -14.493 1.00 26.58 ? 454  ALA A N     1 
ATOM   3827 C  CA    . ALA C 3 448 ? 56.779 39.765  -14.350 1.00 26.63 ? 454  ALA A CA    1 
ATOM   3828 C  C     . ALA C 3 448 ? 57.542 38.496  -13.960 1.00 27.28 ? 454  ALA A C     1 
ATOM   3829 O  O     . ALA C 3 448 ? 58.754 38.425  -14.132 1.00 28.05 ? 454  ALA A O     1 
ATOM   3830 C  CB    . ALA C 3 448 ? 57.024 40.862  -13.329 1.00 27.30 ? 454  ALA A CB    1 
ATOM   3831 N  N     . PHE C 3 449 ? 56.834 37.514  -13.403 1.00 27.05 ? 455  PHE A N     1 
ATOM   3832 C  CA    . PHE C 3 449 ? 57.445 36.238  -13.044 1.00 26.24 ? 455  PHE A CA    1 
ATOM   3833 C  C     . PHE C 3 449 ? 57.006 35.236  -14.113 1.00 25.48 ? 455  PHE A C     1 
ATOM   3834 O  O     . PHE C 3 449 ? 55.863 34.794  -14.114 1.00 24.92 ? 455  PHE A O     1 
ATOM   3835 C  CB    . PHE C 3 449 ? 56.951 35.743  -11.684 1.00 25.51 ? 455  PHE A CB    1 
ATOM   3836 C  CG    . PHE C 3 449 ? 57.444 36.559  -10.515 1.00 23.92 ? 455  PHE A CG    1 
ATOM   3837 C  CD1   . PHE C 3 449 ? 56.797 37.736  -10.141 1.00 23.12 ? 455  PHE A CD1   1 
ATOM   3838 C  CD2   . PHE C 3 449 ? 58.549 36.136  -9.781  1.00 23.69 ? 455  PHE A CD2   1 
ATOM   3839 C  CE1   . PHE C 3 449 ? 57.250 38.488  -9.030  1.00 22.83 ? 455  PHE A CE1   1 
ATOM   3840 C  CE2   . PHE C 3 449 ? 59.009 36.876  -8.674  1.00 24.80 ? 455  PHE A CE2   1 
ATOM   3841 C  CZ    . PHE C 3 449 ? 58.351 38.056  -8.302  1.00 22.14 ? 455  PHE A CZ    1 
ATOM   3842 N  N     . GLY C 3 450 ? 57.899 34.879  -15.026 1.00 24.54 ? 456  GLY A N     1 
ATOM   3843 C  CA    . GLY C 3 450 ? 57.495 33.947  -16.063 1.00 23.50 ? 456  GLY A CA    1 
ATOM   3844 C  C     . GLY C 3 450 ? 58.649 33.311  -16.802 1.00 24.17 ? 456  GLY A C     1 
ATOM   3845 O  O     . GLY C 3 450 ? 59.731 33.897  -16.925 1.00 22.09 ? 456  GLY A O     1 
ATOM   3846 N  N     . ALA C 3 451 ? 58.416 32.096  -17.287 1.00 23.58 ? 457  ALA A N     1 
ATOM   3847 C  CA    . ALA C 3 451 ? 59.435 31.361  -18.025 1.00 24.41 ? 457  ALA A CA    1 
ATOM   3848 C  C     . ALA C 3 451 ? 59.862 32.130  -19.278 1.00 24.36 ? 457  ALA A C     1 
ATOM   3849 O  O     . ALA C 3 451 ? 60.956 31.933  -19.792 1.00 25.91 ? 457  ALA A O     1 
ATOM   3850 C  CB    . ALA C 3 451 ? 58.902 29.981  -18.410 1.00 24.22 ? 457  ALA A CB    1 
ATOM   3851 N  N     . GLU C 3 452 ? 58.995 33.020  -19.751 1.00 24.78 ? 458  GLU A N     1 
ATOM   3852 C  CA    . GLU C 3 452 ? 59.286 33.800  -20.951 1.00 27.60 ? 458  GLU A CA    1 
ATOM   3853 C  C     . GLU C 3 452 ? 60.465 34.753  -20.741 1.00 26.49 ? 458  GLU A C     1 
ATOM   3854 O  O     . GLU C 3 452 ? 61.131 35.142  -21.696 1.00 26.68 ? 458  GLU A O     1 
ATOM   3855 C  CB    . GLU C 3 452 ? 58.049 34.615  -21.378 1.00 26.98 ? 458  GLU A CB    1 
ATOM   3856 C  CG    . GLU C 3 452 ? 57.809 35.857  -20.508 1.00 27.59 ? 458  GLU A CG    1 
ATOM   3857 C  CD    . GLU C 3 452 ? 56.673 36.729  -21.007 1.00 31.09 ? 458  GLU A CD    1 
ATOM   3858 O  OE1   . GLU C 3 452 ? 56.623 37.005  -22.226 1.00 32.40 ? 458  GLU A OE1   1 
ATOM   3859 O  OE2   . GLU C 3 452 ? 55.833 37.152  -20.180 1.00 32.22 ? 458  GLU A OE2   1 
ATOM   3860 N  N     . HIS C 3 453 ? 60.717 35.122  -19.488 1.00 27.89 ? 459  HIS A N     1 
ATOM   3861 C  CA    . HIS C 3 453 ? 61.801 36.050  -19.161 1.00 26.91 ? 459  HIS A CA    1 
ATOM   3862 C  C     . HIS C 3 453 ? 63.174 35.377  -19.114 1.00 28.00 ? 459  HIS A C     1 
ATOM   3863 O  O     . HIS C 3 453 ? 64.190 36.016  -18.823 1.00 28.72 ? 459  HIS A O     1 
ATOM   3864 C  CB    . HIS C 3 453 ? 61.481 36.768  -17.844 1.00 26.43 ? 459  HIS A CB    1 
ATOM   3865 C  CG    . HIS C 3 453 ? 60.134 37.427  -17.842 1.00 25.70 ? 459  HIS A CG    1 
ATOM   3866 N  ND1   . HIS C 3 453 ? 59.764 38.365  -18.783 1.00 26.75 ? 459  HIS A ND1   1 
ATOM   3867 C  CD2   . HIS C 3 453 ? 59.056 37.254  -17.039 1.00 26.39 ? 459  HIS A CD2   1 
ATOM   3868 C  CE1   . HIS C 3 453 ? 58.516 38.741  -18.563 1.00 26.69 ? 459  HIS A CE1   1 
ATOM   3869 N  NE2   . HIS C 3 453 ? 58.062 38.082  -17.509 1.00 27.34 ? 459  HIS A NE2   1 
ATOM   3870 N  N     . HIS C 3 454 ? 63.199 34.077  -19.389 1.00 27.87 ? 460  HIS A N     1 
ATOM   3871 C  CA    . HIS C 3 454 ? 64.464 33.350  -19.452 1.00 27.06 ? 460  HIS A CA    1 
ATOM   3872 C  C     . HIS C 3 454 ? 64.649 32.977  -20.918 1.00 26.76 ? 460  HIS A C     1 
ATOM   3873 O  O     . HIS C 3 454 ? 63.801 32.298  -21.488 1.00 28.03 ? 460  HIS A O     1 
ATOM   3874 C  CB    . HIS C 3 454 ? 64.433 32.057  -18.635 1.00 25.95 ? 460  HIS A CB    1 
ATOM   3875 C  CG    . HIS C 3 454 ? 65.612 31.165  -18.901 1.00 27.86 ? 460  HIS A CG    1 
ATOM   3876 N  ND1   . HIS C 3 454 ? 66.857 31.387  -18.349 1.00 25.25 ? 460  HIS A ND1   1 
ATOM   3877 C  CD2   . HIS C 3 454 ? 65.750 30.091  -19.716 1.00 27.34 ? 460  HIS A CD2   1 
ATOM   3878 C  CE1   . HIS C 3 454 ? 67.710 30.488  -18.809 1.00 26.60 ? 460  HIS A CE1   1 
ATOM   3879 N  NE2   . HIS C 3 454 ? 67.065 29.689  -19.642 1.00 26.79 ? 460  HIS A NE2   1 
ATOM   3880 N  N     . LEU C 3 455 ? 65.741 33.425  -21.527 1.00 28.66 ? 461  LEU A N     1 
ATOM   3881 C  CA    . LEU C 3 455 ? 66.015 33.103  -22.927 1.00 30.10 ? 461  LEU A CA    1 
ATOM   3882 C  C     . LEU C 3 455 ? 66.942 31.888  -22.949 1.00 29.89 ? 461  LEU A C     1 
ATOM   3883 O  O     . LEU C 3 455 ? 67.968 31.867  -22.264 1.00 30.46 ? 461  LEU A O     1 
ATOM   3884 C  CB    . LEU C 3 455 ? 66.678 34.292  -23.628 1.00 29.74 ? 461  LEU A CB    1 
ATOM   3885 C  CG    . LEU C 3 455 ? 65.929 35.627  -23.495 1.00 30.90 ? 461  LEU A CG    1 
ATOM   3886 C  CD1   . LEU C 3 455 ? 66.697 36.704  -24.256 1.00 31.21 ? 461  LEU A CD1   1 
ATOM   3887 C  CD2   . LEU C 3 455 ? 64.509 35.503  -24.030 1.00 29.33 ? 461  LEU A CD2   1 
ATOM   3888 N  N     . ASP C 3 456 ? 66.578 30.873  -23.727 1.00 28.45 ? 462  ASP A N     1 
ATOM   3889 C  CA    . ASP C 3 456 ? 67.375 29.652  -23.787 1.00 28.50 ? 462  ASP A CA    1 
ATOM   3890 C  C     . ASP C 3 456 ? 68.856 29.912  -23.997 1.00 29.28 ? 462  ASP A C     1 
ATOM   3891 O  O     . ASP C 3 456 ? 69.243 30.654  -24.891 1.00 29.35 ? 462  ASP A O     1 
ATOM   3892 C  CB    . ASP C 3 456 ? 66.880 28.731  -24.895 1.00 27.92 ? 462  ASP A CB    1 
ATOM   3893 C  CG    . ASP C 3 456 ? 67.560 27.386  -24.861 1.00 28.42 ? 462  ASP A CG    1 
ATOM   3894 O  OD1   . ASP C 3 456 ? 67.174 26.553  -24.011 1.00 27.32 ? 462  ASP A OD1   1 
ATOM   3895 O  OD2   . ASP C 3 456 ? 68.493 27.169  -25.669 1.00 29.34 ? 462  ASP A OD2   1 
ATOM   3896 N  N     . GLY C 3 457 ? 69.681 29.272  -23.174 1.00 31.25 ? 463  GLY A N     1 
ATOM   3897 C  CA    . GLY C 3 457 ? 71.113 29.460  -23.273 1.00 30.75 ? 463  GLY A CA    1 
ATOM   3898 C  C     . GLY C 3 457 ? 71.707 29.176  -24.639 1.00 31.79 ? 463  GLY A C     1 
ATOM   3899 O  O     . GLY C 3 457 ? 72.754 29.715  -24.984 1.00 33.30 ? 463  GLY A O     1 
ATOM   3900 N  N     . ILE C 3 458 ? 71.047 28.340  -25.428 1.00 31.74 ? 464  ILE A N     1 
ATOM   3901 C  CA    . ILE C 3 458 ? 71.562 27.998  -26.748 1.00 31.16 ? 464  ILE A CA    1 
ATOM   3902 C  C     . ILE C 3 458 ? 70.915 28.754  -27.908 1.00 30.54 ? 464  ILE A C     1 
ATOM   3903 O  O     . ILE C 3 458 ? 71.603 29.329  -28.743 1.00 30.82 ? 464  ILE A O     1 
ATOM   3904 C  CB    . ILE C 3 458 ? 71.415 26.479  -27.008 1.00 31.98 ? 464  ILE A CB    1 
ATOM   3905 C  CG1   . ILE C 3 458 ? 72.387 25.715  -26.104 1.00 31.95 ? 464  ILE A CG1   1 
ATOM   3906 C  CG2   . ILE C 3 458 ? 71.661 26.161  -28.489 1.00 32.32 ? 464  ILE A CG2   1 
ATOM   3907 C  CD1   . ILE C 3 458 ? 72.252 24.217  -26.197 1.00 33.56 ? 464  ILE A CD1   1 
ATOM   3908 N  N     . THR C 3 459 ? 69.593 28.767  -27.946 1.00 29.53 ? 465  THR A N     1 
ATOM   3909 C  CA    . THR C 3 459 ? 68.875 29.411  -29.043 1.00 27.95 ? 465  THR A CA    1 
ATOM   3910 C  C     . THR C 3 459 ? 68.396 30.827  -28.800 1.00 27.95 ? 465  THR A C     1 
ATOM   3911 O  O     . THR C 3 459 ? 67.963 31.490  -29.737 1.00 27.81 ? 465  THR A O     1 
ATOM   3912 C  CB    . THR C 3 459 ? 67.648 28.590  -29.421 1.00 28.99 ? 465  THR A CB    1 
ATOM   3913 O  OG1   . THR C 3 459 ? 66.686 28.664  -28.358 1.00 27.09 ? 465  THR A OG1   1 
ATOM   3914 C  CG2   . THR C 3 459 ? 68.038 27.137  -29.645 1.00 28.66 ? 465  THR A CG2   1 
ATOM   3915 N  N     . GLY C 3 460 ? 68.447 31.288  -27.550 1.00 27.76 ? 466  GLY A N     1 
ATOM   3916 C  CA    . GLY C 3 460 ? 67.977 32.630  -27.251 1.00 29.07 ? 466  GLY A CA    1 
ATOM   3917 C  C     . GLY C 3 460 ? 66.453 32.748  -27.245 1.00 29.81 ? 466  GLY A C     1 
ATOM   3918 O  O     . GLY C 3 460 ? 65.907 33.827  -27.024 1.00 31.27 ? 466  GLY A O     1 
ATOM   3919 N  N     . LYS C 3 461 ? 65.759 31.637  -27.474 1.00 29.90 ? 467  LYS A N     1 
ATOM   3920 C  CA    . LYS C 3 461 ? 64.302 31.647  -27.491 1.00 31.27 ? 467  LYS A CA    1 
ATOM   3921 C  C     . LYS C 3 461 ? 63.712 31.603  -26.083 1.00 29.95 ? 467  LYS A C     1 
ATOM   3922 O  O     . LYS C 3 461 ? 64.210 30.892  -25.213 1.00 29.67 ? 467  LYS A O     1 
ATOM   3923 C  CB    . LYS C 3 461 ? 63.779 30.454  -28.296 1.00 32.33 ? 467  LYS A CB    1 
ATOM   3924 C  CG    . LYS C 3 461 ? 64.270 30.411  -29.745 1.00 36.02 ? 467  LYS A CG    1 
ATOM   3925 C  CD    . LYS C 3 461 ? 63.378 31.235  -30.677 1.00 39.05 ? 467  LYS A CD    1 
ATOM   3926 C  CE    . LYS C 3 461 ? 63.409 32.716  -30.368 1.00 39.17 ? 467  LYS A CE    1 
ATOM   3927 N  NZ    . LYS C 3 461 ? 62.429 33.488  -31.194 1.00 39.90 ? 467  LYS A NZ    1 
ATOM   3928 N  N     . PRO C 3 462 ? 62.636 32.364  -25.846 1.00 28.16 ? 468  PRO A N     1 
ATOM   3929 C  CA    . PRO C 3 462 ? 61.985 32.395  -24.533 1.00 28.61 ? 468  PRO A CA    1 
ATOM   3930 C  C     . PRO C 3 462 ? 61.446 31.018  -24.153 1.00 28.47 ? 468  PRO A C     1 
ATOM   3931 O  O     . PRO C 3 462 ? 60.971 30.281  -25.015 1.00 28.94 ? 468  PRO A O     1 
ATOM   3932 C  CB    . PRO C 3 462 ? 60.841 33.392  -24.734 1.00 28.47 ? 468  PRO A CB    1 
ATOM   3933 C  CG    . PRO C 3 462 ? 61.356 34.306  -25.834 1.00 27.02 ? 468  PRO A CG    1 
ATOM   3934 C  CD    . PRO C 3 462 ? 62.003 33.319  -26.776 1.00 28.06 ? 468  PRO A CD    1 
ATOM   3935 N  N     . TRP C 3 463 ? 61.521 30.664  -22.875 1.00 26.90 ? 469  TRP A N     1 
ATOM   3936 C  CA    . TRP C 3 463 ? 60.976 29.380  -22.451 1.00 25.98 ? 469  TRP A CA    1 
ATOM   3937 C  C     . TRP C 3 463 ? 59.479 29.563  -22.232 1.00 25.43 ? 469  TRP A C     1 
ATOM   3938 O  O     . TRP C 3 463 ? 58.988 30.693  -22.182 1.00 24.96 ? 469  TRP A O     1 
ATOM   3939 C  CB    . TRP C 3 463 ? 61.656 28.890  -21.164 1.00 25.44 ? 469  TRP A CB    1 
ATOM   3940 C  CG    . TRP C 3 463 ? 62.923 28.111  -21.428 1.00 23.54 ? 469  TRP A CG    1 
ATOM   3941 C  CD1   . TRP C 3 463 ? 63.847 28.358  -22.410 1.00 20.21 ? 469  TRP A CD1   1 
ATOM   3942 C  CD2   . TRP C 3 463 ? 63.421 26.987  -20.682 1.00 23.34 ? 469  TRP A CD2   1 
ATOM   3943 N  NE1   . TRP C 3 463 ? 64.886 27.460  -22.319 1.00 21.65 ? 469  TRP A NE1   1 
ATOM   3944 C  CE2   . TRP C 3 463 ? 64.654 26.608  -21.270 1.00 19.67 ? 469  TRP A CE2   1 
ATOM   3945 C  CE3   . TRP C 3 463 ? 62.947 26.264  -19.572 1.00 22.79 ? 469  TRP A CE3   1 
ATOM   3946 C  CZ2   . TRP C 3 463 ? 65.422 25.536  -20.788 1.00 20.31 ? 469  TRP A CZ2   1 
ATOM   3947 C  CZ3   . TRP C 3 463 ? 63.708 25.197  -19.091 1.00 22.80 ? 469  TRP A CZ3   1 
ATOM   3948 C  CH2   . TRP C 3 463 ? 64.936 24.843  -19.700 1.00 21.80 ? 469  TRP A CH2   1 
ATOM   3949 N  N     . VAL C 3 464 ? 58.759 28.453  -22.122 1.00 23.71 ? 470  VAL A N     1 
ATOM   3950 C  CA    . VAL C 3 464 ? 57.321 28.493  -21.917 1.00 25.33 ? 470  VAL A CA    1 
ATOM   3951 C  C     . VAL C 3 464 ? 56.982 27.989  -20.520 1.00 26.01 ? 470  VAL A C     1 
ATOM   3952 O  O     . VAL C 3 464 ? 57.745 27.230  -19.923 1.00 26.72 ? 470  VAL A O     1 
ATOM   3953 C  CB    . VAL C 3 464 ? 56.606 27.650  -22.986 1.00 27.88 ? 470  VAL A CB    1 
ATOM   3954 C  CG1   . VAL C 3 464 ? 55.122 27.563  -22.690 1.00 27.41 ? 470  VAL A CG1   1 
ATOM   3955 C  CG2   . VAL C 3 464 ? 56.825 28.293  -24.358 1.00 27.88 ? 470  VAL A CG2   1 
ATOM   3956 N  N     . GLN C 3 465 ? 55.831 28.401  -20.003 1.00 24.56 ? 471  GLN A N     1 
ATOM   3957 C  CA    . GLN C 3 465 ? 55.440 28.019  -18.651 1.00 26.18 ? 471  GLN A CA    1 
ATOM   3958 C  C     . GLN C 3 465 ? 54.259 27.057  -18.550 1.00 26.04 ? 471  GLN A C     1 
ATOM   3959 O  O     . GLN C 3 465 ? 53.277 27.162  -19.291 1.00 24.88 ? 471  GLN A O     1 
ATOM   3960 C  CB    . GLN C 3 465 ? 55.138 29.296  -17.846 1.00 24.24 ? 471  GLN A CB    1 
ATOM   3961 C  CG    . GLN C 3 465 ? 55.111 29.126  -16.336 1.00 21.82 ? 471  GLN A CG    1 
ATOM   3962 C  CD    . GLN C 3 465 ? 55.154 30.464  -15.609 1.00 22.08 ? 471  GLN A CD    1 
ATOM   3963 O  OE1   . GLN C 3 465 ? 55.879 31.379  -16.016 1.00 23.19 ? 471  GLN A OE1   1 
ATOM   3964 N  NE2   . GLN C 3 465 ? 54.394 30.578  -14.520 1.00 19.42 ? 471  GLN A NE2   1 
ATOM   3965 N  N     . ALA C 3 466 ? 54.367 26.111  -17.622 1.00 27.49 ? 472  ALA A N     1 
ATOM   3966 C  CA    . ALA C 3 466 ? 53.294 25.162  -17.382 1.00 28.28 ? 472  ALA A CA    1 
ATOM   3967 C  C     . ALA C 3 466 ? 52.875 25.339  -15.926 1.00 29.66 ? 472  ALA A C     1 
ATOM   3968 O  O     . ALA C 3 466 ? 53.672 25.116  -15.009 1.00 29.74 ? 472  ALA A O     1 
ATOM   3969 C  CB    . ALA C 3 466 ? 53.772 23.746  -17.626 1.00 29.45 ? 472  ALA A CB    1 
ATOM   3970 N  N     . GLY C 3 467 ? 51.642 25.791  -15.723 1.00 28.94 ? 473  GLY A N     1 
ATOM   3971 C  CA    . GLY C 3 467 ? 51.129 25.972  -14.381 1.00 28.14 ? 473  GLY A CA    1 
ATOM   3972 C  C     . GLY C 3 467 ? 50.174 24.830  -14.090 1.00 29.78 ? 473  GLY A C     1 
ATOM   3973 O  O     . GLY C 3 467 ? 49.228 24.614  -14.845 1.00 31.73 ? 473  GLY A O     1 
ATOM   3974 N  N     . ILE C 3 468 ? 50.419 24.074  -13.025 1.00 29.60 ? 474  ILE A N     1 
ATOM   3975 C  CA    . ILE C 3 468 ? 49.533 22.962  -12.692 1.00 29.33 ? 474  ILE A CA    1 
ATOM   3976 C  C     . ILE C 3 468 ? 49.028 23.089  -11.266 1.00 30.12 ? 474  ILE A C     1 
ATOM   3977 O  O     . ILE C 3 468 ? 49.801 23.380  -10.346 1.00 30.58 ? 474  ILE A O     1 
ATOM   3978 C  CB    . ILE C 3 468 ? 50.229 21.592  -12.835 1.00 29.05 ? 474  ILE A CB    1 
ATOM   3979 C  CG1   . ILE C 3 468 ? 50.776 21.409  -14.248 1.00 29.03 ? 474  ILE A CG1   1 
ATOM   3980 C  CG2   . ILE C 3 468 ? 49.234 20.484  -12.537 1.00 29.36 ? 474  ILE A CG2   1 
ATOM   3981 C  CD1   . ILE C 3 468 ? 52.116 22.035  -14.472 1.00 32.17 ? 474  ILE A CD1   1 
ATOM   3982 N  N     . ASP C 3 469 ? 47.731 22.845  -11.089 1.00 30.16 ? 475  ASP A N     1 
ATOM   3983 C  CA    . ASP C 3 469 ? 47.085 22.950  -9.787  1.00 30.66 ? 475  ASP A CA    1 
ATOM   3984 C  C     . ASP C 3 469 ? 46.335 21.657  -9.446  1.00 29.23 ? 475  ASP A C     1 
ATOM   3985 O  O     . ASP C 3 469 ? 45.745 21.019  -10.325 1.00 27.79 ? 475  ASP A O     1 
ATOM   3986 C  CB    . ASP C 3 469 ? 46.090 24.120  -9.828  1.00 37.46 ? 475  ASP A CB    1 
ATOM   3987 C  CG    . ASP C 3 469 ? 45.964 24.839  -8.499  1.00 45.53 ? 475  ASP A CG    1 
ATOM   3988 O  OD1   . ASP C 3 469 ? 45.551 24.204  -7.496  1.00 49.26 ? 475  ASP A OD1   1 
ATOM   3989 O  OD2   . ASP C 3 469 ? 46.277 26.053  -8.457  1.00 49.52 ? 475  ASP A OD2   1 
ATOM   3990 N  N     . ALA C 3 470 ? 46.364 21.263  -8.178  1.00 26.29 ? 476  ALA A N     1 
ATOM   3991 C  CA    . ALA C 3 470 ? 45.629 20.076  -7.758  1.00 28.44 ? 476  ALA A CA    1 
ATOM   3992 C  C     . ALA C 3 470 ? 44.193 20.589  -7.684  1.00 29.49 ? 476  ALA A C     1 
ATOM   3993 O  O     . ALA C 3 470 ? 43.960 21.696  -7.203  1.00 29.06 ? 476  ALA A O     1 
ATOM   3994 C  CB    . ALA C 3 470 ? 46.107 19.602  -6.387  1.00 27.28 ? 476  ALA A CB    1 
ATOM   3995 N  N     . SER C 3 471 ? 43.240 19.803  -8.171  1.00 31.76 ? 477  SER A N     1 
ATOM   3996 C  CA    . SER C 3 471 ? 41.836 20.222  -8.193  1.00 33.83 ? 477  SER A CA    1 
ATOM   3997 C  C     . SER C 3 471 ? 41.040 19.921  -6.924  1.00 33.65 ? 477  SER A C     1 
ATOM   3998 O  O     . SER C 3 471 ? 40.853 18.759  -6.563  1.00 33.47 ? 477  SER A O     1 
ATOM   3999 C  CB    . SER C 3 471 ? 41.129 19.580  -9.393  1.00 33.76 ? 477  SER A CB    1 
ATOM   4000 O  OG    . SER C 3 471 ? 41.888 19.756  -10.579 1.00 35.26 ? 477  SER A OG    1 
ATOM   4001 N  N     . GLY C 3 472 ? 40.568 20.983  -6.270  1.00 33.74 ? 478  GLY A N     1 
ATOM   4002 C  CA    . GLY C 3 472 ? 39.770 20.865  -5.053  1.00 31.08 ? 478  GLY A CA    1 
ATOM   4003 C  C     . GLY C 3 472 ? 40.309 19.851  -4.068  1.00 31.39 ? 478  GLY A C     1 
ATOM   4004 O  O     . GLY C 3 472 ? 39.547 19.107  -3.444  1.00 29.06 ? 478  GLY A O     1 
ATOM   4005 N  N     . LEU C 3 473 ? 41.629 19.844  -3.914  1.00 29.17 ? 479  LEU A N     1 
ATOM   4006 C  CA    . LEU C 3 473 ? 42.304 18.897  -3.041  1.00 30.66 ? 479  LEU A CA    1 
ATOM   4007 C  C     . LEU C 3 473 ? 41.739 18.770  -1.631  1.00 30.66 ? 479  LEU A C     1 
ATOM   4008 O  O     . LEU C 3 473 ? 41.453 17.666  -1.176  1.00 31.64 ? 479  LEU A O     1 
ATOM   4009 C  CB    . LEU C 3 473 ? 43.802 19.225  -2.974  1.00 31.45 ? 479  LEU A CB    1 
ATOM   4010 C  CG    . LEU C 3 473 ? 44.696 18.173  -2.302  1.00 32.44 ? 479  LEU A CG    1 
ATOM   4011 C  CD1   . LEU C 3 473 ? 44.393 16.793  -2.869  1.00 33.14 ? 479  LEU A CD1   1 
ATOM   4012 C  CD2   . LEU C 3 473 ? 46.158 18.528  -2.523  1.00 32.04 ? 479  LEU A CD2   1 
ATOM   4013 N  N     . GLU C 3 474 ? 41.577 19.891  -0.940  1.00 31.42 ? 480  GLU A N     1 
ATOM   4014 C  CA    . GLU C 3 474 ? 41.072 19.866  0.425   1.00 33.53 ? 480  GLU A CA    1 
ATOM   4015 C  C     . GLU C 3 474 ? 39.716 19.168  0.547   1.00 33.31 ? 480  GLU A C     1 
ATOM   4016 O  O     . GLU C 3 474 ? 39.516 18.343  1.441   1.00 34.89 ? 480  GLU A O     1 
ATOM   4017 C  CB    . GLU C 3 474 ? 40.992 21.292  0.985   1.00 35.08 ? 480  GLU A CB    1 
ATOM   4018 C  CG    . GLU C 3 474 ? 42.351 21.945  1.238   1.00 40.14 ? 480  GLU A CG    1 
ATOM   4019 C  CD    . GLU C 3 474 ? 43.216 22.036  -0.017  1.00 42.23 ? 480  GLU A CD    1 
ATOM   4020 O  OE1   . GLU C 3 474 ? 42.718 22.538  -1.049  1.00 43.04 ? 480  GLU A OE1   1 
ATOM   4021 O  OE2   . GLU C 3 474 ? 44.393 21.610  0.032   1.00 41.39 ? 480  GLU A OE2   1 
ATOM   4022 N  N     . LEU C 3 475 ? 38.789 19.492  -0.345  1.00 32.78 ? 481  LEU A N     1 
ATOM   4023 C  CA    . LEU C 3 475 ? 37.468 18.868  -0.321  1.00 32.54 ? 481  LEU A CA    1 
ATOM   4024 C  C     . LEU C 3 475 ? 37.583 17.365  -0.570  1.00 31.24 ? 481  LEU A C     1 
ATOM   4025 O  O     . LEU C 3 475 ? 36.890 16.561  0.065   1.00 31.06 ? 481  LEU A O     1 
ATOM   4026 C  CB    . LEU C 3 475 ? 36.563 19.496  -1.386  1.00 35.51 ? 481  LEU A CB    1 
ATOM   4027 C  CG    . LEU C 3 475 ? 35.327 20.224  -0.850  1.00 38.60 ? 481  LEU A CG    1 
ATOM   4028 C  CD1   . LEU C 3 475 ? 34.644 20.985  -1.973  1.00 38.93 ? 481  LEU A CD1   1 
ATOM   4029 C  CD2   . LEU C 3 475 ? 34.377 19.220  -0.217  1.00 38.27 ? 481  LEU A CD2   1 
ATOM   4030 N  N     . ARG C 3 476 ? 38.457 16.986  -1.496  1.00 28.87 ? 482  ARG A N     1 
ATOM   4031 C  CA    . ARG C 3 476 ? 38.640 15.575  -1.804  1.00 26.80 ? 482  ARG A CA    1 
ATOM   4032 C  C     . ARG C 3 476 ? 39.246 14.848  -0.609  1.00 26.36 ? 482  ARG A C     1 
ATOM   4033 O  O     . ARG C 3 476 ? 38.911 13.697  -0.342  1.00 25.52 ? 482  ARG A O     1 
ATOM   4034 C  CB    . ARG C 3 476 ? 39.508 15.412  -3.046  1.00 25.83 ? 482  ARG A CB    1 
ATOM   4035 C  CG    . ARG C 3 476 ? 38.903 16.104  -4.250  1.00 26.31 ? 482  ARG A CG    1 
ATOM   4036 C  CD    . ARG C 3 476 ? 39.472 15.611  -5.565  1.00 27.47 ? 482  ARG A CD    1 
ATOM   4037 N  NE    . ARG C 3 476 ? 38.920 16.384  -6.676  1.00 27.44 ? 482  ARG A NE    1 
ATOM   4038 C  CZ    . ARG C 3 476 ? 38.967 16.004  -7.948  1.00 29.25 ? 482  ARG A CZ    1 
ATOM   4039 N  NH1   . ARG C 3 476 ? 39.539 14.852  -8.280  1.00 26.65 ? 482  ARG A NH1   1 
ATOM   4040 N  NH2   . ARG C 3 476 ? 38.452 16.782  -8.893  1.00 29.75 ? 482  ARG A NH2   1 
ATOM   4041 N  N     . CYS C 3 477 ? 40.119 15.523  0.130   1.00 24.85 ? 483  CYS A N     1 
ATOM   4042 C  CA    . CYS C 3 477 ? 40.700 14.889  1.307   1.00 25.47 ? 483  CYS A CA    1 
ATOM   4043 C  C     . CYS C 3 477 ? 39.581 14.640  2.324   1.00 25.06 ? 483  CYS A C     1 
ATOM   4044 O  O     . CYS C 3 477 ? 39.561 13.614  3.006   1.00 24.85 ? 483  CYS A O     1 
ATOM   4045 C  CB    . CYS C 3 477 ? 41.799 15.769  1.907   1.00 24.07 ? 483  CYS A CB    1 
ATOM   4046 S  SG    . CYS C 3 477 ? 43.310 15.832  0.890   1.00 28.35 ? 483  CYS A SG    1 
ATOM   4047 N  N     . LEU C 3 478 ? 38.643 15.577  2.416   1.00 25.25 ? 484  LEU A N     1 
ATOM   4048 C  CA    . LEU C 3 478 ? 37.515 15.419  3.336   1.00 25.14 ? 484  LEU A CA    1 
ATOM   4049 C  C     . LEU C 3 478 ? 36.699 14.202  2.894   1.00 24.18 ? 484  LEU A C     1 
ATOM   4050 O  O     . LEU C 3 478 ? 36.321 13.365  3.710   1.00 25.75 ? 484  LEU A O     1 
ATOM   4051 C  CB    . LEU C 3 478 ? 36.622 16.666  3.317   1.00 25.04 ? 484  LEU A CB    1 
ATOM   4052 C  CG    . LEU C 3 478 ? 35.282 16.526  4.056   1.00 27.76 ? 484  LEU A CG    1 
ATOM   4053 C  CD1   . LEU C 3 478 ? 35.513 16.224  5.517   1.00 26.04 ? 484  LEU A CD1   1 
ATOM   4054 C  CD2   . LEU C 3 478 ? 34.486 17.803  3.913   1.00 29.04 ? 484  LEU A CD2   1 
ATOM   4055 N  N     . ALA C 3 479 ? 36.440 14.110  1.593   1.00 24.96 ? 485  ALA A N     1 
ATOM   4056 C  CA    . ALA C 3 479 ? 35.676 12.996  1.038   1.00 24.55 ? 485  ALA A CA    1 
ATOM   4057 C  C     . ALA C 3 479 ? 36.359 11.677  1.385   1.00 27.41 ? 485  ALA A C     1 
ATOM   4058 O  O     . ALA C 3 479 ? 35.712 10.714  1.797   1.00 28.44 ? 485  ALA A O     1 
ATOM   4059 C  CB    . ALA C 3 479 ? 35.566 13.143  -0.465  1.00 23.04 ? 485  ALA A CB    1 
ATOM   4060 N  N     . HIS C 3 480 ? 37.677 11.649  1.220   1.00 27.00 ? 486  HIS A N     1 
ATOM   4061 C  CA    . HIS C 3 480 ? 38.463 10.462  1.516   1.00 24.90 ? 486  HIS A CA    1 
ATOM   4062 C  C     . HIS C 3 480 ? 38.235 9.987   2.955   1.00 25.21 ? 486  HIS A C     1 
ATOM   4063 O  O     . HIS C 3 480 ? 37.881 8.828   3.191   1.00 26.18 ? 486  HIS A O     1 
ATOM   4064 C  CB    . HIS C 3 480 ? 39.954 10.760  1.299   1.00 24.35 ? 486  HIS A CB    1 
ATOM   4065 C  CG    . HIS C 3 480 ? 40.863 9.716   1.866   1.00 23.52 ? 486  HIS A CG    1 
ATOM   4066 N  ND1   . HIS C 3 480 ? 41.018 8.474   1.292   1.00 23.24 ? 486  HIS A ND1   1 
ATOM   4067 C  CD2   . HIS C 3 480 ? 41.616 9.710   2.991   1.00 22.97 ? 486  HIS A CD2   1 
ATOM   4068 C  CE1   . HIS C 3 480 ? 41.828 7.744   2.040   1.00 23.99 ? 486  HIS A CE1   1 
ATOM   4069 N  NE2   . HIS C 3 480 ? 42.205 8.472   3.077   1.00 23.52 ? 486  HIS A NE2   1 
ATOM   4070 N  N     . PHE C 3 481 ? 38.433 10.884  3.917   1.00 25.48 ? 487  PHE A N     1 
ATOM   4071 C  CA    . PHE C 3 481 ? 38.262 10.525  5.318   1.00 25.96 ? 487  PHE A CA    1 
ATOM   4072 C  C     . PHE C 3 481 ? 36.809 10.202  5.702   1.00 26.85 ? 487  PHE A C     1 
ATOM   4073 O  O     . PHE C 3 481 ? 36.569 9.462   6.661   1.00 28.66 ? 487  PHE A O     1 
ATOM   4074 C  CB    . PHE C 3 481 ? 38.849 11.627  6.205   1.00 25.91 ? 487  PHE A CB    1 
ATOM   4075 C  CG    . PHE C 3 481 ? 40.360 11.710  6.138   1.00 26.39 ? 487  PHE A CG    1 
ATOM   4076 C  CD1   . PHE C 3 481 ? 41.149 10.667  6.621   1.00 26.03 ? 487  PHE A CD1   1 
ATOM   4077 C  CD2   . PHE C 3 481 ? 40.989 12.816  5.581   1.00 26.78 ? 487  PHE A CD2   1 
ATOM   4078 C  CE1   . PHE C 3 481 ? 42.549 10.726  6.548   1.00 28.56 ? 487  PHE A CE1   1 
ATOM   4079 C  CE2   . PHE C 3 481 ? 42.384 12.888  5.504   1.00 26.17 ? 487  PHE A CE2   1 
ATOM   4080 C  CZ    . PHE C 3 481 ? 43.166 11.841  5.988   1.00 26.31 ? 487  PHE A CZ    1 
ATOM   4081 N  N     . MET C 3 482 ? 35.849 10.716  4.937   1.00 26.65 ? 488  MET A N     1 
ATOM   4082 C  CA    . MET C 3 482 ? 34.436 10.447  5.202   1.00 28.99 ? 488  MET A CA    1 
ATOM   4083 C  C     . MET C 3 482 ? 34.024 9.042   4.756   1.00 28.83 ? 488  MET A C     1 
ATOM   4084 O  O     . MET C 3 482 ? 33.098 8.458   5.326   1.00 29.79 ? 488  MET A O     1 
ATOM   4085 C  CB    . MET C 3 482 ? 33.544 11.456  4.474   1.00 27.59 ? 488  MET A CB    1 
ATOM   4086 C  CG    . MET C 3 482 ? 33.529 12.853  5.061   1.00 28.51 ? 488  MET A CG    1 
ATOM   4087 S  SD    . MET C 3 482 ? 32.622 13.966  3.973   1.00 33.57 ? 488  MET A SD    1 
ATOM   4088 C  CE    . MET C 3 482 ? 30.914 13.311  4.162   1.00 32.41 ? 488  MET A CE    1 
ATOM   4089 N  N     . ALA C 3 483 ? 34.705 8.520   3.735   1.00 29.27 ? 489  ALA A N     1 
ATOM   4090 C  CA    . ALA C 3 483 ? 34.416 7.198   3.164   1.00 30.66 ? 489  ALA A CA    1 
ATOM   4091 C  C     . ALA C 3 483 ? 34.312 6.050   4.163   1.00 31.97 ? 489  ALA A C     1 
ATOM   4092 O  O     . ALA C 3 483 ? 33.602 5.074   3.926   1.00 32.56 ? 489  ALA A O     1 
ATOM   4093 C  CB    . ALA C 3 483 ? 35.448 6.854   2.093   1.00 32.57 ? 489  ALA A CB    1 
ATOM   4094 N  N     . ARG C 3 484 ? 35.025 6.143   5.272   1.00 31.12 ? 490  ARG A N     1 
ATOM   4095 C  CA    . ARG C 3 484 ? 34.931 5.086   6.265   1.00 33.05 ? 490  ARG A CA    1 
ATOM   4096 C  C     . ARG C 3 484 ? 33.502 5.085   6.822   1.00 33.06 ? 490  ARG A C     1 
ATOM   4097 O  O     . ARG C 3 484 ? 33.019 4.067   7.319   1.00 30.91 ? 490  ARG A O     1 
ATOM   4098 C  CB    . ARG C 3 484 ? 35.915 5.340   7.410   1.00 33.21 ? 490  ARG A CB    1 
ATOM   4099 C  CG    . ARG C 3 484 ? 35.739 4.381   8.577   1.00 36.14 ? 490  ARG A CG    1 
ATOM   4100 C  CD    . ARG C 3 484 ? 36.079 5.049   9.898   1.00 39.05 ? 490  ARG A CD    1 
ATOM   4101 N  NE    . ARG C 3 484 ? 37.439 4.788   10.377  1.00 43.01 ? 490  ARG A NE    1 
ATOM   4102 C  CZ    . ARG C 3 484 ? 38.557 5.054   9.708   1.00 43.96 ? 490  ARG A CZ    1 
ATOM   4103 N  NH1   . ARG C 3 484 ? 38.503 5.593   8.499   1.00 46.66 ? 490  ARG A NH1   1 
ATOM   4104 N  NH2   . ARG C 3 484 ? 39.740 4.801   10.264  1.00 43.14 ? 490  ARG A NH2   1 
ATOM   4105 N  N     . PHE C 3 485 ? 32.840 6.237   6.722   1.00 31.96 ? 491  PHE A N     1 
ATOM   4106 C  CA    . PHE C 3 485 ? 31.491 6.412   7.243   1.00 32.59 ? 491  PHE A CA    1 
ATOM   4107 C  C     . PHE C 3 485 ? 30.381 6.434   6.199   1.00 32.71 ? 491  PHE A C     1 
ATOM   4108 O  O     . PHE C 3 485 ? 29.298 5.907   6.446   1.00 34.62 ? 491  PHE A O     1 
ATOM   4109 C  CB    . PHE C 3 485 ? 31.434 7.702   8.072   1.00 32.04 ? 491  PHE A CB    1 
ATOM   4110 C  CG    . PHE C 3 485 ? 32.514 7.790   9.111   1.00 30.89 ? 491  PHE A CG    1 
ATOM   4111 C  CD1   . PHE C 3 485 ? 32.441 7.036   10.273  1.00 31.87 ? 491  PHE A CD1   1 
ATOM   4112 C  CD2   . PHE C 3 485 ? 33.636 8.573   8.896   1.00 31.11 ? 491  PHE A CD2   1 
ATOM   4113 C  CE1   . PHE C 3 485 ? 33.475 7.059   11.203  1.00 31.99 ? 491  PHE A CE1   1 
ATOM   4114 C  CE2   . PHE C 3 485 ? 34.674 8.601   9.821   1.00 29.03 ? 491  PHE A CE2   1 
ATOM   4115 C  CZ    . PHE C 3 485 ? 34.595 7.846   10.969  1.00 30.88 ? 491  PHE A CZ    1 
ATOM   4116 N  N     . ASP C 3 486 ? 30.631 7.037   5.041   1.00 31.46 ? 492  ASP A N     1 
ATOM   4117 C  CA    . ASP C 3 486 ? 29.595 7.109   4.015   1.00 30.00 ? 492  ASP A CA    1 
ATOM   4118 C  C     . ASP C 3 486 ? 29.851 6.197   2.823   1.00 30.84 ? 492  ASP A C     1 
ATOM   4119 O  O     . ASP C 3 486 ? 29.111 6.226   1.846   1.00 30.58 ? 492  ASP A O     1 
ATOM   4120 C  CB    . ASP C 3 486 ? 29.422 8.555   3.537   1.00 31.12 ? 492  ASP A CB    1 
ATOM   4121 C  CG    . ASP C 3 486 ? 30.567 9.031   2.658   1.00 31.29 ? 492  ASP A CG    1 
ATOM   4122 O  OD1   . ASP C 3 486 ? 31.586 8.310   2.538   1.00 29.34 ? 492  ASP A OD1   1 
ATOM   4123 O  OD2   . ASP C 3 486 ? 30.439 10.137  2.081   1.00 29.62 ? 492  ASP A OD2   1 
ATOM   4124 N  N     . ASN C 3 487 ? 30.908 5.397   2.906   1.00 30.45 ? 493  ASN A N     1 
ATOM   4125 C  CA    . ASN C 3 487 ? 31.256 4.457   1.848   1.00 32.23 ? 493  ASN A CA    1 
ATOM   4126 C  C     . ASN C 3 487 ? 31.556 5.083   0.489   1.00 31.23 ? 493  ASN A C     1 
ATOM   4127 O  O     . ASN C 3 487 ? 31.306 4.464   -0.544  1.00 32.99 ? 493  ASN A O     1 
ATOM   4128 C  CB    . ASN C 3 487 ? 30.140 3.412   1.695   1.00 32.42 ? 493  ASN A CB    1 
ATOM   4129 C  CG    . ASN C 3 487 ? 29.836 2.696   2.999   1.00 34.69 ? 493  ASN A CG    1 
ATOM   4130 O  OD1   . ASN C 3 487 ? 28.801 2.926   3.622   1.00 37.97 ? 493  ASN A OD1   1 
ATOM   4131 N  ND2   . ASN C 3 487 ? 30.747 1.834   3.425   1.00 34.95 ? 493  ASN A ND2   1 
ATOM   4132 N  N     . GLY C 3 488 ? 32.093 6.300   0.491   1.00 31.24 ? 494  GLY A N     1 
ATOM   4133 C  CA    . GLY C 3 488 ? 32.435 6.969   -0.754  1.00 28.53 ? 494  GLY A CA    1 
ATOM   4134 C  C     . GLY C 3 488 ? 31.369 7.862   -1.372  1.00 29.73 ? 494  GLY A C     1 
ATOM   4135 O  O     . GLY C 3 488 ? 31.572 8.392   -2.473  1.00 29.33 ? 494  GLY A O     1 
ATOM   4136 N  N     . GLU C 3 489 ? 30.242 8.046   -0.687  1.00 28.97 ? 495  GLU A N     1 
ATOM   4137 C  CA    . GLU C 3 489 ? 29.162 8.874   -1.233  1.00 31.56 ? 495  GLU A CA    1 
ATOM   4138 C  C     . GLU C 3 489 ? 29.594 10.318  -1.502  1.00 32.25 ? 495  GLU A C     1 
ATOM   4139 O  O     . GLU C 3 489 ? 29.385 10.846  -2.595  1.00 33.57 ? 495  GLU A O     1 
ATOM   4140 C  CB    . GLU C 3 489 ? 27.946 8.866   -0.293  1.00 31.28 ? 495  GLU A CB    1 
ATOM   4141 N  N     . TYR C 3 490 ? 30.200 10.958  -0.510  1.00 31.92 ? 496  TYR A N     1 
ATOM   4142 C  CA    . TYR C 3 490 ? 30.644 12.332  -0.680  1.00 32.43 ? 496  TYR A CA    1 
ATOM   4143 C  C     . TYR C 3 490 ? 31.652 12.429  -1.835  1.00 32.77 ? 496  TYR A C     1 
ATOM   4144 O  O     . TYR C 3 490 ? 31.586 13.347  -2.654  1.00 32.73 ? 496  TYR A O     1 
ATOM   4145 C  CB    . TYR C 3 490 ? 31.275 12.835  0.617   1.00 32.36 ? 496  TYR A CB    1 
ATOM   4146 C  CG    . TYR C 3 490 ? 31.136 14.321  0.821   1.00 34.14 ? 496  TYR A CG    1 
ATOM   4147 C  CD1   . TYR C 3 490 ? 29.926 14.877  1.251   1.00 34.03 ? 496  TYR A CD1   1 
ATOM   4148 C  CD2   . TYR C 3 490 ? 32.206 15.177  0.582   1.00 34.54 ? 496  TYR A CD2   1 
ATOM   4149 C  CE1   . TYR C 3 490 ? 29.794 16.249  1.439   1.00 34.85 ? 496  TYR A CE1   1 
ATOM   4150 C  CE2   . TYR C 3 490 ? 32.085 16.546  0.764   1.00 34.28 ? 496  TYR A CE2   1 
ATOM   4151 C  CZ    . TYR C 3 490 ? 30.877 17.077  1.194   1.00 36.21 ? 496  TYR A CZ    1 
ATOM   4152 O  OH    . TYR C 3 490 ? 30.765 18.436  1.374   1.00 36.54 ? 496  TYR A OH    1 
ATOM   4153 N  N     . ALA C 3 491 ? 32.580 11.477  -1.902  1.00 32.88 ? 497  ALA A N     1 
ATOM   4154 C  CA    . ALA C 3 491 ? 33.581 11.467  -2.967  1.00 34.24 ? 497  ALA A CA    1 
ATOM   4155 C  C     . ALA C 3 491 ? 32.933 11.287  -4.339  1.00 34.99 ? 497  ALA A C     1 
ATOM   4156 O  O     . ALA C 3 491 ? 33.374 11.878  -5.328  1.00 34.01 ? 497  ALA A O     1 
ATOM   4157 C  CB    . ALA C 3 491 ? 34.605 10.354  -2.726  1.00 34.02 ? 497  ALA A CB    1 
ATOM   4158 N  N     . HIS C 3 492 ? 31.890 10.464  -4.400  1.00 37.63 ? 498  HIS A N     1 
ATOM   4159 C  CA    . HIS C 3 492 ? 31.196 10.222  -5.664  1.00 39.96 ? 498  HIS A CA    1 
ATOM   4160 C  C     . HIS C 3 492 ? 30.507 11.493  -6.144  1.00 40.10 ? 498  HIS A C     1 
ATOM   4161 O  O     . HIS C 3 492 ? 30.528 11.812  -7.329  1.00 38.83 ? 498  HIS A O     1 
ATOM   4162 C  CB    . HIS C 3 492 ? 30.155 9.111   -5.503  1.00 42.11 ? 498  HIS A CB    1 
ATOM   4163 C  CG    . HIS C 3 492 ? 29.438 8.768   -6.772  1.00 45.70 ? 498  HIS A CG    1 
ATOM   4164 N  ND1   . HIS C 3 492 ? 30.040 8.086   -7.808  1.00 48.45 ? 498  HIS A ND1   1 
ATOM   4165 C  CD2   . HIS C 3 492 ? 28.171 9.024   -7.177  1.00 47.12 ? 498  HIS A CD2   1 
ATOM   4166 C  CE1   . HIS C 3 492 ? 29.176 7.936   -8.796  1.00 47.91 ? 498  HIS A CE1   1 
ATOM   4167 N  NE2   . HIS C 3 492 ? 28.034 8.495   -8.439  1.00 48.67 ? 498  HIS A NE2   1 
ATOM   4168 N  N     . GLU C 3 493 ? 29.897 12.218  -5.213  1.00 41.09 ? 499  GLU A N     1 
ATOM   4169 C  CA    . GLU C 3 493 ? 29.202 13.453  -5.548  1.00 42.49 ? 499  GLU A CA    1 
ATOM   4170 C  C     . GLU C 3 493 ? 30.153 14.523  -6.101  1.00 41.41 ? 499  GLU A C     1 
ATOM   4171 O  O     . GLU C 3 493 ? 29.782 15.293  -6.991  1.00 38.58 ? 499  GLU A O     1 
ATOM   4172 C  CB    . GLU C 3 493 ? 28.477 14.000  -4.315  1.00 44.63 ? 499  GLU A CB    1 
ATOM   4173 C  CG    . GLU C 3 493 ? 27.713 15.293  -4.574  1.00 49.57 ? 499  GLU A CG    1 
ATOM   4174 C  CD    . GLU C 3 493 ? 26.470 15.093  -5.430  1.00 51.52 ? 499  GLU A CD    1 
ATOM   4175 O  OE1   . GLU C 3 493 ? 25.959 16.095  -5.972  1.00 53.24 ? 499  GLU A OE1   1 
ATOM   4176 O  OE2   . GLU C 3 493 ? 25.997 13.943  -5.554  1.00 54.14 ? 499  GLU A OE2   1 
ATOM   4177 N  N     . ILE C 3 494 ? 31.373 14.569  -5.572  1.00 39.70 ? 500  ILE A N     1 
ATOM   4178 C  CA    . ILE C 3 494 ? 32.354 15.549  -6.025  1.00 38.48 ? 500  ILE A CA    1 
ATOM   4179 C  C     . ILE C 3 494 ? 32.726 15.307  -7.478  1.00 38.57 ? 500  ILE A C     1 
ATOM   4180 O  O     . ILE C 3 494 ? 32.691 16.216  -8.303  1.00 38.45 ? 500  ILE A O     1 
ATOM   4181 C  CB    . ILE C 3 494 ? 33.665 15.484  -5.193  1.00 38.23 ? 500  ILE A CB    1 
ATOM   4182 C  CG1   . ILE C 3 494 ? 33.389 15.864  -3.738  1.00 38.28 ? 500  ILE A CG1   1 
ATOM   4183 C  CG2   . ILE C 3 494 ? 34.718 16.415  -5.807  1.00 38.99 ? 500  ILE A CG2   1 
ATOM   4184 C  CD1   . ILE C 3 494 ? 34.641 15.935  -2.865  1.00 36.26 ? 500  ILE A CD1   1 
ATOM   4185 N  N     . LEU C 3 495 ? 33.080 14.064  -7.777  1.00 39.02 ? 501  LEU A N     1 
ATOM   4186 C  CA    . LEU C 3 495 ? 33.502 13.669  -9.114  1.00 40.77 ? 501  LEU A CA    1 
ATOM   4187 C  C     . LEU C 3 495 ? 32.408 13.554  -10.173 1.00 42.67 ? 501  LEU A C     1 
ATOM   4188 O  O     . LEU C 3 495 ? 32.668 13.780  -11.356 1.00 43.09 ? 501  LEU A O     1 
ATOM   4189 C  CB    . LEU C 3 495 ? 34.252 12.336  -9.036  1.00 40.81 ? 501  LEU A CB    1 
ATOM   4190 C  CG    . LEU C 3 495 ? 35.710 12.323  -8.560  1.00 41.35 ? 501  LEU A CG    1 
ATOM   4191 C  CD1   . LEU C 3 495 ? 35.910 13.174  -7.327  1.00 41.45 ? 501  LEU A CD1   1 
ATOM   4192 C  CD2   . LEU C 3 495 ? 36.090 10.886  -8.276  1.00 44.46 ? 501  LEU A CD2   1 
ATOM   4193 N  N     . ASN C 3 496 ? 31.194 13.202  -9.765  1.00 43.43 ? 502  ASN A N     1 
ATOM   4194 C  CA    . ASN C 3 496 ? 30.119 13.032  -10.733 1.00 45.46 ? 502  ASN A CA    1 
ATOM   4195 C  C     . ASN C 3 496 ? 28.849 13.818  -10.445 1.00 46.05 ? 502  ASN A C     1 
ATOM   4196 O  O     . ASN C 3 496 ? 27.826 13.581  -11.080 1.00 46.99 ? 502  ASN A O     1 
ATOM   4197 C  CB    . ASN C 3 496 ? 29.766 11.547  -10.850 1.00 45.96 ? 502  ASN A CB    1 
ATOM   4198 C  CG    . ASN C 3 496 ? 30.925 10.707  -11.353 1.00 47.15 ? 502  ASN A CG    1 
ATOM   4199 O  OD1   . ASN C 3 496 ? 31.340 10.818  -12.510 1.00 47.95 ? 502  ASN A OD1   1 
ATOM   4200 N  ND2   . ASN C 3 496 ? 31.457 9.860   -10.483 1.00 47.36 ? 502  ASN A ND2   1 
ATOM   4201 N  N     . GLY C 3 497 ? 28.904 14.750  -9.501  1.00 47.29 ? 503  GLY A N     1 
ATOM   4202 C  CA    . GLY C 3 497 ? 27.713 15.517  -9.184  1.00 47.00 ? 503  GLY A CA    1 
ATOM   4203 C  C     . GLY C 3 497 ? 27.928 16.996  -8.931  1.00 48.28 ? 503  GLY A C     1 
ATOM   4204 O  O     . GLY C 3 497 ? 28.690 17.663  -9.636  1.00 48.77 ? 503  GLY A O     1 
ATOM   4205 N  N     . ASP C 3 498 ? 27.240 17.503  -7.913  1.00 48.66 ? 504  ASP A N     1 
ATOM   4206 C  CA    . ASP C 3 498 ? 27.312 18.906  -7.528  1.00 49.36 ? 504  ASP A CA    1 
ATOM   4207 C  C     . ASP C 3 498 ? 27.451 18.974  -6.012  1.00 49.15 ? 504  ASP A C     1 
ATOM   4208 O  O     . ASP C 3 498 ? 26.458 19.129  -5.298  1.00 49.67 ? 504  ASP A O     1 
ATOM   4209 C  CB    . ASP C 3 498 ? 26.030 19.620  -7.956  1.00 52.15 ? 504  ASP A CB    1 
ATOM   4210 C  CG    . ASP C 3 498 ? 26.122 21.120  -7.806  1.00 54.58 ? 504  ASP A CG    1 
ATOM   4211 O  OD1   . ASP C 3 498 ? 26.535 21.589  -6.723  1.00 56.98 ? 504  ASP A OD1   1 
ATOM   4212 O  OD2   . ASP C 3 498 ? 25.772 21.832  -8.772  1.00 56.07 ? 504  ASP A OD2   1 
ATOM   4213 N  N     . ILE C 3 499 ? 28.684 18.866  -5.522  1.00 48.39 ? 505  ILE A N     1 
ATOM   4214 C  CA    . ILE C 3 499 ? 28.935 18.884  -4.086  1.00 46.85 ? 505  ILE A CA    1 
ATOM   4215 C  C     . ILE C 3 499 ? 28.514 20.192  -3.420  1.00 46.77 ? 505  ILE A C     1 
ATOM   4216 O  O     . ILE C 3 499 ? 28.079 20.205  -2.267  1.00 46.65 ? 505  ILE A O     1 
ATOM   4217 C  CB    . ILE C 3 499 ? 30.439 18.606  -3.778  1.00 45.72 ? 505  ILE A CB    1 
ATOM   4218 C  CG1   . ILE C 3 499 ? 30.601 18.240  -2.304  1.00 43.72 ? 505  ILE A CG1   1 
ATOM   4219 C  CG2   . ILE C 3 499 ? 31.303 19.814  -4.139  1.00 41.94 ? 505  ILE A CG2   1 
ATOM   4220 C  CD1   . ILE C 3 499 ? 29.980 16.910  -1.958  1.00 42.74 ? 505  ILE A CD1   1 
ATOM   4221 N  N     . HIS C 3 500 ? 28.624 21.292  -4.152  1.00 47.77 ? 506  HIS A N     1 
ATOM   4222 C  CA    . HIS C 3 500 ? 28.265 22.589  -3.602  1.00 49.69 ? 506  HIS A CA    1 
ATOM   4223 C  C     . HIS C 3 500 ? 26.768 22.774  -3.349  1.00 50.31 ? 506  HIS A C     1 
ATOM   4224 O  O     . HIS C 3 500 ? 26.374 23.233  -2.273  1.00 50.60 ? 506  HIS A O     1 
ATOM   4225 C  CB    . HIS C 3 500 ? 28.807 23.692  -4.509  1.00 51.22 ? 506  HIS A CB    1 
ATOM   4226 C  CG    . HIS C 3 500 ? 30.300 23.683  -4.624  1.00 51.74 ? 506  HIS A CG    1 
ATOM   4227 N  ND1   . HIS C 3 500 ? 31.129 23.797  -3.528  1.00 51.79 ? 506  HIS A ND1   1 
ATOM   4228 C  CD2   . HIS C 3 500 ? 31.113 23.552  -5.700  1.00 52.07 ? 506  HIS A CD2   1 
ATOM   4229 C  CE1   . HIS C 3 500 ? 32.388 23.738  -3.924  1.00 51.95 ? 506  HIS A CE1   1 
ATOM   4230 N  NE2   . HIS C 3 500 ? 32.406 23.589  -5.237  1.00 52.70 ? 506  HIS A NE2   1 
ATOM   4231 N  N     . THR C 3 501 ? 25.928 22.424  -4.317  1.00 50.19 ? 507  THR A N     1 
ATOM   4232 C  CA    . THR C 3 501 ? 24.492 22.567  -4.104  1.00 51.63 ? 507  THR A CA    1 
ATOM   4233 C  C     . THR C 3 501 ? 24.103 21.549  -3.043  1.00 52.34 ? 507  THR A C     1 
ATOM   4234 O  O     . THR C 3 501 ? 23.172 21.765  -2.263  1.00 52.23 ? 507  THR A O     1 
ATOM   4235 C  CB    . THR C 3 501 ? 23.684 22.290  -5.381  1.00 51.88 ? 507  THR A CB    1 
ATOM   4236 O  OG1   . THR C 3 501 ? 23.896 20.936  -5.798  1.00 53.30 ? 507  THR A OG1   1 
ATOM   4237 C  CG2   . THR C 3 501 ? 24.103 23.239  -6.487  1.00 50.82 ? 507  THR A CG2   1 
ATOM   4238 N  N     . LYS C 3 502 ? 24.829 20.434  -3.018  1.00 52.19 ? 508  LYS A N     1 
ATOM   4239 C  CA    . LYS C 3 502 ? 24.573 19.394  -2.034  1.00 52.47 ? 508  LYS A CA    1 
ATOM   4240 C  C     . LYS C 3 502 ? 24.869 19.964  -0.653  1.00 51.98 ? 508  LYS A C     1 
ATOM   4241 O  O     . LYS C 3 502 ? 24.137 19.704  0.300   1.00 53.00 ? 508  LYS A O     1 
ATOM   4242 C  CB    . LYS C 3 502 ? 25.459 18.175  -2.285  1.00 52.65 ? 508  LYS A CB    1 
ATOM   4243 C  CG    . LYS C 3 502 ? 25.238 17.053  -1.281  1.00 53.69 ? 508  LYS A CG    1 
ATOM   4244 C  CD    . LYS C 3 502 ? 26.152 15.870  -1.552  1.00 54.92 ? 508  LYS A CD    1 
ATOM   4245 C  CE    . LYS C 3 502 ? 25.873 14.713  -0.592  1.00 56.47 ? 508  LYS A CE    1 
ATOM   4246 N  NZ    . LYS C 3 502 ? 26.164 15.065  0.828   1.00 57.93 ? 508  LYS A NZ    1 
ATOM   4247 N  N     . ASN C 3 503 ? 25.942 20.744  -0.546  1.00 51.51 ? 509  ASN A N     1 
ATOM   4248 C  CA    . ASN C 3 503 ? 26.296 21.346  0.733   1.00 50.67 ? 509  ASN A CA    1 
ATOM   4249 C  C     . ASN C 3 503 ? 25.378 22.516  1.046   1.00 51.84 ? 509  ASN A C     1 
ATOM   4250 O  O     . ASN C 3 503 ? 25.199 22.882  2.206   1.00 50.58 ? 509  ASN A O     1 
ATOM   4251 C  CB    . ASN C 3 503 ? 27.748 21.824  0.739   1.00 49.57 ? 509  ASN A CB    1 
ATOM   4252 C  CG    . ASN C 3 503 ? 28.737 20.681  0.810   1.00 47.60 ? 509  ASN A CG    1 
ATOM   4253 O  OD1   . ASN C 3 503 ? 28.470 19.654  1.433   1.00 45.96 ? 509  ASN A OD1   1 
ATOM   4254 N  ND2   . ASN C 3 503 ? 29.893 20.861  0.187   1.00 47.20 ? 509  ASN A ND2   1 
ATOM   4255 N  N     . GLN C 3 504 ? 24.803 23.108  0.005   1.00 53.58 ? 510  GLN A N     1 
ATOM   4256 C  CA    . GLN C 3 504 ? 23.893 24.227  0.192   1.00 55.31 ? 510  GLN A CA    1 
ATOM   4257 C  C     . GLN C 3 504 ? 22.610 23.719  0.838   1.00 55.32 ? 510  GLN A C     1 
ATOM   4258 O  O     . GLN C 3 504 ? 22.155 24.263  1.847   1.00 54.77 ? 510  GLN A O     1 
