data_1SL2
# 
_entry.id   1SL2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SL2         
NDB   PD0527       
RCSB  RCSB021804   
WWPDB D_1000021804 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1T7P 'T7 DNA POLYMERASE COMPLEXED TO DNA PRIMER/TEMPLATE, A NUCLEOSIDE TRIPHOSPHATE, AND ITS PROCESSIVITY FACTOR THIOREDOXIN' 
unspecified 
PDB 1SKR 'T7 DNA polymerase complexed primer/template DNA containing a cis-syn thymine dimer on the template' unspecified 
PDB 1SKS 
;Binary 3' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn thymine dimer on the template
;
unspecified 
PDB 1SKW 
;Binary 3' complex of T7 DNA polymerase with a DNA primer/template containing a disordered cis-syn thymine dimer on the template
;
unspecified 
PDB 1SL0 
;Ternary 3' complex of T7 DNA polymerase with a DNA primer/template containing a disordered cis-syn thymine dimer on the template and an incoming nucleotide
;
unspecified 
PDB 1SL1 
;Binary 5' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn thymine dimer on the template
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SL2 
_pdbx_database_status.recvd_initial_deposition_date   2004-03-05 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, Y.'          1 
'Dutta, S.'       2 
'Doublie, S.'     3 
'Bdour, H.M.'     4 
'Taylor, J.S.'    5 
'Ellenberger, T.' 6 
# 
_citation.id                        primary 
_citation.title                     
'Nucleotide insertion opposite a cis-syn thymine dimer by a replicative DNA polymerase from bacteriophage T7.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            11 
_citation.page_first                784 
_citation.page_last                 790 
_citation.year                      2004 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15235589 
_citation.pdbx_database_id_DOI      10.1038/nsmb792 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, Y.'          1 
primary 'Dutta, S.'       2 
primary 'Doublie, S.'     3 
primary 'Bdour, H.M.'     4 
primary 'Taylor, J.S.'    5 
primary 'Ellenberger, T.' 6 
# 
_cell.entry_id           1SL2 
_cell.length_a           104.983 
_cell.length_b           212.599 
_cell.length_c           51.945 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SL2 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*CP*GP*AP*AP*AP*AP*CP*GP*AP*CP*GP*GP*CP*CP*AP*GP*TP*GP*CP*CP*TP*(2DA))-3'"          6739.383  1   ?       
?              ? 'DNA primer'   
2 polymer     syn "5'-D(*CP*CP*CP*(TTD)P*AP*GP*GP*CP*AP*CP*TP*GP*GP*CP*CP*GP*TP*CP*GP*TP*TP*TP*TP*CP*G)-3'" 7922.077  1   ?       
?              ? 'DNA template' 
3 polymer     man 'DNA polymerase'                                                                          79089.789 1   2.7.7.7 
'DEL(118-123)' ? ?              
4 polymer     man 'Thioredoxin 1'                                                                           11687.388 1   ?       
?              ? ?              
5 non-polymer syn 'MAGNESIUM ION'                                                                           24.305    3   ?       
?              ? ?              
6 non-polymer syn "2',3'-DIDEOXYADENOSINE-5'-TRIPHOSPHATE"                                                  475.182   1   ?       
?              ? ?              
7 water       nat water                                                                                     18.015    223 ?       
?              ? ?              
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 'T7 DNA polymerase' 
4 'TRX1, TRX'         
# 
_entity_name_sys.entity_id   3 
_entity_name_sys.name        2.7.7.7 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes 
;(DC)(DG)(DA)(DA)(DA)(DA)(DC)(DG)(DA)(DC)(DG)(DG)(DC)(DC)(DA)(DG)(DT)(DG)(DC)(DC)
(DT)(2DA)
;
CGAAAACGACGGCCAGTGCCTA P ? 
2 polydeoxyribonucleotide no yes 
;(DC)(DC)(DC)(TTD)(DA)(DG)(DG)(DC)(DA)(DC)(DT)(DG)(DG)(DC)(DC)(DG)(DT)(DC)(DG)
(DT)(DT)(DT)(DT)(DC)(DG)
;
CCCTAGGCACTGGCCGTCGTTTTCG T ? 
3 'polypeptide(L)'        no no  
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFNEE
MMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIEELYVEL
AARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREYVAGAPY
TPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSAEGDKAW
LRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAH
FMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTPAIAALR
ESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKHGWDGDF
AYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFNEE
MMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIEELYVEL
AARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREYVAGAPY
TPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSAEGDKAW
LRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAH
FMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTPAIAALR
ESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKHGWDGDF
AYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
A ? 
4 'polypeptide(L)'        no no  
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DG  n 
1 3   DA  n 
1 4   DA  n 
1 5   DA  n 
1 6   DA  n 
1 7   DC  n 
1 8   DG  n 
1 9   DA  n 
1 10  DC  n 
1 11  DG  n 
1 12  DG  n 
1 13  DC  n 
1 14  DC  n 
1 15  DA  n 
1 16  DG  n 
1 17  DT  n 
1 18  DG  n 
1 19  DC  n 
1 20  DC  n 
1 21  DT  n 
1 22  2DA n 
2 1   DC  n 
2 2   DC  n 
2 3   DC  n 
2 4   TTD n 
2 5   DA  n 
2 6   DG  n 
2 7   DG  n 
2 8   DC  n 
2 9   DA  n 
2 10  DC  n 
2 11  DT  n 
2 12  DG  n 
2 13  DG  n 
2 14  DC  n 
2 15  DC  n 
2 16  DG  n 
2 17  DT  n 
2 18  DC  n 
2 19  DG  n 
2 20  DT  n 
2 21  DT  n 
2 22  DT  n 
2 23  DT  n 
2 24  DC  n 
2 25  DG  n 
3 1   MET n 
3 2   ILE n 
3 3   VAL n 
3 4   SER n 
3 5   ASP n 
3 6   ILE n 
3 7   GLU n 
3 8   ALA n 
3 9   ASN n 
3 10  ALA n 
3 11  LEU n 
3 12  LEU n 
3 13  GLU n 
3 14  SER n 
3 15  VAL n 
3 16  THR n 
3 17  LYS n 
3 18  PHE n 
3 19  HIS n 
3 20  CYS n 
3 21  GLY n 
3 22  VAL n 
3 23  ILE n 
3 24  TYR n 
3 25  ASP n 
3 26  TYR n 
3 27  SER n 
3 28  THR n 
3 29  ALA n 
3 30  GLU n 
3 31  TYR n 
3 32  VAL n 
3 33  SER n 
3 34  TYR n 
3 35  ARG n 
3 36  PRO n 
3 37  SER n 
3 38  ASP n 
3 39  PHE n 
3 40  GLY n 
3 41  ALA n 
3 42  TYR n 
3 43  LEU n 
3 44  ASP n 
3 45  ALA n 
3 46  LEU n 
3 47  GLU n 
3 48  ALA n 
3 49  GLU n 
3 50  VAL n 
3 51  ALA n 
3 52  ARG n 
3 53  GLY n 
3 54  GLY n 
3 55  LEU n 
3 56  ILE n 
3 57  VAL n 
3 58  PHE n 
3 59  HIS n 
3 60  ASN n 
3 61  GLY n 
3 62  HIS n 
3 63  LYS n 
3 64  TYR n 
3 65  ASP n 
3 66  VAL n 
3 67  PRO n 
3 68  ALA n 
3 69  LEU n 
3 70  THR n 
3 71  LYS n 
3 72  LEU n 
3 73  ALA n 
3 74  LYS n 
3 75  LEU n 
3 76  GLN n 
3 77  LEU n 
3 78  ASN n 
3 79  ARG n 
3 80  GLU n 
3 81  PHE n 
3 82  HIS n 
3 83  LEU n 
3 84  PRO n 
3 85  ARG n 
3 86  GLU n 
3 87  ASN n 
3 88  CYS n 
3 89  ILE n 
3 90  ASP n 
3 91  THR n 
3 92  LEU n 
3 93  VAL n 
3 94  LEU n 
3 95  SER n 
3 96  ARG n 
3 97  LEU n 
3 98  ILE n 
3 99  HIS n 
3 100 SER n 
3 101 ASN n 
3 102 LEU n 
3 103 LYS n 
3 104 ASP n 
3 105 THR n 
3 106 ASP n 
3 107 MET n 
3 108 GLY n 
3 109 LEU n 
3 110 LEU n 
3 111 ARG n 
3 112 SER n 
3 113 GLY n 
3 114 LYS n 
3 115 LEU n 
3 116 PRO n 
3 117 GLY n 
3 118 ALA n 
3 119 LEU n 
3 120 GLU n 
3 121 ALA n 
3 122 TRP n 
3 123 GLY n 
3 124 TYR n 
3 125 ARG n 
3 126 LEU n 
3 127 GLY n 
3 128 GLU n 
3 129 MET n 
3 130 LYS n 
3 131 GLY n 
3 132 GLU n 
3 133 TYR n 
3 134 LYS n 
3 135 ASP n 
3 136 ASP n 
3 137 PHE n 
3 138 LYS n 
3 139 ARG n 
3 140 MET n 
3 141 LEU n 
3 142 GLU n 
3 143 GLU n 
3 144 GLN n 
3 145 GLY n 
3 146 GLU n 
3 147 GLU n 
3 148 TYR n 
3 149 VAL n 
3 150 ASP n 
3 151 GLY n 
3 152 MET n 
3 153 GLU n 
3 154 TRP n 
3 155 TRP n 
3 156 ASN n 
3 157 PHE n 
3 158 ASN n 
3 159 GLU n 
3 160 GLU n 
3 161 MET n 
3 162 MET n 
3 163 ASP n 
3 164 TYR n 
3 165 ASN n 
3 166 VAL n 
3 167 GLN n 
3 168 ASP n 
3 169 VAL n 
3 170 VAL n 
3 171 VAL n 
3 172 THR n 
3 173 LYS n 
3 174 ALA n 
3 175 LEU n 
3 176 LEU n 
3 177 GLU n 
3 178 LYS n 
3 179 LEU n 
3 180 LEU n 
3 181 SER n 
3 182 ASP n 
3 183 LYS n 
3 184 HIS n 
3 185 TYR n 
3 186 PHE n 
3 187 PRO n 
3 188 PRO n 
3 189 GLU n 
3 190 ILE n 
3 191 ASP n 
3 192 PHE n 
3 193 THR n 
3 194 ASP n 
3 195 VAL n 
3 196 GLY n 
3 197 TYR n 
3 198 THR n 
3 199 THR n 
3 200 PHE n 
3 201 TRP n 
3 202 SER n 
3 203 GLU n 
3 204 SER n 
3 205 LEU n 
3 206 GLU n 
3 207 ALA n 
3 208 VAL n 
3 209 ASP n 
3 210 ILE n 
3 211 GLU n 
3 212 HIS n 
3 213 ARG n 
3 214 ALA n 
3 215 ALA n 
3 216 TRP n 
3 217 LEU n 
3 218 LEU n 
3 219 ALA n 
3 220 LYS n 
3 221 GLN n 
3 222 GLU n 
3 223 ARG n 
3 224 ASN n 
3 225 GLY n 
3 226 PHE n 
3 227 PRO n 
3 228 PHE n 
3 229 ASP n 
3 230 THR n 
3 231 LYS n 
3 232 ALA n 
3 233 ILE n 
3 234 GLU n 
3 235 GLU n 
3 236 LEU n 
3 237 TYR n 
3 238 VAL n 
3 239 GLU n 
3 240 LEU n 
3 241 ALA n 
3 242 ALA n 
3 243 ARG n 
3 244 ARG n 
3 245 SER n 
3 246 GLU n 
3 247 LEU n 
3 248 LEU n 
3 249 ARG n 
3 250 LYS n 
3 251 LEU n 
3 252 THR n 
3 253 GLU n 
3 254 THR n 
3 255 PHE n 
3 256 GLY n 
3 257 SER n 
3 258 TRP n 
3 259 TYR n 
3 260 GLN n 
3 261 PRO n 
3 262 LYS n 
3 263 GLY n 
3 264 GLY n 
3 265 THR n 
3 266 GLU n 
3 267 MET n 
3 268 PHE n 
3 269 CYS n 
3 270 HIS n 
3 271 PRO n 
3 272 ARG n 
3 273 THR n 
3 274 GLY n 
3 275 LYS n 
3 276 PRO n 
3 277 LEU n 
3 278 PRO n 
3 279 LYS n 
3 280 TYR n 
3 281 PRO n 
3 282 ARG n 
3 283 ILE n 
3 284 LYS n 
3 285 THR n 
3 286 PRO n 
3 287 LYS n 
3 288 VAL n 
3 289 GLY n 
3 290 GLY n 
3 291 ILE n 
3 292 PHE n 
3 293 LYS n 
3 294 LYS n 
3 295 PRO n 
3 296 LYS n 
3 297 ASN n 
3 298 LYS n 
3 299 ALA n 
3 300 GLN n 
3 301 ARG n 
3 302 GLU n 
3 303 GLY n 
3 304 ARG n 
3 305 GLU n 
3 306 PRO n 
3 307 CYS n 
3 308 GLU n 
3 309 LEU n 
3 310 ASP n 
3 311 THR n 
3 312 ARG n 
3 313 GLU n 
3 314 TYR n 
3 315 VAL n 
3 316 ALA n 
3 317 GLY n 
3 318 ALA n 
3 319 PRO n 
3 320 TYR n 
3 321 THR n 
3 322 PRO n 
3 323 VAL n 
3 324 GLU n 
3 325 HIS n 
3 326 VAL n 
3 327 VAL n 
3 328 PHE n 
3 329 ASN n 
3 330 PRO n 
3 331 SER n 
3 332 SER n 
3 333 ARG n 
3 334 ASP n 
3 335 HIS n 
3 336 ILE n 
3 337 GLN n 
3 338 LYS n 
3 339 LYS n 
3 340 LEU n 
3 341 GLN n 
3 342 GLU n 
3 343 ALA n 
3 344 GLY n 
3 345 TRP n 
3 346 VAL n 
3 347 PRO n 
3 348 THR n 
3 349 LYS n 
3 350 TYR n 
3 351 THR n 
3 352 ASP n 
3 353 LYS n 
3 354 GLY n 
3 355 ALA n 
3 356 PRO n 
3 357 VAL n 
3 358 VAL n 
3 359 ASP n 
3 360 ASP n 
3 361 GLU n 
3 362 VAL n 
3 363 LEU n 
3 364 GLU n 
3 365 GLY n 
3 366 VAL n 
3 367 ARG n 
3 368 VAL n 
3 369 ASP n 
3 370 ASP n 
3 371 PRO n 
3 372 GLU n 
3 373 LYS n 
3 374 GLN n 
3 375 ALA n 
3 376 ALA n 
3 377 ILE n 
3 378 ASP n 
3 379 LEU n 
3 380 ILE n 
3 381 LYS n 
3 382 GLU n 
3 383 TYR n 
3 384 LEU n 
3 385 MET n 
3 386 ILE n 
3 387 GLN n 
3 388 LYS n 
3 389 ARG n 
3 390 ILE n 
3 391 GLY n 
3 392 GLN n 
3 393 SER n 
3 394 ALA n 
3 395 GLU n 
3 396 GLY n 
3 397 ASP n 
3 398 LYS n 
3 399 ALA n 
3 400 TRP n 
3 401 LEU n 
3 402 ARG n 
3 403 TYR n 
3 404 VAL n 
3 405 ALA n 
3 406 GLU n 
3 407 ASP n 
3 408 GLY n 
3 409 LYS n 
3 410 ILE n 
3 411 HIS n 
3 412 GLY n 
3 413 SER n 
3 414 VAL n 
3 415 ASN n 
3 416 PRO n 
3 417 ASN n 
3 418 GLY n 
3 419 ALA n 
3 420 VAL n 
3 421 THR n 
3 422 GLY n 
3 423 ARG n 
3 424 ALA n 
3 425 THR n 
3 426 HIS n 
3 427 ALA n 
3 428 PHE n 
3 429 PRO n 
3 430 ASN n 
3 431 LEU n 
3 432 ALA n 
3 433 GLN n 
3 434 ILE n 
3 435 PRO n 
3 436 GLY n 
3 437 VAL n 
3 438 ARG n 
3 439 SER n 
3 440 PRO n 
3 441 TYR n 
3 442 GLY n 
3 443 GLU n 
3 444 GLN n 
3 445 CYS n 
3 446 ARG n 
3 447 ALA n 
3 448 ALA n 
3 449 PHE n 
3 450 GLY n 
3 451 ALA n 
3 452 GLU n 
3 453 HIS n 
3 454 HIS n 
3 455 LEU n 
3 456 ASP n 
3 457 GLY n 
3 458 ILE n 
3 459 THR n 
3 460 GLY n 
3 461 LYS n 
3 462 PRO n 
3 463 TRP n 
3 464 VAL n 
3 465 GLN n 
3 466 ALA n 
3 467 GLY n 
3 468 ILE n 
3 469 ASP n 
3 470 ALA n 
3 471 SER n 
3 472 GLY n 
3 473 LEU n 
3 474 GLU n 
3 475 LEU n 
3 476 ARG n 
3 477 CYS n 
3 478 LEU n 
3 479 ALA n 
3 480 HIS n 
3 481 PHE n 
3 482 MET n 
3 483 ALA n 
3 484 ARG n 
3 485 PHE n 
3 486 ASP n 
3 487 ASN n 
3 488 GLY n 
3 489 GLU n 
3 490 TYR n 
3 491 ALA n 
3 492 HIS n 
3 493 GLU n 
3 494 ILE n 
3 495 LEU n 
3 496 ASN n 
3 497 GLY n 
3 498 ASP n 
3 499 ILE n 
3 500 HIS n 
3 501 THR n 
3 502 LYS n 
3 503 ASN n 
3 504 GLN n 
3 505 ILE n 
3 506 ALA n 
3 507 ALA n 
3 508 GLU n 
3 509 LEU n 
3 510 PRO n 
3 511 THR n 
3 512 ARG n 
3 513 ASP n 
3 514 ASN n 
3 515 ALA n 
3 516 LYS n 
3 517 THR n 
3 518 PHE n 
3 519 ILE n 
3 520 TYR n 
3 521 GLY n 
3 522 PHE n 
3 523 LEU n 
3 524 TYR n 
3 525 GLY n 
3 526 ALA n 
3 527 GLY n 
3 528 ASP n 
3 529 GLU n 
3 530 LYS n 
3 531 ILE n 
3 532 GLY n 
3 533 GLN n 
3 534 ILE n 
3 535 VAL n 
3 536 GLY n 
3 537 ALA n 
3 538 GLY n 
3 539 LYS n 
3 540 GLU n 
3 541 ARG n 
3 542 GLY n 
3 543 LYS n 
3 544 GLU n 
3 545 LEU n 
3 546 LYS n 
3 547 LYS n 
3 548 LYS n 
3 549 PHE n 
3 550 LEU n 
3 551 GLU n 
3 552 ASN n 
3 553 THR n 
3 554 PRO n 
3 555 ALA n 
3 556 ILE n 
3 557 ALA n 
3 558 ALA n 
3 559 LEU n 
3 560 ARG n 
3 561 GLU n 
3 562 SER n 
3 563 ILE n 
3 564 GLN n 
3 565 GLN n 
3 566 THR n 
3 567 LEU n 
3 568 VAL n 
3 569 GLU n 
3 570 SER n 
3 571 SER n 
3 572 GLN n 
3 573 TRP n 
3 574 VAL n 
3 575 ALA n 
3 576 GLY n 
3 577 GLU n 
3 578 GLN n 
3 579 GLN n 
3 580 VAL n 
3 581 LYS n 
3 582 TRP n 
3 583 LYS n 
3 584 ARG n 
3 585 ARG n 
3 586 TRP n 
3 587 ILE n 
3 588 LYS n 
3 589 GLY n 
3 590 LEU n 
3 591 ASP n 
3 592 GLY n 
3 593 ARG n 
3 594 LYS n 
3 595 VAL n 
3 596 HIS n 
3 597 VAL n 
3 598 ARG n 
3 599 SER n 
3 600 PRO n 
3 601 HIS n 
3 602 ALA n 
3 603 ALA n 
3 604 LEU n 
3 605 ASN n 
3 606 THR n 
3 607 LEU n 
3 608 LEU n 
3 609 GLN n 
3 610 SER n 
3 611 ALA n 
3 612 GLY n 
3 613 ALA n 
3 614 LEU n 
3 615 ILE n 
3 616 CYS n 
3 617 LYS n 
3 618 LEU n 
3 619 TRP n 
3 620 ILE n 
3 621 ILE n 
3 622 LYS n 
3 623 THR n 
3 624 GLU n 
3 625 GLU n 
3 626 MET n 
3 627 LEU n 
3 628 VAL n 
3 629 GLU n 
3 630 LYS n 
3 631 GLY n 
3 632 LEU n 
3 633 LYS n 
3 634 HIS n 
3 635 GLY n 
3 636 TRP n 
3 637 ASP n 
3 638 GLY n 
3 639 ASP n 
3 640 PHE n 
3 641 ALA n 
3 642 TYR n 
3 643 MET n 
3 644 ALA n 
3 645 TRP n 
3 646 VAL n 
3 647 HIS n 
3 648 ASP n 
3 649 GLU n 
3 650 ILE n 
3 651 GLN n 
3 652 VAL n 
3 653 GLY n 
3 654 CYS n 
3 655 ARG n 
3 656 THR n 
3 657 GLU n 
3 658 GLU n 
3 659 ILE n 
3 660 ALA n 
3 661 GLN n 
3 662 VAL n 
3 663 VAL n 
3 664 ILE n 
3 665 GLU n 
3 666 THR n 
3 667 ALA n 
3 668 GLN n 
3 669 GLU n 
3 670 ALA n 
3 671 MET n 
3 672 ARG n 
3 673 TRP n 
3 674 VAL n 
3 675 GLY n 
3 676 ASP n 
3 677 HIS n 
3 678 TRP n 
3 679 ASN n 
3 680 PHE n 
3 681 ARG n 
3 682 CYS n 
3 683 LEU n 
3 684 LEU n 
3 685 ASP n 
3 686 THR n 
3 687 GLU n 
3 688 GLY n 
3 689 LYS n 
3 690 MET n 
3 691 GLY n 
3 692 PRO n 
3 693 ASN n 
3 694 TRP n 
3 695 ALA n 
3 696 ILE n 
3 697 CYS n 
3 698 HIS n 
4 1   SER n 
4 2   ASP n 
4 3   LYS n 
4 4   ILE n 
4 5   ILE n 
4 6   HIS n 
4 7   LEU n 
4 8   THR n 
4 9   ASP n 
4 10  ASP n 
4 11  SER n 
4 12  PHE n 
4 13  ASP n 
4 14  THR n 
4 15  ASP n 
4 16  VAL n 
4 17  LEU n 
4 18  LYS n 
4 19  ALA n 
4 20  ASP n 
4 21  GLY n 
4 22  ALA n 
4 23  ILE n 
4 24  LEU n 
4 25  VAL n 
4 26  ASP n 
4 27  PHE n 
4 28  TRP n 
4 29  ALA n 
4 30  GLU n 
4 31  TRP n 
4 32  CYS n 
4 33  GLY n 
4 34  PRO n 
4 35  CYS n 
4 36  LYS n 
4 37  MET n 
4 38  ILE n 
4 39  ALA n 
4 40  PRO n 
4 41  ILE n 
4 42  LEU n 
4 43  ASP n 
4 44  GLU n 
4 45  ILE n 
4 46  ALA n 
4 47  ASP n 
4 48  GLU n 
4 49  TYR n 
4 50  GLN n 
4 51  GLY n 
4 52  LYS n 
4 53  LEU n 
4 54  THR n 
4 55  VAL n 
4 56  ALA n 
4 57  LYS n 
4 58  LEU n 
4 59  ASN n 
4 60  ILE n 
4 61  ASP n 
4 62  GLN n 
4 63  ASN n 
4 64  PRO n 
4 65  GLY n 
4 66  THR n 
4 67  ALA n 
4 68  PRO n 
4 69  LYS n 
4 70  TYR n 
4 71  GLY n 
4 72  ILE n 
4 73  ARG n 
4 74  GLY n 
4 75  ILE n 
4 76  PRO n 
4 77  THR n 
4 78  LEU n 
4 79  LEU n 
4 80  LEU n 
4 81  PHE n 
4 82  LYS n 
4 83  ASN n 
4 84  GLY n 
4 85  GLU n 
4 86  VAL n 
4 87  ALA n 
4 88  ALA n 
4 89  THR n 
4 90  LYS n 
4 91  VAL n 
4 92  GLY n 
4 93  ALA n 
4 94  LEU n 
4 95  SER n 
4 96  LYS n 
4 97  GLY n 
4 98  GLN n 
4 99  LEU n 
4 100 LYS n 
4 101 GLU n 
4 102 PHE n 
4 103 LEU n 
4 104 ASP n 
4 105 ALA n 
4 106 ASN n 
4 107 LEU n 
4 108 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample ? ? ? ? 'T7-like viruses' 5 ? ? ? ? ? ? 'Enterobacteria phage T7' 10760 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? ? Escherichia       
'TRXA, TSNC, FIPA, B3781, C4701, Z5291, ECS4714, STM3915, STMD1.75, STY3639, T3381, SF3854, S3905' ? ? ? ? ? ? 'Escherichia coli' 
562   ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOL_BPT7  P00581 3 
;MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNRE
FHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGKRFGSHALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEW
WNFNEEMMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIE
ELYVELAARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREY
VAGAPYTPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSA
EGDKAWLRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLE
LRCLAHFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTP
AIAALRESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKH
GWDGDFAYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH
;
1 ? 