ATOM   4259 C  CB    . GLN C 3 504 ? 23.564 24.882  -1.146  1.00 56.50 ? 510  GLN A CB    1 
ATOM   4260 C  CG    . GLN C 3 504 ? 22.641 26.072  -1.008  1.00 58.54 ? 510  GLN A CG    1 
ATOM   4261 C  CD    . GLN C 3 504 ? 22.337 26.730  -2.332  1.00 60.54 ? 510  GLN A CD    1 
ATOM   4262 O  OE1   . GLN C 3 504 ? 21.653 27.753  -2.381  1.00 62.08 ? 510  GLN A OE1   1 
ATOM   4263 N  NE2   . GLN C 3 504 ? 22.840 26.148  -3.418  1.00 60.19 ? 510  GLN A NE2   1 
ATOM   4264 N  N     . ILE C 3 505 ? 22.029 22.676  0.251   1.00 55.52 ? 511  ILE A N     1 
ATOM   4265 C  CA    . ILE C 3 505 ? 20.810 22.100  0.796   1.00 56.23 ? 511  ILE A CA    1 
ATOM   4266 C  C     . ILE C 3 505 ? 21.047 21.824  2.272   1.00 57.47 ? 511  ILE A C     1 
ATOM   4267 O  O     . ILE C 3 505 ? 20.187 22.093  3.107   1.00 58.12 ? 511  ILE A O     1 
ATOM   4268 C  CB    . ILE C 3 505 ? 20.434 20.793  0.086   1.00 55.47 ? 511  ILE A CB    1 
ATOM   4269 C  CG1   . ILE C 3 505 ? 20.001 21.098  -1.351  1.00 55.09 ? 511  ILE A CG1   1 
ATOM   4270 C  CG2   . ILE C 3 505 ? 19.324 20.086  0.855   1.00 55.79 ? 511  ILE A CG2   1 
ATOM   4271 C  CD1   . ILE C 3 505 ? 19.566 19.878  -2.135  1.00 53.79 ? 511  ILE A CD1   1 
ATOM   4272 N  N     . ALA C 3 506 ? 22.217 21.280  2.589   1.00 57.95 ? 512  ALA A N     1 
ATOM   4273 C  CA    . ALA C 3 506 ? 22.562 21.016  3.978   1.00 59.01 ? 512  ALA A CA    1 
ATOM   4274 C  C     . ALA C 3 506 ? 22.972 22.385  4.502   1.00 59.73 ? 512  ALA A C     1 
ATOM   4275 O  O     . ALA C 3 506 ? 23.478 23.206  3.743   1.00 59.96 ? 512  ALA A O     1 
ATOM   4276 C  CB    . ALA C 3 506 ? 23.729 20.041  4.060   1.00 59.74 ? 512  ALA A CB    1 
ATOM   4277 N  N     . ALA C 3 507 ? 22.748 22.645  5.784   1.00 60.17 ? 513  ALA A N     1 
ATOM   4278 C  CA    . ALA C 3 507 ? 23.093 23.951  6.347   1.00 61.06 ? 513  ALA A CA    1 
ATOM   4279 C  C     . ALA C 3 507 ? 22.184 25.042  5.764   1.00 61.97 ? 513  ALA A C     1 
ATOM   4280 O  O     . ALA C 3 507 ? 22.307 26.217  6.117   1.00 61.72 ? 513  ALA A O     1 
ATOM   4281 C  CB    . ALA C 3 507 ? 24.560 24.281  6.059   1.00 60.72 ? 513  ALA A CB    1 
ATOM   4282 N  N     . GLU C 3 508 ? 21.282 24.638  4.869   1.00 62.64 ? 514  GLU A N     1 
ATOM   4283 C  CA    . GLU C 3 508 ? 20.326 25.537  4.221   1.00 63.24 ? 514  GLU A CA    1 
ATOM   4284 C  C     . GLU C 3 508 ? 20.869 26.930  3.934   1.00 63.54 ? 514  GLU A C     1 
ATOM   4285 O  O     . GLU C 3 508 ? 20.781 27.823  4.780   1.00 64.45 ? 514  GLU A O     1 
ATOM   4286 C  CB    . GLU C 3 508 ? 19.060 25.669  5.074   1.00 63.35 ? 514  GLU A CB    1 
ATOM   4287 C  CG    . GLU C 3 508 ? 18.206 24.413  5.152   1.00 63.09 ? 514  GLU A CG    1 
ATOM   4288 C  CD    . GLU C 3 508 ? 17.753 23.927  3.786   1.00 63.92 ? 514  GLU A CD    1 
ATOM   4289 O  OE1   . GLU C 3 508 ? 17.481 24.772  2.905   1.00 64.07 ? 514  GLU A OE1   1 
ATOM   4290 O  OE2   . GLU C 3 508 ? 17.652 22.696  3.598   1.00 64.10 ? 514  GLU A OE2   1 
ATOM   4291 N  N     . LEU C 3 509 ? 21.417 27.117  2.737   1.00 63.26 ? 515  LEU A N     1 
ATOM   4292 C  CA    . LEU C 3 509 ? 21.965 28.410  2.351   1.00 62.57 ? 515  LEU A CA    1 
ATOM   4293 C  C     . LEU C 3 509 ? 21.257 28.998  1.134   1.00 62.46 ? 515  LEU A C     1 
ATOM   4294 O  O     . LEU C 3 509 ? 20.680 28.269  0.322   1.00 62.22 ? 515  LEU A O     1 
ATOM   4295 C  CB    . LEU C 3 509 ? 23.465 28.289  2.072   1.00 62.24 ? 515  LEU A CB    1 
ATOM   4296 C  CG    . LEU C 3 509 ? 24.342 27.989  3.289   1.00 61.77 ? 515  LEU A CG    1 
ATOM   4297 C  CD1   . LEU C 3 509 ? 25.803 27.916  2.863   1.00 60.80 ? 515  LEU A CD1   1 
ATOM   4298 C  CD2   . LEU C 3 509 ? 24.143 29.072  4.344   1.00 61.10 ? 515  LEU A CD2   1 
ATOM   4299 N  N     . PRO C 3 510 ? 21.297 30.334  0.994   1.00 62.38 ? 516  PRO A N     1 
ATOM   4300 C  CA    . PRO C 3 510 ? 20.669 31.068  -0.110  1.00 62.49 ? 516  PRO A CA    1 
ATOM   4301 C  C     . PRO C 3 510 ? 21.300 30.830  -1.479  1.00 62.69 ? 516  PRO A C     1 
ATOM   4302 O  O     . PRO C 3 510 ? 20.658 30.297  -2.385  1.00 63.02 ? 516  PRO A O     1 
ATOM   4303 C  CB    . PRO C 3 510 ? 20.795 32.522  0.336   1.00 62.41 ? 516  PRO A CB    1 
ATOM   4304 C  CG    . PRO C 3 510 ? 22.093 32.517  1.084   1.00 62.51 ? 516  PRO A CG    1 
ATOM   4305 C  CD    . PRO C 3 510 ? 21.957 31.268  1.926   1.00 62.17 ? 516  PRO A CD    1 
ATOM   4306 N  N     . THR C 3 511 ? 22.553 31.241  -1.629  1.00 62.38 ? 517  THR A N     1 
ATOM   4307 C  CA    . THR C 3 511 ? 23.259 31.079  -2.894  1.00 63.13 ? 517  THR A CA    1 
ATOM   4308 C  C     . THR C 3 511 ? 24.199 29.885  -2.827  1.00 63.62 ? 517  THR A C     1 
ATOM   4309 O  O     . THR C 3 511 ? 24.795 29.615  -1.783  1.00 64.36 ? 517  THR A O     1 
ATOM   4310 C  CB    . THR C 3 511 ? 24.098 32.323  -3.222  1.00 63.06 ? 517  THR A CB    1 
ATOM   4311 O  OG1   . THR C 3 511 ? 25.091 32.503  -2.204  1.00 63.02 ? 517  THR A OG1   1 
ATOM   4312 C  CG2   . THR C 3 511 ? 23.216 33.563  -3.286  1.00 61.92 ? 517  THR A CG2   1 
ATOM   4313 N  N     . ARG C 3 512 ? 24.336 29.169  -3.937  1.00 62.79 ? 518  ARG A N     1 
ATOM   4314 C  CA    . ARG C 3 512 ? 25.225 28.020  -3.959  1.00 62.23 ? 518  ARG A CA    1 
ATOM   4315 C  C     . ARG C 3 512 ? 26.669 28.505  -3.833  1.00 61.37 ? 518  ARG A C     1 
ATOM   4316 O  O     . ARG C 3 512 ? 27.549 27.758  -3.404  1.00 60.88 ? 518  ARG A O     1 
ATOM   4317 C  CB    . ARG C 3 512 ? 25.027 27.209  -5.244  1.00 62.21 ? 518  ARG A CB    1 
ATOM   4318 C  CG    . ARG C 3 512 ? 25.367 27.936  -6.522  1.00 62.52 ? 518  ARG A CG    1 
ATOM   4319 C  CD    . ARG C 3 512 ? 26.588 27.313  -7.169  1.00 62.94 ? 518  ARG A CD    1 
ATOM   4320 N  NE    . ARG C 3 512 ? 26.425 25.875  -7.363  1.00 60.97 ? 518  ARG A NE    1 
ATOM   4321 C  CZ    . ARG C 3 512 ? 27.357 25.085  -7.887  1.00 61.16 ? 518  ARG A CZ    1 
ATOM   4322 N  NH1   . ARG C 3 512 ? 28.521 25.592  -8.274  1.00 60.25 ? 518  ARG A NH1   1 
ATOM   4323 N  NH2   . ARG C 3 512 ? 27.131 23.785  -8.017  1.00 60.35 ? 518  ARG A NH2   1 
ATOM   4324 N  N     . ASP C 3 513 ? 26.905 29.762  -4.197  1.00 60.00 ? 519  ASP A N     1 
ATOM   4325 C  CA    . ASP C 3 513 ? 28.241 30.339  -4.087  1.00 60.15 ? 519  ASP A CA    1 
ATOM   4326 C  C     . ASP C 3 513 ? 28.559 30.518  -2.612  1.00 59.06 ? 519  ASP A C     1 
ATOM   4327 O  O     . ASP C 3 513 ? 29.724 30.525  -2.209  1.00 58.06 ? 519  ASP A O     1 
ATOM   4328 C  CB    . ASP C 3 513 ? 28.317 31.698  -4.787  1.00 61.05 ? 519  ASP A CB    1 
ATOM   4329 C  CG    . ASP C 3 513 ? 28.321 31.578  -6.295  1.00 61.85 ? 519  ASP A CG    1 
ATOM   4330 O  OD1   . ASP C 3 513 ? 28.537 32.608  -6.968  1.00 63.36 ? 519  ASP A OD1   1 
ATOM   4331 O  OD2   . ASP C 3 513 ? 28.106 30.458  -6.805  1.00 62.81 ? 519  ASP A OD2   1 
ATOM   4332 N  N     . ASN C 3 514 ? 27.510 30.679  -1.813  1.00 58.28 ? 520  ASN A N     1 
ATOM   4333 C  CA    . ASN C 3 514 ? 27.678 30.838  -0.380  1.00 58.49 ? 520  ASN A CA    1 
ATOM   4334 C  C     . ASN C 3 514 ? 28.021 29.484  0.220   1.00 58.34 ? 520  ASN A C     1 
ATOM   4335 O  O     . ASN C 3 514 ? 28.640 29.403  1.283   1.00 58.32 ? 520  ASN A O     1 
ATOM   4336 C  CB    . ASN C 3 514 ? 26.403 31.401  0.251   1.00 59.56 ? 520  ASN A CB    1 
ATOM   4337 C  CG    . ASN C 3 514 ? 26.453 32.910  0.406   1.00 60.93 ? 520  ASN A CG    1 
ATOM   4338 O  OD1   . ASN C 3 514 ? 26.776 33.635  -0.540  1.00 60.86 ? 520  ASN A OD1   1 
ATOM   4339 N  ND2   . ASN C 3 514 ? 26.135 33.393  1.603   1.00 60.79 ? 520  ASN A ND2   1 
ATOM   4340 N  N     . ALA C 3 515 ? 27.613 28.421  -0.468  1.00 57.22 ? 521  ALA A N     1 
ATOM   4341 C  CA    . ALA C 3 515 ? 27.912 27.069  -0.013  1.00 55.65 ? 521  ALA A CA    1 
ATOM   4342 C  C     . ALA C 3 515 ? 29.426 26.927  -0.122  1.00 54.56 ? 521  ALA A C     1 
ATOM   4343 O  O     . ALA C 3 515 ? 30.098 26.506  0.825   1.00 53.63 ? 521  ALA A O     1 
ATOM   4344 C  CB    . ALA C 3 515 ? 27.218 26.046  -0.905  1.00 56.06 ? 521  ALA A CB    1 
ATOM   4345 N  N     . LYS C 3 516 ? 29.954 27.298  -1.286  1.00 53.01 ? 522  LYS A N     1 
ATOM   4346 C  CA    . LYS C 3 516 ? 31.386 27.240  -1.542  1.00 51.97 ? 522  LYS A CA    1 
ATOM   4347 C  C     . LYS C 3 516 ? 32.110 28.056  -0.470  1.00 51.75 ? 522  LYS A C     1 
ATOM   4348 O  O     . LYS C 3 516 ? 33.018 27.559  0.199   1.00 50.74 ? 522  LYS A O     1 
ATOM   4349 C  CB    . LYS C 3 516 ? 31.696 27.804  -2.933  1.00 50.21 ? 522  LYS A CB    1 
ATOM   4350 N  N     . THR C 3 517 ? 31.695 29.310  -0.309  1.00 51.94 ? 523  THR A N     1 
ATOM   4351 C  CA    . THR C 3 517 ? 32.290 30.194  0.687   1.00 53.01 ? 523  THR A CA    1 
ATOM   4352 C  C     . THR C 3 517 ? 32.298 29.477  2.031   1.00 53.19 ? 523  THR A C     1 
ATOM   4353 O  O     . THR C 3 517 ? 33.290 29.497  2.762   1.00 53.52 ? 523  THR A O     1 
ATOM   4354 C  CB    . THR C 3 517 ? 31.469 31.490  0.844   1.00 53.60 ? 523  THR A CB    1 
ATOM   4355 O  OG1   . THR C 3 517 ? 31.254 32.087  -0.442  1.00 55.32 ? 523  THR A OG1   1 
ATOM   4356 C  CG2   . THR C 3 517 ? 32.203 32.475  1.744   1.00 54.03 ? 523  THR A CG2   1 
ATOM   4357 N  N     . PHE C 3 518 ? 31.175 28.840  2.339   1.00 52.83 ? 524  PHE A N     1 
ATOM   4358 C  CA    . PHE C 3 518 ? 30.996 28.111  3.585   1.00 53.10 ? 524  PHE A CA    1 
ATOM   4359 C  C     . PHE C 3 518 ? 31.917 26.901  3.750   1.00 53.06 ? 524  PHE A C     1 
ATOM   4360 O  O     . PHE C 3 518 ? 32.541 26.722  4.796   1.00 53.36 ? 524  PHE A O     1 
ATOM   4361 C  CB    . PHE C 3 518 ? 29.548 27.642  3.698   1.00 53.46 ? 524  PHE A CB    1 
ATOM   4362 C  CG    . PHE C 3 518 ? 29.323 26.661  4.804   1.00 54.99 ? 524  PHE A CG    1 
ATOM   4363 C  CD1   . PHE C 3 518 ? 29.369 27.068  6.132   1.00 56.00 ? 524  PHE A CD1   1 
ATOM   4364 C  CD2   . PHE C 3 518 ? 29.098 25.318  4.518   1.00 55.70 ? 524  PHE A CD2   1 
ATOM   4365 C  CE1   . PHE C 3 518 ? 29.195 26.150  7.166   1.00 56.37 ? 524  PHE A CE1   1 
ATOM   4366 C  CE2   . PHE C 3 518 ? 28.924 24.390  5.540   1.00 55.67 ? 524  PHE A CE2   1 
ATOM   4367 C  CZ    . PHE C 3 518 ? 28.972 24.805  6.869   1.00 56.21 ? 524  PHE A CZ    1 
ATOM   4368 N  N     . ILE C 3 519 ? 31.987 26.069  2.717   1.00 52.05 ? 525  ILE A N     1 
ATOM   4369 C  CA    . ILE C 3 519 ? 32.803 24.863  2.768   1.00 51.06 ? 525  ILE A CA    1 
ATOM   4370 C  C     . ILE C 3 519 ? 34.300 25.155  2.804   1.00 51.64 ? 525  ILE A C     1 
ATOM   4371 O  O     . ILE C 3 519 ? 35.028 24.593  3.627   1.00 51.96 ? 525  ILE A O     1 
ATOM   4372 C  CB    . ILE C 3 519 ? 32.478 23.921  1.566   1.00 49.17 ? 525  ILE A CB    1 
ATOM   4373 C  CG1   . ILE C 3 519 ? 33.013 22.514  1.844   1.00 46.17 ? 525  ILE A CG1   1 
ATOM   4374 C  CG2   . ILE C 3 519 ? 33.071 24.473  0.274   1.00 47.93 ? 525  ILE A CG2   1 
ATOM   4375 C  CD1   . ILE C 3 519 ? 32.370 21.844  3.044   1.00 45.55 ? 525  ILE A CD1   1 
ATOM   4376 N  N     . TYR C 3 520 ? 34.763 26.037  1.923   1.00 51.99 ? 526  TYR A N     1 
ATOM   4377 C  CA    . TYR C 3 520 ? 36.179 26.366  1.880   1.00 52.61 ? 526  TYR A CA    1 
ATOM   4378 C  C     . TYR C 3 520 ? 36.623 27.040  3.160   1.00 52.60 ? 526  TYR A C     1 
ATOM   4379 O  O     . TYR C 3 520 ? 37.809 27.047  3.490   1.00 52.93 ? 526  TYR A O     1 
ATOM   4380 C  CB    . TYR C 3 520 ? 36.486 27.230  0.657   1.00 54.31 ? 526  TYR A CB    1 
ATOM   4381 C  CG    . TYR C 3 520 ? 36.391 26.431  -0.625  1.00 57.03 ? 526  TYR A CG    1 
ATOM   4382 C  CD1   . TYR C 3 520 ? 37.129 25.257  -0.787  1.00 57.72 ? 526  TYR A CD1   1 
ATOM   4383 C  CD2   . TYR C 3 520 ? 35.530 26.815  -1.656  1.00 58.20 ? 526  TYR A CD2   1 
ATOM   4384 C  CE1   . TYR C 3 520 ? 37.010 24.481  -1.939  1.00 59.18 ? 526  TYR A CE1   1 
ATOM   4385 C  CE2   . TYR C 3 520 ? 35.405 26.044  -2.814  1.00 58.93 ? 526  TYR A CE2   1 
ATOM   4386 C  CZ    . TYR C 3 520 ? 36.147 24.878  -2.946  1.00 59.74 ? 526  TYR A CZ    1 
ATOM   4387 O  OH    . TYR C 3 520 ? 36.020 24.100  -4.076  1.00 60.23 ? 526  TYR A OH    1 
ATOM   4388 N  N     . GLY C 3 521 ? 35.663 27.591  3.891   1.00 51.72 ? 527  GLY A N     1 
ATOM   4389 C  CA    . GLY C 3 521 ? 35.989 28.222  5.153   1.00 51.80 ? 527  GLY A CA    1 
ATOM   4390 C  C     . GLY C 3 521 ? 35.904 27.159  6.229   1.00 52.37 ? 527  GLY A C     1 
ATOM   4391 O  O     . GLY C 3 521 ? 36.559 27.237  7.268   1.00 52.59 ? 527  GLY A O     1 
ATOM   4392 N  N     . PHE C 3 522 ? 35.086 26.147  5.958   1.00 52.38 ? 528  PHE A N     1 
ATOM   4393 C  CA    . PHE C 3 522 ? 34.877 25.038  6.879   1.00 53.16 ? 528  PHE A CA    1 
ATOM   4394 C  C     . PHE C 3 522 ? 36.128 24.168  6.970   1.00 53.30 ? 528  PHE A C     1 
ATOM   4395 O  O     . PHE C 3 522 ? 36.501 23.706  8.051   1.00 51.55 ? 528  PHE A O     1 
ATOM   4396 C  CB    . PHE C 3 522 ? 33.702 24.185  6.395   1.00 54.17 ? 528  PHE A CB    1 
ATOM   4397 C  CG    . PHE C 3 522 ? 33.255 23.155  7.387   1.00 56.20 ? 528  PHE A CG    1 
ATOM   4398 C  CD1   . PHE C 3 522 ? 32.480 23.521  8.482   1.00 56.83 ? 528  PHE A CD1   1 
ATOM   4399 C  CD2   . PHE C 3 522 ? 33.629 21.822  7.244   1.00 57.10 ? 528  PHE A CD2   1 
ATOM   4400 C  CE1   . PHE C 3 522 ? 32.084 22.575  9.424   1.00 57.30 ? 528  PHE A CE1   1 
ATOM   4401 C  CE2   . PHE C 3 522 ? 33.239 20.868  8.182   1.00 56.58 ? 528  PHE A CE2   1 
ATOM   4402 C  CZ    . PHE C 3 522 ? 32.464 21.248  9.275   1.00 56.82 ? 528  PHE A CZ    1 
ATOM   4403 N  N     . LEU C 3 523 ? 36.764 23.949  5.821   1.00 54.08 ? 529  LEU A N     1 
ATOM   4404 C  CA    . LEU C 3 523 ? 37.969 23.132  5.736   1.00 55.70 ? 529  LEU A CA    1 
ATOM   4405 C  C     . LEU C 3 523 ? 39.125 23.800  6.464   1.00 57.54 ? 529  LEU A C     1 
ATOM   4406 O  O     . LEU C 3 523 ? 39.961 23.124  7.064   1.00 58.12 ? 529  LEU A O     1 
ATOM   4407 C  CB    . LEU C 3 523 ? 38.355 22.900  4.272   1.00 54.27 ? 529  LEU A CB    1 
ATOM   4408 C  CG    . LEU C 3 523 ? 37.308 22.235  3.374   1.00 53.84 ? 529  LEU A CG    1 
ATOM   4409 C  CD1   . LEU C 3 523 ? 37.858 22.107  1.962   1.00 51.52 ? 529  LEU A CD1   1 
ATOM   4410 C  CD2   . LEU C 3 523 ? 36.934 20.869  3.940   1.00 53.38 ? 529  LEU A CD2   1 
ATOM   4411 N  N     . TYR C 3 524 ? 39.170 25.128  6.395   1.00 59.06 ? 530  TYR A N     1 
ATOM   4412 C  CA    . TYR C 3 524 ? 40.214 25.902  7.055   1.00 59.84 ? 530  TYR A CA    1 
ATOM   4413 C  C     . TYR C 3 524 ? 39.660 26.471  8.357   1.00 60.80 ? 530  TYR A C     1 
ATOM   4414 O  O     . TYR C 3 524 ? 39.584 27.689  8.530   1.00 61.33 ? 530  TYR A O     1 
ATOM   4415 C  CB    . TYR C 3 524 ? 40.690 27.040  6.146   1.00 59.17 ? 530  TYR A CB    1 
ATOM   4416 N  N     . GLY C 3 525 ? 39.269 25.567  9.256   1.00 61.69 ? 531  GLY A N     1 
ATOM   4417 C  CA    . GLY C 3 525 ? 38.712 25.932  10.550  1.00 61.47 ? 531  GLY A CA    1 
ATOM   4418 C  C     . GLY C 3 525 ? 38.560 27.413  10.841  1.00 62.47 ? 531  GLY A C     1 
ATOM   4419 O  O     . GLY C 3 525 ? 39.260 27.959  11.699  1.00 63.19 ? 531  GLY A O     1 
ATOM   4420 N  N     . ALA C 3 526 ? 37.647 28.068  10.129  1.00 62.83 ? 532  ALA A N     1 
ATOM   4421 C  CA    . ALA C 3 526 ? 37.406 29.494  10.327  1.00 62.92 ? 532  ALA A CA    1 
ATOM   4422 C  C     . ALA C 3 526 ? 36.387 29.695  11.446  1.00 63.33 ? 532  ALA A C     1 
ATOM   4423 O  O     . ALA C 3 526 ? 35.446 28.910  11.589  1.00 63.66 ? 532  ALA A O     1 
ATOM   4424 C  CB    . ALA C 3 526 ? 36.900 30.124  9.034   1.00 62.67 ? 532  ALA A CB    1 
ATOM   4425 N  N     . GLY C 3 527 ? 36.584 30.743  12.242  1.00 63.68 ? 533  GLY A N     1 
ATOM   4426 C  CA    . GLY C 3 527 ? 35.677 31.025  13.342  1.00 63.60 ? 533  GLY A CA    1 
ATOM   4427 C  C     . GLY C 3 527 ? 34.234 31.193  12.903  1.00 63.60 ? 533  GLY A C     1 
ATOM   4428 O  O     . GLY C 3 527 ? 33.960 31.427  11.725  1.00 63.77 ? 533  GLY A O     1 
ATOM   4429 N  N     . ASP C 3 528 ? 33.307 31.070  13.850  1.00 63.83 ? 534  ASP A N     1 
ATOM   4430 C  CA    . ASP C 3 528 ? 31.886 31.214  13.550  1.00 63.97 ? 534  ASP A CA    1 
ATOM   4431 C  C     . ASP C 3 528 ? 31.616 32.597  12.960  1.00 63.85 ? 534  ASP A C     1 
ATOM   4432 O  O     . ASP C 3 528 ? 30.709 32.773  12.143  1.00 63.37 ? 534  ASP A O     1 
ATOM   4433 C  CB    . ASP C 3 528 ? 31.053 31.019  14.823  1.00 63.74 ? 534  ASP A CB    1 
ATOM   4434 N  N     . GLU C 3 529 ? 32.417 33.572  13.377  1.00 63.76 ? 535  GLU A N     1 
ATOM   4435 C  CA    . GLU C 3 529 ? 32.275 34.939  12.893  1.00 64.69 ? 535  GLU A CA    1 
ATOM   4436 C  C     . GLU C 3 529 ? 32.416 34.987  11.374  1.00 65.06 ? 535  GLU A C     1 
ATOM   4437 O  O     . GLU C 3 529 ? 31.517 35.457  10.671  1.00 65.05 ? 535  GLU A O     1 
ATOM   4438 C  CB    . GLU C 3 529 ? 33.330 35.840  13.543  1.00 64.59 ? 535  GLU A CB    1 
ATOM   4439 N  N     . LYS C 3 530 ? 33.548 34.497  10.875  1.00 65.37 ? 536  LYS A N     1 
ATOM   4440 C  CA    . LYS C 3 530 ? 33.811 34.482  9.439   1.00 65.26 ? 536  LYS A CA    1 
ATOM   4441 C  C     . LYS C 3 530 ? 32.651 33.826  8.687   1.00 65.16 ? 536  LYS A C     1 
ATOM   4442 O  O     . LYS C 3 530 ? 32.371 34.165  7.534   1.00 64.28 ? 536  LYS A O     1 
ATOM   4443 C  CB    . LYS C 3 530 ? 35.115 33.728  9.153   1.00 65.16 ? 536  LYS A CB    1 
ATOM   4444 N  N     . ILE C 3 531 ? 31.983 32.888  9.354   1.00 65.16 ? 537  ILE A N     1 
ATOM   4445 C  CA    . ILE C 3 531 ? 30.852 32.179  8.768   1.00 65.55 ? 537  ILE A CA    1 
ATOM   4446 C  C     . ILE C 3 531 ? 29.660 33.118  8.618   1.00 65.89 ? 537  ILE A C     1 
ATOM   4447 O  O     . ILE C 3 531 ? 28.991 33.127  7.584   1.00 66.46 ? 537  ILE A O     1 
ATOM   4448 C  CB    . ILE C 3 531 ? 30.430 30.978  9.643   1.00 65.07 ? 537  ILE A CB    1 
ATOM   4449 N  N     . GLY C 3 532 ? 29.403 33.908  9.656   1.00 66.71 ? 538  GLY A N     1 
ATOM   4450 C  CA    . GLY C 3 532 ? 28.291 34.843  9.620   1.00 66.91 ? 538  GLY A CA    1 
ATOM   4451 C  C     . GLY C 3 532 ? 28.426 35.878  8.518   1.00 67.41 ? 538  GLY A C     1 
ATOM   4452 O  O     . GLY C 3 532 ? 27.468 36.142  7.785   1.00 67.43 ? 538  GLY A O     1 
ATOM   4453 N  N     . GLN C 3 533 ? 29.621 36.456  8.393   1.00 67.11 ? 539  GLN A N     1 
ATOM   4454 C  CA    . GLN C 3 533 ? 29.898 37.480  7.384   1.00 66.66 ? 539  GLN A CA    1 
ATOM   4455 C  C     . GLN C 3 533 ? 29.653 37.010  5.950   1.00 66.83 ? 539  GLN A C     1 
ATOM   4456 O  O     . GLN C 3 533 ? 29.621 37.824  5.019   1.00 66.27 ? 539  GLN A O     1 
ATOM   4457 C  CB    . GLN C 3 533 ? 31.343 37.974  7.521   1.00 66.56 ? 539  GLN A CB    1 
ATOM   4458 N  N     . ILE C 3 534 ? 29.485 35.701  5.772   1.00 66.97 ? 540  ILE A N     1 
ATOM   4459 C  CA    . ILE C 3 534 ? 29.238 35.137  4.448   1.00 66.25 ? 540  ILE A CA    1 
ATOM   4460 C  C     . ILE C 3 534 ? 27.771 35.319  4.076   1.00 66.20 ? 540  ILE A C     1 
ATOM   4461 O  O     . ILE C 3 534 ? 27.412 35.329  2.896   1.00 66.16 ? 540  ILE A O     1 
ATOM   4462 C  CB    . ILE C 3 534 ? 29.580 33.632  4.404   1.00 65.46 ? 540  ILE A CB    1 
ATOM   4463 N  N     . VAL C 3 535 ? 26.928 35.458  5.095   1.00 65.79 ? 541  VAL A N     1 
ATOM   4464 C  CA    . VAL C 3 535 ? 25.495 35.649  4.897   1.00 65.68 ? 541  VAL A CA    1 
ATOM   4465 C  C     . VAL C 3 535 ? 25.112 37.077  5.276   1.00 66.23 ? 541  VAL A C     1 
ATOM   4466 O  O     . VAL C 3 535 ? 24.210 37.671  4.678   1.00 66.59 ? 541  VAL A O     1 
ATOM   4467 C  CB    . VAL C 3 535 ? 24.674 34.679  5.767   1.00 64.17 ? 541  VAL A CB    1 
ATOM   4468 N  N     . GLY C 3 536 ? 25.809 37.622  6.268   1.00 66.09 ? 542  GLY A N     1 
ATOM   4469 C  CA    . GLY C 3 536 ? 25.529 38.970  6.723   1.00 66.20 ? 542  GLY A CA    1 
ATOM   4470 C  C     . GLY C 3 536 ? 24.935 38.958  8.118   1.00 66.69 ? 542  GLY A C     1 
ATOM   4471 O  O     . GLY C 3 536 ? 24.041 39.747  8.431   1.00 67.02 ? 542  GLY A O     1 
ATOM   4472 N  N     . ALA C 3 537 ? 25.431 38.054  8.958   1.00 66.75 ? 543  ALA A N     1 
ATOM   4473 C  CA    . ALA C 3 537 ? 24.957 37.928  10.333  1.00 66.47 ? 543  ALA A CA    1 
ATOM   4474 C  C     . ALA C 3 537 ? 26.134 37.653  11.264  1.00 66.70 ? 543  ALA A C     1 
ATOM   4475 O  O     . ALA C 3 537 ? 25.957 37.135  12.366  1.00 66.99 ? 543  ALA A O     1 
ATOM   4476 C  CB    . ALA C 3 537 ? 23.932 36.801  10.432  1.00 66.35 ? 543  ALA A CB    1 
ATOM   4477 N  N     . GLY C 3 538 ? 27.329 38.012  10.798  1.00 67.07 ? 544  GLY A N     1 
ATOM   4478 C  CA    . GLY C 3 538 ? 28.565 37.821  11.544  1.00 67.47 ? 544  GLY A CA    1 
ATOM   4479 C  C     . GLY C 3 538 ? 28.530 37.280  12.966  1.00 68.20 ? 544  GLY A C     1 
ATOM   4480 O  O     . GLY C 3 538 ? 27.869 37.836  13.842  1.00 68.49 ? 544  GLY A O     1 
ATOM   4481 N  N     . LYS C 3 539 ? 29.263 36.190  13.189  1.00 68.79 ? 545  LYS A N     1 
ATOM   4482 C  CA    . LYS C 3 539 ? 29.370 35.547  14.500  1.00 68.97 ? 545  LYS A CA    1 
ATOM   4483 C  C     . LYS C 3 539 ? 28.047 35.157  15.159  1.00 69.80 ? 545  LYS A C     1 
ATOM   4484 O  O     . LYS C 3 539 ? 28.043 34.549  16.233  1.00 69.23 ? 545  LYS A O     1 
ATOM   4485 C  CB    . LYS C 3 539 ? 30.167 36.442  15.456  1.00 69.45 ? 545  LYS A CB    1 
ATOM   4486 N  N     . GLU C 3 540 ? 26.931 35.506  14.525  1.00 70.34 ? 546  GLU A N     1 
ATOM   4487 C  CA    . GLU C 3 540 ? 25.614 35.177  15.066  1.00 70.29 ? 546  GLU A CA    1 
ATOM   4488 C  C     . GLU C 3 540 ? 25.145 33.840  14.504  1.00 70.10 ? 546  GLU A C     1 
ATOM   4489 O  O     . GLU C 3 540 ? 25.074 32.843  15.225  1.00 69.99 ? 546  GLU A O     1 
ATOM   4490 C  CB    . GLU C 3 540 ? 24.602 36.272  14.713  1.00 70.32 ? 546  GLU A CB    1 
ATOM   4491 N  N     . ARG C 3 541 ? 24.826 33.826  13.214  1.00 70.01 ? 547  ARG A N     1 
ATOM   4492 C  CA    . ARG C 3 541 ? 24.379 32.605  12.557  1.00 70.64 ? 547  ARG A CA    1 
ATOM   4493 C  C     . ARG C 3 541 ? 25.585 31.696  12.313  1.00 70.55 ? 547  ARG A C     1 
ATOM   4494 O  O     . ARG C 3 541 ? 25.438 30.559  11.858  1.00 70.83 ? 547  ARG A O     1 
ATOM   4495 C  CB    . ARG C 3 541 ? 23.695 32.937  11.227  1.00 70.65 ? 547  ARG A CB    1 
ATOM   4496 N  N     . GLY C 3 542 ? 26.774 32.211  12.622  1.00 70.12 ? 548  GLY A N     1 
ATOM   4497 C  CA    . GLY C 3 542 ? 27.995 31.446  12.441  1.00 69.96 ? 548  GLY A CA    1 
ATOM   4498 C  C     . GLY C 3 542 ? 27.992 30.137  13.213  1.00 69.96 ? 548  GLY A C     1 
ATOM   4499 O  O     . GLY C 3 542 ? 28.638 29.168  12.810  1.00 70.11 ? 548  GLY A O     1 
ATOM   4500 N  N     . LYS C 3 543 ? 27.269 30.109  14.329  1.00 69.18 ? 549  LYS A N     1 
ATOM   4501 C  CA    . LYS C 3 543 ? 27.179 28.907  15.148  1.00 68.32 ? 549  LYS A CA    1 
ATOM   4502 C  C     . LYS C 3 543 ? 26.059 28.015  14.622  1.00 67.82 ? 549  LYS A C     1 
ATOM   4503 O  O     . LYS C 3 543 ? 26.159 26.787  14.656  1.00 67.64 ? 549  LYS A O     1 
ATOM   4504 C  CB    . LYS C 3 543 ? 26.900 29.278  16.607  1.00 68.41 ? 549  LYS A CB    1 
ATOM   4505 N  N     . GLU C 3 544 ? 24.997 28.647  14.131  1.00 67.11 ? 550  GLU A N     1 
ATOM   4506 C  CA    . GLU C 3 544 ? 23.844 27.931  13.595  1.00 66.19 ? 550  GLU A CA    1 
ATOM   4507 C  C     . GLU C 3 544 ? 24.169 27.211  12.288  1.00 65.50 ? 550  GLU A C     1 
ATOM   4508 O  O     . GLU C 3 544 ? 23.828 26.040  12.117  1.00 65.52 ? 550  GLU A O     1 
ATOM   4509 C  CB    . GLU C 3 544 ? 22.682 28.903  13.363  1.00 65.87 ? 550  GLU A CB    1 
ATOM   4510 N  N     . LEU C 3 545 ? 24.823 27.917  11.369  1.00 64.77 ? 551  LEU A N     1 
ATOM   4511 C  CA    . LEU C 3 545 ? 25.183 27.346  10.074  1.00 63.87 ? 551  LEU A CA    1 
ATOM   4512 C  C     . LEU C 3 545 ? 25.962 26.040  10.217  1.00 63.28 ? 551  LEU A C     1 
ATOM   4513 O  O     . LEU C 3 545 ? 25.503 24.984  9.776   1.00 63.54 ? 551  LEU A O     1 
ATOM   4514 C  CB    . LEU C 3 545 ? 26.005 28.351  9.262   1.00 63.77 ? 551  LEU A CB    1 
ATOM   4515 C  CG    . LEU C 3 545 ? 25.293 29.639  8.843   1.00 63.39 ? 551  LEU A CG    1 
ATOM   4516 C  CD1   . LEU C 3 545 ? 26.255 30.522  8.065   1.00 63.44 ? 551  LEU A CD1   1 
ATOM   4517 C  CD2   . LEU C 3 545 ? 24.075 29.301  7.997   1.00 62.91 ? 551  LEU A CD2   1 
ATOM   4518 N  N     . LYS C 3 546 ? 27.141 26.117  10.827  1.00 62.69 ? 552  LYS A N     1 
ATOM   4519 C  CA    . LYS C 3 546 ? 27.965 24.935  11.021  1.00 61.72 ? 552  LYS A CA    1 
ATOM   4520 C  C     . LYS C 3 546 ? 27.114 23.784  11.542  1.00 61.67 ? 552  LYS A C     1 
ATOM   4521 O  O     . LYS C 3 546 ? 27.090 22.707  10.949  1.00 62.32 ? 552  LYS A O     1 
ATOM   4522 C  CB    . LYS C 3 546 ? 29.102 25.228  12.006  1.00 61.42 ? 552  LYS A CB    1 
ATOM   4523 C  CG    . LYS C 3 546 ? 30.128 26.234  11.496  1.00 60.72 ? 552  LYS A CG    1 
ATOM   4524 C  CD    . LYS C 3 546 ? 31.216 26.503  12.533  1.00 60.28 ? 552  LYS A CD    1 
ATOM   4525 C  CE    . LYS C 3 546 ? 32.153 27.619  12.075  1.00 59.87 ? 552  LYS A CE    1 
ATOM   4526 N  NZ    . LYS C 3 546 ? 33.174 27.976  13.107  1.00 58.78 ? 552  LYS A NZ    1 
ATOM   4527 N  N     . LYS C 3 547 ? 26.399 24.026  12.637  1.00 61.34 ? 553  LYS A N     1 
ATOM   4528 C  CA    . LYS C 3 547 ? 25.549 23.009  13.256  1.00 60.69 ? 553  LYS A CA    1 
ATOM   4529 C  C     . LYS C 3 547 ? 24.543 22.352  12.304  1.00 60.43 ? 553  LYS A C     1 
ATOM   4530 O  O     . LYS C 3 547 ? 24.418 21.127  12.285  1.00 60.44 ? 553  LYS A O     1 
ATOM   4531 C  CB    . LYS C 3 547 ? 24.805 23.609  14.454  1.00 60.32 ? 553  LYS A CB    1 
ATOM   4532 N  N     . LYS C 3 548 ? 23.829 23.160  11.522  1.00 59.78 ? 554  LYS A N     1 
ATOM   4533 C  CA    . LYS C 3 548 ? 22.831 22.644  10.581  1.00 59.06 ? 554  LYS A CA    1 
ATOM   4534 C  C     . LYS C 3 548 ? 23.465 21.840  9.445   1.00 58.67 ? 554  LYS A C     1 
ATOM   4535 O  O     . LYS C 3 548 ? 22.843 20.933  8.884   1.00 58.78 ? 554  LYS A O     1 
ATOM   4536 C  CB    . LYS C 3 548 ? 22.014 23.797  9.993   1.00 59.02 ? 554  LYS A CB    1 
ATOM   4537 N  N     . PHE C 3 549 ? 24.703 22.186  9.106   1.00 57.87 ? 555  PHE A N     1 
ATOM   4538 C  CA    . PHE C 3 549 ? 25.442 21.502  8.048   1.00 55.96 ? 555  PHE A CA    1 
ATOM   4539 C  C     . PHE C 3 549 ? 25.771 20.081  8.504   1.00 55.41 ? 555  PHE A C     1 
ATOM   4540 O  O     . PHE C 3 549 ? 25.484 19.109  7.807   1.00 55.39 ? 555  PHE A O     1 
ATOM   4541 C  CB    . PHE C 3 549 ? 26.734 22.266  7.753   1.00 54.79 ? 555  PHE A CB    1 
ATOM   4542 C  CG    . PHE C 3 549 ? 27.624 21.598  6.746   1.00 52.32 ? 555  PHE A CG    1 
ATOM   4543 C  CD1   . PHE C 3 549 ? 27.209 21.437  5.428   1.00 51.83 ? 555  PHE A CD1   1 
ATOM   4544 C  CD2   . PHE C 3 549 ? 28.886 21.147  7.113   1.00 51.66 ? 555  PHE A CD2   1 
ATOM   4545 C  CE1   . PHE C 3 549 ? 28.040 20.839  4.488   1.00 51.81 ? 555  PHE A CE1   1 
ATOM   4546 C  CE2   . PHE C 3 549 ? 29.728 20.546  6.181   1.00 50.66 ? 555  PHE A CE2   1 
ATOM   4547 C  CZ    . PHE C 3 549 ? 29.303 20.392  4.864   1.00 52.19 ? 555  PHE A CZ    1 
ATOM   4548 N  N     . LEU C 3 550 ? 26.378 19.978  9.681   1.00 54.67 ? 556  LEU A N     1 
ATOM   4549 C  CA    . LEU C 3 550 ? 26.746 18.692  10.257  1.00 54.43 ? 556  LEU A CA    1 
ATOM   4550 C  C     . LEU C 3 550 ? 25.527 17.791  10.414  1.00 54.41 ? 556  LEU A C     1 
ATOM   4551 O  O     . LEU C 3 550 ? 25.576 16.599  10.106  1.00 54.28 ? 556  LEU A O     1 
ATOM   4552 C  CB    . LEU C 3 550 ? 27.404 18.902  11.623  1.00 54.92 ? 556  LEU A CB    1 
ATOM   4553 C  CG    . LEU C 3 550 ? 28.860 19.375  11.641  1.00 56.12 ? 556  LEU A CG    1 
ATOM   4554 C  CD1   . LEU C 3 550 ? 29.049 20.585  10.736  1.00 56.97 ? 556  LEU A CD1   1 
ATOM   4555 C  CD2   . LEU C 3 550 ? 29.252 19.706  13.071  1.00 56.65 ? 556  LEU A CD2   1 
ATOM   4556 N  N     . GLU C 3 551 ? 24.431 18.368  10.896  1.00 54.54 ? 557  GLU A N     1 
ATOM   4557 C  CA    . GLU C 3 551 ? 23.199 17.618  11.099  1.00 53.28 ? 557  GLU A CA    1 
ATOM   4558 C  C     . GLU C 3 551 ? 22.762 16.915  9.817   1.00 52.33 ? 557  GLU A C     1 
ATOM   4559 O  O     . GLU C 3 551 ? 22.345 15.758  9.848   1.00 51.67 ? 557  GLU A O     1 
ATOM   4560 C  CB    . GLU C 3 551 ? 22.088 18.557  11.586  1.00 54.21 ? 557  GLU A CB    1 
ATOM   4561 N  N     . ASN C 3 552 ? 22.872 17.615  8.691   1.00 52.28 ? 558  ASN A N     1 
ATOM   4562 C  CA    . ASN C 3 552 ? 22.481 17.058  7.397   1.00 52.13 ? 558  ASN A CA    1 
ATOM   4563 C  C     . ASN C 3 552 ? 23.616 16.366  6.642   1.00 50.60 ? 558  ASN A C     1 
ATOM   4564 O  O     . ASN C 3 552 ? 23.472 16.020  5.467   1.00 50.51 ? 558  ASN A O     1 
ATOM   4565 C  CB    . ASN C 3 552 ? 21.877 18.155  6.517   1.00 53.28 ? 558  ASN A CB    1 
ATOM   4566 C  CG    . ASN C 3 552 ? 20.519 18.608  7.009   1.00 55.59 ? 558  ASN A CG    1 
ATOM   4567 O  OD1   . ASN C 3 552 ? 19.586 17.807  7.110   1.00 57.21 ? 558  ASN A OD1   1 
ATOM   4568 N  ND2   . ASN C 3 552 ? 20.398 19.895  7.322   1.00 54.95 ? 558  ASN A ND2   1 
ATOM   4569 N  N     . THR C 3 553 ? 24.744 16.174  7.316   1.00 48.50 ? 559  THR A N     1 
ATOM   4570 C  CA    . THR C 3 553 ? 25.896 15.507  6.714   1.00 46.86 ? 559  THR A CA    1 
ATOM   4571 C  C     . THR C 3 553 ? 26.522 14.701  7.840   1.00 45.07 ? 559  THR A C     1 
ATOM   4572 O  O     . THR C 3 553 ? 27.631 14.991  8.290   1.00 44.73 ? 559  THR A O     1 
ATOM   4573 C  CB    . THR C 3 553 ? 26.931 16.516  6.189   1.00 47.40 ? 559  THR A CB    1 
ATOM   4574 O  OG1   . THR C 3 553 ? 26.275 17.520  5.407   1.00 49.30 ? 559  THR A OG1   1 
ATOM   4575 C  CG2   . THR C 3 553 ? 27.954 15.810  5.313   1.00 48.68 ? 559  THR A CG2   1 
ATOM   4576 N  N     . PRO C 3 554 ? 25.806 13.671  8.313   1.00 43.14 ? 560  PRO A N     1 
ATOM   4577 C  CA    . PRO C 3 554 ? 26.268 12.807  9.403   1.00 41.86 ? 560  PRO A CA    1 
ATOM   4578 C  C     . PRO C 3 554 ? 27.668 12.204  9.253   1.00 40.03 ? 560  PRO A C     1 
ATOM   4579 O  O     . PRO C 3 554 ? 28.357 12.001  10.247  1.00 40.26 ? 560  PRO A O     1 
ATOM   4580 C  CB    . PRO C 3 554 ? 25.162 11.751  9.498   1.00 40.32 ? 560  PRO A CB    1 
ATOM   4581 C  CG    . PRO C 3 554 ? 24.651 11.675  8.101   1.00 41.12 ? 560  PRO A CG    1 
ATOM   4582 C  CD    . PRO C 3 554 ? 24.583 13.126  7.699   1.00 41.81 ? 560  PRO A CD    1 
ATOM   4583 N  N     . ALA C 3 555 ? 28.094 11.925  8.025   1.00 38.88 ? 561  ALA A N     1 
ATOM   4584 C  CA    . ALA C 3 555 ? 29.425 11.352  7.824   1.00 37.56 ? 561  ALA A CA    1 
ATOM   4585 C  C     . ALA C 3 555 ? 30.511 12.285  8.373   1.00 35.86 ? 561  ALA A C     1 
ATOM   4586 O  O     . ALA C 3 555 ? 31.504 11.823  8.931   1.00 35.40 ? 561  ALA A O     1 
ATOM   4587 C  CB    . ALA C 3 555 ? 29.670 11.064  6.340   1.00 36.18 ? 561  ALA A CB    1 
ATOM   4588 N  N     . ILE C 3 556 ? 30.315 13.593  8.229   1.00 34.74 ? 562  ILE A N     1 
ATOM   4589 C  CA    . ILE C 3 556 ? 31.291 14.556  8.727   1.00 34.56 ? 562  ILE A CA    1 
ATOM   4590 C  C     . ILE C 3 556 ? 31.303 14.582  10.250  1.00 35.29 ? 562  ILE A C     1 
ATOM   4591 O  O     . ILE C 3 556 ? 32.369 14.641  10.869  1.00 36.22 ? 562  ILE A O     1 
ATOM   4592 C  CB    . ILE C 3 556 ? 31.010 15.977  8.204   1.00 33.92 ? 562  ILE A CB    1 
ATOM   4593 C  CG1   . ILE C 3 556 ? 31.083 15.991  6.676   1.00 34.00 ? 562  ILE A CG1   1 
ATOM   4594 C  CG2   . ILE C 3 556 ? 32.033 16.956  8.774   1.00 36.04 ? 562  ILE A CG2   1 
ATOM   4595 C  CD1   . ILE C 3 556 ? 31.035 17.374  6.064   1.00 31.85 ? 562  ILE A CD1   1 
ATOM   4596 N  N     . ALA C 3 557 ? 30.122 14.533  10.859  1.00 34.51 ? 563  ALA A N     1 
ATOM   4597 C  CA    . ALA C 3 557 ? 30.027 14.543  12.318  1.00 32.81 ? 563  ALA A CA    1 
ATOM   4598 C  C     . ALA C 3 557 ? 30.663 13.266  12.858  1.00 31.53 ? 563  ALA A C     1 
ATOM   4599 O  O     . ALA C 3 557 ? 31.306 13.266  13.903  1.00 30.59 ? 563  ALA A O     1 
ATOM   4600 C  CB    . ALA C 3 557 ? 28.558 14.635  12.758  1.00 32.35 ? 563  ALA A CB    1 
ATOM   4601 N  N     . ALA C 3 558 ? 30.472 12.169  12.138  1.00 31.92 ? 564  ALA A N     1 
ATOM   4602 C  CA    . ALA C 3 558 ? 31.058 10.904  12.552  1.00 33.72 ? 564  ALA A CA    1 
ATOM   4603 C  C     . ALA C 3 558 ? 32.584 11.047  12.529  1.00 33.13 ? 564  ALA A C     1 
ATOM   4604 O  O     . ALA C 3 558 ? 33.268 10.621  13.458  1.00 34.12 ? 564  ALA A O     1 
ATOM   4605 C  CB    . ALA C 3 558 ? 30.618 9.791   11.614  1.00 32.01 ? 564  ALA A CB    1 
ATOM   4606 N  N     . LEU C 3 559 ? 33.105 11.654  11.467  1.00 32.74 ? 565  LEU A N     1 
ATOM   4607 C  CA    . LEU C 3 559 ? 34.552 11.857  11.325  1.00 33.42 ? 565  LEU A CA    1 
ATOM   4608 C  C     . LEU C 3 559 ? 35.112 12.697  12.470  1.00 34.34 ? 565  LEU A C     1 
ATOM   4609 O  O     . LEU C 3 559 ? 36.077 12.300  13.121  1.00 33.04 ? 565  LEU A O     1 
ATOM   4610 C  CB    . LEU C 3 559 ? 34.863 12.534  9.988   1.00 29.64 ? 565  LEU A CB    1 
ATOM   4611 C  CG    . LEU C 3 559 ? 36.315 12.956  9.719   1.00 29.74 ? 565  LEU A CG    1 
ATOM   4612 C  CD1   . LEU C 3 559 ? 37.272 11.770  9.863   1.00 28.11 ? 565  LEU A CD1   1 
ATOM   4613 C  CD2   . LEU C 3 559 ? 36.386 13.536  8.318   1.00 24.99 ? 565  LEU A CD2   1 
ATOM   4614 N  N     . ARG C 3 560 ? 34.498 13.852  12.714  1.00 36.70 ? 566  ARG A N     1 
ATOM   4615 C  CA    . ARG C 3 560 ? 34.937 14.730  13.790  1.00 39.93 ? 566  ARG A CA    1 
ATOM   4616 C  C     . ARG C 3 560 ? 35.006 13.950  15.091  1.00 40.54 ? 566  ARG A C     1 
ATOM   4617 O  O     . ARG C 3 560 ? 35.946 14.102  15.874  1.00 40.28 ? 566  ARG A O     1 
ATOM   4618 C  CB    . ARG C 3 560 ? 33.966 15.896  13.985  1.00 43.83 ? 566  ARG A CB    1 
ATOM   4619 C  CG    . ARG C 3 560 ? 33.985 16.969  12.909  1.00 47.88 ? 566  ARG A CG    1 
ATOM   4620 C  CD    . ARG C 3 560 ? 33.217 18.186  13.410  1.00 52.51 ? 566  ARG A CD    1 
ATOM   4621 N  NE    . ARG C 3 560 ? 33.471 19.381  12.612  1.00 57.52 ? 566  ARG A NE    1 
ATOM   4622 C  CZ    . ARG C 3 560 ? 33.206 20.620  13.020  1.00 60.03 ? 566  ARG A CZ    1 
ATOM   4623 N  NH1   . ARG C 3 560 ? 32.678 20.826  14.223  1.00 60.39 ? 566  ARG A NH1   1 
ATOM   4624 N  NH2   . ARG C 3 560 ? 33.474 21.653  12.230  1.00 60.55 ? 566  ARG A NH2   1 
ATOM   4625 N  N     . GLU C 3 561 ? 33.999 13.112  15.315  1.00 40.21 ? 567  GLU A N     1 
ATOM   4626 C  CA    . GLU C 3 561 ? 33.936 12.320  16.531  1.00 41.39 ? 567  GLU A CA    1 
ATOM   4627 C  C     . GLU C 3 561 ? 35.033 11.264  16.640  1.00 39.50 ? 567  GLU A C     1 
ATOM   4628 O  O     . GLU C 3 561 ? 35.650 11.124  17.697  1.00 37.96 ? 567  GLU A O     1 
ATOM   4629 C  CB    . GLU C 3 561 ? 32.552 11.674  16.666  1.00 43.97 ? 567  GLU A CB    1 
ATOM   4630 C  CG    . GLU C 3 561 ? 31.445 12.688  16.949  1.00 50.22 ? 567  GLU A CG    1 
ATOM   4631 C  CD    . GLU C 3 561 ? 30.064 12.051  17.065  1.00 53.47 ? 567  GLU A CD    1 
ATOM   4632 O  OE1   . GLU C 3 561 ? 29.893 11.146  17.914  1.00 54.20 ? 567  GLU A OE1   1 
ATOM   4633 O  OE2   . GLU C 3 561 ? 29.150 12.462  16.310  1.00 53.81 ? 567  GLU A OE2   1 
ATOM   4634 N  N     . SER C 3 562 ? 35.283 10.514  15.571  1.00 38.98 ? 568  SER A N     1 
ATOM   4635 C  CA    . SER C 3 562 ? 36.328 9.498   15.644  1.00 39.32 ? 568  SER A CA    1 
ATOM   4636 C  C     . SER C 3 562 ? 37.685 10.187  15.786  1.00 39.55 ? 568  SER A C     1 
ATOM   4637 O  O     . SER C 3 562 ? 38.591 9.655   16.417  1.00 38.23 ? 568  SER A O     1 
ATOM   4638 C  CB    . SER C 3 562 ? 36.315 8.598   14.403  1.00 39.91 ? 568  SER A CB    1 
ATOM   4639 O  OG    . SER C 3 562 ? 36.489 9.353   13.222  1.00 43.03 ? 568  SER A OG    1 
ATOM   4640 N  N     . ILE C 3 563 ? 37.812 11.379  15.208  1.00 40.55 ? 569  ILE A N     1 
ATOM   4641 C  CA    . ILE C 3 563 ? 39.058 12.132  15.294  1.00 42.94 ? 569  ILE A CA    1 
ATOM   4642 C  C     . ILE C 3 563 ? 39.353 12.535  16.740  1.00 44.07 ? 569  ILE A C     1 
ATOM   4643 O  O     . ILE C 3 563 ? 40.461 12.336  17.233  1.00 43.26 ? 569  ILE A O     1 
ATOM   4644 C  CB    . ILE C 3 563 ? 39.005 13.406  14.420  1.00 43.47 ? 569  ILE A CB    1 
ATOM   4645 C  CG1   . ILE C 3 563 ? 39.267 13.046  12.957  1.00 44.46 ? 569  ILE A CG1   1 
ATOM   4646 C  CG2   . ILE C 3 563 ? 40.020 14.416  14.905  1.00 45.18 ? 569  ILE A CG2   1 
ATOM   4647 C  CD1   . ILE C 3 563 ? 39.238 14.241  12.025  1.00 45.17 ? 569  ILE A CD1   1 
ATOM   4648 N  N     . GLN C 3 564 ? 38.357 13.103  17.412  1.00 45.02 ? 570  GLN A N     1 
ATOM   4649 C  CA    . GLN C 3 564 ? 38.529 13.525  18.794  1.00 46.85 ? 570  GLN A CA    1 
ATOM   4650 C  C     . GLN C 3 564 ? 38.690 12.373  19.784  1.00 46.46 ? 570  GLN A C     1 
ATOM   4651 O  O     . GLN C 3 564 ? 39.326 12.539  20.824  1.00 47.25 ? 570  GLN A O     1 
ATOM   4652 C  CB    . GLN C 3 564 ? 37.368 14.419  19.223  1.00 49.17 ? 570  GLN A CB    1 
ATOM   4653 C  CG    . GLN C 3 564 ? 37.485 15.840  18.698  1.00 51.35 ? 570  GLN A CG    1 
ATOM   4654 C  CD    . GLN C 3 564 ? 36.618 16.806  19.476  1.00 53.00 ? 570  GLN A CD    1 
ATOM   4655 O  OE1   . GLN C 3 564 ? 36.660 16.835  20.711  1.00 52.97 ? 570  GLN A OE1   1 
ATOM   4656 N  NE2   . GLN C 3 564 ? 35.834 17.610  18.762  1.00 53.03 ? 570  GLN A NE2   1 
ATOM   4657 N  N     . GLN C 3 565 ? 38.122 11.212  19.471  1.00 45.34 ? 571  GLN A N     1 
ATOM   4658 C  CA    . GLN C 3 565 ? 38.249 10.059  20.359  1.00 44.89 ? 571  GLN A CA    1 
ATOM   4659 C  C     . GLN C 3 565 ? 39.709 9.629   20.384  1.00 44.71 ? 571  GLN A C     1 
ATOM   4660 O  O     . GLN C 3 565 ? 40.213 9.113   21.381  1.00 44.10 ? 571  GLN A O     1 
ATOM   4661 C  CB    . GLN C 3 565 ? 37.381 8.896   19.867  1.00 43.98 ? 571  GLN A CB    1 
ATOM   4662 N  N     . THR C 3 566 ? 40.386 9.851   19.267  1.00 44.80 ? 572  THR A N     1 
ATOM   4663 C  CA    . THR C 3 566 ? 41.788 9.495   19.143  1.00 45.33 ? 572  THR A CA    1 
ATOM   4664 C  C     . THR C 3 566 ? 42.663 10.398  20.003  1.00 44.42 ? 572  THR A C     1 
ATOM   4665 O  O     . THR C 3 566 ? 43.679 9.964   20.536  1.00 45.41 ? 572  THR A O     1 
ATOM   4666 C  CB    . THR C 3 566 ? 42.242 9.608   17.673  1.00 46.09 ? 572  THR A CB    1 
ATOM   4667 O  OG1   . THR C 3 566 ? 41.589 8.596   16.895  1.00 48.58 ? 572  THR A OG1   1 
ATOM   4668 C  CG2   . THR C 3 566 ? 43.743 9.444   17.557  1.00 48.03 ? 572  THR A CG2   1 
ATOM   4669 N  N     . LEU C 3 567 ? 42.252 11.651  20.152  1.00 43.66 ? 573  LEU A N     1 
ATOM   4670 C  CA    . LEU C 3 567 ? 43.032 12.617  20.914  1.00 44.22 ? 573  LEU A CA    1 
ATOM   4671 C  C     . LEU C 3 567 ? 42.593 12.830  22.360  1.00 46.05 ? 573  LEU A C     1 
ATOM   4672 O  O     . LEU C 3 567 ? 43.414 12.763  23.275  1.00 46.06 ? 573  LEU A O     1 
ATOM   4673 C  CB    . LEU C 3 567 ? 43.014 13.963  20.191  1.00 40.91 ? 573  LEU A CB    1 
ATOM   4674 C  CG    . LEU C 3 567 ? 43.406 13.948  18.711  1.00 40.32 ? 573  LEU A CG    1 
ATOM   4675 C  CD1   . LEU C 3 567 ? 43.130 15.310  18.111  1.00 38.20 ? 573  LEU A CD1   1 
ATOM   4676 C  CD2   . LEU C 3 567 ? 44.878 13.566  18.560  1.00 39.76 ? 573  LEU A CD2   1 
ATOM   4677 N  N     . VAL C 3 568 ? 41.302 13.090  22.555  1.00 48.23 ? 574  VAL A N     1 
ATOM   4678 C  CA    . VAL C 3 568 ? 40.749 13.363  23.880  1.00 50.60 ? 574  VAL A CA    1 
ATOM   4679 C  C     . VAL C 3 568 ? 40.205 12.150  24.620  1.00 51.92 ? 574  VAL A C     1 
ATOM   4680 O  O     . VAL C 3 568 ? 39.361 11.421  24.101  1.00 52.17 ? 574  VAL A O     1 
ATOM   4681 C  CB    . VAL C 3 568 ? 39.619 14.401  23.789  1.00 50.88 ? 574  VAL A CB    1 
ATOM   4682 C  CG1   . VAL C 3 568 ? 39.111 14.742  25.182  1.00 51.53 ? 574  VAL A CG1   1 
ATOM   4683 C  CG2   . VAL C 3 568 ? 40.117 15.645  23.073  1.00 51.53 ? 574  VAL A CG2   1 
ATOM   4684 N  N     . GLU C 3 569 ? 40.681 11.954  25.846  1.00 53.40 ? 575  GLU A N     1 
ATOM   4685 C  CA    . GLU C 3 569 ? 40.237 10.832  26.667  1.00 55.51 ? 575  GLU A CA    1 
ATOM   4686 C  C     . GLU C 3 569 ? 39.326 11.343  27.783  1.00 55.48 ? 575  GLU A C     1 
ATOM   4687 O  O     . GLU C 3 569 ? 39.139 12.579  27.843  1.00 55.20 ? 575  GLU A O     1 
ATOM   4688 C  CB    . GLU C 3 569 ? 41.446 10.110  27.277  1.00 56.93 ? 575  GLU A CB    1 
ATOM   4689 C  CG    . GLU C 3 569 ? 41.236 8.619   27.548  1.00 59.35 ? 575  GLU A CG    1 
ATOM   4690 C  CD    . GLU C 3 569 ? 40.104 8.333   28.521  1.00 61.03 ? 575  GLU A CD    1 
ATOM   4691 O  OE1   . GLU C 3 569 ? 38.945 8.683   28.210  1.00 62.56 ? 575  GLU A OE1   1 
ATOM   4692 O  OE2   . GLU C 3 569 ? 40.375 7.753   29.596  1.00 61.47 ? 575  GLU A OE2   1 
ATOM   4693 N  N     . LYS C 3 581 ? 43.277 15.154  29.918  1.00 49.01 ? 587  LYS A N     1 
ATOM   4694 C  CA    . LYS C 3 581 ? 42.528 15.817  28.816  1.00 47.87 ? 587  LYS A CA    1 
ATOM   4695 C  C     . LYS C 3 581 ? 42.957 15.259  27.458  1.00 48.35 ? 587  LYS A C     1 
ATOM   4696 O  O     . LYS C 3 581 ? 42.158 15.237  26.517  1.00 49.53 ? 587  LYS A O     1 
ATOM   4697 C  CB    . LYS C 3 581 ? 42.761 17.333  28.854  1.00 46.40 ? 587  LYS A CB    1 
ATOM   4698 N  N     . TRP C 3 582 ? 44.210 14.809  27.357  1.00 47.26 ? 588  TRP A N     1 
ATOM   4699 C  CA    . TRP C 3 582 ? 44.725 14.251  26.104  1.00 45.20 ? 588  TRP A CA    1 
ATOM   4700 C  C     . TRP C 3 582 ? 45.282 12.850  26.274  1.00 44.81 ? 588  TRP A C     1 
ATOM   4701 O  O     . TRP C 3 582 ? 46.001 12.572  27.230  1.00 43.24 ? 588  TRP A O     1 
ATOM   4702 C  CB    . TRP C 3 582 ? 45.862 15.102  25.523  1.00 45.47 ? 588  TRP A CB    1 
ATOM   4703 C  CG    . TRP C 3 582 ? 45.516 16.495  25.139  1.00 43.87 ? 588  TRP A CG    1 
ATOM   4704 C  CD1   . TRP C 3 582 ? 45.540 17.596  25.943  1.00 43.96 ? 588  TRP A CD1   1 
ATOM   4705 C  CD2   . TRP C 3 582 ? 45.137 16.955  23.837  1.00 43.64 ? 588  TRP A CD2   1 
ATOM   4706 N  NE1   . TRP C 3 582 ? 45.208 18.717  25.221  1.00 43.32 ? 588  TRP A NE1   1 
ATOM   4707 C  CE2   . TRP C 3 582 ? 44.954 18.352  23.924  1.00 43.08 ? 588  TRP A CE2   1 
ATOM   4708 C  CE3   . TRP C 3 582 ? 44.934 16.321  22.602  1.00 43.43 ? 588  TRP A CE3   1 
ATOM   4709 C  CZ2   . TRP C 3 582 ? 44.578 19.131  22.823  1.00 43.87 ? 588  TRP A CZ2   1 
ATOM   4710 C  CZ3   . TRP C 3 582 ? 44.561 17.094  21.507  1.00 42.76 ? 588  TRP A CZ3   1 
ATOM   4711 C  CH2   . TRP C 3 582 ? 44.388 18.487  21.627  1.00 42.96 ? 588  TRP A CH2   1 
ATOM   4712 N  N     . LYS C 3 583 ? 44.951 11.972  25.334  1.00 44.16 ? 589  LYS A N     1 
ATOM   4713 C  CA    . LYS C 3 583 ? 45.472 10.615  25.348  1.00 45.42 ? 589  LYS A CA    1 
ATOM   4714 C  C     . LYS C 3 583 ? 46.593 10.597  24.309  1.00 44.52 ? 589  LYS A C     1 
ATOM   4715 O  O     . LYS C 3 583 ? 47.464 9.726   24.328  1.00 45.47 ? 589  LYS A O     1 
ATOM   4716 C  CB    . LYS C 3 583 ? 44.381 9.606   24.973  1.00 47.12 ? 589  LYS A CB    1 
ATOM   4717 C  CG    . LYS C 3 583 ? 43.781 9.819   23.601  1.00 50.23 ? 589  LYS A CG    1 
ATOM   4718 C  CD    . LYS C 3 583 ? 42.608 8.883   23.349  1.00 52.63 ? 589  LYS A CD    1 
ATOM   4719 C  CE    . LYS C 3 583 ? 43.029 7.422   23.382  1.00 53.33 ? 589  LYS A CE    1 
ATOM   4720 N  NZ    . LYS C 3 583 ? 41.890 6.519   23.033  1.00 54.75 ? 589  LYS A NZ    1 
ATOM   4721 N  N     . ARG C 3 584 ? 46.565 11.591  23.420  1.00 43.55 ? 590  ARG A N     1 
ATOM   4722 C  CA    . ARG C 3 584 ? 47.549 11.744  22.345  1.00 40.58 ? 590  ARG A CA    1 
ATOM   4723 C  C     . ARG C 3 584 ? 47.413 13.167  21.780  1.00 39.85 ? 590  ARG A C     1 
ATOM   4724 O  O     . ARG C 3 584 ? 46.315 13.589  21.423  1.00 38.93 ? 590  ARG A O     1 
ATOM   4725 C  CB    . ARG C 3 584 ? 47.266 10.704  21.258  1.00 39.80 ? 590  ARG A CB    1 
ATOM   4726 C  CG    . ARG C 3 584 ? 48.316 10.584  20.180  1.00 40.10 ? 590  ARG A CG    1 
ATOM   4727 C  CD    . ARG C 3 584 ? 48.040 9.366   19.303  1.00 37.94 ? 590  ARG A CD    1 
ATOM   4728 N  N     . ARG C 3 585 ? 48.517 13.908  21.698  1.00 38.97 ? 591  ARG A N     1 
ATOM   4729 C  CA    . ARG C 3 585 ? 48.462 15.286  21.194  1.00 38.53 ? 591  ARG A CA    1 
ATOM   4730 C  C     . ARG C 3 585 ? 48.761 15.475  19.705  1.00 35.24 ? 591  ARG A C     1 
ATOM   4731 O  O     . ARG C 3 585 ? 49.091 16.579  19.262  1.00 34.21 ? 591  ARG A O     1 
ATOM   4732 C  CB    . ARG C 3 585 ? 49.394 16.184  22.011  1.00 40.75 ? 591  ARG A CB    1 
ATOM   4733 C  CG    . ARG C 3 585 ? 48.932 16.410  23.454  1.00 45.94 ? 591  ARG A CG    1 
ATOM   4734 C  CD    . ARG C 3 585 ? 49.671 17.571  24.105  1.00 47.69 ? 591  ARG A CD    1 
ATOM   4735 N  NE    . ARG C 3 585 ? 49.153 17.865  25.439  1.00 50.42 ? 591  ARG A NE    1 
ATOM   4736 C  CZ    . ARG C 3 585 ? 49.315 17.068  26.489  1.00 51.98 ? 591  ARG A CZ    1 
ATOM   4737 N  NH1   . ARG C 3 585 ? 49.986 15.931  26.362  1.00 53.19 ? 591  ARG A NH1   1 
ATOM   4738 N  NH2   . ARG C 3 585 ? 48.800 17.402  27.663  1.00 53.20 ? 591  ARG A NH2   1 
ATOM   4739 N  N     . TRP C 3 586 ? 48.626 14.411  18.929  1.00 32.90 ? 592  TRP A N     1 
ATOM   4740 C  CA    . TRP C 3 586 ? 48.898 14.494  17.501  1.00 30.70 ? 592  TRP A CA    1 
ATOM   4741 C  C     . TRP C 3 586 ? 48.074 13.512  16.685  1.00 29.64 ? 592  TRP A C     1 
ATOM   4742 O  O     . TRP C 3 586 ? 47.553 12.538  17.218  1.00 31.44 ? 592  TRP A O     1 
ATOM   4743 C  CB    . TRP C 3 586 ? 50.385 14.223  17.235  1.00 27.70 ? 592  TRP A CB    1 
ATOM   4744 C  CG    . TRP C 3 586 ? 50.921 13.021  17.968  1.00 26.31 ? 592  TRP A CG    1 
ATOM   4745 C  CD1   . TRP C 3 586 ? 51.476 13.008  19.219  1.00 27.62 ? 592  TRP A CD1   1 
ATOM   4746 C  CD2   . TRP C 3 586 ? 50.956 11.663  17.503  1.00 25.44 ? 592  TRP A CD2   1 
ATOM   4747 N  NE1   . TRP C 3 586 ? 51.857 11.732  19.559  1.00 25.77 ? 592  TRP A NE1   1 
ATOM   4748 C  CE2   . TRP C 3 586 ? 51.551 10.886  18.525  1.00 26.26 ? 592  TRP A CE2   1 
ATOM   4749 C  CE3   . TRP C 3 586 ? 50.541 11.025  16.320  1.00 26.65 ? 592  TRP A CE3   1 
ATOM   4750 C  CZ2   . TRP C 3 586 ? 51.747 9.503   18.403  1.00 26.05 ? 592  TRP A CZ2   1 
ATOM   4751 C  CZ3   . TRP C 3 586 ? 50.733 9.649   16.196  1.00 25.39 ? 592  TRP A CZ3   1 
ATOM   4752 C  CH2   . TRP C 3 586 ? 51.333 8.903   17.235  1.00 27.07 ? 592  TRP A CH2   1 
ATOM   4753 N  N     . ILE C 3 587 ? 47.959 13.779  15.388  1.00 28.65 ? 593  ILE A N     1 
ATOM   4754 C  CA    . ILE C 3 587 ? 47.245 12.886  14.485  1.00 28.76 ? 593  ILE A CA    1 
ATOM   4755 C  C     . ILE C 3 587 ? 48.312 12.287  13.575  1.00 28.19 ? 593  ILE A C     1 
ATOM   4756 O  O     . ILE C 3 587 ? 49.399 12.849  13.418  1.00 28.08 ? 593  ILE A O     1 
ATOM   4757 C  CB    . ILE C 3 587 ? 46.181 13.633  13.630  1.00 30.57 ? 593  ILE A CB    1 
ATOM   4758 C  CG1   . ILE C 3 587 ? 45.554 12.678  12.601  1.00 35.19 ? 593  ILE A CG1   1 
ATOM   4759 C  CG2   . ILE C 3 587 ? 46.827 14.771  12.867  1.00 28.67 ? 593  ILE A CG2   1 
ATOM   4760 C  CD1   . ILE C 3 587 ? 45.033 11.346  13.171  1.00 39.04 ? 593  ILE A CD1   1 
ATOM   4761 N  N     . LYS C 3 588 ? 48.006 11.142  12.989  1.00 27.47 ? 594  LYS A N     1 
ATOM   4762 C  CA    . LYS C 3 588 ? 48.940 10.465  12.112  1.00 28.36 ? 594  LYS A CA    1 
ATOM   4763 C  C     . LYS C 3 588 ? 48.759 10.951  10.679  1.00 27.65 ? 594  LYS A C     1 
ATOM   4764 O  O     . LYS C 3 588 ? 47.695 10.783  10.094  1.00 25.11 ? 594  LYS A O     1 
ATOM   4765 C  CB    . LYS C 3 588 ? 48.716 8.951   12.189  1.00 30.75 ? 594  LYS A CB    1 
ATOM   4766 C  CG    . LYS C 3 588 ? 49.904 8.133   11.704  1.00 33.85 ? 594  LYS A CG    1 
ATOM   4767 C  CD    . LYS C 3 588 ? 49.707 6.645   11.947  1.00 35.23 ? 594  LYS A CD    1 
ATOM   4768 C  CE    . LYS C 3 588 ? 48.783 6.024   10.913  1.00 38.79 ? 594  LYS A CE    1 
ATOM   4769 N  NZ    . LYS C 3 588 ? 49.391 6.043   9.548   1.00 40.30 ? 594  LYS A NZ    1 
ATOM   4770 N  N     . GLY C 3 589 ? 49.800 11.565  10.127  1.00 26.95 ? 595  GLY A N     1 
ATOM   4771 C  CA    . GLY C 3 589 ? 49.736 12.056  8.761   1.00 25.82 ? 595  GLY A CA    1 
ATOM   4772 C  C     . GLY C 3 589 ? 49.717 10.912  7.766   1.00 25.78 ? 595  GLY A C     1 
ATOM   4773 O  O     . GLY C 3 589 ? 49.913 9.756   8.148   1.00 26.54 ? 595  GLY A O     1 
ATOM   4774 N  N     . LEU C 3 590 ? 49.499 11.223  6.491   1.00 25.47 ? 596  LEU A N     1 
ATOM   4775 C  CA    . LEU C 3 590 ? 49.437 10.192  5.456   1.00 24.86 ? 596  LEU A CA    1 
ATOM   4776 C  C     . LEU C 3 590 ? 50.707 9.362   5.327   1.00 25.77 ? 596  LEU A C     1 
ATOM   4777 O  O     . LEU C 3 590 ? 50.649 8.200   4.924   1.00 25.24 ? 596  LEU A O     1 
ATOM   4778 C  CB    . LEU C 3 590 ? 49.090 10.810  4.092   1.00 24.91 ? 596  LEU A CB    1 
ATOM   4779 C  CG    . LEU C 3 590 ? 47.678 11.399  3.936   1.00 23.07 ? 596  LEU A CG    1 
ATOM   4780 C  CD1   . LEU C 3 590 ? 47.530 12.069  2.577   1.00 22.77 ? 596  LEU A CD1   1 
ATOM   4781 C  CD2   . LEU C 3 590 ? 46.648 10.297  4.106   1.00 23.21 ? 596  LEU A CD2   1 
ATOM   4782 N  N     . ASP C 3 591 ? 51.856 9.943   5.665   1.00 25.68 ? 597  ASP A N     1 
ATOM   4783 C  CA    . ASP C 3 591 ? 53.091 9.187   5.555   1.00 25.02 ? 597  ASP A CA    1 
ATOM   4784 C  C     . ASP C 3 591 ? 53.561 8.663   6.906   1.00 24.85 ? 597  ASP A C     1 
ATOM   4785 O  O     . ASP C 3 591 ? 54.709 8.262   7.054   1.00 22.95 ? 597  ASP A O     1 
ATOM   4786 C  CB    . ASP C 3 591 ? 54.190 10.021  4.891   1.00 25.44 ? 597  ASP A CB    1 
ATOM   4787 C  CG    . ASP C 3 591 ? 54.484 11.303  5.635   1.00 27.31 ? 597  ASP A CG    1 
ATOM   4788 O  OD1   . ASP C 3 591 ? 54.051 11.432  6.799   1.00 28.30 ? 597  ASP A OD1   1 
ATOM   4789 O  OD2   . ASP C 3 591 ? 55.157 12.177  5.056   1.00 28.06 ? 597  ASP A OD2   1 
ATOM   4790 N  N     . GLY C 3 592 ? 52.660 8.678   7.886   1.00 25.31 ? 598  GLY A N     1 
ATOM   4791 C  CA    . GLY C 3 592 ? 52.975 8.164   9.207   1.00 25.40 ? 598  GLY A CA    1 
ATOM   4792 C  C     . GLY C 3 592 ? 53.490 9.132   10.251  1.00 25.94 ? 598  GLY A C     1 
ATOM   4793 O  O     . GLY C 3 592 ? 53.501 8.808   11.438  1.00 26.59 ? 598  GLY A O     1 
ATOM   4794 N  N     . ARG C 3 593 ? 53.913 10.315  9.829   1.00 25.58 ? 599  ARG A N     1 
ATOM   4795 C  CA    . ARG C 3 593 ? 54.446 11.293  10.768  1.00 25.39 ? 599  ARG A CA    1 
ATOM   4796 C  C     . ARG C 3 593 ? 53.417 11.799  11.778  1.00 26.06 ? 599  ARG A C     1 
ATOM   4797 O  O     . ARG C 3 593 ? 52.203 11.761  11.539  1.00 22.37 ? 599  ARG A O     1 
ATOM   4798 C  CB    . ARG C 3 593 ? 54.978 12.497  10.009  1.00 25.60 ? 599  ARG A CB    1 
ATOM   4799 C  CG    . ARG C 3 593 ? 53.871 13.239  9.276   1.00 28.71 ? 599  ARG A CG    1 
ATOM   4800 C  CD    . ARG C 3 593 ? 54.341 13.632  7.893   1.00 28.30 ? 599  ARG A CD    1 
ATOM   4801 N  NE    . ARG C 3 593 ? 54.902 14.953  7.900   1.00 27.54 ? 599  ARG A NE    1 
ATOM   4802 C  CZ    . ARG C 3 593 ? 55.705 15.432  6.967   1.00 24.63 ? 599  ARG A CZ    1 
ATOM   4803 N  NH1   . ARG C 3 593 ? 56.058 14.683  5.930   1.00 25.92 ? 599  ARG A NH1   1 
ATOM   4804 N  NH2   . ARG C 3 593 ? 56.135 16.677  7.083   1.00 22.88 ? 599  ARG A NH2   1 
ATOM   4805 N  N     . LYS C 3 594 ? 53.918 12.285  12.906  1.00 24.39 ? 600  LYS A N     1 
ATOM   4806 C  CA    . LYS C 3 594 ? 53.044 12.848  13.918  1.00 26.31 ? 600  LYS A CA    1 
ATOM   4807 C  C     . LYS C 3 594 ? 52.799 14.277  13.462  1.00 27.09 ? 600  LYS A C     1 
ATOM   4808 O  O     . LYS C 3 594 ? 53.702 14.910  12.916  1.00 26.35 ? 600  LYS A O     1 
ATOM   4809 C  CB    . LYS C 3 594 ? 53.733 12.917  15.283  1.00 26.63 ? 600  LYS A CB    1 
ATOM   4810 C  CG    . LYS C 3 594 ? 54.276 11.621  15.848  1.00 27.72 ? 600  LYS A CG    1 
ATOM   4811 C  CD    . LYS C 3 594 ? 54.918 11.941  17.192  1.00 30.64 ? 600  LYS A CD    1 
ATOM   4812 C  CE    . LYS C 3 594 ? 55.571 10.751  17.846  1.00 33.86 ? 600  LYS A CE    1 
ATOM   4813 N  NZ    . LYS C 3 594 ? 56.176 11.169  19.148  1.00 34.22 ? 600  LYS A NZ    1 
ATOM   4814 N  N     . VAL C 3 595 ? 51.588 14.779  13.682  1.00 27.10 ? 601  VAL A N     1 
ATOM   4815 C  CA    . VAL C 3 595 ? 51.249 16.154  13.335  1.00 28.15 ? 601  VAL A CA    1 
ATOM   4816 C  C     . VAL C 3 595 ? 50.612 16.758  14.575  1.00 29.00 ? 601  VAL A C     1 
ATOM   4817 O  O     . VAL C 3 595 ? 49.467 16.445  14.911  1.00 29.81 ? 601  VAL A O     1 
ATOM   4818 C  CB    . VAL C 3 595 ? 50.249 16.227  12.170  1.00 28.95 ? 601  VAL A CB    1 
ATOM   4819 C  CG1   . VAL C 3 595 ? 49.990 17.688  11.809  1.00 28.77 ? 601  VAL A CG1   1 
ATOM   4820 C  CG2   . VAL C 3 595 ? 50.801 15.472  10.960  1.00 28.50 ? 601  VAL A CG2   1 
ATOM   4821 N  N     . HIS C 3 596 ? 51.352 17.614  15.268  1.00 28.55 ? 602  HIS A N     1 
ATOM   4822 C  CA    . HIS C 3 596 ? 50.825 18.221  16.485  1.00 32.50 ? 602  HIS A CA    1 
ATOM   4823 C  C     . HIS C 3 596 ? 49.462 18.896  16.291  1.00 32.21 ? 602  HIS A C     1 
ATOM   4824 O  O     . HIS C 3 596 ? 49.208 19.542  15.275  1.00 33.03 ? 602  HIS A O     1 
ATOM   4825 C  CB    . HIS C 3 596 ? 51.807 19.245  17.049  1.00 32.43 ? 602  HIS A CB    1 
ATOM   4826 C  CG    . HIS C 3 596 ? 51.354 19.855  18.337  1.00 35.66 ? 602  HIS A CG    1 
ATOM   4827 N  ND1   . HIS C 3 596 ? 51.258 19.133  19.507  1.00 36.14 ? 602  HIS A ND1   1 
ATOM   4828 C  CD2   . HIS C 3 596 ? 50.929 21.107  18.632  1.00 36.24 ? 602  HIS A CD2   1 
ATOM   4829 C  CE1   . HIS C 3 596 ? 50.791 19.912  20.466  1.00 36.56 ? 602  HIS A CE1   1 
ATOM   4830 N  NE2   . HIS C 3 596 ? 50.584 21.115  19.961  1.00 37.65 ? 602  HIS A NE2   1 
ATOM   4831 N  N     . VAL C 3 597 ? 48.585 18.724  17.273  1.00 34.17 ? 603  VAL A N     1 
ATOM   4832 C  CA    . VAL C 3 597 ? 47.262 19.339  17.233  1.00 34.81 ? 603  VAL A CA    1 
ATOM   4833 C  C     . VAL C 3 597 ? 47.162 20.262  18.440  1.00 36.68 ? 603  VAL A C     1 
ATOM   4834 O  O     . VAL C 3 597 ? 47.409 19.836  19.567  1.00 37.55 ? 603  VAL A O     1 
ATOM   4835 C  CB    . VAL C 3 597 ? 46.142 18.287  17.319  1.00 34.07 ? 603  VAL A CB    1 
ATOM   4836 C  CG1   . VAL C 3 597 ? 44.784 18.981  17.373  1.00 32.72 ? 603  VAL A CG1   1 
ATOM   4837 C  CG2   . VAL C 3 597 ? 46.210 17.356  16.123  1.00 32.16 ? 603  VAL A CG2   1 
ATOM   4838 N  N     . ARG C 3 598 ? 46.812 21.523  18.206  1.00 39.53 ? 604  ARG A N     1 
ATOM   4839 C  CA    . ARG C 3 598 ? 46.695 22.489  19.296  1.00 42.76 ? 604  ARG A CA    1 
ATOM   4840 C  C     . ARG C 3 598 ? 45.481 22.216  20.182  1.00 44.55 ? 604  ARG A C     1 
ATOM   4841 O  O     . ARG C 3 598 ? 45.613 22.073  21.402  1.00 45.27 ? 604  ARG A O     1 
ATOM   4842 C  CB    . ARG C 3 598 ? 46.615 23.911  18.735  1.00 44.12 ? 604  ARG A CB    1 
ATOM   4843 N  N     . SER C 3 599 ? 44.299 22.146  19.571  1.00 45.30 ? 605  SER A N     1 
ATOM   4844 C  CA    . SER C 3 599 ? 43.076 21.886  20.320  1.00 45.25 ? 605  SER A CA    1 
ATOM   4845 C  C     . SER C 3 599 ? 42.199 20.864  19.605  1.00 45.96 ? 605  SER A C     1 
ATOM   4846 O  O     . SER C 3 599 ? 42.287 20.700  18.388  1.00 44.82 ? 605  SER A O     1 
ATOM   4847 C  CB    . SER C 3 599 ? 42.286 23.183  20.519  1.00 45.23 ? 605  SER A CB    1 
ATOM   4848 O  OG    . SER C 3 599 ? 41.751 23.651  19.293  1.00 46.75 ? 605  SER A OG    1 
ATOM   4849 N  N     . PRO C 3 600 ? 41.337 20.161  20.358  1.00 47.27 ? 606  PRO A N     1 
ATOM   4850 C  CA    . PRO C 3 600 ? 40.444 19.153  19.778  1.00 47.87 ? 606  PRO A CA    1 
ATOM   4851 C  C     . PRO C 3 600 ? 39.606 19.743  18.646  1.00 48.85 ? 606  PRO A C     1 
ATOM   4852 O  O     . PRO C 3 600 ? 39.340 19.078  17.643  1.00 49.10 ? 606  PRO A O     1 
ATOM   4853 C  CB    . PRO C 3 600 ? 39.595 18.727  20.971  1.00 48.18 ? 606  PRO A CB    1 
ATOM   4854 C  CG    . PRO C 3 600 ? 40.553 18.858  22.116  1.00 48.64 ? 606  PRO A CG    1 
ATOM   4855 C  CD    . PRO C 3 600 ? 41.201 20.196  21.826  1.00 47.38 ? 606  PRO A CD    1 
ATOM   4856 N  N     . HIS C 3 601 ? 39.201 20.999  18.812  1.00 49.10 ? 607  HIS A N     1 
ATOM   4857 C  CA    . HIS C 3 601 ? 38.397 21.685  17.805  1.00 50.77 ? 607  HIS A CA    1 
ATOM   4858 C  C     . HIS C 3 601 ? 39.129 21.821  16.471  1.00 49.19 ? 607  HIS A C     1 
ATOM   4859 O  O     . HIS C 3 601 ? 38.501 21.882  15.412  1.00 49.56 ? 607  HIS A O     1 
ATOM   4860 C  CB    . HIS C 3 601 ? 37.993 23.079  18.306  1.00 53.34 ? 607  HIS A CB    1 
ATOM   4861 C  CG    . HIS C 3 601 ? 37.311 23.918  17.268  1.00 56.62 ? 607  HIS A CG    1 
ATOM   4862 N  ND1   . HIS C 3 601 ? 36.189 23.493  16.585  1.00 58.51 ? 607  HIS A ND1   1 
ATOM   4863 C  CD2   . HIS C 3 601 ? 37.598 25.152  16.788  1.00 57.15 ? 607  HIS A CD2   1 
ATOM   4864 C  CE1   . HIS C 3 601 ? 35.816 24.429  15.729  1.00 58.36 ? 607  HIS A CE1   1 
ATOM   4865 N  NE2   . HIS C 3 601 ? 36.655 25.446  15.833  1.00 58.51 ? 607  HIS A NE2   1 
ATOM   4866 N  N     . ALA C 3 602 ? 40.456 21.869  16.523  1.00 47.33 ? 608  ALA A N     1 
ATOM   4867 C  CA    . ALA C 3 602 ? 41.259 22.015  15.313  1.00 45.30 ? 608  ALA A CA    1 
ATOM   4868 C  C     . ALA C 3 602 ? 41.620 20.673  14.674  1.00 43.64 ? 608  ALA A C     1 
ATOM   4869 O  O     . ALA C 3 602 ? 42.046 20.622  13.522  1.00 43.38 ? 608  ALA A O     1 
ATOM   4870 C  CB    . ALA C 3 602 ? 42.529 22.800  15.630  1.00 46.36 ? 608  ALA A CB    1 
ATOM   4871 N  N     . ALA C 3 603 ? 41.442 19.594  15.426  1.00 41.13 ? 609  ALA A N     1 
ATOM   4872 C  CA    . ALA C 3 603 ? 41.761 18.250  14.958  1.00 40.60 ? 609  ALA A CA    1 
ATOM   4873 C  C     . ALA C 3 603 ? 41.415 17.992  13.492  1.00 40.36 ? 609  ALA A C     1 
ATOM   4874 O  O     . ALA C 3 603 ? 42.304 17.775  12.668  1.00 39.09 ? 609  ALA A O     1 
ATOM   4875 C  CB    . ALA C 3 603 ? 41.072 17.223  15.844  1.00 40.62 ? 609  ALA A CB    1 
ATOM   4876 N  N     . LEU C 3 604 ? 40.126 18.010  13.168  1.00 39.53 ? 610  LEU A N     1 
ATOM   4877 C  CA    . LEU C 3 604 ? 39.689 17.764  11.801  1.00 38.93 ? 610  LEU A CA    1 
ATOM   4878 C  C     . LEU C 3 604 ? 40.442 18.615  10.790  1.00 37.75 ? 610  LEU A C     1 
ATOM   4879 O  O     . LEU C 3 604 ? 40.991 18.092  9.824   1.00 36.35 ? 610  LEU A O     1 
ATOM   4880 C  CB    . LEU C 3 604 ? 38.181 18.018  11.663  1.00 39.78 ? 610  LEU A CB    1 
ATOM   4881 C  CG    . LEU C 3 604 ? 37.577 17.863  10.255  1.00 39.98 ? 610  LEU A CG    1 
ATOM   4882 C  CD1   . LEU C 3 604 ? 37.863 16.469  9.714   1.00 38.82 ? 610  LEU A CD1   1 
ATOM   4883 C  CD2   . LEU C 3 604 ? 36.064 18.125  10.306  1.00 39.14 ? 610  LEU A CD2   1 
ATOM   4884 N  N     . ASN C 3 605 ? 40.462 19.927  11.009  1.00 37.68 ? 611  ASN A N     1 
ATOM   4885 C  CA    . ASN C 3 605 ? 41.146 20.835  10.094  1.00 37.45 ? 611  ASN A CA    1 
ATOM   4886 C  C     . ASN C 3 605 ? 42.621 20.467  9.920   1.00 37.39 ? 611  ASN A C     1 
ATOM   4887 O  O     . ASN C 3 605 ? 43.143 20.463  8.802   1.00 36.58 ? 611  ASN A O     1 
ATOM   4888 C  CB    . ASN C 3 605 ? 41.001 22.279  10.582  1.00 39.40 ? 611  ASN A CB    1 
ATOM   4889 C  CG    . ASN C 3 605 ? 42.000 23.217  9.934   1.00 43.05 ? 611  ASN A CG    1 
ATOM   4890 O  OD1   . ASN C 3 605 ? 43.047 23.520  10.511  1.00 45.95 ? 611  ASN A OD1   1 
ATOM   4891 N  ND2   . ASN C 3 605 ? 41.693 23.672  8.725   1.00 44.30 ? 611  ASN A ND2   1 
ATOM   4892 N  N     . THR C 3 606 ? 43.289 20.159  11.025  1.00 35.93 ? 612  THR A N     1 
ATOM   4893 C  CA    . THR C 3 606 ? 44.691 19.766  10.973  1.00 36.47 ? 612  THR A CA    1 
ATOM   4894 C  C     . THR C 3 606 ? 44.802 18.532  10.077  1.00 35.90 ? 612  THR A C     1 
ATOM   4895 O  O     . THR C 3 606 ? 45.668 18.463  9.205   1.00 35.09 ? 612  THR A O     1 
ATOM   4896 C  CB    . THR C 3 606 ? 45.217 19.429  12.381  1.00 36.63 ? 612  THR A CB    1 
ATOM   4897 O  OG1   . THR C 3 606 ? 45.115 20.594  13.212  1.00 36.51 ? 612  THR A OG1   1 
ATOM   4898 C  CG2   . THR C 3 606 ? 46.664 18.982  12.321  1.00 36.31 ? 612  THR A CG2   1 
ATOM   4899 N  N     . LEU C 3 607 ? 43.903 17.572  10.291  1.00 34.62 ? 613  LEU A N     1 
ATOM   4900 C  CA    . LEU C 3 607 ? 43.869 16.340  9.504   1.00 34.98 ? 613  LEU A CA    1 
ATOM   4901 C  C     . LEU C 3 607 ? 43.770 16.624  8.007   1.00 34.62 ? 613  LEU A C     1 
ATOM   4902 O  O     . LEU C 3 607 ? 44.558 16.111  7.213   1.00 34.91 ? 613  LEU A O     1 
ATOM   4903 C  CB    . LEU C 3 607 ? 42.675 15.467  9.910   1.00 34.45 ? 613  LEU A CB    1 
ATOM   4904 C  CG    . LEU C 3 607 ? 42.500 14.175  9.096   1.00 35.42 ? 613  LEU A CG    1 
ATOM   4905 C  CD1   . LEU C 3 607 ? 43.599 13.191  9.477   1.00 34.18 ? 613  LEU A CD1   1 
ATOM   4906 C  CD2   . LEU C 3 607 ? 41.130 13.551  9.359   1.00 35.05 ? 613  LEU A CD2   1 
ATOM   4907 N  N     . LEU C 3 608 ? 42.797 17.443  7.626   1.00 34.68 ? 614  LEU A N     1 
ATOM   4908 C  CA    . LEU C 3 608 ? 42.592 17.765  6.220   1.00 34.00 ? 614  LEU A CA    1 
ATOM   4909 C  C     . LEU C 3 608 ? 43.751 18.537  5.604   1.00 33.22 ? 614  LEU A C     1 
ATOM   4910 O  O     . LEU C 3 608 ? 44.231 18.178  4.534   1.00 32.76 ? 614  LEU A O     1 
ATOM   4911 C  CB    . LEU C 3 608 ? 41.289 18.551  6.036   1.00 35.10 ? 614  LEU A CB    1 
ATOM   4912 C  CG    . LEU C 3 608 ? 40.021 17.886  6.581   1.00 36.65 ? 614  LEU A CG    1 
ATOM   4913 C  CD1   . LEU C 3 608 ? 38.807 18.698  6.155   1.00 36.73 ? 614  LEU A CD1   1 
ATOM   4914 C  CD2   . LEU C 3 608 ? 39.910 16.452  6.067   1.00 35.84 ? 614  LEU A CD2   1 
ATOM   4915 N  N     . GLN C 3 609 ? 44.192 19.599  6.273   1.00 33.29 ? 615  GLN A N     1 
ATOM   4916 C  CA    . GLN C 3 609 ? 45.300 20.412  5.777   1.00 32.87 ? 615  GLN A CA    1 
ATOM   4917 C  C     . GLN C 3 609 ? 46.581 19.588  5.642   1.00 30.47 ? 615  GLN A C     1 
ATOM   4918 O  O     . GLN C 3 609 ? 47.364 19.793  4.719   1.00 30.48 ? 615  GLN A O     1 
ATOM   4919 C  CB    . GLN C 3 609 ? 45.562 21.606  6.716   1.00 37.07 ? 615  GLN A CB    1 
ATOM   4920 C  CG    . GLN C 3 609 ? 46.809 22.429  6.336   1.00 45.48 ? 615  GLN A CG    1 
ATOM   4921 C  CD    . GLN C 3 609 ? 47.166 23.531  7.344   1.00 49.62 ? 615  GLN A CD    1 
ATOM   4922 O  OE1   . GLN C 3 609 ? 48.263 24.113  7.289   1.00 49.12 ? 615  GLN A OE1   1 
ATOM   4923 N  NE2   . GLN C 3 609 ? 46.244 23.823  8.261   1.00 50.55 ? 615  GLN A NE2   1 
ATOM   4924 N  N     . SER C 3 610 ? 46.798 18.664  6.569   1.00 28.32 ? 616  SER A N     1 
ATOM   4925 C  CA    . SER C 3 610 ? 47.998 17.839  6.527   1.00 27.43 ? 616  SER A CA    1 
ATOM   4926 C  C     . SER C 3 610 ? 47.923 16.867  5.359   1.00 27.61 ? 616  SER A C     1 
ATOM   4927 O  O     . SER C 3 610 ? 48.933 16.589  4.708   1.00 28.67 ? 616  SER A O     1 
ATOM   4928 C  CB    . SER C 3 610 ? 48.174 17.063  7.835   1.00 25.17 ? 616  SER A CB    1 
ATOM   4929 O  OG    . SER C 3 610 ? 49.376 16.314  7.806   1.00 28.20 ? 616  SER A OG    1 
ATOM   4930 N  N     . ALA C 3 611 ? 46.728 16.342  5.103   1.00 27.59 ? 617  ALA A N     1 
ATOM   4931 C  CA    . ALA C 3 611 ? 46.542 15.418  3.991   1.00 27.64 ? 617  ALA A CA    1 
ATOM   4932 C  C     . ALA C 3 611 ? 46.843 16.166  2.689   1.00 26.20 ? 617  ALA A C     1 
ATOM   4933 O  O     . ALA C 3 611 ? 47.567 15.661  1.837   1.00 25.87 ? 617  ALA A O     1 
ATOM   4934 C  CB    . ALA C 3 611 ? 45.113 14.870  3.983   1.00 27.44 ? 617  ALA A CB    1 
ATOM   4935 N  N     . GLY C 3 612 ? 46.305 17.376  2.544   1.00 26.14 ? 618  GLY A N     1 
ATOM   4936 C  CA    . GLY C 3 612 ? 46.570 18.151  1.336   1.00 24.70 ? 618  GLY A CA    1 
ATOM   4937 C  C     . GLY C 3 612 ? 48.056 18.453  1.164   1.00 24.46 ? 618  GLY A C     1 
ATOM   4938 O  O     . GLY C 3 612 ? 48.630 18.283  0.081   1.00 24.89 ? 618  GLY A O     1 
ATOM   4939 N  N     . ALA C 3 613 ? 48.690 18.914  2.238   1.00 24.09 ? 619  ALA A N     1 
ATOM   4940 C  CA    . ALA C 3 613 ? 50.119 19.223  2.201   1.00 23.06 ? 619  ALA A CA    1 
ATOM   4941 C  C     . ALA C 3 613 ? 50.965 18.012  1.792   1.00 23.12 ? 619  ALA A C     1 
ATOM   4942 O  O     . ALA C 3 613 ? 51.848 18.127  0.941   1.00 24.42 ? 619  ALA A O     1 
ATOM   4943 C  CB    . ALA C 3 613 ? 50.583 19.722  3.575   1.00 22.12 ? 619  ALA A CB    1 
ATOM   4944 N  N     . LEU C 3 614 ? 50.704 16.853  2.396   1.00 23.51 ? 620  LEU A N     1 
ATOM   4945 C  CA    . LEU C 3 614 ? 51.499 15.672  2.077   1.00 22.28 ? 620  LEU A CA    1 
ATOM   4946 C  C     . LEU C 3 614 ? 51.213 15.116  0.688   1.00 23.73 ? 620  LEU A C     1 
ATOM   4947 O  O     . LEU C 3 614 ? 52.113 14.615  0.025   1.00 23.61 ? 620  LEU A O     1 
ATOM   4948 C  CB    . LEU C 3 614 ? 51.330 14.602  3.161   1.00 20.99 ? 620  LEU A CB    1 
ATOM   4949 C  CG    . LEU C 3 614 ? 51.754 15.079  4.563   1.00 21.00 ? 620  LEU A CG    1 
ATOM   4950 C  CD1   . LEU C 3 614 ? 51.776 13.893  5.531   1.00 16.50 ? 620  LEU A CD1   1 
ATOM   4951 C  CD2   . LEU C 3 614 ? 53.130 15.739  4.511   1.00 18.76 ? 620  LEU A CD2   1 
ATOM   4952 N  N     . ILE C 3 615 ? 49.971 15.216  0.230   1.00 24.65 ? 621  ILE A N     1 
ATOM   4953 C  CA    . ILE C 3 615 ? 49.659 14.747  -1.112  1.00 23.95 ? 621  ILE A CA    1 
ATOM   4954 C  C     . ILE C 3 615 ? 50.376 15.634  -2.134  1.00 24.59 ? 621  ILE A C     1 
ATOM   4955 O  O     . ILE C 3 615 ? 50.953 15.128  -3.100  1.00 23.19 ? 621  ILE A O     1 
ATOM   4956 C  CB    . ILE C 3 615 ? 48.154 14.779  -1.385  1.00 24.29 ? 621  ILE A CB    1 
ATOM   4957 C  CG1   . ILE C 3 615 ? 47.522 13.490  -0.870  1.00 23.09 ? 621  ILE A CG1   1 
ATOM   4958 C  CG2   . ILE C 3 615 ? 47.891 14.937  -2.884  1.00 23.66 ? 621  ILE A CG2   1 
ATOM   4959 C  CD1   . ILE C 3 615 ? 46.012 13.526  -0.831  1.00 28.59 ? 621  ILE A CD1   1 
ATOM   4960 N  N     . CYS C 3 616 ? 50.342 16.952  -1.928  1.00 23.27 ? 622  CYS A N     1 
ATOM   4961 C  CA    . CYS C 3 616 ? 51.016 17.855  -2.858  1.00 26.04 ? 622  CYS A CA    1 
ATOM   4962 C  C     . CYS C 3 616 ? 52.528 17.687  -2.821  1.00 24.65 ? 622  CYS A C     1 
ATOM   4963 O  O     . CYS C 3 616 ? 53.196 17.833  -3.836  1.00 25.83 ? 622  CYS A O     1 
ATOM   4964 C  CB    . CYS C 3 616 ? 50.665 19.319  -2.567  1.00 28.12 ? 622  CYS A CB    1 
ATOM   4965 S  SG    . CYS C 3 616 ? 49.045 19.802  -3.177  1.00 37.93 ? 622  CYS A SG    1 
ATOM   4966 N  N     . LYS C 3 617 ? 53.066 17.384  -1.649  1.00 23.83 ? 623  LYS A N     1 
ATOM   4967 C  CA    . LYS C 3 617 ? 54.504 17.202  -1.520  1.00 24.92 ? 623  LYS A CA    1 
ATOM   4968 C  C     . LYS C 3 617 ? 54.939 15.966  -2.316  1.00 24.47 ? 623  LYS A C     1 
ATOM   4969 O  O     . LYS C 3 617 ? 55.815 16.050  -3.181  1.00 25.61 ? 623  LYS A O     1 
ATOM   4970 C  CB    . LYS C 3 617 ? 54.869 17.078  -0.038  1.00 24.83 ? 623  LYS A CB    1 
ATOM   4971 C  CG    . LYS C 3 617 ? 56.345 16.934  0.259   1.00 23.72 ? 623  LYS A CG    1 
ATOM   4972 C  CD    . LYS C 3 617 ? 56.624 17.219  1.732   1.00 25.85 ? 623  LYS A CD    1 
ATOM   4973 C  CE    . LYS C 3 617 ? 56.492 18.712  2.059   1.00 25.47 ? 623  LYS A CE    1 
ATOM   4974 N  NZ    . LYS C 3 617 ? 56.789 19.027  3.495   1.00 23.43 ? 623  LYS A NZ    1 
ATOM   4975 N  N     . LEU C 3 618 ? 54.314 14.822  -2.045  1.00 23.64 ? 624  LEU A N     1 
ATOM   4976 C  CA    . LEU C 3 618 ? 54.659 13.597  -2.770  1.00 24.97 ? 624  LEU A CA    1 
ATOM   4977 C  C     . LEU C 3 618 ? 54.385 13.776  -4.265  1.00 22.73 ? 624  LEU A C     1 
ATOM   4978 O  O     . LEU C 3 618 ? 55.112 13.254  -5.104  1.00 23.20 ? 624  LEU A O     1 
ATOM   4979 C  CB    . LEU C 3 618 ? 53.852 12.403  -2.231  1.00 24.45 ? 624  LEU A CB    1 
ATOM   4980 C  CG    . LEU C 3 618 ? 54.189 11.025  -2.820  1.00 25.26 ? 624  LEU A CG    1 
ATOM   4981 C  CD1   . LEU C 3 618 ? 55.699 10.755  -2.722  1.00 25.56 ? 624  LEU A CD1   1 
ATOM   4982 C  CD2   . LEU C 3 618 ? 53.403 9.946   -2.063  1.00 25.21 ? 624  LEU A CD2   1 
ATOM   4983 N  N     . TRP C 3 619 ? 53.339 14.527  -4.592  1.00 23.69 ? 625  TRP A N     1 
ATOM   4984 C  CA    . TRP C 3 619 ? 52.982 14.783  -5.985  1.00 24.71 ? 625  TRP A CA    1 
ATOM   4985 C  C     . TRP C 3 619 ? 54.084 15.511  -6.772  1.00 25.43 ? 625  TRP A C     1 
ATOM   4986 O  O     . TRP C 3 619 ? 54.489 15.056  -7.841  1.00 26.80 ? 625  TRP A O     1 
ATOM   4987 C  CB    . TRP C 3 619 ? 51.681 15.584  -6.050  1.00 24.66 ? 625  TRP A CB    1 
ATOM   4988 C  CG    . TRP C 3 619 ? 51.386 16.171  -7.405  1.00 24.16 ? 625  TRP A CG    1 
ATOM   4989 C  CD1   . TRP C 3 619 ? 51.302 15.502  -8.596  1.00 22.26 ? 625  TRP A CD1   1 
ATOM   4990 C  CD2   . TRP C 3 619 ? 51.101 17.545  -7.694  1.00 24.96 ? 625  TRP A CD2   1 
ATOM   4991 N  NE1   . TRP C 3 619 ? 50.977 16.379  -9.605  1.00 25.51 ? 625  TRP A NE1   1 
ATOM   4992 C  CE2   . TRP C 3 619 ? 50.849 17.638  -9.077  1.00 25.10 ? 625  TRP A CE2   1 
ATOM   4993 C  CE3   . TRP C 3 619 ? 51.033 18.709  -6.914  1.00 25.83 ? 625  TRP A CE3   1 
ATOM   4994 C  CZ2   . TRP C 3 619 ? 50.532 18.851  -9.699  1.00 25.46 ? 625  TRP A CZ2   1 
ATOM   4995 C  CZ3   . TRP C 3 619 ? 50.719 19.911  -7.534  1.00 26.10 ? 625  TRP A CZ3   1 
ATOM   4996 C  CH2   . TRP C 3 619 ? 50.473 19.970  -8.912  1.00 25.28 ? 625  TRP A CH2   1 
ATOM   4997 N  N     . ILE C 3 620 ? 54.580 16.629  -6.250  1.00 25.08 ? 626  ILE A N     1 
ATOM   4998 C  CA    . ILE C 3 620 ? 55.618 17.354  -6.967  1.00 26.54 ? 626  ILE A CA    1 
ATOM   4999 C  C     . ILE C 3 620 ? 56.889 16.502  -7.068  1.00 26.06 ? 626  ILE A C     1 
ATOM   5000 O  O     . ILE C 3 620 ? 57.626 16.588  -8.046  1.00 26.26 ? 626  ILE A O     1 
ATOM   5001 C  CB    . ILE C 3 620 ? 55.957 18.713  -6.295  1.00 28.36 ? 626  ILE A CB    1 
ATOM   5002 C  CG1   . ILE C 3 620 ? 56.465 18.493  -4.868  1.00 29.76 ? 626  ILE A CG1   1 
ATOM   5003 C  CG2   . ILE C 3 620 ? 54.728 19.605  -6.300  1.00 28.89 ? 626  ILE A CG2   1 
ATOM   5004 C  CD1   . ILE C 3 620 ? 57.092 19.732  -4.229  1.00 31.85 ? 626  ILE A CD1   1 
ATOM   5005 N  N     . ILE C 3 621 ? 57.135 15.672  -6.060  1.00 25.60 ? 627  ILE A N     1 
ATOM   5006 C  CA    . ILE C 3 621 ? 58.308 14.812  -6.077  1.00 23.55 ? 627  ILE A CA    1 
ATOM   5007 C  C     . ILE C 3 621 ? 58.176 13.755  -7.179  1.00 23.93 ? 627  ILE A C     1 
ATOM   5008 O  O     . ILE C 3 621 ? 59.095 13.548  -7.970  1.00 23.61 ? 627  ILE A O     1 
ATOM   5009 C  CB    . ILE C 3 621 ? 58.504 14.093  -4.725  1.00 23.13 ? 627  ILE A CB    1 
ATOM   5010 C  CG1   . ILE C 3 621 ? 58.951 15.097  -3.657  1.00 24.77 ? 627  ILE A CG1   1 
ATOM   5011 C  CG2   . ILE C 3 621 ? 59.547 12.971  -4.880  1.00 22.89 ? 627  ILE A CG2   1 
ATOM   5012 C  CD1   . ILE C 3 621 ? 58.894 14.543  -2.242  1.00 24.05 ? 627  ILE A CD1   1 
ATOM   5013 N  N     . LYS C 3 622 ? 57.029 13.084  -7.215  1.00 23.56 ? 628  LYS A N     1 
ATOM   5014 C  CA    . LYS C 3 622 ? 56.785 12.056  -8.216  1.00 24.94 ? 628  LYS A CA    1 
ATOM   5015 C  C     . LYS C 3 622 ? 56.737 12.655  -9.619  1.00 25.04 ? 628  LYS A C     1 
ATOM   5016 O  O     . LYS C 3 622 ? 57.223 12.053  -10.570 1.00 27.00 ? 628  LYS A O     1 
ATOM   5017 C  CB    . LYS C 3 622 ? 55.472 11.317  -7.922  1.00 25.46 ? 628  LYS A CB    1 
ATOM   5018 C  CG    . LYS C 3 622 ? 55.200 10.150  -8.889  1.00 28.74 ? 628  LYS A CG    1 
ATOM   5019 C  CD    . LYS C 3 622 ? 56.273 9.058   -8.791  1.00 29.73 ? 628  LYS A CD    1 
ATOM   5020 C  CE    . LYS C 3 622 ? 56.000 7.929   -9.787  1.00 35.88 ? 628  LYS A CE    1 
ATOM   5021 N  NZ    . LYS C 3 622 ? 57.023 6.831   -9.734  1.00 37.53 ? 628  LYS A NZ    1 
ATOM   5022 N  N     . THR C 3 623 ? 56.149 13.839  -9.751  1.00 25.97 ? 629  THR A N     1 
ATOM   5023 C  CA    . THR C 3 623 ? 56.080 14.487  -11.060 1.00 25.74 ? 629  THR A CA    1 
ATOM   5024 C  C     . THR C 3 623 ? 57.492 14.644  -11.629 1.00 26.68 ? 629  THR A C     1 
ATOM   5025 O  O     . THR C 3 623 ? 57.758 14.269  -12.773 1.00 26.95 ? 629  THR A O     1 
ATOM   5026 C  CB    . THR C 3 623 ? 55.423 15.880  -10.964 1.00 25.54 ? 629  THR A CB    1 
ATOM   5027 O  OG1   . THR C 3 623 ? 54.033 15.733  -10.645 1.00 25.71 ? 629  THR A OG1   1 
ATOM   5028 C  CG2   . THR C 3 623 ? 55.566 16.637  -12.283 1.00 25.65 ? 629  THR A CG2   1 
ATOM   5029 N  N     . GLU C 3 624 ? 58.404 15.193  -10.826 1.00 27.71 ? 630  GLU A N     1 
ATOM   5030 C  CA    . GLU C 3 624 ? 59.776 15.389  -11.289 1.00 28.52 ? 630  GLU A CA    1 
ATOM   5031 C  C     . GLU C 3 624 ? 60.485 14.069  -11.573 1.00 28.71 ? 630  GLU A C     1 
ATOM   5032 O  O     . GLU C 3 624 ? 61.238 13.967  -12.541 1.00 29.23 ? 630  GLU A O     1 
ATOM   5033 C  CB    . GLU C 3 624 ? 60.586 16.195  -10.272 1.00 28.58 ? 630  GLU A CB    1 
ATOM   5034 C  CG    . GLU C 3 624 ? 61.851 16.794  -10.862 1.00 28.95 ? 630  GLU A CG    1 
ATOM   5035 C  CD    . GLU C 3 624 ? 63.122 16.242  -10.243 1.00 30.48 ? 630  GLU A CD    1 
ATOM   5036 O  OE1   . GLU C 3 624 ? 63.043 15.284  -9.440  1.00 29.36 ? 630  GLU A OE1   1 
ATOM   5037 O  OE2   . GLU C 3 624 ? 64.209 16.773  -10.563 1.00 30.98 ? 630  GLU A OE2   1 
ATOM   5038 N  N     . GLU C 3 625 ? 60.253 13.058  -10.737 1.00 29.36 ? 631  GLU A N     1 
ATOM   5039 C  CA    . GLU C 3 625 ? 60.895 11.760  -10.954 1.00 31.72 ? 631  GLU A CA    1 
ATOM   5040 C  C     . GLU C 3 625 ? 60.412 11.112  -12.256 1.00 30.36 ? 631  GLU A C     1 
ATOM   5041 O  O     . GLU C 3 625 ? 61.199 10.500  -12.975 1.00 29.28 ? 631  GLU A O     1 
ATOM   5042 C  CB    . GLU C 3 625 ? 60.640 10.808  -9.776  1.00 35.21 ? 631  GLU A CB    1 
ATOM   5043 C  CG    . GLU C 3 625 ? 61.348 9.462   -9.932  1.00 41.46 ? 631  GLU A CG    1 
ATOM   5044 C  CD    . GLU C 3 625 ? 61.312 8.607   -8.669  1.00 45.76 ? 631  GLU A CD    1 
ATOM   5045 O  OE1   . GLU C 3 625 ? 60.207 8.163   -8.269  1.00 45.27 ? 631  GLU A OE1   1 
ATOM   5046 O  OE2   . GLU C 3 625 ? 62.397 8.381   -8.078  1.00 49.60 ? 631  GLU A OE2   1 
ATOM   5047 N  N     . MET C 3 626 ? 59.124 11.251  -12.557 1.00 28.34 ? 632  MET A N     1 
ATOM   5048 C  CA    . MET C 3 626 ? 58.567 10.694  -13.791 1.00 28.97 ? 632  MET A CA    1 
ATOM   5049 C  C     . MET C 3 626 ? 59.115 11.437  -15.020 1.00 29.57 ? 632  MET A C     1 
ATOM   5050 O  O     . MET C 3 626 ? 59.399 10.818  -16.056 1.00 26.76 ? 632  MET A O     1 
ATOM   5051 C  CB    . MET C 3 626 ? 57.035 10.774  -13.775 1.00 29.44 ? 632  MET A CB    1 
ATOM   5052 C  CG    . MET C 3 626 ? 56.371 9.775   -12.839 1.00 30.67 ? 632  MET A CG    1 
ATOM   5053 S  SD    . MET C 3 626 ? 54.565 9.940   -12.773 1.00 33.49 ? 632  MET A SD    1 
ATOM   5054 C  CE    . MET C 3 626 ? 54.116 9.225   -14.393 1.00 36.23 ? 632  MET A CE    1 
ATOM   5055 N  N     . LEU C 3 627 ? 59.264 12.759  -14.906 1.00 28.50 ? 633  LEU A N     1 
ATOM   5056 C  CA    . LEU C 3 627 ? 59.796 13.545  -16.020 1.00 29.38 ? 633  LEU A CA    1 
ATOM   5057 C  C     . LEU C 3 627 ? 61.213 13.070  -16.320 1.00 30.03 ? 633  LEU A C     1 
ATOM   5058 O  O     . LEU C 3 627 ? 61.582 12.862  -17.481 1.00 28.66 ? 633  LEU A O     1 
ATOM   5059 C  CB    . LEU C 3 627 ? 59.815 15.042  -15.688 1.00 27.24 ? 633  LEU A CB    1 
ATOM   5060 C  CG    . LEU C 3 627 ? 58.461 15.758  -15.579 1.00 27.91 ? 633  LEU A CG    1 
ATOM   5061 C  CD1   . LEU C 3 627 ? 58.699 17.223  -15.226 1.00 26.71 ? 633  LEU A CD1   1 
ATOM   5062 C  CD2   . LEU C 3 627 ? 57.689 15.637  -16.888 1.00 25.85 ? 633  LEU A CD2   1 
ATOM   5063 N  N     . VAL C 3 628 ? 62.006 12.900  -15.265 1.00 31.45 ? 634  VAL A N     1 
ATOM   5064 C  CA    . VAL C 3 628 ? 63.374 12.434  -15.427 1.00 32.98 ? 634  VAL A CA    1 
ATOM   5065 C  C     . VAL C 3 628 ? 63.370 11.028  -16.026 1.00 33.62 ? 634  VAL A C     1 
ATOM   5066 O  O     . VAL C 3 628 ? 64.200 10.715  -16.872 1.00 35.12 ? 634  VAL A O     1 
ATOM   5067 C  CB    . VAL C 3 628 ? 64.130 12.427  -14.085 1.00 31.96 ? 634  VAL A CB    1 
ATOM   5068 C  CG1   . VAL C 3 628 ? 65.471 11.688  -14.232 1.00 32.91 ? 634  VAL A CG1   1 
ATOM   5069 C  CG2   . VAL C 3 628 ? 64.383 13.851  -13.641 1.00 29.54 ? 634  VAL A CG2   1 
ATOM   5070 N  N     . GLU C 3 629 ? 62.437 10.185  -15.588 1.00 35.57 ? 635  GLU A N     1 
ATOM   5071 C  CA    . GLU C 3 629 ? 62.341 8.824   -16.116 1.00 38.14 ? 635  GLU A CA    1 
ATOM   5072 C  C     . GLU C 3 629 ? 62.076 8.862   -17.613 1.00 36.87 ? 635  GLU A C     1 
ATOM   5073 O  O     . GLU C 3 629 ? 62.585 8.033   -18.355 1.00 37.23 ? 635  GLU A O     1 
ATOM   5074 C  CB    . GLU C 3 629 ? 61.216 8.040   -15.428 1.00 40.96 ? 635  GLU A CB    1 
ATOM   5075 C  CG    . GLU C 3 629 ? 61.569 7.534   -14.040 1.00 47.04 ? 635  GLU A CG    1 
ATOM   5076 C  CD    . GLU C 3 629 ? 60.420 6.789   -13.368 1.00 51.31 ? 635  GLU A CD    1 
ATOM   5077 O  OE1   . GLU C 3 629 ? 60.617 6.301   -12.232 1.00 52.90 ? 635  GLU A OE1   1 
ATOM   5078 O  OE2   . GLU C 3 629 ? 59.325 6.694   -13.972 1.00 53.15 ? 635  GLU A OE2   1 
ATOM   5079 N  N     . LYS C 3 630 ? 61.269 9.827   -18.044 1.00 36.43 ? 636  LYS A N     1 
ATOM   5080 C  CA    . LYS C 3 630 ? 60.922 9.982   -19.455 1.00 35.59 ? 636  LYS A CA    1 
ATOM   5081 C  C     . LYS C 3 630 ? 62.097 10.476  -20.286 1.00 34.87 ? 636  LYS A C     1 
ATOM   5082 O  O     . LYS C 3 630 ? 61.987 10.592  -21.503 1.00 36.00 ? 636  LYS A O     1 
ATOM   5083 C  CB    . LYS C 3 630 ? 59.759 10.964  -19.617 1.00 36.07 ? 636  LYS A CB    1 
ATOM   5084 C  CG    . LYS C 3 630 ? 58.383 10.417  -19.262 1.00 36.81 ? 636  LYS A CG    1 
ATOM   5085 C  CD    . LYS C 3 630 ? 57.344 11.524  -19.365 1.00 37.83 ? 636  LYS A CD    1 
ATOM   5086 C  CE    . LYS C 3 630 ? 55.938 10.986  -19.573 1.00 40.46 ? 636  LYS A CE    1 
ATOM   5087 N  NZ    . LYS C 3 630 ? 55.464 10.154  -18.438 1.00 43.52 ? 636  LYS A NZ    1 
ATOM   5088 N  N     . GLY C 3 631 ? 63.207 10.786  -19.628 1.00 33.67 ? 637  GLY A N     1 
ATOM   5089 C  CA    . GLY C 3 631 ? 64.378 11.265  -20.341 1.00 33.91 ? 637  GLY A CA    1 
ATOM   5090 C  C     . GLY C 3 631 ? 64.617 12.767  -20.324 1.00 33.51 ? 637  GLY A C     1 
ATOM   5091 O  O     . GLY C 3 631 ? 65.609 13.240  -20.878 1.00 33.43 ? 637  GLY A O     1 
ATOM   5092 N  N     . LEU C 3 632 ? 63.718 13.517  -19.692 1.00 32.54 ? 638  LEU A N     1 
ATOM   5093 C  CA    . LEU C 3 632 ? 63.836 14.973  -19.609 1.00 31.86 ? 638  LEU A CA    1 
ATOM   5094 C  C     . LEU C 3 632 ? 64.832 15.399  -18.529 1.00 31.59 ? 638  LEU A C     1 
ATOM   5095 O  O     . LEU C 3 632 ? 64.855 14.835  -17.430 1.00 32.82 ? 638  LEU A O     1 
ATOM   5096 C  CB    . LEU C 3 632 ? 62.458 15.589  -19.334 1.00 30.70 ? 638  LEU A CB    1 
ATOM   5097 C  CG    . LEU C 3 632 ? 61.491 15.633  -20.523 1.00 31.64 ? 638  LEU A CG    1 
ATOM   5098 C  CD1   . LEU C 3 632 ? 61.480 14.295  -21.231 1.00 36.54 ? 638  LEU A CD1   1 
ATOM   5099 C  CD2   . LEU C 3 632 ? 60.097 15.986  -20.045 1.00 32.48 ? 638  LEU A CD2   1 
ATOM   5100 N  N     . LYS C 3 633 ? 65.651 16.396  -18.847 1.00 29.73 ? 639  LYS A N     1 
ATOM   5101 C  CA    . LYS C 3 633 ? 66.663 16.888  -17.917 1.00 28.59 ? 639  LYS A CA    1 
ATOM   5102 C  C     . LYS C 3 633 ? 66.219 18.127  -17.145 1.00 26.42 ? 639  LYS A C     1 
ATOM   5103 O  O     . LYS C 3 633 ? 65.732 19.088  -17.735 1.00 25.26 ? 639  LYS A O     1 
ATOM   5104 C  CB    . LYS C 3 633 ? 67.959 17.198  -18.662 1.00 32.00 ? 639  LYS A CB    1 
ATOM   5105 C  CG    . LYS C 3 633 ? 69.064 17.683  -17.736 1.00 36.95 ? 639  LYS A CG    1 
ATOM   5106 C  CD    . LYS C 3 633 ? 70.312 18.109  -18.495 1.00 39.98 ? 639  LYS A CD    1 
ATOM   5107 C  CE    . LYS C 3 633 ? 71.446 18.382  -17.517 1.00 42.56 ? 639  LYS A CE    1 
ATOM   5108 N  NZ    . LYS C 3 633 ? 70.988 19.247  -16.388 1.00 43.51 ? 639  LYS A NZ    1 
ATOM   5109 N  N     . HIS C 3 634 ? 66.420 18.102  -15.826 1.00 25.36 ? 640  HIS A N     1 
ATOM   5110 C  CA    . HIS C 3 634 ? 66.023 19.208  -14.950 1.00 23.62 ? 640  HIS A CA    1 
ATOM   5111 C  C     . HIS C 3 634 ? 67.087 20.290  -14.829 1.00 24.63 ? 640  HIS A C     1 
ATOM   5112 O  O     . HIS C 3 634 ? 68.132 20.093  -14.200 1.00 22.52 ? 640  HIS A O     1 
ATOM   5113 C  CB    . HIS C 3 634 ? 65.681 18.678  -13.552 1.00 21.30 ? 640  HIS A CB    1 
ATOM   5114 C  CG    . HIS C 3 634 ? 64.934 19.657  -12.696 1.00 21.56 ? 640  HIS A CG    1 
ATOM   5115 N  ND1   . HIS C 3 634 ? 64.377 19.307  -11.487 1.00 19.36 ? 640  HIS A ND1   1 
ATOM   5116 C  CD2   . HIS C 3 634 ? 64.637 20.967  -12.880 1.00 20.52 ? 640  HIS A CD2   1 
ATOM   5117 C  CE1   . HIS C 3 634 ? 63.766 20.355  -10.963 1.00 20.59 ? 640  HIS A CE1   1 
ATOM   5118 N  NE2   . HIS C 3 634 ? 63.908 21.374  -11.788 1.00 22.70 ? 640  HIS A NE2   1 
ATOM   5119 N  N     . GLY C 3 635 ? 66.807 21.442  -15.429 1.00 24.42 ? 641  GLY A N     1 
ATOM   5120 C  CA    . GLY C 3 635 ? 67.739 22.550  -15.372 1.00 23.76 ? 641  GLY A CA    1 
ATOM   5121 C  C     . GLY C 3 635 ? 67.577 23.460  -16.576 1.00 24.24 ? 641  GLY A C     1 
ATOM   5122 O  O     . GLY C 3 635 ? 66.941 23.080  -17.557 1.00 22.83 ? 641  GLY A O     1 