2 UNP THIO_ECOLI P0AA25 4 
;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
;
1 ? 
3 PDB 1SL2       1SL2   1 ? ? ? 
4 PDB 1SL2       1SL2   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1SL2 A 1 ? 698 ? P00581 1 ? 704 ? 1 704 
2 2 1SL2 B 1 ? 108 ? P0AA25 1 ? 108 ? 1 108 
3 3 1SL2 P 1 ? 22  ? 1SL2   1 ? 22  ? 1 22  
4 4 1SL2 T 1 ? 25  ? 1SL2   2 ? 26  ? 2 26  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1SL2 ? A ? ? UNP P00581 LYS 118 DELETION ? 1 
1 1SL2 ? A ? ? UNP P00581 ARG 119 DELETION ? 2 
1 1SL2 ? A ? ? UNP P00581 PHE 120 DELETION ? 3 
1 1SL2 ? A ? ? UNP P00581 GLY 121 DELETION ? 4 
1 1SL2 ? A ? ? UNP P00581 SER 122 DELETION ? 5 
1 1SL2 ? A ? ? UNP P00581 HIS 123 DELETION ? 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2DA 'DNA linking'       n "2',3'-DIDEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O5 P'   315.222 
ALA 'L-peptide linking' y ALANINE                                   ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                  ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                           ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                  ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"      ? 'C10 H14 N5 O6 P'   331.222 
DAD non-polymer         . "2',3'-DIDEOXYADENOSINE-5'-TRIPHOSPHATE"  ? 'C10 H16 N5 O11 P3' 475.182 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"       ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"      ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"              ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                                 ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                           ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                   ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                 ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                     ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                   ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                    ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                           ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                             ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                   ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                    ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                 ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                ? 'C11 H12 N2 O2'     204.225 
TTD 'DNA linking'       n 'CIS-SYN CYCLOBUTANE THYMINE DIMER'       
;[(3S,4S,9S,10R,12R,15AR,18BS,18CS)-3,7-DIHYDROXY-15A,15B-DIMETHYL-7-OXIDO-13,15,16,18-TETRAOXOHEXADECAHYDRO-1H-1,4-EPOXY-9,12-METHANO-6,8,11-TRIOXA-12A,14,17,18A-TETRAAZA-7-PHOSPHACYCLOHEXADECA[1,2,3,4-DEF]BIPHENYLEN-10-YL]METHYL DIHYDROGEN PHOSPHATE
;
'C20 H28 N4 O15 P2' 626.402 
TYR 'L-peptide linking' y TYROSINE                                  ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                    ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1SL2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.16 
_exptl_crystal.density_percent_sol   60.73 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'VAPOR DIFFUSION, HANGING DROP, pH 7.5' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2003-07-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             0.979 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1SL2 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.3 
_reflns.number_obs                   52685 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         93.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.089 
_reflns.pdbx_netI_over_sigmaI        30.4 
_reflns.B_iso_Wilson_estimate        26.6 
_reflns.pdbx_redundancy              27.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.38 
_reflns_shell.percent_possible_all   88.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.338 
_reflns_shell.meanI_over_sigI_obs    5.88 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1SL2 
_refine.ls_number_reflns_obs                     48921 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    92.8 
_refine.ls_R_factor_obs                          0.246 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.246 
_refine.ls_R_factor_R_free                       0.279 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  2416 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               34.7 
_refine.aniso_B[1][1]                            6.63 
_refine.aniso_B[2][2]                            7.72 
_refine.aniso_B[3][3]                            -14.36 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.338115 
_refine.solvent_model_param_bsol                 34.8884 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1SL2 
_refine_analyze.Luzzati_coordinate_error_obs    0.31 
_refine_analyze.Luzzati_sigma_a_obs             0.18 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.37 
_refine_analyze.Luzzati_sigma_a_free            0.23 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5893 
_refine_hist.pdbx_number_atoms_nucleic_acid   410 
_refine_hist.pdbx_number_atoms_ligand         32 
_refine_hist.number_atoms_solvent             223 
_refine_hist.number_atoms_total               6558 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      21.6  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.87  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.02  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.60  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             7.83  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            8.84  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.30 
_refine_ls_shell.d_res_low                        2.44 
_refine_ls_shell.number_reflns_R_work             7197 
_refine_ls_shell.R_factor_R_work                  0.251 
_refine_ls_shell.percent_reflns_obs               86.6 
_refine_ls_shell.R_factor_R_free                  0.299 
_refine_ls_shell.R_factor_R_free_error            0.017 
_refine_ls_shell.percent_reflns_R_free            4.1 
_refine_ls_shell.number_reflns_R_free             307 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1SL2 
_struct.title                     
;Ternary 5' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn thymine dimer on the template and an incoming nucleotide
;
_struct.pdbx_descriptor           'DNA POLYMERASE (E.C.2.7.7.7)/THIOREDOXIN 1/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SL2 
_struct_keywords.pdbx_keywords   'TRANSFERASE/ELECTRON TRANSPORT/DNA' 
_struct_keywords.text            
'DNA polymerase, fidelity, lesion bypass, thymine dimer, open, close, TRANSFERASE-ELECTRON TRANSPORT-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 6 ? 
I N N 7 ? 
J N N 7 ? 
K N N 7 ? 
L N N 7 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU C 11  ? VAL C 15  ? LEU A 11  VAL A 15  5 ? 5  
HELX_P HELX_P2  2  ARG C 35  ? SER C 37  ? ARG A 35  SER A 37  5 ? 3  
HELX_P HELX_P3  3  ASP C 38  ? ARG C 52  ? ASP A 38  ARG A 52  1 ? 15 
HELX_P HELX_P4  4  TYR C 64  ? ASN C 78  ? TYR A 64  ASN A 78  1 ? 15 
HELX_P HELX_P5  5  PRO C 84  ? GLU C 86  ? PRO A 84  GLU A 86  5 ? 3  
HELX_P HELX_P6  6  THR C 91  ? HIS C 99  ? THR A 91  HIS A 99  1 ? 9  
HELX_P HELX_P7  7  ARG C 111 ? LEU C 115 ? ARG A 111 LEU A 115 5 ? 5  
HELX_P HELX_P8  8  GLU C 120 ? GLN C 144 ? GLU A 126 GLN A 150 1 ? 25 
HELX_P HELX_P9  9  GLY C 151 ? TRP C 155 ? GLY A 157 TRP A 161 5 ? 5  
HELX_P HELX_P10 10 ASN C 158 ? SER C 181 ? ASN A 164 SER A 187 1 ? 24 
HELX_P HELX_P11 11 GLY C 196 ? SER C 204 ? GLY A 202 SER A 210 1 ? 9  
HELX_P HELX_P12 12 LEU C 205 ? GLY C 225 ? LEU A 211 GLY A 231 1 ? 21 
HELX_P HELX_P13 13 ASP C 229 ? PHE C 255 ? ASP A 235 PHE A 261 1 ? 27 
HELX_P HELX_P14 14 SER C 332 ? ALA C 343 ? SER A 338 ALA A 349 1 ? 12 
HELX_P HELX_P15 15 ASP C 359 ? VAL C 366 ? ASP A 365 VAL A 372 1 ? 8  
HELX_P HELX_P16 16 ASP C 370 ? ALA C 394 ? ASP A 376 ALA A 400 1 ? 25 
HELX_P HELX_P17 17 ALA C 399 ? VAL C 404 ? ALA A 405 VAL A 410 1 ? 6  
HELX_P HELX_P18 18 TYR C 441 ? PHE C 449 ? TYR A 447 PHE A 455 1 ? 9  
HELX_P HELX_P19 19 GLY C 450 ? HIS C 454 ? GLY A 456 HIS A 460 5 ? 5  
HELX_P HELX_P20 20 GLY C 472 ? ASN C 487 ? GLY A 478 ASN A 493 1 ? 16 
HELX_P HELX_P21 21 GLY C 488 ? LEU C 495 ? GLY A 494 LEU A 501 1 ? 8  
HELX_P HELX_P22 22 ASP C 498 ? ALA C 507 ? ASP A 504 ALA A 513 1 ? 10 
HELX_P HELX_P23 23 THR C 511 ? TYR C 524 ? THR A 517 TYR A 530 1 ? 14 
HELX_P HELX_P24 24 ASP C 528 ? GLY C 536 ? ASP A 534 GLY A 542 1 ? 9  
HELX_P HELX_P25 25 GLY C 538 ? THR C 553 ? GLY A 544 THR A 559 1 ? 16 
HELX_P HELX_P26 26 PRO C 554 ? VAL C 568 ? PRO A 560 VAL A 574 1 ? 15 
HELX_P HELX_P27 27 ALA C 602 ? LYS C 630 ? ALA A 608 LYS A 636 1 ? 29 
HELX_P HELX_P28 28 THR C 656 ? TRP C 678 ? THR A 662 TRP A 684 1 ? 23 
HELX_P HELX_P29 29 SER D 11  ? VAL D 16  ? SER B 11  VAL B 16  1 ? 6  
HELX_P HELX_P30 30 CYS D 32  ? TYR D 49  ? CYS B 32  TYR B 49  1 ? 18 
HELX_P HELX_P31 31 GLY D 65  ? TYR D 70  ? GLY B 65  TYR B 70  1 ? 6  
HELX_P HELX_P32 32 SER D 95  ? LEU D 107 ? SER B 95  LEU B 107 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E MG  .  MG    ? ? ? 1_555 C ALA 470 O   ? ? A MG  4001 A ALA 476  1_555 ? ? ? ? ? ? ?            2.510 ? 
metalc2  metalc ? ? E MG  .  MG    ? ? ? 1_555 H DAD .   O1G ? ? A MG  4001 A DAD 4004 1_555 ? ? ? ? ? ? ?            2.622 ? 
metalc3  metalc ? ? E MG  .  MG    ? ? ? 1_555 H DAD .   O1A ? ? A MG  4001 A DAD 4004 1_555 ? ? ? ? ? ? ?            2.975 ? 
metalc4  metalc ? ? E MG  .  MG    ? ? ? 1_555 H DAD .   O2B ? ? A MG  4001 A DAD 4004 1_555 ? ? ? ? ? ? ?            2.666 ? 
metalc5  metalc ? ? E MG  .  MG    ? ? ? 1_555 H DAD .   O3A ? ? A MG  4001 A DAD 4004 1_555 ? ? ? ? ? ? ?            2.600 ? 
metalc6  metalc ? ? E MG  .  MG    ? ? ? 1_555 C ASP 648 OD2 ? ? A MG  4001 A ASP 654  1_555 ? ? ? ? ? ? ?            2.561 ? 
metalc7  metalc ? ? F MG  .  MG    ? ? ? 1_555 C ASP 648 OD1 ? ? A MG  4002 A ASP 654  1_555 ? ? ? ? ? ? ?            2.371 ? 
metalc8  metalc ? ? F MG  .  MG    ? ? ? 1_555 K HOH .   O   ? ? A MG  4002 A HOH 5046 1_555 ? ? ? ? ? ? ?            2.570 ? 
metalc9  metalc ? ? F MG  .  MG    ? ? ? 1_555 H DAD .   O1A ? ? A MG  4002 A DAD 4004 1_555 ? ? ? ? ? ? ?            2.484 ? 
metalc10 metalc ? ? F MG  .  MG    ? ? ? 1_555 K HOH .   O   ? ? A MG  4002 A HOH 5288 1_555 ? ? ? ? ? ? ?            3.009 ? 
metalc11 metalc ? ? F MG  .  MG    ? ? ? 1_555 C ASP 469 OD1 ? ? A MG  4002 A ASP 475  1_555 ? ? ? ? ? ? ?            3.033 ? 
metalc12 metalc ? ? F MG  .  MG    ? ? ? 1_555 C ASP 469 OD2 ? ? A MG  4002 A ASP 475  1_555 ? ? ? ? ? ? ?            2.382 ? 
metalc13 metalc ? ? F MG  .  MG    ? ? ? 1_555 C ASP 648 OD2 ? ? A MG  4002 A ASP 654  1_555 ? ? ? ? ? ? ?            3.062 ? 
metalc14 metalc ? ? G MG  .  MG    ? ? ? 1_555 K HOH .   O   ? ? A MG  4003 A HOH 5043 1_555 ? ? ? ? ? ? ?            2.554 ? 
metalc15 metalc ? ? G MG  .  MG    ? ? ? 1_555 K HOH .   O   ? ? A MG  4003 A HOH 5291 1_555 ? ? ? ? ? ? ?            2.596 ? 
metalc16 metalc ? ? G MG  .  MG    ? ? ? 1_555 K HOH .   O   ? ? A MG  4003 A HOH 5280 1_555 ? ? ? ? ? ? ?            2.769 ? 
metalc17 metalc ? ? G MG  .  MG    ? ? ? 1_555 K HOH .   O   ? ? A MG  4003 A HOH 5290 1_555 ? ? ? ? ? ? ?            2.532 ? 
metalc18 metalc ? ? G MG  .  MG    ? ? ? 1_555 K HOH .   O   ? ? A MG  4003 A HOH 5289 1_555 ? ? ? ? ? ? ?            2.673 ? 
covale1  covale ? ? A DT  21 "O3'" ? ? ? 1_555 A 2DA 22  P   ? ? P DT  21   P 2DA 22   1_555 ? ? ? ? ? ? ?            1.609 ? 
covale2  covale ? ? B TTD 4  "O3'" ? ? ? 1_555 B DA  5   P   ? ? T TTD 5    T DA  6    1_555 ? ? ? ? ? ? ?            1.619 ? 
hydrog1  hydrog ? ? A DC  14 N3    ? ? ? 1_555 B DG  12  N1  ? ? P DC  14   T DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DC  14 N4    ? ? ? 1_555 B DG  12  O6  ? ? P DC  14   T DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DC  14 O2    ? ? ? 1_555 B DG  12  N2  ? ? P DC  14   T DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DA  15 N1    ? ? ? 1_555 B DT  11  N3  ? ? P DA  15   T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DA  15 N6    ? ? ? 1_555 B DT  11  O4  ? ? P DA  15   T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DG  16 N1    ? ? ? 1_555 B DC  10  N3  ? ? P DG  16   T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DG  16 N2    ? ? ? 1_555 B DC  10  O2  ? ? P DG  16   T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DG  16 O6    ? ? ? 1_555 B DC  10  N4  ? ? P DG  16   T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DT  17 N3    ? ? ? 1_555 B DA  9   N1  ? ? P DT  17   T DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DT  17 O4    ? ? ? 1_555 B DA  9   N6  ? ? P DT  17   T DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG  18 N1    ? ? ? 1_555 B DC  8   N3  ? ? P DG  18   T DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG  18 N2    ? ? ? 1_555 B DC  8   O2  ? ? P DG  18   T DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DG  18 O6    ? ? ? 1_555 B DC  8   N4  ? ? P DG  18   T DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DC  19 N3    ? ? ? 1_555 B DG  7   N1  ? ? P DC  19   T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DC  19 N4    ? ? ? 1_555 B DG  7   O6  ? ? P DC  19   T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DC  19 O2    ? ? ? 1_555 B DG  7   N2  ? ? P DC  19   T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DC  20 N3    ? ? ? 1_555 B DG  6   N1  ? ? P DC  20   T DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DC  20 N4    ? ? ? 1_555 B DG  6   O6  ? ? P DC  20   T DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DC  20 O2    ? ? ? 1_555 B DG  6   N2  ? ? P DC  20   T DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DT  21 N3    ? ? ? 1_555 B DA  5   N1  ? ? P DT  21   T DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DT  21 O4    ? ? ? 1_555 B DA  5   N6  ? ? P DT  21   T DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 428 C . ? PHE 434 A PRO 429 C ? PRO 435 A 1 -0.89 
2 ILE 75  D . ? ILE 75  B PRO 76  D ? PRO 76  B 1 -0.03 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 3 ? 
D ? 2 ? 
E ? 4 ? 
F ? 2 ? 
G ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR C 31  ? TYR C 34  ? TYR A 31  TYR A 34  
A 2 PHE C 18  ? ASP C 25  ? PHE A 18  ASP A 25  
A 3 ILE C 2   ? ALA C 8   ? ILE A 2   ALA A 8   
A 4 ILE C 56  ? PHE C 58  ? ILE A 56  PHE A 58  
A 5 CYS C 88  ? ASP C 90  ? CYS A 88  ASP A 90  
B 1 PHE C 226 ? PRO C 227 ? PHE A 232 PRO A 233 
B 2 LYS C 409 ? ILE C 410 ? LYS A 415 ILE A 416 
C 1 TRP C 258 ? PRO C 261 ? TRP A 264 PRO A 267 
C 2 THR C 321 ? VAL C 326 ? THR A 327 VAL A 332 
C 3 GLY D 74  ? ILE D 75  ? GLY B 74  ILE B 75  
D 1 SER C 413 ? ASN C 415 ? SER A 419 ASN A 421 
D 2 THR C 425 ? ALA C 427 ? THR A 431 ALA A 433 
E 1 PHE C 640 ? TRP C 645 ? PHE A 646 TRP A 651 
E 2 GLU C 649 ? CYS C 654 ? GLU A 655 CYS A 660 
E 3 VAL C 464 ? ALA C 470 ? VAL A 470 ALA A 476 
E 4 THR C 686 ? GLY C 691 ? THR A 692 GLY A 697 
F 1 TRP C 586 ? LYS C 588 ? TRP A 592 LYS A 594 
F 2 LYS C 594 ? HIS C 596 ? LYS A 600 HIS A 602 
G 1 ILE D 5   ? HIS D 6   ? ILE B 5   HIS B 6   
G 2 THR D 54  ? ASN D 59  ? THR B 54  ASN B 59  
G 3 ALA D 22  ? TRP D 28  ? ALA B 22  TRP B 28  
G 4 THR D 77  ? LYS D 82  ? THR B 77  LYS B 82  
G 5 GLU D 85  ? VAL D 91  ? GLU B 85  VAL B 91  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR C 34  ? O TYR A 34  N GLY C 21  ? N GLY A 21  
A 2 3 O TYR C 24  ? O TYR A 24  N VAL C 3   ? N VAL A 3   
A 3 4 N SER C 4   ? N SER A 4   O VAL C 57  ? O VAL A 57  
A 4 5 N ILE C 56  ? N ILE A 56  O ILE C 89  ? O ILE A 89  
B 1 2 N PHE C 226 ? N PHE A 232 O ILE C 410 ? O ILE A 416 
C 1 2 N TRP C 258 ? N TRP A 264 O VAL C 326 ? O VAL A 332 
C 2 3 N THR C 321 ? N THR A 327 O ILE D 75  ? O ILE B 75  
D 1 2 N ASN C 415 ? N ASN A 421 O THR C 425 ? O THR A 431 
E 1 2 N ALA C 641 ? N ALA A 647 O GLY C 653 ? O GLY A 659 
E 2 3 O CYS C 654 ? O CYS A 660 N VAL C 464 ? N VAL A 470 
E 3 4 N GLN C 465 ? N GLN A 471 O GLY C 691 ? O GLY A 697 
F 1 2 N ILE C 587 ? N ILE A 593 O VAL C 595 ? O VAL A 601 
G 1 2 N ILE D 5   ? N ILE B 5   O VAL D 55  ? O VAL B 55  
G 2 3 O ALA D 56  ? O ALA B 56  N LEU D 24  ? N LEU B 24  
G 3 4 N VAL D 25  ? N VAL B 25  O LEU D 79  ? O LEU B 79  
G 4 5 N LEU D 78  ? N LEU B 78  O LYS D 90  ? O LYS B 90  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 4001'  
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 4002'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 4003'  
AC4 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE DAD A 4004' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  ASP C 469 ? ASP A 475  . ? 1_555 ? 