ATOM   5123 N  N     . TRP C 3 636 ? 68.145 24.659  -16.502 1.00 23.01 ? 642  TRP A N     1 
ATOM   5124 C  CA    . TRP C 3 636 ? 68.055 25.598  -17.606 1.00 26.25 ? 642  TRP A CA    1 
ATOM   5125 C  C     . TRP C 3 636 ? 68.899 25.080  -18.769 1.00 27.64 ? 642  TRP A C     1 
ATOM   5126 O  O     . TRP C 3 636 ? 68.693 25.460  -19.922 1.00 29.19 ? 642  TRP A O     1 
ATOM   5127 C  CB    . TRP C 3 636 ? 68.532 26.985  -17.163 1.00 24.77 ? 642  TRP A CB    1 
ATOM   5128 C  CG    . TRP C 3 636 ? 67.703 27.559  -16.042 1.00 25.35 ? 642  TRP A CG    1 
ATOM   5129 C  CD1   . TRP C 3 636 ? 68.122 27.849  -14.769 1.00 25.61 ? 642  TRP A CD1   1 
ATOM   5130 C  CD2   . TRP C 3 636 ? 66.319 27.917  -16.100 1.00 22.45 ? 642  TRP A CD2   1 
ATOM   5131 N  NE1   . TRP C 3 636 ? 67.081 28.368  -14.033 1.00 24.38 ? 642  TRP A NE1   1 
ATOM   5132 C  CE2   . TRP C 3 636 ? 65.963 28.422  -14.826 1.00 23.41 ? 642  TRP A CE2   1 
ATOM   5133 C  CE3   . TRP C 3 636 ? 65.341 27.862  -17.106 1.00 23.70 ? 642  TRP A CE3   1 
ATOM   5134 C  CZ2   . TRP C 3 636 ? 64.673 28.872  -14.532 1.00 24.17 ? 642  TRP A CZ2   1 
ATOM   5135 C  CZ3   . TRP C 3 636 ? 64.049 28.309  -16.814 1.00 23.04 ? 642  TRP A CZ3   1 
ATOM   5136 C  CH2   . TRP C 3 636 ? 63.731 28.809  -15.533 1.00 22.66 ? 642  TRP A CH2   1 
ATOM   5137 N  N     . ASP C 3 637 ? 69.852 24.209  -18.456 1.00 28.68 ? 643  ASP A N     1 
ATOM   5138 C  CA    . ASP C 3 637 ? 70.701 23.607  -19.481 1.00 30.52 ? 643  ASP A CA    1 
ATOM   5139 C  C     . ASP C 3 637 ? 70.018 22.312  -19.926 1.00 29.46 ? 643  ASP A C     1 
ATOM   5140 O  O     . ASP C 3 637 ? 70.619 21.478  -20.602 1.00 30.08 ? 643  ASP A O     1 
ATOM   5141 C  CB    . ASP C 3 637 ? 72.095 23.303  -18.908 1.00 32.16 ? 643  ASP A CB    1 
ATOM   5142 C  CG    . ASP C 3 637 ? 72.054 22.302  -17.757 1.00 34.42 ? 643  ASP A CG    1 
ATOM   5143 O  OD1   . ASP C 3 637 ? 71.022 22.220  -17.062 1.00 35.42 ? 643  ASP A OD1   1 
ATOM   5144 O  OD2   . ASP C 3 637 ? 73.065 21.603  -17.531 1.00 39.62 ? 643  ASP A OD2   1 
ATOM   5145 N  N     . GLY C 3 638 ? 68.750 22.159  -19.545 1.00 28.61 ? 644  GLY A N     1 
ATOM   5146 C  CA    . GLY C 3 638 ? 68.009 20.963  -19.904 1.00 27.11 ? 644  GLY A CA    1 
ATOM   5147 C  C     . GLY C 3 638 ? 66.687 21.174  -20.620 1.00 26.92 ? 644  GLY A C     1 
ATOM   5148 O  O     . GLY C 3 638 ? 66.613 21.914  -21.607 1.00 26.60 ? 644  GLY A O     1 
ATOM   5149 N  N     . ASP C 3 639 ? 65.637 20.525  -20.114 1.00 26.02 ? 645  ASP A N     1 
ATOM   5150 C  CA    . ASP C 3 639 ? 64.304 20.596  -20.716 1.00 24.96 ? 645  ASP A CA    1 
ATOM   5151 C  C     . ASP C 3 639 ? 63.256 21.317  -19.863 1.00 25.93 ? 645  ASP A C     1 
ATOM   5152 O  O     . ASP C 3 639 ? 62.345 21.949  -20.396 1.00 26.40 ? 645  ASP A O     1 
ATOM   5153 C  CB    . ASP C 3 639 ? 63.809 19.178  -21.020 1.00 26.16 ? 645  ASP A CB    1 
ATOM   5154 C  CG    . ASP C 3 639 ? 64.822 18.363  -21.814 1.00 26.78 ? 645  ASP A CG    1 
ATOM   5155 O  OD1   . ASP C 3 639 ? 65.187 18.789  -22.926 1.00 28.21 ? 645  ASP A OD1   1 
ATOM   5156 O  OD2   . ASP C 3 639 ? 65.253 17.299  -21.325 1.00 29.25 ? 645  ASP A OD2   1 
ATOM   5157 N  N     . PHE C 3 640 ? 63.366 21.210  -18.539 1.00 25.12 ? 646  PHE A N     1 
ATOM   5158 C  CA    . PHE C 3 640 ? 62.402 21.876  -17.669 1.00 23.02 ? 646  PHE A CA    1 
ATOM   5159 C  C     . PHE C 3 640 ? 63.074 22.347  -16.381 1.00 23.95 ? 646  PHE A C     1 
ATOM   5160 O  O     . PHE C 3 640 ? 64.182 21.914  -16.046 1.00 22.31 ? 646  PHE A O     1 
ATOM   5161 C  CB    . PHE C 3 640 ? 61.242 20.930  -17.322 1.00 22.17 ? 646  PHE A CB    1 
ATOM   5162 C  CG    . PHE C 3 640 ? 61.636 19.808  -16.403 1.00 24.26 ? 646  PHE A CG    1 
ATOM   5163 C  CD1   . PHE C 3 640 ? 62.244 18.655  -16.903 1.00 24.00 ? 646  PHE A CD1   1 
ATOM   5164 C  CD2   . PHE C 3 640 ? 61.454 19.926  -15.024 1.00 24.77 ? 646  PHE A CD2   1 
ATOM   5165 C  CE1   . PHE C 3 640 ? 62.667 17.634  -16.041 1.00 24.73 ? 646  PHE A CE1   1 
ATOM   5166 C  CE2   . PHE C 3 640 ? 61.877 18.909  -14.150 1.00 25.87 ? 646  PHE A CE2   1 
ATOM   5167 C  CZ    . PHE C 3 640 ? 62.483 17.766  -14.660 1.00 23.64 ? 646  PHE A CZ    1 
ATOM   5168 N  N     . ALA C 3 641 ? 62.390 23.230  -15.659 1.00 22.96 ? 647  ALA A N     1 
ATOM   5169 C  CA    . ALA C 3 641 ? 62.915 23.753  -14.411 1.00 23.72 ? 647  ALA A CA    1 
ATOM   5170 C  C     . ALA C 3 641 ? 61.797 24.187  -13.481 1.00 24.10 ? 647  ALA A C     1 
ATOM   5171 O  O     . ALA C 3 641 ? 60.985 25.040  -13.832 1.00 24.63 ? 647  ALA A O     1 
ATOM   5172 C  CB    . ALA C 3 641 ? 63.852 24.935  -14.684 1.00 21.53 ? 647  ALA A CB    1 
ATOM   5173 N  N     . TYR C 3 642 ? 61.746 23.573  -12.303 1.00 24.17 ? 648  TYR A N     1 
ATOM   5174 C  CA    . TYR C 3 642 ? 60.755 23.939  -11.300 1.00 22.36 ? 648  TYR A CA    1 
ATOM   5175 C  C     . TYR C 3 642 ? 61.093 25.374  -10.930 1.00 23.84 ? 648  TYR A C     1 
ATOM   5176 O  O     . TYR C 3 642 ? 62.246 25.689  -10.658 1.00 22.53 ? 648  TYR A O     1 
ATOM   5177 C  CB    . TYR C 3 642 ? 60.884 23.042  -10.066 1.00 22.28 ? 648  TYR A CB    1 
ATOM   5178 C  CG    . TYR C 3 642 ? 60.058 21.779  -10.124 1.00 25.44 ? 648  TYR A CG    1 
ATOM   5179 C  CD1   . TYR C 3 642 ? 60.000 20.999  -11.283 1.00 26.11 ? 648  TYR A CD1   1 
ATOM   5180 C  CD2   . TYR C 3 642 ? 59.339 21.351  -9.007  1.00 26.74 ? 648  TYR A CD2   1 
ATOM   5181 C  CE1   . TYR C 3 642 ? 59.244 19.826  -11.323 1.00 27.66 ? 648  TYR A CE1   1 
ATOM   5182 C  CE2   . TYR C 3 642 ? 58.589 20.191  -9.034  1.00 27.40 ? 648  TYR A CE2   1 
ATOM   5183 C  CZ    . TYR C 3 642 ? 58.542 19.432  -10.189 1.00 28.30 ? 648  TYR A CZ    1 
ATOM   5184 O  OH    . TYR C 3 642 ? 57.780 18.288  -10.192 1.00 31.41 ? 648  TYR A OH    1 
ATOM   5185 N  N     . MET C 3 643 ? 60.091 26.244  -10.930 1.00 23.10 ? 649  MET A N     1 
ATOM   5186 C  CA    . MET C 3 643 ? 60.307 27.644  -10.611 1.00 23.11 ? 649  MET A CA    1 
ATOM   5187 C  C     . MET C 3 643 ? 59.631 28.026  -9.306  1.00 24.25 ? 649  MET A C     1 
ATOM   5188 O  O     . MET C 3 643 ? 60.138 28.871  -8.566  1.00 22.24 ? 649  MET A O     1 
ATOM   5189 C  CB    . MET C 3 643 ? 59.764 28.537  -11.737 1.00 22.36 ? 649  MET A CB    1 
ATOM   5190 C  CG    . MET C 3 643 ? 60.419 28.318  -13.105 1.00 22.47 ? 649  MET A CG    1 
ATOM   5191 S  SD    . MET C 3 643 ? 59.588 29.277  -14.395 1.00 26.04 ? 649  MET A SD    1 
ATOM   5192 C  CE    . MET C 3 643 ? 60.809 29.560  -15.459 1.00 25.85 ? 649  MET A CE    1 
ATOM   5193 N  N     . ALA C 3 644 ? 58.482 27.413  -9.036  1.00 24.46 ? 650  ALA A N     1 
ATOM   5194 C  CA    . ALA C 3 644 ? 57.735 27.721  -7.822  1.00 26.99 ? 650  ALA A CA    1 
ATOM   5195 C  C     . ALA C 3 644 ? 56.699 26.672  -7.438  1.00 27.33 ? 650  ALA A C     1 
ATOM   5196 O  O     . ALA C 3 644 ? 56.035 26.088  -8.292  1.00 29.29 ? 650  ALA A O     1 
ATOM   5197 C  CB    . ALA C 3 644 ? 57.040 29.077  -7.981  1.00 26.56 ? 650  ALA A CB    1 
ATOM   5198 N  N     . TRP C 3 645 ? 56.572 26.444  -6.137  1.00 26.89 ? 651  TRP A N     1 
ATOM   5199 C  CA    . TRP C 3 645 ? 55.586 25.522  -5.598  1.00 26.96 ? 651  TRP A CA    1 
ATOM   5200 C  C     . TRP C 3 645 ? 54.858 26.305  -4.515  1.00 27.81 ? 651  TRP A C     1 
ATOM   5201 O  O     . TRP C 3 645 ? 55.407 26.563  -3.443  1.00 27.27 ? 651  TRP A O     1 
ATOM   5202 C  CB    . TRP C 3 645 ? 56.250 24.276  -5.000  1.00 25.81 ? 651  TRP A CB    1 
ATOM   5203 C  CG    . TRP C 3 645 ? 55.292 23.451  -4.200  1.00 27.83 ? 651  TRP A CG    1 
ATOM   5204 C  CD1   . TRP C 3 645 ? 53.991 23.175  -4.511  1.00 27.67 ? 651  TRP A CD1   1 
ATOM   5205 C  CD2   . TRP C 3 645 ? 55.543 22.828  -2.937  1.00 28.13 ? 651  TRP A CD2   1 
ATOM   5206 N  NE1   . TRP C 3 645 ? 53.412 22.424  -3.515  1.00 28.12 ? 651  TRP A NE1   1 
ATOM   5207 C  CE2   . TRP C 3 645 ? 54.343 22.196  -2.537  1.00 29.84 ? 651  TRP A CE2   1 
ATOM   5208 C  CE3   . TRP C 3 645 ? 56.666 22.746  -2.100  1.00 28.41 ? 651  TRP A CE3   1 
ATOM   5209 C  CZ2   . TRP C 3 645 ? 54.230 21.489  -1.332  1.00 30.59 ? 651  TRP A CZ2   1 
ATOM   5210 C  CZ3   . TRP C 3 645 ? 56.555 22.044  -0.900  1.00 31.34 ? 651  TRP A CZ3   1 
ATOM   5211 C  CH2   . TRP C 3 645 ? 55.343 21.425  -0.530  1.00 30.80 ? 651  TRP A CH2   1 
ATOM   5212 N  N     . VAL C 3 646 ? 53.630 26.706  -4.816  1.00 28.35 ? 652  VAL A N     1 
ATOM   5213 C  CA    . VAL C 3 646 ? 52.822 27.481  -3.892  1.00 30.03 ? 652  VAL A CA    1 
ATOM   5214 C  C     . VAL C 3 646 ? 51.583 26.683  -3.523  1.00 31.88 ? 652  VAL A C     1 
ATOM   5215 O  O     . VAL C 3 646 ? 50.618 26.610  -4.280  1.00 30.76 ? 652  VAL A O     1 
ATOM   5216 C  CB    . VAL C 3 646 ? 52.436 28.850  -4.516  1.00 29.48 ? 652  VAL A CB    1 
ATOM   5217 C  CG1   . VAL C 3 646 ? 51.401 29.568  -3.644  1.00 32.35 ? 652  VAL A CG1   1 
ATOM   5218 C  CG2   . VAL C 3 646 ? 53.683 29.707  -4.651  1.00 25.87 ? 652  VAL A CG2   1 
ATOM   5219 N  N     . HIS C 3 647 ? 51.655 26.072  -2.347  1.00 34.21 ? 653  HIS A N     1 
ATOM   5220 C  CA    . HIS C 3 647 ? 50.603 25.229  -1.799  1.00 36.23 ? 653  HIS A CA    1 
ATOM   5221 C  C     . HIS C 3 647 ? 50.124 24.100  -2.695  1.00 33.75 ? 653  HIS A C     1 
ATOM   5222 O  O     . HIS C 3 647 ? 50.698 23.016  -2.659  1.00 34.91 ? 653  HIS A O     1 
ATOM   5223 C  CB    . HIS C 3 647 ? 49.427 26.075  -1.323  1.00 40.93 ? 653  HIS A CB    1 
ATOM   5224 C  CG    . HIS C 3 647 ? 49.376 26.212  0.167   1.00 47.18 ? 653  HIS A CG    1 
ATOM   5225 N  ND1   . HIS C 3 647 ? 48.225 26.002  0.898   1.00 49.41 ? 653  HIS A ND1   1 
ATOM   5226 C  CD2   . HIS C 3 647 ? 50.348 26.503  1.067   1.00 48.10 ? 653  HIS A CD2   1 
ATOM   5227 C  CE1   . HIS C 3 647 ? 48.491 26.157  2.184   1.00 50.10 ? 653  HIS A CE1   1 
ATOM   5228 N  NE2   . HIS C 3 647 ? 49.771 26.462  2.313   1.00 49.59 ? 653  HIS A NE2   1 
ATOM   5229 N  N     . ASP C 3 648 ? 49.089 24.333  -3.497  1.00 32.04 ? 654  ASP A N     1 
ATOM   5230 C  CA    . ASP C 3 648 ? 48.578 23.283  -4.373  1.00 31.64 ? 654  ASP A CA    1 
ATOM   5231 C  C     . ASP C 3 648 ? 48.919 23.451  -5.861  1.00 29.78 ? 654  ASP A C     1 
ATOM   5232 O  O     . ASP C 3 648 ? 48.363 22.753  -6.707  1.00 28.35 ? 654  ASP A O     1 
ATOM   5233 C  CB    . ASP C 3 648 ? 47.056 23.153  -4.212  1.00 35.19 ? 654  ASP A CB    1 
ATOM   5234 C  CG    . ASP C 3 648 ? 46.651 22.711  -2.819  1.00 38.11 ? 654  ASP A CG    1 
ATOM   5235 O  OD1   . ASP C 3 648 ? 47.549 22.494  -1.973  1.00 40.54 ? 654  ASP A OD1   1 
ATOM   5236 O  OD2   . ASP C 3 648 ? 45.433 22.580  -2.566  1.00 39.67 ? 654  ASP A OD2   1 
ATOM   5237 N  N     . GLU C 3 649 ? 49.828 24.364  -6.183  1.00 28.57 ? 655  GLU A N     1 
ATOM   5238 C  CA    . GLU C 3 649 ? 50.204 24.569  -7.578  1.00 27.68 ? 655  GLU A CA    1 
ATOM   5239 C  C     . GLU C 3 649 ? 51.713 24.647  -7.744  1.00 25.32 ? 655  GLU A C     1 
ATOM   5240 O  O     . GLU C 3 649 ? 52.433 25.022  -6.831  1.00 25.38 ? 655  GLU A O     1 
ATOM   5241 C  CB    . GLU C 3 649 ? 49.607 25.873  -8.124  1.00 29.92 ? 655  GLU A CB    1 
ATOM   5242 C  CG    . GLU C 3 649 ? 50.300 27.131  -7.594  1.00 34.01 ? 655  GLU A CG    1 
ATOM   5243 C  CD    . GLU C 3 649 ? 49.742 28.436  -8.164  1.00 35.94 ? 655  GLU A CD    1 
ATOM   5244 O  OE1   . GLU C 3 649 ? 49.839 28.663  -9.386  1.00 37.79 ? 655  GLU A OE1   1 
ATOM   5245 O  OE2   . GLU C 3 649 ? 49.211 29.244  -7.377  1.00 36.20 ? 655  GLU A OE2   1 
ATOM   5246 N  N     . ILE C 3 650 ? 52.182 24.281  -8.925  1.00 25.64 ? 656  ILE A N     1 
ATOM   5247 C  CA    . ILE C 3 650 ? 53.586 24.383  -9.237  1.00 26.12 ? 656  ILE A CA    1 
ATOM   5248 C  C     . ILE C 3 650 ? 53.640 25.113  -10.558 1.00 24.24 ? 656  ILE A C     1 
ATOM   5249 O  O     . ILE C 3 650 ? 52.726 24.983  -11.373 1.00 23.06 ? 656  ILE A O     1 
ATOM   5250 C  CB    . ILE C 3 650 ? 54.273 23.003  -9.385  1.00 27.96 ? 656  ILE A CB    1 
ATOM   5251 C  CG1   . ILE C 3 650 ? 53.508 22.121  -10.370 1.00 28.94 ? 656  ILE A CG1   1 
ATOM   5252 C  CG2   . ILE C 3 650 ? 54.384 22.350  -8.029  1.00 28.83 ? 656  ILE A CG2   1 
ATOM   5253 C  CD1   . ILE C 3 650 ? 54.258 20.851  -10.755 1.00 31.04 ? 656  ILE A CD1   1 
ATOM   5254 N  N     . GLN C 3 651 ? 54.686 25.910  -10.745 1.00 23.17 ? 657  GLN A N     1 
ATOM   5255 C  CA    . GLN C 3 651 ? 54.893 26.640  -11.989 1.00 24.23 ? 657  GLN A CA    1 
ATOM   5256 C  C     . GLN C 3 651 ? 56.229 26.116  -12.508 1.00 23.36 ? 657  GLN A C     1 
ATOM   5257 O  O     . GLN C 3 651 ? 57.254 26.261  -11.848 1.00 23.29 ? 657  GLN A O     1 
ATOM   5258 C  CB    . GLN C 3 651 ? 54.974 28.146  -11.734 1.00 22.70 ? 657  GLN A CB    1 
ATOM   5259 C  CG    . GLN C 3 651 ? 53.696 28.778  -11.201 1.00 24.07 ? 657  GLN A CG    1 
ATOM   5260 C  CD    . GLN C 3 651 ? 52.498 28.573  -12.118 1.00 27.31 ? 657  GLN A CD    1 
ATOM   5261 O  OE1   . GLN C 3 651 ? 52.618 28.631  -13.339 1.00 25.72 ? 657  GLN A OE1   1 
ATOM   5262 N  NE2   . GLN C 3 651 ? 51.327 28.346  -11.523 1.00 26.94 ? 657  GLN A NE2   1 
ATOM   5263 N  N     . VAL C 3 652 ? 56.212 25.497  -13.680 1.00 24.18 ? 658  VAL A N     1 
ATOM   5264 C  CA    . VAL C 3 652 ? 57.417 24.908  -14.253 1.00 24.23 ? 658  VAL A CA    1 
ATOM   5265 C  C     . VAL C 3 652 ? 57.820 25.554  -15.576 1.00 24.80 ? 658  VAL A C     1 
ATOM   5266 O  O     . VAL C 3 652 ? 56.982 25.723  -16.461 1.00 25.01 ? 658  VAL A O     1 
ATOM   5267 C  CB    . VAL C 3 652 ? 57.202 23.393  -14.501 1.00 24.84 ? 658  VAL A CB    1 
ATOM   5268 C  CG1   . VAL C 3 652 ? 58.473 22.756  -15.021 1.00 26.15 ? 658  VAL A CG1   1 
ATOM   5269 C  CG2   . VAL C 3 652 ? 56.743 22.706  -13.209 1.00 25.18 ? 658  VAL A CG2   1 
ATOM   5270 N  N     . GLY C 3 653 ? 59.102 25.901  -15.703 1.00 25.16 ? 659  GLY A N     1 
ATOM   5271 C  CA    . GLY C 3 653 ? 59.602 26.493  -16.933 1.00 24.02 ? 659  GLY A CA    1 
ATOM   5272 C  C     . GLY C 3 653 ? 59.990 25.370  -17.887 1.00 25.76 ? 659  GLY A C     1 
ATOM   5273 O  O     . GLY C 3 653 ? 60.654 24.405  -17.482 1.00 24.85 ? 659  GLY A O     1 
ATOM   5274 N  N     . CYS C 3 654 ? 59.582 25.485  -19.149 1.00 25.50 ? 660  CYS A N     1 
ATOM   5275 C  CA    . CYS C 3 654 ? 59.865 24.446  -20.136 1.00 25.59 ? 660  CYS A CA    1 
ATOM   5276 C  C     . CYS C 3 654 ? 60.503 25.019  -21.406 1.00 25.82 ? 660  CYS A C     1 
ATOM   5277 O  O     . CYS C 3 654 ? 60.063 26.045  -21.921 1.00 26.03 ? 660  CYS A O     1 
ATOM   5278 C  CB    . CYS C 3 654 ? 58.565 23.711  -20.497 1.00 26.31 ? 660  CYS A CB    1 
ATOM   5279 S  SG    . CYS C 3 654 ? 57.545 23.172  -19.077 1.00 25.83 ? 660  CYS A SG    1 
ATOM   5280 N  N     . ARG C 3 655 ? 61.522 24.336  -21.919 1.00 25.20 ? 661  ARG A N     1 
ATOM   5281 C  CA    . ARG C 3 655 ? 62.242 24.778  -23.116 1.00 24.27 ? 661  ARG A CA    1 
ATOM   5282 C  C     . ARG C 3 655 ? 61.373 24.890  -24.372 1.00 25.64 ? 661  ARG A C     1 
ATOM   5283 O  O     . ARG C 3 655 ? 61.654 25.714  -25.245 1.00 27.01 ? 661  ARG A O     1 
ATOM   5284 C  CB    . ARG C 3 655 ? 63.425 23.834  -23.386 1.00 21.32 ? 661  ARG A CB    1 
ATOM   5285 C  CG    . ARG C 3 655 ? 64.382 24.317  -24.490 1.00 21.08 ? 661  ARG A CG    1 
ATOM   5286 C  CD    . ARG C 3 655 ? 65.696 23.540  -24.478 1.00 20.49 ? 661  ARG A CD    1 
ATOM   5287 N  NE    . ARG C 3 655 ? 65.481 22.093  -24.506 1.00 22.44 ? 661  ARG A NE    1 
ATOM   5288 C  CZ    . ARG C 3 655 ? 65.034 21.418  -25.560 1.00 23.71 ? 661  ARG A CZ    1 
ATOM   5289 N  NH1   . ARG C 3 655 ? 64.755 22.062  -26.693 1.00 22.56 ? 661  ARG A NH1   1 
ATOM   5290 N  NH2   . ARG C 3 655 ? 64.855 20.099  -25.480 1.00 23.27 ? 661  ARG A NH2   1 
ATOM   5291 N  N     . THR C 3 656 ? 60.327 24.064  -24.466 1.00 25.82 ? 662  THR A N     1 
ATOM   5292 C  CA    . THR C 3 656 ? 59.418 24.079  -25.621 1.00 26.83 ? 662  THR A CA    1 
ATOM   5293 C  C     . THR C 3 656 ? 57.980 23.769  -25.210 1.00 26.96 ? 662  THR A C     1 
ATOM   5294 O  O     . THR C 3 656 ? 57.728 23.195  -24.144 1.00 26.64 ? 662  THR A O     1 
ATOM   5295 C  CB    . THR C 3 656 ? 59.786 23.012  -26.695 1.00 25.10 ? 662  THR A CB    1 
ATOM   5296 O  OG1   . THR C 3 656 ? 59.347 21.729  -26.241 1.00 25.58 ? 662  THR A OG1   1 
ATOM   5297 C  CG2   . THR C 3 656 ? 61.294 22.962  -26.946 1.00 24.83 ? 662  THR A CG2   1 
ATOM   5298 N  N     . GLU C 3 657 ? 57.045 24.125  -26.084 1.00 27.95 ? 663  GLU A N     1 
ATOM   5299 C  CA    . GLU C 3 657 ? 55.626 23.886  -25.851 1.00 29.22 ? 663  GLU A CA    1 
ATOM   5300 C  C     . GLU C 3 657 ? 55.368 22.394  -25.678 1.00 29.08 ? 663  GLU A C     1 
ATOM   5301 O  O     . GLU C 3 657 ? 54.589 21.973  -24.820 1.00 27.55 ? 663  GLU A O     1 
ATOM   5302 C  CB    . GLU C 3 657 ? 54.808 24.408  -27.035 1.00 33.08 ? 663  GLU A CB    1 
ATOM   5303 C  CG    . GLU C 3 657 ? 53.818 25.500  -26.673 1.00 39.51 ? 663  GLU A CG    1 
ATOM   5304 C  CD    . GLU C 3 657 ? 53.061 26.029  -27.879 1.00 42.53 ? 663  GLU A CD    1 
ATOM   5305 O  OE1   . GLU C 3 657 ? 52.486 25.205  -28.629 1.00 41.94 ? 663  GLU A OE1   1 
ATOM   5306 O  OE2   . GLU C 3 657 ? 53.037 27.268  -28.066 1.00 43.60 ? 663  GLU A OE2   1 
ATOM   5307 N  N     . GLU C 3 658 ? 56.033 21.600  -26.506 1.00 28.90 ? 664  GLU A N     1 
ATOM   5308 C  CA    . GLU C 3 658 ? 55.882 20.153  -26.471 1.00 30.68 ? 664  GLU A CA    1 
ATOM   5309 C  C     . GLU C 3 658 ? 56.218 19.623  -25.081 1.00 30.14 ? 664  GLU A C     1 
ATOM   5310 O  O     . GLU C 3 658 ? 55.508 18.778  -24.528 1.00 31.13 ? 664  GLU A O     1 
ATOM   5311 C  CB    . GLU C 3 658 ? 56.800 19.518  -27.519 1.00 31.79 ? 664  GLU A CB    1 
ATOM   5312 C  CG    . GLU C 3 658 ? 56.588 18.025  -27.714 1.00 38.03 ? 664  GLU A CG    1 
ATOM   5313 C  CD    . GLU C 3 658 ? 57.605 17.421  -28.666 1.00 41.53 ? 664  GLU A CD    1 
ATOM   5314 O  OE1   . GLU C 3 658 ? 57.774 17.960  -29.784 1.00 42.23 ? 664  GLU A OE1   1 
ATOM   5315 O  OE2   . GLU C 3 658 ? 58.233 16.406  -28.293 1.00 44.76 ? 664  GLU A OE2   1 
ATOM   5316 N  N     . ILE C 3 659 ? 57.304 20.130  -24.515 1.00 28.88 ? 665  ILE A N     1 
ATOM   5317 C  CA    . ILE C 3 659 ? 57.725 19.718  -23.187 1.00 26.51 ? 665  ILE A CA    1 
ATOM   5318 C  C     . ILE C 3 659 ? 56.697 20.126  -22.133 1.00 26.10 ? 665  ILE A C     1 
ATOM   5319 O  O     . ILE C 3 659 ? 56.410 19.365  -21.201 1.00 24.53 ? 665  ILE A O     1 
ATOM   5320 C  CB    . ILE C 3 659 ? 59.089 20.340  -22.838 1.00 26.87 ? 665  ILE A CB    1 
ATOM   5321 C  CG1   . ILE C 3 659 ? 60.184 19.640  -23.643 1.00 25.46 ? 665  ILE A CG1   1 
ATOM   5322 C  CG2   . ILE C 3 659 ? 59.330 20.261  -21.338 1.00 22.90 ? 665  ILE A CG2   1 
ATOM   5323 C  CD1   . ILE C 3 659 ? 61.551 20.311  -23.553 1.00 26.79 ? 665  ILE A CD1   1 
ATOM   5324 N  N     . ALA C 3 660 ? 56.142 21.327  -22.286 1.00 24.90 ? 666  ALA A N     1 
ATOM   5325 C  CA    . ALA C 3 660 ? 55.153 21.827  -21.335 1.00 25.30 ? 666  ALA A CA    1 
ATOM   5326 C  C     . ALA C 3 660 ? 53.927 20.924  -21.346 1.00 26.05 ? 666  ALA A C     1 
ATOM   5327 O  O     . ALA C 3 660 ? 53.339 20.636  -20.296 1.00 25.97 ? 666  ALA A O     1 
ATOM   5328 C  CB    . ALA C 3 660 ? 54.761 23.279  -21.681 1.00 24.14 ? 666  ALA A CB    1 
ATOM   5329 N  N     . GLN C 3 661 ? 53.539 20.468  -22.534 1.00 27.25 ? 667  GLN A N     1 
ATOM   5330 C  CA    . GLN C 3 661 ? 52.393 19.574  -22.634 1.00 27.16 ? 667  GLN A CA    1 
ATOM   5331 C  C     . GLN C 3 661 ? 52.721 18.261  -21.928 1.00 26.60 ? 667  GLN A C     1 
ATOM   5332 O  O     . GLN C 3 661 ? 51.873 17.689  -21.249 1.00 26.48 ? 667  GLN A O     1 
ATOM   5333 C  CB    . GLN C 3 661 ? 52.022 19.358  -24.106 1.00 31.49 ? 667  GLN A CB    1 
ATOM   5334 C  CG    . GLN C 3 661 ? 51.499 20.657  -24.726 1.00 37.40 ? 667  GLN A CG    1 
ATOM   5335 C  CD    . GLN C 3 661 ? 51.248 20.579  -26.210 1.00 41.74 ? 667  GLN A CD    1 
ATOM   5336 O  OE1   . GLN C 3 661 ? 52.051 20.028  -26.962 1.00 43.41 ? 667  GLN A OE1   1 
ATOM   5337 N  NE2   . GLN C 3 661 ? 50.134 21.159  -26.648 1.00 45.37 ? 667  GLN A NE2   1 
ATOM   5338 N  N     . VAL C 3 662 ? 53.965 17.803  -22.056 1.00 25.94 ? 668  VAL A N     1 
ATOM   5339 C  CA    . VAL C 3 662 ? 54.377 16.569  -21.394 1.00 25.89 ? 668  VAL A CA    1 
ATOM   5340 C  C     . VAL C 3 662 ? 54.362 16.731  -19.867 1.00 24.52 ? 668  VAL A C     1 
ATOM   5341 O  O     . VAL C 3 662 ? 53.914 15.844  -19.141 1.00 23.57 ? 668  VAL A O     1 
ATOM   5342 C  CB    . VAL C 3 662 ? 55.782 16.135  -21.856 1.00 27.25 ? 668  VAL A CB    1 
ATOM   5343 C  CG1   . VAL C 3 662 ? 56.249 14.936  -21.050 1.00 27.00 ? 668  VAL A CG1   1 
ATOM   5344 C  CG2   . VAL C 3 662 ? 55.743 15.777  -23.349 1.00 29.79 ? 668  VAL A CG2   1 
ATOM   5345 N  N     . VAL C 3 663 ? 54.840 17.873  -19.387 1.00 24.56 ? 669  VAL A N     1 
ATOM   5346 C  CA    . VAL C 3 663 ? 54.860 18.159  -17.952 1.00 23.99 ? 669  VAL A CA    1 
ATOM   5347 C  C     . VAL C 3 663 ? 53.442 18.160  -17.378 1.00 24.89 ? 669  VAL A C     1 
ATOM   5348 O  O     . VAL C 3 663 ? 53.182 17.606  -16.303 1.00 24.18 ? 669  VAL A O     1 
ATOM   5349 C  CB    . VAL C 3 663 ? 55.512 19.531  -17.683 1.00 23.70 ? 669  VAL A CB    1 
ATOM   5350 C  CG1   . VAL C 3 663 ? 55.164 20.015  -16.274 1.00 24.76 ? 669  VAL A CG1   1 
ATOM   5351 C  CG2   . VAL C 3 663 ? 57.029 19.421  -17.859 1.00 24.70 ? 669  VAL A CG2   1 
ATOM   5352 N  N     . ILE C 3 664 ? 52.526 18.788  -18.106 1.00 26.72 ? 670  ILE A N     1 
ATOM   5353 C  CA    . ILE C 3 664 ? 51.134 18.865  -17.689 1.00 26.84 ? 670  ILE A CA    1 
ATOM   5354 C  C     . ILE C 3 664 ? 50.510 17.472  -17.580 1.00 27.44 ? 670  ILE A C     1 
ATOM   5355 O  O     . ILE C 3 664 ? 49.896 17.143  -16.565 1.00 27.75 ? 670  ILE A O     1 
ATOM   5356 C  CB    . ILE C 3 664 ? 50.322 19.748  -18.675 1.00 28.56 ? 670  ILE A CB    1 
ATOM   5357 C  CG1   . ILE C 3 664 ? 50.666 21.224  -18.434 1.00 28.33 ? 670  ILE A CG1   1 
ATOM   5358 C  CG2   . ILE C 3 664 ? 48.814 19.464  -18.544 1.00 28.58 ? 670  ILE A CG2   1 
ATOM   5359 C  CD1   . ILE C 3 664 ? 49.960 22.180  -19.370 1.00 28.85 ? 670  ILE A CD1   1 
ATOM   5360 N  N     . GLU C 3 665 ? 50.670 16.642  -18.608 1.00 28.26 ? 671  GLU A N     1 
ATOM   5361 C  CA    . GLU C 3 665 ? 50.091 15.305  -18.534 1.00 30.32 ? 671  GLU A CA    1 
ATOM   5362 C  C     . GLU C 3 665 ? 50.836 14.422  -17.545 1.00 28.50 ? 671  GLU A C     1 
ATOM   5363 O  O     . GLU C 3 665 ? 50.242 13.543  -16.929 1.00 27.58 ? 671  GLU A O     1 
ATOM   5364 C  CB    . GLU C 3 665 ? 50.031 14.622  -19.914 1.00 32.85 ? 671  GLU A CB    1 
ATOM   5365 C  CG    . GLU C 3 665 ? 50.927 15.203  -20.985 1.00 39.16 ? 671  GLU A CG    1 
ATOM   5366 C  CD    . GLU C 3 665 ? 50.720 14.548  -22.348 1.00 40.28 ? 671  GLU A CD    1 
ATOM   5367 O  OE1   . GLU C 3 665 ? 51.259 13.444  -22.574 1.00 41.58 ? 671  GLU A OE1   1 
ATOM   5368 O  OE2   . GLU C 3 665 ? 50.001 15.134  -23.189 1.00 43.22 ? 671  GLU A OE2   1 
ATOM   5369 N  N     . THR C 3 666 ? 52.133 14.659  -17.379 1.00 28.27 ? 672  THR A N     1 
ATOM   5370 C  CA    . THR C 3 666 ? 52.910 13.856  -16.445 1.00 27.67 ? 672  THR A CA    1 
ATOM   5371 C  C     . THR C 3 666 ? 52.469 14.162  -15.015 1.00 27.94 ? 672  THR A C     1 
ATOM   5372 O  O     . THR C 3 666 ? 52.384 13.263  -14.179 1.00 27.80 ? 672  THR A O     1 
ATOM   5373 C  CB    . THR C 3 666 ? 54.419 14.124  -16.595 1.00 27.90 ? 672  THR A CB    1 
ATOM   5374 O  OG1   . THR C 3 666 ? 54.828 13.774  -17.921 1.00 26.15 ? 672  THR A OG1   1 
ATOM   5375 C  CG2   . THR C 3 666 ? 55.209 13.288  -15.598 1.00 26.57 ? 672  THR A CG2   1 
ATOM   5376 N  N     . ALA C 3 667 ? 52.172 15.432  -14.749 1.00 27.29 ? 673  ALA A N     1 
ATOM   5377 C  CA    . ALA C 3 667 ? 51.722 15.855  -13.428 1.00 26.66 ? 673  ALA A CA    1 
ATOM   5378 C  C     . ALA C 3 667 ? 50.399 15.181  -13.064 1.00 26.61 ? 673  ALA A C     1 
ATOM   5379 O  O     . ALA C 3 667 ? 50.165 14.845  -11.900 1.00 27.25 ? 673  ALA A O     1 
ATOM   5380 C  CB    . ALA C 3 667 ? 51.566 17.372  -13.388 1.00 24.34 ? 673  ALA A CB    1 
ATOM   5381 N  N     . GLN C 3 668 ? 49.536 14.990  -14.059 1.00 26.96 ? 674  GLN A N     1 
ATOM   5382 C  CA    . GLN C 3 668 ? 48.244 14.336  -13.841 1.00 27.23 ? 674  GLN A CA    1 
ATOM   5383 C  C     . GLN C 3 668 ? 48.532 12.877  -13.513 1.00 26.62 ? 674  GLN A C     1 
ATOM   5384 O  O     . GLN C 3 668 ? 47.968 12.307  -12.575 1.00 26.01 ? 674  GLN A O     1 
ATOM   5385 C  CB    . GLN C 3 668 ? 47.368 14.447  -15.105 1.00 28.31 ? 674  GLN A CB    1 
ATOM   5386 C  CG    . GLN C 3 668 ? 46.075 13.613  -15.093 1.00 28.17 ? 674  GLN A CG    1 
ATOM   5387 C  CD    . GLN C 3 668 ? 45.081 14.039  -14.015 1.00 31.01 ? 674  GLN A CD    1 
ATOM   5388 O  OE1   . GLN C 3 668 ? 45.183 15.130  -13.459 1.00 30.45 ? 674  GLN A OE1   1 
ATOM   5389 N  NE2   . GLN C 3 668 ? 44.101 13.176  -13.729 1.00 29.57 ? 674  GLN A NE2   1 
ATOM   5390 N  N     . GLU C 3 669 ? 49.423 12.274  -14.291 1.00 27.71 ? 675  GLU A N     1 
ATOM   5391 C  CA    . GLU C 3 669 ? 49.822 10.889  -14.051 1.00 29.50 ? 675  GLU A CA    1 
ATOM   5392 C  C     . GLU C 3 669 ? 50.363 10.744  -12.619 1.00 27.23 ? 675  GLU A C     1 
ATOM   5393 O  O     . GLU C 3 669 ? 49.974 9.840   -11.884 1.00 27.42 ? 675  GLU A O     1 
ATOM   5394 C  CB    . GLU C 3 669 ? 50.913 10.471  -15.049 1.00 32.78 ? 675  GLU A CB    1 
ATOM   5395 C  CG    . GLU C 3 669 ? 50.432 10.190  -16.476 1.00 38.24 ? 675  GLU A CG    1 
ATOM   5396 C  CD    . GLU C 3 669 ? 51.597 10.065  -17.463 1.00 40.75 ? 675  GLU A CD    1 
ATOM   5397 O  OE1   . GLU C 3 669 ? 52.650 9.516   -17.079 1.00 41.66 ? 675  GLU A OE1   1 
ATOM   5398 O  OE2   . GLU C 3 669 ? 51.458 10.509  -18.626 1.00 44.30 ? 675  GLU A OE2   1 
ATOM   5399 N  N     . ALA C 3 670 ? 51.260 11.642  -12.225 1.00 25.34 ? 676  ALA A N     1 
ATOM   5400 C  CA    . ALA C 3 670 ? 51.845 11.591  -10.885 1.00 24.00 ? 676  ALA A CA    1 
ATOM   5401 C  C     . ALA C 3 670 ? 50.797 11.708  -9.773  1.00 23.00 ? 676  ALA A C     1 
ATOM   5402 O  O     . ALA C 3 670 ? 50.895 11.027  -8.745  1.00 22.61 ? 676  ALA A O     1 
ATOM   5403 C  CB    . ALA C 3 670 ? 52.877 12.677  -10.735 1.00 21.85 ? 676  ALA A CB    1 
ATOM   5404 N  N     . MET C 3 671 ? 49.807 12.575  -9.971  1.00 21.28 ? 677  MET A N     1 
ATOM   5405 C  CA    . MET C 3 671 ? 48.754 12.756  -8.973  1.00 23.82 ? 677  MET A CA    1 
ATOM   5406 C  C     . MET C 3 671 ? 47.955 11.470  -8.789  1.00 23.89 ? 677  MET A C     1 
ATOM   5407 O  O     . MET C 3 671 ? 47.684 11.068  -7.660  1.00 26.04 ? 677  MET A O     1 
ATOM   5408 C  CB    . MET C 3 671 ? 47.810 13.897  -9.374  1.00 24.76 ? 677  MET A CB    1 
ATOM   5409 C  CG    . MET C 3 671 ? 46.704 14.171  -8.362  1.00 26.02 ? 677  MET A CG    1 
ATOM   5410 S  SD    . MET C 3 671 ? 47.332 14.555  -6.696  1.00 29.21 ? 677  MET A SD    1 
ATOM   5411 C  CE    . MET C 3 671 ? 47.816 16.263  -6.915  1.00 25.57 ? 677  MET A CE    1 
ATOM   5412 N  N     . ARG C 3 672 ? 47.581 10.825  -9.892  1.00 23.59 ? 678  ARG A N     1 
ATOM   5413 C  CA    . ARG C 3 672 ? 46.832 9.574   -9.814  1.00 24.88 ? 678  ARG A CA    1 
ATOM   5414 C  C     . ARG C 3 672 ? 47.691 8.529   -9.100  1.00 25.98 ? 678  ARG A C     1 
ATOM   5415 O  O     . ARG C 3 672 ? 47.196 7.728   -8.298  1.00 26.23 ? 678  ARG A O     1 
ATOM   5416 C  CB    . ARG C 3 672 ? 46.468 9.071   -11.223 1.00 27.38 ? 678  ARG A CB    1 
ATOM   5417 C  CG    . ARG C 3 672 ? 45.376 9.893   -11.928 1.00 25.97 ? 678  ARG A CG    1 
ATOM   5418 C  CD    . ARG C 3 672 ? 44.089 9.953   -11.098 1.00 27.43 ? 678  ARG A CD    1 
ATOM   5419 N  NE    . ARG C 3 672 ? 43.045 10.723  -11.779 1.00 28.30 ? 678  ARG A NE    1 
ATOM   5420 C  CZ    . ARG C 3 672 ? 42.270 10.237  -12.745 1.00 32.04 ? 678  ARG A CZ    1 
ATOM   5421 N  NH1   . ARG C 3 672 ? 42.408 8.976   -13.141 1.00 29.95 ? 678  ARG A NH1   1 
ATOM   5422 N  NH2   . ARG C 3 672 ? 41.373 11.017  -13.336 1.00 32.08 ? 678  ARG A NH2   1 
ATOM   5423 N  N     . TRP C 3 673 ? 48.987 8.548   -9.389  1.00 23.76 ? 679  TRP A N     1 
ATOM   5424 C  CA    . TRP C 3 673 ? 49.907 7.612   -8.759  1.00 23.72 ? 679  TRP A CA    1 
ATOM   5425 C  C     . TRP C 3 673 ? 49.859 7.827   -7.239  1.00 23.13 ? 679  TRP A C     1 
ATOM   5426 O  O     . TRP C 3 673 ? 49.823 6.870   -6.463  1.00 23.98 ? 679  TRP A O     1 
ATOM   5427 C  CB    . TRP C 3 673 ? 51.333 7.835   -9.287  1.00 22.95 ? 679  TRP A CB    1 
ATOM   5428 C  CG    . TRP C 3 673 ? 52.319 6.827   -8.790  1.00 26.04 ? 679  TRP A CG    1 
ATOM   5429 C  CD1   . TRP C 3 673 ? 52.657 5.638   -9.385  1.00 25.97 ? 679  TRP A CD1   1 
ATOM   5430 C  CD2   . TRP C 3 673 ? 53.091 6.904   -7.585  1.00 25.83 ? 679  TRP A CD2   1 
ATOM   5431 N  NE1   . TRP C 3 673 ? 53.589 4.979   -8.624  1.00 25.40 ? 679  TRP A NE1   1 
ATOM   5432 C  CE2   . TRP C 3 673 ? 53.875 5.730   -7.514  1.00 26.21 ? 679  TRP A CE2   1 
ATOM   5433 C  CE3   . TRP C 3 673 ? 53.199 7.855   -6.557  1.00 27.34 ? 679  TRP A CE3   1 
ATOM   5434 C  CZ2   . TRP C 3 673 ? 54.758 5.477   -6.454  1.00 25.58 ? 679  TRP A CZ2   1 
ATOM   5435 C  CZ3   . TRP C 3 673 ? 54.084 7.603   -5.497  1.00 27.53 ? 679  TRP A CZ3   1 
ATOM   5436 C  CH2   . TRP C 3 673 ? 54.848 6.423   -5.460  1.00 26.55 ? 679  TRP A CH2   1 
ATOM   5437 N  N     . VAL C 3 674 ? 49.841 9.085   -6.816  1.00 22.20 ? 680  VAL A N     1 
ATOM   5438 C  CA    . VAL C 3 674 ? 49.794 9.389   -5.393  1.00 22.06 ? 680  VAL A CA    1 
ATOM   5439 C  C     . VAL C 3 674 ? 48.487 8.894   -4.758  1.00 23.49 ? 680  VAL A C     1 
ATOM   5440 O  O     . VAL C 3 674 ? 48.501 8.304   -3.677  1.00 23.84 ? 680  VAL A O     1 
ATOM   5441 C  CB    . VAL C 3 674 ? 49.978 10.908  -5.148  1.00 22.15 ? 680  VAL A CB    1 
ATOM   5442 C  CG1   . VAL C 3 674 ? 49.592 11.266  -3.710  1.00 22.92 ? 680  VAL A CG1   1 
ATOM   5443 C  CG2   . VAL C 3 674 ? 51.445 11.299  -5.405  1.00 17.99 ? 680  VAL A CG2   1 
ATOM   5444 N  N     . GLY C 3 675 ? 47.364 9.121   -5.439  1.00 24.39 ? 681  GLY A N     1 
ATOM   5445 C  CA    . GLY C 3 675 ? 46.075 8.680   -4.918  1.00 24.53 ? 681  GLY A CA    1 
ATOM   5446 C  C     . GLY C 3 675 ? 46.022 7.170   -4.744  1.00 27.12 ? 681  GLY A C     1 
ATOM   5447 O  O     . GLY C 3 675 ? 45.457 6.660   -3.774  1.00 27.59 ? 681  GLY A O     1 
ATOM   5448 N  N     . ASP C 3 676 ? 46.617 6.456   -5.694  1.00 28.42 ? 682  ASP A N     1 
ATOM   5449 C  CA    . ASP C 3 676 ? 46.677 4.999   -5.661  1.00 28.96 ? 682  ASP A CA    1 
ATOM   5450 C  C     . ASP C 3 676 ? 47.669 4.548   -4.588  1.00 28.98 ? 682  ASP A C     1 
ATOM   5451 O  O     . ASP C 3 676 ? 47.412 3.593   -3.844  1.00 27.76 ? 682  ASP A O     1 
ATOM   5452 C  CB    . ASP C 3 676 ? 47.126 4.463   -7.020  1.00 30.56 ? 682  ASP A CB    1 
ATOM   5453 C  CG    . ASP C 3 676 ? 47.388 2.973   -6.995  1.00 35.50 ? 682  ASP A CG    1 
ATOM   5454 O  OD1   . ASP C 3 676 ? 46.412 2.188   -7.042  1.00 36.85 ? 682  ASP A OD1   1 
ATOM   5455 O  OD2   . ASP C 3 676 ? 48.575 2.586   -6.914  1.00 38.22 ? 682  ASP A OD2   1 
ATOM   5456 N  N     . HIS C 3 677 ? 48.796 5.252   -4.513  1.00 28.16 ? 683  HIS A N     1 
ATOM   5457 C  CA    . HIS C 3 677 ? 49.851 4.958   -3.541  1.00 28.05 ? 683  HIS A CA    1 
ATOM   5458 C  C     . HIS C 3 677 ? 49.322 4.966   -2.106  1.00 27.52 ? 683  HIS A C     1 
ATOM   5459 O  O     . HIS C 3 677 ? 49.680 4.106   -1.294  1.00 25.20 ? 683  HIS A O     1 
ATOM   5460 C  CB    . HIS C 3 677 ? 50.990 5.984   -3.682  1.00 27.70 ? 683  HIS A CB    1 
ATOM   5461 C  CG    . HIS C 3 677 ? 52.063 5.853   -2.642  1.00 28.49 ? 683  HIS A CG    1 
ATOM   5462 N  ND1   . HIS C 3 677 ? 53.012 4.854   -2.667  1.00 30.86 ? 683  HIS A ND1   1 
ATOM   5463 C  CD2   . HIS C 3 677 ? 52.333 6.599   -1.545  1.00 28.65 ? 683  HIS A CD2   1 
ATOM   5464 C  CE1   . HIS C 3 677 ? 53.820 4.991   -1.631  1.00 31.60 ? 683  HIS A CE1   1 
ATOM   5465 N  NE2   . HIS C 3 677 ? 53.428 6.042   -0.933  1.00 30.19 ? 683  HIS A NE2   1 
ATOM   5466 N  N     . TRP C 3 678 ? 48.478 5.941   -1.788  1.00 26.82 ? 684  TRP A N     1 
ATOM   5467 C  CA    . TRP C 3 678 ? 47.927 6.014   -0.450  1.00 26.48 ? 684  TRP A CA    1 
ATOM   5468 C  C     . TRP C 3 678 ? 46.490 5.502   -0.336  1.00 26.48 ? 684  TRP A C     1 
ATOM   5469 O  O     . TRP C 3 678 ? 45.775 5.849   0.600   1.00 25.96 ? 684  TRP A O     1 
ATOM   5470 C  CB    . TRP C 3 678 ? 48.048 7.440   0.103   1.00 25.59 ? 684  TRP A CB    1 
ATOM   5471 C  CG    . TRP C 3 678 ? 49.410 7.705   0.684   1.00 26.78 ? 684  TRP A CG    1 
ATOM   5472 C  CD1   . TRP C 3 678 ? 50.222 6.796   1.316   1.00 26.82 ? 684  TRP A CD1   1 
ATOM   5473 C  CD2   . TRP C 3 678 ? 50.115 8.954   0.712   1.00 25.53 ? 684  TRP A CD2   1 
ATOM   5474 N  NE1   . TRP C 3 678 ? 51.382 7.403   1.732   1.00 26.12 ? 684  TRP A NE1   1 
ATOM   5475 C  CE2   . TRP C 3 678 ? 51.346 8.725   1.372   1.00 25.28 ? 684  TRP A CE2   1 
ATOM   5476 C  CE3   . TRP C 3 678 ? 49.827 10.243  0.244   1.00 26.20 ? 684  TRP A CE3   1 
ATOM   5477 C  CZ2   . TRP C 3 678 ? 52.291 9.740   1.572   1.00 25.35 ? 684  TRP A CZ2   1 
ATOM   5478 C  CZ3   . TRP C 3 678 ? 50.763 11.251  0.442   1.00 25.86 ? 684  TRP A CZ3   1 
ATOM   5479 C  CH2   . TRP C 3 678 ? 51.983 10.993  1.102   1.00 26.22 ? 684  TRP A CH2   1 
ATOM   5480 N  N     . ASN C 3 679 ? 46.082 4.666   -1.287  1.00 26.21 ? 685  ASN A N     1 
ATOM   5481 C  CA    . ASN C 3 679 ? 44.748 4.073   -1.266  1.00 28.60 ? 685  ASN A CA    1 
ATOM   5482 C  C     . ASN C 3 679 ? 43.663 5.111   -0.982  1.00 27.43 ? 685  ASN A C     1 
ATOM   5483 O  O     . ASN C 3 679 ? 42.774 4.879   -0.163  1.00 26.17 ? 685  ASN A O     1 
ATOM   5484 C  CB    . ASN C 3 679 ? 44.705 2.977   -0.194  1.00 28.31 ? 685  ASN A CB    1 
ATOM   5485 C  CG    . ASN C 3 679 ? 45.877 1.998   -0.313  1.00 35.50 ? 685  ASN A CG    1 
ATOM   5486 O  OD1   . ASN C 3 679 ? 46.070 1.369   -1.359  1.00 37.03 ? 685  ASN A OD1   1 
ATOM   5487 N  ND2   . ASN C 3 679 ? 46.662 1.868   0.761   1.00 32.56 ? 685  ASN A ND2   1 
ATOM   5488 N  N     . PHE C 3 680 ? 43.734 6.245   -1.670  1.00 27.07 ? 686  PHE A N     1 
ATOM   5489 C  CA    . PHE C 3 680 ? 42.769 7.316   -1.460  1.00 27.62 ? 686  PHE A CA    1 
ATOM   5490 C  C     . PHE C 3 680 ? 41.368 6.941   -1.946  1.00 28.23 ? 686  PHE A C     1 
ATOM   5491 O  O     . PHE C 3 680 ? 41.198 6.421   -3.047  1.00 29.04 ? 686  PHE A O     1 
ATOM   5492 C  CB    . PHE C 3 680 ? 43.252 8.599   -2.143  1.00 26.40 ? 686  PHE A CB    1 
ATOM   5493 C  CG    . PHE C 3 680 ? 43.313 9.784   -1.216  1.00 26.24 ? 686  PHE A CG    1 
ATOM   5494 C  CD1   . PHE C 3 680 ? 43.990 9.694   -0.004  1.00 25.84 ? 686  PHE A CD1   1 
ATOM   5495 C  CD2   . PHE C 3 680 ? 42.681 10.973  -1.542  1.00 24.08 ? 686  PHE A CD2   1 
ATOM   5496 C  CE1   . PHE C 3 680 ? 44.029 10.774  0.868   1.00 27.26 ? 686  PHE A CE1   1 
ATOM   5497 C  CE2   . PHE C 3 680 ? 42.714 12.059  -0.678  1.00 26.50 ? 686  PHE A CE2   1 
ATOM   5498 C  CZ    . PHE C 3 680 ? 43.387 11.961  0.530   1.00 25.87 ? 686  PHE A CZ    1 
ATOM   5499 N  N     . ARG C 3 681 ? 40.374 7.224   -1.109  1.00 28.80 ? 687  ARG A N     1 
ATOM   5500 C  CA    . ARG C 3 681 ? 38.981 6.898   -1.399  1.00 30.70 ? 687  ARG A CA    1 
ATOM   5501 C  C     . ARG C 3 681 ? 38.303 7.900   -2.317  1.00 30.86 ? 687  ARG A C     1 
ATOM   5502 O  O     . ARG C 3 681 ? 37.135 7.748   -2.659  1.00 33.58 ? 687  ARG A O     1 
ATOM   5503 C  CB    . ARG C 3 681 ? 38.211 6.792   -0.091  1.00 33.23 ? 687  ARG A CB    1 
ATOM   5504 C  CG    . ARG C 3 681 ? 38.897 5.897   0.911   1.00 37.70 ? 687  ARG A CG    1 
ATOM   5505 C  CD    . ARG C 3 681 ? 38.822 4.433   0.510   1.00 39.76 ? 687  ARG A CD    1 
ATOM   5506 N  NE    . ARG C 3 681 ? 37.871 3.745   1.372   1.00 44.32 ? 687  ARG A NE    1 
ATOM   5507 C  CZ    . ARG C 3 681 ? 36.586 3.575   1.089   1.00 41.93 ? 687  ARG A CZ    1 
ATOM   5508 N  NH1   . ARG C 3 681 ? 36.094 4.029   -0.053  1.00 44.52 ? 687  ARG A NH1   1 
ATOM   5509 N  NH2   . ARG C 3 681 ? 35.791 2.990   1.970   1.00 37.74 ? 687  ARG A NH2   1 
ATOM   5510 N  N     . CYS C 3 682 ? 39.025 8.943   -2.692  1.00 28.66 ? 688  CYS A N     1 
ATOM   5511 C  CA    . CYS C 3 682 ? 38.482 9.924   -3.617  1.00 29.03 ? 688  CYS A CA    1 
ATOM   5512 C  C     . CYS C 3 682 ? 39.528 10.063  -4.699  1.00 29.34 ? 688  CYS A C     1 
ATOM   5513 O  O     . CYS C 3 682 ? 40.730 10.131  -4.411  1.00 30.25 ? 688  CYS A O     1 
ATOM   5514 C  CB    . CYS C 3 682 ? 38.242 11.279  -2.942  1.00 26.51 ? 688  CYS A CB    1 
ATOM   5515 S  SG    . CYS C 3 682 ? 37.345 12.482  -3.989  1.00 30.95 ? 688  CYS A SG    1 
ATOM   5516 N  N     . LEU C 3 683 ? 39.069 10.081  -5.941  1.00 29.55 ? 689  LEU A N     1 
ATOM   5517 C  CA    . LEU C 3 683 ? 39.951 10.214  -7.085  1.00 28.85 ? 689  LEU A CA    1 
ATOM   5518 C  C     . LEU C 3 683 ? 40.601 11.593  -7.025  1.00 29.12 ? 689  LEU A C     1 
ATOM   5519 O  O     . LEU C 3 683 ? 39.954 12.571  -6.657  1.00 27.03 ? 689  LEU A O     1 
ATOM   5520 C  CB    . LEU C 3 683 ? 39.136 10.071  -8.369  1.00 30.80 ? 689  LEU A CB    1 
ATOM   5521 C  CG    . LEU C 3 683 ? 39.902 9.836   -9.666  1.00 33.46 ? 689  LEU A CG    1 
ATOM   5522 C  CD1   . LEU C 3 683 ? 40.725 8.559   -9.533  1.00 32.80 ? 689  LEU A CD1   1 
ATOM   5523 C  CD2   . LEU C 3 683 ? 38.916 9.716   -10.825 1.00 32.96 ? 689  LEU A CD2   1 
ATOM   5524 N  N     . LEU C 3 684 ? 41.879 11.674  -7.383  1.00 29.07 ? 690  LEU A N     1 
ATOM   5525 C  CA    . LEU C 3 684 ? 42.585 12.951  -7.353  1.00 29.26 ? 690  LEU A CA    1 
ATOM   5526 C  C     . LEU C 3 684 ? 42.936 13.413  -8.757  1.00 29.61 ? 690  LEU A C     1 
ATOM   5527 O  O     . LEU C 3 684 ? 43.304 12.607  -9.609  1.00 30.88 ? 690  LEU A O     1 
ATOM   5528 C  CB    . LEU C 3 684 ? 43.865 12.829  -6.525  1.00 29.27 ? 690  LEU A CB    1 
ATOM   5529 C  CG    . LEU C 3 684 ? 43.708 12.397  -5.066  1.00 29.43 ? 690  LEU A CG    1 
ATOM   5530 C  CD1   . LEU C 3 684 ? 45.090 12.312  -4.417  1.00 26.91 ? 690  LEU A CD1   1 
ATOM   5531 C  CD2   . LEU C 3 684 ? 42.813 13.408  -4.323  1.00 28.35 ? 690  LEU A CD2   1 
ATOM   5532 N  N     . ASP C 3 685 ? 42.825 14.713  -8.995  1.00 28.14 ? 691  ASP A N     1 
ATOM   5533 C  CA    . ASP C 3 685 ? 43.140 15.264  -10.304 1.00 29.12 ? 691  ASP A CA    1 
ATOM   5534 C  C     . ASP C 3 685 ? 43.915 16.566  -10.205 1.00 27.44 ? 691  ASP A C     1 
ATOM   5535 O  O     . ASP C 3 685 ? 44.063 17.144  -9.130  1.00 25.82 ? 691  ASP A O     1 
ATOM   5536 C  CB    . ASP C 3 685 ? 41.854 15.518  -11.104 1.00 30.20 ? 691  ASP A CB    1 
ATOM   5537 C  CG    . ASP C 3 685 ? 41.110 14.239  -11.427 1.00 32.39 ? 691  ASP A CG    1 
ATOM   5538 O  OD1   . ASP C 3 685 ? 41.674 13.393  -12.147 1.00 30.90 ? 691  ASP A OD1   1 
ATOM   5539 O  OD2   . ASP C 3 685 ? 39.966 14.078  -10.955 1.00 34.66 ? 691  ASP A OD2   1 
ATOM   5540 N  N     . THR C 3 686 ? 44.401 17.006  -11.355 1.00 28.06 ? 692  THR A N     1 
ATOM   5541 C  CA    . THR C 3 686 ? 45.138 18.248  -11.489 1.00 28.84 ? 692  THR A CA    1 
ATOM   5542 C  C     . THR C 3 686 ? 44.599 18.922  -12.739 1.00 31.38 ? 692  THR A C     1 
ATOM   5543 O  O     . THR C 3 686 ? 43.917 18.293  -13.552 1.00 31.10 ? 692  THR A O     1 
ATOM   5544 C  CB    . THR C 3 686 ? 46.633 18.016  -11.738 1.00 28.23 ? 692  THR A CB    1 
ATOM   5545 O  OG1   . THR C 3 686 ? 46.798 17.352  -12.996 1.00 26.90 ? 692  THR A OG1   1 
ATOM   5546 C  CG2   . THR C 3 686 ? 47.246 17.184  -10.626 1.00 26.95 ? 692  THR A CG2   1 
ATOM   5547 N  N     . GLU C 3 687 ? 44.903 20.204  -12.883 1.00 32.95 ? 693  GLU A N     1 
ATOM   5548 C  CA    . GLU C 3 687 ? 44.492 20.974  -14.050 1.00 35.57 ? 693  GLU A CA    1 
ATOM   5549 C  C     . GLU C 3 687 ? 45.734 21.756  -14.454 1.00 32.58 ? 693  GLU A C     1 
ATOM   5550 O  O     . GLU C 3 687 ? 46.372 22.374  -13.608 1.00 31.82 ? 693  GLU A O     1 
ATOM   5551 C  CB    . GLU C 3 687 ? 43.358 21.945  -13.700 1.00 39.11 ? 693  GLU A CB    1 
ATOM   5552 C  CG    . GLU C 3 687 ? 43.070 22.952  -14.805 1.00 47.95 ? 693  GLU A CG    1 
ATOM   5553 C  CD    . GLU C 3 687 ? 42.201 24.111  -14.341 1.00 53.17 ? 693  GLU A CD    1 
ATOM   5554 O  OE1   . GLU C 3 687 ? 42.596 24.807  -13.376 1.00 56.11 ? 693  GLU A OE1   1 
ATOM   5555 O  OE2   . GLU C 3 687 ? 41.127 24.330  -14.947 1.00 55.72 ? 693  GLU A OE2   1 
ATOM   5556 N  N     . GLY C 3 688 ? 46.077 21.718  -15.735 1.00 32.90 ? 694  GLY A N     1 
ATOM   5557 C  CA    . GLY C 3 688 ? 47.260 22.419  -16.202 1.00 31.40 ? 694  GLY A CA    1 
ATOM   5558 C  C     . GLY C 3 688 ? 46.953 23.507  -17.209 1.00 32.52 ? 694  GLY A C     1 
ATOM   5559 O  O     . GLY C 3 688 ? 45.987 23.414  -17.975 1.00 31.95 ? 694  GLY A O     1 
ATOM   5560 N  N     . LYS C 3 689 ? 47.783 24.545  -17.208 1.00 32.32 ? 695  LYS A N     1 
ATOM   5561 C  CA    . LYS C 3 689 ? 47.617 25.671  -18.116 1.00 33.13 ? 695  LYS A CA    1 
ATOM   5562 C  C     . LYS C 3 689 ? 48.993 26.040  -18.656 1.00 31.91 ? 695  LYS A C     1 
ATOM   5563 O  O     . LYS C 3 689 ? 49.973 26.065  -17.908 1.00 30.37 ? 695  LYS A O     1 
ATOM   5564 C  CB    . LYS C 3 689 ? 47.016 26.861  -17.358 1.00 35.98 ? 695  LYS A CB    1 
ATOM   5565 C  CG    . LYS C 3 689 ? 45.983 27.665  -18.129 1.00 40.56 ? 695  LYS A CG    1 
ATOM   5566 C  CD    . LYS C 3 689 ? 46.551 28.280  -19.401 1.00 42.56 ? 695  LYS A CD    1 
ATOM   5567 C  CE    . LYS C 3 689 ? 45.509 29.154  -20.088 1.00 44.01 ? 695  LYS A CE    1 
ATOM   5568 N  NZ    . LYS C 3 689 ? 46.038 29.819  -21.310 1.00 43.93 ? 695  LYS A NZ    1 
ATOM   5569 N  N     . MET C 3 690 ? 49.067 26.317  -19.953 1.00 31.72 ? 696  MET A N     1 
ATOM   5570 C  CA    . MET C 3 690 ? 50.327 26.687  -20.590 1.00 32.96 ? 696  MET A CA    1 
ATOM   5571 C  C     . MET C 3 690 ? 50.302 28.177  -20.908 1.00 32.60 ? 696  MET A C     1 
ATOM   5572 O  O     . MET C 3 690 ? 49.242 28.733  -21.180 1.00 34.60 ? 696  MET A O     1 
ATOM   5573 C  CB    . MET C 3 690 ? 50.518 25.883  -21.876 1.00 34.22 ? 696  MET A CB    1 
ATOM   5574 C  CG    . MET C 3 690 ? 51.859 26.091  -22.567 1.00 38.22 ? 696  MET A CG    1 
ATOM   5575 S  SD    . MET C 3 690 ? 52.011 25.052  -24.052 1.00 43.22 ? 696  MET A SD    1 
ATOM   5576 C  CE    . MET C 3 690 ? 51.726 23.457  -23.336 1.00 43.59 ? 696  MET A CE    1 
ATOM   5577 N  N     . GLY C 3 691 ? 51.467 28.819  -20.868 1.00 32.18 ? 697  GLY A N     1 
ATOM   5578 C  CA    . GLY C 3 691 ? 51.545 30.243  -21.150 1.00 29.92 ? 697  GLY A CA    1 
ATOM   5579 C  C     . GLY C 3 691 ? 52.936 30.821  -20.930 1.00 28.94 ? 697  GLY A C     1 
ATOM   5580 O  O     . GLY C 3 691 ? 53.847 30.118  -20.510 1.00 29.04 ? 697  GLY A O     1 
ATOM   5581 N  N     . PRO C 3 692 ? 53.128 32.115  -21.202 1.00 29.10 ? 698  PRO A N     1 
ATOM   5582 C  CA    . PRO C 3 692 ? 54.435 32.759  -21.024 1.00 28.79 ? 698  PRO A CA    1 
ATOM   5583 C  C     . PRO C 3 692 ? 54.804 33.141  -19.581 1.00 29.31 ? 698  PRO A C     1 
ATOM   5584 O  O     . PRO C 3 692 ? 55.986 33.214  -19.241 1.00 28.64 ? 698  PRO A O     1 
ATOM   5585 C  CB    . PRO C 3 692 ? 54.327 33.982  -21.923 1.00 28.70 ? 698  PRO A CB    1 
ATOM   5586 C  CG    . PRO C 3 692 ? 52.885 34.365  -21.763 1.00 30.06 ? 698  PRO A CG    1 
ATOM   5587 C  CD    . PRO C 3 692 ? 52.168 33.030  -21.848 1.00 29.36 ? 698  PRO A CD    1 
ATOM   5588 N  N     . ASN C 3 693 ? 53.802 33.362  -18.734 1.00 29.09 ? 699  ASN A N     1 
ATOM   5589 C  CA    . ASN C 3 693 ? 54.071 33.778  -17.362 1.00 28.19 ? 699  ASN A CA    1 
ATOM   5590 C  C     . ASN C 3 693 ? 52.994 33.410  -16.332 1.00 27.37 ? 699  ASN A C     1 
ATOM   5591 O  O     . ASN C 3 693 ? 51.976 32.800  -16.658 1.00 26.72 ? 699  ASN A O     1 
ATOM   5592 C  CB    . ASN C 3 693 ? 54.309 35.288  -17.339 1.00 28.39 ? 699  ASN A CB    1 
ATOM   5593 C  CG    . ASN C 3 693 ? 53.131 36.071  -17.887 1.00 29.39 ? 699  ASN A CG    1 
ATOM   5594 O  OD1   . ASN C 3 693 ? 51.995 35.900  -17.441 1.00 30.41 ? 699  ASN A OD1   1 
ATOM   5595 N  ND2   . ASN C 3 693 ? 53.396 36.936  -18.853 1.00 29.77 ? 699  ASN A ND2   1 
ATOM   5596 N  N     . TRP C 3 694 ? 53.227 33.809  -15.085 1.00 26.84 ? 700  TRP A N     1 
ATOM   5597 C  CA    . TRP C 3 694 ? 52.318 33.492  -13.985 1.00 25.34 ? 700  TRP A CA    1 
ATOM   5598 C  C     . TRP C 3 694 ? 50.962 34.174  -14.063 1.00 25.94 ? 700  TRP A C     1 
ATOM   5599 O  O     . TRP C 3 694 ? 50.000 33.700  -13.463 1.00 25.80 ? 700  TRP A O     1 
ATOM   5600 C  CB    . TRP C 3 694 ? 52.980 33.828  -12.644 1.00 24.10 ? 700  TRP A CB    1 
ATOM   5601 C  CG    . TRP C 3 694 ? 52.577 32.925  -11.512 1.00 24.20 ? 700  TRP A CG    1 
ATOM   5602 C  CD1   . TRP C 3 694 ? 51.555 32.015  -11.496 1.00 23.16 ? 700  TRP A CD1   1 
ATOM   5603 C  CD2   . TRP C 3 694 ? 53.231 32.811  -10.244 1.00 25.12 ? 700  TRP A CD2   1 
ATOM   5604 N  NE1   . TRP C 3 694 ? 51.539 31.338  -10.295 1.00 23.51 ? 700  TRP A NE1   1 
ATOM   5605 C  CE2   . TRP C 3 694 ? 52.558 31.807  -9.511  1.00 24.87 ? 700  TRP A CE2   1 
ATOM   5606 C  CE3   . TRP C 3 694 ? 54.326 33.460  -9.657  1.00 27.36 ? 700  TRP A CE3   1 
ATOM   5607 C  CZ2   . TRP C 3 694 ? 52.947 31.433  -8.219  1.00 27.21 ? 700  TRP A CZ2   1 
ATOM   5608 C  CZ3   . TRP C 3 694 ? 54.711 33.087  -8.371  1.00 27.97 ? 700  TRP A CZ3   1 
ATOM   5609 C  CH2   . TRP C 3 694 ? 54.023 32.083  -7.669  1.00 27.72 ? 700  TRP A CH2   1 
ATOM   5610 N  N     . ALA C 3 695 ? 50.873 35.287  -14.790 1.00 27.78 ? 701  ALA A N     1 
ATOM   5611 C  CA    . ALA C 3 695 ? 49.589 35.971  -14.913 1.00 29.10 ? 701  ALA A CA    1 
ATOM   5612 C  C     . ALA C 3 695 ? 48.672 35.124  -15.792 1.00 31.49 ? 701  ALA A C     1 
ATOM   5613 O  O     . ALA C 3 695 ? 47.475 34.979  -15.522 1.00 31.05 ? 701  ALA A O     1 
ATOM   5614 C  CB    . ALA C 3 695 ? 49.776 37.353  -15.526 1.00 29.37 ? 701  ALA A CB    1 
ATOM   5615 N  N     . ILE C 3 696 ? 49.252 34.550  -16.838 1.00 32.74 ? 702  ILE A N     1 
ATOM   5616 C  CA    . ILE C 3 696 ? 48.497 33.723  -17.767 1.00 33.58 ? 702  ILE A CA    1 
ATOM   5617 C  C     . ILE C 3 696 ? 48.342 32.286  -17.287 1.00 35.04 ? 702  ILE A C     1 
ATOM   5618 O  O     . ILE C 3 696 ? 47.361 31.629  -17.621 1.00 36.71 ? 702  ILE A O     1 
ATOM   5619 C  CB    . ILE C 3 696 ? 49.155 33.751  -19.157 1.00 33.67 ? 702  ILE A CB    1 
ATOM   5620 C  CG1   . ILE C 3 696 ? 49.109 35.186  -19.686 1.00 35.30 ? 702  ILE A CG1   1 
ATOM   5621 C  CG2   . ILE C 3 696 ? 48.427 32.807  -20.122 1.00 31.33 ? 702  ILE A CG2   1 
ATOM   5622 C  CD1   . ILE C 3 696 ? 49.868 35.397  -20.956 1.00 39.18 ? 702  ILE A CD1   1 
ATOM   5623 N  N     . CYS C 3 697 ? 49.289 31.808  -16.482 1.00 35.18 ? 703  CYS A N     1 
ATOM   5624 C  CA    . CYS C 3 697 ? 49.232 30.443  -15.976 1.00 37.55 ? 703  CYS A CA    1 
ATOM   5625 C  C     . CYS C 3 697 ? 48.606 30.266  -14.593 1.00 40.68 ? 703  CYS A C     1 
ATOM   5626 O  O     . CYS C 3 697 ? 49.013 29.387  -13.833 1.00 40.75 ? 703  CYS A O     1 
ATOM   5627 C  CB    . CYS C 3 697 ? 50.633 29.828  -15.974 1.00 35.30 ? 703  CYS A CB    1 
ATOM   5628 S  SG    . CYS C 3 697 ? 51.340 29.636  -17.613 1.00 31.36 ? 703  CYS A SG    1 
ATOM   5629 N  N     . HIS C 3 698 ? 47.620 31.086  -14.255 1.00 44.44 ? 704  HIS A N     1 
ATOM   5630 C  CA    . HIS C 3 698 ? 46.976 30.936  -12.958 1.00 49.14 ? 704  HIS A CA    1 
ATOM   5631 C  C     . HIS C 3 698 ? 45.461 30.970  -13.082 1.00 49.76 ? 704  HIS A C     1 
ATOM   5632 O  O     . HIS C 3 698 ? 44.913 29.906  -13.443 1.00 50.06 ? 704  HIS A O     1 
ATOM   5633 C  CB    . HIS C 3 698 ? 47.431 32.023  -11.980 1.00 54.38 ? 704  HIS A CB    1 
ATOM   5634 C  CG    . HIS C 3 698 ? 47.003 31.766  -10.566 1.00 58.33 ? 704  HIS A CG    1 
ATOM   5635 N  ND1   . HIS C 3 698 ? 47.515 30.732  -9.812  1.00 60.06 ? 704  HIS A ND1   1 
ATOM   5636 C  CD2   . HIS C 3 698 ? 46.070 32.370  -9.791  1.00 60.05 ? 704  HIS A CD2   1 
ATOM   5637 C  CE1   . HIS C 3 698 ? 46.913 30.707  -8.635  1.00 61.10 ? 704  HIS A CE1   1 
ATOM   5638 N  NE2   . HIS C 3 698 ? 46.032 31.690  -8.597  1.00 61.25 ? 704  HIS A NE2   1 
ATOM   5639 N  N     . LYS D 4 3   ? 39.554 92.841  25.839  1.00 55.16 ? 3    LYS B N     1 
ATOM   5640 C  CA    . LYS D 4 3   ? 39.496 93.348  24.441  1.00 53.88 ? 3    LYS B CA    1 
ATOM   5641 C  C     . LYS D 4 3   ? 40.674 92.844  23.610  1.00 53.43 ? 3    LYS B C     1 
ATOM   5642 O  O     . LYS D 4 3   ? 41.452 93.628  23.062  1.00 53.47 ? 3    LYS B O     1 
ATOM   5643 C  CB    . LYS D 4 3   ? 39.476 94.877  24.440  1.00 55.14 ? 3    LYS B CB    1 
ATOM   5644 C  CG    . LYS D 4 3   ? 40.647 95.521  25.166  1.00 55.14 ? 3    LYS B CG    1 
ATOM   5645 C  CD    . LYS D 4 3   ? 40.559 97.042  25.102  1.00 53.76 ? 3    LYS B CD    1 
ATOM   5646 N  N     . ILE D 4 4   ? 40.798 91.523  23.520  1.00 51.04 ? 4    ILE B N     1 
ATOM   5647 C  CA    . ILE D 4 4   ? 41.865 90.904  22.746  1.00 48.83 ? 4    ILE B CA    1 
ATOM   5648 C  C     . ILE D 4 4   ? 41.359 90.535  21.353  1.00 46.25 ? 4    ILE B C     1 
ATOM   5649 O  O     . ILE D 4 4   ? 40.192 90.190  21.183  1.00 44.94 ? 4    ILE B O     1 
ATOM   5650 C  CB    . ILE D 4 4   ? 42.386 89.636  23.445  1.00 49.55 ? 4    ILE B CB    1 
ATOM   5651 C  CG1   . ILE D 4 4   ? 43.067 90.026  24.761  1.00 49.18 ? 4    ILE B CG1   1 
ATOM   5652 C  CG2   . ILE D 4 4   ? 43.342 88.884  22.526  1.00 48.45 ? 4    ILE B CG2   1 
ATOM   5653 C  CD1   . ILE D 4 4   ? 43.592 88.852  25.563  1.00 48.87 ? 4    ILE B CD1   1 
ATOM   5654 N  N     . ILE D 4 5   ? 42.240 90.627  20.361  1.00 44.39 ? 5    ILE B N     1 
ATOM   5655 C  CA    . ILE D 4 5   ? 41.886 90.289  18.987  1.00 43.05 ? 5    ILE B CA    1 
ATOM   5656 C  C     . ILE D 4 5   ? 42.153 88.813  18.716  1.00 42.20 ? 5    ILE B C     1 
ATOM   5657 O  O     . ILE D 4 5   ? 43.283 88.344  18.854  1.00 42.09 ? 5    ILE B O     1 
ATOM   5658 C  CB    . ILE D 4 5   ? 42.699 91.115  17.970  1.00 43.92 ? 5    ILE B CB    1 
ATOM   5659 C  CG1   . ILE D 4 5   ? 42.356 92.598  18.104  1.00 44.05 ? 5    ILE B CG1   1 
ATOM   5660 C  CG2   . ILE D 4 5   ? 42.397 90.641  16.562  1.00 44.58 ? 5    ILE B CG2   1 
ATOM   5661 C  CD1   . ILE D 4 5   ? 43.087 93.474  17.112  1.00 48.03 ? 5    ILE B CD1   1 
ATOM   5662 N  N     . HIS D 4 6   ? 41.108 88.091  18.328  1.00 39.95 ? 6    HIS B N     1 
ATOM   5663 C  CA    . HIS D 4 6   ? 41.212 86.668  18.028  1.00 39.02 ? 6    HIS B CA    1 
ATOM   5664 C  C     . HIS D 4 6   ? 41.393 86.490  16.527  1.00 37.22 ? 6    HIS B C     1 
ATOM   5665 O  O     . HIS D 4 6   ? 40.439 86.572  15.755  1.00 36.49 ? 6    HIS B O     1 
ATOM   5666 C  CB    . HIS D 4 6   ? 39.951 85.952  18.507  1.00 41.15 ? 6    HIS B CB    1 
ATOM   5667 C  CG    . HIS D 4 6   ? 39.678 86.150  19.965  1.00 44.36 ? 6    HIS B CG    1 
ATOM   5668 N  ND1   . HIS D 4 6   ? 40.446 85.567  20.951  1.00 43.79 ? 6    HIS B ND1   1 
ATOM   5669 C  CD2   . HIS D 4 6   ? 38.753 86.904  20.605  1.00 45.54 ? 6    HIS B CD2   1 
ATOM   5670 C  CE1   . HIS D 4 6   ? 40.005 85.954  22.135  1.00 45.81 ? 6    HIS B CE1   1 
ATOM   5671 N  NE2   . HIS D 4 6   ? 38.979 86.766  21.953  1.00 46.60 ? 6    HIS B NE2   1 
ATOM   5672 N  N     . LEU D 4 7   ? 42.628 86.233  16.125  1.00 33.65 ? 7    LEU B N     1 
ATOM   5673 C  CA    . LEU D 4 7   ? 42.965 86.079  14.721  1.00 33.75 ? 7    LEU B CA    1 
ATOM   5674 C  C     . LEU D 4 7   ? 42.565 84.753  14.091  1.00 31.51 ? 7    LEU B C     1 
ATOM   5675 O  O     . LEU D 4 7   ? 42.155 83.817  14.774  1.00 32.27 ? 7    LEU B O     1 
ATOM   5676 C  CB    . LEU D 4 7   ? 44.471 86.252  14.543  1.00 33.85 ? 7    LEU B CB    1 
ATOM   5677 C  CG    . LEU D 4 7   ? 45.103 87.498  15.160  1.00 33.93 ? 7    LEU B CG    1 
ATOM   5678 C  CD1   . LEU D 4 7   ? 46.618 87.344  15.138  1.00 32.70 ? 7    LEU B CD1   1 
ATOM   5679 C  CD2   . LEU D 4 7   ? 44.657 88.749  14.390  1.00 32.99 ? 7    LEU B CD2   1 
ATOM   5680 N  N     . THR D 4 8   ? 42.693 84.708  12.767  1.00 30.88 ? 8    THR B N     1 
ATOM   5681 C  CA    . THR D 4 8   ? 42.448 83.511  11.966  1.00 31.50 ? 8    THR B CA    1 
ATOM   5682 C  C     . THR D 4 8   ? 43.527 83.592  10.899  1.00 31.37 ? 8    THR B C     1 
ATOM   5683 O  O     . THR D 4 8   ? 44.110 84.658  10.691  1.00 31.65 ? 8    THR B O     1 
ATOM   5684 C  CB    . THR D 4 8   ? 41.086 83.525  11.239  1.00 30.15 ? 8    THR B CB    1 
ATOM   5685 O  OG1   . THR D 4 8   ? 41.053 84.629  10.327  1.00 29.97 ? 8    THR B OG1   1 
ATOM   5686 C  CG2   . THR D 4 8   ? 39.933 83.634  12.240  1.00 32.45 ? 8    THR B CG2   1 
ATOM   5687 N  N     . ASP D 4 9   ? 43.805 82.481  10.227  1.00 32.53 ? 9    ASP B N     1 
ATOM   5688 C  CA    . ASP D 4 9   ? 44.804 82.490  9.165   1.00 32.87 ? 9    ASP B CA    1 
ATOM   5689 C  C     . ASP D 4 9   ? 44.453 83.526  8.095   1.00 33.59 ? 9    ASP B C     1 
ATOM   5690 O  O     . ASP D 4 9   ? 45.316 84.273  7.639   1.00 32.28 ? 9    ASP B O     1 
ATOM   5691 C  CB    . ASP D 4 9   ? 44.898 81.108  8.519   1.00 34.11 ? 9    ASP B CB    1 
ATOM   5692 C  CG    . ASP D 4 9   ? 45.761 80.147  9.320   1.00 35.45 ? 9    ASP B CG    1 
ATOM   5693 O  OD1   . ASP D 4 9   ? 45.516 78.928  9.234   1.00 37.66 ? 9    ASP B OD1   1 
ATOM   5694 O  OD2   . ASP D 4 9   ? 46.690 80.608  10.019  1.00 39.45 ? 9    ASP B OD2   1 
ATOM   5695 N  N     . ASP D 4 10  ? 43.178 83.567  7.709   1.00 34.56 ? 10   ASP B N     1 
ATOM   5696 C  CA    . ASP D 4 10  ? 42.695 84.488  6.679   1.00 34.07 ? 10   ASP B CA    1 
ATOM   5697 C  C     . ASP D 4 10  ? 42.780 85.969  7.046   1.00 33.60 ? 10   ASP B C     1 
ATOM   5698 O  O     . ASP D 4 10  ? 42.988 86.811  6.173   1.00 33.29 ? 10   ASP B O     1 
ATOM   5699 C  CB    . ASP D 4 10  ? 41.248 84.145  6.303   1.00 36.79 ? 10   ASP B CB    1 
ATOM   5700 C  CG    . ASP D 4 10  ? 41.152 83.041  5.254   1.00 39.85 ? 10   ASP B CG    1 
ATOM   5701 O  OD1   . ASP D 4 10  ? 41.746 81.964  5.445   1.00 38.60 ? 10   ASP B OD1   1 
ATOM   5702 O  OD2   . ASP D 4 10  ? 40.467 83.253  4.232   1.00 45.53 ? 10   ASP B OD2   1 
ATOM   5703 N  N     . SER D 4 11  ? 42.626 86.287  8.330   1.00 33.29 ? 11   SER B N     1 
ATOM   5704 C  CA    . SER D 4 11  ? 42.662 87.677  8.776   1.00 32.67 ? 11   SER B CA    1 
ATOM   5705 C  C     . SER D 4 11  ? 44.031 88.157  9.247   1.00 34.28 ? 11   SER B C     1 
ATOM   5706 O  O     . SER D 4 11  ? 44.241 89.356  9.417   1.00 34.06 ? 11   SER B O     1 
ATOM   5707 C  CB    . SER D 4 11  ? 41.662 87.892  9.915   1.00 32.15 ? 11   SER B CB    1 
ATOM   5708 O  OG    . SER D 4 11  ? 42.153 87.371  11.146  1.00 34.25 ? 11   SER B OG    1 
ATOM   5709 N  N     . PHE D 4 12  ? 44.956 87.226  9.458   1.00 35.74 ? 12   PHE B N     1 
ATOM   5710 C  CA    . PHE D 4 12  ? 46.288 87.569  9.948   1.00 36.90 ? 12   PHE B CA    1 
ATOM   5711 C  C     . PHE D 4 12  ? 46.990 88.671  9.165   1.00 37.27 ? 12   PHE B C     1 
ATOM   5712 O  O     . PHE D 4 12  ? 47.408 89.671  9.743   1.00 37.37 ? 12   PHE B O     1 
ATOM   5713 C  CB    . PHE D 4 12  ? 47.173 86.319  9.987   1.00 37.65 ? 12   PHE B CB    1 
ATOM   5714 C  CG    . PHE D 4 12  ? 48.476 86.520  10.712  1.00 36.69 ? 12   PHE B CG    1 
ATOM   5715 C  CD1   . PHE D 4 12  ? 49.599 86.995  10.038  1.00 36.02 ? 12   PHE B CD1   1 
ATOM   5716 C  CD2   . PHE D 4 12  ? 48.574 86.245  12.071  1.00 36.61 ? 12   PHE B CD2   1 
ATOM   5717 C  CE1   . PHE D 4 12  ? 50.799 87.192  10.708  1.00 37.33 ? 12   PHE B CE1   1 
ATOM   5718 C  CE2   . PHE D 4 12  ? 49.771 86.439  12.755  1.00 37.79 ? 12   PHE B CE2   1 
ATOM   5719 C  CZ    . PHE D 4 12  ? 50.887 86.914  12.073  1.00 36.84 ? 12   PHE B CZ    1 
ATOM   5720 N  N     . ASP D 4 13  ? 47.110 88.501  7.856   1.00 38.41 ? 13   ASP B N     1 
ATOM   5721 C  CA    . ASP D 4 13  ? 47.788 89.495  7.029   1.00 39.65 ? 13   ASP B CA    1 
ATOM   5722 C  C     . ASP D 4 13  ? 47.280 90.912  7.277   1.00 39.69 ? 13   ASP B C     1 
ATOM   5723 O  O     . ASP D 4 13  ? 48.069 91.835  7.496   1.00 39.56 ? 13   ASP B O     1 
ATOM   5724 C  CB    . ASP D 4 13  ? 47.629 89.147  5.547   1.00 42.53 ? 13   ASP B CB    1 
ATOM   5725 C  CG    . ASP D 4 13  ? 48.554 89.959  4.652   1.00 46.14 ? 13   ASP B CG    1 
ATOM   5726 O  OD1   . ASP D 4 13  ? 48.583 91.203  4.781   1.00 47.48 ? 13   ASP B OD1   1 
ATOM   5727 O  OD2   . ASP D 4 13  ? 49.250 89.352  3.811   1.00 49.90 ? 13   ASP B OD2   1 
ATOM   5728 N  N     . THR D 4 14  ? 45.960 91.075  7.264   1.00 40.24 ? 14   THR B N     1 
ATOM   5729 C  CA    . THR D 4 14  ? 45.341 92.381  7.456   1.00 40.96 ? 14   THR B CA    1 
ATOM   5730 C  C     . THR D 4 14  ? 45.361 92.882  8.903   1.00 41.10 ? 14   THR B C     1 
ATOM   5731 O  O     . THR D 4 14  ? 45.716 94.034  9.159   1.00 41.58 ? 14   THR B O     1 
ATOM   5732 C  CB    . THR D 4 14  ? 43.868 92.374  6.927   1.00 41.96 ? 14   THR B CB    1 
ATOM   5733 O  OG1   . THR D 4 14  ? 43.372 93.714  6.857   1.00 44.00 ? 14   THR B OG1   1 
ATOM   5734 C  CG2   . THR D 4 14  ? 42.959 91.574  7.854   1.00 43.32 ? 14   THR B CG2   1 
ATOM   5735 N  N     . ASP D 4 15  ? 44.990 92.024  9.848   1.00 41.24 ? 15   ASP B N     1 
ATOM   5736 C  CA    . ASP D 4 15  ? 44.958 92.415  11.255  1.00 40.93 ? 15   ASP B CA    1 
ATOM   5737 C  C     . ASP D 4 15  ? 46.331 92.644  11.889  1.00 40.87 ? 15   ASP B C     1 
ATOM   5738 O  O     . ASP D 4 15  ? 46.451 93.402  12.852  1.00 40.59 ? 15   ASP B O     1 
ATOM   5739 C  CB    . ASP D 4 15  ? 44.201 91.370  12.086  1.00 41.03 ? 15   ASP B CB    1 
ATOM   5740 C  CG    . ASP D 4 15  ? 42.702 91.401  11.849  1.00 42.96 ? 15   ASP B CG    1 
ATOM   5741 O  OD1   . ASP D 4 15  ? 42.198 92.445  11.384  1.00 43.85 ? 15   ASP B OD1   1 
ATOM   5742 O  OD2   . ASP D 4 15  ? 42.021 90.392  12.147  1.00 41.29 ? 15   ASP B OD2   1 
ATOM   5743 N  N     . VAL D 4 16  ? 47.365 92.003  11.352  1.00 41.19 ? 16   VAL B N     1 
ATOM   5744 C  CA    . VAL D 4 16  ? 48.705 92.130  11.922  1.00 41.37 ? 16   VAL B CA    1 
ATOM   5745 C  C     . VAL D 4 16  ? 49.720 92.842  11.028  1.00 42.67 ? 16   VAL B C     1 
ATOM   5746 O  O     . VAL D 4 16  ? 50.214 93.918  11.364  1.00 44.06 ? 16   VAL B O     1 
ATOM   5747 C  CB    . VAL D 4 16  ? 49.276 90.735  12.283  1.00 40.28 ? 16   VAL B CB    1 
ATOM   5748 C  CG1   . VAL D 4 16  ? 50.602 90.880  13.010  1.00 40.85 ? 16   VAL B CG1   1 
ATOM   5749 C  CG2   . VAL D 4 16  ? 48.283 89.973  13.139  1.00 38.44 ? 16   VAL B CG2   1 
ATOM   5750 N  N     . LEU D 4 17  ? 50.029 92.231  9.892   1.00 43.43 ? 17   LEU B N     1 
ATOM   5751 C  CA    . LEU D 4 17  ? 51.005 92.775  8.957   1.00 45.39 ? 17   LEU B CA    1 
ATOM   5752 C  C     . LEU D 4 17  ? 50.641 94.097  8.279   1.00 47.82 ? 17   LEU B C     1 
ATOM   5753 O  O     . LEU D 4 17  ? 51.463 94.666  7.563   1.00 48.86 ? 17   LEU B O     1 
ATOM   5754 C  CB    . LEU D 4 17  ? 51.313 91.727  7.885   1.00 45.16 ? 17   LEU B CB    1 
ATOM   5755 C  CG    . LEU D 4 17  ? 51.710 90.360  8.446   1.00 45.10 ? 17   LEU B CG    1 
ATOM   5756 C  CD1   . LEU D 4 17  ? 51.992 89.395  7.303   1.00 44.04 ? 17   LEU B CD1   1 
ATOM   5757 C  CD2   . LEU D 4 17  ? 52.932 90.520  9.354   1.00 43.46 ? 17   LEU B CD2   1 
ATOM   5758 N  N     . LYS D 4 18  ? 49.425 94.588  8.486   1.00 48.98 ? 18   LYS B N     1 
ATOM   5759 C  CA    . LYS D 4 18  ? 49.033 95.847  7.866   1.00 52.13 ? 18   LYS B CA    1 
ATOM   5760 C  C     . LYS D 4 18  ? 48.459 96.822  8.878   1.00 53.00 ? 18   LYS B C     1 
ATOM   5761 O  O     . LYS D 4 18  ? 48.154 97.966  8.543   1.00 53.73 ? 18   LYS B O     1 
ATOM   5762 C  CB    . LYS D 4 18  ? 48.014 95.606  6.747   1.00 53.05 ? 18   LYS B CB    1 
ATOM   5763 C  CG    . LYS D 4 18  ? 48.585 94.900  5.529   1.00 54.90 ? 18   LYS B CG    1 
ATOM   5764 C  CD    . LYS D 4 18  ? 47.527 94.726  4.447   1.00 57.41 ? 18   LYS B CD    1 
ATOM   5765 C  CE    . LYS D 4 18  ? 48.053 93.903  3.277   1.00 58.55 ? 18   LYS B CE    1 
ATOM   5766 N  NZ    . LYS D 4 18  ? 46.997 93.647  2.247   1.00 58.65 ? 18   LYS B NZ    1 
ATOM   5767 N  N     . ALA D 4 19  ? 48.318 96.370  10.118  1.00 54.54 ? 19   ALA B N     1 
ATOM   5768 C  CA    . ALA D 4 19  ? 47.780 97.217  11.173  1.00 55.61 ? 19   ALA B CA    1 
ATOM   5769 C  C     . ALA D 4 19  ? 48.758 98.337  11.503  1.00 56.82 ? 19   ALA B C     1 
ATOM   5770 O  O     . ALA D 4 19  ? 49.962 98.217  11.264  1.00 56.87 ? 19   ALA B O     1 
ATOM   5771 C  CB    . ALA D 4 19  ? 47.496 96.388  12.416  1.00 55.31 ? 19   ALA B CB    1 
ATOM   5772 N  N     . ASP D 4 20  ? 48.230 99.431  12.044  1.00 58.25 ? 20   ASP B N     1 
ATOM   5773 C  CA    . ASP D 4 20  ? 49.058 100.572 12.413  1.00 58.73 ? 20   ASP B CA    1 
ATOM   5774 C  C     . ASP D 4 20  ? 49.452 100.437 13.877  1.00 59.27 ? 20   ASP B C     1 
ATOM   5775 O  O     . ASP D 4 20  ? 48.601 100.206 14.737  1.00 60.11 ? 20   ASP B O     1 
ATOM   5776 C  CB    . ASP D 4 20  ? 48.289 101.879 12.196  1.00 58.49 ? 20   ASP B CB    1 
ATOM   5777 N  N     . GLY D 4 21  ? 50.745 100.567 14.156  1.00 58.85 ? 21   GLY B N     1 
ATOM   5778 C  CA    . GLY D 4 21  ? 51.210 100.451 15.525  1.00 57.88 ? 21   GLY B CA    1 
ATOM   5779 C  C     . GLY D 4 21  ? 51.767 99.078  15.862  1.00 57.18 ? 21   GLY B C     1 
ATOM   5780 O  O     . GLY D 4 21  ? 51.913 98.216  14.990  1.00 57.48 ? 21   GLY B O     1 
ATOM   5781 N  N     . ALA D 4 22  ? 52.078 98.878  17.139  1.00 55.31 ? 22   ALA B N     1 
ATOM   5782 C  CA    . ALA D 4 22  ? 52.628 97.617  17.616  1.00 52.93 ? 22   ALA B CA    1 
ATOM   5783 C  C     . ALA D 4 22  ? 51.534 96.594  17.923  1.00 50.75 ? 22   ALA B C     1 
ATOM   5784 O  O     . ALA D 4 22  ? 50.480 96.937  18.457  1.00 51.13 ? 22   ALA B O     1 
ATOM   5785 C  CB    . ALA D 4 22  ? 53.473 97.864  18.862  1.00 52.87 ? 22   ALA B CB    1 
ATOM   5786 N  N     . ILE D 4 23  ? 51.796 95.335  17.583  1.00 49.04 ? 23   ILE B N     1 
ATOM   5787 C  CA    . ILE D 4 23  ? 50.841 94.256  17.826  1.00 46.66 ? 23   ILE B CA    1 
ATOM   5788 C  C     . ILE D 4 23  ? 51.550 93.055  18.441  1.00 43.91 ? 23   ILE B C     1 
ATOM   5789 O  O     . ILE D 4 23  ? 52.513 92.541  17.873  1.00 42.23 ? 23   ILE B O     1 
ATOM   5790 C  CB    . ILE D 4 23  ? 50.185 93.772  16.516  1.00 47.20 ? 23   ILE B CB    1 
ATOM   5791 C  CG1   . ILE D 4 23  ? 49.740 94.964  15.676  1.00 48.43 ? 23   ILE B CG1   1 
ATOM   5792 C  CG2   . ILE D 4 23  ? 48.988 92.878  16.836  1.00 45.00 ? 23   ILE B CG2   1 
ATOM   5793 C  CD1   . ILE D 4 23  ? 49.303 94.577  14.294  1.00 50.86 ? 23   ILE B CD1   1 
ATOM   5794 N  N     . LEU D 4 24  ? 51.078 92.608  19.598  1.00 42.70 ? 24   LEU B N     1 
ATOM   5795 C  CA    . LEU D 4 24  ? 51.675 91.444  20.244  1.00 41.21 ? 24   LEU B CA    1 
ATOM   5796 C  C     . LEU D 4 24  ? 50.824 90.227  19.925  1.00 39.91 ? 24   LEU B C     1 
ATOM   5797 O  O     . LEU D 4 24  ? 49.693 90.114  20.395  1.00 40.62 ? 24   LEU B O     1 
ATOM   5798 C  CB    . LEU D 4 24  ? 51.738 91.620  21.760  1.00 42.52 ? 24   LEU B CB    1 
ATOM   5799 C  CG    . LEU D 4 24  ? 52.314 90.406  22.501  1.00 41.69 ? 24   LEU B CG    1 
ATOM   5800 C  CD1   . LEU D 4 24  ? 53.799 90.287  22.214  1.00 39.91 ? 24   LEU B CD1   1 
ATOM   5801 C  CD2   . LEU D 4 24  ? 52.073 90.545  23.991  1.00 42.87 ? 24   LEU B CD2   1 
ATOM   5802 N  N     . VAL D 4 25  ? 51.366 89.321  19.122  1.00 37.78 ? 25   VAL B N     1 
ATOM   5803 C  CA    . VAL D 4 25  ? 50.641 88.114  18.753  1.00 36.82 ? 25   VAL B CA    1 
ATOM   5804 C  C     . VAL D 4 25  ? 51.043 86.942  19.634  1.00 36.79 ? 25   VAL B C     1 
ATOM   5805 O  O     . VAL D 4 25  ? 52.228 86.697  19.856  1.00 37.88 ? 25   VAL B O     1 
ATOM   5806 C  CB    . VAL D 4 25  ? 50.916 87.714  17.290  1.00 36.80 ? 25   VAL B CB    1 
ATOM   5807 C  CG1   . VAL D 4 25  ? 50.154 86.433  16.948  1.00 35.94 ? 25   VAL B CG1   1 
ATOM   5808 C  CG2   . VAL D 4 25  ? 50.527 88.847  16.361  1.00 35.64 ? 25   VAL B CG2   1 
ATOM   5809 N  N     . ASP D 4 26  ? 50.045 86.224  20.136  1.00 35.62 ? 26   ASP B N     1 
ATOM   5810 C  CA    . ASP D 4 26  ? 50.287 85.054  20.967  1.00 34.22 ? 26   ASP B CA    1 
ATOM   5811 C  C     . ASP D 4 26  ? 49.835 83.769  20.267  1.00 33.87 ? 26   ASP B C     1 
ATOM   5812 O  O     . ASP D 4 26  ? 48.644 83.547  20.050  1.00 33.39 ? 26   ASP B O     1 
ATOM   5813 C  CB    . ASP D 4 26  ? 49.563 85.199  22.306  1.00 33.24 ? 26   ASP B CB    1 
ATOM   5814 C  CG    . ASP D 4 26  ? 49.510 83.902  23.075  1.00 33.88 ? 26   ASP B CG    1 
ATOM   5815 O  OD1   . ASP D 4 26  ? 50.502 83.152  23.019  1.00 36.25 ? 26   ASP B OD1   1 
ATOM   5816 O  OD2   . ASP D 4 26  ? 48.487 83.631  23.745  1.00 32.72 ? 26   ASP B OD2   1 
ATOM   5817 N  N     . PHE D 4 27  ? 50.802 82.940  19.893  1.00 33.61 ? 27   PHE B N     1 
ATOM   5818 C  CA    . PHE D 4 27  ? 50.532 81.662  19.251  1.00 34.18 ? 27   PHE B CA    1 
ATOM   5819 C  C     . PHE D 4 27  ? 50.394 80.652  20.379  1.00 34.13 ? 27   PHE B C     1 
ATOM   5820 O  O     . PHE D 4 27  ? 51.329 80.448  21.160  1.00 35.20 ? 27   PHE B O     1 
ATOM   5821 C  CB    . PHE D 4 27  ? 51.691 81.274  18.335  1.00 35.54 ? 27   PHE B CB    1 
ATOM   5822 C  CG    . PHE D 4 27  ? 51.879 82.204  17.174  1.00 37.20 ? 27   PHE B CG    1 
ATOM   5823 C  CD1   . PHE D 4 27  ? 52.614 83.378  17.315  1.00 37.61 ? 27   PHE B CD1   1 
ATOM   5824 C  CD2   . PHE D 4 27  ? 51.305 81.913  15.936  1.00 38.84 ? 27   PHE B CD2   1 
ATOM   5825 C  CE1   . PHE D 4 27  ? 52.778 84.253  16.238  1.00 40.17 ? 27   PHE B CE1   1 
ATOM   5826 C  CE2   . PHE D 4 27  ? 51.461 82.780  14.850  1.00 39.51 ? 27   PHE B CE2   1 
ATOM   5827 C  CZ    . PHE D 4 27  ? 52.200 83.953  15.002  1.00 40.31 ? 27   PHE B CZ    1 
ATOM   5828 N  N     . TRP D 4 28  ? 49.233 80.019  20.468  1.00 33.72 ? 28   TRP B N     1 
ATOM   5829 C  CA    . TRP D 4 28  ? 48.976 79.078  21.547  1.00 32.61 ? 28   TRP B CA    1 
ATOM   5830 C  C     . TRP D 4 28  ? 48.163 77.858  21.132  1.00 32.75 ? 28   TRP B C     1 
ATOM   5831 O  O     . TRP D 4 28  ? 47.671 77.768  20.008  1.00 30.60 ? 28   TRP B O     1 
ATOM   5832 C  CB    . TRP D 4 28  ? 48.220 79.797  22.667  1.00 32.39 ? 28   TRP B CB    1 
ATOM   5833 C  CG    . TRP D 4 28  ? 46.855 80.234  22.232  1.00 30.67 ? 28   TRP B CG    1 
ATOM   5834 C  CD1   . TRP D 4 28  ? 46.557 81.207  21.315  1.00 30.35 ? 28   TRP B CD1   1 
ATOM   5835 C  CD2   . TRP D 4 28  ? 45.601 79.663  22.631  1.00 29.43 ? 28   TRP B CD2   1 
ATOM   5836 N  NE1   . TRP D 4 28  ? 45.197 81.272  21.115  1.00 27.73 ? 28   TRP B NE1   1 
ATOM   5837 C  CE2   . TRP D 4 28  ? 44.585 80.339  21.911  1.00 29.11 ? 28   TRP B CE2   1 
ATOM   5838 C  CE3   . TRP D 4 28  ? 45.236 78.645  23.524  1.00 29.42 ? 28   TRP B CE3   1 
ATOM   5839 C  CZ2   . TRP D 4 28  ? 43.225 80.030  22.059  1.00 29.41 ? 28   TRP B CZ2   1 
ATOM   5840 C  CZ3   . TRP D 4 28  ? 43.888 78.337  23.674  1.00 28.94 ? 28   TRP B CZ3   1 
ATOM   5841 C  CH2   . TRP D 4 28  ? 42.895 79.029  22.944  1.00 29.80 ? 28   TRP B CH2   1 
ATOM   5842 N  N     . ALA D 4 29  ? 48.017 76.930  22.072  1.00 34.29 ? 29   ALA B N     1 
ATOM   5843 C  CA    . ALA D 4 29  ? 47.249 75.710  21.856  1.00 35.48 ? 29   ALA B CA    1 
ATOM   5844 C  C     . ALA D 4 29  ? 46.487 75.412  23.137  1.00 37.43 ? 29   ALA B C     1 
ATOM   5845 O  O     . ALA D 4 29  ? 46.958 75.708  24.232  1.00 38.00 ? 29   ALA B O     1 
ATOM   5846 C  CB    . ALA D 4 29  ? 48.175 74.547  21.504  1.00 35.36 ? 29   ALA B CB    1 
ATOM   5847 N  N     . GLU D 4 30  ? 45.302 74.839  22.989  1.00 39.50 ? 30   GLU B N     1 
ATOM   5848 C  CA    . GLU D 4 30  ? 44.446 74.505  24.118  1.00 42.38 ? 30   GLU B CA    1 
ATOM   5849 C  C     . GLU D 4 30  ? 45.118 73.507  25.067  1.00 42.81 ? 30   GLU B C     1 
ATOM   5850 O  O     . GLU D 4 30  ? 44.950 73.589  26.285  1.00 44.54 ? 30   GLU B O     1 
ATOM   5851 C  CB    . GLU D 4 30  ? 43.123 73.935  23.582  1.00 45.35 ? 30   GLU B CB    1 
ATOM   5852 C  CG    . GLU D 4 30  ? 42.115 73.470  24.629  1.00 50.49 ? 30   GLU B CG    1 
ATOM   5853 C  CD    . GLU D 4 30  ? 41.469 74.614  25.393  1.00 53.16 ? 30   GLU B CD    1 
ATOM   5854 O  OE1   . GLU D 4 30  ? 40.923 75.539  24.747  1.00 53.91 ? 30   GLU B OE1   1 
ATOM   5855 O  OE2   . GLU D 4 30  ? 41.498 74.582  26.641  1.00 55.46 ? 30   GLU B OE2   1 
ATOM   5856 N  N     . TRP D 4 31  ? 45.897 72.586  24.506  1.00 41.91 ? 31   TRP B N     1 
ATOM   5857 C  CA    . TRP D 4 31  ? 46.578 71.547  25.282  1.00 41.31 ? 31   TRP B CA    1 
ATOM   5858 C  C     . TRP D 4 31  ? 47.924 71.909  25.909  1.00 41.51 ? 31   TRP B C     1 
ATOM   5859 O  O     . TRP D 4 31  ? 48.623 71.034  26.415  1.00 42.05 ? 31   TRP B O     1 
ATOM   5860 C  CB    . TRP D 4 31  ? 46.770 70.300  24.413  1.00 39.82 ? 31   TRP B CB    1 
ATOM   5861 C  CG    . TRP D 4 31  ? 47.147 70.598  22.981  1.00 38.44 ? 31   TRP B CG    1 
ATOM   5862 C  CD1   . TRP D 4 31  ? 46.303 70.639  21.906  1.00 37.94 ? 31   TRP B CD1   1 
ATOM   5863 C  CD2   . TRP D 4 31  ? 48.457 70.902  22.472  1.00 37.09 ? 31   TRP B CD2   1 
ATOM   5864 N  NE1   . TRP D 4 31  ? 47.005 70.946  20.763  1.00 37.26 ? 31   TRP B NE1   1 
ATOM   5865 C  CE2   . TRP D 4 31  ? 48.326 71.113  21.081  1.00 36.17 ? 31   TRP B CE2   1 
ATOM   5866 C  CE3   . TRP D 4 31  ? 49.727 71.016  23.058  1.00 36.45 ? 31   TRP B CE3   1 
ATOM   5867 C  CZ2   . TRP D 4 31  ? 49.416 71.431  20.264  1.00 35.18 ? 31   TRP B CZ2   1 
ATOM   5868 C  CZ3   . TRP D 4 31  ? 50.815 71.333  22.242  1.00 34.42 ? 31   TRP B CZ3   1 
ATOM   5869 C  CH2   . TRP D 4 31  ? 50.648 71.537  20.859  1.00 36.42 ? 31   TRP B CH2   1 
ATOM   5870 N  N     . CYS D 4 32  ? 48.289 73.185  25.890  1.00 41.64 ? 32   CYS B N     1 
ATOM   5871 C  CA    . CYS D 4 32  ? 49.570 73.607  26.451  1.00 41.60 ? 32   CYS B CA    1 
ATOM   5872 C  C     . CYS D 4 32  ? 49.405 74.247  27.826  1.00 42.12 ? 32   CYS B C     1 
ATOM   5873 O  O     . CYS D 4 32  ? 48.745 75.282  27.966  1.00 40.72 ? 32   CYS B O     1 
ATOM   5874 C  CB    . CYS D 4 32  ? 50.259 74.589  25.497  1.00 41.13 ? 32   CYS B CB    1 
ATOM   5875 S  SG    . CYS D 4 32  ? 51.769 75.372  26.131  1.00 39.19 ? 32   CYS B SG    1 
ATOM   5876 N  N     . GLY D 4 33  ? 50.004 73.613  28.835  1.00 42.44 ? 33   GLY B N     1 
ATOM   5877 C  CA    . GLY D 4 33  ? 49.930 74.123  30.193  1.00 42.41 ? 33   GLY B CA    1 
ATOM   5878 C  C     . GLY D 4 33  ? 50.451 75.547  30.267  1.00 41.90 ? 33   GLY B C     1 
ATOM   5879 O  O     . GLY D 4 33  ? 49.790 76.423  30.827  1.00 44.14 ? 33   GLY B O     1 
ATOM   5880 N  N     . PRO D 4 34  ? 51.645 75.807  29.718  1.00 40.58 ? 34   PRO B N     1 
ATOM   5881 C  CA    . PRO D 4 34  ? 52.233 77.148  29.730  1.00 40.66 ? 34   PRO B CA    1 
ATOM   5882 C  C     . PRO D 4 34  ? 51.338 78.189  29.046  1.00 41.67 ? 34   PRO B C     1 
ATOM   5883 O  O     . PRO D 4 34  ? 51.306 79.354  29.451  1.00 43.35 ? 34   PRO B O     1 
ATOM   5884 C  CB    . PRO D 4 34  ? 53.553 76.944  28.999  1.00 39.90 ? 34   PRO B CB    1 
ATOM   5885 C  CG    . PRO D 4 34  ? 53.932 75.553  29.402  1.00 38.56 ? 34   PRO B CG    1 
ATOM   5886 C  CD    . PRO D 4 34  ? 52.627 74.811  29.250  1.00 39.67 ? 34   PRO B CD    1 
ATOM   5887 N  N     . CYS D 4 35  ? 50.617 77.767  28.010  1.00 41.00 ? 35   CYS B N     1 
ATOM   5888 C  CA    . CYS D 4 35  ? 49.723 78.670  27.292  1.00 40.15 ? 35   CYS B CA    1 
ATOM   5889 C  C     . CYS D 4 35  ? 48.574 79.108  28.192  1.00 40.63 ? 35   CYS B C     1 
ATOM   5890 O  O     . CYS D 4 35  ? 48.213 80.286  28.220  1.00 40.93 ? 35   CYS B O     1 
ATOM   5891 C  CB    . CYS D 4 35  ? 49.162 77.994  26.033  1.00 38.13 ? 35   CYS B CB    1 
ATOM   5892 S  SG    . CYS D 4 35  ? 50.316 77.933  24.644  1.00 39.13 ? 35   CYS B SG    1 
ATOM   5893 N  N     . LYS D 4 36  ? 48.006 78.154  28.926  1.00 40.90 ? 36   LYS B N     1 
ATOM   5894 C  CA    . LYS D 4 36  ? 46.898 78.442  29.826  1.00 42.57 ? 36   LYS B CA    1 
ATOM   5895 C  C     . LYS D 4 36  ? 47.342 79.347  30.976  1.00 43.10 ? 36   LYS B C     1 
ATOM   5896 O  O     . LYS D 4 36  ? 46.537 80.093  31.534  1.00 43.82 ? 36   LYS B O     1 
ATOM   5897 C  CB    . LYS D 4 36  ? 46.313 77.137  30.375  1.00 43.10 ? 36   LYS B CB    1 
ATOM   5898 C  CG    . LYS D 4 36  ? 45.195 77.337  31.383  1.00 45.42 ? 36   LYS B CG    1 
ATOM   5899 N  N     . MET D 4 37  ? 48.624 79.281  31.322  1.00 43.11 ? 37   MET B N     1 
ATOM   5900 C  CA    . MET D 4 37  ? 49.174 80.108  32.393  1.00 43.84 ? 37   MET B CA    1 
ATOM   5901 C  C     . MET D 4 37  ? 49.210 81.579  32.002  1.00 43.73 ? 37   MET B C     1 
ATOM   5902 O  O     . MET D 4 37  ? 48.770 82.449  32.754  1.00 43.15 ? 37   MET B O     1 
ATOM   5903 C  CB    . MET D 4 37  ? 50.603 79.669  32.735  1.00 44.38 ? 37   MET B CB    1 
ATOM   5904 C  CG    . MET D 4 37  ? 50.714 78.482  33.677  1.00 44.58 ? 37   MET B CG    1 
ATOM   5905 S  SD    . MET D 4 37  ? 52.434 77.923  33.823  1.00 47.77 ? 37   MET B SD    1 
ATOM   5906 C  CE    . MET D 4 37  ? 53.190 79.310  34.698  1.00 43.73 ? 37   MET B CE    1 
ATOM   5907 N  N     . ILE D 4 38  ? 49.744 81.854  30.817  1.00 43.46 ? 38   ILE B N     1 
ATOM   5908 C  CA    . ILE D 4 38  ? 49.872 83.226  30.353  1.00 44.35 ? 38   ILE B CA    1 
ATOM   5909 C  C     . ILE D 4 38  ? 48.576 83.870  29.845  1.00 44.19 ? 38   ILE B C     1 
ATOM   5910 O  O     . ILE D 4 38  ? 48.468 85.097  29.806  1.00 44.42 ? 38   ILE B O     1 
ATOM   5911 C  CB    . ILE D 4 38  ? 50.957 83.319  29.262  1.00 43.50 ? 38   ILE B CB    1 
ATOM   5912 C  CG1   . ILE D 4 38  ? 51.368 84.779  29.068  1.00 43.77 ? 38   ILE B CG1   1 
ATOM   5913 C  CG2   . ILE D 4 38  ? 50.441 82.718  27.955  1.00 44.40 ? 38   ILE B CG2   1 
ATOM   5914 C  CD1   . ILE D 4 38  ? 52.599 84.955  28.196  1.00 44.26 ? 38   ILE B CD1   1 
ATOM   5915 N  N     . ALA D 4 39  ? 47.595 83.052  29.479  1.00 43.57 ? 39   ALA B N     1 
ATOM   5916 C  CA    . ALA D 4 39  ? 46.321 83.560  28.965  1.00 44.44 ? 39   ALA B CA    1 
ATOM   5917 C  C     . ALA D 4 39  ? 45.713 84.667  29.835  1.00 45.50 ? 39   ALA B C     1 
ATOM   5918 O  O     . ALA D 4 39  ? 45.465 85.775  29.354  1.00 45.07 ? 39   ALA B O     1 
ATOM   5919 C  CB    . ALA D 4 39  ? 45.319 82.404  28.792  1.00 42.31 ? 39   ALA B CB    1 
ATOM   5920 N  N     . PRO D 4 40  ? 45.455 84.385  31.125  1.00 46.12 ? 40   PRO B N     1 
ATOM   5921 C  CA    . PRO D 4 40  ? 44.875 85.447  31.954  1.00 46.69 ? 40   PRO B CA    1 
ATOM   5922 C  C     . PRO D 4 40  ? 45.807 86.653  32.092  1.00 46.01 ? 40   PRO B C     1 
ATOM   5923 O  O     . PRO D 4 40  ? 45.358 87.771  32.344  1.00 46.60 ? 40   PRO B O     1 
ATOM   5924 C  CB    . PRO D 4 40  ? 44.589 84.739  33.282  1.00 46.69 ? 40   PRO B CB    1 
ATOM   5925 C  CG    . PRO D 4 40  ? 45.605 83.638  33.313  1.00 47.82 ? 40   PRO B CG    1 
ATOM   5926 C  CD    . PRO D 4 40  ? 45.603 83.136  31.891  1.00 46.33 ? 40   PRO B CD    1 
ATOM   5927 N  N     . ILE D 4 41  ? 47.103 86.428  31.915  1.00 45.70 ? 41   ILE B N     1 
ATOM   5928 C  CA    . ILE D 4 41  ? 48.064 87.522  31.998  1.00 45.60 ? 41   ILE B CA    1 
ATOM   5929 C  C     . ILE D 4 41  ? 47.882 88.415  30.773  1.00 45.68 ? 41   ILE B C     1 
ATOM   5930 O  O     . ILE D 4 41  ? 47.968 89.643  30.858  1.00 45.86 ? 41   ILE B O     1 
ATOM   5931 C  CB    . ILE D 4 41  ? 49.516 87.004  32.019  1.00 44.97 ? 41   ILE B CB    1 
ATOM   5932 C  CG1   . ILE D 4 41  ? 49.760 86.177  33.283  1.00 46.55 ? 41   ILE B CG1   1 
ATOM   5933 C  CG2   . ILE D 4 41  ? 50.488 88.171  31.944  1.00 44.54 ? 41   ILE B CG2   1 
ATOM   5934 C  CD1   . ILE D 4 41  ? 49.536 86.937  34.574  1.00 47.40 ? 41   ILE B CD1   1 
ATOM   5935 N  N     . LEU D 4 42  ? 47.626 87.790  29.628  1.00 45.71 ? 42   LEU B N     1 
ATOM   5936 C  CA    . LEU D 4 42  ? 47.429 88.536  28.397  1.00 45.86 ? 42   LEU B CA    1 
ATOM   5937 C  C     . LEU D 4 42  ? 46.173 89.401  28.484  1.00 46.16 ? 42   LEU B C     1 
ATOM   5938 O  O     . LEU D 4 42  ? 46.152 90.514  27.963  1.00 45.15 ? 42   LEU B O     1 
ATOM   5939 C  CB    . LEU D 4 42  ? 47.349 87.575  27.203  1.00 44.81 ? 42   LEU B CB    1 
ATOM   5940 C  CG    . LEU D 4 42  ? 48.698 87.059  26.682  1.00 43.04 ? 42   LEU B CG    1 
ATOM   5941 C  CD1   . LEU D 4 42  ? 48.489 85.917  25.704  1.00 42.54 ? 42   LEU B CD1   1 
ATOM   5942 C  CD2   . LEU D 4 42  ? 49.445 88.193  26.010  1.00 43.60 ? 42   LEU B CD2   1 
ATOM   5943 N  N     . ASP D 4 43  ? 45.138 88.894  29.152  1.00 47.57 ? 43   ASP B N     1 
ATOM   5944 C  CA    . ASP D 4 43  ? 43.887 89.639  29.306  1.00 49.52 ? 43   ASP B CA    1 
ATOM   5945 C  C     . ASP D 4 43  ? 44.118 90.949  30.050  1.00 50.77 ? 43   ASP B C     1 
ATOM   5946 O  O     . ASP D 4 43  ? 43.498 91.968  29.741  1.00 50.20 ? 43   ASP B O     1 
ATOM   5947 C  CB    . ASP D 4 43  ? 42.843 88.821  30.080  1.00 51.38 ? 43   ASP B CB    1 
ATOM   5948 C  CG    . ASP D 4 43  ? 42.395 87.573  29.336  1.00 52.18 ? 43   ASP B CG    1 
ATOM   5949 O  OD1   . ASP D 4 43  ? 42.223 87.646  28.102  1.00 52.63 ? 43   ASP B OD1   1 
ATOM   5950 O  OD2   . ASP D 4 43  ? 42.200 86.525  29.993  1.00 52.72 ? 43   ASP B OD2   1 
ATOM   5951 N  N     . GLU D 4 44  ? 45.012 90.914  31.033  1.00 51.61 ? 44   GLU B N     1 
ATOM   5952 C  CA    . GLU D 4 44  ? 45.318 92.092  31.832  1.00 52.38 ? 44   GLU B CA    1 
ATOM   5953 C  C     . GLU D 4 44  ? 46.175 93.096  31.069  1.00 52.34 ? 44   GLU B C     1 
ATOM   5954 O  O     . GLU D 4 44  ? 45.917 94.298  31.113  1.00 52.98 ? 44   GLU B O     1 
ATOM   5955 C  CB    . GLU D 4 44  ? 46.025 91.673  33.121  1.00 53.94 ? 44   GLU B CB    1 
ATOM   5956 C  CG    . GLU D 4 44  ? 45.227 90.687  33.958  1.00 56.78 ? 44   GLU B CG    1 
ATOM   5957 C  CD    . GLU D 4 44  ? 45.975 90.230  35.198  1.00 59.97 ? 44   GLU B CD    1 
ATOM   5958 O  OE1   . GLU D 4 44  ? 47.092 89.680  35.058  1.00 60.60 ? 44   GLU B OE1   1 
ATOM   5959 O  OE2   . GLU D 4 44  ? 45.443 90.417  36.314  1.00 60.22 ? 44   GLU B OE2   1 
ATOM   5960 N  N     . ILE D 4 45  ? 47.193 92.607  30.370  1.00 52.30 ? 45   ILE B N     1 
ATOM   5961 C  CA    . ILE D 4 45  ? 48.065 93.484  29.604  1.00 52.15 ? 45   ILE B CA    1 
ATOM   5962 C  C     . ILE D 4 45  ? 47.281 94.220  28.522  1.00 52.92 ? 45   ILE B C     1 
ATOM   5963 O  O     . ILE D 4 45  ? 47.523 95.399  28.263  1.00 53.13 ? 45   ILE B O     1 
ATOM   5964 C  CB    . ILE D 4 45  ? 49.228 92.689  28.960  1.00 52.12 ? 45   ILE B CB    1 
ATOM   5965 C  CG1   . ILE D 4 45  ? 50.381 92.552  29.961  1.00 52.50 ? 45   ILE B CG1   1 
ATOM   5966 C  CG2   . ILE D 4 45  ? 49.721 93.386  27.698  1.00 50.86 ? 45   ILE B CG2   1 
ATOM   5967 C  CD1   . ILE D 4 45  ? 50.002 91.884  31.271  1.00 53.79 ? 45   ILE B CD1   1 
ATOM   5968 N  N     . ALA D 4 46  ? 46.337 93.523  27.895  1.00 53.59 ? 46   ALA B N     1 
ATOM   5969 C  CA    . ALA D 4 46  ? 45.523 94.120  26.843  1.00 54.31 ? 46   ALA B CA    1 
ATOM   5970 C  C     . ALA D 4 46  ? 44.786 95.350  27.359  1.00 54.72 ? 46   ALA B C     1 
ATOM   5971 O  O     . ALA D 4 46  ? 44.683 96.355  26.662  1.00 54.89 ? 46   ALA B O     1 
ATOM   5972 C  CB    . ALA D 4 46  ? 44.526 93.098  26.312  1.00 54.35 ? 46   ALA B CB    1 
ATOM   5973 N  N     . ASP D 4 47  ? 44.282 95.264  28.586  1.00 55.65 ? 47   ASP B N     1 
ATOM   5974 C  CA    . ASP D 4 47  ? 43.548 96.364  29.202  1.00 57.66 ? 47   ASP B CA    1 
ATOM   5975 C  C     . ASP D 4 47  ? 44.420 97.530  29.633  1.00 57.48 ? 47   ASP B C     1 
ATOM   5976 O  O     . ASP D 4 47  ? 44.042 98.686  29.458  1.00 58.65 ? 47   ASP B O     1 
ATOM   5977 C  CB    . ASP D 4 47  ? 42.763 95.864  30.417  1.00 58.72 ? 47   ASP B CB    1 
ATOM   5978 C  CG    . ASP D 4 47  ? 41.387 95.356  30.050  1.00 60.92 ? 47   ASP B CG    1 
ATOM   5979 O  OD1   . ASP D 4 47  ? 40.728 94.739  30.916  1.00 62.94 ? 47   ASP B OD1   1 
ATOM   5980 O  OD2   . ASP D 4 47  ? 40.960 95.582  28.897  1.00 62.40 ? 47   ASP B OD2   1 
ATOM   5981 N  N     . GLU D 4 48  ? 45.583 97.226  30.198  1.00 57.71 ? 48   GLU B N     1 
ATOM   5982 C  CA    . GLU D 4 48  ? 46.496 98.258  30.678  1.00 57.85 ? 48   GLU B CA    1 
ATOM   5983 C  C     . GLU D 4 48  ? 47.254 98.978  29.567  1.00 57.66 ? 48   GLU B C     1 
ATOM   5984 O  O     . GLU D 4 48  ? 47.680 100.118 29.744  1.00 58.34 ? 48   GLU B O     1 
ATOM   5985 C  CB    . GLU D 4 48  ? 47.490 97.648  31.668  1.00 58.71 ? 48   GLU B CB    1 
ATOM   5986 C  CG    . GLU D 4 48  ? 46.825 96.752  32.698  1.00 60.93 ? 48   GLU B CG    1 