2  AC1 6  ALA C 470 ? ALA A 476  . ? 1_555 ? 
3  AC1 6  GLY C 472 ? GLY A 478  . ? 1_555 ? 
4  AC1 6  LEU C 473 ? LEU A 479  . ? 1_555 ? 
5  AC1 6  ASP C 648 ? ASP A 654  . ? 1_555 ? 
6  AC1 6  DAD H .   ? DAD A 4004 . ? 1_555 ? 
7  AC2 5  ASP C 469 ? ASP A 475  . ? 1_555 ? 
8  AC2 5  ASP C 648 ? ASP A 654  . ? 1_555 ? 
9  AC2 5  DAD H .   ? DAD A 4004 . ? 1_555 ? 
10 AC2 5  HOH K .   ? HOH A 5046 . ? 1_555 ? 
11 AC2 5  HOH K .   ? HOH A 5288 . ? 1_555 ? 
12 AC3 6  ASP C 5   ? ASP A 5    . ? 1_555 ? 
13 AC3 6  HOH K .   ? HOH A 5043 . ? 1_555 ? 
14 AC3 6  HOH K .   ? HOH A 5280 . ? 1_555 ? 
15 AC3 6  HOH K .   ? HOH A 5289 . ? 1_555 ? 
16 AC3 6  HOH K .   ? HOH A 5290 . ? 1_555 ? 
17 AC3 6  HOH K .   ? HOH A 5291 . ? 1_555 ? 
18 AC4 18 ARG C 423 ? ARG A 429  . ? 1_555 ? 
19 AC4 18 ASP C 469 ? ASP A 475  . ? 1_555 ? 
20 AC4 18 ALA C 470 ? ALA A 476  . ? 1_555 ? 
21 AC4 18 SER C 471 ? SER A 477  . ? 1_555 ? 
22 AC4 18 GLY C 472 ? GLY A 478  . ? 1_555 ? 
23 AC4 18 LEU C 473 ? LEU A 479  . ? 1_555 ? 
24 AC4 18 GLU C 474 ? GLU A 480  . ? 1_555 ? 
25 AC4 18 HIS C 500 ? HIS A 506  . ? 1_555 ? 
26 AC4 18 ARG C 512 ? ARG A 518  . ? 1_555 ? 
27 AC4 18 LYS C 516 ? LYS A 522  . ? 1_555 ? 
28 AC4 18 TYR C 520 ? TYR A 526  . ? 1_555 ? 
29 AC4 18 ASP C 648 ? ASP A 654  . ? 1_555 ? 
30 AC4 18 MG  E .   ? MG  A 4001 . ? 1_555 ? 
31 AC4 18 MG  F .   ? MG  A 4002 . ? 1_555 ? 
32 AC4 18 HOH K .   ? HOH A 5056 . ? 1_555 ? 
33 AC4 18 HOH K .   ? HOH A 5288 . ? 1_555 ? 
34 AC4 18 2DA A 22  ? 2DA P 22   . ? 1_555 ? 
35 AC4 18 TTD B 4   ? TTD T 5    . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1SL2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SL2 
_atom_sites.fract_transf_matrix[1][1]   0.009525 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004704 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019251 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    P  P     . DC  A 1 14  ? 65.602 43.632  18.648  1.00 73.50 ? 14   DC  P P     1 
ATOM   2    O  OP1   . DC  A 1 14  ? 65.487 42.412  17.745  1.00 72.77 ? 14   DC  P OP1   1 
ATOM   3    O  OP2   . DC  A 1 14  ? 66.567 43.433  19.809  1.00 72.92 ? 14   DC  P OP2   1 
ATOM   4    O  "O5'" . DC  A 1 14  ? 64.118 43.841  19.292  1.00 71.87 ? 14   DC  P "O5'" 1 
ATOM   5    C  "C5'" . DC  A 1 14  ? 63.936 43.999  20.713  1.00 69.35 ? 14   DC  P "C5'" 1 
ATOM   6    C  "C4'" . DC  A 1 14  ? 62.490 44.313  21.023  1.00 67.79 ? 14   DC  P "C4'" 1 
ATOM   7    O  "O4'" . DC  A 1 14  ? 62.099 45.532  20.342  1.00 67.11 ? 14   DC  P "O4'" 1 
ATOM   8    C  "C3'" . DC  A 1 14  ? 61.487 43.245  20.585  1.00 66.87 ? 14   DC  P "C3'" 1 
ATOM   9    O  "O3'" . DC  A 1 14  ? 60.436 43.149  21.549  1.00 66.58 ? 14   DC  P "O3'" 1 
ATOM   10   C  "C2'" . DC  A 1 14  ? 60.949 43.784  19.272  1.00 66.75 ? 14   DC  P "C2'" 1 
ATOM   11   C  "C1'" . DC  A 1 14  ? 60.978 45.288  19.502  1.00 66.34 ? 14   DC  P "C1'" 1 
ATOM   12   N  N1    . DC  A 1 14  ? 61.134 46.107  18.280  1.00 64.92 ? 14   DC  P N1    1 
ATOM   13   C  C2    . DC  A 1 14  ? 60.314 47.236  18.110  1.00 64.02 ? 14   DC  P C2    1 
ATOM   14   O  O2    . DC  A 1 14  ? 59.483 47.521  18.990  1.00 63.58 ? 14   DC  P O2    1 
ATOM   15   N  N3    . DC  A 1 14  ? 60.450 47.986  16.992  1.00 63.18 ? 14   DC  P N3    1 
ATOM   16   C  C4    . DC  A 1 14  ? 61.354 47.652  16.067  1.00 62.55 ? 14   DC  P C4    1 
ATOM   17   N  N4    . DC  A 1 14  ? 61.450 48.419  14.981  1.00 61.15 ? 14   DC  P N4    1 
ATOM   18   C  C5    . DC  A 1 14  ? 62.201 46.515  16.215  1.00 63.02 ? 14   DC  P C5    1 
ATOM   19   C  C6    . DC  A 1 14  ? 62.059 45.779  17.325  1.00 63.83 ? 14   DC  P C6    1 
ATOM   20   P  P     . DA  A 1 15  ? 59.316 42.003  21.407  1.00 68.32 ? 15   DA  P P     1 
ATOM   21   O  OP1   . DA  A 1 15  ? 59.308 41.205  22.662  1.00 68.44 ? 15   DA  P OP1   1 
ATOM   22   O  OP2   . DA  A 1 15  ? 59.482 41.311  20.097  1.00 68.05 ? 15   DA  P OP2   1 
ATOM   23   O  "O5'" . DA  A 1 15  ? 57.959 42.830  21.350  1.00 66.26 ? 15   DA  P "O5'" 1 
ATOM   24   C  "C5'" . DA  A 1 15  ? 57.688 43.838  22.320  1.00 63.92 ? 15   DA  P "C5'" 1 
ATOM   25   C  "C4'" . DA  A 1 15  ? 56.543 44.709  21.863  1.00 61.88 ? 15   DA  P "C4'" 1 
ATOM   26   O  "O4'" . DA  A 1 15  ? 56.949 45.507  20.726  1.00 60.91 ? 15   DA  P "O4'" 1 
ATOM   27   C  "C3'" . DA  A 1 15  ? 55.303 43.935  21.420  1.00 61.19 ? 15   DA  P "C3'" 1 
ATOM   28   O  "O3'" . DA  A 1 15  ? 54.139 44.623  21.866  1.00 62.08 ? 15   DA  P "O3'" 1 
ATOM   29   C  "C2'" . DA  A 1 15  ? 55.392 43.958  19.905  1.00 60.87 ? 15   DA  P "C2'" 1 
ATOM   30   C  "C1'" . DA  A 1 15  ? 56.053 45.301  19.644  1.00 59.59 ? 15   DA  P "C1'" 1 
ATOM   31   N  N9    . DA  A 1 15  ? 56.820 45.378  18.399  1.00 57.92 ? 15   DA  P N9    1 
ATOM   32   C  C8    . DA  A 1 15  ? 57.871 44.586  17.997  1.00 57.34 ? 15   DA  P C8    1 
ATOM   33   N  N7    . DA  A 1 15  ? 58.351 44.903  16.818  1.00 57.05 ? 15   DA  P N7    1 
ATOM   34   C  C5    . DA  A 1 15  ? 57.566 45.976  16.415  1.00 56.87 ? 15   DA  P C5    1 
ATOM   35   C  C6    . DA  A 1 15  ? 57.569 46.765  15.252  1.00 56.08 ? 15   DA  P C6    1 
ATOM   36   N  N6    . DA  A 1 15  ? 58.419 46.586  14.238  1.00 56.10 ? 15   DA  P N6    1 
ATOM   37   N  N1    . DA  A 1 15  ? 56.656 47.758  15.164  1.00 57.02 ? 15   DA  P N1    1 
ATOM   38   C  C2    . DA  A 1 15  ? 55.802 47.937  16.181  1.00 56.67 ? 15   DA  P C2    1 
ATOM   39   N  N3    . DA  A 1 15  ? 55.699 47.261  17.322  1.00 56.47 ? 15   DA  P N3    1 
ATOM   40   C  C4    . DA  A 1 15  ? 56.620 46.281  17.379  1.00 57.21 ? 15   DA  P C4    1 
ATOM   41   P  P     . DG  A 1 16  ? 52.725 43.865  21.902  1.00 63.06 ? 16   DG  P P     1 
ATOM   42   O  OP1   . DG  A 1 16  ? 52.203 43.903  23.294  1.00 62.96 ? 16   DG  P OP1   1 
ATOM   43   O  OP2   . DG  A 1 16  ? 52.865 42.558  21.201  1.00 63.32 ? 16   DG  P OP2   1 
ATOM   44   O  "O5'" . DG  A 1 16  ? 51.801 44.796  21.005  1.00 60.56 ? 16   DG  P "O5'" 1 
ATOM   45   C  "C5'" . DG  A 1 16  ? 51.828 46.214  21.156  1.00 56.77 ? 16   DG  P "C5'" 1 
ATOM   46   C  "C4'" . DG  A 1 16  ? 51.212 46.873  19.944  1.00 54.35 ? 16   DG  P "C4'" 1 
ATOM   47   O  "O4'" . DG  A 1 16  ? 52.137 46.872  18.827  1.00 52.49 ? 16   DG  P "O4'" 1 
ATOM   48   C  "C3'" . DG  A 1 16  ? 49.943 46.180  19.448  1.00 52.81 ? 16   DG  P "C3'" 1 
ATOM   49   O  "O3'" . DG  A 1 16  ? 48.969 47.162  19.088  1.00 52.29 ? 16   DG  P "O3'" 1 
ATOM   50   C  "C2'" . DG  A 1 16  ? 50.423 45.397  18.236  1.00 51.36 ? 16   DG  P "C2'" 1 
ATOM   51   C  "C1'" . DG  A 1 16  ? 51.503 46.314  17.687  1.00 51.15 ? 16   DG  P "C1'" 1 
ATOM   52   N  N9    . DG  A 1 16  ? 52.527 45.675  16.863  1.00 50.04 ? 16   DG  P N9    1 
ATOM   53   C  C8    . DG  A 1 16  ? 53.221 44.520  17.139  1.00 50.11 ? 16   DG  P C8    1 
ATOM   54   N  N7    . DG  A 1 16  ? 54.089 44.208  16.214  1.00 49.44 ? 16   DG  P N7    1 
ATOM   55   C  C5    . DG  A 1 16  ? 53.961 45.214  15.265  1.00 48.55 ? 16   DG  P C5    1 
ATOM   56   C  C6    . DG  A 1 16  ? 54.649 45.417  14.035  1.00 47.58 ? 16   DG  P C6    1 
ATOM   57   O  O6    . DG  A 1 16  ? 55.530 44.724  13.519  1.00 46.86 ? 16   DG  P O6    1 
ATOM   58   N  N1    . DG  A 1 16  ? 54.213 46.567  13.390  1.00 48.68 ? 16   DG  P N1    1 
ATOM   59   C  C2    . DG  A 1 16  ? 53.240 47.412  13.855  1.00 46.60 ? 16   DG  P C2    1 
ATOM   60   N  N2    . DG  A 1 16  ? 52.964 48.460  13.078  1.00 46.35 ? 16   DG  P N2    1 
ATOM   61   N  N3    . DG  A 1 16  ? 52.588 47.237  14.996  1.00 47.88 ? 16   DG  P N3    1 
ATOM   62   C  C4    . DG  A 1 16  ? 52.998 46.126  15.646  1.00 49.16 ? 16   DG  P C4    1 
ATOM   63   P  P     . DT  A 1 17  ? 47.426 46.742  18.941  1.00 52.86 ? 17   DT  P P     1 
ATOM   64   O  OP1   . DT  A 1 17  ? 46.614 47.793  19.611  1.00 54.50 ? 17   DT  P OP1   1 
ATOM   65   O  OP2   . DT  A 1 17  ? 47.269 45.316  19.340  1.00 52.74 ? 17   DT  P OP2   1 
ATOM   66   O  "O5'" . DT  A 1 17  ? 47.177 46.833  17.378  1.00 51.48 ? 17   DT  P "O5'" 1 
ATOM   67   C  "C5'" . DT  A 1 17  ? 48.252 46.602  16.482  1.00 50.34 ? 17   DT  P "C5'" 1 
ATOM   68   C  "C4'" . DT  A 1 17  ? 47.943 47.189  15.131  1.00 47.87 ? 17   DT  P "C4'" 1 
ATOM   69   O  "O4'" . DT  A 1 17  ? 49.104 47.008  14.290  1.00 48.54 ? 17   DT  P "O4'" 1 
ATOM   70   C  "C3'" . DT  A 1 17  ? 46.789 46.484  14.429  1.00 46.36 ? 17   DT  P "C3'" 1 
ATOM   71   O  "O3'" . DT  A 1 17  ? 46.008 47.446  13.715  1.00 43.14 ? 17   DT  P "O3'" 1 
ATOM   72   C  "C2'" . DT  A 1 17  ? 47.479 45.466  13.536  1.00 45.45 ? 17   DT  P "C2'" 1 
ATOM   73   C  "C1'" . DT  A 1 17  ? 48.828 46.110  13.229  1.00 47.57 ? 17   DT  P "C1'" 1 
ATOM   74   N  N1    . DT  A 1 17  ? 49.978 45.175  13.124  1.00 48.52 ? 17   DT  P N1    1 
ATOM   75   C  C2    . DT  A 1 17  ? 50.897 45.392  12.122  1.00 48.25 ? 17   DT  P C2    1 
ATOM   76   O  O2    . DT  A 1 17  ? 50.827 46.323  11.338  1.00 49.41 ? 17   DT  P O2    1 
ATOM   77   N  N3    . DT  A 1 17  ? 51.916 44.475  12.074  1.00 49.56 ? 17   DT  P N3    1 
ATOM   78   C  C4    . DT  A 1 17  ? 52.114 43.392  12.907  1.00 50.66 ? 17   DT  P C4    1 
ATOM   79   O  O4    . DT  A 1 17  ? 53.083 42.648  12.728  1.00 52.15 ? 17   DT  P O4    1 
ATOM   80   C  C5    . DT  A 1 17  ? 51.121 43.229  13.948  1.00 50.55 ? 17   DT  P C5    1 
ATOM   81   C  C7    . DT  A 1 17  ? 51.254 42.086  14.910  1.00 50.31 ? 17   DT  P C7    1 
ATOM   82   C  C6    . DT  A 1 17  ? 50.119 44.116  14.003  1.00 48.64 ? 17   DT  P C6    1 
ATOM   83   P  P     . DG  A 1 18  ? 44.663 46.990  12.971  1.00 42.36 ? 18   DG  P P     1 
ATOM   84   O  OP1   . DG  A 1 18  ? 43.830 48.198  12.755  1.00 44.72 ? 18   DG  P OP1   1 
ATOM   85   O  OP2   . DG  A 1 18  ? 44.083 45.817  13.678  1.00 43.01 ? 18   DG  P OP2   1 
ATOM   86   O  "O5'" . DG  A 1 18  ? 45.200 46.506  11.554  1.00 44.95 ? 18   DG  P "O5'" 1 
ATOM   87   C  "C5'" . DG  A 1 18  ? 45.985 47.384  10.752  1.00 43.68 ? 18   DG  P "C5'" 1 
ATOM   88   C  "C4'" . DG  A 1 18  ? 46.442 46.690  9.492   1.00 44.03 ? 18   DG  P "C4'" 1 
ATOM   89   O  "O4'" . DG  A 1 18  ? 47.635 45.903  9.738   1.00 43.53 ? 18   DG  P "O4'" 1 
ATOM   90   C  "C3'" . DG  A 1 18  ? 45.415 45.752  8.850   1.00 44.33 ? 18   DG  P "C3'" 1 
ATOM   91   O  "O3'" . DG  A 1 18  ? 45.282 46.054  7.458   1.00 44.07 ? 18   DG  P "O3'" 1 
ATOM   92   C  "C2'" . DG  A 1 18  ? 46.006 44.368  9.068   1.00 43.31 ? 18   DG  P "C2'" 1 
ATOM   93   C  "C1'" . DG  A 1 18  ? 47.502 44.641  9.110   1.00 44.37 ? 18   DG  P "C1'" 1 
ATOM   94   N  N9    . DG  A 1 18  ? 48.291 43.667  9.866   1.00 45.95 ? 18   DG  P N9    1 
ATOM   95   C  C8    . DG  A 1 18  ? 47.950 43.051  11.050  1.00 45.75 ? 18   DG  P C8    1 
ATOM   96   N  N7    . DG  A 1 18  ? 48.848 42.198  11.464  1.00 47.19 ? 18   DG  P N7    1 
ATOM   97   C  C5    . DG  A 1 18  ? 49.848 42.257  10.502  1.00 46.38 ? 18   DG  P C5    1 
ATOM   98   C  C6    . DG  A 1 18  ? 51.078 41.549  10.410  1.00 47.17 ? 18   DG  P C6    1 
ATOM   99   O  O6    . DG  A 1 18  ? 51.540 40.703  11.188  1.00 47.01 ? 18   DG  P O6    1 
ATOM   100  N  N1    . DG  A 1 18  ? 51.794 41.912  9.271   1.00 46.65 ? 18   DG  P N1    1 
ATOM   101  C  C2    . DG  A 1 18  ? 51.381 42.842  8.342   1.00 46.94 ? 18   DG  P C2    1 
ATOM   102  N  N2    . DG  A 1 18  ? 52.212 43.061  7.306   1.00 45.20 ? 18   DG  P N2    1 
ATOM   103  N  N3    . DG  A 1 18  ? 50.239 43.508  8.420   1.00 45.99 ? 18   DG  P N3    1 
ATOM   104  C  C4    . DG  A 1 18  ? 49.527 43.167  9.515   1.00 46.01 ? 18   DG  P C4    1 
ATOM   105  P  P     . DC  A 1 19  ? 44.310 45.168  6.528   1.00 41.97 ? 19   DC  P P     1 
ATOM   106  O  OP1   . DC  A 1 19  ? 43.395 46.091  5.819   1.00 42.08 ? 19   DC  P OP1   1 
ATOM   107  O  OP2   . DC  A 1 19  ? 43.747 44.048  7.322   1.00 41.44 ? 19   DC  P OP2   1 
ATOM   108  O  "O5'" . DC  A 1 19  ? 45.330 44.577  5.455   1.00 40.43 ? 19   DC  P "O5'" 1 
ATOM   109  C  "C5'" . DC  A 1 19  ? 46.268 45.444  4.813   1.00 36.78 ? 19   DC  P "C5'" 1 
ATOM   110  C  "C4'" . DC  A 1 19  ? 47.222 44.656  3.946   1.00 36.75 ? 19   DC  P "C4'" 1 
ATOM   111  O  "O4'" . DC  A 1 19  ? 48.134 43.887  4.767   1.00 35.57 ? 19   DC  P "O4'" 1 
ATOM   112  C  "C3'" . DC  A 1 19  ? 46.562 43.661  2.992   1.00 36.61 ? 19   DC  P "C3'" 1 
ATOM   113  O  "O3'" . DC  A 1 19  ? 47.280 43.668  1.756   1.00 37.98 ? 19   DC  P "O3'" 1 
ATOM   114  C  "C2'" . DC  A 1 19  ? 46.737 42.333  3.710   1.00 34.83 ? 19   DC  P "C2'" 1 
ATOM   115  C  "C1'" . DC  A 1 19  ? 48.091 42.530  4.373   1.00 34.15 ? 19   DC  P "C1'" 1 
ATOM   116  N  N1    . DC  A 1 19  ? 48.406 41.694  5.552   1.00 34.71 ? 19   DC  P N1    1 
ATOM   117  C  C2    . DC  A 1 19  ? 49.665 41.065  5.605   1.00 33.28 ? 19   DC  P C2    1 
ATOM   118  O  O2    . DC  A 1 19  ? 50.459 41.230  4.670   1.00 33.23 ? 19   DC  P O2    1 
ATOM   119  N  N3    . DC  A 1 19  ? 49.977 40.290  6.669   1.00 32.89 ? 19   DC  P N3    1 
ATOM   120  C  C4    . DC  A 1 19  ? 49.096 40.129  7.657   1.00 33.43 ? 19   DC  P C4    1 
ATOM   121  N  N4    . DC  A 1 19  ? 49.454 39.354  8.687   1.00 32.89 ? 19   DC  P N4    1 
ATOM   122  C  C5    . DC  A 1 19  ? 47.809 40.756  7.634   1.00 32.53 ? 19   DC  P C5    1 
ATOM   123  C  C6    . DC  A 1 19  ? 47.509 41.523  6.572   1.00 32.97 ? 19   DC  P C6    1 
ATOM   124  P  P     . DC  A 1 20  ? 46.561 43.185  0.402   1.00 40.93 ? 20   DC  P P     1 
ATOM   125  O  OP1   . DC  A 1 20  ? 46.385 44.385  -0.455  1.00 42.06 ? 20   DC  P OP1   1 
ATOM   126  O  OP2   . DC  A 1 20  ? 45.384 42.335  0.743   1.00 37.26 ? 20   DC  P OP2   1 
ATOM   127  O  "O5'" . DC  A 1 20  ? 47.652 42.269  -0.311  1.00 40.29 ? 20   DC  P "O5'" 1 
ATOM   128  C  "C5'" . DC  A 1 20  ? 48.700 41.680  0.444   1.00 38.58 ? 20   DC  P "C5'" 1 
ATOM   129  C  "C4'" . DC  A 1 20  ? 49.310 40.528  -0.314  1.00 35.51 ? 20   DC  P "C4'" 1 
ATOM   130  O  "O4'" . DC  A 1 20  ? 50.191 39.918  0.662   1.00 35.70 ? 20   DC  P "O4'" 1 
ATOM   131  C  "C3'" . DC  A 1 20  ? 48.277 39.466  -0.704  1.00 35.41 ? 20   DC  P "C3'" 1 
ATOM   132  O  "O3'" . DC  A 1 20  ? 48.264 39.052  -2.062  1.00 34.08 ? 20   DC  P "O3'" 1 
ATOM   133  C  "C2'" . DC  A 1 20  ? 48.584 38.252  0.139   1.00 34.11 ? 20   DC  P "C2'" 1 
ATOM   134  C  "C1'" . DC  A 1 20  ? 49.830 38.573  0.927   1.00 33.88 ? 20   DC  P "C1'" 1 
ATOM   135  N  N1    . DC  A 1 20  ? 49.437 38.452  2.340   1.00 33.40 ? 20   DC  P N1    1 
ATOM   136  C  C2    . DC  A 1 20  ? 49.980 37.414  3.091   1.00 32.43 ? 20   DC  P C2    1 
ATOM   137  O  O2    . DC  A 1 20  ? 50.890 36.730  2.598   1.00 32.54 ? 20   DC  P O2    1 
ATOM   138  N  N3    . DC  A 1 20  ? 49.501 37.175  4.328   1.00 33.44 ? 20   DC  P N3    1 
ATOM   139  C  C4    . DC  A 1 20  ? 48.527 37.937  4.827   1.00 33.84 ? 20   DC  P C4    1 
ATOM   140  N  N4    . DC  A 1 20  ? 48.050 37.625  6.035   1.00 31.71 ? 20   DC  P N4    1 
ATOM   141  C  C5    . DC  A 1 20  ? 47.997 39.047  4.107   1.00 34.01 ? 20   DC  P C5    1 
ATOM   142  C  C6    . DC  A 1 20  ? 48.489 39.278  2.885   1.00 32.98 ? 20   DC  P C6    1 