ATOM   5987 C  CD    . GLU D 4 48  ? 47.784 96.261  33.761  1.00 62.48 ? 48   GLU B CD    1 
ATOM   5988 O  OE1   . GLU D 4 48  ? 48.920 95.872  33.410  1.00 62.78 ? 48   GLU B OE1   1 
ATOM   5989 O  OE2   . GLU D 4 48  ? 47.395 96.253  34.950  1.00 63.16 ? 48   GLU B OE2   1 
ATOM   5990 N  N     . TYR D 4 49  ? 47.423 98.321  28.423  1.00 55.73 ? 49   TYR B N     1 
ATOM   5991 C  CA    . TYR D 4 49  ? 48.137 98.934  27.313  1.00 54.73 ? 49   TYR B CA    1 
ATOM   5992 C  C     . TYR D 4 49  ? 47.216 99.388  26.196  1.00 54.97 ? 49   TYR B C     1 
ATOM   5993 O  O     . TYR D 4 49  ? 47.675 99.731  25.107  1.00 54.32 ? 49   TYR B O     1 
ATOM   5994 C  CB    . TYR D 4 49  ? 49.187 97.972  26.753  1.00 54.02 ? 49   TYR B CB    1 
ATOM   5995 C  CG    . TYR D 4 49  ? 50.379 97.793  27.661  1.00 53.12 ? 49   TYR B CG    1 
ATOM   5996 C  CD1   . TYR D 4 49  ? 50.240 97.200  28.913  1.00 53.15 ? 49   TYR B CD1   1 
ATOM   5997 C  CD2   . TYR D 4 49  ? 51.643 98.249  27.283  1.00 52.58 ? 49   TYR B CD2   1 
ATOM   5998 C  CE1   . TYR D 4 49  ? 51.325 97.066  29.772  1.00 52.65 ? 49   TYR B CE1   1 
ATOM   5999 C  CE2   . TYR D 4 49  ? 52.738 98.120  28.134  1.00 52.28 ? 49   TYR B CE2   1 
ATOM   6000 C  CZ    . TYR D 4 49  ? 52.569 97.527  29.378  1.00 52.91 ? 49   TYR B CZ    1 
ATOM   6001 O  OH    . TYR D 4 49  ? 53.634 97.402  30.239  1.00 54.33 ? 49   TYR B OH    1 
ATOM   6002 N  N     . GLN D 4 50  ? 45.915 99.393  26.465  1.00 56.13 ? 50   GLN B N     1 
ATOM   6003 C  CA    . GLN D 4 50  ? 44.959 99.819  25.455  1.00 57.49 ? 50   GLN B CA    1 
ATOM   6004 C  C     . GLN D 4 50  ? 45.302 101.233 25.009  1.00 56.80 ? 50   GLN B C     1 
ATOM   6005 O  O     . GLN D 4 50  ? 45.466 102.134 25.831  1.00 56.60 ? 50   GLN B O     1 
ATOM   6006 C  CB    . GLN D 4 50  ? 43.529 99.755  26.002  1.00 58.57 ? 50   GLN B CB    1 
ATOM   6007 C  CG    . GLN D 4 50  ? 43.257 100.631 27.209  1.00 61.72 ? 50   GLN B CG    1 
ATOM   6008 C  CD    . GLN D 4 50  ? 41.842 100.453 27.736  1.00 63.70 ? 50   GLN B CD    1 
ATOM   6009 O  OE1   . GLN D 4 50  ? 41.458 99.360  28.163  1.00 63.77 ? 50   GLN B OE1   1 
ATOM   6010 N  NE2   . GLN D 4 50  ? 41.057 101.526 27.705  1.00 64.70 ? 50   GLN B NE2   1 
ATOM   6011 N  N     . GLY D 4 51  ? 45.427 101.414 23.700  1.00 57.03 ? 51   GLY B N     1 
ATOM   6012 C  CA    . GLY D 4 51  ? 45.764 102.716 23.161  1.00 57.67 ? 51   GLY B CA    1 
ATOM   6013 C  C     . GLY D 4 51  ? 47.245 102.809 22.856  1.00 58.29 ? 51   GLY B C     1 
ATOM   6014 O  O     . GLY D 4 51  ? 47.679 103.673 22.092  1.00 59.11 ? 51   GLY B O     1 
ATOM   6015 N  N     . LYS D 4 52  ? 48.023 101.910 23.452  1.00 58.06 ? 52   LYS B N     1 
ATOM   6016 C  CA    . LYS D 4 52  ? 49.465 101.888 23.247  1.00 58.11 ? 52   LYS B CA    1 
ATOM   6017 C  C     . LYS D 4 52  ? 49.902 100.581 22.583  1.00 58.06 ? 52   LYS B C     1 
ATOM   6018 O  O     . LYS D 4 52  ? 50.923 100.533 21.888  1.00 56.59 ? 52   LYS B O     1 
ATOM   6019 C  CB    . LYS D 4 52  ? 50.181 102.076 24.592  1.00 59.74 ? 52   LYS B CB    1 
ATOM   6020 C  CG    . LYS D 4 52  ? 49.708 103.317 25.357  1.00 61.20 ? 52   LYS B CG    1 
ATOM   6021 C  CD    . LYS D 4 52  ? 50.588 103.670 26.559  1.00 63.08 ? 52   LYS B CD    1 
ATOM   6022 C  CE    . LYS D 4 52  ? 50.478 102.661 27.696  1.00 63.50 ? 52   LYS B CE    1 
ATOM   6023 N  NZ    . LYS D 4 52  ? 51.089 101.347 27.358  1.00 65.19 ? 52   LYS B NZ    1 
ATOM   6024 N  N     . LEU D 4 53  ? 49.115 99.527  22.788  1.00 56.52 ? 53   LEU B N     1 
ATOM   6025 C  CA    . LEU D 4 53  ? 49.419 98.222  22.206  1.00 55.56 ? 53   LEU B CA    1 
ATOM   6026 C  C     . LEU D 4 53  ? 48.172 97.397  21.892  1.00 53.89 ? 53   LEU B C     1 
ATOM   6027 O  O     . LEU D 4 53  ? 47.145 97.514  22.561  1.00 54.24 ? 53   LEU B O     1 
ATOM   6028 C  CB    . LEU D 4 53  ? 50.313 97.419  23.156  1.00 55.45 ? 53   LEU B CB    1 
ATOM   6029 C  CG    . LEU D 4 53  ? 50.648 95.988  22.719  1.00 55.51 ? 53   LEU B CG    1 
ATOM   6030 C  CD1   . LEU D 4 53  ? 51.499 96.023  21.454  1.00 55.07 ? 53   LEU B CD1   1 
ATOM   6031 C  CD2   . LEU D 4 53  ? 51.381 95.265  23.836  1.00 55.74 ? 53   LEU B CD2   1 
ATOM   6032 N  N     . THR D 4 54  ? 48.278 96.560  20.864  1.00 52.33 ? 54   THR B N     1 
ATOM   6033 C  CA    . THR D 4 54  ? 47.187 95.679  20.467  1.00 50.76 ? 54   THR B CA    1 
ATOM   6034 C  C     . THR D 4 54  ? 47.612 94.224  20.697  1.00 49.36 ? 54   THR B C     1 
ATOM   6035 O  O     . THR D 4 54  ? 48.583 93.748  20.104  1.00 47.34 ? 54   THR B O     1 
ATOM   6036 C  CB    . THR D 4 54  ? 46.823 95.854  18.978  1.00 52.03 ? 54   THR B CB    1 
ATOM   6037 O  OG1   . THR D 4 54  ? 46.303 97.175  18.756  1.00 52.76 ? 54   THR B OG1   1 
ATOM   6038 C  CG2   . THR D 4 54  ? 45.776 94.823  18.566  1.00 51.44 ? 54   THR B CG2   1 
ATOM   6039 N  N     . VAL D 4 55  ? 46.884 93.528  21.567  1.00 47.78 ? 55   VAL B N     1 
ATOM   6040 C  CA    . VAL D 4 55  ? 47.177 92.132  21.877  1.00 45.56 ? 55   VAL B CA    1 
ATOM   6041 C  C     . VAL D 4 55  ? 46.291 91.218  21.033  1.00 44.09 ? 55   VAL B C     1 
ATOM   6042 O  O     . VAL D 4 55  ? 45.059 91.329  21.064  1.00 44.17 ? 55   VAL B O     1 
ATOM   6043 C  CB    . VAL D 4 55  ? 46.931 91.825  23.380  1.00 45.37 ? 55   VAL B CB    1 
ATOM   6044 C  CG1   . VAL D 4 55  ? 47.345 90.393  23.702  1.00 43.63 ? 55   VAL B CG1   1 
ATOM   6045 C  CG2   . VAL D 4 55  ? 47.709 92.808  24.243  1.00 45.12 ? 55   VAL B CG2   1 
ATOM   6046 N  N     . ALA D 4 56  ? 46.927 90.317  20.286  1.00 41.96 ? 56   ALA B N     1 
ATOM   6047 C  CA    . ALA D 4 56  ? 46.220 89.375  19.420  1.00 39.21 ? 56   ALA B CA    1 
ATOM   6048 C  C     . ALA D 4 56  ? 46.636 87.930  19.694  1.00 37.94 ? 56   ALA B C     1 
ATOM   6049 O  O     . ALA D 4 56  ? 47.785 87.658  20.050  1.00 38.39 ? 56   ALA B O     1 
ATOM   6050 C  CB    . ALA D 4 56  ? 46.485 89.718  17.965  1.00 37.20 ? 56   ALA B CB    1 
ATOM   6051 N  N     . LYS D 4 57  ? 45.696 87.008  19.516  1.00 35.72 ? 57   LYS B N     1 
ATOM   6052 C  CA    . LYS D 4 57  ? 45.952 85.591  19.739  1.00 35.05 ? 57   LYS B CA    1 
ATOM   6053 C  C     . LYS D 4 57  ? 45.600 84.734  18.521  1.00 35.08 ? 57   LYS B C     1 
ATOM   6054 O  O     . LYS D 4 57  ? 44.595 84.970  17.836  1.00 33.06 ? 57   LYS B O     1 
ATOM   6055 C  CB    . LYS D 4 57  ? 45.149 85.096  20.944  1.00 35.28 ? 57   LYS B CB    1 
ATOM   6056 C  CG    . LYS D 4 57  ? 45.591 85.691  22.279  1.00 36.23 ? 57   LYS B CG    1 
ATOM   6057 C  CD    . LYS D 4 57  ? 44.643 85.308  23.421  1.00 36.68 ? 57   LYS B CD    1 
ATOM   6058 C  CE    . LYS D 4 57  ? 44.715 83.834  23.765  1.00 37.98 ? 57   LYS B CE    1 
ATOM   6059 N  NZ    . LYS D 4 57  ? 43.875 83.516  24.953  1.00 39.43 ? 57   LYS B NZ    1 
ATOM   6060 N  N     . LEU D 4 58  ? 46.436 83.736  18.261  1.00 33.20 ? 58   LEU B N     1 
ATOM   6061 C  CA    . LEU D 4 58  ? 46.210 82.820  17.159  1.00 34.10 ? 58   LEU B CA    1 
ATOM   6062 C  C     . LEU D 4 58  ? 46.364 81.380  17.640  1.00 33.77 ? 58   LEU B C     1 
ATOM   6063 O  O     . LEU D 4 58  ? 47.462 80.944  17.988  1.00 34.33 ? 58   LEU B O     1 
ATOM   6064 C  CB    . LEU D 4 58  ? 47.201 83.071  16.025  1.00 34.91 ? 58   LEU B CB    1 
ATOM   6065 C  CG    . LEU D 4 58  ? 47.004 82.094  14.859  1.00 36.79 ? 58   LEU B CG    1 
ATOM   6066 C  CD1   . LEU D 4 58  ? 45.806 82.544  14.016  1.00 36.86 ? 58   LEU B CD1   1 
ATOM   6067 C  CD2   . LEU D 4 58  ? 48.255 82.038  14.005  1.00 37.26 ? 58   LEU B CD2   1 
ATOM   6068 N  N     . ASN D 4 59  ? 45.262 80.646  17.663  1.00 33.59 ? 59   ASN B N     1 
ATOM   6069 C  CA    . ASN D 4 59  ? 45.287 79.251  18.079  1.00 34.85 ? 59   ASN B CA    1 
ATOM   6070 C  C     . ASN D 4 59  ? 45.826 78.442  16.906  1.00 34.95 ? 59   ASN B C     1 
ATOM   6071 O  O     . ASN D 4 59  ? 45.181 78.369  15.865  1.00 35.11 ? 59   ASN B O     1 
ATOM   6072 C  CB    . ASN D 4 59  ? 43.877 78.785  18.427  1.00 35.32 ? 59   ASN B CB    1 
ATOM   6073 C  CG    . ASN D 4 59  ? 43.806 77.295  18.681  1.00 37.34 ? 59   ASN B CG    1 
ATOM   6074 O  OD1   . ASN D 4 59  ? 44.031 76.490  17.779  1.00 39.41 ? 59   ASN B OD1   1 
ATOM   6075 N  ND2   . ASN D 4 59  ? 43.500 76.920  19.915  1.00 38.57 ? 59   ASN B ND2   1 
ATOM   6076 N  N     . ILE D 4 60  ? 46.996 77.831  17.076  1.00 34.20 ? 60   ILE B N     1 
ATOM   6077 C  CA    . ILE D 4 60  ? 47.622 77.066  15.999  1.00 33.60 ? 60   ILE B CA    1 
ATOM   6078 C  C     . ILE D 4 60  ? 46.920 75.800  15.494  1.00 33.79 ? 60   ILE B C     1 
ATOM   6079 O  O     . ILE D 4 60  ? 47.272 75.290  14.430  1.00 32.51 ? 60   ILE B O     1 
ATOM   6080 C  CB    . ILE D 4 60  ? 49.082 76.707  16.353  1.00 34.26 ? 60   ILE B CB    1 
ATOM   6081 C  CG1   . ILE D 4 60  ? 49.120 75.806  17.589  1.00 35.30 ? 60   ILE B CG1   1 
ATOM   6082 C  CG2   . ILE D 4 60  ? 49.880 77.989  16.571  1.00 33.50 ? 60   ILE B CG2   1 
ATOM   6083 C  CD1   . ILE D 4 60  ? 50.530 75.433  18.034  1.00 36.46 ? 60   ILE B CD1   1 
ATOM   6084 N  N     . ASP D 4 61  ? 45.938 75.288  16.231  1.00 35.64 ? 61   ASP B N     1 
ATOM   6085 C  CA    . ASP D 4 61  ? 45.218 74.098  15.770  1.00 36.20 ? 61   ASP B CA    1 
ATOM   6086 C  C     . ASP D 4 61  ? 44.063 74.493  14.852  1.00 36.74 ? 61   ASP B C     1 
ATOM   6087 O  O     . ASP D 4 61  ? 43.720 73.763  13.919  1.00 35.13 ? 61   ASP B O     1 
ATOM   6088 C  CB    . ASP D 4 61  ? 44.659 73.285  16.942  1.00 36.67 ? 61   ASP B CB    1 
ATOM   6089 C  CG    . ASP D 4 61  ? 45.746 72.590  17.747  1.00 38.34 ? 61   ASP B CG    1 
ATOM   6090 O  OD1   . ASP D 4 61  ? 46.804 72.261  17.167  1.00 37.81 ? 61   ASP B OD1   1 
ATOM   6091 O  OD2   . ASP D 4 61  ? 45.530 72.362  18.956  1.00 37.84 ? 61   ASP B OD2   1 
ATOM   6092 N  N     . GLN D 4 62  ? 43.465 75.648  15.134  1.00 37.10 ? 62   GLN B N     1 
ATOM   6093 C  CA    . GLN D 4 62  ? 42.346 76.161  14.351  1.00 37.61 ? 62   GLN B CA    1 
ATOM   6094 C  C     . GLN D 4 62  ? 42.846 76.920  13.123  1.00 35.57 ? 62   GLN B C     1 
ATOM   6095 O  O     . GLN D 4 62  ? 42.142 77.031  12.126  1.00 36.35 ? 62   GLN B O     1 
ATOM   6096 C  CB    . GLN D 4 62  ? 41.492 77.093  15.215  1.00 39.96 ? 62   GLN B CB    1 
ATOM   6097 C  CG    . GLN D 4 62  ? 41.117 76.502  16.559  1.00 44.90 ? 62   GLN B CG    1 
ATOM   6098 C  CD    . GLN D 4 62  ? 40.308 77.457  17.412  1.00 47.34 ? 62   GLN B CD    1 
ATOM   6099 O  OE1   . GLN D 4 62  ? 40.664 78.627  17.566  1.00 49.48 ? 62   GLN B OE1   1 
ATOM   6100 N  NE2   . GLN D 4 62  ? 39.213 76.960  17.980  1.00 49.38 ? 62   GLN B NE2   1 
ATOM   6101 N  N     . ASN D 4 63  ? 44.067 77.439  13.212  1.00 35.62 ? 63   ASN B N     1 
ATOM   6102 C  CA    . ASN D 4 63  ? 44.688 78.204  12.133  1.00 34.93 ? 63   ASN B CA    1 
ATOM   6103 C  C     . ASN D 4 63  ? 46.110 77.684  11.961  1.00 36.14 ? 63   ASN B C     1 
ATOM   6104 O  O     . ASN D 4 63  ? 47.065 78.321  12.396  1.00 36.48 ? 63   ASN B O     1 
ATOM   6105 C  CB    . ASN D 4 63  ? 44.724 79.679  12.524  1.00 34.45 ? 63   ASN B CB    1 
ATOM   6106 C  CG    . ASN D 4 63  ? 43.364 80.197  12.929  1.00 34.48 ? 63   ASN B CG    1 
ATOM   6107 O  OD1   . ASN D 4 63  ? 42.523 80.494  12.079  1.00 35.44 ? 63   ASN B OD1   1 
ATOM   6108 N  ND2   . ASN D 4 63  ? 43.129 80.286  14.233  1.00 34.28 ? 63   ASN B ND2   1 
ATOM   6109 N  N     . PRO D 4 64  ? 46.268 76.522  11.310  1.00 35.86 ? 64   PRO B N     1 
ATOM   6110 C  CA    . PRO D 4 64  ? 47.585 75.913  11.098  1.00 36.08 ? 64   PRO B CA    1 
ATOM   6111 C  C     . PRO D 4 64  ? 48.498 76.492  10.028  1.00 35.09 ? 64   PRO B C     1 
ATOM   6112 O  O     . PRO D 4 64  ? 49.646 76.072  9.913   1.00 35.54 ? 64   PRO B O     1 
ATOM   6113 C  CB    . PRO D 4 64  ? 47.237 74.457  10.815  1.00 36.45 ? 64   PRO B CB    1 
ATOM   6114 C  CG    . PRO D 4 64  ? 45.964 74.583  10.041  1.00 36.67 ? 64   PRO B CG    1 
ATOM   6115 C  CD    . PRO D 4 64  ? 45.194 75.632  10.826  1.00 35.99 ? 64   PRO B CD    1 
ATOM   6116 N  N     . GLY D 4 65  ? 48.017 77.465  9.263   1.00 36.04 ? 65   GLY B N     1 
ATOM   6117 C  CA    . GLY D 4 65  ? 48.842 78.017  8.203   1.00 35.21 ? 65   GLY B CA    1 
ATOM   6118 C  C     . GLY D 4 65  ? 49.812 79.145  8.510   1.00 36.04 ? 65   GLY B C     1 
ATOM   6119 O  O     . GLY D 4 65  ? 50.750 79.360  7.747   1.00 36.90 ? 65   GLY B O     1 
ATOM   6120 N  N     . THR D 4 66  ? 49.618 79.852  9.620   1.00 36.66 ? 66   THR B N     1 
ATOM   6121 C  CA    . THR D 4 66  ? 50.475 80.987  9.957   1.00 37.12 ? 66   THR B CA    1 
ATOM   6122 C  C     . THR D 4 66  ? 51.763 80.702  10.749  1.00 37.69 ? 66   THR B C     1 
ATOM   6123 O  O     . THR D 4 66  ? 52.845 81.146  10.357  1.00 36.65 ? 66   THR B O     1 
ATOM   6124 C  CB    . THR D 4 66  ? 49.666 82.062  10.722  1.00 37.57 ? 66   THR B CB    1 
ATOM   6125 O  OG1   . THR D 4 66  ? 48.513 82.432  9.956   1.00 39.64 ? 66   THR B OG1   1 
ATOM   6126 C  CG2   . THR D 4 66  ? 50.515 83.294  10.970  1.00 38.57 ? 66   THR B CG2   1 
ATOM   6127 N  N     . ALA D 4 67  ? 51.646 79.980  11.862  1.00 37.55 ? 67   ALA B N     1 
ATOM   6128 C  CA    . ALA D 4 67  ? 52.805 79.681  12.701  1.00 38.19 ? 67   ALA B CA    1 
ATOM   6129 C  C     . ALA D 4 67  ? 54.032 79.204  11.923  1.00 38.50 ? 67   ALA B C     1 
ATOM   6130 O  O     . ALA D 4 67  ? 55.133 79.712  12.125  1.00 38.87 ? 67   ALA B O     1 
ATOM   6131 C  CB    . ALA D 4 67  ? 52.432 78.655  13.769  1.00 38.06 ? 67   ALA B CB    1 
ATOM   6132 N  N     . PRO D 4 68  ? 53.859 78.224  11.023  1.00 39.42 ? 68   PRO B N     1 
ATOM   6133 C  CA    . PRO D 4 68  ? 54.997 77.721  10.246  1.00 40.60 ? 68   PRO B CA    1 
ATOM   6134 C  C     . PRO D 4 68  ? 55.841 78.826  9.604   1.00 42.74 ? 68   PRO B C     1 
ATOM   6135 O  O     . PRO D 4 68  ? 57.064 78.709  9.512   1.00 43.01 ? 68   PRO B O     1 
ATOM   6136 C  CB    . PRO D 4 68  ? 54.330 76.828  9.204   1.00 39.70 ? 68   PRO B CB    1 
ATOM   6137 C  CG    . PRO D 4 68  ? 53.144 76.286  9.947   1.00 39.12 ? 68   PRO B CG    1 
ATOM   6138 C  CD    . PRO D 4 68  ? 52.621 77.499  10.679  1.00 38.90 ? 68   PRO B CD    1 
ATOM   6139 N  N     . LYS D 4 69  ? 55.187 79.902  9.177   1.00 44.17 ? 69   LYS B N     1 
ATOM   6140 C  CA    . LYS D 4 69  ? 55.879 81.011  8.525   1.00 46.10 ? 69   LYS B CA    1 
ATOM   6141 C  C     . LYS D 4 69  ? 56.890 81.732  9.411   1.00 46.72 ? 69   LYS B C     1 
ATOM   6142 O  O     . LYS D 4 69  ? 57.737 82.477  8.913   1.00 47.53 ? 69   LYS B O     1 
ATOM   6143 C  CB    . LYS D 4 69  ? 54.862 82.023  7.987   1.00 45.76 ? 69   LYS B CB    1 
ATOM   6144 C  CG    . LYS D 4 69  ? 53.938 81.465  6.915   1.00 48.69 ? 69   LYS B CG    1 
ATOM   6145 C  CD    . LYS D 4 69  ? 53.081 82.563  6.298   1.00 49.03 ? 69   LYS B CD    1 
ATOM   6146 C  CE    . LYS D 4 69  ? 52.191 82.023  5.185   1.00 50.57 ? 69   LYS B CE    1 
ATOM   6147 N  NZ    . LYS D 4 69  ? 51.370 83.111  4.575   1.00 49.61 ? 69   LYS B NZ    1 
ATOM   6148 N  N     . TYR D 4 70  ? 56.805 81.513  10.718  1.00 47.70 ? 70   TYR B N     1 
ATOM   6149 C  CA    . TYR D 4 70  ? 57.717 82.162  11.651  1.00 48.65 ? 70   TYR B CA    1 
ATOM   6150 C  C     . TYR D 4 70  ? 58.524 81.148  12.452  1.00 49.08 ? 70   TYR B C     1 
ATOM   6151 O  O     . TYR D 4 70  ? 59.127 81.487  13.468  1.00 48.78 ? 70   TYR B O     1 
ATOM   6152 C  CB    . TYR D 4 70  ? 56.929 83.074  12.594  1.00 49.31 ? 70   TYR B CB    1 
ATOM   6153 C  CG    . TYR D 4 70  ? 56.161 84.154  11.867  1.00 49.00 ? 70   TYR B CG    1 
ATOM   6154 C  CD1   . TYR D 4 70  ? 56.823 85.236  11.294  1.00 48.80 ? 70   TYR B CD1   1 
ATOM   6155 C  CD2   . TYR D 4 70  ? 54.777 84.066  11.705  1.00 48.72 ? 70   TYR B CD2   1 
ATOM   6156 C  CE1   . TYR D 4 70  ? 56.130 86.206  10.573  1.00 49.82 ? 70   TYR B CE1   1 
ATOM   6157 C  CE2   . TYR D 4 70  ? 54.071 85.028  10.982  1.00 48.32 ? 70   TYR B CE2   1 
ATOM   6158 C  CZ    . TYR D 4 70  ? 54.754 86.096  10.419  1.00 49.58 ? 70   TYR B CZ    1 
ATOM   6159 O  OH    . TYR D 4 70  ? 54.071 87.054  9.704   1.00 48.93 ? 70   TYR B OH    1 
ATOM   6160 N  N     . GLY D 4 71  ? 58.528 79.903  11.988  1.00 50.40 ? 71   GLY B N     1 
ATOM   6161 C  CA    . GLY D 4 71  ? 59.277 78.859  12.667  1.00 52.87 ? 71   GLY B CA    1 
ATOM   6162 C  C     . GLY D 4 71  ? 58.542 78.226  13.832  1.00 53.83 ? 71   GLY B C     1 
ATOM   6163 O  O     . GLY D 4 71  ? 57.972 77.139  13.708  1.00 56.06 ? 71   GLY B O     1 
ATOM   6164 N  N     . ILE D 4 72  ? 58.558 78.906  14.971  1.00 53.24 ? 72   ILE B N     1 
ATOM   6165 C  CA    . ILE D 4 72  ? 57.893 78.412  16.167  1.00 52.51 ? 72   ILE B CA    1 
ATOM   6166 C  C     . ILE D 4 72  ? 58.301 76.983  16.517  1.00 50.96 ? 72   ILE B C     1 
ATOM   6167 O  O     . ILE D 4 72  ? 57.929 76.024  15.839  1.00 50.31 ? 72   ILE B O     1 
ATOM   6168 C  CB    . ILE D 4 72  ? 56.358 78.494  16.017  1.00 52.94 ? 72   ILE B CB    1 
ATOM   6169 C  CG1   . ILE D 4 72  ? 55.932 79.965  15.991  1.00 53.58 ? 72   ILE B CG1   1 
ATOM   6170 C  CG2   . ILE D 4 72  ? 55.672 77.755  17.155  1.00 52.58 ? 72   ILE B CG2   1 
ATOM   6171 C  CD1   . ILE D 4 72  ? 54.435 80.179  16.015  1.00 55.63 ? 72   ILE B CD1   1 
ATOM   6172 N  N     . ARG D 4 73  ? 59.078 76.862  17.589  1.00 49.23 ? 73   ARG B N     1 
ATOM   6173 C  CA    . ARG D 4 73  ? 59.554 75.573  18.071  1.00 47.25 ? 73   ARG B CA    1 
ATOM   6174 C  C     . ARG D 4 73  ? 58.923 75.298  19.434  1.00 46.01 ? 73   ARG B C     1 
ATOM   6175 O  O     . ARG D 4 73  ? 59.075 74.210  19.993  1.00 46.43 ? 73   ARG B O     1 
ATOM   6176 C  CB    . ARG D 4 73  ? 61.079 75.592  18.191  1.00 46.96 ? 73   ARG B CB    1 
ATOM   6177 N  N     . GLY D 4 74  ? 58.215 76.294  19.960  1.00 44.50 ? 74   GLY B N     1 
ATOM   6178 C  CA    . GLY D 4 74  ? 57.561 76.155  21.250  1.00 42.72 ? 74   GLY B CA    1 
ATOM   6179 C  C     . GLY D 4 74  ? 56.432 77.150  21.454  1.00 42.20 ? 74   GLY B C     1 
ATOM   6180 O  O     . GLY D 4 74  ? 56.336 78.152  20.749  1.00 42.04 ? 74   GLY B O     1 
ATOM   6181 N  N     . ILE D 4 75  ? 55.572 76.870  22.425  1.00 41.77 ? 75   ILE B N     1 
ATOM   6182 C  CA    . ILE D 4 75  ? 54.442 77.738  22.727  1.00 41.29 ? 75   ILE B CA    1 
ATOM   6183 C  C     . ILE D 4 75  ? 54.294 77.885  24.241  1.00 40.90 ? 75   ILE B C     1 
ATOM   6184 O  O     . ILE D 4 75  ? 54.627 76.973  24.996  1.00 41.20 ? 75   ILE B O     1 
ATOM   6185 C  CB    . ILE D 4 75  ? 53.131 77.161  22.142  1.00 40.83 ? 75   ILE B CB    1 
ATOM   6186 C  CG1   . ILE D 4 75  ? 52.926 75.728  22.645  1.00 41.24 ? 75   ILE B CG1   1 
ATOM   6187 C  CG2   . ILE D 4 75  ? 53.185 77.187  20.619  1.00 40.81 ? 75   ILE B CG2   1 
ATOM   6188 C  CD1   . ILE D 4 75  ? 51.597 75.103  22.244  1.00 40.54 ? 75   ILE B CD1   1 
ATOM   6189 N  N     . PRO D 4 76  ? 53.772 79.029  24.702  1.00 39.87 ? 76   PRO B N     1 
ATOM   6190 C  CA    . PRO D 4 76  ? 53.319 80.166  23.896  1.00 39.97 ? 76   PRO B CA    1 
ATOM   6191 C  C     . PRO D 4 76  ? 54.455 80.994  23.314  1.00 38.86 ? 76   PRO B C     1 
ATOM   6192 O  O     . PRO D 4 76  ? 55.456 81.259  23.987  1.00 40.79 ? 76   PRO B O     1 
ATOM   6193 C  CB    . PRO D 4 76  ? 52.488 80.970  24.888  1.00 39.28 ? 76   PRO B CB    1 
ATOM   6194 C  CG    . PRO D 4 76  ? 53.286 80.802  26.148  1.00 40.23 ? 76   PRO B CG    1 
ATOM   6195 C  CD    . PRO D 4 76  ? 53.590 79.308  26.138  1.00 40.55 ? 76   PRO B CD    1 
ATOM   6196 N  N     . THR D 4 77  ? 54.294 81.396  22.059  1.00 37.91 ? 77   THR B N     1 
ATOM   6197 C  CA    . THR D 4 77  ? 55.284 82.226  21.388  1.00 37.28 ? 77   THR B CA    1 
ATOM   6198 C  C     . THR D 4 77  ? 54.661 83.601  21.220  1.00 37.67 ? 77   THR B C     1 
ATOM   6199 O  O     . THR D 4 77  ? 53.598 83.744  20.620  1.00 38.32 ? 77   THR B O     1 
ATOM   6200 C  CB    . THR D 4 77  ? 55.675 81.656  20.003  1.00 36.60 ? 77   THR B CB    1 
ATOM   6201 O  OG1   . THR D 4 77  ? 56.420 80.447  20.182  1.00 35.82 ? 77   THR B OG1   1 
ATOM   6202 C  CG2   . THR D 4 77  ? 56.531 82.650  19.227  1.00 34.52 ? 77   THR B CG2   1 
ATOM   6203 N  N     . LEU D 4 78  ? 55.326 84.608  21.769  1.00 38.39 ? 78   LEU B N     1 
ATOM   6204 C  CA    . LEU D 4 78  ? 54.843 85.977  21.702  1.00 39.37 ? 78   LEU B CA    1 
ATOM   6205 C  C     . LEU D 4 78  ? 55.683 86.770  20.724  1.00 39.70 ? 78   LEU B C     1 
ATOM   6206 O  O     . LEU D 4 78  ? 56.866 86.982  20.956  1.00 40.97 ? 78   LEU B O     1 
ATOM   6207 C  CB    . LEU D 4 78  ? 54.931 86.625  23.084  1.00 38.23 ? 78   LEU B CB    1 
ATOM   6208 C  CG    . LEU D 4 78  ? 54.397 85.791  24.249  1.00 39.65 ? 78   LEU B CG    1 
ATOM   6209 C  CD1   . LEU D 4 78  ? 54.699 86.496  25.569  1.00 40.23 ? 78   LEU B CD1   1 
ATOM   6210 C  CD2   . LEU D 4 78  ? 52.901 85.575  24.084  1.00 39.58 ? 78   LEU B CD2   1 
ATOM   6211 N  N     . LEU D 4 79  ? 55.076 87.200  19.623  1.00 40.76 ? 79   LEU B N     1 
ATOM   6212 C  CA    . LEU D 4 79  ? 55.795 87.986  18.626  1.00 41.78 ? 79   LEU B CA    1 
ATOM   6213 C  C     . LEU D 4 79  ? 55.283 89.411  18.616  1.00 43.56 ? 79   LEU B C     1 
ATOM   6214 O  O     . LEU D 4 79  ? 54.073 89.647  18.519  1.00 44.22 ? 79   LEU B O     1 
ATOM   6215 C  CB    . LEU D 4 79  ? 55.621 87.385  17.230  1.00 41.36 ? 79   LEU B CB    1 
ATOM   6216 C  CG    . LEU D 4 79  ? 56.758 86.534  16.661  1.00 41.76 ? 79   LEU B CG    1 
ATOM   6217 C  CD1   . LEU D 4 79  ? 57.290 85.583  17.721  1.00 40.60 ? 79   LEU B CD1   1 
ATOM   6218 C  CD2   . LEU D 4 79  ? 56.246 85.775  15.438  1.00 40.27 ? 79   LEU B CD2   1 
ATOM   6219 N  N     . LEU D 4 80  ? 56.203 90.363  18.722  1.00 44.61 ? 80   LEU B N     1 
ATOM   6220 C  CA    . LEU D 4 80  ? 55.826 91.765  18.706  1.00 45.65 ? 80   LEU B CA    1 
ATOM   6221 C  C     . LEU D 4 80  ? 56.031 92.279  17.294  1.00 45.84 ? 80   LEU B C     1 
ATOM   6222 O  O     . LEU D 4 80  ? 57.151 92.269  16.785  1.00 46.86 ? 80   LEU B O     1 
ATOM   6223 C  CB    . LEU D 4 80  ? 56.679 92.570  19.695  1.00 45.00 ? 80   LEU B CB    1 
ATOM   6224 C  CG    . LEU D 4 80  ? 56.342 94.059  19.836  1.00 44.50 ? 80   LEU B CG    1 
ATOM   6225 C  CD1   . LEU D 4 80  ? 54.841 94.245  19.968  1.00 44.71 ? 80   LEU B CD1   1 
ATOM   6226 C  CD2   . LEU D 4 80  ? 57.058 94.630  21.054  1.00 44.13 ? 80   LEU B CD2   1 
ATOM   6227 N  N     . PHE D 4 81  ? 54.942 92.705  16.661  1.00 46.12 ? 81   PHE B N     1 
ATOM   6228 C  CA    . PHE D 4 81  ? 55.001 93.224  15.303  1.00 46.17 ? 81   PHE B CA    1 
ATOM   6229 C  C     . PHE D 4 81  ? 54.959 94.742  15.293  1.00 47.85 ? 81   PHE B C     1 
ATOM   6230 O  O     . PHE D 4 81  ? 54.361 95.363  16.170  1.00 47.95 ? 81   PHE B O     1 
ATOM   6231 C  CB    . PHE D 4 81  ? 53.835 92.697  14.460  1.00 43.27 ? 81   PHE B CB    1 
ATOM   6232 C  CG    . PHE D 4 81  ? 53.929 91.237  14.129  1.00 40.58 ? 81   PHE B CG    1 
ATOM   6233 C  CD1   . PHE D 4 81  ? 53.468 90.273  15.020  1.00 39.35 ? 81   PHE B CD1   1 
ATOM   6234 C  CD2   . PHE D 4 81  ? 54.474 90.824  12.921  1.00 39.37 ? 81   PHE B CD2   1 
ATOM   6235 C  CE1   . PHE D 4 81  ? 53.546 88.920  14.708  1.00 37.79 ? 81   PHE B CE1   1 
ATOM   6236 C  CE2   . PHE D 4 81  ? 54.557 89.472  12.600  1.00 38.95 ? 81   PHE B CE2   1 
ATOM   6237 C  CZ    . PHE D 4 81  ? 54.091 88.519  13.495  1.00 39.18 ? 81   PHE B CZ    1 
ATOM   6238 N  N     . LYS D 4 82  ? 55.591 95.331  14.286  1.00 50.00 ? 82   LYS B N     1 
ATOM   6239 C  CA    . LYS D 4 82  ? 55.627 96.779  14.136  1.00 52.33 ? 82   LYS B CA    1 
ATOM   6240 C  C     . LYS D 4 82  ? 55.833 97.086  12.661  1.00 53.87 ? 82   LYS B C     1 
ATOM   6241 O  O     . LYS D 4 82  ? 56.896 96.808  12.109  1.00 55.10 ? 82   LYS B O     1 
ATOM   6242 C  CB    . LYS D 4 82  ? 56.775 97.371  14.960  1.00 52.50 ? 82   LYS B CB    1 
ATOM   6243 N  N     . ASN D 4 83  ? 54.811 97.654  12.028  1.00 55.14 ? 83   ASN B N     1 
ATOM   6244 C  CA    . ASN D 4 83  ? 54.869 97.990  10.605  1.00 56.28 ? 83   ASN B CA    1 
ATOM   6245 C  C     . ASN D 4 83  ? 54.986 96.753  9.726   1.00 55.86 ? 83   ASN B C     1 
ATOM   6246 O  O     . ASN D 4 83  ? 55.689 96.764  8.715   1.00 56.77 ? 83   ASN B O     1 
ATOM   6247 C  CB    . ASN D 4 83  ? 56.040 98.938  10.305  1.00 58.57 ? 83   ASN B CB    1 
ATOM   6248 C  CG    . ASN D 4 83  ? 55.746 100.377 10.703  1.00 61.12 ? 83   ASN B CG    1 
ATOM   6249 O  OD1   . ASN D 4 83  ? 54.700 100.926 10.349  1.00 62.13 ? 83   ASN B OD1   1 
ATOM   6250 N  ND2   . ASN D 4 83  ? 56.672 100.997 11.431  1.00 61.80 ? 83   ASN B ND2   1 
ATOM   6251 N  N     . GLY D 4 84  ? 54.294 95.689  10.121  1.00 55.56 ? 84   GLY B N     1 
ATOM   6252 C  CA    . GLY D 4 84  ? 54.305 94.457  9.352   1.00 55.02 ? 84   GLY B CA    1 
ATOM   6253 C  C     . GLY D 4 84  ? 55.563 93.616  9.436   1.00 54.67 ? 84   GLY B C     1 
ATOM   6254 O  O     . GLY D 4 84  ? 55.826 92.807  8.547   1.00 54.69 ? 84   GLY B O     1 
ATOM   6255 N  N     . GLU D 4 85  ? 56.341 93.796  10.498  1.00 55.50 ? 85   GLU B N     1 
ATOM   6256 C  CA    . GLU D 4 85  ? 57.569 93.028  10.672  1.00 55.85 ? 85   GLU B CA    1 
ATOM   6257 C  C     . GLU D 4 85  ? 57.773 92.662  12.136  1.00 54.75 ? 85   GLU B C     1 
ATOM   6258 O  O     . GLU D 4 85  ? 57.308 93.371  13.032  1.00 55.25 ? 85   GLU B O     1 
ATOM   6259 C  CB    . GLU D 4 85  ? 58.768 93.833  10.158  1.00 57.93 ? 85   GLU B CB    1 
ATOM   6260 C  CG    . GLU D 4 85  ? 58.956 95.172  10.857  1.00 61.00 ? 85   GLU B CG    1 
ATOM   6261 C  CD    . GLU D 4 85  ? 59.983 96.055  10.169  1.00 63.90 ? 85   GLU B CD    1 
ATOM   6262 O  OE1   . GLU D 4 85  ? 60.247 97.169  10.680  1.00 63.93 ? 85   GLU B OE1   1 
ATOM   6263 O  OE2   . GLU D 4 85  ? 60.522 95.636  9.117   1.00 64.10 ? 85   GLU B OE2   1 
ATOM   6264 N  N     . VAL D 4 86  ? 58.462 91.551  12.377  1.00 53.21 ? 86   VAL B N     1 
ATOM   6265 C  CA    . VAL D 4 86  ? 58.727 91.104  13.739  1.00 51.75 ? 86   VAL B CA    1 
ATOM   6266 C  C     . VAL D 4 86  ? 59.843 91.930  14.369  1.00 51.29 ? 86   VAL B C     1 
ATOM   6267 O  O     . VAL D 4 86  ? 60.982 91.901  13.902  1.00 50.23 ? 86   VAL B O     1 
ATOM   6268 C  CB    . VAL D 4 86  ? 59.141 89.622  13.773  1.00 51.41 ? 86   VAL B CB    1 
ATOM   6269 C  CG1   . VAL D 4 86  ? 59.475 89.205  15.210  1.00 49.09 ? 86   VAL B CG1   1 
ATOM   6270 C  CG2   . VAL D 4 86  ? 58.019 88.764  13.215  1.00 50.90 ? 86   VAL B CG2   1 
ATOM   6271 N  N     . ALA D 4 87  ? 59.512 92.652  15.435  1.00 50.27 ? 87   ALA B N     1 
ATOM   6272 C  CA    . ALA D 4 87  ? 60.486 93.491  16.125  1.00 50.90 ? 87   ALA B CA    1 
ATOM   6273 C  C     . ALA D 4 87  ? 61.132 92.802  17.325  1.00 51.33 ? 87   ALA B C     1 
ATOM   6274 O  O     . ALA D 4 87  ? 62.314 93.006  17.600  1.00 52.37 ? 87   ALA B O     1 
ATOM   6275 C  CB    . ALA D 4 87  ? 59.827 94.790  16.570  1.00 51.17 ? 87   ALA B CB    1 
ATOM   6276 N  N     . ALA D 4 88  ? 60.357 91.997  18.045  1.00 50.42 ? 88   ALA B N     1 
ATOM   6277 C  CA    . ALA D 4 88  ? 60.874 91.294  19.216  1.00 49.34 ? 88   ALA B CA    1 
ATOM   6278 C  C     . ALA D 4 88  ? 60.122 89.991  19.429  1.00 49.10 ? 88   ALA B C     1 
ATOM   6279 O  O     . ALA D 4 88  ? 58.953 89.864  19.051  1.00 47.80 ? 88   ALA B O     1 
ATOM   6280 C  CB    . ALA D 4 88  ? 60.755 92.173  20.455  1.00 48.41 ? 88   ALA B CB    1 
ATOM   6281 N  N     . THR D 4 89  ? 60.794 89.025  20.046  1.00 49.12 ? 89   THR B N     1 
ATOM   6282 C  CA    . THR D 4 89  ? 60.187 87.728  20.289  1.00 48.38 ? 89   THR B CA    1 
ATOM   6283 C  C     . THR D 4 89  ? 60.647 87.030  21.565  1.00 48.44 ? 89   THR B C     1 
ATOM   6284 O  O     . THR D 4 89  ? 61.839 86.970  21.870  1.00 48.74 ? 89   THR B O     1 
ATOM   6285 C  CB    . THR D 4 89  ? 60.424 86.782  19.082  1.00 48.23 ? 89   THR B CB    1 
ATOM   6286 O  OG1   . THR D 4 89  ? 60.527 85.427  19.543  1.00 47.97 ? 89   THR B OG1   1 
ATOM   6287 C  CG2   . THR D 4 89  ? 61.689 87.170  18.334  1.00 48.22 ? 89   THR B CG2   1 
ATOM   6288 N  N     . LYS D 4 90  ? 59.675 86.509  22.308  1.00 48.12 ? 90   LYS B N     1 
ATOM   6289 C  CA    . LYS D 4 90  ? 59.932 85.780  23.543  1.00 47.30 ? 90   LYS B CA    1 
ATOM   6290 C  C     . LYS D 4 90  ? 59.069 84.523  23.539  1.00 46.64 ? 90   LYS B C     1 
ATOM   6291 O  O     . LYS D 4 90  ? 57.939 84.533  23.041  1.00 47.10 ? 90   LYS B O     1 
ATOM   6292 C  CB    . LYS D 4 90  ? 59.596 86.645  24.762  1.00 48.59 ? 90   LYS B CB    1 
ATOM   6293 C  CG    . LYS D 4 90  ? 60.818 87.130  25.549  1.00 50.50 ? 90   LYS B CG    1 
ATOM   6294 C  CD    . LYS D 4 90  ? 61.816 87.863  24.655  1.00 52.56 ? 90   LYS B CD    1 
ATOM   6295 C  CE    . LYS D 4 90  ? 62.961 88.480  25.457  1.00 52.84 ? 90   LYS B CE    1 
ATOM   6296 N  NZ    . LYS D 4 90  ? 63.722 87.465  26.234  1.00 53.61 ? 90   LYS B NZ    1 
ATOM   6297 N  N     . VAL D 4 91  ? 59.609 83.442  24.091  1.00 44.54 ? 91   VAL B N     1 
ATOM   6298 C  CA    . VAL D 4 91  ? 58.897 82.172  24.145  1.00 42.49 ? 91   VAL B CA    1 
ATOM   6299 C  C     . VAL D 4 91  ? 58.765 81.688  25.585  1.00 42.78 ? 91   VAL B C     1 
ATOM   6300 O  O     . VAL D 4 91  ? 59.753 81.626  26.318  1.00 42.74 ? 91   VAL B O     1 
ATOM   6301 C  CB    . VAL D 4 91  ? 59.636 81.096  23.328  1.00 39.94 ? 91   VAL B CB    1 
ATOM   6302 C  CG1   . VAL D 4 91  ? 58.822 79.812  23.290  1.00 38.66 ? 91   VAL B CG1   1 
ATOM   6303 C  CG2   . VAL D 4 91  ? 59.908 81.612  21.926  1.00 39.29 ? 91   VAL B CG2   1 
ATOM   6304 N  N     . GLY D 4 92  ? 57.543 81.354  25.989  1.00 42.65 ? 92   GLY B N     1 
ATOM   6305 C  CA    . GLY D 4 92  ? 57.322 80.874  27.342  1.00 43.11 ? 92   GLY B CA    1 
ATOM   6306 C  C     . GLY D 4 92  ? 56.282 81.677  28.097  1.00 43.00 ? 92   GLY B C     1 
ATOM   6307 O  O     . GLY D 4 92  ? 55.889 82.763  27.665  1.00 42.89 ? 92   GLY B O     1 
ATOM   6308 N  N     . ALA D 4 93  ? 55.840 81.145  29.231  1.00 43.10 ? 93   ALA B N     1 
ATOM   6309 C  CA    . ALA D 4 93  ? 54.829 81.807  30.046  1.00 44.86 ? 93   ALA B CA    1 
ATOM   6310 C  C     . ALA D 4 93  ? 55.435 82.826  31.013  1.00 45.75 ? 93   ALA B C     1 
ATOM   6311 O  O     . ALA D 4 93  ? 55.606 82.553  32.204  1.00 46.22 ? 93   ALA B O     1 
ATOM   6312 C  CB    . ALA D 4 93  ? 54.014 80.762  30.819  1.00 43.94 ? 93   ALA B CB    1 
ATOM   6313 N  N     . LEU D 4 94  ? 55.757 84.003  30.490  1.00 46.87 ? 94   LEU B N     1 
ATOM   6314 C  CA    . LEU D 4 94  ? 56.332 85.066  31.302  1.00 47.29 ? 94   LEU B CA    1 
ATOM   6315 C  C     . LEU D 4 94  ? 55.324 85.577  32.321  1.00 47.96 ? 94   LEU B C     1 
ATOM   6316 O  O     . LEU D 4 94  ? 54.113 85.450  32.135  1.00 47.49 ? 94   LEU B O     1 
ATOM   6317 C  CB    . LEU D 4 94  ? 56.793 86.220  30.411  1.00 47.93 ? 94   LEU B CB    1 
ATOM   6318 C  CG    . LEU D 4 94  ? 58.066 85.993  29.590  1.00 47.71 ? 94   LEU B CG    1 
ATOM   6319 C  CD1   . LEU D 4 94  ? 57.959 84.705  28.795  1.00 49.13 ? 94   LEU B CD1   1 
ATOM   6320 C  CD2   . LEU D 4 94  ? 58.281 87.176  28.667  1.00 48.84 ? 94   LEU B CD2   1 
ATOM   6321 N  N     . SER D 4 95  ? 55.835 86.145  33.407  1.00 48.74 ? 95   SER B N     1 
ATOM   6322 C  CA    . SER D 4 95  ? 54.983 86.692  34.451  1.00 49.20 ? 95   SER B CA    1 
ATOM   6323 C  C     . SER D 4 95  ? 54.499 88.046  33.962  1.00 49.34 ? 95   SER B C     1 
ATOM   6324 O  O     . SER D 4 95  ? 55.055 88.604  33.017  1.00 48.65 ? 95   SER B O     1 
ATOM   6325 C  CB    . SER D 4 95  ? 55.772 86.875  35.752  1.00 48.18 ? 95   SER B CB    1 
ATOM   6326 O  OG    . SER D 4 95  ? 56.746 87.897  35.611  1.00 46.32 ? 95   SER B OG    1 
ATOM   6327 N  N     . LYS D 4 96  ? 53.463 88.573  34.604  1.00 50.49 ? 96   LYS B N     1 
ATOM   6328 C  CA    . LYS D 4 96  ? 52.926 89.869  34.220  1.00 51.63 ? 96   LYS B CA    1 
ATOM   6329 C  C     . LYS D 4 96  ? 54.048 90.899  34.255  1.00 52.15 ? 96   LYS B C     1 
ATOM   6330 O  O     . LYS D 4 96  ? 54.086 91.817  33.436  1.00 52.85 ? 96   LYS B O     1 
ATOM   6331 C  CB    . LYS D 4 96  ? 51.802 90.272  35.179  1.00 53.00 ? 96   LYS B CB    1 
ATOM   6332 C  CG    . LYS D 4 96  ? 51.093 91.572  34.825  1.00 52.99 ? 96   LYS B CG    1 
ATOM   6333 C  CD    . LYS D 4 96  ? 49.825 91.727  35.651  1.00 54.50 ? 96   LYS B CD    1 
ATOM   6334 C  CE    . LYS D 4 96  ? 49.153 93.070  35.411  1.00 55.57 ? 96   LYS B CE    1 
ATOM   6335 N  NZ    . LYS D 4 96  ? 48.846 93.287  33.971  1.00 57.06 ? 96   LYS B NZ    1 
ATOM   6336 N  N     . GLY D 4 97  ? 54.973 90.720  35.195  1.00 52.57 ? 97   GLY B N     1 
ATOM   6337 C  CA    . GLY D 4 97  ? 56.087 91.643  35.337  1.00 52.70 ? 97   GLY B CA    1 
ATOM   6338 C  C     . GLY D 4 97  ? 57.127 91.564  34.236  1.00 52.88 ? 97   GLY B C     1 
ATOM   6339 O  O     . GLY D 4 97  ? 57.569 92.589  33.714  1.00 52.51 ? 97   GLY B O     1 
ATOM   6340 N  N     . GLN D 4 98  ? 57.530 90.349  33.882  1.00 53.16 ? 98   GLN B N     1 
ATOM   6341 C  CA    . GLN D 4 98  ? 58.531 90.154  32.837  1.00 53.21 ? 98   GLN B CA    1 
ATOM   6342 C  C     . GLN D 4 98  ? 57.994 90.638  31.492  1.00 52.38 ? 98   GLN B C     1 
ATOM   6343 O  O     . GLN D 4 98  ? 58.743 91.158  30.665  1.00 51.96 ? 98   GLN B O     1 
ATOM   6344 C  CB    . GLN D 4 98  ? 58.901 88.673  32.740  1.00 55.08 ? 98   GLN B CB    1 
ATOM   6345 C  CG    . GLN D 4 98  ? 59.165 88.012  34.084  1.00 56.33 ? 98   GLN B CG    1 
ATOM   6346 C  CD    . GLN D 4 98  ? 59.372 86.516  33.963  1.00 58.37 ? 98   GLN B CD    1 
ATOM   6347 O  OE1   . GLN D 4 98  ? 60.366 86.059  33.399  1.00 59.64 ? 98   GLN B OE1   1 
ATOM   6348 N  NE2   . GLN D 4 98  ? 58.428 85.743  34.486  1.00 58.79 ? 98   GLN B NE2   1 
ATOM   6349 N  N     . LEU D 4 99  ? 56.694 90.457  31.277  1.00 51.45 ? 99   LEU B N     1 
ATOM   6350 C  CA    . LEU D 4 99  ? 56.067 90.882  30.030  1.00 51.17 ? 99   LEU B CA    1 
ATOM   6351 C  C     . LEU D 4 99  ? 55.990 92.403  30.016  1.00 51.11 ? 99   LEU B C     1 
ATOM   6352 O  O     . LEU D 4 99  ? 56.392 93.046  29.043  1.00 51.28 ? 99   LEU B O     1 
ATOM   6353 C  CB    . LEU D 4 99  ? 54.657 90.296  29.906  1.00 51.02 ? 99   LEU B CB    1 
ATOM   6354 C  CG    . LEU D 4 99  ? 54.315 89.496  28.644  1.00 51.24 ? 99   LEU B CG    1 
ATOM   6355 C  CD1   . LEU D 4 99  ? 52.836 89.131  28.683  1.00 51.73 ? 99   LEU B CD1   1 
ATOM   6356 C  CD2   . LEU D 4 99  ? 54.625 90.300  27.391  1.00 51.16 ? 99   LEU B CD2   1 
ATOM   6357 N  N     . LYS D 4 100 ? 55.470 92.972  31.101  1.00 50.90 ? 100  LYS B N     1 
ATOM   6358 C  CA    . LYS D 4 100 ? 55.348 94.421  31.219  1.00 51.63 ? 100  LYS B CA    1 
ATOM   6359 C  C     . LYS D 4 100 ? 56.699 95.049  30.916  1.00 51.20 ? 100  LYS B C     1 
ATOM   6360 O  O     . LYS D 4 100 ? 56.781 96.100  30.281  1.00 51.91 ? 100  LYS B O     1 
ATOM   6361 C  CB    . LYS D 4 100 ? 54.900 94.809  32.632  1.00 51.01 ? 100  LYS B CB    1 
ATOM   6362 N  N     . GLU D 4 101 ? 57.760 94.383  31.365  1.00 52.47 ? 101  GLU B N     1 
ATOM   6363 C  CA    . GLU D 4 101 ? 59.125 94.856  31.150  1.00 52.47 ? 101  GLU B CA    1 
ATOM   6364 C  C     . GLU D 4 101 ? 59.520 94.672  29.691  1.00 51.89 ? 101  GLU B C     1 
ATOM   6365 O  O     . GLU D 4 101 ? 60.155 95.538  29.093  1.00 51.66 ? 101  GLU B O     1 
ATOM   6366 C  CB    . GLU D 4 101 ? 60.099 94.087  32.052  1.00 52.74 ? 101  GLU B CB    1 
ATOM   6367 N  N     . PHE D 4 102 ? 59.137 93.534  29.124  1.00 52.37 ? 102  PHE B N     1 
ATOM   6368 C  CA    . PHE D 4 102 ? 59.440 93.230  27.733  1.00 52.34 ? 102  PHE B CA    1 
ATOM   6369 C  C     . PHE D 4 102 ? 58.800 94.264  26.813  1.00 52.71 ? 102  PHE B C     1 
ATOM   6370 O  O     . PHE D 4 102 ? 59.438 94.771  25.889  1.00 52.41 ? 102  PHE B O     1 
ATOM   6371 C  CB    . PHE D 4 102 ? 58.917 91.834  27.387  1.00 52.96 ? 102  PHE B CB    1 
ATOM   6372 C  CG    . PHE D 4 102 ? 59.056 91.469  25.934  1.00 52.78 ? 102  PHE B CG    1 
ATOM   6373 C  CD1   . PHE D 4 102 ? 60.306 91.435  25.326  1.00 52.38 ? 102  PHE B CD1   1 
ATOM   6374 C  CD2   . PHE D 4 102 ? 57.935 91.132  25.181  1.00 52.94 ? 102  PHE B CD2   1 
ATOM   6375 C  CE1   . PHE D 4 102 ? 60.437 91.067  23.987  1.00 52.86 ? 102  PHE B CE1   1 
ATOM   6376 C  CE2   . PHE D 4 102 ? 58.055 90.762  23.843  1.00 52.08 ? 102  PHE B CE2   1 
ATOM   6377 C  CZ    . PHE D 4 102 ? 59.307 90.728  23.245  1.00 52.71 ? 102  PHE B CZ    1 
ATOM   6378 N  N     . LEU D 4 103 ? 57.537 94.579  27.077  1.00 52.85 ? 103  LEU B N     1 
ATOM   6379 C  CA    . LEU D 4 103 ? 56.807 95.544  26.263  1.00 53.49 ? 103  LEU B CA    1 
ATOM   6380 C  C     . LEU D 4 103 ? 57.338 96.970  26.410  1.00 53.86 ? 103  LEU B C     1 
ATOM   6381 O  O     . LEU D 4 103 ? 57.793 97.569  25.434  1.00 54.08 ? 103  LEU B O     1 
ATOM   6382 C  CB    . LEU D 4 103 ? 55.314 95.493  26.609  1.00 52.75 ? 103  LEU B CB    1 
ATOM   6383 C  CG    . LEU D 4 103 ? 54.645 94.126  26.399  1.00 53.07 ? 103  LEU B CG    1 
ATOM   6384 C  CD1   . LEU D 4 103 ? 53.176 94.185  26.808  1.00 52.48 ? 103  LEU B CD1   1 
ATOM   6385 C  CD2   . LEU D 4 103 ? 54.780 93.712  24.941  1.00 52.70 ? 103  LEU B CD2   1 
ATOM   6386 N  N     . ASP D 4 104 ? 57.283 97.514  27.623  1.00 54.46 ? 104  ASP B N     1 
ATOM   6387 C  CA    . ASP D 4 104 ? 57.768 98.872  27.853  1.00 55.03 ? 104  ASP B CA    1 
ATOM   6388 C  C     . ASP D 4 104 ? 59.120 99.062  27.174  1.00 54.73 ? 104  ASP B C     1 
ATOM   6389 O  O     . ASP D 4 104 ? 59.356 100.061 26.495  1.00 54.11 ? 104  ASP B O     1 
ATOM   6390 C  CB    . ASP D 4 104 ? 57.909 99.157  29.354  1.00 56.00 ? 104  ASP B CB    1 
ATOM   6391 C  CG    . ASP D 4 104 ? 56.582 99.090  30.096  1.00 57.60 ? 104  ASP B CG    1 
ATOM   6392 O  OD1   . ASP D 4 104 ? 55.560 99.557  29.545  1.00 58.18 ? 104  ASP B OD1   1 
ATOM   6393 O  OD2   . ASP D 4 104 ? 56.564 98.586  31.241  1.00 57.82 ? 104  ASP B OD2   1 
ATOM   6394 N  N     . ALA D 4 105 ? 59.996 98.078  27.353  1.00 55.12 ? 105  ALA B N     1 
ATOM   6395 C  CA    . ALA D 4 105 ? 61.338 98.111  26.784  1.00 54.81 ? 105  ALA B CA    1 
ATOM   6396 C  C     . ALA D 4 105 ? 61.384 98.154  25.260  1.00 54.27 ? 105  ALA B C     1 
ATOM   6397 O  O     . ALA D 4 105 ? 62.266 98.793  24.683  1.00 54.47 ? 105  ALA B O     1 
ATOM   6398 C  CB    . ALA D 4 105 ? 62.134 96.908  27.288  1.00 55.65 ? 105  ALA B CB    1 
ATOM   6399 N  N     . ASN D 4 106 ? 60.442 97.476  24.607  1.00 53.77 ? 106  ASN B N     1 
ATOM   6400 C  CA    . ASN D 4 106 ? 60.407 97.429  23.145  1.00 52.70 ? 106  ASN B CA    1 
ATOM   6401 C  C     . ASN D 4 106 ? 59.501 98.474  22.507  1.00 53.37 ? 106  ASN B C     1 
ATOM   6402 O  O     . ASN D 4 106 ? 59.695 98.848  21.350  1.00 52.71 ? 106  ASN B O     1 
ATOM   6403 C  CB    . ASN D 4 106 ? 59.976 96.036  22.681  1.00 52.02 ? 106  ASN B CB    1 
ATOM   6404 C  CG    . ASN D 4 106 ? 61.033 94.986  22.940  1.00 50.30 ? 106  ASN B CG    1 
ATOM   6405 O  OD1   . ASN D 4 106 ? 62.055 94.942  22.260  1.00 49.72 ? 106  ASN B OD1   1 
ATOM   6406 N  ND2   . ASN D 4 106 ? 60.796 94.138  23.931  1.00 49.14 ? 106  ASN B ND2   1 
ATOM   6407 N  N     . LEU D 4 107 ? 58.506 98.930  23.259  1.00 53.91 ? 107  LEU B N     1 
ATOM   6408 C  CA    . LEU D 4 107 ? 57.568 99.932  22.769  1.00 54.03 ? 107  LEU B CA    1 
ATOM   6409 C  C     . LEU D 4 107 ? 58.231 101.304 22.652  1.00 54.73 ? 107  LEU B C     1 
ATOM   6410 O  O     . LEU D 4 107 ? 58.722 101.610 21.541  1.00 54.98 ? 107  LEU B O     1 
ATOM   6411 C  CB    . LEU D 4 107 ? 56.358 100.010 23.708  1.00 52.65 ? 107  LEU B CB    1 
ATOM   6412 C  CG    . LEU D 4 107 ? 55.227 98.996  23.491  1.00 53.26 ? 107  LEU B CG    1 
ATOM   6413 C  CD1   . LEU D 4 107 ? 55.790 97.618  23.192  1.00 53.15 ? 107  LEU B CD1   1 
ATOM   6414 C  CD2   . LEU D 4 107 ? 54.342 98.959  24.726  1.00 51.51 ? 107  LEU B CD2   1 
HETATM 6415 MG MG    . MG  E 5 .   ? 77.747 24.232  7.680   1.00 47.41 ? 4003 MG  A MG    1 
HETATM 6416 O  O     . HOH F 6 .   ? 52.726 32.865  2.977   1.00 37.19 ? 5022 HOH T O     1 
HETATM 6417 O  O     . HOH F 6 .   ? 58.952 29.519  8.136   1.00 36.99 ? 5083 HOH T O     1 
HETATM 6418 O  O     . HOH F 6 .   ? 61.718 42.065  6.587   1.00 37.65 ? 5105 HOH T O     1 