ATOM   143  P  P     . DT  A 1 21  ? 47.087 38.061  -2.549  1.00 35.34 ? 21   DT  P P     1 
ATOM   144  O  OP1   . DT  A 1 21  ? 46.844 38.251  -4.002  1.00 34.98 ? 21   DT  P OP1   1 
ATOM   145  O  OP2   . DT  A 1 21  ? 45.958 38.218  -1.597  1.00 36.65 ? 21   DT  P OP2   1 
ATOM   146  O  "O5'" . DT  A 1 21  ? 47.678 36.599  -2.282  1.00 34.99 ? 21   DT  P "O5'" 1 
ATOM   147  C  "C5'" . DT  A 1 21  ? 48.913 36.191  -2.864  1.00 32.90 ? 21   DT  P "C5'" 1 
ATOM   148  C  "C4'" . DT  A 1 21  ? 49.381 34.873  -2.276  1.00 33.26 ? 21   DT  P "C4'" 1 
ATOM   149  O  "O4'" . DT  A 1 21  ? 49.739 35.041  -0.884  1.00 33.48 ? 21   DT  P "O4'" 1 
ATOM   150  C  "C3'" . DT  A 1 21  ? 48.400 33.711  -2.265  1.00 31.96 ? 21   DT  P "C3'" 1 
ATOM   151  O  "O3'" . DT  A 1 21  ? 48.397 33.066  -3.529  1.00 33.15 ? 21   DT  P "O3'" 1 
ATOM   152  C  "C2'" . DT  A 1 21  ? 49.005 32.795  -1.207  1.00 33.06 ? 21   DT  P "C2'" 1 
ATOM   153  C  "C1'" . DT  A 1 21  ? 49.579 33.804  -0.208  1.00 32.91 ? 21   DT  P "C1'" 1 
ATOM   154  N  N1    . DT  A 1 21  ? 48.721 34.007  0.980   1.00 34.79 ? 21   DT  P N1    1 
ATOM   155  C  C2    . DT  A 1 21  ? 48.809 33.088  2.009   1.00 34.18 ? 21   DT  P C2    1 
ATOM   156  O  O2    . DT  A 1 21  ? 49.519 32.095  1.969   1.00 34.72 ? 21   DT  P O2    1 
ATOM   157  N  N3    . DT  A 1 21  ? 48.018 33.368  3.092   1.00 34.95 ? 21   DT  P N3    1 
ATOM   158  C  C4    . DT  A 1 21  ? 47.153 34.427  3.247   1.00 34.77 ? 21   DT  P C4    1 
ATOM   159  O  O4    . DT  A 1 21  ? 46.519 34.544  4.291   1.00 36.02 ? 21   DT  P O4    1 
ATOM   160  C  C5    . DT  A 1 21  ? 47.078 35.334  2.121   1.00 36.37 ? 21   DT  P C5    1 
ATOM   161  C  C7    . DT  A 1 21  ? 46.131 36.492  2.180   1.00 34.61 ? 21   DT  P C7    1 
ATOM   162  C  C6    . DT  A 1 21  ? 47.864 35.088  1.062   1.00 35.60 ? 21   DT  P C6    1 
HETATM 163  P  P     . 2DA A 1 22  ? 47.149 32.147  -3.960  1.00 35.32 ? 22   2DA P P     1 
HETATM 164  O  OP1   . 2DA A 1 22  ? 47.367 31.759  -5.379  1.00 36.38 ? 22   2DA P OP1   1 
HETATM 165  O  OP2   . 2DA A 1 22  ? 45.898 32.857  -3.579  1.00 36.10 ? 22   2DA P OP2   1 
HETATM 166  O  "O5'" . 2DA A 1 22  ? 47.283 30.847  -3.039  1.00 34.34 ? 22   2DA P "O5'" 1 
HETATM 167  C  "C5'" . 2DA A 1 22  ? 48.310 29.883  -3.272  1.00 37.75 ? 22   2DA P "C5'" 1 
HETATM 168  C  "C4'" . 2DA A 1 22  ? 48.176 28.721  -2.307  1.00 40.57 ? 22   2DA P "C4'" 1 
HETATM 169  O  "O4'" . 2DA A 1 22  ? 48.534 29.150  -0.968  1.00 41.40 ? 22   2DA P "O4'" 1 
HETATM 170  C  "C3'" . 2DA A 1 22  ? 46.781 28.122  -2.178  1.00 41.17 ? 22   2DA P "C3'" 1 
HETATM 171  C  "C2'" . 2DA A 1 22  ? 46.812 27.521  -0.777  1.00 42.17 ? 22   2DA P "C2'" 1 
HETATM 172  C  "C1'" . 2DA A 1 22  ? 47.679 28.533  -0.024  1.00 42.20 ? 22   2DA P "C1'" 1 
HETATM 173  N  N9    . 2DA A 1 22  ? 46.907 29.586  0.633   1.00 43.60 ? 22   2DA P N9    1 
HETATM 174  C  C8    . 2DA A 1 22  ? 46.488 30.779  0.092   1.00 45.00 ? 22   2DA P C8    1 
HETATM 175  N  N7    . 2DA A 1 22  ? 45.840 31.543  0.935   1.00 44.04 ? 22   2DA P N7    1 
HETATM 176  C  C5    . 2DA A 1 22  ? 45.823 30.803  2.106   1.00 44.19 ? 22   2DA P C5    1 
HETATM 177  C  C6    . 2DA A 1 22  ? 45.291 31.068  3.368   1.00 45.06 ? 22   2DA P C6    1 
HETATM 178  N  N6    . 2DA A 1 22  ? 44.660 32.204  3.666   1.00 46.48 ? 22   2DA P N6    1 
HETATM 179  N  N1    . 2DA A 1 22  ? 45.434 30.123  4.326   1.00 46.12 ? 22   2DA P N1    1 
HETATM 180  C  C2    . 2DA A 1 22  ? 46.077 28.989  4.016   1.00 45.60 ? 22   2DA P C2    1 
HETATM 181  N  N3    . 2DA A 1 22  ? 46.627 28.625  2.858   1.00 44.92 ? 22   2DA P N3    1 
HETATM 182  C  C4    . 2DA A 1 22  ? 46.465 29.590  1.934   1.00 44.00 ? 22   2DA P C4    1 
HETATM 183  P  P     . TTD B 2 4   ? 37.460 32.511  13.846  1.00 67.92 ? 5    TTD T P     1 
HETATM 184  O  OP1   . TTD B 2 4   ? 36.079 32.420  13.296  1.00 67.05 ? 5    TTD T OP1   1 
HETATM 185  O  OP2   . TTD B 2 4   ? 37.668 32.465  15.317  1.00 66.50 ? 5    TTD T OP2   1 
HETATM 186  O  "O5'" . TTD B 2 4   ? 38.342 31.357  13.184  1.00 67.07 ? 5    TTD T "O5'" 1 
HETATM 187  C  "C5'" . TTD B 2 4   ? 37.862 30.008  13.116  1.00 65.93 ? 5    TTD T "C5'" 1 
HETATM 188  C  C4R   . TTD B 2 4   ? 38.908 29.089  12.448  1.00 64.40 ? 5    TTD T C4R   1 
HETATM 189  O  "O4'" . TTD B 2 4   ? 39.163 29.398  11.066  1.00 64.98 ? 5    TTD T "O4'" 1 
HETATM 190  C  C3R   . TTD B 2 4   ? 40.215 29.189  13.219  1.00 63.48 ? 5    TTD T C3R   1 
HETATM 191  O  O3R   . TTD B 2 4   ? 40.438 27.898  13.823  1.00 61.01 ? 5    TTD T O3R   1 
HETATM 192  C  "C2'" . TTD B 2 4   ? 41.227 29.578  12.134  1.00 64.46 ? 5    TTD T "C2'" 1 
HETATM 193  C  "C1'" . TTD B 2 4   ? 40.576 29.053  10.858  1.00 64.38 ? 5    TTD T "C1'" 1 
HETATM 194  N  N1    . TTD B 2 4   ? 40.852 29.729  9.545   1.00 63.32 ? 5    TTD T N1    1 
HETATM 195  C  C2    . TTD B 2 4   ? 40.136 29.102  8.491   1.00 62.63 ? 5    TTD T C2    1 
HETATM 196  O  O2    . TTD B 2 4   ? 39.411 28.130  8.663   1.00 62.30 ? 5    TTD T O2    1 
HETATM 197  N  N3    . TTD B 2 4   ? 40.270 29.617  7.274   1.00 62.07 ? 5    TTD T N3    1 
HETATM 198  C  C4    . TTD B 2 4   ? 41.021 30.700  6.913   1.00 61.00 ? 5    TTD T C4    1 
HETATM 199  O  O4    . TTD B 2 4   ? 41.007 31.029  5.738   1.00 60.34 ? 5    TTD T O4    1 
HETATM 200  C  C5    . TTD B 2 4   ? 41.793 31.392  7.991   1.00 60.86 ? 5    TTD T C5    1 
HETATM 201  C  C5A   . TTD B 2 4   ? 41.028 32.815  7.944   1.00 61.32 ? 5    TTD T C5A   1 
HETATM 202  C  C6    . TTD B 2 4   ? 41.702 30.867  9.299   1.00 61.15 ? 5    TTD T C6    1 
HETATM 203  P  PB    . TTD B 2 4   ? 41.688 27.536  14.732  1.00 59.91 ? 5    TTD T PB    1 
HETATM 204  O  O5P   . TTD B 2 4   ? 41.495 26.263  15.424  1.00 60.77 ? 5    TTD T O5P   1 
HETATM 205  O  O4P   . TTD B 2 4   ? 41.875 28.787  15.560  1.00 59.98 ? 5    TTD T O4P   1 
HETATM 206  O  O5R   . TTD B 2 4   ? 42.844 27.374  13.681  1.00 58.04 ? 5    TTD T O5R   1 
HETATM 207  C  C5R   . TTD B 2 4   ? 42.872 26.257  12.772  1.00 55.03 ? 5    TTD T C5R   1 
HETATM 208  O  O4R   . TTD B 2 4   ? 43.129 27.486  10.674  1.00 54.10 ? 5    TTD T O4R   1 
HETATM 209  C  C2R   . TTD B 2 4   ? 44.898 28.749  11.478  1.00 53.42 ? 5    TTD T C2R   1 
HETATM 210  C  C1R   . TTD B 2 4   ? 44.207 28.238  10.250  1.00 54.80 ? 5    TTD T C1R   1 
HETATM 211  N  N1T   . TTD B 2 4   ? 43.998 29.393  9.272   1.00 56.28 ? 5    TTD T N1T   1 
HETATM 212  C  C2T   . TTD B 2 4   ? 44.610 29.080  8.068   1.00 56.48 ? 5    TTD T C2T   1 
HETATM 213  O  O2T   . TTD B 2 4   ? 45.191 28.037  7.847   1.00 54.80 ? 5    TTD T O2T   1 
HETATM 214  N  N3T   . TTD B 2 4   ? 44.562 29.996  7.085   1.00 57.55 ? 5    TTD T N3T   1 
HETATM 215  C  C4T   . TTD B 2 4   ? 43.963 31.235  7.149   1.00 58.45 ? 5    TTD T C4T   1 
HETATM 216  O  O4T   . TTD B 2 4   ? 44.066 31.885  6.125   1.00 58.74 ? 5    TTD T O4T   1 
HETATM 217  C  C5T   . TTD B 2 4   ? 43.296 31.590  8.439   1.00 59.44 ? 5    TTD T C5T   1 
HETATM 218  C  C5M   . TTD B 2 4   ? 43.681 33.105  8.741   1.00 59.62 ? 5    TTD T C5M   1 
HETATM 219  C  C6T   . TTD B 2 4   ? 43.319 30.707  9.412   1.00 59.12 ? 5    TTD T C6T   1 
HETATM 220  C  "C4'" . TTD B 2 4   ? 43.809 26.640  11.622  1.00 52.72 ? 5    TTD T "C4'" 1 
HETATM 221  C  "C3'" . TTD B 2 4   ? 44.981 27.435  12.204  1.00 51.39 ? 5    TTD T "C3'" 1 
HETATM 222  O  "O3'" . TTD B 2 4   ? 46.242 26.785  12.012  1.00 47.39 ? 5    TTD T "O3'" 1 
ATOM   223  P  P     . DA  B 2 5   ? 47.534 27.249  12.870  1.00 44.28 ? 6    DA  T P     1 
ATOM   224  O  OP1   . DA  B 2 5   ? 47.726 26.331  14.015  1.00 45.17 ? 6    DA  T OP1   1 
ATOM   225  O  OP2   . DA  B 2 5   ? 47.465 28.713  13.118  1.00 45.30 ? 6    DA  T OP2   1 
ATOM   226  O  "O5'" . DA  B 2 5   ? 48.730 27.008  11.844  1.00 41.89 ? 6    DA  T "O5'" 1 
ATOM   227  C  "C5'" . DA  B 2 5   ? 48.870 25.759  11.166  1.00 37.67 ? 6    DA  T "C5'" 1 
ATOM   228  C  "C4'" . DA  B 2 5   ? 49.608 25.945  9.856   1.00 36.14 ? 6    DA  T "C4'" 1 
ATOM   229  O  "O4'" . DA  B 2 5   ? 48.745 26.536  8.850   1.00 34.83 ? 6    DA  T "O4'" 1 
ATOM   230  C  "C3'" . DA  B 2 5   ? 50.810 26.870  9.907   1.00 35.24 ? 6    DA  T "C3'" 1 
ATOM   231  O  "O3'" . DA  B 2 5   ? 51.936 26.184  10.432  1.00 33.69 ? 6    DA  T "O3'" 1 
ATOM   232  C  "C2'" . DA  B 2 5   ? 50.981 27.259  8.444   1.00 34.78 ? 6    DA  T "C2'" 1 
ATOM   233  C  "C1'" . DA  B 2 5   ? 49.524 27.342  7.976   1.00 34.73 ? 6    DA  T "C1'" 1 
ATOM   234  N  N9    . DA  B 2 5   ? 48.968 28.698  7.979   1.00 34.40 ? 6    DA  T N9    1 
ATOM   235  C  C8    . DA  B 2 5   ? 48.324 29.339  9.013   1.00 34.55 ? 6    DA  T C8    1 
ATOM   236  N  N7    . DA  B 2 5   ? 47.873 30.530  8.699   1.00 35.91 ? 6    DA  T N7    1 
ATOM   237  C  C5    . DA  B 2 5   ? 48.256 30.695  7.374   1.00 35.85 ? 6    DA  T C5    1 
ATOM   238  C  C6    . DA  B 2 5   ? 48.056 31.743  6.451   1.00 35.54 ? 6    DA  T C6    1 
ATOM   239  N  N6    . DA  B 2 5   ? 47.378 32.860  6.730   1.00 35.88 ? 6    DA  T N6    1 
ATOM   240  N  N1    . DA  B 2 5   ? 48.575 31.594  5.210   1.00 34.48 ? 6    DA  T N1    1 
ATOM   241  C  C2    . DA  B 2 5   ? 49.236 30.466  4.924   1.00 34.44 ? 6    DA  T C2    1 
ATOM   242  N  N3    . DA  B 2 5   ? 49.478 29.409  5.700   1.00 33.51 ? 6    DA  T N3    1 
ATOM   243  C  C4    . DA  B 2 5   ? 48.953 29.584  6.924   1.00 34.79 ? 6    DA  T C4    1 
ATOM   244  P  P     . DG  B 2 6   ? 53.099 27.014  11.165  1.00 32.13 ? 7    DG  T P     1 
ATOM   245  O  OP1   . DG  B 2 6   ? 54.039 26.036  11.769  1.00 32.06 ? 7    DG  T OP1   1 
ATOM   246  O  OP2   . DG  B 2 6   ? 52.480 28.061  12.019  1.00 33.21 ? 7    DG  T OP2   1 
ATOM   247  O  "O5'" . DG  B 2 6   ? 53.826 27.739  9.954   1.00 32.65 ? 7    DG  T "O5'" 1 
ATOM   248  C  "C5'" . DG  B 2 6   ? 53.997 29.145  9.948   1.00 32.17 ? 7    DG  T "C5'" 1 
ATOM   249  C  "C4'" . DG  B 2 6   ? 54.381 29.605  8.566   1.00 32.86 ? 7    DG  T "C4'" 1 
ATOM   250  O  "O4'" . DG  B 2 6   ? 53.160 29.937  7.848   1.00 33.76 ? 7    DG  T "O4'" 1 
ATOM   251  C  "C3'" . DG  B 2 6   ? 55.202 30.886  8.637   1.00 33.61 ? 7    DG  T "C3'" 1 
ATOM   252  O  "O3'" . DG  B 2 6   ? 56.476 30.830  8.020   1.00 30.91 ? 7    DG  T "O3'" 1 
ATOM   253  C  "C2'" . DG  B 2 6   ? 54.370 31.949  7.962   1.00 34.55 ? 7    DG  T "C2'" 1 
ATOM   254  C  "C1'" . DG  B 2 6   ? 53.283 31.207  7.224   1.00 35.39 ? 7    DG  T "C1'" 1 
ATOM   255  N  N9    . DG  B 2 6   ? 52.073 31.983  7.468   1.00 37.05 ? 7    DG  T N9    1 
ATOM   256  C  C8    . DG  B 2 6   ? 51.318 32.036  8.619   1.00 38.04 ? 7    DG  T C8    1 
ATOM   257  N  N7    . DG  B 2 6   ? 50.429 32.992  8.601   1.00 38.51 ? 7    DG  T N7    1 
ATOM   258  C  C5    . DG  B 2 6   ? 50.576 33.572  7.347   1.00 38.80 ? 7    DG  T C5    1 
ATOM   259  C  C6    . DG  B 2 6   ? 49.910 34.674  6.758   1.00 38.00 ? 7    DG  T C6    1 
ATOM   260  O  O6    . DG  B 2 6   ? 49.047 35.403  7.255   1.00 39.50 ? 7    DG  T O6    1 
ATOM   261  N  N1    . DG  B 2 6   ? 50.352 34.905  5.458   1.00 37.07 ? 7    DG  T N1    1 
ATOM   262  C  C2    . DG  B 2 6   ? 51.318 34.175  4.814   1.00 37.70 ? 7    DG  T C2    1 
ATOM   263  N  N2    . DG  B 2 6   ? 51.589 34.524  3.552   1.00 37.45 ? 7    DG  T N2    1 
ATOM   264  N  N3    . DG  B 2 6   ? 51.967 33.167  5.362   1.00 36.46 ? 7    DG  T N3    1 
ATOM   265  C  C4    . DG  B 2 6   ? 51.548 32.922  6.618   1.00 37.47 ? 7    DG  T C4    1 
ATOM   266  P  P     . DG  B 2 7   ? 57.519 32.010  8.340   1.00 31.54 ? 8    DG  T P     1 
ATOM   267  O  OP1   . DG  B 2 7   ? 58.908 31.519  8.150   1.00 33.19 ? 8    DG  T OP1   1 
ATOM   268  O  OP2   . DG  B 2 7   ? 57.108 32.566  9.653   1.00 30.28 ? 8    DG  T OP2   1 
ATOM   269  O  "O5'" . DG  B 2 7   ? 57.200 33.108  7.228   1.00 29.27 ? 8    DG  T "O5'" 1 
ATOM   270  C  "C5'" . DG  B 2 7   ? 57.325 32.791  5.842   1.00 28.97 ? 8    DG  T "C5'" 1 
ATOM   271  C  "C4'" . DG  B 2 7   ? 57.474 34.051  5.020   1.00 29.34 ? 8    DG  T "C4'" 1 
ATOM   272  O  "O4'" . DG  B 2 7   ? 56.235 34.796  5.023   1.00 28.98 ? 8    DG  T "O4'" 1 
ATOM   273  C  "C3'" . DG  B 2 7   ? 58.560 35.025  5.469   1.00 27.09 ? 8    DG  T "C3'" 1 
ATOM   274  O  "O3'" . DG  B 2 7   ? 59.192 35.568  4.305   1.00 26.70 ? 8    DG  T "O3'" 1 
ATOM   275  C  "C2'" . DG  B 2 7   ? 57.795 36.068  6.271   1.00 29.08 ? 8    DG  T "C2'" 1 
ATOM   276  C  "C1'" . DG  B 2 7   ? 56.398 36.055  5.659   1.00 28.69 ? 8    DG  T "C1'" 1 
ATOM   277  N  N9    . DG  B 2 7   ? 55.304 36.185  6.618   1.00 31.00 ? 8    DG  T N9    1 
ATOM   278  C  C8    . DG  B 2 7   ? 55.138 35.481  7.787   1.00 32.56 ? 8    DG  T C8    1 
ATOM   279  N  N7    . DG  B 2 7   ? 54.034 35.783  8.416   1.00 32.93 ? 8    DG  T N7    1 
ATOM   280  C  C5    . DG  B 2 7   ? 53.439 36.753  7.620   1.00 32.86 ? 8    DG  T C5    1 
ATOM   281  C  C6    . DG  B 2 7   ? 52.219 37.454  7.791   1.00 33.59 ? 8    DG  T C6    1 
ATOM   282  O  O6    . DG  B 2 7   ? 51.398 37.355  8.711   1.00 35.14 ? 8    DG  T O6    1 
ATOM   283  N  N1    . DG  B 2 7   ? 51.989 38.345  6.746   1.00 33.37 ? 8    DG  T N1    1 
ATOM   284  C  C2    . DG  B 2 7   ? 52.832 38.538  5.674   1.00 34.19 ? 8    DG  T C2    1 
ATOM   285  N  N2    . DG  B 2 7   ? 52.443 39.445  4.762   1.00 32.94 ? 8    DG  T N2    1 
ATOM   286  N  N3    . DG  B 2 7   ? 53.976 37.888  5.508   1.00 31.66 ? 8    DG  T N3    1 
ATOM   287  C  C4    . DG  B 2 7   ? 54.213 37.018  6.510   1.00 31.38 ? 8    DG  T C4    1 
ATOM   288  P  P     . DC  B 2 8   ? 60.346 36.681  4.448   1.00 24.68 ? 9    DC  T P     1 
ATOM   289  O  OP1   . DC  B 2 8   ? 61.041 36.762  3.140   1.00 24.10 ? 9    DC  T OP1   1 
ATOM   290  O  OP2   . DC  B 2 8   ? 61.141 36.448  5.678   1.00 27.10 ? 9    DC  T OP2   1 
ATOM   291  O  "O5'" . DC  B 2 8   ? 59.513 38.019  4.640   1.00 27.73 ? 9    DC  T "O5'" 1 
ATOM   292  C  "C5'" . DC  B 2 8   ? 58.616 38.441  3.621   1.00 29.69 ? 9    DC  T "C5'" 1 
ATOM   293  C  "C4'" . DC  B 2 8   ? 57.977 39.757  3.986   1.00 32.43 ? 9    DC  T "C4'" 1 
ATOM   294  O  "O4'" . DC  B 2 8   ? 56.878 39.569  4.910   1.00 34.03 ? 9    DC  T "O4'" 1 
ATOM   295  C  "C3'" . DC  B 2 8   ? 58.904 40.802  4.613   1.00 33.07 ? 9    DC  T "C3'" 1 
ATOM   296  O  "O3'" . DC  B 2 8   ? 58.690 42.033  3.939   1.00 32.01 ? 9    DC  T "O3'" 1 
ATOM   297  C  "C2'" . DC  B 2 8   ? 58.403 40.905  6.047   1.00 33.90 ? 9    DC  T "C2'" 1 
ATOM   298  C  "C1'" . DC  B 2 8   ? 56.924 40.595  5.879   1.00 34.44 ? 9    DC  T "C1'" 1 
ATOM   299  N  N1    . DC  B 2 8   ? 56.185 40.132  7.073   1.00 36.40 ? 9    DC  T N1    1 
ATOM   300  C  C2    . DC  B 2 8   ? 54.902 40.665  7.319   1.00 37.49 ? 9    DC  T C2    1 
ATOM   301  O  O2    . DC  B 2 8   ? 54.419 41.480  6.518   1.00 39.07 ? 9    DC  T O2    1 
ATOM   302  N  N3    . DC  B 2 8   ? 54.221 40.268  8.418   1.00 37.86 ? 9    DC  T N3    1 
ATOM   303  C  C4    . DC  B 2 8   ? 54.759 39.368  9.247   1.00 39.44 ? 9    DC  T C4    1 
ATOM   304  N  N4    . DC  B 2 8   ? 54.047 39.004  10.321  1.00 39.78 ? 9    DC  T N4    1 
ATOM   305  C  C5    . DC  B 2 8   ? 56.049 38.800  9.015   1.00 37.28 ? 9    DC  T C5    1 
ATOM   306  C  C6    . DC  B 2 8   ? 56.722 39.210  7.929   1.00 36.16 ? 9    DC  T C6    1 
ATOM   307  P  P     . DA  B 2 9   ? 59.810 43.185  3.964   1.00 32.39 ? 10   DA  T P     1 
ATOM   308  O  OP1   . DA  B 2 9   ? 60.520 43.198  2.664   1.00 31.03 ? 10   DA  T OP1   1 
ATOM   309  O  OP2   . DA  B 2 9   ? 60.595 43.121  5.225   1.00 31.30 ? 10   DA  T OP2   1 
ATOM   310  O  "O5'" . DA  B 2 9   ? 58.888 44.473  3.998   1.00 34.82 ? 10   DA  T "O5'" 1 
ATOM   311  C  "C5'" . DA  B 2 9   ? 57.764 44.556  3.124   1.00 35.12 ? 10   DA  T "C5'" 1 
ATOM   312  C  "C4'" . DA  B 2 9   ? 56.805 45.610  3.613   1.00 37.16 ? 10   DA  T "C4'" 1 
ATOM   313  O  "O4'" . DA  B 2 9   ? 56.031 45.126  4.735   1.00 38.68 ? 10   DA  T "O4'" 1 
ATOM   314  C  "C3'" . DA  B 2 9   ? 57.512 46.873  4.088   1.00 40.00 ? 10   DA  T "C3'" 1 
ATOM   315  O  "O3'" . DA  B 2 9   ? 56.785 47.999  3.635   1.00 44.60 ? 10   DA  T "O3'" 1 
ATOM   316  C  "C2'" . DA  B 2 9   ? 57.496 46.756  5.603   1.00 39.60 ? 10   DA  T "C2'" 1 
ATOM   317  C  "C1'" . DA  B 2 9   ? 56.226 45.959  5.871   1.00 39.85 ? 10   DA  T "C1'" 1 
ATOM   318  N  N9    . DA  B 2 9   ? 56.274 45.087  7.044   1.00 39.29 ? 10   DA  T N9    1 
ATOM   319  C  C8    . DA  B 2 9   ? 57.222 44.144  7.365   1.00 38.94 ? 10   DA  T C8    1 
ATOM   320  N  N7    . DA  B 2 9   ? 56.954 43.475  8.459   1.00 39.84 ? 10   DA  T N7    1 
ATOM   321  C  C5    . DA  B 2 9   ? 55.756 44.018  8.896   1.00 38.76 ? 10   DA  T C5    1 
ATOM   322  C  C6    . DA  B 2 9   ? 54.936 43.733  10.001  1.00 39.81 ? 10   DA  T C6    1 
ATOM   323  N  N6    . DA  B 2 9   ? 55.208 42.787  10.903  1.00 38.85 ? 10   DA  T N6    1 
ATOM   324  N  N1    . DA  B 2 9   ? 53.809 44.463  10.152  1.00 40.65 ? 10   DA  T N1    1 
ATOM   325  C  C2    . DA  B 2 9   ? 53.536 45.415  9.247   1.00 40.88 ? 10   DA  T C2    1 
ATOM   326  N  N3    . DA  B 2 9   ? 54.227 45.773  8.164   1.00 38.67 ? 10   DA  T N3    1 
ATOM   327  C  C4    . DA  B 2 9   ? 55.335 45.026  8.044   1.00 39.26 ? 10   DA  T C4    1 
ATOM   328  P  P     . DC  B 2 10  ? 57.547 49.382  3.382   1.00 45.90 ? 11   DC  T P     1 
ATOM   329  O  OP1   . DC  B 2 10  ? 57.165 49.851  2.029   1.00 46.17 ? 11   DC  T OP1   1 
ATOM   330  O  OP2   . DC  B 2 10  ? 58.988 49.219  3.726   1.00 42.83 ? 11   DC  T OP2   1 
ATOM   331  O  "O5'" . DC  B 2 10  ? 56.873 50.324  4.472   1.00 44.25 ? 11   DC  T "O5'" 1 
ATOM   332  C  "C5'" . DC  B 2 10  ? 55.455 50.375  4.598   1.00 41.33 ? 11   DC  T "C5'" 1 
ATOM   333  C  "C4'" . DC  B 2 10  ? 55.064 50.891  5.964   1.00 40.42 ? 11   DC  T "C4'" 1 
ATOM   334  O  "O4'" . DC  B 2 10  ? 55.008 49.820  6.942   1.00 39.56 ? 11   DC  T "O4'" 1 
ATOM   335  C  "C3'" . DC  B 2 10  ? 55.974 51.978  6.545   1.00 38.59 ? 11   DC  T "C3'" 1 
ATOM   336  O  "O3'" . DC  B 2 10  ? 55.199 53.115  6.913   1.00 38.66 ? 11   DC  T "O3'" 1 
ATOM   337  C  "C2'" . DC  B 2 10  ? 56.592 51.322  7.769   1.00 38.69 ? 11   DC  T "C2'" 1 
ATOM   338  C  "C1'" . DC  B 2 10  ? 55.556 50.280  8.164   1.00 38.89 ? 11   DC  T "C1'" 1 
ATOM   339  N  N1    . DC  B 2 10  ? 56.088 49.114  8.906   1.00 37.47 ? 11   DC  T N1    1 
ATOM   340  C  C2    . DC  B 2 10  ? 55.332 48.572  9.969   1.00 37.86 ? 11   DC  T C2    1 
ATOM   341  O  O2    . DC  B 2 10  ? 54.230 49.063  10.245  1.00 34.94 ? 11   DC  T O2    1 
ATOM   342  N  N3    . DC  B 2 10  ? 55.831 47.525  10.669  1.00 38.85 ? 11   DC  T N3    1 
ATOM   343  C  C4    . DC  B 2 10  ? 57.027 47.019  10.353  1.00 37.84 ? 11   DC  T C4    1 
ATOM   344  N  N4    . DC  B 2 10  ? 57.486 45.998  11.084  1.00 39.07 ? 11   DC  T N4    1 
ATOM   345  C  C5    . DC  B 2 10  ? 57.806 47.538  9.277   1.00 38.12 ? 11   DC  T C5    1 
ATOM   346  C  C6    . DC  B 2 10  ? 57.303 48.571  8.585   1.00 36.89 ? 11   DC  T C6    1 
ATOM   347  P  P     . DT  B 2 11  ? 55.907 54.410  7.558   1.00 37.88 ? 12   DT  T P     1 
ATOM   348  O  OP1   . DT  B 2 11  ? 55.389 55.599  6.827   1.00 41.65 ? 12   DT  T OP1   1 
ATOM   349  O  OP2   . DT  B 2 11  ? 57.374 54.221  7.688   1.00 37.60 ? 12   DT  T OP2   1 
ATOM   350  O  "O5'" . DT  B 2 11  ? 55.286 54.420  9.018   1.00 37.23 ? 12   DT  T "O5'" 1 
ATOM   351  C  "C5'" . DT  B 2 11  ? 53.896 54.187  9.201   1.00 39.80 ? 12   DT  T "C5'" 1 
ATOM   352  C  "C4'" . DT  B 2 11  ? 53.561 54.133  10.670  1.00 40.80 ? 12   DT  T "C4'" 1 
ATOM   353  O  "O4'" . DT  B 2 11  ? 54.030 52.891  11.246  1.00 40.72 ? 12   DT  T "O4'" 1 
ATOM   354  C  "C3'" . DT  B 2 11  ? 54.175 55.259  11.497  1.00 41.15 ? 12   DT  T "C3'" 1 
ATOM   355  O  "O3'" . DT  B 2 11  ? 53.190 55.769  12.399  1.00 42.81 ? 12   DT  T "O3'" 1 
ATOM   356  C  "C2'" . DT  B 2 11  ? 55.336 54.586  12.218  1.00 41.55 ? 12   DT  T "C2'" 1 
ATOM   357  C  "C1'" . DT  B 2 11  ? 54.851 53.150  12.374  1.00 41.40 ? 12   DT  T "C1'" 1 
ATOM   358  N  N1    . DT  B 2 11  ? 55.897 52.096  12.420  1.00 42.32 ? 12   DT  T N1    1 
ATOM   359  C  C2    . DT  B 2 11  ? 55.777 51.103  13.376  1.00 43.20 ? 12   DT  T C2    1 
ATOM   360  O  O2    . DT  B 2 11  ? 54.881 51.067  14.204  1.00 44.53 ? 12   DT  T O2    1 
ATOM   361  N  N3    . DT  B 2 11  ? 56.755 50.140  13.328  1.00 44.09 ? 12   DT  T N3    1 
ATOM   362  C  C4    . DT  B 2 11  ? 57.818 50.068  12.450  1.00 43.92 ? 12   DT  T C4    1 
ATOM   363  O  O4    . DT  B 2 11  ? 58.607 49.129  12.527  1.00 44.92 ? 12   DT  T O4    1 
ATOM   364  C  C5    . DT  B 2 11  ? 57.898 51.148  11.487  1.00 43.89 ? 12   DT  T C5    1 
ATOM   365  C  C7    . DT  B 2 11  ? 59.026 51.161  10.503  1.00 42.42 ? 12   DT  T C7    1 
ATOM   366  C  C6    . DT  B 2 11  ? 56.947 52.095  11.521  1.00 42.87 ? 12   DT  T C6    1 
ATOM   367  P  P     . DG  B 2 12  ? 53.418 57.188  13.120  1.00 41.34 ? 13   DG  T P     1 
ATOM   368  O  OP1   . DG  B 2 12  ? 52.089 57.824  13.284  1.00 40.83 ? 13   DG  T OP1   1 
ATOM   369  O  OP2   . DG  B 2 12  ? 54.500 57.917  12.413  1.00 39.71 ? 13   DG  T OP2   1 
ATOM   370  O  "O5'" . DG  B 2 12  ? 53.937 56.765  14.565  1.00 43.35 ? 13   DG  T "O5'" 1 
ATOM   371  C  "C5'" . DG  B 2 12  ? 53.119 55.957  15.410  1.00 45.39 ? 13   DG  T "C5'" 1 
ATOM   372  C  "C4'" . DG  B 2 12  ? 53.912 55.448  16.590  1.00 48.66 ? 13   DG  T "C4'" 1 
ATOM   373  O  "O4'" . DG  B 2 12  ? 54.818 54.385  16.199  1.00 48.47 ? 13   DG  T "O4'" 1 
ATOM   374  C  "C3'" . DG  B 2 12  ? 54.766 56.501  17.299  1.00 50.39 ? 13   DG  T "C3'" 1 
ATOM   375  O  "O3'" . DG  B 2 12  ? 54.657 56.312  18.710  1.00 54.13 ? 13   DG  T "O3'" 1 
ATOM   376  C  "C2'" . DG  B 2 12  ? 56.176 56.171  16.839  1.00 50.18 ? 13   DG  T "C2'" 1 
ATOM   377  C  "C1'" . DG  B 2 12  ? 56.105 54.658  16.730  1.00 48.35 ? 13   DG  T "C1'" 1 
ATOM   378  N  N9    . DG  B 2 12  ? 57.105 54.014  15.879  1.00 48.15 ? 13   DG  T N9    1 
ATOM   379  C  C8    . DG  B 2 12  ? 57.733 54.537  14.773  1.00 47.95 ? 13   DG  T C8    1 
ATOM   380  N  N7    . DG  B 2 12  ? 58.598 53.716  14.239  1.00 47.88 ? 13   DG  T N7    1 
ATOM   381  C  C5    . DG  B 2 12  ? 58.532 52.580  15.034  1.00 47.47 ? 13   DG  T C5    1 
ATOM   382  C  C6    . DG  B 2 12  ? 59.243 51.349  14.945  1.00 49.21 ? 13   DG  T C6    1 
ATOM   383  O  O6    . DG  B 2 12  ? 60.098 51.006  14.116  1.00 50.15 ? 13   DG  T O6    1 
ATOM   384  N  N1    . DG  B 2 12  ? 58.873 50.471  15.959  1.00 48.35 ? 13   DG  T N1    1 
ATOM   385  C  C2    . DG  B 2 12  ? 57.943 50.737  16.933  1.00 48.87 ? 13   DG  T C2    1 
ATOM   386  N  N2    . DG  B 2 12  ? 57.736 49.763  17.830  1.00 48.37 ? 13   DG  T N2    1 
ATOM   387  N  N3    . DG  B 2 12  ? 57.269 51.875  17.024  1.00 47.81 ? 13   DG  T N3    1 
ATOM   388  C  C4    . DG  B 2 12  ? 57.614 52.745  16.049  1.00 47.63 ? 13   DG  T C4    1 
ATOM   389  P  P     . DG  B 2 13  ? 55.166 57.454  19.716  1.00 56.82 ? 14   DG  T P     1 
ATOM   390  O  OP1   . DG  B 2 13  ? 53.962 57.978  20.413  1.00 55.90 ? 14   DG  T OP1   1 
ATOM   391  O  OP2   . DG  B 2 13  ? 56.053 58.392  18.972  1.00 55.34 ? 14   DG  T OP2   1 
ATOM   392  O  "O5'" . DG  B 2 13  ? 56.064 56.646  20.757  1.00 57.34 ? 14   DG  T "O5'" 1 
ATOM   393  C  "C5'" . DG  B 2 13  ? 55.545 55.501  21.438  1.00 58.97 ? 14   DG  T "C5'" 1 
ATOM   394  C  "C4'" . DG  B 2 13  ? 56.670 54.627  21.949  1.00 60.08 ? 14   DG  T "C4'" 1 
ATOM   395  O  "O4'" . DG  B 2 13  ? 57.350 53.984  20.840  1.00 60.53 ? 14   DG  T "O4'" 1 
ATOM   396  C  "C3'" . DG  B 2 13  ? 57.754 55.345  22.762  1.00 60.40 ? 14   DG  T "C3'" 1 
ATOM   397  O  "O3'" . DG  B 2 13  ? 58.139 54.556  23.899  1.00 60.20 ? 14   DG  T "O3'" 1 
ATOM   398  C  "C2'" . DG  B 2 13  ? 58.914 55.441  21.788  1.00 60.82 ? 14   DG  T "C2'" 1 
ATOM   399  C  "C1'" . DG  B 2 13  ? 58.751 54.157  20.989  1.00 61.28 ? 14   DG  T "C1'" 1 
ATOM   400  N  N9    . DG  B 2 13  ? 59.365 54.156  19.661  1.00 61.64 ? 14   DG  T N9    1 
ATOM   401  C  C8    . DG  B 2 13  ? 59.313 55.153  18.714  1.00 61.75 ? 14   DG  T C8    1 
ATOM   402  N  N7    . DG  B 2 13  ? 59.981 54.866  17.629  1.00 61.76 ? 14   DG  T N7    1 
ATOM   403  C  C5    . DG  B 2 13  ? 60.502 53.601  17.870  1.00 61.42 ? 14   DG  T C5    1 
ATOM   404  C  C6    . DG  B 2 13  ? 61.316 52.769  17.052  1.00 62.20 ? 14   DG  T C6    1 
ATOM   405  O  O6    . DG  B 2 13  ? 61.754 52.994  15.917  1.00 61.83 ? 14   DG  T O6    1 
ATOM   406  N  N1    . DG  B 2 13  ? 61.613 51.565  17.683  1.00 63.01 ? 14   DG  T N1    1 
ATOM   407  C  C2    . DG  B 2 13  ? 61.186 51.203  18.938  1.00 63.25 ? 14   DG  T C2    1 
ATOM   408  N  N2    . DG  B 2 13  ? 61.577 49.993  19.371  1.00 63.77 ? 14   DG  T N2    1 
ATOM   409  N  N3    . DG  B 2 13  ? 60.430 51.969  19.711  1.00 63.02 ? 14   DG  T N3    1 
ATOM   410  C  C4    . DG  B 2 13  ? 60.128 53.146  19.117  1.00 61.89 ? 14   DG  T C4    1 
ATOM   411  N  N     . MET C 3 1   ? 79.317 4.595   7.905   1.00 26.14 ? 1    MET A N     1 
ATOM   412  C  CA    . MET C 3 1   ? 78.725 5.954   8.025   1.00 25.06 ? 1    MET A CA    1 
ATOM   413  C  C     . MET C 3 1   ? 79.770 6.954   8.473   1.00 25.42 ? 1    MET A C     1 
ATOM   414  O  O     . MET C 3 1   ? 80.553 6.675   9.375   1.00 26.48 ? 1    MET A O     1 
ATOM   415  C  CB    . MET C 3 1   ? 77.565 5.959   9.038   1.00 25.92 ? 1    MET A CB    1 
ATOM   416  C  CG    . MET C 3 1   ? 77.057 7.371   9.423   1.00 23.77 ? 1    MET A CG    1 
ATOM   417  S  SD    . MET C 3 1   ? 75.564 7.360   10.476  1.00 26.13 ? 1    MET A SD    1 
ATOM   418  C  CE    . MET C 3 1   ? 74.328 6.955   9.283   1.00 21.68 ? 1    MET A CE    1 
ATOM   419  N  N     . ILE C 3 2   ? 79.785 8.117   7.830   1.00 25.45 ? 2    ILE A N     1 
ATOM   420  C  CA    . ILE C 3 2   ? 80.711 9.172   8.209   1.00 24.13 ? 2    ILE A CA    1 
ATOM   421  C  C     . ILE C 3 2   ? 79.916 10.453  8.435   1.00 23.76 ? 2    ILE A C     1 
ATOM   422  O  O     . ILE C 3 2   ? 78.819 10.629  7.901   1.00 22.58 ? 2    ILE A O     1 
ATOM   423  C  CB    . ILE C 3 2   ? 81.804 9.433   7.126   1.00 22.56 ? 2    ILE A CB    1 
ATOM   424  C  CG1   . ILE C 3 2   ? 81.158 9.898   5.824   1.00 22.53 ? 2    ILE A CG1   1 
ATOM   425  C  CG2   . ILE C 3 2   ? 82.631 8.174   6.892   1.00 20.63 ? 2    ILE A CG2   1 
ATOM   426  N  N     . VAL C 3 3   ? 80.470 11.333  9.258   1.00 23.96 ? 3    VAL A N     1 
ATOM   427  C  CA    . VAL C 3 3   ? 79.846 12.606  9.554   1.00 21.66 ? 3    VAL A CA    1 
ATOM   428  C  C     . VAL C 3 3   ? 80.875 13.619  9.088   1.00 22.01 ? 3    VAL A C     1 
ATOM   429  O  O     . VAL C 3 3   ? 82.063 13.477  9.367   1.00 23.05 ? 3    VAL A O     1 
ATOM   430  C  CB    . VAL C 3 3   ? 79.569 12.753  11.064  1.00 19.71 ? 3    VAL A CB    1 
ATOM   431  C  CG1   . VAL C 3 3   ? 78.703 14.001  11.328  1.00 17.28 ? 3    VAL A CG1   1 
ATOM   432  C  CG2   . VAL C 3 3   ? 78.862 11.500  11.576  1.00 19.90 ? 3    VAL A CG2   1 
ATOM   433  N  N     . SER C 3 4   ? 80.427 14.637  8.368   1.00 22.14 ? 4    SER A N     1 
ATOM   434  C  CA    . SER C 3 4   ? 81.350 15.615  7.843   1.00 21.36 ? 4    SER A CA    1 
ATOM   435  C  C     . SER C 3 4   ? 80.770 17.017  7.788   1.00 22.11 ? 4    SER A C     1 
ATOM   436  O  O     . SER C 3 4   ? 79.563 17.222  7.944   1.00 22.96 ? 4    SER A O     1 
ATOM   437  C  CB    . SER C 3 4   ? 81.797 15.178  6.443   1.00 20.85 ? 4    SER A CB    1 
ATOM   438  O  OG    . SER C 3 4   ? 82.888 15.951  5.985   1.00 20.28 ? 4    SER A OG    1 
ATOM   439  N  N     . ASP C 3 5   ? 81.656 17.975  7.556   1.00 21.99 ? 5    ASP A N     1 
ATOM   440  C  CA    . ASP C 3 5   ? 81.312 19.388  7.454   1.00 22.30 ? 5    ASP A CA    1 
ATOM   441  C  C     . ASP C 3 5   ? 82.496 20.094  6.787   1.00 22.92 ? 5    ASP A C     1 
ATOM   442  O  O     . ASP C 3 5   ? 83.632 19.650  6.914   1.00 22.86 ? 5    ASP A O     1 
ATOM   443  C  CB    . ASP C 3 5   ? 81.082 19.979  8.847   1.00 21.46 ? 5    ASP A CB    1 
ATOM   444  C  CG    . ASP C 3 5   ? 80.769 21.459  8.803   1.00 22.78 ? 5    ASP A CG    1 
ATOM   445  O  OD1   . ASP C 3 5   ? 79.771 21.842  8.162   1.00 25.75 ? 5    ASP A OD1   1 
ATOM   446  O  OD2   . ASP C 3 5   ? 81.524 22.247  9.414   1.00 27.65 ? 5    ASP A OD2   1 
ATOM   447  N  N     . ILE C 3 6   ? 82.234 21.180  6.071   1.00 24.83 ? 6    ILE A N     1 
ATOM   448  C  CA    . ILE C 3 6   ? 83.316 21.907  5.422   1.00 25.50 ? 6    ILE A CA    1 
ATOM   449  C  C     . ILE C 3 6   ? 83.214 23.383  5.746   1.00 28.41 ? 6    ILE A C     1 
ATOM   450  O  O     . ILE C 3 6   ? 82.161 23.878  6.141   1.00 29.13 ? 6    ILE A O     1 
ATOM   451  C  CB    . ILE C 3 6   ? 83.286 21.777  3.869   1.00 25.34 ? 6    ILE A CB    1 
ATOM   452  C  CG1   . ILE C 3 6   ? 82.125 22.598  3.292   1.00 25.78 ? 6    ILE A CG1   1 
ATOM   453  C  CG2   . ILE C 3 6   ? 83.151 20.307  3.451   1.00 23.86 ? 6    ILE A CG2   1 
ATOM   454  N  N     . GLU C 3 7   ? 84.326 24.085  5.583   1.00 29.03 ? 7    GLU A N     1 
ATOM   455  C  CA    . GLU C 3 7   ? 84.351 25.516  5.802   1.00 28.35 ? 7    GLU A CA    1 
ATOM   456  C  C     . GLU C 3 7   ? 84.819 26.043  4.454   1.00 28.36 ? 7    GLU A C     1 
ATOM   457  O  O     . GLU C 3 7   ? 85.779 25.514  3.871   1.00 27.53 ? 7    GLU A O     1 
ATOM   458  C  CB    . GLU C 3 7   ? 85.347 25.871  6.916   1.00 28.81 ? 7    GLU A CB    1 
ATOM   459  C  CG    . GLU C 3 7   ? 85.052 25.191  8.255   1.00 28.71 ? 7    GLU A CG    1 
ATOM   460  C  CD    . GLU C 3 7   ? 83.790 25.718  8.930   1.00 31.17 ? 7    GLU A CD    1 
ATOM   461  O  OE1   . GLU C 3 7   ? 82.996 26.424  8.269   1.00 29.14 ? 7    GLU A OE1   1 
ATOM   462  O  OE2   . GLU C 3 7   ? 83.587 25.418  10.128  1.00 32.22 ? 7    GLU A OE2   1 
ATOM   463  N  N     . ALA C 3 8   ? 84.122 27.046  3.933   1.00 27.45 ? 8    ALA A N     1 
ATOM   464  C  CA    . ALA C 3 8   ? 84.482 27.625  2.647   1.00 27.03 ? 8    ALA A CA    1 
ATOM   465  C  C     . ALA C 3 8   ? 84.420 29.154  2.731   1.00 27.85 ? 8    ALA A C     1 