HETATM 6419 O  O     . HOH F 6 .   ? 58.220 41.917  0.748   1.00 34.28 ? 5125 HOH T O     1 
HETATM 6420 O  O     . HOH F 6 .   ? 61.359 35.489  7.484   1.00 32.78 ? 5165 HOH T O     1 
HETATM 6421 O  O     . HOH F 6 .   ? 61.232 47.546  4.454   1.00 37.21 ? 5260 HOH T O     1 
HETATM 6422 O  O     . HOH G 6 .   ? 76.763 23.348  9.699   1.00 33.75 ? 5001 HOH A O     1 
HETATM 6423 O  O     . HOH G 6 .   ? 68.330 12.688  0.575   1.00 20.00 ? 5002 HOH A O     1 
HETATM 6424 O  O     . HOH G 6 .   ? 63.238 27.881  -25.812 1.00 24.54 ? 5003 HOH A O     1 
HETATM 6425 O  O     . HOH G 6 .   ? 65.435 22.222  0.375   1.00 21.61 ? 5005 HOH A O     1 
HETATM 6426 O  O     . HOH G 6 .   ? 60.109 32.198  -1.635  1.00 22.07 ? 5007 HOH A O     1 
HETATM 6427 O  O     . HOH G 6 .   ? 81.629 19.318  -9.966  1.00 23.85 ? 5008 HOH A O     1 
HETATM 6428 O  O     . HOH G 6 .   ? 69.227 21.743  3.539   1.00 23.97 ? 5009 HOH A O     1 
HETATM 6429 O  O     . HOH G 6 .   ? 70.723 24.802  -3.024  1.00 19.75 ? 5010 HOH A O     1 
HETATM 6430 O  O     . HOH G 6 .   ? 62.673 29.167  -7.655  1.00 26.95 ? 5011 HOH A O     1 
HETATM 6431 O  O     . HOH G 6 .   ? 78.838 23.890  5.528   1.00 31.49 ? 5012 HOH A O     1 
HETATM 6432 O  O     . HOH G 6 .   ? 77.304 17.059  -4.844  1.00 26.89 ? 5013 HOH A O     1 
HETATM 6433 O  O     . HOH G 6 .   ? 55.953 15.985  11.853  1.00 24.63 ? 5014 HOH A O     1 
HETATM 6434 O  O     . HOH G 6 .   ? 61.105 24.999  10.629  1.00 30.58 ? 5015 HOH A O     1 
HETATM 6435 O  O     . HOH G 6 .   ? 55.282 17.868  9.592   1.00 29.31 ? 5016 HOH A O     1 
HETATM 6436 O  O     . HOH G 6 .   ? 52.543 34.174  -4.862  1.00 25.82 ? 5018 HOH A O     1 
HETATM 6437 O  O     . HOH G 6 .   ? 57.072 7.267   -0.581  1.00 29.85 ? 5019 HOH A O     1 
HETATM 6438 O  O     . HOH G 6 .   ? 57.242 14.252  15.626  1.00 27.10 ? 5020 HOH A O     1 
HETATM 6439 O  O     . HOH G 6 .   ? 76.187 23.760  -7.370  1.00 28.03 ? 5021 HOH A O     1 
HETATM 6440 O  O     . HOH G 6 .   ? 61.469 18.404  7.128   1.00 24.27 ? 5023 HOH A O     1 
HETATM 6441 O  O     . HOH G 6 .   ? 58.306 12.560  17.996  1.00 29.38 ? 5025 HOH A O     1 
HETATM 6442 O  O     . HOH G 6 .   ? 40.168 6.427   6.703   1.00 42.05 ? 5026 HOH A O     1 
HETATM 6443 O  O     . HOH G 6 .   ? 57.980 38.970  0.065   1.00 30.82 ? 5027 HOH A O     1 
HETATM 6444 O  O     . HOH G 6 .   ? 65.560 10.095  0.365   1.00 37.20 ? 5028 HOH A O     1 
HETATM 6445 O  O     . HOH G 6 .   ? 79.840 25.036  8.829   1.00 47.54 ? 5029 HOH A O     1 
HETATM 6446 O  O     . HOH G 6 .   ? 33.104 9.883   0.616   1.00 24.63 ? 5030 HOH A O     1 
HETATM 6447 O  O     . HOH G 6 .   ? 57.357 22.353  -29.220 1.00 23.49 ? 5032 HOH A O     1 
HETATM 6448 O  O     . HOH G 6 .   ? 64.533 27.003  -28.308 1.00 21.72 ? 5033 HOH A O     1 
HETATM 6449 O  O     . HOH G 6 .   ? 70.347 24.813  -14.370 1.00 35.73 ? 5034 HOH A O     1 
HETATM 6450 O  O     . HOH G 6 .   ? 69.253 19.588  -4.932  1.00 23.20 ? 5035 HOH A O     1 
HETATM 6451 O  O     . HOH G 6 .   ? 53.013 6.141   12.100  1.00 31.12 ? 5036 HOH A O     1 
HETATM 6452 O  O     . HOH G 6 .   ? 74.281 5.981   -5.111  1.00 29.17 ? 5037 HOH A O     1 
HETATM 6453 O  O     . HOH G 6 .   ? 61.699 18.744  3.187   1.00 25.39 ? 5038 HOH A O     1 
HETATM 6454 O  O     . HOH G 6 .   ? 68.978 27.960  -20.878 1.00 27.16 ? 5039 HOH A O     1 
HETATM 6455 O  O     . HOH G 6 .   ? 62.252 28.852  -4.752  1.00 29.28 ? 5041 HOH A O     1 
HETATM 6456 O  O     . HOH G 6 .   ? 54.303 25.323  -1.079  1.00 32.27 ? 5042 HOH A O     1 
HETATM 6457 O  O     . HOH G 6 .   ? 59.411 27.280  18.615  1.00 29.22 ? 5043 HOH A O     1 
HETATM 6458 O  O     . HOH G 6 .   ? 57.979 27.996  -4.401  1.00 31.79 ? 5044 HOH A O     1 
HETATM 6459 O  O     . HOH G 6 .   ? 48.627 6.556   4.801   1.00 35.97 ? 5045 HOH A O     1 
HETATM 6460 O  O     . HOH G 6 .   ? 64.212 24.777  -0.236  1.00 29.28 ? 5046 HOH A O     1 
HETATM 6461 O  O     . HOH G 6 .   ? 57.768 28.104  10.487  1.00 31.66 ? 5047 HOH A O     1 
HETATM 6462 O  O     . HOH G 6 .   ? 74.733 16.418  -6.065  1.00 26.80 ? 5049 HOH A O     1 
HETATM 6463 O  O     . HOH G 6 .   ? 84.461 13.197  -8.604  1.00 33.93 ? 5050 HOH A O     1 
HETATM 6464 O  O     . HOH G 6 .   ? 77.068 19.588  7.968   1.00 24.94 ? 5051 HOH A O     1 
HETATM 6465 O  O     . HOH G 6 .   ? 64.715 21.996  5.557   1.00 32.45 ? 5052 HOH A O     1 
HETATM 6466 O  O     . HOH G 6 .   ? 67.120 20.766  15.445  1.00 39.82 ? 5053 HOH A O     1 
HETATM 6467 O  O     . HOH G 6 .   ? 74.147 29.643  0.506   1.00 32.78 ? 5054 HOH A O     1 
HETATM 6468 O  O     . HOH G 6 .   ? 67.574 15.973  -14.300 1.00 28.44 ? 5055 HOH A O     1 
HETATM 6469 O  O     . HOH G 6 .   ? 56.468 41.382  -17.594 1.00 32.27 ? 5056 HOH A O     1 
HETATM 6470 O  O     . HOH G 6 .   ? 77.366 20.542  10.689  1.00 36.00 ? 5058 HOH A O     1 
HETATM 6471 O  O     . HOH G 6 .   ? 59.023 41.251  -1.963  1.00 25.72 ? 5059 HOH A O     1 
HETATM 6472 O  O     . HOH G 6 .   ? 74.851 32.523  12.713  1.00 36.51 ? 5060 HOH A O     1 
HETATM 6473 O  O     . HOH G 6 .   ? 63.323 29.412  4.139   1.00 34.36 ? 5061 HOH A O     1 
HETATM 6474 O  O     . HOH G 6 .   ? 65.728 24.423  24.338  1.00 31.48 ? 5062 HOH A O     1 
HETATM 6475 O  O     . HOH G 6 .   ? 71.339 18.974  -2.909  1.00 27.57 ? 5063 HOH A O     1 
HETATM 6476 O  O     . HOH G 6 .   ? 61.907 13.104  19.200  1.00 32.34 ? 5064 HOH A O     1 
HETATM 6477 O  O     . HOH G 6 .   ? 51.762 44.532  -2.550  1.00 38.14 ? 5065 HOH A O     1 
HETATM 6478 O  O     . HOH G 6 .   ? 78.943 14.311  19.258  1.00 38.04 ? 5066 HOH A O     1 
HETATM 6479 O  O     . HOH G 6 .   ? 88.067 33.647  -0.015  1.00 37.22 ? 5067 HOH A O     1 
HETATM 6480 O  O     . HOH G 6 .   ? 70.871 -2.881  12.445  1.00 38.24 ? 5068 HOH A O     1 
HETATM 6481 O  O     . HOH G 6 .   ? 67.919 34.845  -19.980 1.00 42.54 ? 5069 HOH A O     1 
HETATM 6482 O  O     . HOH G 6 .   ? 54.072 31.150  -23.997 1.00 39.46 ? 5070 HOH A O     1 
HETATM 6483 O  O     . HOH G 6 .   ? 44.525 7.036   -9.019  1.00 29.91 ? 5071 HOH A O     1 
HETATM 6484 O  O     . HOH G 6 .   ? 70.149 28.458  -12.162 1.00 25.18 ? 5072 HOH A O     1 
HETATM 6485 O  O     . HOH G 6 .   ? 85.888 14.814  -12.986 1.00 43.27 ? 5073 HOH A O     1 
HETATM 6486 O  O     . HOH G 6 .   ? 56.899 38.735  -2.669  1.00 27.38 ? 5074 HOH A O     1 
HETATM 6487 O  O     . HOH G 6 .   ? 56.403 58.757  -4.750  1.00 35.54 ? 5075 HOH A O     1 
HETATM 6488 O  O     . HOH G 6 .   ? 81.611 25.699  -10.810 1.00 30.62 ? 5076 HOH A O     1 
HETATM 6489 O  O     . HOH G 6 .   ? 70.804 12.590  -7.051  1.00 31.47 ? 5078 HOH A O     1 
HETATM 6490 O  O     . HOH G 6 .   ? 69.676 4.118   15.305  1.00 33.55 ? 5080 HOH A O     1 
HETATM 6491 O  O     . HOH G 6 .   ? 47.789 18.596  -15.150 1.00 35.11 ? 5081 HOH A O     1 
HETATM 6492 O  O     . HOH G 6 .   ? 68.414 24.689  -26.740 1.00 28.80 ? 5082 HOH A O     1 
HETATM 6493 O  O     . HOH G 6 .   ? 69.592 24.434  12.801  1.00 29.03 ? 5084 HOH A O     1 
HETATM 6494 O  O     . HOH G 6 .   ? 90.699 24.504  -1.325  1.00 26.42 ? 5085 HOH A O     1 
HETATM 6495 O  O     . HOH G 6 .   ? 70.264 29.082  15.769  1.00 36.45 ? 5086 HOH A O     1 
HETATM 6496 O  O     . HOH G 6 .   ? 54.358 17.578  15.489  1.00 35.21 ? 5087 HOH A O     1 
HETATM 6497 O  O     . HOH G 6 .   ? 88.019 7.555   9.425   1.00 40.00 ? 5088 HOH A O     1 
HETATM 6498 O  O     . HOH G 6 .   ? 48.719 13.884  6.159   1.00 27.49 ? 5089 HOH A O     1 
HETATM 6499 O  O     . HOH G 6 .   ? 93.312 18.789  -3.385  1.00 24.32 ? 5090 HOH A O     1 
HETATM 6500 O  O     . HOH G 6 .   ? 96.632 23.407  3.772   1.00 39.12 ? 5091 HOH A O     1 
HETATM 6501 O  O     . HOH G 6 .   ? 54.701 43.000  -15.884 1.00 37.06 ? 5092 HOH A O     1 
HETATM 6502 O  O     . HOH G 6 .   ? 64.350 14.577  -4.614  1.00 23.53 ? 5093 HOH A O     1 
HETATM 6503 O  O     . HOH G 6 .   ? 93.939 16.419  -1.587  1.00 37.39 ? 5094 HOH A O     1 
HETATM 6504 O  O     . HOH G 6 .   ? 69.344 27.365  -2.585  1.00 29.28 ? 5095 HOH A O     1 
HETATM 6505 O  O     . HOH G 6 .   ? 45.449 43.396  -12.181 1.00 45.99 ? 5096 HOH A O     1 
HETATM 6506 O  O     . HOH G 6 .   ? 57.053 31.942  -23.611 1.00 31.68 ? 5097 HOH A O     1 
HETATM 6507 O  O     . HOH G 6 .   ? 75.158 19.679  -6.793  1.00 31.51 ? 5098 HOH A O     1 
HETATM 6508 O  O     . HOH G 6 .   ? 42.616 16.660  -6.655  1.00 28.37 ? 5099 HOH A O     1 
HETATM 6509 O  O     . HOH G 6 .   ? 64.747 39.994  -17.042 1.00 41.80 ? 5100 HOH A O     1 
HETATM 6510 O  O     . HOH G 6 .   ? 79.863 35.312  9.940   1.00 42.00 ? 5101 HOH A O     1 
HETATM 6511 O  O     . HOH G 6 .   ? 61.288 7.435   20.997  1.00 36.29 ? 5102 HOH A O     1 
HETATM 6512 O  O     . HOH G 6 .   ? 49.295 7.070   -12.742 1.00 32.90 ? 5103 HOH A O     1 
HETATM 6513 O  O     . HOH G 6 .   ? 46.155 6.424   3.208   1.00 33.45 ? 5104 HOH A O     1 
HETATM 6514 O  O     . HOH G 6 .   ? 38.356 16.521  -11.569 1.00 36.79 ? 5106 HOH A O     1 
HETATM 6515 O  O     . HOH G 6 .   ? 61.575 6.475   4.741   1.00 37.79 ? 5107 HOH A O     1 
HETATM 6516 O  O     . HOH G 6 .   ? 76.700 25.346  11.761  1.00 36.30 ? 5108 HOH A O     1 
HETATM 6517 O  O     . HOH G 6 .   ? 63.174 7.281   -4.161  1.00 38.68 ? 5109 HOH A O     1 
HETATM 6518 O  O     . HOH G 6 .   ? 44.196 7.505   5.220   1.00 28.13 ? 5111 HOH A O     1 
HETATM 6519 O  O     . HOH G 6 .   ? 90.902 10.975  3.921   1.00 47.71 ? 5112 HOH A O     1 
HETATM 6520 O  O     . HOH G 6 .   ? 81.648 28.409  5.991   1.00 37.26 ? 5113 HOH A O     1 
HETATM 6521 O  O     . HOH G 6 .   ? 77.287 11.965  20.031  1.00 33.02 ? 5114 HOH A O     1 
HETATM 6522 O  O     . HOH G 6 .   ? 45.960 13.814  7.153   1.00 29.11 ? 5117 HOH A O     1 
HETATM 6523 O  O     . HOH G 6 .   ? 69.412 18.209  23.585  1.00 52.60 ? 5118 HOH A O     1 
HETATM 6524 O  O     . HOH G 6 .   ? 71.374 27.511  2.888   1.00 38.84 ? 5119 HOH A O     1 
HETATM 6525 O  O     . HOH G 6 .   ? 80.983 31.541  -7.302  1.00 44.60 ? 5121 HOH A O     1 
HETATM 6526 O  O     . HOH G 6 .   ? 72.606 12.661  21.027  1.00 29.72 ? 5122 HOH A O     1 
HETATM 6527 O  O     . HOH G 6 .   ? 50.781 57.003  -12.085 1.00 42.39 ? 5123 HOH A O     1 
HETATM 6528 O  O     . HOH G 6 .   ? 41.785 2.944   1.649   1.00 36.71 ? 5126 HOH A O     1 
HETATM 6529 O  O     . HOH G 6 .   ? 85.248 7.537   3.131   1.00 30.40 ? 5127 HOH A O     1 
HETATM 6530 O  O     . HOH G 6 .   ? 46.936 25.549  -22.015 1.00 39.13 ? 5128 HOH A O     1 
HETATM 6531 O  O     . HOH G 6 .   ? 57.772 25.682  23.534  1.00 43.13 ? 5129 HOH A O     1 
HETATM 6532 O  O     . HOH G 6 .   ? 58.551 9.568   19.631  1.00 44.73 ? 5131 HOH A O     1 
HETATM 6533 O  O     . HOH G 6 .   ? 72.577 16.764  3.441   1.00 30.46 ? 5132 HOH A O     1 
HETATM 6534 O  O     . HOH G 6 .   ? 68.110 18.018  -10.416 1.00 49.80 ? 5133 HOH A O     1 
HETATM 6535 O  O     . HOH G 6 .   ? 84.612 2.664   -1.184  1.00 45.19 ? 5134 HOH A O     1 
HETATM 6536 O  O     . HOH G 6 .   ? 35.294 70.831  0.731   1.00 42.03 ? 5135 HOH A O     1 
HETATM 6537 O  O     . HOH G 6 .   ? 61.681 14.342  -7.345  1.00 40.61 ? 5136 HOH A O     1 
HETATM 6538 O  O     . HOH G 6 .   ? 56.242 4.207   6.763   1.00 34.04 ? 5138 HOH A O     1 
HETATM 6539 O  O     . HOH G 6 .   ? 72.530 0.430   0.238   1.00 34.33 ? 5140 HOH A O     1 
HETATM 6540 O  O     . HOH G 6 .   ? 87.036 8.057   -3.719  1.00 36.13 ? 5141 HOH A O     1 
HETATM 6541 O  O     . HOH G 6 .   ? 43.416 9.218   -7.092  1.00 30.59 ? 5142 HOH A O     1 
HETATM 6542 O  O     . HOH G 6 .   ? 67.709 35.812  -5.879  1.00 29.15 ? 5143 HOH A O     1 
HETATM 6543 O  O     . HOH G 6 .   ? 64.820 4.910   17.359  1.00 60.03 ? 5144 HOH A O     1 
HETATM 6544 O  O     . HOH G 6 .   ? 90.466 10.639  0.848   1.00 43.47 ? 5145 HOH A O     1 
HETATM 6545 O  O     . HOH G 6 .   ? 46.257 10.981  8.013   1.00 35.36 ? 5146 HOH A O     1 
HETATM 6546 O  O     . HOH G 6 .   ? 55.340 39.851  -19.951 1.00 38.50 ? 5147 HOH A O     1 
HETATM 6547 O  O     . HOH G 6 .   ? 89.269 11.598  15.984  1.00 36.16 ? 5148 HOH A O     1 
HETATM 6548 O  O     . HOH G 6 .   ? 66.921 2.808   16.165  1.00 38.54 ? 5149 HOH A O     1 
HETATM 6549 O  O     . HOH G 6 .   ? 60.968 37.287  -23.344 1.00 40.44 ? 5150 HOH A O     1 
HETATM 6550 O  O     . HOH G 6 .   ? 81.478 4.331   6.736   1.00 42.01 ? 5152 HOH A O     1 
HETATM 6551 O  O     . HOH G 6 .   ? 72.411 27.291  0.092   1.00 39.99 ? 5153 HOH A O     1 
HETATM 6552 O  O     . HOH G 6 .   ? 67.694 27.162  15.201  1.00 29.44 ? 5154 HOH A O     1 
HETATM 6553 O  O     . HOH G 6 .   ? 75.674 4.053   -3.136  1.00 33.28 ? 5155 HOH A O     1 
HETATM 6554 O  O     . HOH G 6 .   ? 63.645 42.857  -17.761 1.00 44.85 ? 5156 HOH A O     1 
HETATM 6555 O  O     . HOH G 6 .   ? 69.567 25.092  -11.420 1.00 27.74 ? 5157 HOH A O     1 
HETATM 6556 O  O     . HOH G 6 .   ? 68.378 19.082  -23.741 1.00 43.08 ? 5158 HOH A O     1 
HETATM 6557 O  O     . HOH G 6 .   ? 54.627 6.819   18.444  1.00 31.42 ? 5159 HOH A O     1 
HETATM 6558 O  O     . HOH G 6 .   ? 37.808 18.797  15.143  1.00 40.36 ? 5160 HOH A O     1 
HETATM 6559 O  O     . HOH G 6 .   ? 47.802 12.154  -17.970 1.00 50.04 ? 5162 HOH A O     1 
HETATM 6560 O  O     . HOH G 6 .   ? 43.836 10.913  -15.601 1.00 38.93 ? 5163 HOH A O     1 
HETATM 6561 O  O     . HOH G 6 .   ? 54.552 45.590  1.137   1.00 35.34 ? 5166 HOH A O     1 
HETATM 6562 O  O     . HOH G 6 .   ? 27.045 11.169  14.094  1.00 55.05 ? 5167 HOH A O     1 
HETATM 6563 O  O     . HOH G 6 .   ? 67.983 26.852  12.024  1.00 42.81 ? 5168 HOH A O     1 
HETATM 6564 O  O     . HOH G 6 .   ? 68.247 26.207  5.104   1.00 45.27 ? 5169 HOH A O     1 
HETATM 6565 O  O     . HOH G 6 .   ? 68.955 25.028  -22.740 1.00 31.90 ? 5170 HOH A O     1 
HETATM 6566 O  O     . HOH G 6 .   ? 62.784 52.283  -11.492 1.00 41.77 ? 5172 HOH A O     1 
HETATM 6567 O  O     . HOH G 6 .   ? 83.395 8.514   18.695  1.00 46.94 ? 5173 HOH A O     1 
HETATM 6568 O  O     . HOH G 6 .   ? 74.762 25.556  5.954   1.00 34.61 ? 5174 HOH A O     1 
HETATM 6569 O  O     . HOH G 6 .   ? 86.710 10.296  9.218   1.00 35.68 ? 5175 HOH A O     1 
HETATM 6570 O  O     . HOH G 6 .   ? 38.318 12.775  -13.220 1.00 39.51 ? 5176 HOH A O     1 
HETATM 6571 O  O     . HOH G 6 .   ? 74.406 28.945  -28.913 1.00 43.06 ? 5177 HOH A O     1 
HETATM 6572 O  O     . HOH G 6 .   ? 79.457 2.308   4.546   1.00 46.96 ? 5178 HOH A O     1 
HETATM 6573 O  O     . HOH G 6 .   ? 50.761 4.275   -6.726  1.00 42.78 ? 5179 HOH A O     1 
HETATM 6574 O  O     . HOH G 6 .   ? 55.455 4.967   13.655  1.00 38.58 ? 5182 HOH A O     1 
HETATM 6575 O  O     . HOH G 6 .   ? 65.770 35.345  -16.513 1.00 43.40 ? 5183 HOH A O     1 
HETATM 6576 O  O     . HOH G 6 .   ? 74.445 -3.365  8.457   1.00 43.35 ? 5184 HOH A O     1 
HETATM 6577 O  O     . HOH G 6 .   ? 74.631 17.944  -9.197  1.00 39.83 ? 5185 HOH A O     1 
HETATM 6578 O  O     . HOH G 6 .   ? 38.387 8.284   8.365   1.00 34.42 ? 5188 HOH A O     1 
HETATM 6579 O  O     . HOH G 6 .   ? 76.353 4.096   16.535  1.00 54.56 ? 5189 HOH A O     1 
HETATM 6580 O  O     . HOH G 6 .   ? 27.975 11.340  20.325  1.00 46.64 ? 5191 HOH A O     1 
HETATM 6581 O  O     . HOH G 6 .   ? 70.371 17.301  -13.944 1.00 50.65 ? 5193 HOH A O     1 
HETATM 6582 O  O     . HOH G 6 .   ? 37.738 60.029  -4.155  1.00 42.80 ? 5194 HOH A O     1 
HETATM 6583 O  O     . HOH G 6 .   ? 66.014 17.748  -7.982  1.00 26.40 ? 5195 HOH A O     1 
HETATM 6584 O  O     . HOH G 6 .   ? 93.355 22.027  -2.836  1.00 46.25 ? 5197 HOH A O     1 
HETATM 6585 O  O     . HOH G 6 .   ? 53.036 23.644  1.020   1.00 45.35 ? 5198 HOH A O     1 
HETATM 6586 O  O     . HOH G 6 .   ? 30.304 9.005   16.301  1.00 39.77 ? 5199 HOH A O     1 
HETATM 6587 O  O     . HOH G 6 .   ? 63.387 35.535  -29.046 1.00 45.94 ? 5200 HOH A O     1 
HETATM 6588 O  O     . HOH G 6 .   ? 55.220 31.286  3.402   1.00 41.40 ? 5201 HOH A O     1 
HETATM 6589 O  O     . HOH G 6 .   ? 64.924 6.341   -1.485  1.00 42.04 ? 5202 HOH A O     1 
HETATM 6590 O  O     . HOH G 6 .   ? 50.391 28.312  4.563   1.00 48.85 ? 5204 HOH A O     1 
HETATM 6591 O  O     . HOH G 6 .   ? 64.983 26.775  4.653   1.00 44.47 ? 5205 HOH A O     1 
HETATM 6592 O  O     . HOH G 6 .   ? 48.157 45.139  -13.444 1.00 47.96 ? 5206 HOH A O     1 
HETATM 6593 O  O     . HOH G 6 .   ? 49.884 0.594   -4.778  1.00 52.42 ? 5207 HOH A O     1 
HETATM 6594 O  O     . HOH G 6 .   ? 67.187 33.814  -30.722 1.00 39.40 ? 5208 HOH A O     1 
HETATM 6595 O  O     . HOH G 6 .   ? 66.445 15.601  -11.474 1.00 44.19 ? 5209 HOH A O     1 
HETATM 6596 O  O     . HOH G 6 .   ? 46.859 15.212  -22.906 1.00 44.81 ? 5210 HOH A O     1 
HETATM 6597 O  O     . HOH G 6 .   ? 61.840 28.979  8.089   1.00 35.22 ? 5212 HOH A O     1 
HETATM 6598 O  O     . HOH G 6 .   ? 81.375 6.757   -5.972  1.00 46.07 ? 5214 HOH A O     1 
HETATM 6599 O  O     . HOH G 6 .   ? 66.516 20.881  22.956  1.00 28.89 ? 5216 HOH A O     1 
HETATM 6600 O  O     . HOH G 6 .   ? 70.952 33.191  -24.865 1.00 46.53 ? 5217 HOH A O     1 
HETATM 6601 O  O     . HOH G 6 .   ? 66.195 21.966  3.127   1.00 27.05 ? 5220 HOH A O     1 
HETATM 6602 O  O     . HOH G 6 .   ? 72.840 18.529  -5.461  1.00 26.27 ? 5221 HOH A O     1 
HETATM 6603 O  O     . HOH G 6 .   ? 71.799 23.960  -9.865  1.00 35.16 ? 5224 HOH A O     1 
HETATM 6604 O  O     . HOH G 6 .   ? 60.354 30.140  4.605   1.00 29.88 ? 5225 HOH A O     1 
HETATM 6605 O  O     . HOH G 6 .   ? 68.873 21.877  -25.886 1.00 31.95 ? 5226 HOH A O     1 
HETATM 6606 O  O     . HOH G 6 .   ? 59.821 30.246  -3.795  1.00 39.21 ? 5228 HOH A O     1 
HETATM 6607 O  O     . HOH G 6 .   ? 43.228 5.416   -6.914  1.00 39.45 ? 5229 HOH A O     1 
HETATM 6608 O  O     . HOH G 6 .   ? 74.868 26.423  -7.679  1.00 34.50 ? 5231 HOH A O     1 
HETATM 6609 O  O     . HOH G 6 .   ? 51.157 13.046  22.738  1.00 43.11 ? 5236 HOH A O     1 
HETATM 6610 O  O     . HOH G 6 .   ? 68.029 36.775  2.309   1.00 41.68 ? 5239 HOH A O     1 
HETATM 6611 O  O     . HOH G 6 .   ? 49.005 18.681  30.158  1.00 34.87 ? 5240 HOH A O     1 
HETATM 6612 O  O     . HOH G 6 .   ? 45.699 17.706  -16.986 1.00 40.28 ? 5241 HOH A O     1 
HETATM 6613 O  O     . HOH G 6 .   ? 27.076 12.181  5.400   1.00 44.03 ? 5242 HOH A O     1 
HETATM 6614 O  O     . HOH G 6 .   ? 69.626 29.376  -4.807  1.00 42.97 ? 5243 HOH A O     1 
HETATM 6615 O  O     . HOH G 6 .   ? 79.717 20.612  -12.129 1.00 33.48 ? 5244 HOH A O     1 
HETATM 6616 O  O     . HOH G 6 .   ? 47.038 35.442  -9.815  1.00 36.93 ? 5245 HOH A O     1 
HETATM 6617 O  O     . HOH G 6 .   ? 60.589 19.512  -27.287 1.00 33.06 ? 5246 HOH A O     1 
HETATM 6618 O  O     . HOH G 6 .   ? 46.617 17.366  -20.775 1.00 37.89 ? 5247 HOH A O     1 
HETATM 6619 O  O     . HOH G 6 .   ? 75.771 28.984  11.358  1.00 33.81 ? 5248 HOH A O     1 
HETATM 6620 O  O     . HOH G 6 .   ? 80.516 12.201  -7.721  1.00 40.15 ? 5249 HOH A O     1 
HETATM 6621 O  O     . HOH G 6 .   ? 59.688 30.709  -27.425 1.00 51.39 ? 5250 HOH A O     1 
HETATM 6622 O  O     . HOH G 6 .   ? 59.984 27.555  -26.325 1.00 47.95 ? 5251 HOH A O     1 
HETATM 6623 O  O     . HOH G 6 .   ? 55.481 60.604  -2.252  1.00 46.81 ? 5252 HOH A O     1 
HETATM 6624 O  O     . HOH G 6 .   ? 52.871 2.998   -4.704  1.00 36.26 ? 5253 HOH A O     1 
HETATM 6625 O  O     . HOH G 6 .   ? 81.180 4.982   16.032  1.00 51.30 ? 5255 HOH A O     1 
HETATM 6626 O  O     . HOH G 6 .   ? 74.079 3.987   8.643   1.00 44.28 ? 5256 HOH A O     1 
HETATM 6627 O  O     . HOH G 6 .   ? 70.399 7.201   18.629  1.00 51.94 ? 5258 HOH A O     1 
HETATM 6628 O  O     . HOH G 6 .   ? 91.637 19.550  13.517  1.00 46.90 ? 5259 HOH A O     1 
HETATM 6629 O  O     . HOH G 6 .   ? 44.392 20.327  -17.689 1.00 34.18 ? 5261 HOH A O     1 
HETATM 6630 O  O     . HOH G 6 .   ? 66.559 33.674  -0.832  1.00 58.58 ? 5263 HOH A O     1 
HETATM 6631 O  O     . HOH G 6 .   ? 71.831 29.166  -8.965  1.00 34.76 ? 5264 HOH A O     1 
HETATM 6632 O  O     . HOH G 6 .   ? 78.177 35.570  0.390   1.00 39.19 ? 5266 HOH A O     1 
HETATM 6633 O  O     . HOH G 6 .   ? 90.812 27.925  1.248   1.00 43.41 ? 5267 HOH A O     1 
HETATM 6634 O  O     . HOH G 6 .   ? 76.319 22.505  6.747   1.00 29.45 ? 5268 HOH A O     1 
HETATM 6635 O  O     . HOH H 6 .   ? 48.695 72.770  15.546  1.00 39.39 ? 5024 HOH B O     1 
HETATM 6636 O  O     . HOH H 6 .   ? 42.543 82.890  19.814  1.00 33.44 ? 5031 HOH B O     1 
HETATM 6637 O  O     . HOH H 6 .   ? 42.693 82.023  16.867  1.00 29.66 ? 5040 HOH B O     1 
HETATM 6638 O  O     . HOH H 6 .   ? 61.383 81.375  28.473  1.00 38.45 ? 5048 HOH B O     1 
HETATM 6639 O  O     . HOH H 6 .   ? 49.479 78.418  12.876  1.00 31.24 ? 5077 HOH B O     1 
HETATM 6640 O  O     . HOH H 6 .   ? 58.691 79.465  19.202  1.00 36.56 ? 5079 HOH B O     1 
HETATM 6641 O  O     . HOH H 6 .   ? 52.074 71.662  28.610  1.00 43.69 ? 5116 HOH B O     1 
HETATM 6642 O  O     . HOH H 6 .   ? 44.167 74.306  20.453  1.00 41.33 ? 5137 HOH B O     1 
HETATM 6643 O  O     . HOH H 6 .   ? 39.841 79.806  5.356   1.00 46.28 ? 5151 HOH B O     1 
HETATM 6644 O  O     . HOH H 6 .   ? 44.098 85.698  26.878  1.00 34.11 ? 5161 HOH B O     1 
HETATM 6645 O  O     . HOH H 6 .   ? 41.091 81.419  8.228   1.00 41.33 ? 5180 HOH B O     1 
HETATM 6646 O  O     . HOH H 6 .   ? 47.749 81.682  25.582  1.00 32.51 ? 5187 HOH B O     1 
HETATM 6647 O  O     . HOH H 6 .   ? 40.927 81.119  2.396   1.00 48.18 ? 5190 HOH B O     1 
HETATM 6648 O  O     . HOH H 6 .   ? 46.143 86.405  6.285   1.00 39.24 ? 5196 HOH B O     1 
HETATM 6649 O  O     . HOH H 6 .   ? 42.257 78.699  9.156   1.00 58.03 ? 5203 HOH B O     1 
HETATM 6650 O  O     . HOH H 6 .   ? 44.297 94.361  22.542  1.00 47.48 ? 5213 HOH B O     1 
HETATM 6651 O  O     . HOH H 6 .   ? 48.367 98.745  17.863  1.00 50.07 ? 5218 HOH B O     1 
HETATM 6652 O  O     . HOH H 6 .   ? 44.514 88.964  5.424   1.00 48.04 ? 5219 HOH B O     1 
HETATM 6653 O  O     . HOH H 6 .   ? 38.766 89.864  18.010  1.00 43.25 ? 5262 HOH B O     1 
HETATM 6654 O  O     . HOH H 6 .   ? 45.138 71.351  13.207  1.00 52.42 ? 5265 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   1   ?   ?   ?   P . n 
A 1 2   DG  2   2   ?   ?   ?   P . n 
A 1 3   DA  3   3   ?   ?   ?   P . n 
A 1 4   DA  4   4   ?   ?   ?   P . n 
A 1 5   DA  5   5   ?   ?   ?   P . n 
A 1 6   DA  6   6   ?   ?   ?   P . n 
A 1 7   DC  7   7   ?   ?   ?   P . n 
A 1 8   DG  8   8   ?   ?   ?   P . n 
A 1 9   DA  9   9   ?   ?   ?   P . n 
A 1 10  DC  10  10  ?   ?   ?   P . n 
A 1 11  DG  11  11  ?   ?   ?   P . n 
A 1 12  DG  12  12  ?   ?   ?   P . n 
A 1 13  DC  13  13  ?   ?   ?   P . n 
A 1 14  DC  14  14  14  DC  CYT P . n 
A 1 15  DA  15  15  15  DA  ADE P . n 
A 1 16  DG  16  16  16  DG  GUA P . n 
A 1 17  DT  17  17  17  DT  THY P . n 
A 1 18  DG  18  18  18  DG  GUA P . n 
A 1 19  DC  19  19  19  DC  CYT P . n 
A 1 20  DC  20  20  20  DC  CYT P . n 
A 1 21  DT  21  21  21  DT  THY P . n 
A 1 22  2DA 22  22  22  2DA 2DA P . n 
B 2 1   DC  1   2   ?   ?   ?   T . n 
B 2 2   DC  2   3   ?   ?   ?   T . n 
B 2 3   DC  3   4   ?   ?   ?   T . n 
B 2 4   TTD 4   5   5   TTD TTD T . n 
B 2 5   DA  5   6   6   DA  ADE T . n 
B 2 6   DG  6   7   7   DG  GUA T . n 
B 2 7   DG  7   8   8   DG  GUA T . n 
B 2 8   DC  8   9   9   DC  CYT T . n 
B 2 9   DA  9   10  10  DA  ADE T . n 
B 2 10  DC  10  11  11  DC  CYT T . n 
B 2 11  DT  11  12  12  DT  THY T . n 
B 2 12  DG  12  13  13  DG  GUA T . n 
B 2 13  DG  13  14  14  DG  GUA T . n 
B 2 14  DC  14  15  ?   ?   ?   T . n 
B 2 15  DC  15  16  ?   ?   ?   T . n 
B 2 16  DG  16  17  ?   ?   ?   T . n 
B 2 17  DT  17  18  ?   ?   ?   T . n 
B 2 18  DC  18  19  ?   ?   ?   T . n 
B 2 19  DG  19  20  ?   ?   ?   T . n 
B 2 20  DT  20  21  ?   ?   ?   T . n 
B 2 21  DT  21  22  ?   ?   ?   T . n 
B 2 22  DT  22  23  ?   ?   ?   T . n 
B 2 23  DT  23  24  ?   ?   ?   T . n 
B 2 24  DC  24  25  ?   ?   ?   T . n 
B 2 25  DG  25  26  ?   ?   ?   T . n 
C 3 1   MET 1   1   1   MET MET A . n 
C 3 2   ILE 2   2   2   ILE ILE A . n 
C 3 3   VAL 3   3   3   VAL VAL A . n 
C 3 4   SER 4   4   4   SER SER A . n 
C 3 5   ASP 5   5   5   ASP ASP A . n 
C 3 6   ILE 6   6   6   ILE ILE A . n 
C 3 7   GLU 7   7   7   GLU GLU A . n 
C 3 8   ALA 8   8   8   ALA ALA A . n 
C 3 9   ASN 9   9   9   ASN ASN A . n 
C 3 10  ALA 10  10  10  ALA ALA A . n 
C 3 11  LEU 11  11  11  LEU LEU A . n 
C 3 12  LEU 12  12  12  LEU LEU A . n 
C 3 13  GLU 13  13  13  GLU GLU A . n 
C 3 14  SER 14  14  14  SER SER A . n 
C 3 15  VAL 15  15  15  VAL VAL A . n 
C 3 16  THR 16  16  16  THR THR A . n 
C 3 17  LYS 17  17  17  LYS LYS A . n 
C 3 18  PHE 18  18  18  PHE PHE A . n 
C 3 19  HIS 19  19  19  HIS HIS A . n 
C 3 20  CYS 20  20  20  CYS CYS A . n 
C 3 21  GLY 21  21  21  GLY GLY A . n 
C 3 22  VAL 22  22  22  VAL VAL A . n 
C 3 23  ILE 23  23  23  ILE ILE A . n 
C 3 24  TYR 24  24  24  TYR TYR A . n 
C 3 25  ASP 25  25  25  ASP ASP A . n 
C 3 26  TYR 26  26  26  TYR TYR A . n 
C 3 27  SER 27  27  27  SER SER A . n 
C 3 28  THR 28  28  28  THR THR A . n 
C 3 29  ALA 29  29  29  ALA ALA A . n 
C 3 30  GLU 30  30  30  GLU GLU A . n 
C 3 31  TYR 31  31  31  TYR TYR A . n 
C 3 32  VAL 32  32  32  VAL VAL A . n 
C 3 33  SER 33  33  33  SER SER A . n 
C 3 34  TYR 34  34  34  TYR TYR A . n 
C 3 35  ARG 35  35  35  ARG ARG A . n 
C 3 36  PRO 36  36  36  PRO PRO A . n 
C 3 37  SER 37  37  37  SER SER A . n 
C 3 38  ASP 38  38  38  ASP ASP A . n 
C 3 39  PHE 39  39  39  PHE PHE A . n 
C 3 40  GLY 40  40  40  GLY GLY A . n 
C 3 41  ALA 41  41  41  ALA ALA A . n 
C 3 42  TYR 42  42  42  TYR TYR A . n 
C 3 43  LEU 43  43  43  LEU LEU A . n 
C 3 44  ASP 44  44  44  ASP ASP A . n 
C 3 45  ALA 45  45  45  ALA ALA A . n 
C 3 46  LEU 46  46  46  LEU LEU A . n 
C 3 47  GLU 47  47  47  GLU GLU A . n 
C 3 48  ALA 48  48  48  ALA ALA A . n 
C 3 49  GLU 49  49  49  GLU GLU A . n 
C 3 50  VAL 50  50  50  VAL VAL A . n 
C 3 51  ALA 51  51  51  ALA ALA A . n 
C 3 52  ARG 52  52  52  ARG ARG A . n 
C 3 53  GLY 53  53  53  GLY GLY A . n 
C 3 54  GLY 54  54  54  GLY GLY A . n 
C 3 55  LEU 55  55  55  LEU LEU A . n 
C 3 56  ILE 56  56  56  ILE ILE A . n 
C 3 57  VAL 57  57  57  VAL VAL A . n 
C 3 58  PHE 58  58  58  PHE PHE A . n 
C 3 59  HIS 59  59  59  HIS HIS A . n 
C 3 60  ASN 60  60  60  ASN ASN A . n 
C 3 61  GLY 61  61  61  GLY GLY A . n 
C 3 62  HIS 62  62  62  HIS HIS A . n 
C 3 63  LYS 63  63  63  LYS LYS A . n 
C 3 64  TYR 64  64  64  TYR TYR A . n 
C 3 65  ASP 65  65  65  ASP ASP A . n 
C 3 66  VAL 66  66  66  VAL VAL A . n 
C 3 67  PRO 67  67  67  PRO PRO A . n 
C 3 68  ALA 68  68  68  ALA ALA A . n 
C 3 69  LEU 69  69  69  LEU LEU A . n 
C 3 70  THR 70  70  70  THR THR A . n 
C 3 71  LYS 71  71  71  LYS LYS A . n 
C 3 72  LEU 72  72  72  LEU LEU A . n 
C 3 73  ALA 73  73  73  ALA ALA A . n 
C 3 74  LYS 74  74  74  LYS LYS A . n 
C 3 75  LEU 75  75  75  LEU LEU A . n 
C 3 76  GLN 76  76  76  GLN GLN A . n 
C 3 77  LEU 77  77  77  LEU LEU A . n 
C 3 78  ASN 78  78  78  ASN ASN A . n 
C 3 79  ARG 79  79  79  ARG ARG A . n 
C 3 80  GLU 80  80  80  GLU GLU A . n 
C 3 81  PHE 81  81  81  PHE PHE A . n 
C 3 82  HIS 82  82  82  HIS HIS A . n 
C 3 83  LEU 83  83  83  LEU LEU A . n 
C 3 84  PRO 84  84  84  PRO PRO A . n 
C 3 85  ARG 85  85  85  ARG ARG A . n 
C 3 86  GLU 86  86  86  GLU GLU A . n 
C 3 87  ASN 87  87  87  ASN ASN A . n 
C 3 88  CYS 88  88  88  CYS CYS A . n 
C 3 89  ILE 89  89  89  ILE ILE A . n 
C 3 90  ASP 90  90  90  ASP ASP A . n 
C 3 91  THR 91  91  91  THR THR A . n 
C 3 92  LEU 92  92  92  LEU LEU A . n 
C 3 93  VAL 93  93  93  VAL VAL A . n 
C 3 94  LEU 94  94  94  LEU LEU A . n 
C 3 95  SER 95  95  95  SER SER A . n 
C 3 96  ARG 96  96  96  ARG ARG A . n 
C 3 97  LEU 97  97  97  LEU LEU A . n 
C 3 98  ILE 98  98  98  ILE ILE A . n 
C 3 99  HIS 99  99  99  HIS HIS A . n 
C 3 100 SER 100 100 100 SER SER A . n 
C 3 101 ASN 101 101 101 ASN ASN A . n 
C 3 102 LEU 102 102 102 LEU LEU A . n 
C 3 103 LYS 103 103 103 LYS LYS A . n 
C 3 104 ASP 104 104 104 ASP ASP A . n 
C 3 105 THR 105 105 105 THR THR A . n 
C 3 106 ASP 106 106 106 ASP ASP A . n 
C 3 107 MET 107 107 107 MET MET A . n 
C 3 108 GLY 108 108 108 GLY GLY A . n 
C 3 109 LEU 109 109 109 LEU LEU A . n 
C 3 110 LEU 110 110 110 LEU LEU A . n 
C 3 111 ARG 111 111 111 ARG ARG A . n 
C 3 112 SER 112 112 112 SER SER A . n 
C 3 113 GLY 113 113 113 GLY GLY A . n 
C 3 114 LYS 114 114 114 LYS LYS A . n 
C 3 115 LEU 115 115 115 LEU LEU A . n 
C 3 116 PRO 116 116 116 PRO PRO A . n 
C 3 117 GLY 117 117 117 GLY GLY A . n 
C 3 118 ALA 118 124 124 ALA ALA A . n 
C 3 119 LEU 119 125 125 LEU LEU A . n 
C 3 120 GLU 120 126 126 GLU GLU A . n 
C 3 121 ALA 121 127 127 ALA ALA A . n 
C 3 122 TRP 122 128 128 TRP TRP A . n 
C 3 123 GLY 123 129 129 GLY GLY A . n 
C 3 124 TYR 124 130 130 TYR TYR A . n 
C 3 125 ARG 125 131 131 ARG ARG A . n 
C 3 126 LEU 126 132 132 LEU LEU A . n 
C 3 127 GLY 127 133 133 GLY GLY A . n 
C 3 128 GLU 128 134 134 GLU GLU A . n 
C 3 129 MET 129 135 135 MET MET A . n 
C 3 130 LYS 130 136 136 LYS LYS A . n 
C 3 131 GLY 131 137 137 GLY GLY A . n 
C 3 132 GLU 132 138 138 GLU GLU A . n 
C 3 133 TYR 133 139 139 TYR TYR A . n 
C 3 134 LYS 134 140 140 LYS LYS A . n 
C 3 135 ASP 135 141 141 ASP ASP A . n 
C 3 136 ASP 136 142 142 ASP ASP A . n 
C 3 137 PHE 137 143 143 PHE PHE A . n 
C 3 138 LYS 138 144 144 LYS LYS A . n 
C 3 139 ARG 139 145 145 ARG ARG A . n 
C 3 140 MET 140 146 146 MET MET A . n 
C 3 141 LEU 141 147 147 LEU LEU A . n 
C 3 142 GLU 142 148 148 GLU GLU A . n 
C 3 143 GLU 143 149 149 GLU GLU A . n 
C 3 144 GLN 144 150 150 GLN GLN A . n 
C 3 145 GLY 145 151 151 GLY GLY A . n 
C 3 146 GLU 146 152 152 GLU GLU A . n 
C 3 147 GLU 147 153 153 GLU GLU A . n 
C 3 148 TYR 148 154 154 TYR TYR A . n 
C 3 149 VAL 149 155 155 VAL VAL A . n 
C 3 150 ASP 150 156 156 ASP ASP A . n 
C 3 151 GLY 151 157 157 GLY GLY A . n 
C 3 152 MET 152 158 158 MET MET A . n 
C 3 153 GLU 153 159 159 GLU GLU A . n 
C 3 154 TRP 154 160 160 TRP TRP A . n 
C 3 155 TRP 155 161 161 TRP TRP A . n 
C 3 156 ASN 156 162 162 ASN ASN A . n 
C 3 157 PHE 157 163 163 PHE PHE A . n 
C 3 158 ASN 158 164 164 ASN ASN A . n 
C 3 159 GLU 159 165 165 GLU GLU A . n 
C 3 160 GLU 160 166 166 GLU GLU A . n 
C 3 161 MET 161 167 167 MET MET A . n 
C 3 162 MET 162 168 168 MET MET A . n 
C 3 163 ASP 163 169 169 ASP ASP A . n 
C 3 164 TYR 164 170 170 TYR TYR A . n 
C 3 165 ASN 165 171 171 ASN ASN A . n 
C 3 166 VAL 166 172 172 VAL VAL A . n 
C 3 167 GLN 167 173 173 GLN GLN A . n 
C 3 168 ASP 168 174 174 ASP ASP A . n 
C 3 169 VAL 169 175 175 VAL VAL A . n 
C 3 170 VAL 170 176 176 VAL VAL A . n 
C 3 171 VAL 171 177 177 VAL VAL A . n 
C 3 172 THR 172 178 178 THR THR A . n 
C 3 173 LYS 173 179 179 LYS LYS A . n 
C 3 174 ALA 174 180 180 ALA ALA A . n 
C 3 175 LEU 175 181 181 LEU LEU A . n 
C 3 176 LEU 176 182 182 LEU LEU A . n 
C 3 177 GLU 177 183 183 GLU GLU A . n 
C 3 178 LYS 178 184 184 LYS LYS A . n 
C 3 179 LEU 179 185 185 LEU LEU A . n 
C 3 180 LEU 180 186 186 LEU LEU A . n 
C 3 181 SER 181 187 187 SER SER A . n 
C 3 182 ASP 182 188 188 ASP ASP A . n 
C 3 183 LYS 183 189 189 LYS LYS A . n 
C 3 184 HIS 184 190 190 HIS HIS A . n 
C 3 185 TYR 185 191 191 TYR TYR A . n 
C 3 186 PHE 186 192 192 PHE PHE A . n 
C 3 187 PRO 187 193 193 PRO PRO A . n 
C 3 188 PRO 188 194 194 PRO PRO A . n 
C 3 189 GLU 189 195 195 GLU GLU A . n 
C 3 190 ILE 190 196 196 ILE ILE A . n 
C 3 191 ASP 191 197 197 ASP ASP A . n 
C 3 192 PHE 192 198 198 PHE PHE A . n 
C 3 193 THR 193 199 199 THR THR A . n 
C 3 194 ASP 194 200 200 ASP ASP A . n 
C 3 195 VAL 195 201 201 VAL VAL A . n 
C 3 196 GLY 196 202 202 GLY GLY A . n 
C 3 197 TYR 197 203 203 TYR TYR A . n 
C 3 198 THR 198 204 204 THR THR A . n 
C 3 199 THR 199 205 205 THR THR A . n 
C 3 200 PHE 200 206 206 PHE PHE A . n 
C 3 201 TRP 201 207 207 TRP TRP A . n 
C 3 202 SER 202 208 208 SER SER A . n 
C 3 203 GLU 203 209 209 GLU GLU A . n 
C 3 204 SER 204 210 210 SER SER A . n 
C 3 205 LEU 205 211 211 LEU LEU A . n 
C 3 206 GLU 206 212 212 GLU GLU A . n 
C 3 207 ALA 207 213 213 ALA ALA A . n 
C 3 208 VAL 208 214 214 VAL VAL A . n 
C 3 209 ASP 209 215 215 ASP ASP A . n 
C 3 210 ILE 210 216 216 ILE ILE A . n 
C 3 211 GLU 211 217 217 GLU GLU A . n 
C 3 212 HIS 212 218 218 HIS HIS A . n 
C 3 213 ARG 213 219 219 ARG ARG A . n 
C 3 214 ALA 214 220 220 ALA ALA A . n 
C 3 215 ALA 215 221 221 ALA ALA A . n 
C 3 216 TRP 216 222 222 TRP TRP A . n 
C 3 217 LEU 217 223 223 LEU LEU A . n 
C 3 218 LEU 218 224 224 LEU LEU A . n 
C 3 219 ALA 219 225 225 ALA ALA A . n 
C 3 220 LYS 220 226 226 LYS LYS A . n 
C 3 221 GLN 221 227 227 GLN GLN A . n 
C 3 222 GLU 222 228 228 GLU GLU A . n 
C 3 223 ARG 223 229 229 ARG ARG A . n 
C 3 224 ASN 224 230 230 ASN ASN A . n 
C 3 225 GLY 225 231 231 GLY GLY A . n 
C 3 226 PHE 226 232 232 PHE PHE A . n 
C 3 227 PRO 227 233 233 PRO PRO A . n 
C 3 228 PHE 228 234 234 PHE PHE A . n 
C 3 229 ASP 229 235 235 ASP ASP A . n 
C 3 230 THR 230 236 236 THR THR A . n 
C 3 231 LYS 231 237 237 LYS LYS A . n 
C 3 232 ALA 232 238 238 ALA ALA A . n 
C 3 233 ILE 233 239 239 ILE ILE A . n 
C 3 234 GLU 234 240 240 GLU GLU A . n 
C 3 235 GLU 235 241 241 GLU GLU A . n 
C 3 236 LEU 236 242 242 LEU LEU A . n 
C 3 237 TYR 237 243 243 TYR TYR A . n 
C 3 238 VAL 238 244 244 VAL VAL A . n 
C 3 239 GLU 239 245 245 GLU GLU A . n 
C 3 240 LEU 240 246 246 LEU LEU A . n 
C 3 241 ALA 241 247 247 ALA ALA A . n 
C 3 242 ALA 242 248 248 ALA ALA A . n 
C 3 243 ARG 243 249 249 ARG ARG A . n 
C 3 244 ARG 244 250 250 ARG ARG A . n 
C 3 245 SER 245 251 251 SER SER A . n 
C 3 246 GLU 246 252 252 GLU GLU A . n 
C 3 247 LEU 247 253 253 LEU LEU A . n 
C 3 248 LEU 248 254 254 LEU LEU A . n 
C 3 249 ARG 249 255 255 ARG ARG A . n 
C 3 250 LYS 250 256 256 LYS LYS A . n 
C 3 251 LEU 251 257 257 LEU LEU A . n 
C 3 252 THR 252 258 258 THR THR A . n 
C 3 253 GLU 253 259 259 GLU GLU A . n 
C 3 254 THR 254 260 260 THR THR A . n 
C 3 255 PHE 255 261 261 PHE PHE A . n 
C 3 256 GLY 256 262 262 GLY GLY A . n 
C 3 257 SER 257 263 263 SER SER A . n 
C 3 258 TRP 258 264 264 TRP TRP A . n 
C 3 259 TYR 259 265 265 TYR TYR A . n 
C 3 260 GLN 260 266 266 GLN GLN A . n 
C 3 261 PRO 261 267 267 PRO PRO A . n 
C 3 262 LYS 262 268 268 LYS LYS A . n 
C 3 263 GLY 263 269 269 GLY GLY A . n 
C 3 264 GLY 264 270 270 GLY GLY A . n 
C 3 265 THR 265 271 271 THR THR A . n 
C 3 266 GLU 266 272 272 GLU GLU A . n 
C 3 267 MET 267 273 273 MET MET A . n 
C 3 268 PHE 268 274 274 PHE PHE A . n 
C 3 269 CYS 269 275 275 CYS CYS A . n 
C 3 270 HIS 270 276 276 HIS HIS A . n 
C 3 271 PRO 271 277 277 PRO PRO A . n 
C 3 272 ARG 272 278 278 ARG ARG A . n 
C 3 273 THR 273 279 279 THR THR A . n 
C 3 274 GLY 274 280 280 GLY GLY A . n 
C 3 275 LYS 275 281 281 LYS LYS A . n 
C 3 276 PRO 276 282 282 PRO PRO A . n 
C 3 277 LEU 277 283 283 LEU LEU A . n 
C 3 278 PRO 278 284 284 PRO PRO A . n 
C 3 279 LYS 279 285 285 LYS LYS A . n 
C 3 280 TYR 280 286 286 TYR TYR A . n 
C 3 281 PRO 281 287 287 PRO PRO A . n 
C 3 282 ARG 282 288 288 ARG ARG A . n 
C 3 283 ILE 283 289 289 ILE ILE A . n 
C 3 284 LYS 284 290 290 LYS LYS A . n 
C 3 285 THR 285 291 291 THR THR A . n 
C 3 286 PRO 286 292 292 PRO PRO A . n 
C 3 287 LYS 287 293 293 LYS LYS A . n 
C 3 288 VAL 288 294 294 VAL VAL A . n 
C 3 289 GLY 289 295 295 GLY GLY A . n 
C 3 290 GLY 290 296 296 GLY GLY A . n 
C 3 291 ILE 291 297 297 ILE ILE A . n 
C 3 292 PHE 292 298 298 PHE PHE A . n 
C 3 293 LYS 293 299 299 LYS LYS A . n 
C 3 294 LYS 294 300 300 LYS LYS A . n 
C 3 295 PRO 295 301 301 PRO PRO A . n 
C 3 296 LYS 296 302 ?   ?   ?   A . n 
C 3 297 ASN 297 303 ?   ?   ?   A . n 
C 3 298 LYS 298 304 ?   ?   ?   A . n 
C 3 299 ALA 299 305 ?   ?   ?   A . n 
C 3 300 GLN 300 306 ?   ?   ?   A . n 
C 3 301 ARG 301 307 ?   ?   ?   A . n 
C 3 302 GLU 302 308 ?   ?   ?   A . n 
C 3 303 GLY 303 309 ?   ?   ?   A . n 
C 3 304 ARG 304 310 ?   ?   ?   A . n 
C 3 305 GLU 305 311 311 GLU GLU A . n 
C 3 306 PRO 306 312 312 PRO PRO A . n 
C 3 307 CYS 307 313 313 CYS CYS A . n 
C 3 308 GLU 308 314 314 GLU GLU A . n 
C 3 309 LEU 309 315 315 LEU LEU A . n 
C 3 310 ASP 310 316 316 ASP ASP A . n 
C 3 311 THR 311 317 317 THR THR A . n 
C 3 312 ARG 312 318 318 ARG ARG A . n 
C 3 313 GLU 313 319 319 GLU GLU A . n 
C 3 314 TYR 314 320 320 TYR TYR A . n 
C 3 315 VAL 315 321 321 VAL VAL A . n 
C 3 316 ALA 316 322 322 ALA ALA A . n 
C 3 317 GLY 317 323 323 GLY GLY A . n 
C 3 318 ALA 318 324 324 ALA ALA A . n 
C 3 319 PRO 319 325 325 PRO PRO A . n 
C 3 320 TYR 320 326 326 TYR TYR A . n 
C 3 321 THR 321 327 327 THR THR A . n 
C 3 322 PRO 322 328 328 PRO PRO A . n 
C 3 323 VAL 323 329 329 VAL VAL A . n 
C 3 324 GLU 324 330 330 GLU GLU A . n 
C 3 325 HIS 325 331 331 HIS HIS A . n 
C 3 326 VAL 326 332 332 VAL VAL A . n 
C 3 327 VAL 327 333 333 VAL VAL A . n 
C 3 328 PHE 328 334 334 PHE PHE A . n 
C 3 329 ASN 329 335 335 ASN ASN A . n 
C 3 330 PRO 330 336 336 PRO PRO A . n 
C 3 331 SER 331 337 337 SER SER A . n 
C 3 332 SER 332 338 338 SER SER A . n 
C 3 333 ARG 333 339 339 ARG ARG A . n 
C 3 334 ASP 334 340 340 ASP ASP A . n 
C 3 335 HIS 335 341 341 HIS HIS A . n 
C 3 336 ILE 336 342 342 ILE ILE A . n 
C 3 337 GLN 337 343 343 GLN GLN A . n 
C 3 338 LYS 338 344 344 LYS LYS A . n 
C 3 339 LYS 339 345 345 LYS LYS A . n 
C 3 340 LEU 340 346 346 LEU LEU A . n 
C 3 341 GLN 341 347 347 GLN GLN A . n 
C 3 342 GLU 342 348 348 GLU GLU A . n 
C 3 343 ALA 343 349 349 ALA ALA A . n 
C 3 344 GLY 344 350 350 GLY GLY A . n 
C 3 345 TRP 345 351 351 TRP TRP A . n 
C 3 346 VAL 346 352 352 VAL VAL A . n 
C 3 347 PRO 347 353 353 PRO PRO A . n 
C 3 348 THR 348 354 354 THR THR A . n 
C 3 349 LYS 349 355 355 LYS LYS A . n 
C 3 350 TYR 350 356 356 TYR TYR A . n 
C 3 351 THR 351 357 357 THR THR A . n 
C 3 352 ASP 352 358 358 ASP ASP A . n 
C 3 353 LYS 353 359 359 LYS LYS A . n 
C 3 354 GLY 354 360 360 GLY GLY A . n 
C 3 355 ALA 355 361 361 ALA ALA A . n 
C 3 356 PRO 356 362 362 PRO PRO A . n 
C 3 357 VAL 357 363 363 VAL VAL A . n 
C 3 358 VAL 358 364 364 VAL VAL A . n 
C 3 359 ASP 359 365 365 ASP ASP A . n 
C 3 360 ASP 360 366 366 ASP ASP A . n 
C 3 361 GLU 361 367 367 GLU GLU A . n 
C 3 362 VAL 362 368 368 VAL VAL A . n 
C 3 363 LEU 363 369 369 LEU LEU A . n 
C 3 364 GLU 364 370 370 GLU GLU A . n 
C 3 365 GLY 365 371 371 GLY GLY A . n 
C 3 366 VAL 366 372 372 VAL VAL A . n 
C 3 367 ARG 367 373 373 ARG ARG A . n 
C 3 368 VAL 368 374 374 VAL VAL A . n 
C 3 369 ASP 369 375 375 ASP ASP A . n 
C 3 370 ASP 370 376 376 ASP ASP A . n 
C 3 371 PRO 371 377 377 PRO PRO A . n 
C 3 372 GLU 372 378 378 GLU GLU A . n 
C 3 373 LYS 373 379 379 LYS LYS A . n 
C 3 374 GLN 374 380 380 GLN GLN A . n 
C 3 375 ALA 375 381 381 ALA ALA A . n 
C 3 376 ALA 376 382 382 ALA ALA A . n 
C 3 377 ILE 377 383 383 ILE ILE A . n 
C 3 378 ASP 378 384 384 ASP ASP A . n 
C 3 379 LEU 379 385 385 LEU LEU A . n 
C 3 380 ILE 380 386 386 ILE ILE A . n 
C 3 381 LYS 381 387 387 LYS LYS A . n 
C 3 382 GLU 382 388 388 GLU GLU A . n 
C 3 383 TYR 383 389 389 TYR TYR A . n 
C 3 384 LEU 384 390 390 LEU LEU A . n 
C 3 385 MET 385 391 391 MET MET A . n 
C 3 386 ILE 386 392 392 ILE ILE A . n 
C 3 387 GLN 387 393 393 GLN GLN A . n 
C 3 388 LYS 388 394 394 LYS LYS A . n 
C 3 389 ARG 389 395 395 ARG ARG A . n 
C 3 390 ILE 390 396 396 ILE ILE A . n 
C 3 391 GLY 391 397 397 GLY GLY A . n 
C 3 392 GLN 392 398 398 GLN GLN A . n 
C 3 393 SER 393 399 399 SER SER A . n 
C 3 394 ALA 394 400 400 ALA ALA A . n 
C 3 395 GLU 395 401 401 GLU GLU A . n 
C 3 396 GLY 396 402 402 GLY GLY A . n 
C 3 397 ASP 397 403 403 ASP ASP A . n 
C 3 398 LYS 398 404 404 LYS LYS A . n 
C 3 399 ALA 399 405 405 ALA ALA A . n 
C 3 400 TRP 400 406 406 TRP TRP A . n 
C 3 401 LEU 401 407 407 LEU LEU A . n 
C 3 402 ARG 402 408 408 ARG ARG A . n 
C 3 403 TYR 403 409 409 TYR TYR A . n 
C 3 404 VAL 404 410 410 VAL VAL A . n 
C 3 405 ALA 405 411 411 ALA ALA A . n 
C 3 406 GLU 406 412 412 GLU GLU A . n 
C 3 407 ASP 407 413 413 ASP ASP A . n 
C 3 408 GLY 408 414 414 GLY GLY A . n 
C 3 409 LYS 409 415 415 LYS LYS A . n 
C 3 410 ILE 410 416 416 ILE ILE A . n 
C 3 411 HIS 411 417 417 HIS HIS A . n 
C 3 412 GLY 412 418 418 GLY GLY A . n 
C 3 413 SER 413 419 419 SER SER A . n 
C 3 414 VAL 414 420 420 VAL VAL A . n 
C 3 415 ASN 415 421 421 ASN ASN A . n 
C 3 416 PRO 416 422 422 PRO PRO A . n 
C 3 417 ASN 417 423 423 ASN ASN A . n 
C 3 418 GLY 418 424 424 GLY GLY A . n 
C 3 419 ALA 419 425 425 ALA ALA A . n 