ATOM   466  O  O     . ALA C 3 8   ? 83.906 29.713  3.704   1.00 27.36 ? 8    ALA A O     1 
ATOM   467  C  CB    . ALA C 3 8   ? 83.561 27.094  1.554   1.00 25.85 ? 8    ALA A CB    1 
ATOM   468  N  N     . ASN C 3 9   ? 84.928 29.821  1.700   1.00 27.51 ? 9    ASN A N     1 
ATOM   469  C  CA    . ASN C 3 9   ? 85.006 31.279  1.684   1.00 27.58 ? 9    ASN A CA    1 
ATOM   470  C  C     . ASN C 3 9   ? 83.736 32.098  1.482   1.00 27.59 ? 9    ASN A C     1 
ATOM   471  O  O     . ASN C 3 9   ? 83.742 33.284  1.775   1.00 29.14 ? 9    ASN A O     1 
ATOM   472  C  CB    . ASN C 3 9   ? 86.063 31.718  0.658   1.00 28.62 ? 9    ASN A CB    1 
ATOM   473  C  CG    . ASN C 3 9   ? 85.582 31.584  -0.779  1.00 28.42 ? 9    ASN A CG    1 
ATOM   474  O  OD1   . ASN C 3 9   ? 84.624 30.866  -1.066  1.00 26.89 ? 9    ASN A OD1   1 
ATOM   475  N  ND2   . ASN C 3 9   ? 86.258 32.274  -1.694  1.00 29.66 ? 9    ASN A ND2   1 
ATOM   476  N  N     . ALA C 3 10  ? 82.655 31.501  0.986   1.00 27.66 ? 10   ALA A N     1 
ATOM   477  C  CA    . ALA C 3 10  ? 81.420 32.269  0.789   1.00 26.44 ? 10   ALA A CA    1 
ATOM   478  C  C     . ALA C 3 10  ? 80.174 31.400  0.702   1.00 27.42 ? 10   ALA A C     1 
ATOM   479  O  O     . ALA C 3 10  ? 80.239 30.177  0.841   1.00 27.17 ? 10   ALA A O     1 
ATOM   480  C  CB    . ALA C 3 10  ? 81.525 33.135  -0.470  1.00 21.77 ? 10   ALA A CB    1 
ATOM   481  N  N     . LEU C 3 11  ? 79.035 32.057  0.499   1.00 27.02 ? 11   LEU A N     1 
ATOM   482  C  CA    . LEU C 3 11  ? 77.763 31.370  0.350   1.00 28.15 ? 11   LEU A CA    1 
ATOM   483  C  C     . LEU C 3 11  ? 77.825 30.620  -0.987  1.00 27.93 ? 11   LEU A C     1 
ATOM   484  O  O     . LEU C 3 11  ? 78.643 30.953  -1.847  1.00 27.26 ? 11   LEU A O     1 
ATOM   485  C  CB    . LEU C 3 11  ? 76.609 32.379  0.355   1.00 27.50 ? 11   LEU A CB    1 
ATOM   486  C  CG    . LEU C 3 11  ? 76.410 33.136  1.679   1.00 31.18 ? 11   LEU A CG    1 
ATOM   487  C  CD1   . LEU C 3 11  ? 75.309 34.182  1.527   1.00 31.73 ? 11   LEU A CD1   1 
ATOM   488  C  CD2   . LEU C 3 11  ? 76.057 32.146  2.790   1.00 32.04 ? 11   LEU A CD2   1 
ATOM   489  N  N     . LEU C 3 12  ? 76.970 29.613  -1.150  1.00 27.80 ? 12   LEU A N     1 
ATOM   490  C  CA    . LEU C 3 12  ? 76.953 28.792  -2.364  1.00 27.03 ? 12   LEU A CA    1 
ATOM   491  C  C     . LEU C 3 12  ? 77.051 29.583  -3.662  1.00 26.76 ? 12   LEU A C     1 
ATOM   492  O  O     . LEU C 3 12  ? 77.845 29.247  -4.542  1.00 24.89 ? 12   LEU A O     1 
ATOM   493  C  CB    . LEU C 3 12  ? 75.691 27.921  -2.397  1.00 25.53 ? 12   LEU A CB    1 
ATOM   494  C  CG    . LEU C 3 12  ? 75.561 26.948  -3.581  1.00 26.63 ? 12   LEU A CG    1 
ATOM   495  C  CD1   . LEU C 3 12  ? 76.743 25.963  -3.594  1.00 23.37 ? 12   LEU A CD1   1 
ATOM   496  C  CD2   . LEU C 3 12  ? 74.242 26.197  -3.478  1.00 23.00 ? 12   LEU A CD2   1 
ATOM   497  N  N     . GLU C 3 13  ? 76.244 30.634  -3.780  1.00 26.44 ? 13   GLU A N     1 
ATOM   498  C  CA    . GLU C 3 13  ? 76.234 31.455  -4.984  1.00 26.29 ? 13   GLU A CA    1 
ATOM   499  C  C     . GLU C 3 13  ? 77.606 31.972  -5.426  1.00 26.34 ? 13   GLU A C     1 
ATOM   500  O  O     . GLU C 3 13  ? 77.897 32.038  -6.619  1.00 25.54 ? 13   GLU A O     1 
ATOM   501  C  CB    . GLU C 3 13  ? 75.293 32.647  -4.799  1.00 29.08 ? 13   GLU A CB    1 
ATOM   502  C  CG    . GLU C 3 13  ? 73.826 32.268  -4.683  1.00 33.07 ? 13   GLU A CG    1 
ATOM   503  N  N     . SER C 3 14  ? 78.455 32.342  -4.480  1.00 25.30 ? 14   SER A N     1 
ATOM   504  C  CA    . SER C 3 14  ? 79.750 32.868  -4.865  1.00 27.31 ? 14   SER A CA    1 
ATOM   505  C  C     . SER C 3 14  ? 80.951 32.170  -4.255  1.00 27.12 ? 14   SER A C     1 
ATOM   506  O  O     . SER C 3 14  ? 82.045 32.730  -4.262  1.00 28.69 ? 14   SER A O     1 
ATOM   507  C  CB    . SER C 3 14  ? 79.808 34.371  -4.556  1.00 28.64 ? 14   SER A CB    1 
ATOM   508  O  OG    . SER C 3 14  ? 79.452 34.626  -3.206  1.00 32.50 ? 14   SER A OG    1 
ATOM   509  N  N     . VAL C 3 15  ? 80.767 30.950  -3.749  1.00 25.10 ? 15   VAL A N     1 
ATOM   510  C  CA    . VAL C 3 15  ? 81.889 30.235  -3.152  1.00 24.15 ? 15   VAL A CA    1 
ATOM   511  C  C     . VAL C 3 15  ? 82.908 29.890  -4.228  1.00 24.90 ? 15   VAL A C     1 
ATOM   512  O  O     . VAL C 3 15  ? 82.550 29.444  -5.321  1.00 25.79 ? 15   VAL A O     1 
ATOM   513  C  CB    . VAL C 3 15  ? 81.444 28.930  -2.417  1.00 23.21 ? 15   VAL A CB    1 
ATOM   514  C  CG1   . VAL C 3 15  ? 80.928 27.893  -3.408  1.00 19.44 ? 15   VAL A CG1   1 
ATOM   515  C  CG2   . VAL C 3 15  ? 82.609 28.373  -1.611  1.00 19.64 ? 15   VAL A CG2   1 
ATOM   516  N  N     . THR C 3 16  ? 84.183 30.109  -3.917  1.00 25.18 ? 16   THR A N     1 
ATOM   517  C  CA    . THR C 3 16  ? 85.252 29.817  -4.865  1.00 25.36 ? 16   THR A CA    1 
ATOM   518  C  C     . THR C 3 16  ? 86.407 29.062  -4.224  1.00 25.07 ? 16   THR A C     1 
ATOM   519  O  O     . THR C 3 16  ? 87.266 28.548  -4.925  1.00 26.94 ? 16   THR A O     1 
ATOM   520  C  CB    . THR C 3 16  ? 85.805 31.107  -5.496  1.00 25.38 ? 16   THR A CB    1 
ATOM   521  O  OG1   . THR C 3 16  ? 86.203 32.011  -4.457  1.00 27.05 ? 16   THR A OG1   1 
ATOM   522  C  CG2   . THR C 3 16  ? 84.748 31.767  -6.368  1.00 26.39 ? 16   THR A CG2   1 
ATOM   523  N  N     . LYS C 3 17  ? 86.431 28.985  -2.897  1.00 25.09 ? 17   LYS A N     1 
ATOM   524  C  CA    . LYS C 3 17  ? 87.508 28.273  -2.225  1.00 25.88 ? 17   LYS A CA    1 
ATOM   525  C  C     . LYS C 3 17  ? 87.092 27.411  -1.043  1.00 24.76 ? 17   LYS A C     1 
ATOM   526  O  O     . LYS C 3 17  ? 86.345 27.838  -0.161  1.00 24.98 ? 17   LYS A O     1 
ATOM   527  C  CB    . LYS C 3 17  ? 88.588 29.251  -1.730  1.00 30.19 ? 17   LYS A CB    1 
ATOM   528  C  CG    . LYS C 3 17  ? 89.247 30.089  -2.812  1.00 36.20 ? 17   LYS A CG    1 
ATOM   529  C  CD    . LYS C 3 17  ? 90.320 31.021  -2.232  1.00 38.02 ? 17   LYS A CD    1 
ATOM   530  C  CE    . LYS C 3 17  ? 91.651 30.305  -2.009  1.00 40.68 ? 17   LYS A CE    1 
ATOM   531  N  NZ    . LYS C 3 17  ? 91.568 29.163  -1.053  1.00 41.89 ? 17   LYS A NZ    1 
ATOM   532  N  N     . PHE C 3 18  ? 87.615 26.194  -1.039  1.00 24.36 ? 18   PHE A N     1 
ATOM   533  C  CA    . PHE C 3 18  ? 87.410 25.231  0.037   1.00 22.67 ? 18   PHE A CA    1 
ATOM   534  C  C     . PHE C 3 18  ? 88.528 25.563  1.042   1.00 22.05 ? 18   PHE A C     1 
ATOM   535  O  O     . PHE C 3 18  ? 89.701 25.525  0.688   1.00 21.56 ? 18   PHE A O     1 
ATOM   536  C  CB    . PHE C 3 18  ? 87.613 23.819  -0.519  1.00 20.92 ? 18   PHE A CB    1 
ATOM   537  C  CG    . PHE C 3 18  ? 87.801 22.757  0.530   1.00 21.95 ? 18   PHE A CG    1 
ATOM   538  C  CD1   . PHE C 3 18  ? 86.712 22.040  1.022   1.00 22.28 ? 18   PHE A CD1   1 
ATOM   539  C  CD2   . PHE C 3 18  ? 89.078 22.420  0.975   1.00 20.39 ? 18   PHE A CD2   1 
ATOM   540  C  CE1   . PHE C 3 18  ? 86.892 20.994  1.937   1.00 21.66 ? 18   PHE A CE1   1 
ATOM   541  C  CE2   . PHE C 3 18  ? 89.270 21.382  1.885   1.00 20.48 ? 18   PHE A CE2   1 
ATOM   542  C  CZ    . PHE C 3 18  ? 88.172 20.664  2.366   1.00 21.67 ? 18   PHE A CZ    1 
ATOM   543  N  N     . HIS C 3 19  ? 88.177 25.900  2.278   1.00 22.07 ? 19   HIS A N     1 
ATOM   544  C  CA    . HIS C 3 19  ? 89.197 26.212  3.275   1.00 22.60 ? 19   HIS A CA    1 
ATOM   545  C  C     . HIS C 3 19  ? 89.645 24.943  4.021   1.00 23.91 ? 19   HIS A C     1 
ATOM   546  O  O     . HIS C 3 19  ? 90.840 24.655  4.135   1.00 22.89 ? 19   HIS A O     1 
ATOM   547  C  CB    . HIS C 3 19  ? 88.671 27.242  4.291   1.00 24.47 ? 19   HIS A CB    1 
ATOM   548  C  CG    . HIS C 3 19  ? 88.534 28.636  3.750   1.00 25.72 ? 19   HIS A CG    1 
ATOM   549  N  ND1   . HIS C 3 19  ? 89.526 29.257  3.018   1.00 25.88 ? 19   HIS A ND1   1 
ATOM   550  C  CD2   . HIS C 3 19  ? 87.547 29.555  3.894   1.00 26.87 ? 19   HIS A CD2   1 
ATOM   551  C  CE1   . HIS C 3 19  ? 89.157 30.495  2.737   1.00 23.77 ? 19   HIS A CE1   1 
ATOM   552  N  NE2   . HIS C 3 19  ? 87.960 30.701  3.258   1.00 25.99 ? 19   HIS A NE2   1 
ATOM   553  N  N     . CYS C 3 20  ? 88.679 24.184  4.526   1.00 23.14 ? 20   CYS A N     1 
ATOM   554  C  CA    . CYS C 3 20  ? 88.981 22.972  5.269   1.00 23.77 ? 20   CYS A CA    1 
ATOM   555  C  C     . CYS C 3 20  ? 87.758 22.085  5.413   1.00 24.07 ? 20   CYS A C     1 
ATOM   556  O  O     . CYS C 3 20  ? 86.640 22.496  5.107   1.00 22.84 ? 20   CYS A O     1 
ATOM   557  C  CB    . CYS C 3 20  ? 89.520 23.323  6.660   1.00 21.96 ? 20   CYS A CB    1 
ATOM   558  S  SG    . CYS C 3 20  ? 88.394 24.275  7.698   1.00 27.51 ? 20   CYS A SG    1 
ATOM   559  N  N     . GLY C 3 21  ? 87.990 20.867  5.891   1.00 25.32 ? 21   GLY A N     1 
ATOM   560  C  CA    . GLY C 3 21  ? 86.916 19.908  6.076   1.00 25.35 ? 21   GLY A CA    1 
ATOM   561  C  C     . GLY C 3 21  ? 87.277 18.910  7.162   1.00 25.98 ? 21   GLY A C     1 
ATOM   562  O  O     . GLY C 3 21  ? 88.453 18.687  7.446   1.00 25.05 ? 21   GLY A O     1 
ATOM   563  N  N     . VAL C 3 22  ? 86.265 18.312  7.781   1.00 25.59 ? 22   VAL A N     1 
ATOM   564  C  CA    . VAL C 3 22  ? 86.497 17.342  8.841   1.00 23.30 ? 22   VAL A CA    1 
ATOM   565  C  C     . VAL C 3 22  ? 85.609 16.129  8.619   1.00 23.89 ? 22   VAL A C     1 
ATOM   566  O  O     . VAL C 3 22  ? 84.438 16.262  8.247   1.00 24.27 ? 22   VAL A O     1 
ATOM   567  C  CB    . VAL C 3 22  ? 86.192 17.957  10.226  1.00 24.16 ? 22   VAL A CB    1 
ATOM   568  C  CG1   . VAL C 3 22  ? 86.296 16.899  11.313  1.00 24.00 ? 22   VAL A CG1   1 
ATOM   569  C  CG2   . VAL C 3 22  ? 87.161 19.096  10.513  1.00 23.79 ? 22   VAL A CG2   1 
ATOM   570  N  N     . ILE C 3 23  ? 86.171 14.943  8.831   1.00 24.01 ? 23   ILE A N     1 
ATOM   571  C  CA    . ILE C 3 23  ? 85.413 13.711  8.666   1.00 24.89 ? 23   ILE A CA    1 
ATOM   572  C  C     . ILE C 3 23  ? 85.521 12.822  9.890   1.00 25.87 ? 23   ILE A C     1 
ATOM   573  O  O     . ILE C 3 23  ? 86.625 12.551  10.386  1.00 24.80 ? 23   ILE A O     1 
ATOM   574  C  CB    . ILE C 3 23  ? 85.897 12.878  7.448   1.00 25.74 ? 23   ILE A CB    1 
ATOM   575  C  CG1   . ILE C 3 23  ? 85.618 13.629  6.143   1.00 25.88 ? 23   ILE A CG1   1 
ATOM   576  C  CG2   . ILE C 3 23  ? 85.184 11.519  7.420   1.00 25.63 ? 23   ILE A CG2   1 
ATOM   577  N  N     . TYR C 3 24  ? 84.366 12.396  10.394  1.00 26.41 ? 24   TYR A N     1 
ATOM   578  C  CA    . TYR C 3 24  ? 84.325 11.471  11.512  1.00 27.63 ? 24   TYR A CA    1 
ATOM   579  C  C     . TYR C 3 24  ? 83.863 10.161  10.892  1.00 28.22 ? 24   TYR A C     1 
ATOM   580  O  O     . TYR C 3 24  ? 82.816 10.122  10.239  1.00 30.11 ? 24   TYR A O     1 
ATOM   581  C  CB    . TYR C 3 24  ? 83.307 11.876  12.575  1.00 27.58 ? 24   TYR A CB    1 
ATOM   582  C  CG    . TYR C 3 24  ? 83.158 10.784  13.616  1.00 29.77 ? 24   TYR A CG    1 
ATOM   583  C  CD1   . TYR C 3 24  ? 84.131 10.598  14.605  1.00 31.37 ? 24   TYR A CD1   1 
ATOM   584  C  CD2   . TYR C 3 24  ? 82.104 9.872   13.551  1.00 28.58 ? 24   TYR A CD2   1 
ATOM   585  C  CE1   . TYR C 3 24  ? 84.061 9.527   15.498  1.00 31.28 ? 24   TYR A CE1   1 
ATOM   586  C  CE2   . TYR C 3 24  ? 82.024 8.797   14.436  1.00 29.63 ? 24   TYR A CE2   1 
ATOM   587  C  CZ    . TYR C 3 24  ? 83.008 8.629   15.403  1.00 30.83 ? 24   TYR A CZ    1 
ATOM   588  O  OH    . TYR C 3 24  ? 82.959 7.541   16.249  1.00 31.55 ? 24   TYR A OH    1 
ATOM   589  N  N     . ASP C 3 25  ? 84.627 9.095   11.096  1.00 29.26 ? 25   ASP A N     1 
ATOM   590  C  CA    . ASP C 3 25  ? 84.283 7.788   10.541  1.00 29.27 ? 25   ASP A CA    1 
ATOM   591  C  C     . ASP C 3 25  ? 83.882 6.812   11.654  1.00 29.73 ? 25   ASP A C     1 
ATOM   592  O  O     . ASP C 3 25  ? 84.708 6.445   12.484  1.00 30.23 ? 25   ASP A O     1 
ATOM   593  C  CB    . ASP C 3 25  ? 85.486 7.227   9.776   1.00 30.25 ? 25   ASP A CB    1 
ATOM   594  C  CG    . ASP C 3 25  ? 85.113 6.098   8.836   1.00 32.60 ? 25   ASP A CG    1 
ATOM   595  O  OD1   . ASP C 3 25  ? 84.208 5.297   9.169   1.00 35.76 ? 25   ASP A OD1   1 
ATOM   596  O  OD2   . ASP C 3 25  ? 85.741 5.999   7.761   1.00 35.16 ? 25   ASP A OD2   1 
ATOM   597  N  N     . TYR C 3 26  ? 82.618 6.390   11.667  1.00 30.54 ? 26   TYR A N     1 
ATOM   598  C  CA    . TYR C 3 26  ? 82.126 5.454   12.676  1.00 31.15 ? 26   TYR A CA    1 
ATOM   599  C  C     . TYR C 3 26  ? 82.919 4.142   12.757  1.00 31.81 ? 26   TYR A C     1 
ATOM   600  O  O     . TYR C 3 26  ? 83.077 3.579   13.838  1.00 32.14 ? 26   TYR A O     1 
ATOM   601  C  CB    . TYR C 3 26  ? 80.643 5.130   12.427  1.00 30.68 ? 26   TYR A CB    1 
ATOM   602  C  CG    . TYR C 3 26  ? 79.696 6.095   13.104  1.00 30.12 ? 26   TYR A CG    1 
ATOM   603  C  CD1   . TYR C 3 26  ? 79.408 5.982   14.466  1.00 29.49 ? 26   TYR A CD1   1 
ATOM   604  C  CD2   . TYR C 3 26  ? 79.156 7.172   12.404  1.00 27.88 ? 26   TYR A CD2   1 
ATOM   605  C  CE1   . TYR C 3 26  ? 78.607 6.930   15.109  1.00 30.04 ? 26   TYR A CE1   1 
ATOM   606  C  CE2   . TYR C 3 26  ? 78.363 8.116   13.031  1.00 26.41 ? 26   TYR A CE2   1 
ATOM   607  C  CZ    . TYR C 3 26  ? 78.091 7.997   14.377  1.00 29.41 ? 26   TYR A CZ    1 
ATOM   608  O  OH    . TYR C 3 26  ? 77.318 8.955   14.989  1.00 28.31 ? 26   TYR A OH    1 
ATOM   609  N  N     . SER C 3 27  ? 83.419 3.658   11.624  1.00 32.91 ? 27   SER A N     1 
ATOM   610  C  CA    . SER C 3 27  ? 84.168 2.400   11.608  1.00 35.00 ? 27   SER A CA    1 
ATOM   611  C  C     . SER C 3 27  ? 85.571 2.487   12.221  1.00 35.10 ? 27   SER A C     1 
ATOM   612  O  O     . SER C 3 27  ? 86.169 1.458   12.540  1.00 37.10 ? 27   SER A O     1 
ATOM   613  C  CB    . SER C 3 27  ? 84.261 1.854   10.178  1.00 34.83 ? 27   SER A CB    1 
ATOM   614  O  OG    . SER C 3 27  ? 85.094 2.665   9.370   1.00 37.19 ? 27   SER A OG    1 
ATOM   615  N  N     . THR C 3 28  ? 86.093 3.701   12.383  1.00 34.13 ? 28   THR A N     1 
ATOM   616  C  CA    . THR C 3 28  ? 87.416 3.901   12.983  1.00 34.15 ? 28   THR A CA    1 
ATOM   617  C  C     . THR C 3 28  ? 87.272 4.714   14.264  1.00 34.53 ? 28   THR A C     1 
ATOM   618  O  O     . THR C 3 28  ? 88.149 4.694   15.123  1.00 34.22 ? 28   THR A O     1 
ATOM   619  C  CB    . THR C 3 28  ? 88.381 4.689   12.059  1.00 33.98 ? 28   THR A CB    1 
ATOM   620  O  OG1   . THR C 3 28  ? 87.887 6.024   11.880  1.00 34.19 ? 28   THR A OG1   1 
ATOM   621  C  CG2   . THR C 3 28  ? 88.516 4.007   10.705  1.00 33.90 ? 28   THR A CG2   1 
ATOM   622  N  N     . ALA C 3 29  ? 86.160 5.436   14.372  1.00 34.49 ? 29   ALA A N     1 
ATOM   623  C  CA    . ALA C 3 29  ? 85.874 6.278   15.526  1.00 34.70 ? 29   ALA A CA    1 
ATOM   624  C  C     . ALA C 3 29  ? 86.899 7.400   15.677  1.00 34.66 ? 29   ALA A C     1 
ATOM   625  O  O     . ALA C 3 29  ? 87.144 7.881   16.783  1.00 34.78 ? 29   ALA A O     1 
ATOM   626  C  CB    . ALA C 3 29  ? 85.829 5.433   16.797  1.00 35.04 ? 29   ALA A CB    1 
ATOM   627  N  N     . GLU C 3 30  ? 87.486 7.830   14.565  1.00 34.51 ? 30   GLU A N     1 
ATOM   628  C  CA    . GLU C 3 30  ? 88.486 8.896   14.614  1.00 35.35 ? 30   GLU A CA    1 
ATOM   629  C  C     . GLU C 3 30  ? 88.093 10.107  13.773  1.00 33.62 ? 30   GLU A C     1 
ATOM   630  O  O     . GLU C 3 30  ? 87.362 9.982   12.791  1.00 31.71 ? 30   GLU A O     1 
ATOM   631  C  CB    . GLU C 3 30  ? 89.839 8.371   14.119  1.00 37.53 ? 30   GLU A CB    1 
ATOM   632  C  CG    . GLU C 3 30  ? 90.344 7.140   14.860  1.00 43.07 ? 30   GLU A CG    1 
ATOM   633  C  CD    . GLU C 3 30  ? 91.642 6.597   14.277  1.00 46.49 ? 30   GLU A CD    1 
ATOM   634  O  OE1   . GLU C 3 30  ? 91.693 6.351   13.048  1.00 46.46 ? 30   GLU A OE1   1 
ATOM   635  O  OE2   . GLU C 3 30  ? 92.609 6.409   15.051  1.00 49.10 ? 30   GLU A OE2   1 
ATOM   636  N  N     . TYR C 3 31  ? 88.581 11.277  14.170  1.00 32.21 ? 31   TYR A N     1 
ATOM   637  C  CA    . TYR C 3 31  ? 88.310 12.503  13.436  1.00 31.87 ? 31   TYR A CA    1 
ATOM   638  C  C     . TYR C 3 31  ? 89.514 12.828  12.567  1.00 32.43 ? 31   TYR A C     1 
ATOM   639  O  O     . TYR C 3 31  ? 90.650 12.755  13.021  1.00 33.93 ? 31   TYR A O     1 
ATOM   640  C  CB    . TYR C 3 31  ? 88.067 13.669  14.386  1.00 32.33 ? 31   TYR A CB    1 
ATOM   641  C  CG    . TYR C 3 31  ? 86.798 13.564  15.193  1.00 32.33 ? 31   TYR A CG    1 
ATOM   642  C  CD1   . TYR C 3 31  ? 86.779 12.899  16.418  1.00 29.96 ? 31   TYR A CD1   1 
ATOM   643  C  CD2   . TYR C 3 31  ? 85.613 14.145  14.736  1.00 29.88 ? 31   TYR A CD2   1 
ATOM   644  C  CE1   . TYR C 3 31  ? 85.607 12.821  17.174  1.00 32.46 ? 31   TYR A CE1   1 
ATOM   645  C  CE2   . TYR C 3 31  ? 84.440 14.072  15.477  1.00 29.96 ? 31   TYR A CE2   1 
ATOM   646  C  CZ    . TYR C 3 31  ? 84.442 13.411  16.696  1.00 31.32 ? 31   TYR A CZ    1 
ATOM   647  O  OH    . TYR C 3 31  ? 83.290 13.354  17.444  1.00 32.87 ? 31   TYR A OH    1 
ATOM   648  N  N     . VAL C 3 32  ? 89.270 13.184  11.314  1.00 31.64 ? 32   VAL A N     1 
ATOM   649  C  CA    . VAL C 3 32  ? 90.361 13.528  10.416  1.00 29.71 ? 32   VAL A CA    1 
ATOM   650  C  C     . VAL C 3 32  ? 90.141 14.936  9.869   1.00 30.14 ? 32   VAL A C     1 
ATOM   651  O  O     . VAL C 3 32  ? 89.055 15.268  9.376   1.00 29.25 ? 32   VAL A O     1 
ATOM   652  C  CB    . VAL C 3 32  ? 90.458 12.534  9.242   1.00 28.51 ? 32   VAL A CB    1 
ATOM   653  C  CG1   . VAL C 3 32  ? 91.590 12.938  8.319   1.00 30.03 ? 32   VAL A CG1   1 
ATOM   654  C  CG2   . VAL C 3 32  ? 90.685 11.114  9.774   1.00 28.13 ? 32   VAL A CG2   1 
ATOM   655  N  N     . SER C 3 33  ? 91.172 15.768  9.975   1.00 28.38 ? 33   SER A N     1 
ATOM   656  C  CA    . SER C 3 33  ? 91.090 17.131  9.490   1.00 26.19 ? 33   SER A CA    1 
ATOM   657  C  C     . SER C 3 33  ? 91.752 17.259  8.132   1.00 26.11 ? 33   SER A C     1 
ATOM   658  O  O     . SER C 3 33  ? 92.790 16.647  7.864   1.00 25.30 ? 33   SER A O     1 
ATOM   659  C  CB    . SER C 3 33  ? 91.747 18.091  10.476  1.00 26.17 ? 33   SER A CB    1 
ATOM   660  O  OG    . SER C 3 33  ? 90.917 18.286  11.604  1.00 27.15 ? 33   SER A OG    1 
ATOM   661  N  N     . TYR C 3 34  ? 91.131 18.055  7.275   1.00 24.35 ? 34   TYR A N     1 
ATOM   662  C  CA    . TYR C 3 34  ? 91.636 18.292  5.937   1.00 26.17 ? 34   TYR A CA    1 
ATOM   663  C  C     . TYR C 3 34  ? 91.786 19.793  5.775   1.00 27.30 ? 34   TYR A C     1 
ATOM   664  O  O     . TYR C 3 34  ? 90.828 20.547  5.974   1.00 26.26 ? 34   TYR A O     1 
ATOM   665  C  CB    . TYR C 3 34  ? 90.661 17.758  4.886   1.00 24.22 ? 34   TYR A CB    1 
ATOM   666  C  CG    . TYR C 3 34  ? 90.457 16.265  4.928   1.00 24.29 ? 34   TYR A CG    1 
ATOM   667  C  CD1   . TYR C 3 34  ? 89.648 15.675  5.902   1.00 24.84 ? 34   TYR A CD1   1 
ATOM   668  C  CD2   . TYR C 3 34  ? 91.053 15.434  3.973   1.00 24.84 ? 34   TYR A CD2   1 
ATOM   669  C  CE1   . TYR C 3 34  ? 89.434 14.286  5.921   1.00 23.64 ? 34   TYR A CE1   1 
ATOM   670  C  CE2   . TYR C 3 34  ? 90.846 14.049  3.984   1.00 23.38 ? 34   TYR A CE2   1 
ATOM   671  C  CZ    . TYR C 3 34  ? 90.037 13.484  4.960   1.00 24.29 ? 34   TYR A CZ    1 
ATOM   672  O  OH    . TYR C 3 34  ? 89.847 12.116  4.980   1.00 25.73 ? 34   TYR A OH    1 
ATOM   673  N  N     . ARG C 3 35  ? 92.999 20.215  5.428   1.00 29.17 ? 35   ARG A N     1 
ATOM   674  C  CA    . ARG C 3 35  ? 93.317 21.623  5.236   1.00 26.69 ? 35   ARG A CA    1 
ATOM   675  C  C     . ARG C 3 35  ? 93.220 21.963  3.755   1.00 26.99 ? 35   ARG A C     1 
ATOM   676  O  O     . ARG C 3 35  ? 93.062 21.070  2.922   1.00 26.01 ? 35   ARG A O     1 
ATOM   677  C  CB    . ARG C 3 35  ? 94.701 21.899  5.814   1.00 27.12 ? 35   ARG A CB    1 
ATOM   678  C  CG    . ARG C 3 35  ? 94.696 21.668  7.318   1.00 29.55 ? 35   ARG A CG    1 
ATOM   679  C  CD    . ARG C 3 35  ? 96.040 21.862  8.006   1.00 32.64 ? 35   ARG A CD    1 
ATOM   680  N  NE    . ARG C 3 35  ? 95.844 21.885  9.454   1.00 34.11 ? 35   ARG A NE    1 
ATOM   681  C  CZ    . ARG C 3 35  ? 95.501 20.825  10.180  1.00 37.19 ? 35   ARG A CZ    1 
ATOM   682  N  NH1   . ARG C 3 35  ? 95.326 19.640  9.600   1.00 36.60 ? 35   ARG A NH1   1 
ATOM   683  N  NH2   . ARG C 3 35  ? 95.298 20.957  11.484  1.00 38.95 ? 35   ARG A NH2   1 
ATOM   684  N  N     . PRO C 3 36  ? 93.313 23.252  3.402   1.00 27.76 ? 36   PRO A N     1 
ATOM   685  C  CA    . PRO C 3 36  ? 93.203 23.621  1.988   1.00 28.98 ? 36   PRO A CA    1 
ATOM   686  C  C     . PRO C 3 36  ? 93.907 22.765  0.948   1.00 29.47 ? 36   PRO A C     1 
ATOM   687  O  O     . PRO C 3 36  ? 93.302 22.413  -0.063  1.00 31.39 ? 36   PRO A O     1 
ATOM   688  C  CB    . PRO C 3 36  ? 93.636 25.095  1.961   1.00 28.92 ? 36   PRO A CB    1 
ATOM   689  C  CG    . PRO C 3 36  ? 94.324 25.314  3.281   1.00 30.24 ? 36   PRO A CG    1 
ATOM   690  C  CD    . PRO C 3 36  ? 93.602 24.430  4.237   1.00 27.67 ? 36   PRO A CD    1 
ATOM   691  N  N     . SER C 3 37  ? 95.164 22.412  1.175   1.00 29.55 ? 37   SER A N     1 
ATOM   692  C  CA    . SER C 3 37  ? 95.863 21.598  0.191   1.00 30.56 ? 37   SER A CA    1 
ATOM   693  C  C     . SER C 3 37  ? 95.429 20.128  0.221   1.00 30.25 ? 37   SER A C     1 
ATOM   694  O  O     . SER C 3 37  ? 95.889 19.331  -0.598  1.00 28.53 ? 37   SER A O     1 
ATOM   695  C  CB    . SER C 3 37  ? 97.389 21.714  0.377   1.00 31.31 ? 37   SER A CB    1 
ATOM   696  O  OG    . SER C 3 37  ? 97.771 21.436  1.711   1.00 32.96 ? 37   SER A OG    1 
ATOM   697  N  N     . ASP C 3 38  ? 94.531 19.782  1.148   1.00 30.51 ? 38   ASP A N     1 
ATOM   698  C  CA    . ASP C 3 38  ? 94.033 18.410  1.271   1.00 29.48 ? 38   ASP A CA    1 
ATOM   699  C  C     . ASP C 3 38  ? 92.678 18.225  0.579   1.00 29.51 ? 38   ASP A C     1 
ATOM   700  O  O     . ASP C 3 38  ? 92.068 17.158  0.675   1.00 30.06 ? 38   ASP A O     1 
ATOM   701  C  CB    . ASP C 3 38  ? 93.872 18.015  2.745   1.00 30.75 ? 38   ASP A CB    1 
ATOM   702  C  CG    . ASP C 3 38  ? 95.161 18.167  3.554   1.00 32.64 ? 38   ASP A CG    1 
ATOM   703  O  OD1   . ASP C 3 38  ? 96.223 17.693  3.103   1.00 31.71 ? 38   ASP A OD1   1 
ATOM   704  O  OD2   . ASP C 3 38  ? 95.102 18.750  4.660   1.00 34.45 ? 38   ASP A OD2   1 
ATOM   705  N  N     . PHE C 3 39  ? 92.207 19.253  -0.123  1.00 28.79 ? 39   PHE A N     1 
ATOM   706  C  CA    . PHE C 3 39  ? 90.904 19.180  -0.792  1.00 27.75 ? 39   PHE A CA    1 
ATOM   707  C  C     . PHE C 3 39  ? 90.705 17.890  -1.600  1.00 26.65 ? 39   PHE A C     1 
ATOM   708  O  O     . PHE C 3 39  ? 89.687 17.218  -1.466  1.00 26.99 ? 39   PHE A O     1 
ATOM   709  C  CB    . PHE C 3 39  ? 90.697 20.425  -1.683  1.00 25.18 ? 39   PHE A CB    1 
ATOM   710  C  CG    . PHE C 3 39  ? 89.288 20.576  -2.215  1.00 24.60 ? 39   PHE A CG    1 
ATOM   711  C  CD1   . PHE C 3 39  ? 88.191 20.120  -1.480  1.00 21.25 ? 39   PHE A CD1   1 
ATOM   712  C  CD2   . PHE C 3 39  ? 89.058 21.164  -3.460  1.00 23.09 ? 39   PHE A CD2   1 
ATOM   713  C  CE1   . PHE C 3 39  ? 86.887 20.240  -1.978  1.00 22.99 ? 39   PHE A CE1   1 
ATOM   714  C  CE2   . PHE C 3 39  ? 87.755 21.291  -3.970  1.00 23.37 ? 39   PHE A CE2   1 
ATOM   715  C  CZ    . PHE C 3 39  ? 86.663 20.824  -3.225  1.00 21.40 ? 39   PHE A CZ    1 
ATOM   716  N  N     . GLY C 3 40  ? 91.682 17.545  -2.431  1.00 27.27 ? 40   GLY A N     1 
ATOM   717  C  CA    . GLY C 3 40  ? 91.578 16.338  -3.231  1.00 26.66 ? 40   GLY A CA    1 
ATOM   718  C  C     . GLY C 3 40  ? 91.339 15.108  -2.377  1.00 26.15 ? 40   GLY A C     1 
ATOM   719  O  O     . GLY C 3 40  ? 90.485 14.278  -2.688  1.00 28.09 ? 40   GLY A O     1 
ATOM   720  N  N     . ALA C 3 41  ? 92.092 14.995  -1.291  1.00 25.36 ? 41   ALA A N     1 
ATOM   721  C  CA    . ALA C 3 41  ? 91.963 13.866  -0.383  1.00 24.30 ? 41   ALA A CA    1 
ATOM   722  C  C     . ALA C 3 41  ? 90.616 13.898  0.327   1.00 24.09 ? 41   ALA A C     1 
ATOM   723  O  O     . ALA C 3 41  ? 90.032 12.858  0.591   1.00 24.88 ? 41   ALA A O     1 
ATOM   724  C  CB    . ALA C 3 41  ? 93.098 13.884  0.646   1.00 24.19 ? 41   ALA A CB    1 
ATOM   725  N  N     . TYR C 3 42  ? 90.120 15.090  0.644   1.00 24.17 ? 42   TYR A N     1 
ATOM   726  C  CA    . TYR C 3 42  ? 88.832 15.177  1.328   1.00 23.88 ? 42   TYR A CA    1 
ATOM   727  C  C     . TYR C 3 42  ? 87.762 14.518  0.459   1.00 22.89 ? 42   TYR A C     1 
ATOM   728  O  O     . TYR C 3 42  ? 87.002 13.673  0.922   1.00 23.46 ? 42   TYR A O     1 
ATOM   729  C  CB    . TYR C 3 42  ? 88.456 16.638  1.601   1.00 22.46 ? 42   TYR A CB    1 
ATOM   730  C  CG    . TYR C 3 42  ? 87.063 16.801  2.159   1.00 20.76 ? 42   TYR A CG    1 
ATOM   731  C  CD1   . TYR C 3 42  ? 86.761 16.414  3.467   1.00 20.47 ? 42   TYR A CD1   1 
ATOM   732  C  CD2   . TYR C 3 42  ? 86.037 17.321  1.370   1.00 20.15 ? 42   TYR A CD2   1 
ATOM   733  C  CE1   . TYR C 3 42  ? 85.464 16.542  3.976   1.00 21.38 ? 42   TYR A CE1   1 
ATOM   734  C  CE2   . TYR C 3 42  ? 84.737 17.457  1.863   1.00 19.92 ? 42   TYR A CE2   1 
ATOM   735  C  CZ    . TYR C 3 42  ? 84.455 17.065  3.164   1.00 21.19 ? 42   TYR A CZ    1 
ATOM   736  O  OH    . TYR C 3 42  ? 83.166 17.168  3.639   1.00 18.67 ? 42   TYR A OH    1 
ATOM   737  N  N     . LEU C 3 43  ? 87.726 14.920  -0.807  1.00 23.25 ? 43   LEU A N     1 
ATOM   738  C  CA    . LEU C 3 43  ? 86.782 14.391  -1.772  1.00 22.00 ? 43   LEU A CA    1 
ATOM   739  C  C     . LEU C 3 43  ? 86.966 12.884  -1.948  1.00 21.88 ? 43   LEU A C     1 
ATOM   740  O  O     . LEU C 3 43  ? 85.985 12.146  -1.997  1.00 21.82 ? 43   LEU A O     1 
ATOM   741  C  CB    . LEU C 3 43  ? 86.975 15.088  -3.122  1.00 21.83 ? 43   LEU A CB    1 
ATOM   742  C  CG    . LEU C 3 43  ? 86.782 16.606  -3.156  1.00 24.28 ? 43   LEU A CG    1 
ATOM   743  C  CD1   . LEU C 3 43  ? 87.142 17.127  -4.552  1.00 22.06 ? 43   LEU A CD1   1 
ATOM   744  C  CD2   . LEU C 3 43  ? 85.325 16.952  -2.791  1.00 21.05 ? 43   LEU A CD2   1 
ATOM   745  N  N     . ASP C 3 44  ? 88.214 12.432  -2.047  1.00 21.89 ? 44   ASP A N     1 
ATOM   746  C  CA    . ASP C 3 44  ? 88.477 11.002  -2.226  1.00 23.70 ? 44   ASP A CA    1 
ATOM   747  C  C     . ASP C 3 44  ? 87.817 10.214  -1.107  1.00 22.05 ? 44   ASP A C     1 
ATOM   748  O  O     . ASP C 3 44  ? 87.187 9.182   -1.353  1.00 24.05 ? 44   ASP A O     1 
ATOM   749  C  CB    . ASP C 3 44  ? 89.980 10.681  -2.210  1.00 24.83 ? 44   ASP A CB    1 
ATOM   750  C  CG    . ASP C 3 44  ? 90.727 11.218  -3.425  1.00 27.37 ? 44   ASP A CG    1 
ATOM   751  O  OD1   . ASP C 3 44  ? 90.110 11.459  -4.484  1.00 28.77 ? 44   ASP A OD1   1 
ATOM   752  O  OD2   . ASP C 3 44  ? 91.962 11.375  -3.316  1.00 29.37 ? 44   ASP A OD2   1 
ATOM   753  N  N     . ALA C 3 45  ? 87.979 10.702  0.119   1.00 20.99 ? 45   ALA A N     1 
ATOM   754  C  CA    . ALA C 3 45  ? 87.404 10.054  1.291   1.00 21.72 ? 45   ALA A CA    1 
ATOM   755  C  C     . ALA C 3 45  ? 85.879 9.981   1.208   1.00 22.59 ? 45   ALA A C     1 
ATOM   756  O  O     . ALA C 3 45  ? 85.283 8.967   1.582   1.00 23.66 ? 45   ALA A O     1 
ATOM   757  C  CB    . ALA C 3 45  ? 87.830 10.788  2.561   1.00 18.49 ? 45   ALA A CB    1 
ATOM   758  N  N     . LEU C 3 46  ? 85.243 11.044  0.717   1.00 23.47 ? 46   LEU A N     1 
ATOM   759  C  CA    . LEU C 3 46  ? 83.780 11.039  0.594   1.00 24.79 ? 46   LEU A CA    1 
ATOM   760  C  C     . LEU C 3 46  ? 83.348 10.013  -0.455  1.00 25.16 ? 46   LEU A C     1 
ATOM   761  O  O     . LEU C 3 46  ? 82.402 9.258   -0.240  1.00 25.41 ? 46   LEU A O     1 
ATOM   762  C  CB    . LEU C 3 46  ? 83.245 12.426  0.206   1.00 21.78 ? 46   LEU A CB    1 
ATOM   763  C  CG    . LEU C 3 46  ? 83.472 13.575  1.194   1.00 23.90 ? 46   LEU A CG    1 
ATOM   764  C  CD1   . LEU C 3 46  ? 82.865 14.863  0.650   1.00 25.10 ? 46   LEU A CD1   1 
ATOM   765  C  CD2   . LEU C 3 46  ? 82.835 13.220  2.539   1.00 24.97 ? 46   LEU A CD2   1 
ATOM   766  N  N     . GLU C 3 47  ? 84.035 9.984   -1.590  1.00 26.32 ? 47   GLU A N     1 
ATOM   767  C  CA    . GLU C 3 47  ? 83.682 9.030   -2.633  1.00 29.32 ? 47   GLU A CA    1 
ATOM   768  C  C     . GLU C 3 47  ? 83.993 7.588   -2.235  1.00 29.34 ? 47   GLU A C     1 
ATOM   769  O  O     . GLU C 3 47  ? 83.403 6.654   -2.773  1.00 29.16 ? 47   GLU A O     1 
ATOM   770  C  CB    . GLU C 3 47  ? 84.378 9.387   -3.948  1.00 32.09 ? 47   GLU A CB    1 
ATOM   771  C  CG    . GLU C 3 47  ? 83.752 10.594  -4.625  1.00 33.47 ? 47   GLU A CG    1 
ATOM   772  C  CD    . GLU C 3 47  ? 84.381 10.920  -5.965  1.00 37.04 ? 47   GLU A CD    1 
ATOM   773  O  OE1   . GLU C 3 47  ? 85.625 11.039  -6.031  1.00 36.69 ? 47   GLU A OE1   1 
ATOM   774  O  OE2   . GLU C 3 47  ? 83.626 11.065  -6.953  1.00 38.70 ? 47   GLU A OE2   1 
ATOM   775  N  N     . ALA C 3 48  ? 84.902 7.409   -1.282  1.00 29.37 ? 48   ALA A N     1 
ATOM   776  C  CA    . ALA C 3 48  ? 85.248 6.070   -0.821  1.00 29.96 ? 48   ALA A CA    1 
ATOM   777  C  C     . ALA C 3 48  ? 84.068 5.526   -0.021  1.00 30.75 ? 48   ALA A C     1 
ATOM   778  O  O     . ALA C 3 48  ? 83.711 4.353   -0.137  1.00 32.57 ? 48   ALA A O     1 
ATOM   779  C  CB    . ALA C 3 48  ? 86.502 6.112   0.046   1.00 29.64 ? 48   ALA A CB    1 
ATOM   780  N  N     . GLU C 3 49  ? 83.458 6.387   0.786   1.00 29.49 ? 49   GLU A N     1 
ATOM   781  C  CA    . GLU C 3 49  ? 82.309 5.986   1.588   1.00 28.74 ? 49   GLU A CA    1 
ATOM   782  C  C     . GLU C 3 49  ? 81.169 5.619   0.639   1.00 27.08 ? 49   GLU A C     1 
ATOM   783  O  O     . GLU C 3 49  ? 80.411 4.690   0.894   1.00 26.74 ? 49   GLU A O     1 
ATOM   784  C  CB    . GLU C 3 49  ? 81.894 7.130   2.526   1.00 27.98 ? 49   GLU A CB    1 
ATOM   785  C  CG    . GLU C 3 49  ? 80.702 6.834   3.439   1.00 28.27 ? 49   GLU A CG    1 
ATOM   786  C  CD    . GLU C 3 49  ? 80.951 5.696   4.435   1.00 28.48 ? 49   GLU A CD    1 
ATOM   787  O  OE1   . GLU C 3 49  ? 82.122 5.326   4.666   1.00 27.06 ? 49   GLU A OE1   1 
ATOM   788  O  OE2   . GLU C 3 49  ? 79.961 5.184   5.004   1.00 26.02 ? 49   GLU A OE2   1 
ATOM   789  N  N     . VAL C 3 50  ? 81.063 6.354   -0.463  1.00 28.09 ? 50   VAL A N     1 