C 3 420 VAL 420 426 426 VAL VAL A . n 
C 3 421 THR 421 427 427 THR THR A . n 
C 3 422 GLY 422 428 428 GLY GLY A . n 
C 3 423 ARG 423 429 429 ARG ARG A . n 
C 3 424 ALA 424 430 430 ALA ALA A . n 
C 3 425 THR 425 431 431 THR THR A . n 
C 3 426 HIS 426 432 432 HIS HIS A . n 
C 3 427 ALA 427 433 433 ALA ALA A . n 
C 3 428 PHE 428 434 434 PHE PHE A . n 
C 3 429 PRO 429 435 435 PRO PRO A . n 
C 3 430 ASN 430 436 436 ASN ASN A . n 
C 3 431 LEU 431 437 437 LEU LEU A . n 
C 3 432 ALA 432 438 438 ALA ALA A . n 
C 3 433 GLN 433 439 439 GLN GLN A . n 
C 3 434 ILE 434 440 440 ILE ILE A . n 
C 3 435 PRO 435 441 441 PRO PRO A . n 
C 3 436 GLY 436 442 442 GLY GLY A . n 
C 3 437 VAL 437 443 443 VAL VAL A . n 
C 3 438 ARG 438 444 444 ARG ARG A . n 
C 3 439 SER 439 445 445 SER SER A . n 
C 3 440 PRO 440 446 446 PRO PRO A . n 
C 3 441 TYR 441 447 447 TYR TYR A . n 
C 3 442 GLY 442 448 448 GLY GLY A . n 
C 3 443 GLU 443 449 449 GLU GLU A . n 
C 3 444 GLN 444 450 450 GLN GLN A . n 
C 3 445 CYS 445 451 451 CYS CYS A . n 
C 3 446 ARG 446 452 452 ARG ARG A . n 
C 3 447 ALA 447 453 453 ALA ALA A . n 
C 3 448 ALA 448 454 454 ALA ALA A . n 
C 3 449 PHE 449 455 455 PHE PHE A . n 
C 3 450 GLY 450 456 456 GLY GLY A . n 
C 3 451 ALA 451 457 457 ALA ALA A . n 
C 3 452 GLU 452 458 458 GLU GLU A . n 
C 3 453 HIS 453 459 459 HIS HIS A . n 
C 3 454 HIS 454 460 460 HIS HIS A . n 
C 3 455 LEU 455 461 461 LEU LEU A . n 
C 3 456 ASP 456 462 462 ASP ASP A . n 
C 3 457 GLY 457 463 463 GLY GLY A . n 
C 3 458 ILE 458 464 464 ILE ILE A . n 
C 3 459 THR 459 465 465 THR THR A . n 
C 3 460 GLY 460 466 466 GLY GLY A . n 
C 3 461 LYS 461 467 467 LYS LYS A . n 
C 3 462 PRO 462 468 468 PRO PRO A . n 
C 3 463 TRP 463 469 469 TRP TRP A . n 
C 3 464 VAL 464 470 470 VAL VAL A . n 
C 3 465 GLN 465 471 471 GLN GLN A . n 
C 3 466 ALA 466 472 472 ALA ALA A . n 
C 3 467 GLY 467 473 473 GLY GLY A . n 
C 3 468 ILE 468 474 474 ILE ILE A . n 
C 3 469 ASP 469 475 475 ASP ASP A . n 
C 3 470 ALA 470 476 476 ALA ALA A . n 
C 3 471 SER 471 477 477 SER SER A . n 
C 3 472 GLY 472 478 478 GLY GLY A . n 
C 3 473 LEU 473 479 479 LEU LEU A . n 
C 3 474 GLU 474 480 480 GLU GLU A . n 
C 3 475 LEU 475 481 481 LEU LEU A . n 
C 3 476 ARG 476 482 482 ARG ARG A . n 
C 3 477 CYS 477 483 483 CYS CYS A . n 
C 3 478 LEU 478 484 484 LEU LEU A . n 
C 3 479 ALA 479 485 485 ALA ALA A . n 
C 3 480 HIS 480 486 486 HIS HIS A . n 
C 3 481 PHE 481 487 487 PHE PHE A . n 
C 3 482 MET 482 488 488 MET MET A . n 
C 3 483 ALA 483 489 489 ALA ALA A . n 
C 3 484 ARG 484 490 490 ARG ARG A . n 
C 3 485 PHE 485 491 491 PHE PHE A . n 
C 3 486 ASP 486 492 492 ASP ASP A . n 
C 3 487 ASN 487 493 493 ASN ASN A . n 
C 3 488 GLY 488 494 494 GLY GLY A . n 
C 3 489 GLU 489 495 495 GLU GLU A . n 
C 3 490 TYR 490 496 496 TYR TYR A . n 
C 3 491 ALA 491 497 497 ALA ALA A . n 
C 3 492 HIS 492 498 498 HIS HIS A . n 
C 3 493 GLU 493 499 499 GLU GLU A . n 
C 3 494 ILE 494 500 500 ILE ILE A . n 
C 3 495 LEU 495 501 501 LEU LEU A . n 
C 3 496 ASN 496 502 502 ASN ASN A . n 
C 3 497 GLY 497 503 503 GLY GLY A . n 
C 3 498 ASP 498 504 504 ASP ASP A . n 
C 3 499 ILE 499 505 505 ILE ILE A . n 
C 3 500 HIS 500 506 506 HIS HIS A . n 
C 3 501 THR 501 507 507 THR THR A . n 
C 3 502 LYS 502 508 508 LYS LYS A . n 
C 3 503 ASN 503 509 509 ASN ASN A . n 
C 3 504 GLN 504 510 510 GLN GLN A . n 
C 3 505 ILE 505 511 511 ILE ILE A . n 
C 3 506 ALA 506 512 512 ALA ALA A . n 
C 3 507 ALA 507 513 513 ALA ALA A . n 
C 3 508 GLU 508 514 514 GLU GLU A . n 
C 3 509 LEU 509 515 515 LEU LEU A . n 
C 3 510 PRO 510 516 516 PRO PRO A . n 
C 3 511 THR 511 517 517 THR THR A . n 
C 3 512 ARG 512 518 518 ARG ARG A . n 
C 3 513 ASP 513 519 519 ASP ASP A . n 
C 3 514 ASN 514 520 520 ASN ASN A . n 
C 3 515 ALA 515 521 521 ALA ALA A . n 
C 3 516 LYS 516 522 522 LYS LYS A . n 
C 3 517 THR 517 523 523 THR THR A . n 
C 3 518 PHE 518 524 524 PHE PHE A . n 
C 3 519 ILE 519 525 525 ILE ILE A . n 
C 3 520 TYR 520 526 526 TYR TYR A . n 
C 3 521 GLY 521 527 527 GLY GLY A . n 
C 3 522 PHE 522 528 528 PHE PHE A . n 
C 3 523 LEU 523 529 529 LEU LEU A . n 
C 3 524 TYR 524 530 530 TYR TYR A . n 
C 3 525 GLY 525 531 531 GLY GLY A . n 
C 3 526 ALA 526 532 532 ALA ALA A . n 
C 3 527 GLY 527 533 533 GLY GLY A . n 
C 3 528 ASP 528 534 534 ASP ASP A . n 
C 3 529 GLU 529 535 535 GLU GLU A . n 
C 3 530 LYS 530 536 536 LYS LYS A . n 
C 3 531 ILE 531 537 537 ILE ILE A . n 
C 3 532 GLY 532 538 538 GLY GLY A . n 
C 3 533 GLN 533 539 539 GLN GLN A . n 
C 3 534 ILE 534 540 540 ILE ILE A . n 
C 3 535 VAL 535 541 541 VAL VAL A . n 
C 3 536 GLY 536 542 542 GLY GLY A . n 
C 3 537 ALA 537 543 543 ALA ALA A . n 
C 3 538 GLY 538 544 544 GLY GLY A . n 
C 3 539 LYS 539 545 545 LYS LYS A . n 
C 3 540 GLU 540 546 546 GLU GLU A . n 
C 3 541 ARG 541 547 547 ARG ARG A . n 
C 3 542 GLY 542 548 548 GLY GLY A . n 
C 3 543 LYS 543 549 549 LYS LYS A . n 
C 3 544 GLU 544 550 550 GLU GLU A . n 
C 3 545 LEU 545 551 551 LEU LEU A . n 
C 3 546 LYS 546 552 552 LYS LYS A . n 
C 3 547 LYS 547 553 553 LYS LYS A . n 
C 3 548 LYS 548 554 554 LYS LYS A . n 
C 3 549 PHE 549 555 555 PHE PHE A . n 
C 3 550 LEU 550 556 556 LEU LEU A . n 
C 3 551 GLU 551 557 557 GLU GLU A . n 
C 3 552 ASN 552 558 558 ASN ASN A . n 
C 3 553 THR 553 559 559 THR THR A . n 
C 3 554 PRO 554 560 560 PRO PRO A . n 
C 3 555 ALA 555 561 561 ALA ALA A . n 
C 3 556 ILE 556 562 562 ILE ILE A . n 
C 3 557 ALA 557 563 563 ALA ALA A . n 
C 3 558 ALA 558 564 564 ALA ALA A . n 
C 3 559 LEU 559 565 565 LEU LEU A . n 
C 3 560 ARG 560 566 566 ARG ARG A . n 
C 3 561 GLU 561 567 567 GLU GLU A . n 
C 3 562 SER 562 568 568 SER SER A . n 
C 3 563 ILE 563 569 569 ILE ILE A . n 
C 3 564 GLN 564 570 570 GLN GLN A . n 
C 3 565 GLN 565 571 571 GLN GLN A . n 
C 3 566 THR 566 572 572 THR THR A . n 
C 3 567 LEU 567 573 573 LEU LEU A . n 
C 3 568 VAL 568 574 574 VAL VAL A . n 
C 3 569 GLU 569 575 575 GLU GLU A . n 
C 3 570 SER 570 576 ?   ?   ?   A . n 
C 3 571 SER 571 577 ?   ?   ?   A . n 
C 3 572 GLN 572 578 ?   ?   ?   A . n 
C 3 573 TRP 573 579 ?   ?   ?   A . n 
C 3 574 VAL 574 580 ?   ?   ?   A . n 
C 3 575 ALA 575 581 ?   ?   ?   A . n 
C 3 576 GLY 576 582 ?   ?   ?   A . n 
C 3 577 GLU 577 583 ?   ?   ?   A . n 
C 3 578 GLN 578 584 ?   ?   ?   A . n 
C 3 579 GLN 579 585 ?   ?   ?   A . n 
C 3 580 VAL 580 586 ?   ?   ?   A . n 
C 3 581 LYS 581 587 587 LYS LYS A . n 
C 3 582 TRP 582 588 588 TRP TRP A . n 
C 3 583 LYS 583 589 589 LYS LYS A . n 
C 3 584 ARG 584 590 590 ARG ARG A . n 
C 3 585 ARG 585 591 591 ARG ARG A . n 
C 3 586 TRP 586 592 592 TRP TRP A . n 
C 3 587 ILE 587 593 593 ILE ILE A . n 
C 3 588 LYS 588 594 594 LYS LYS A . n 
C 3 589 GLY 589 595 595 GLY GLY A . n 
C 3 590 LEU 590 596 596 LEU LEU A . n 
C 3 591 ASP 591 597 597 ASP ASP A . n 
C 3 592 GLY 592 598 598 GLY GLY A . n 
C 3 593 ARG 593 599 599 ARG ARG A . n 
C 3 594 LYS 594 600 600 LYS LYS A . n 
C 3 595 VAL 595 601 601 VAL VAL A . n 
C 3 596 HIS 596 602 602 HIS HIS A . n 
C 3 597 VAL 597 603 603 VAL VAL A . n 
C 3 598 ARG 598 604 604 ARG ARG A . n 
C 3 599 SER 599 605 605 SER SER A . n 
C 3 600 PRO 600 606 606 PRO PRO A . n 
C 3 601 HIS 601 607 607 HIS HIS A . n 
C 3 602 ALA 602 608 608 ALA ALA A . n 
C 3 603 ALA 603 609 609 ALA ALA A . n 
C 3 604 LEU 604 610 610 LEU LEU A . n 
C 3 605 ASN 605 611 611 ASN ASN A . n 
C 3 606 THR 606 612 612 THR THR A . n 
C 3 607 LEU 607 613 613 LEU LEU A . n 
C 3 608 LEU 608 614 614 LEU LEU A . n 
C 3 609 GLN 609 615 615 GLN GLN A . n 
C 3 610 SER 610 616 616 SER SER A . n 
C 3 611 ALA 611 617 617 ALA ALA A . n 
C 3 612 GLY 612 618 618 GLY GLY A . n 
C 3 613 ALA 613 619 619 ALA ALA A . n 
C 3 614 LEU 614 620 620 LEU LEU A . n 
C 3 615 ILE 615 621 621 ILE ILE A . n 
C 3 616 CYS 616 622 622 CYS CYS A . n 
C 3 617 LYS 617 623 623 LYS LYS A . n 
C 3 618 LEU 618 624 624 LEU LEU A . n 
C 3 619 TRP 619 625 625 TRP TRP A . n 
C 3 620 ILE 620 626 626 ILE ILE A . n 
C 3 621 ILE 621 627 627 ILE ILE A . n 
C 3 622 LYS 622 628 628 LYS LYS A . n 
C 3 623 THR 623 629 629 THR THR A . n 
C 3 624 GLU 624 630 630 GLU GLU A . n 
C 3 625 GLU 625 631 631 GLU GLU A . n 
C 3 626 MET 626 632 632 MET MET A . n 
C 3 627 LEU 627 633 633 LEU LEU A . n 
C 3 628 VAL 628 634 634 VAL VAL A . n 
C 3 629 GLU 629 635 635 GLU GLU A . n 
C 3 630 LYS 630 636 636 LYS LYS A . n 
C 3 631 GLY 631 637 637 GLY GLY A . n 
C 3 632 LEU 632 638 638 LEU LEU A . n 
C 3 633 LYS 633 639 639 LYS LYS A . n 
C 3 634 HIS 634 640 640 HIS HIS A . n 
C 3 635 GLY 635 641 641 GLY GLY A . n 
C 3 636 TRP 636 642 642 TRP TRP A . n 
C 3 637 ASP 637 643 643 ASP ASP A . n 
C 3 638 GLY 638 644 644 GLY GLY A . n 
C 3 639 ASP 639 645 645 ASP ASP A . n 
C 3 640 PHE 640 646 646 PHE PHE A . n 
C 3 641 ALA 641 647 647 ALA ALA A . n 
C 3 642 TYR 642 648 648 TYR TYR A . n 
C 3 643 MET 643 649 649 MET MET A . n 
C 3 644 ALA 644 650 650 ALA ALA A . n 
C 3 645 TRP 645 651 651 TRP TRP A . n 
C 3 646 VAL 646 652 652 VAL VAL A . n 
C 3 647 HIS 647 653 653 HIS HIS A . n 
C 3 648 ASP 648 654 654 ASP ASP A . n 
C 3 649 GLU 649 655 655 GLU GLU A . n 
C 3 650 ILE 650 656 656 ILE ILE A . n 
C 3 651 GLN 651 657 657 GLN GLN A . n 
C 3 652 VAL 652 658 658 VAL VAL A . n 
C 3 653 GLY 653 659 659 GLY GLY A . n 
C 3 654 CYS 654 660 660 CYS CYS A . n 
C 3 655 ARG 655 661 661 ARG ARG A . n 
C 3 656 THR 656 662 662 THR THR A . n 
C 3 657 GLU 657 663 663 GLU GLU A . n 
C 3 658 GLU 658 664 664 GLU GLU A . n 
C 3 659 ILE 659 665 665 ILE ILE A . n 
C 3 660 ALA 660 666 666 ALA ALA A . n 
C 3 661 GLN 661 667 667 GLN GLN A . n 
C 3 662 VAL 662 668 668 VAL VAL A . n 
C 3 663 VAL 663 669 669 VAL VAL A . n 
C 3 664 ILE 664 670 670 ILE ILE A . n 
C 3 665 GLU 665 671 671 GLU GLU A . n 
C 3 666 THR 666 672 672 THR THR A . n 
C 3 667 ALA 667 673 673 ALA ALA A . n 
C 3 668 GLN 668 674 674 GLN GLN A . n 
C 3 669 GLU 669 675 675 GLU GLU A . n 
C 3 670 ALA 670 676 676 ALA ALA A . n 
C 3 671 MET 671 677 677 MET MET A . n 
C 3 672 ARG 672 678 678 ARG ARG A . n 
C 3 673 TRP 673 679 679 TRP TRP A . n 
C 3 674 VAL 674 680 680 VAL VAL A . n 
C 3 675 GLY 675 681 681 GLY GLY A . n 
C 3 676 ASP 676 682 682 ASP ASP A . n 
C 3 677 HIS 677 683 683 HIS HIS A . n 
C 3 678 TRP 678 684 684 TRP TRP A . n 
C 3 679 ASN 679 685 685 ASN ASN A . n 
C 3 680 PHE 680 686 686 PHE PHE A . n 
C 3 681 ARG 681 687 687 ARG ARG A . n 
C 3 682 CYS 682 688 688 CYS CYS A . n 
C 3 683 LEU 683 689 689 LEU LEU A . n 
C 3 684 LEU 684 690 690 LEU LEU A . n 
C 3 685 ASP 685 691 691 ASP ASP A . n 
C 3 686 THR 686 692 692 THR THR A . n 
C 3 687 GLU 687 693 693 GLU GLU A . n 
C 3 688 GLY 688 694 694 GLY GLY A . n 
C 3 689 LYS 689 695 695 LYS LYS A . n 
C 3 690 MET 690 696 696 MET MET A . n 
C 3 691 GLY 691 697 697 GLY GLY A . n 
C 3 692 PRO 692 698 698 PRO PRO A . n 
C 3 693 ASN 693 699 699 ASN ASN A . n 
C 3 694 TRP 694 700 700 TRP TRP A . n 
C 3 695 ALA 695 701 701 ALA ALA A . n 
C 3 696 ILE 696 702 702 ILE ILE A . n 
C 3 697 CYS 697 703 703 CYS CYS A . n 
C 3 698 HIS 698 704 704 HIS HIS A . n 
D 4 1   SER 1   1   ?   ?   ?   B . n 
D 4 2   ASP 2   2   ?   ?   ?   B . n 
D 4 3   LYS 3   3   3   LYS LYS B . n 
D 4 4   ILE 4   4   4   ILE ILE B . n 
D 4 5   ILE 5   5   5   ILE ILE B . n 
D 4 6   HIS 6   6   6   HIS HIS B . n 
D 4 7   LEU 7   7   7   LEU LEU B . n 
D 4 8   THR 8   8   8   THR THR B . n 
D 4 9   ASP 9   9   9   ASP ASP B . n 
D 4 10  ASP 10  10  10  ASP ASP B . n 
D 4 11  SER 11  11  11  SER SER B . n 
D 4 12  PHE 12  12  12  PHE PHE B . n 
D 4 13  ASP 13  13  13  ASP ASP B . n 
D 4 14  THR 14  14  14  THR THR B . n 
D 4 15  ASP 15  15  15  ASP ASP B . n 
D 4 16  VAL 16  16  16  VAL VAL B . n 
D 4 17  LEU 17  17  17  LEU LEU B . n 
D 4 18  LYS 18  18  18  LYS LYS B . n 
D 4 19  ALA 19  19  19  ALA ALA B . n 
D 4 20  ASP 20  20  20  ASP ASP B . n 
D 4 21  GLY 21  21  21  GLY GLY B . n 
D 4 22  ALA 22  22  22  ALA ALA B . n 
D 4 23  ILE 23  23  23  ILE ILE B . n 
D 4 24  LEU 24  24  24  LEU LEU B . n 
D 4 25  VAL 25  25  25  VAL VAL B . n 
D 4 26  ASP 26  26  26  ASP ASP B . n 
D 4 27  PHE 27  27  27  PHE PHE B . n 
D 4 28  TRP 28  28  28  TRP TRP B . n 
D 4 29  ALA 29  29  29  ALA ALA B . n 
D 4 30  GLU 30  30  30  GLU GLU B . n 
D 4 31  TRP 31  31  31  TRP TRP B . n 
D 4 32  CYS 32  32  32  CYS CYS B . n 
D 4 33  GLY 33  33  33  GLY GLY B . n 
D 4 34  PRO 34  34  34  PRO PRO B . n 
D 4 35  CYS 35  35  35  CYS CYS B . n 
D 4 36  LYS 36  36  36  LYS LYS B . n 
D 4 37  MET 37  37  37  MET MET B . n 
D 4 38  ILE 38  38  38  ILE ILE B . n 
D 4 39  ALA 39  39  39  ALA ALA B . n 
D 4 40  PRO 40  40  40  PRO PRO B . n 
D 4 41  ILE 41  41  41  ILE ILE B . n 
D 4 42  LEU 42  42  42  LEU LEU B . n 
D 4 43  ASP 43  43  43  ASP ASP B . n 
D 4 44  GLU 44  44  44  GLU GLU B . n 
D 4 45  ILE 45  45  45  ILE ILE B . n 
D 4 46  ALA 46  46  46  ALA ALA B . n 
D 4 47  ASP 47  47  47  ASP ASP B . n 
D 4 48  GLU 48  48  48  GLU GLU B . n 
D 4 49  TYR 49  49  49  TYR TYR B . n 
D 4 50  GLN 50  50  50  GLN GLN B . n 
D 4 51  GLY 51  51  51  GLY GLY B . n 
D 4 52  LYS 52  52  52  LYS LYS B . n 
D 4 53  LEU 53  53  53  LEU LEU B . n 
D 4 54  THR 54  54  54  THR THR B . n 
D 4 55  VAL 55  55  55  VAL VAL B . n 
D 4 56  ALA 56  56  56  ALA ALA B . n 
D 4 57  LYS 57  57  57  LYS LYS B . n 
D 4 58  LEU 58  58  58  LEU LEU B . n 
D 4 59  ASN 59  59  59  ASN ASN B . n 
D 4 60  ILE 60  60  60  ILE ILE B . n 
D 4 61  ASP 61  61  61  ASP ASP B . n 
D 4 62  GLN 62  62  62  GLN GLN B . n 
D 4 63  ASN 63  63  63  ASN ASN B . n 
D 4 64  PRO 64  64  64  PRO PRO B . n 
D 4 65  GLY 65  65  65  GLY GLY B . n 
D 4 66  THR 66  66  66  THR THR B . n 
D 4 67  ALA 67  67  67  ALA ALA B . n 
D 4 68  PRO 68  68  68  PRO PRO B . n 
D 4 69  LYS 69  69  69  LYS LYS B . n 
D 4 70  TYR 70  70  70  TYR TYR B . n 
D 4 71  GLY 71  71  71  GLY GLY B . n 
D 4 72  ILE 72  72  72  ILE ILE B . n 
D 4 73  ARG 73  73  73  ARG ARG B . n 
D 4 74  GLY 74  74  74  GLY GLY B . n 
D 4 75  ILE 75  75  75  ILE ILE B . n 
D 4 76  PRO 76  76  76  PRO PRO B . n 
D 4 77  THR 77  77  77  THR THR B . n 
D 4 78  LEU 78  78  78  LEU LEU B . n 
D 4 79  LEU 79  79  79  LEU LEU B . n 
D 4 80  LEU 80  80  80  LEU LEU B . n 
D 4 81  PHE 81  81  81  PHE PHE B . n 
D 4 82  LYS 82  82  82  LYS LYS B . n 
D 4 83  ASN 83  83  83  ASN ASN B . n 
D 4 84  GLY 84  84  84  GLY GLY B . n 
D 4 85  GLU 85  85  85  GLU GLU B . n 
D 4 86  VAL 86  86  86  VAL VAL B . n 
D 4 87  ALA 87  87  87  ALA ALA B . n 
D 4 88  ALA 88  88  88  ALA ALA B . n 
D 4 89  THR 89  89  89  THR THR B . n 
D 4 90  LYS 90  90  90  LYS LYS B . n 
D 4 91  VAL 91  91  91  VAL VAL B . n 
D 4 92  GLY 92  92  92  GLY GLY B . n 
D 4 93  ALA 93  93  93  ALA ALA B . n 
D 4 94  LEU 94  94  94  LEU LEU B . n 
D 4 95  SER 95  95  95  SER SER B . n 
D 4 96  LYS 96  96  96  LYS LYS B . n 
D 4 97  GLY 97  97  97  GLY GLY B . n 
D 4 98  GLN 98  98  98  GLN GLN B . n 
D 4 99  LEU 99  99  99  LEU LEU B . n 
D 4 100 LYS 100 100 100 LYS LYS B . n 
D 4 101 GLU 101 101 101 GLU GLU B . n 
D 4 102 PHE 102 102 102 PHE PHE B . n 
D 4 103 LEU 103 103 103 LEU LEU B . n 
D 4 104 ASP 104 104 104 ASP ASP B . n 
D 4 105 ALA 105 105 105 ALA ALA B . n 
D 4 106 ASN 106 106 106 ASN ASN B . n 
D 4 107 LEU 107 107 107 LEU LEU B . n 
D 4 108 ALA 108 108 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 MG  1   4003 4003 MG  MG  A . 
F 6 HOH 1   5022 5022 HOH HOH T . 
F 6 HOH 2   5083 5083 HOH HOH T . 
F 6 HOH 3   5105 5105 HOH HOH T . 
F 6 HOH 4   5125 5125 HOH HOH T . 
F 6 HOH 5   5165 5165 HOH HOH T . 
F 6 HOH 6   5260 5260 HOH HOH T . 
G 6 HOH 1   5001 5001 HOH HOH A . 
G 6 HOH 2   5002 5002 HOH HOH A . 
G 6 HOH 3   5003 5003 HOH HOH A . 
G 6 HOH 4   5005 5005 HOH HOH A . 
G 6 HOH 5   5007 5007 HOH HOH A . 
G 6 HOH 6   5008 5008 HOH HOH A . 
G 6 HOH 7   5009 5009 HOH HOH A . 
G 6 HOH 8   5010 5010 HOH HOH A . 
G 6 HOH 9   5011 5011 HOH HOH A . 
G 6 HOH 10  5012 5012 HOH HOH A . 
G 6 HOH 11  5013 5013 HOH HOH A . 
G 6 HOH 12  5014 5014 HOH HOH A . 
G 6 HOH 13  5015 5015 HOH HOH A . 
G 6 HOH 14  5016 5016 HOH HOH A . 
G 6 HOH 15  5018 5018 HOH HOH A . 
G 6 HOH 16  5019 5019 HOH HOH A . 
G 6 HOH 17  5020 5020 HOH HOH A . 
G 6 HOH 18  5021 5021 HOH HOH A . 
G 6 HOH 19  5023 5023 HOH HOH A . 
G 6 HOH 20  5025 5025 HOH HOH A . 
G 6 HOH 21  5026 5026 HOH HOH A . 
G 6 HOH 22  5027 5027 HOH HOH A . 
G 6 HOH 23  5028 5028 HOH HOH A . 
G 6 HOH 24  5029 5029 HOH HOH A . 
G 6 HOH 25  5030 5030 HOH HOH A . 
G 6 HOH 26  5032 5032 HOH HOH A . 
G 6 HOH 27  5033 5033 HOH HOH A . 
G 6 HOH 28  5034 5034 HOH HOH A . 
G 6 HOH 29  5035 5035 HOH HOH A . 
G 6 HOH 30  5036 5036 HOH HOH A . 
G 6 HOH 31  5037 5037 HOH HOH A . 
G 6 HOH 32  5038 5038 HOH HOH A . 
G 6 HOH 33  5039 5039 HOH HOH A . 
G 6 HOH 34  5041 5041 HOH HOH A . 
G 6 HOH 35  5042 5042 HOH HOH A . 
G 6 HOH 36  5043 5043 HOH HOH A . 
G 6 HOH 37  5044 5044 HOH HOH A . 
G 6 HOH 38  5045 5045 HOH HOH A . 
G 6 HOH 39  5046 5046 HOH HOH A . 
G 6 HOH 40  5047 5047 HOH HOH A . 
G 6 HOH 41  5049 5049 HOH HOH A . 
G 6 HOH 42  5050 5050 HOH HOH A . 
G 6 HOH 43  5051 5051 HOH HOH A . 
G 6 HOH 44  5052 5052 HOH HOH A . 
G 6 HOH 45  5053 5053 HOH HOH A . 
G 6 HOH 46  5054 5054 HOH HOH A . 
G 6 HOH 47  5055 5055 HOH HOH A . 
G 6 HOH 48  5056 5056 HOH HOH A . 
G 6 HOH 49  5058 5058 HOH HOH A . 
G 6 HOH 50  5059 5059 HOH HOH A . 
G 6 HOH 51  5060 5060 HOH HOH A . 
G 6 HOH 52  5061 5061 HOH HOH A . 
G 6 HOH 53  5062 5062 HOH HOH A . 
G 6 HOH 54  5063 5063 HOH HOH A . 
G 6 HOH 55  5064 5064 HOH HOH A . 
G 6 HOH 56  5065 5065 HOH HOH A . 
G 6 HOH 57  5066 5066 HOH HOH A . 
G 6 HOH 58  5067 5067 HOH HOH A . 
G 6 HOH 59  5068 5068 HOH HOH A . 
G 6 HOH 60  5069 5069 HOH HOH A . 
G 6 HOH 61  5070 5070 HOH HOH A . 
G 6 HOH 62  5071 5071 HOH HOH A . 
G 6 HOH 63  5072 5072 HOH HOH A . 
G 6 HOH 64  5073 5073 HOH HOH A . 
G 6 HOH 65  5074 5074 HOH HOH A . 
G 6 HOH 66  5075 5075 HOH HOH A . 
G 6 HOH 67  5076 5076 HOH HOH A . 
G 6 HOH 68  5078 5078 HOH HOH A . 
G 6 HOH 69  5080 5080 HOH HOH A . 
G 6 HOH 70  5081 5081 HOH HOH A . 
G 6 HOH 71  5082 5082 HOH HOH A . 
G 6 HOH 72  5084 5084 HOH HOH A . 
G 6 HOH 73  5085 5085 HOH HOH A . 
G 6 HOH 74  5086 5086 HOH HOH A . 
G 6 HOH 75  5087 5087 HOH HOH A . 
G 6 HOH 76  5088 5088 HOH HOH A . 
G 6 HOH 77  5089 5089 HOH HOH A . 
G 6 HOH 78  5090 5090 HOH HOH A . 
G 6 HOH 79  5091 5091 HOH HOH A . 
G 6 HOH 80  5092 5092 HOH HOH A . 
G 6 HOH 81  5093 5093 HOH HOH A . 
G 6 HOH 82  5094 5094 HOH HOH A . 
G 6 HOH 83  5095 5095 HOH HOH A . 
G 6 HOH 84  5096 5096 HOH HOH A . 
G 6 HOH 85  5097 5097 HOH HOH A . 
G 6 HOH 86  5098 5098 HOH HOH A . 
G 6 HOH 87  5099 5099 HOH HOH A . 
G 6 HOH 88  5100 5100 HOH HOH A . 
G 6 HOH 89  5101 5101 HOH HOH A . 
G 6 HOH 90  5102 5102 HOH HOH A . 
G 6 HOH 91  5103 5103 HOH HOH A . 
G 6 HOH 92  5104 5104 HOH HOH A . 
G 6 HOH 93  5106 5106 HOH HOH A . 
G 6 HOH 94  5107 5107 HOH HOH A . 
G 6 HOH 95  5108 5108 HOH HOH A . 
G 6 HOH 96  5109 5109 HOH HOH A . 
G 6 HOH 97  5111 5111 HOH HOH A . 
G 6 HOH 98  5112 5112 HOH HOH A . 
G 6 HOH 99  5113 5113 HOH HOH A . 
G 6 HOH 100 5114 5114 HOH HOH A . 
G 6 HOH 101 5117 5117 HOH HOH A . 
G 6 HOH 102 5118 5118 HOH HOH A . 
G 6 HOH 103 5119 5119 HOH HOH A . 
G 6 HOH 104 5121 5121 HOH HOH A . 
G 6 HOH 105 5122 5122 HOH HOH A . 
G 6 HOH 106 5123 5123 HOH HOH A . 
G 6 HOH 107 5126 5126 HOH HOH A . 
G 6 HOH 108 5127 5127 HOH HOH A . 
G 6 HOH 109 5128 5128 HOH HOH A . 
G 6 HOH 110 5129 5129 HOH HOH A . 
G 6 HOH 111 5131 5131 HOH HOH A . 
G 6 HOH 112 5132 5132 HOH HOH A . 
G 6 HOH 113 5133 5133 HOH HOH A . 
G 6 HOH 114 5134 5134 HOH HOH A . 
G 6 HOH 115 5135 5135 HOH HOH A . 
G 6 HOH 116 5136 5136 HOH HOH A . 
G 6 HOH 117 5138 5138 HOH HOH A . 
G 6 HOH 118 5140 5140 HOH HOH A . 
G 6 HOH 119 5141 5141 HOH HOH A . 
G 6 HOH 120 5142 5142 HOH HOH A . 
G 6 HOH 121 5143 5143 HOH HOH A . 
G 6 HOH 122 5144 5144 HOH HOH A . 
G 6 HOH 123 5145 5145 HOH HOH A . 
G 6 HOH 124 5146 5146 HOH HOH A . 
G 6 HOH 125 5147 5147 HOH HOH A . 
G 6 HOH 126 5148 5148 HOH HOH A . 
G 6 HOH 127 5149 5149 HOH HOH A . 
G 6 HOH 128 5150 5150 HOH HOH A . 
G 6 HOH 129 5152 5152 HOH HOH A . 
G 6 HOH 130 5153 5153 HOH HOH A . 
G 6 HOH 131 5154 5154 HOH HOH A . 
G 6 HOH 132 5155 5155 HOH HOH A . 
G 6 HOH 133 5156 5156 HOH HOH A . 
G 6 HOH 134 5157 5157 HOH HOH A . 
G 6 HOH 135 5158 5158 HOH HOH A . 
G 6 HOH 136 5159 5159 HOH HOH A . 
G 6 HOH 137 5160 5160 HOH HOH A . 
G 6 HOH 138 5162 5162 HOH HOH A . 
G 6 HOH 139 5163 5163 HOH HOH A . 
G 6 HOH 140 5166 5166 HOH HOH A . 
G 6 HOH 141 5167 5167 HOH HOH A . 
G 6 HOH 142 5168 5168 HOH HOH A . 
G 6 HOH 143 5169 5169 HOH HOH A . 
G 6 HOH 144 5170 5170 HOH HOH A . 
G 6 HOH 145 5172 5172 HOH HOH A . 
G 6 HOH 146 5173 5173 HOH HOH A . 
G 6 HOH 147 5174 5174 HOH HOH A . 
G 6 HOH 148 5175 5175 HOH HOH A . 
G 6 HOH 149 5176 5176 HOH HOH A . 
G 6 HOH 150 5177 5177 HOH HOH A . 
G 6 HOH 151 5178 5178 HOH HOH A . 
G 6 HOH 152 5179 5179 HOH HOH A . 
G 6 HOH 153 5182 5182 HOH HOH A . 
G 6 HOH 154 5183 5183 HOH HOH A . 
G 6 HOH 155 5184 5184 HOH HOH A . 
G 6 HOH 156 5185 5185 HOH HOH A . 
G 6 HOH 157 5188 5188 HOH HOH A . 
G 6 HOH 158 5189 5189 HOH HOH A . 
G 6 HOH 159 5191 5191 HOH HOH A . 
G 6 HOH 160 5193 5193 HOH HOH A . 
G 6 HOH 161 5194 5194 HOH HOH A . 
G 6 HOH 162 5195 5195 HOH HOH A . 
G 6 HOH 163 5197 5197 HOH HOH A . 
G 6 HOH 164 5198 5198 HOH HOH A . 
G 6 HOH 165 5199 5199 HOH HOH A . 
G 6 HOH 166 5200 5200 HOH HOH A . 
G 6 HOH 167 5201 5201 HOH HOH A . 
G 6 HOH 168 5202 5202 HOH HOH A . 
G 6 HOH 169 5204 5204 HOH HOH A . 
G 6 HOH 170 5205 5205 HOH HOH A . 
G 6 HOH 171 5206 5206 HOH HOH A . 
G 6 HOH 172 5207 5207 HOH HOH A . 
G 6 HOH 173 5208 5208 HOH HOH A . 
G 6 HOH 174 5209 5209 HOH HOH A . 
G 6 HOH 175 5210 5210 HOH HOH A . 
G 6 HOH 176 5212 5212 HOH HOH A . 
G 6 HOH 177 5214 5214 HOH HOH A . 
G 6 HOH 178 5216 5216 HOH HOH A . 
G 6 HOH 179 5217 5217 HOH HOH A . 
G 6 HOH 180 5220 5220 HOH HOH A . 
G 6 HOH 181 5221 5221 HOH HOH A . 
G 6 HOH 182 5224 5224 HOH HOH A . 
G 6 HOH 183 5225 5225 HOH HOH A . 
G 6 HOH 184 5226 5226 HOH HOH A . 
G 6 HOH 185 5228 5228 HOH HOH A . 
G 6 HOH 186 5229 5229 HOH HOH A . 
G 6 HOH 187 5231 5231 HOH HOH A . 
G 6 HOH 188 5236 5236 HOH HOH A . 
G 6 HOH 189 5239 5239 HOH HOH A . 
G 6 HOH 190 5240 5240 HOH HOH A . 
G 6 HOH 191 5241 5241 HOH HOH A . 
G 6 HOH 192 5242 5242 HOH HOH A . 
G 6 HOH 193 5243 5243 HOH HOH A . 
G 6 HOH 194 5244 5244 HOH HOH A . 
G 6 HOH 195 5245 5245 HOH HOH A . 
G 6 HOH 196 5246 5246 HOH HOH A . 
G 6 HOH 197 5247 5247 HOH HOH A . 
G 6 HOH 198 5248 5248 HOH HOH A . 
G 6 HOH 199 5249 5249 HOH HOH A . 
G 6 HOH 200 5250 5250 HOH HOH A . 
G 6 HOH 201 5251 5251 HOH HOH A . 
G 6 HOH 202 5252 5252 HOH HOH A . 
G 6 HOH 203 5253 5253 HOH HOH A . 
G 6 HOH 204 5255 5255 HOH HOH A . 
G 6 HOH 205 5256 5256 HOH HOH A . 
G 6 HOH 206 5258 5258 HOH HOH A . 
G 6 HOH 207 5259 5259 HOH HOH A . 
G 6 HOH 208 5261 5261 HOH HOH A . 
G 6 HOH 209 5263 5263 HOH HOH A . 
G 6 HOH 210 5264 5264 HOH HOH A . 
G 6 HOH 211 5266 5266 HOH HOH A . 
G 6 HOH 212 5267 5267 HOH HOH A . 
G 6 HOH 213 5268 5268 HOH HOH A . 
H 6 HOH 1   5024 5024 HOH HOH B . 
H 6 HOH 2   5031 5031 HOH HOH B . 
H 6 HOH 3   5040 5040 HOH HOH B . 
H 6 HOH 4   5048 5048 HOH HOH B . 
H 6 HOH 5   5077 5077 HOH HOH B . 
H 6 HOH 6   5079 5079 HOH HOH B . 
H 6 HOH 7   5116 5116 HOH HOH B . 
H 6 HOH 8   5137 5137 HOH HOH B . 
H 6 HOH 9   5151 5151 HOH HOH B . 
H 6 HOH 10  5161 5161 HOH HOH B . 
H 6 HOH 11  5180 5180 HOH HOH B . 
H 6 HOH 12  5187 5187 HOH HOH B . 
H 6 HOH 13  5190 5190 HOH HOH B . 
H 6 HOH 14  5196 5196 HOH HOH B . 
H 6 HOH 15  5203 5203 HOH HOH B . 
H 6 HOH 16  5213 5213 HOH HOH B . 
H 6 HOH 17  5218 5218 HOH HOH B . 
H 6 HOH 18  5219 5219 HOH HOH B . 
H 6 HOH 19  5262 5262 HOH HOH B . 
H 6 HOH 20  5265 5265 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A 2DA 22 P 2DA 22 ? DA "2',3'-DIDEOXYADENOSINE-5'-MONOPHOSPHATE" 
2 B TTD 4  T TTD 5  ? DT 'CIS-SYN CYCLOBUTANE THYMINE DIMER'       
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O ? G HOH . ? A HOH 5268 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 O   ? G HOH . ? A HOH 5029 ? 1_555 153.0 ? 
2  O ? G HOH . ? A HOH 5268 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 O   ? G HOH . ? A HOH 5012 ? 1_555 79.9  ? 
3  O ? G HOH . ? A HOH 5029 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 O   ? G HOH . ? A HOH 5012 ? 1_555 94.3  ? 
4  O ? G HOH . ? A HOH 5268 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 O   ? G HOH . ? A HOH 5001 ? 1_555 79.7  ? 
5  O ? G HOH . ? A HOH 5029 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 O   ? G HOH . ? A HOH 5001 ? 1_555 94.2  ? 
6  O ? G HOH . ? A HOH 5012 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 O   ? G HOH . ? A HOH 5001 ? 1_555 150.4 ? 
7  O ? G HOH . ? A HOH 5268 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 OD1 ? C ASP 5 ? A ASP 5    ? 1_555 74.9  ? 
8  O ? G HOH . ? A HOH 5029 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 OD1 ? C ASP 5 ? A ASP 5    ? 1_555 78.1  ? 
9  O ? G HOH . ? A HOH 5012 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 OD1 ? C ASP 5 ? A ASP 5    ? 1_555 75.8  ? 
10 O ? G HOH . ? A HOH 5001 ? 1_555 MG ? E MG . ? A MG 4003 ? 1_555 OD1 ? C ASP 5 ? A ASP 5    ? 1_555 78.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-07-06 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       . ? 1 
HKL-2000  'data reduction' . ? 2 
SCALEPACK 'data scaling'   . ? 3 
EPMR      phasing          . ? 4 
# 
_pdbx_database_remark.id     600 
_pdbx_database_remark.text   
;HETEROGEN
THERE IS A DD-ATP PRESENT IN THE CRYSTAL BUT
NO DENSITY FOR IT.    
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 64  ? ? -115.58 -77.05  
2  1 HIS A 99  ? ? -109.49 44.09   
3  1 ASP A 156 ? ? -5.81   -63.75  
4  1 LYS A 299 ? ? -43.89  155.79  
5  1 CYS A 313 ? ? -57.95  -176.55 
6  1 ALA A 322 ? ? -37.63  126.64  
7  1 ALA A 361 ? ? 175.26  143.16  
8  1 ALA A 400 ? ? -137.86 -40.51  
9  1 HIS A 417 ? ? -105.38 74.45   
10 1 ALA A 513 ? ? 67.88   -0.75   
11 1 GLU A 514 ? ? 35.22   92.25   
12 1 TYR A 530 ? ? -100.32 61.78   
13 1 ALA A 543 ? ? -140.55 21.45   
14 1 LYS A 545 ? ? 54.76   -3.88   
15 1 GLU A 546 ? ? -91.97  -69.93  
16 1 HIS A 653 ? ? 53.54   -92.06  
17 1 CYS A 703 ? ? -95.21  33.35   
18 1 ILE B 72  ? ? 52.14   108.35  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DC P 19 ? ? 0.072 'SIDE CHAIN' 
2 1 DG T 8  ? ? 0.063 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 P 2DA 22  ? N9    ? A 2DA 22  N9    
2   1 Y 1 P 2DA 22  ? C8    ? A 2DA 22  C8    
3   1 Y 1 P 2DA 22  ? N7    ? A 2DA 22  N7    
4   1 Y 1 P 2DA 22  ? C5    ? A 2DA 22  C5    
5   1 Y 1 P 2DA 22  ? C6    ? A 2DA 22  C6    
6   1 Y 1 P 2DA 22  ? N6    ? A 2DA 22  N6    
7   1 Y 1 P 2DA 22  ? N1    ? A 2DA 22  N1    
8   1 Y 1 P 2DA 22  ? C2    ? A 2DA 22  C2    
9   1 Y 1 P 2DA 22  ? N3    ? A 2DA 22  N3    
10  1 Y 1 P 2DA 22  ? C4    ? A 2DA 22  C4    
11  1 Y 1 T TTD 5   ? P     ? B TTD 4   P     
12  1 Y 1 T TTD 5   ? OP1   ? B TTD 4   OP1   
13  1 Y 1 T TTD 5   ? OP2   ? B TTD 4   OP2   
14  1 Y 1 T TTD 5   ? "O5'" ? B TTD 4   "O5'" 
15  1 Y 1 T TTD 5   ? "C5'" ? B TTD 4   "C5'" 
16  1 Y 1 A GLU 13  ? CG    ? C GLU 13  CG    
17  1 Y 1 A GLU 13  ? CD    ? C GLU 13  CD    
18  1 Y 1 A GLU 13  ? OE1   ? C GLU 13  OE1   
19  1 Y 1 A GLU 13  ? OE2   ? C GLU 13  OE2   
20  1 Y 1 A LYS 114 ? CG    ? C LYS 114 CG    
21  1 Y 1 A LYS 114 ? CD    ? C LYS 114 CD    
22  1 Y 1 A LYS 114 ? CE    ? C LYS 114 CE    
23  1 Y 1 A LYS 114 ? NZ    ? C LYS 114 NZ    
24  1 Y 1 A GLU 148 ? CG    ? C GLU 142 CG    
25  1 Y 1 A GLU 148 ? CD    ? C GLU 142 CD    
26  1 Y 1 A GLU 148 ? OE1   ? C GLU 142 OE1   
27  1 Y 1 A GLU 148 ? OE2   ? C GLU 142 OE2   
28  1 Y 1 A GLU 153 ? CG    ? C GLU 147 CG    
29  1 Y 1 A GLU 153 ? CD    ? C GLU 147 CD    
30  1 Y 1 A GLU 153 ? OE1   ? C GLU 147 OE1   
31  1 Y 1 A GLU 153 ? OE2   ? C GLU 147 OE2   
32  1 Y 1 A GLU 166 ? CG    ? C GLU 160 CG    
33  1 Y 1 A GLU 166 ? CD    ? C GLU 160 CD    
34  1 Y 1 A GLU 166 ? OE1   ? C GLU 160 OE1   
35  1 Y 1 A GLU 166 ? OE2   ? C GLU 160 OE2   
36  1 Y 1 A LYS 189 ? CG    ? C LYS 183 CG    
37  1 Y 1 A LYS 189 ? CD    ? C LYS 183 CD    
38  1 Y 1 A LYS 189 ? CE    ? C LYS 183 CE    
39  1 Y 1 A LYS 189 ? NZ    ? C LYS 183 NZ    
40  1 Y 1 A LYS 237 ? CD    ? C LYS 231 CD    
41  1 Y 1 A LYS 237 ? CE    ? C LYS 231 CE    
42  1 Y 1 A LYS 237 ? NZ    ? C LYS 231 NZ    
43  1 Y 1 A LYS 268 ? CD    ? C LYS 262 CD    
44  1 Y 1 A LYS 268 ? CE    ? C LYS 262 CE    
45  1 Y 1 A LYS 268 ? NZ    ? C LYS 262 NZ    
46  1 Y 1 A LYS 285 ? CG    ? C LYS 279 CG    
47  1 Y 1 A LYS 285 ? CD    ? C LYS 279 CD    
48  1 Y 1 A LYS 285 ? CE    ? C LYS 279 CE    
49  1 Y 1 A LYS 285 ? NZ    ? C LYS 279 NZ    
50  1 Y 1 A LYS 290 ? CG    ? C LYS 284 CG    
51  1 Y 1 A LYS 290 ? CD    ? C LYS 284 CD    
52  1 Y 1 A LYS 290 ? CE    ? C LYS 284 CE    
53  1 Y 1 A LYS 290 ? NZ    ? C LYS 284 NZ    
54  1 Y 1 A LYS 293 ? CG    ? C LYS 287 CG    
55  1 Y 1 A LYS 293 ? CD    ? C LYS 287 CD    
56  1 Y 1 A LYS 293 ? CE    ? C LYS 287 CE    
57  1 Y 1 A LYS 293 ? NZ    ? C LYS 287 NZ    
58  1 Y 1 A ILE 297 ? CD1   ? C ILE 291 CD1   
59  1 Y 1 A PHE 298 ? CG    ? C PHE 292 CG    
60  1 Y 1 A PHE 298 ? CD1   ? C PHE 292 CD1   
61  1 Y 1 A PHE 298 ? CD2   ? C PHE 292 CD2   
62  1 Y 1 A PHE 298 ? CE1   ? C PHE 292 CE1   
63  1 Y 1 A PHE 298 ? CE2   ? C PHE 292 CE2   
64  1 Y 1 A PHE 298 ? CZ    ? C PHE 292 CZ    
65  1 Y 1 A LYS 300 ? CG    ? C LYS 294 CG    
66  1 Y 1 A LYS 300 ? CD    ? C LYS 294 CD    
67  1 Y 1 A LYS 300 ? CE    ? C LYS 294 CE    
68  1 Y 1 A LYS 300 ? NZ    ? C LYS 294 NZ    
69  1 Y 1 A GLU 311 ? CG    ? C GLU 305 CG    
70  1 Y 1 A GLU 311 ? CD    ? C GLU 305 CD    
71  1 Y 1 A GLU 311 ? OE1   ? C GLU 305 OE1   
72  1 Y 1 A GLU 311 ? OE2   ? C GLU 305 OE2   
73  1 Y 1 A GLU 314 ? CG    ? C GLU 308 CG    
74  1 Y 1 A GLU 314 ? CD    ? C GLU 308 CD    
75  1 Y 1 A GLU 314 ? OE1   ? C GLU 308 OE1   
76  1 Y 1 A GLU 314 ? OE2   ? C GLU 308 OE2   
77  1 Y 1 A LEU 315 ? CG    ? C LEU 309 CG    
78  1 Y 1 A LEU 315 ? CD1   ? C LEU 309 CD1   
79  1 Y 1 A LEU 315 ? CD2   ? C LEU 309 CD2   
80  1 Y 1 A ARG 318 ? CG    ? C ARG 312 CG    
81  1 Y 1 A ARG 318 ? CD    ? C ARG 312 CD    
82  1 Y 1 A ARG 318 ? NE    ? C ARG 312 NE    
83  1 Y 1 A ARG 318 ? CZ    ? C ARG 312 CZ    
84  1 Y 1 A ARG 318 ? NH1   ? C ARG 312 NH1   
85  1 Y 1 A ARG 318 ? NH2   ? C ARG 312 NH2   
86  1 Y 1 A VAL 352 ? CG1   ? C VAL 346 CG1   
87  1 Y 1 A VAL 352 ? CG2   ? C VAL 346 CG2   
88  1 Y 1 A ASP 358 ? CG    ? C ASP 352 CG    
89  1 Y 1 A ASP 358 ? OD1   ? C ASP 352 OD1   
90  1 Y 1 A ASP 358 ? OD2   ? C ASP 352 OD2   
91  1 Y 1 A LYS 387 ? CE    ? C LYS 381 CE    
92  1 Y 1 A LYS 387 ? NZ    ? C LYS 381 NZ    
93  1 Y 1 A GLU 495 ? CG    ? C GLU 489 CG    
94  1 Y 1 A GLU 495 ? CD    ? C GLU 489 CD    
95  1 Y 1 A GLU 495 ? OE1   ? C GLU 489 OE1   
96  1 Y 1 A GLU 495 ? OE2   ? C GLU 489 OE2   
97  1 Y 1 A LYS 522 ? CG    ? C LYS 516 CG    
98  1 Y 1 A LYS 522 ? CD    ? C LYS 516 CD    
99  1 Y 1 A LYS 522 ? CE    ? C LYS 516 CE    
100 1 Y 1 A LYS 522 ? NZ    ? C LYS 516 NZ    
101 1 Y 1 A TYR 530 ? CG    ? C TYR 524 CG    
102 1 Y 1 A TYR 530 ? CD1   ? C TYR 524 CD1   
103 1 Y 1 A TYR 530 ? CD2   ? C TYR 524 CD2   
104 1 Y 1 A TYR 530 ? CE1   ? C TYR 524 CE1   
105 1 Y 1 A TYR 530 ? CE2   ? C TYR 524 CE2   
106 1 Y 1 A TYR 530 ? CZ    ? C TYR 524 CZ    
107 1 Y 1 A TYR 530 ? OH    ? C TYR 524 OH    
108 1 Y 1 A ASP 534 ? CG    ? C ASP 528 CG    
109 1 Y 1 A ASP 534 ? OD1   ? C ASP 528 OD1   
110 1 Y 1 A ASP 534 ? OD2   ? C ASP 528 OD2   
111 1 Y 1 A GLU 535 ? CG    ? C GLU 529 CG    
112 1 Y 1 A GLU 535 ? CD    ? C GLU 529 CD    
113 1 Y 1 A GLU 535 ? OE1   ? C GLU 529 OE1   
114 1 Y 1 A GLU 535 ? OE2   ? C GLU 529 OE2   
115 1 Y 1 A LYS 536 ? CG    ? C LYS 530 CG    
116 1 Y 1 A LYS 536 ? CD    ? C LYS 530 CD    
117 1 Y 1 A LYS 536 ? CE    ? C LYS 530 CE    
118 1 Y 1 A LYS 536 ? NZ    ? C LYS 530 NZ    
119 1 Y 1 A ILE 537 ? CG1   ? C ILE 531 CG1   
120 1 Y 1 A ILE 537 ? CG2   ? C ILE 531 CG2   
121 1 Y 1 A ILE 537 ? CD1   ? C ILE 531 CD1   
122 1 Y 1 A GLN 539 ? CG    ? C GLN 533 CG    
123 1 Y 1 A GLN 539 ? CD    ? C GLN 533 CD    
124 1 Y 1 A GLN 539 ? OE1   ? C GLN 533 OE1   
125 1 Y 1 A GLN 539 ? NE2   ? C GLN 533 NE2   
126 1 Y 1 A ILE 540 ? CG1   ? C ILE 534 CG1   
127 1 Y 1 A ILE 540 ? CG2   ? C ILE 534 CG2   
128 1 Y 1 A ILE 540 ? CD1   ? C ILE 534 CD1   
129 1 Y 1 A VAL 541 ? CG1   ? C VAL 535 CG1   
130 1 Y 1 A VAL 541 ? CG2   ? C VAL 535 CG2   
131 1 Y 1 A LYS 545 ? CG    ? C LYS 539 CG    
132 1 Y 1 A LYS 545 ? CD    ? C LYS 539 CD    
133 1 Y 1 A LYS 545 ? CE    ? C LYS 539 CE    
134 1 Y 1 A LYS 545 ? NZ    ? C LYS 539 NZ    
135 1 Y 1 A GLU 546 ? CG    ? C GLU 540 CG    
136 1 Y 1 A GLU 546 ? CD    ? C GLU 540 CD    
137 1 Y 1 A GLU 546 ? OE1   ? C GLU 540 OE1   
138 1 Y 1 A GLU 546 ? OE2   ? C GLU 540 OE2   
139 1 Y 1 A ARG 547 ? CG    ? C ARG 541 CG    
140 1 Y 1 A ARG 547 ? CD    ? C ARG 541 CD    
141 1 Y 1 A ARG 547 ? NE    ? C ARG 541 NE    
142 1 Y 1 A ARG 547 ? CZ    ? C ARG 541 CZ    
143 1 Y 1 A ARG 547 ? NH1   ? C ARG 541 NH1   
144 1 Y 1 A ARG 547 ? NH2   ? C ARG 541 NH2   
145 1 Y 1 A LYS 549 ? CG    ? C LYS 543 CG    
146 1 Y 1 A LYS 549 ? CD    ? C LYS 543 CD    
147 1 Y 1 A LYS 549 ? CE    ? C LYS 543 CE    
148 1 Y 1 A LYS 549 ? NZ    ? C LYS 543 NZ    
149 1 Y 1 A GLU 550 ? CG    ? C GLU 544 CG    
150 1 Y 1 A GLU 550 ? CD    ? C GLU 544 CD    
151 1 Y 1 A GLU 550 ? OE1   ? C GLU 544 OE1   
152 1 Y 1 A GLU 550 ? OE2   ? C GLU 544 OE2   
153 1 Y 1 A LYS 553 ? CG    ? C LYS 547 CG    
154 1 Y 1 A LYS 553 ? CD    ? C LYS 547 CD    
155 1 Y 1 A LYS 553 ? CE    ? C LYS 547 CE    
156 1 Y 1 A LYS 553 ? NZ    ? C LYS 547 NZ    
157 1 Y 1 A LYS 554 ? CG    ? C LYS 548 CG    
158 1 Y 1 A LYS 554 ? CD    ? C LYS 548 CD    
159 1 Y 1 A LYS 554 ? CE    ? C LYS 548 CE    
160 1 Y 1 A LYS 554 ? NZ    ? C LYS 548 NZ    
161 1 Y 1 A GLU 557 ? CG    ? C GLU 551 CG    
162 1 Y 1 A GLU 557 ? CD    ? C GLU 551 CD    
163 1 Y 1 A GLU 557 ? OE1   ? C GLU 551 OE1   
164 1 Y 1 A GLU 557 ? OE2   ? C GLU 551 OE2   
165 1 Y 1 A GLN 571 ? CG    ? C GLN 565 CG    
166 1 Y 1 A GLN 571 ? CD    ? C GLN 565 CD    
167 1 Y 1 A GLN 571 ? OE1   ? C GLN 565 OE1   
168 1 Y 1 A GLN 571 ? NE2   ? C GLN 565 NE2   
169 1 Y 1 A LYS 587 ? CG    ? C LYS 581 CG    
170 1 Y 1 A LYS 587 ? CD    ? C LYS 581 CD    
171 1 Y 1 A LYS 587 ? CE    ? C LYS 581 CE    
172 1 Y 1 A LYS 587 ? NZ    ? C LYS 581 NZ    
173 1 Y 1 A ARG 590 ? NE    ? C ARG 584 NE    
174 1 Y 1 A ARG 590 ? CZ    ? C ARG 584 CZ    
175 1 Y 1 A ARG 590 ? NH1   ? C ARG 584 NH1   
176 1 Y 1 A ARG 590 ? NH2   ? C ARG 584 NH2   
177 1 Y 1 A ARG 604 ? CG    ? C ARG 598 CG    
178 1 Y 1 A ARG 604 ? CD    ? C ARG 598 CD    
179 1 Y 1 A ARG 604 ? NE    ? C ARG 598 NE    
180 1 Y 1 A ARG 604 ? CZ    ? C ARG 598 CZ    
181 1 Y 1 A ARG 604 ? NH1   ? C ARG 598 NH1   
182 1 Y 1 A ARG 604 ? NH2   ? C ARG 598 NH2   
183 1 Y 1 B LYS 3   ? CE    ? D LYS 3   CE    
184 1 Y 1 B LYS 3   ? NZ    ? D LYS 3   NZ    
185 1 Y 1 B ASP 20  ? CG    ? D ASP 20  CG    
186 1 Y 1 B ASP 20  ? OD1   ? D ASP 20  OD1   
187 1 Y 1 B ASP 20  ? OD2   ? D ASP 20  OD2   
188 1 Y 1 B LYS 36  ? CD    ? D LYS 36  CD    
189 1 Y 1 B LYS 36  ? CE    ? D LYS 36  CE    
190 1 Y 1 B LYS 36  ? NZ    ? D LYS 36  NZ    
191 1 Y 1 B ARG 73  ? CG    ? D ARG 73  CG    
192 1 Y 1 B ARG 73  ? CD    ? D ARG 73  CD    
193 1 Y 1 B ARG 73  ? NE    ? D ARG 73  NE    
194 1 Y 1 B ARG 73  ? CZ    ? D ARG 73  CZ    
195 1 Y 1 B ARG 73  ? NH1   ? D ARG 73  NH1   
196 1 Y 1 B ARG 73  ? NH2   ? D ARG 73  NH2   
197 1 Y 1 B LYS 82  ? CG    ? D LYS 82  CG    
198 1 Y 1 B LYS 82  ? CD    ? D LYS 82  CD    
199 1 Y 1 B LYS 82  ? CE    ? D LYS 82  CE    
200 1 Y 1 B LYS 82  ? NZ    ? D LYS 82  NZ    
201 1 Y 1 B LYS 100 ? CG    ? D LYS 100 CG    
202 1 Y 1 B LYS 100 ? CD    ? D LYS 100 CD    
203 1 Y 1 B LYS 100 ? CE    ? D LYS 100 CE    
204 1 Y 1 B LYS 100 ? NZ    ? D LYS 100 NZ    
205 1 Y 1 B GLU 101 ? CG    ? D GLU 101 CG    
206 1 Y 1 B GLU 101 ? CD    ? D GLU 101 CD    
207 1 Y 1 B GLU 101 ? OE1   ? D GLU 101 OE1   
208 1 Y 1 B GLU 101 ? OE2   ? D GLU 101 OE2   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 P DC  1   ? A DC  1   
2  1 Y 1 P DG  2   ? A DG  2   
3  1 Y 1 P DA  3   ? A DA  3   
4  1 Y 1 P DA  4   ? A DA  4   
5  1 Y 1 P DA  5   ? A DA  5   
6  1 Y 1 P DA  6   ? A DA  6   
7  1 Y 1 P DC  7   ? A DC  7   
8  1 Y 1 P DG  8   ? A DG  8   
9  1 Y 1 P DA  9   ? A DA  9   
10 1 Y 1 P DC  10  ? A DC  10  
11 1 Y 1 P DG  11  ? A DG  11  
12 1 Y 1 P DG  12  ? A DG  12  
13 1 Y 1 P DC  13  ? A DC  13  
14 1 Y 1 T DC  2   ? B DC  1   
15 1 Y 1 T DC  3   ? B DC  2   
16 1 Y 1 T DC  4   ? B DC  3   
17 1 Y 1 T DC  15  ? B DC  14  
18 1 Y 1 T DC  16  ? B DC  15  
19 1 Y 1 T DG  17  ? B DG  16  
20 1 Y 1 T DT  18  ? B DT  17  
21 1 Y 1 T DC  19  ? B DC  18  
22 1 Y 1 T DG  20  ? B DG  19  
23 1 Y 1 T DT  21  ? B DT  20  
24 1 Y 1 T DT  22  ? B DT  21  
25 1 Y 1 T DT  23  ? B DT  22  
26 1 Y 1 T DT  24  ? B DT  23  
27 1 Y 1 T DC  25  ? B DC  24  
28 1 Y 1 T DG  26  ? B DG  25  
29 1 Y 1 A LYS 302 ? C LYS 296 
30 1 Y 1 A ASN 303 ? C ASN 297 
31 1 Y 1 A LYS 304 ? C LYS 298 
32 1 Y 1 A ALA 305 ? C ALA 299 
33 1 Y 1 A GLN 306 ? C GLN 300 
34 1 Y 1 A ARG 307 ? C ARG 301 
35 1 Y 1 A GLU 308 ? C GLU 302 
36 1 Y 1 A GLY 309 ? C GLY 303 
37 1 Y 1 A ARG 310 ? C ARG 304 
38 1 Y 1 A SER 576 ? C SER 570 
39 1 Y 1 A SER 577 ? C SER 571 
40 1 Y 1 A GLN 578 ? C GLN 572 
41 1 Y 1 A TRP 579 ? C TRP 573 
42 1 Y 1 A VAL 580 ? C VAL 574 
43 1 Y 1 A ALA 581 ? C ALA 575 
44 1 Y 1 A GLY 582 ? C GLY 576 
45 1 Y 1 A GLU 583 ? C GLU 577 
46 1 Y 1 A GLN 584 ? C GLN 578 
47 1 Y 1 A GLN 585 ? C GLN 579 
48 1 Y 1 A VAL 586 ? C VAL 580 
49 1 Y 1 B SER 1   ? D SER 1   
50 1 Y 1 B ASP 2   ? D ASP 2   
51 1 Y 1 B ALA 108 ? D ALA 108 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1SL1 'double helix'        
1SL1 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC 14 1_555 B DG 12 1_555 0.658  0.055  0.900  -13.462 -0.953  3.159  1 P_DC14:DG13_T P 14 ? T 13 ? 19 1 
1 A DA 15 1_555 B DT 11 1_555 0.555  -0.039 -0.158 -14.771 -10.790 -5.098 2 P_DA15:DT12_T P 15 ? T 12 ? 20 1 
1 A DG 16 1_555 B DC 10 1_555 -0.234 -0.095 -0.151 -0.505  -13.596 -0.429 3 P_DG16:DC11_T P 16 ? T 11 ? 19 1 
1 A DT 17 1_555 B DA 9  1_555 -0.115 -0.144 -0.753 5.410   -1.406  2.559  4 P_DT17:DA10_T P 17 ? T 10 ? 20 1 
1 A DG 18 1_555 B DC 8  1_555 0.358  -0.020 -0.354 5.671   -0.666  0.222  5 P_DG18:DC9_T  P 18 ? T 9  ? 19 1 
1 A DC 19 1_555 B DG 7  1_555 0.378  -0.463 -0.300 2.768   -1.693  -6.563 6 P_DC19:DG8_T  P 19 ? T 8  ? 19 1 
1 A DC 20 1_555 B DG 6  1_555 0.256  -0.023 0.689  0.649   -23.103 6.195  7 P_DC20:DG7_T  P 20 ? T 7  ? 19 1 
1 A DT 21 1_555 B DA 5  1_555 0.251  0.098  0.016  13.910  -25.995 18.687 8 P_DT21:DA6_T  P 21 ? T 6  ? ?  1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 14 1_555 B DG 12 1_555 A DA 15 1_555 B DT 11 1_555 -1.198 0.126  3.374 4.252  -1.433 40.809 0.337  2.177  3.232 -2.047 
-6.075  41.044 1 PP_DC14DA15:DT12DG13_TT P 14 ? T 13 ? P 15 ? T 12 ? 
1 A DA 15 1_555 B DT 11 1_555 A DG 16 1_555 B DC 10 1_555 0.463  0.082  2.976 0.477  3.678  28.116 -0.606 -0.845 2.969 7.530  
-0.976  28.354 2 PP_DA15DG16:DC11DT12_TT P 15 ? T 12 ? P 16 ? T 11 ? 
1 A DG 16 1_555 B DC 10 1_555 A DT 17 1_555 B DA 9  1_555 0.907  -0.596 3.119 5.354  6.995  31.639 -2.207 -0.724 3.031 12.529 
-9.589  32.812 3 PP_DG16DT17:DA10DC11_TT P 16 ? T 11 ? P 17 ? T 10 ? 
1 A DT 17 1_555 B DA 9  1_555 A DG 18 1_555 B DC 8  1_555 -0.595 -0.010 3.506 -3.440 5.581  31.598 -1.092 0.410  3.497 10.113 
6.234   32.254 4 PP_DT17DG18:DC9DA10_TT  P 17 ? T 10 ? P 18 ? T 9  ? 
1 A DG 18 1_555 B DC 8  1_555 A DC 19 1_555 B DG 7  1_555 -0.739 -0.630 3.359 -5.337 15.159 36.264 -2.730 0.459  2.952 23.016 
8.103   39.556 5 PP_DG18DC19:DG8DC9_TT   P 18 ? T 9  ? P 19 ? T 8  ? 
1 A DC 19 1_555 B DG 7  1_555 A DC 20 1_555 B DG 6  1_555 0.016  -0.505 3.440 -6.575 11.593 28.463 -3.172 -1.298 2.942 22.110 
12.540  31.370 6 PP_DC19DC20:DG7DG8_TT   P 19 ? T 8  ? P 20 ? T 7  ? 
1 A DC 20 1_555 B DG 6  1_555 A DT 21 1_555 B DA 5  1_555 -0.146 0.262  2.854 6.015  15.157 27.026 -2.047 1.273  2.554 29.293 
-11.625 31.486 7 PP_DC20DT21:DA6DG7_TT   P 20 ? T 7  ? P 21 ? T 6  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'MAGNESIUM ION' MG  
6 water           HOH 
#