ATOM   790  C  CA    . VAL C 3 50  ? 80.032 6.103   -1.471  1.00 27.51 ? 50   VAL A CA    1 
ATOM   791  C  C     . VAL C 3 50  ? 80.286 4.755   -2.159  1.00 29.62 ? 50   VAL A C     1 
ATOM   792  O  O     . VAL C 3 50  ? 79.348 4.026   -2.501  1.00 30.02 ? 50   VAL A O     1 
ATOM   793  C  CB    . VAL C 3 50  ? 80.032 7.214   -2.537  1.00 25.97 ? 50   VAL A CB    1 
ATOM   794  C  CG1   . VAL C 3 50  ? 79.066 6.867   -3.661  1.00 26.08 ? 50   VAL A CG1   1 
ATOM   795  C  CG2   . VAL C 3 50  ? 79.648 8.541   -1.899  1.00 25.50 ? 50   VAL A CG2   1 
ATOM   796  N  N     . ALA C 3 51  ? 81.560 4.429   -2.355  1.00 30.06 ? 51   ALA A N     1 
ATOM   797  C  CA    . ALA C 3 51  ? 81.941 3.174   -2.993  1.00 31.79 ? 51   ALA A CA    1 
ATOM   798  C  C     . ALA C 3 51  ? 81.560 1.982   -2.114  1.00 31.67 ? 51   ALA A C     1 
ATOM   799  O  O     . ALA C 3 51  ? 81.297 0.894   -2.619  1.00 32.91 ? 51   ALA A O     1 
ATOM   800  C  CB    . ALA C 3 51  ? 83.453 3.160   -3.274  1.00 29.98 ? 51   ALA A CB    1 
ATOM   801  N  N     . ARG C 3 52  ? 81.539 2.189   -0.800  1.00 30.73 ? 52   ARG A N     1 
ATOM   802  C  CA    . ARG C 3 52  ? 81.185 1.121   0.132   1.00 29.96 ? 52   ARG A CA    1 
ATOM   803  C  C     . ARG C 3 52  ? 79.674 0.982   0.287   1.00 29.14 ? 52   ARG A C     1 
ATOM   804  O  O     . ARG C 3 52  ? 79.204 0.133   1.044   1.00 29.78 ? 52   ARG A O     1 
ATOM   805  C  CB    . ARG C 3 52  ? 81.761 1.394   1.520   1.00 30.41 ? 52   ARG A CB    1 
ATOM   806  C  CG    . ARG C 3 52  ? 83.267 1.524   1.599   1.00 32.89 ? 52   ARG A CG    1 
ATOM   807  C  CD    . ARG C 3 52  ? 83.673 1.826   3.035   1.00 35.12 ? 52   ARG A CD    1 
ATOM   808  N  NE    . ARG C 3 52  ? 85.026 2.364   3.112   1.00 41.49 ? 52   ARG A NE    1 
ATOM   809  C  CZ    . ARG C 3 52  ? 85.326 3.656   3.210   1.00 41.50 ? 52   ARG A CZ    1 
ATOM   810  N  NH1   . ARG C 3 52  ? 84.366 4.568   3.254   1.00 42.59 ? 52   ARG A NH1   1 
ATOM   811  N  NH2   . ARG C 3 52  ? 86.597 4.033   3.248   1.00 43.87 ? 52   ARG A NH2   1 
ATOM   812  N  N     . GLY C 3 53  ? 78.915 1.805   -0.426  1.00 28.15 ? 53   GLY A N     1 
ATOM   813  C  CA    . GLY C 3 53  ? 77.473 1.758   -0.282  1.00 26.55 ? 53   GLY A CA    1 
ATOM   814  C  C     . GLY C 3 53  ? 77.166 2.378   1.071   1.00 26.49 ? 53   GLY A C     1 
ATOM   815  O  O     . GLY C 3 53  ? 76.166 2.061   1.704   1.00 27.73 ? 53   GLY A O     1 
ATOM   816  N  N     . GLY C 3 54  ? 78.051 3.272   1.508   1.00 26.39 ? 54   GLY A N     1 
ATOM   817  C  CA    . GLY C 3 54  ? 77.900 3.922   2.797   1.00 25.24 ? 54   GLY A CA    1 
ATOM   818  C  C     . GLY C 3 54  ? 77.016 5.154   2.846   1.00 25.84 ? 54   GLY A C     1 
ATOM   819  O  O     . GLY C 3 54  ? 76.242 5.434   1.921   1.00 25.97 ? 54   GLY A O     1 
ATOM   820  N  N     . LEU C 3 55  ? 77.134 5.895   3.945   1.00 23.80 ? 55   LEU A N     1 
ATOM   821  C  CA    . LEU C 3 55  ? 76.343 7.100   4.159   1.00 23.24 ? 55   LEU A CA    1 
ATOM   822  C  C     . LEU C 3 55  ? 77.192 8.274   4.619   1.00 22.43 ? 55   LEU A C     1 
ATOM   823  O  O     . LEU C 3 55  ? 78.173 8.096   5.353   1.00 22.94 ? 55   LEU A O     1 
ATOM   824  C  CB    . LEU C 3 55  ? 75.250 6.826   5.197   1.00 21.43 ? 55   LEU A CB    1 
ATOM   825  C  CG    . LEU C 3 55  ? 74.086 6.013   4.643   1.00 23.52 ? 55   LEU A CG    1 
ATOM   826  C  CD1   . LEU C 3 55  ? 73.253 5.443   5.785   1.00 24.77 ? 55   LEU A CD1   1 
ATOM   827  C  CD2   . LEU C 3 55  ? 73.249 6.916   3.719   1.00 20.95 ? 55   LEU A CD2   1 
ATOM   828  N  N     . ILE C 3 56  ? 76.797 9.470   4.188   1.00 21.70 ? 56   ILE A N     1 
ATOM   829  C  CA    . ILE C 3 56  ? 77.502 10.700  4.541   1.00 20.42 ? 56   ILE A CA    1 
ATOM   830  C  C     . ILE C 3 56  ? 76.539 11.661  5.243   1.00 18.60 ? 56   ILE A C     1 
ATOM   831  O  O     . ILE C 3 56  ? 75.532 12.074  4.665   1.00 16.84 ? 56   ILE A O     1 
ATOM   832  C  CB    . ILE C 3 56  ? 78.062 11.395  3.282   1.00 22.01 ? 56   ILE A CB    1 
ATOM   833  C  CG1   . ILE C 3 56  ? 79.025 10.451  2.550   1.00 21.66 ? 56   ILE A CG1   1 
ATOM   834  C  CG2   . ILE C 3 56  ? 78.753 12.697  3.671   1.00 19.26 ? 56   ILE A CG2   1 
ATOM   835  N  N     . VAL C 3 57  ? 76.852 12.012  6.486   1.00 18.29 ? 57   VAL A N     1 
ATOM   836  C  CA    . VAL C 3 57  ? 76.006 12.919  7.248   1.00 19.07 ? 57   VAL A CA    1 
ATOM   837  C  C     . VAL C 3 57  ? 76.576 14.340  7.348   1.00 21.09 ? 57   VAL A C     1 
ATOM   838  O  O     . VAL C 3 57  ? 77.707 14.549  7.794   1.00 22.19 ? 57   VAL A O     1 
ATOM   839  C  CB    . VAL C 3 57  ? 75.778 12.405  8.685   1.00 20.96 ? 57   VAL A CB    1 
ATOM   840  C  CG1   . VAL C 3 57  ? 74.808 13.314  9.403   1.00 18.46 ? 57   VAL A CG1   1 
ATOM   841  C  CG2   . VAL C 3 57  ? 75.261 10.953  8.658   1.00 22.03 ? 57   VAL A CG2   1 
ATOM   842  N  N     . PHE C 3 58  ? 75.769 15.304  6.922   1.00 20.45 ? 58   PHE A N     1 
ATOM   843  C  CA    . PHE C 3 58  ? 76.109 16.719  6.975   1.00 19.99 ? 58   PHE A CA    1 
ATOM   844  C  C     . PHE C 3 58  ? 74.952 17.388  7.698   1.00 20.98 ? 58   PHE A C     1 
ATOM   845  O  O     . PHE C 3 58  ? 73.844 16.837  7.757   1.00 20.76 ? 58   PHE A O     1 
ATOM   846  C  CB    . PHE C 3 58  ? 76.139 17.336  5.580   1.00 18.34 ? 58   PHE A CB    1 
ATOM   847  C  CG    . PHE C 3 58  ? 77.362 17.028  4.776   1.00 21.09 ? 58   PHE A CG    1 
ATOM   848  C  CD1   . PHE C 3 58  ? 78.560 17.694  5.021   1.00 20.19 ? 58   PHE A CD1   1 
ATOM   849  C  CD2   . PHE C 3 58  ? 77.290 16.151  3.694   1.00 19.67 ? 58   PHE A CD2   1 
ATOM   850  C  CE1   . PHE C 3 58  ? 79.661 17.502  4.197   1.00 20.03 ? 58   PHE A CE1   1 
ATOM   851  C  CE2   . PHE C 3 58  ? 78.386 15.954  2.864   1.00 19.49 ? 58   PHE A CE2   1 
ATOM   852  C  CZ    . PHE C 3 58  ? 79.574 16.633  3.114   1.00 19.05 ? 58   PHE A CZ    1 
ATOM   853  N  N     . HIS C 3 59  ? 75.197 18.568  8.256   1.00 21.69 ? 59   HIS A N     1 
ATOM   854  C  CA    . HIS C 3 59  ? 74.104 19.317  8.865   1.00 20.58 ? 59   HIS A CA    1 
ATOM   855  C  C     . HIS C 3 59  ? 73.848 20.382  7.798   1.00 21.06 ? 59   HIS A C     1 
ATOM   856  O  O     . HIS C 3 59  ? 74.716 21.217  7.539   1.00 19.57 ? 59   HIS A O     1 
ATOM   857  C  CB    . HIS C 3 59  ? 74.514 19.990  10.170  1.00 20.90 ? 59   HIS A CB    1 
ATOM   858  C  CG    . HIS C 3 59  ? 73.383 20.701  10.849  1.00 22.41 ? 59   HIS A CG    1 
ATOM   859  N  ND1   . HIS C 3 59  ? 72.373 20.033  11.514  1.00 21.26 ? 59   HIS A ND1   1 
ATOM   860  C  CD2   . HIS C 3 59  ? 73.088 22.021  10.942  1.00 20.74 ? 59   HIS A CD2   1 
ATOM   861  C  CE1   . HIS C 3 59  ? 71.509 20.912  11.991  1.00 23.22 ? 59   HIS A CE1   1 
ATOM   862  N  NE2   . HIS C 3 59  ? 71.919 22.125  11.657  1.00 23.45 ? 59   HIS A NE2   1 
ATOM   863  N  N     . ASN C 3 60  ? 72.679 20.333  7.162   1.00 21.75 ? 60   ASN A N     1 
ATOM   864  C  CA    . ASN C 3 60  ? 72.328 21.281  6.099   1.00 22.12 ? 60   ASN A CA    1 
ATOM   865  C  C     . ASN C 3 60  ? 73.227 21.067  4.866   1.00 21.58 ? 60   ASN A C     1 
ATOM   866  O  O     . ASN C 3 60  ? 73.513 21.998  4.110   1.00 19.20 ? 60   ASN A O     1 
ATOM   867  C  CB    . ASN C 3 60  ? 72.446 22.733  6.612   1.00 22.12 ? 60   ASN A CB    1 
ATOM   868  C  CG    . ASN C 3 60  ? 71.999 23.765  5.577   1.00 21.24 ? 60   ASN A CG    1 
ATOM   869  O  OD1   . ASN C 3 60  ? 70.920 23.654  4.998   1.00 22.93 ? 60   ASN A OD1   1 
ATOM   870  N  ND2   . ASN C 3 60  ? 72.830 24.769  5.345   1.00 17.08 ? 60   ASN A ND2   1 
ATOM   871  N  N     . GLY C 3 61  ? 73.663 19.823  4.663   1.00 21.10 ? 61   GLY A N     1 
ATOM   872  C  CA    . GLY C 3 61  ? 74.516 19.522  3.526   1.00 19.78 ? 61   GLY A CA    1 
ATOM   873  C  C     . GLY C 3 61  ? 73.766 19.518  2.202   1.00 19.42 ? 61   GLY A C     1 
ATOM   874  O  O     . GLY C 3 61  ? 74.350 19.772  1.157   1.00 18.01 ? 61   GLY A O     1 
ATOM   875  N  N     . HIS C 3 62  ? 72.467 19.237  2.239   1.00 19.34 ? 62   HIS A N     1 
ATOM   876  C  CA    . HIS C 3 62  ? 71.671 19.209  1.013   1.00 18.45 ? 62   HIS A CA    1 
ATOM   877  C  C     . HIS C 3 62  ? 71.637 20.578  0.311   1.00 17.82 ? 62   HIS A C     1 
ATOM   878  O  O     . HIS C 3 62  ? 71.690 20.666  -0.916  1.00 17.86 ? 62   HIS A O     1 
ATOM   879  C  CB    . HIS C 3 62  ? 70.245 18.755  1.333   1.00 18.91 ? 62   HIS A CB    1 
ATOM   880  C  CG    . HIS C 3 62  ? 70.074 17.271  1.379   1.00 18.02 ? 62   HIS A CG    1 
ATOM   881  N  ND1   . HIS C 3 62  ? 71.011 16.425  1.934   1.00 17.30 ? 62   HIS A ND1   1 
ATOM   882  C  CD2   . HIS C 3 62  ? 69.046 16.483  0.981   1.00 16.45 ? 62   HIS A CD2   1 
ATOM   883  C  CE1   . HIS C 3 62  ? 70.565 15.183  1.882   1.00 16.01 ? 62   HIS A CE1   1 
ATOM   884  N  NE2   . HIS C 3 62  ? 69.375 15.192  1.310   1.00 17.24 ? 62   HIS A NE2   1 
ATOM   885  N  N     . LYS C 3 63  ? 71.541 21.650  1.080   1.00 16.20 ? 63   LYS A N     1 
ATOM   886  C  CA    . LYS C 3 63  ? 71.509 22.964  0.452   1.00 18.47 ? 63   LYS A CA    1 
ATOM   887  C  C     . LYS C 3 63  ? 72.881 23.583  0.299   1.00 18.08 ? 63   LYS A C     1 
ATOM   888  O  O     . LYS C 3 63  ? 73.094 24.370  -0.616  1.00 18.47 ? 63   LYS A O     1 
ATOM   889  C  CB    . LYS C 3 63  ? 70.585 23.915  1.220   1.00 19.66 ? 63   LYS A CB    1 
ATOM   890  C  CG    . LYS C 3 63  ? 69.124 23.472  1.155   1.00 23.04 ? 63   LYS A CG    1 
ATOM   891  C  CD    . LYS C 3 63  ? 68.193 24.274  2.057   1.00 25.76 ? 63   LYS A CD    1 
ATOM   892  C  CE    . LYS C 3 63  ? 68.046 25.718  1.611   1.00 29.73 ? 63   LYS A CE    1 
ATOM   893  N  NZ    . LYS C 3 63  ? 66.798 26.315  2.172   1.00 27.18 ? 63   LYS A NZ    1 
ATOM   894  N  N     . TYR C 3 64  ? 73.827 23.210  1.159   1.00 17.96 ? 64   TYR A N     1 
ATOM   895  C  CA    . TYR C 3 64  ? 75.150 23.802  1.058   1.00 20.35 ? 64   TYR A CA    1 
ATOM   896  C  C     . TYR C 3 64  ? 76.346 22.901  0.750   1.00 21.39 ? 64   TYR A C     1 
ATOM   897  O  O     . TYR C 3 64  ? 76.822 22.882  -0.385  1.00 21.71 ? 64   TYR A O     1 
ATOM   898  C  CB    . TYR C 3 64  ? 75.465 24.623  2.315   1.00 21.51 ? 64   TYR A CB    1 
ATOM   899  C  CG    . TYR C 3 64  ? 76.742 25.418  2.163   1.00 22.56 ? 64   TYR A CG    1 
ATOM   900  C  CD1   . TYR C 3 64  ? 76.810 26.487  1.278   1.00 22.41 ? 64   TYR A CD1   1 
ATOM   901  C  CD2   . TYR C 3 64  ? 77.899 25.068  2.861   1.00 24.54 ? 64   TYR A CD2   1 
ATOM   902  C  CE1   . TYR C 3 64  ? 77.998 27.192  1.081   1.00 22.71 ? 64   TYR A CE1   1 
ATOM   903  C  CE2   . TYR C 3 64  ? 79.098 25.769  2.673   1.00 25.02 ? 64   TYR A CE2   1 
ATOM   904  C  CZ    . TYR C 3 64  ? 79.137 26.829  1.778   1.00 23.29 ? 64   TYR A CZ    1 
ATOM   905  O  OH    . TYR C 3 64  ? 80.312 27.515  1.561   1.00 23.46 ? 64   TYR A OH    1 
ATOM   906  N  N     . ASP C 3 65  ? 76.835 22.169  1.750   1.00 20.58 ? 65   ASP A N     1 
ATOM   907  C  CA    . ASP C 3 65  ? 78.014 21.325  1.563   1.00 23.31 ? 65   ASP A CA    1 
ATOM   908  C  C     . ASP C 3 65  ? 78.059 20.489  0.281   1.00 23.52 ? 65   ASP A C     1 
ATOM   909  O  O     . ASP C 3 65  ? 79.059 20.521  -0.444  1.00 22.90 ? 65   ASP A O     1 
ATOM   910  C  CB    . ASP C 3 65  ? 78.217 20.404  2.775   1.00 23.81 ? 65   ASP A CB    1 
ATOM   911  C  CG    . ASP C 3 65  ? 78.230 21.159  4.084   1.00 23.80 ? 65   ASP A CG    1 
ATOM   912  O  OD1   . ASP C 3 65  ? 77.159 21.678  4.474   1.00 25.39 ? 65   ASP A OD1   1 
ATOM   913  O  OD2   . ASP C 3 65  ? 79.304 21.241  4.721   1.00 25.36 ? 65   ASP A OD2   1 
ATOM   914  N  N     . VAL C 3 66  ? 76.991 19.743  -0.002  1.00 22.21 ? 66   VAL A N     1 
ATOM   915  C  CA    . VAL C 3 66  ? 76.972 18.903  -1.195  1.00 21.45 ? 66   VAL A CA    1 
ATOM   916  C  C     . VAL C 3 66  ? 77.080 19.719  -2.492  1.00 21.21 ? 66   VAL A C     1 
ATOM   917  O  O     . VAL C 3 66  ? 77.951 19.460  -3.316  1.00 22.01 ? 66   VAL A O     1 
ATOM   918  C  CB    . VAL C 3 66  ? 75.717 18.004  -1.218  1.00 22.27 ? 66   VAL A CB    1 
ATOM   919  C  CG1   . VAL C 3 66  ? 75.736 17.109  -2.457  1.00 21.53 ? 66   VAL A CG1   1 
ATOM   920  C  CG2   . VAL C 3 66  ? 75.682 17.142  0.043   1.00 22.55 ? 66   VAL A CG2   1 
ATOM   921  N  N     . PRO C 3 67  ? 76.189 20.707  -2.695  1.00 22.08 ? 67   PRO A N     1 
ATOM   922  C  CA    . PRO C 3 67  ? 76.256 21.530  -3.915  1.00 21.97 ? 67   PRO A CA    1 
ATOM   923  C  C     . PRO C 3 67  ? 77.605 22.272  -3.956  1.00 22.54 ? 67   PRO A C     1 
ATOM   924  O  O     . PRO C 3 67  ? 78.276 22.336  -4.990  1.00 23.04 ? 67   PRO A O     1 
ATOM   925  C  CB    . PRO C 3 67  ? 75.099 22.523  -3.739  1.00 22.52 ? 67   PRO A CB    1 
ATOM   926  C  CG    . PRO C 3 67  ? 74.152 21.817  -2.808  1.00 22.90 ? 67   PRO A CG    1 
ATOM   927  C  CD    . PRO C 3 67  ? 75.058 21.111  -1.837  1.00 19.79 ? 67   PRO A CD    1 
ATOM   928  N  N     . ALA C 3 68  ? 77.994 22.834  -2.818  1.00 19.24 ? 68   ALA A N     1 
ATOM   929  C  CA    . ALA C 3 68  ? 79.256 23.571  -2.737  1.00 21.51 ? 68   ALA A CA    1 
ATOM   930  C  C     . ALA C 3 68  ? 80.449 22.727  -3.187  1.00 20.88 ? 68   ALA A C     1 
ATOM   931  O  O     . ALA C 3 68  ? 81.299 23.197  -3.936  1.00 21.03 ? 68   ALA A O     1 
ATOM   932  C  CB    . ALA C 3 68  ? 79.484 24.086  -1.308  1.00 19.12 ? 68   ALA A CB    1 
ATOM   933  N  N     . LEU C 3 69  ? 80.506 21.476  -2.739  1.00 23.75 ? 69   LEU A N     1 
ATOM   934  C  CA    . LEU C 3 69  ? 81.615 20.606  -3.112  1.00 23.90 ? 69   LEU A CA    1 
ATOM   935  C  C     . LEU C 3 69  ? 81.648 20.298  -4.614  1.00 24.90 ? 69   LEU A C     1 
ATOM   936  O  O     . LEU C 3 69  ? 82.726 20.207  -5.209  1.00 26.34 ? 69   LEU A O     1 
ATOM   937  C  CB    . LEU C 3 69  ? 81.567 19.316  -2.292  1.00 23.47 ? 69   LEU A CB    1 
ATOM   938  C  CG    . LEU C 3 69  ? 81.834 19.499  -0.797  1.00 23.72 ? 69   LEU A CG    1 
ATOM   939  C  CD1   . LEU C 3 69  ? 81.547 18.189  -0.068  1.00 20.23 ? 69   LEU A CD1   1 
ATOM   940  C  CD2   . LEU C 3 69  ? 83.281 19.952  -0.573  1.00 22.58 ? 69   LEU A CD2   1 
ATOM   941  N  N     . THR C 3 70  ? 80.482 20.132  -5.232  1.00 24.80 ? 70   THR A N     1 
ATOM   942  C  CA    . THR C 3 70  ? 80.446 19.874  -6.671  1.00 25.24 ? 70   THR A CA    1 
ATOM   943  C  C     . THR C 3 70  ? 81.067 21.099  -7.344  1.00 25.16 ? 70   THR A C     1 
ATOM   944  O  O     . THR C 3 70  ? 81.950 20.986  -8.199  1.00 27.19 ? 70   THR A O     1 
ATOM   945  C  CB    . THR C 3 70  ? 78.992 19.700  -7.190  1.00 26.59 ? 70   THR A CB    1 
ATOM   946  O  OG1   . THR C 3 70  ? 78.466 18.452  -6.731  1.00 26.98 ? 70   THR A OG1   1 
ATOM   947  C  CG2   . THR C 3 70  ? 78.947 19.733  -8.716  1.00 25.46 ? 70   THR A CG2   1 
ATOM   948  N  N     . LYS C 3 71  ? 80.598 22.272  -6.933  1.00 23.13 ? 71   LYS A N     1 
ATOM   949  C  CA    . LYS C 3 71  ? 81.080 23.531  -7.473  1.00 23.78 ? 71   LYS A CA    1 
ATOM   950  C  C     . LYS C 3 71  ? 82.581 23.740  -7.247  1.00 22.14 ? 71   LYS A C     1 
ATOM   951  O  O     . LYS C 3 71  ? 83.319 24.060  -8.176  1.00 21.30 ? 71   LYS A O     1 
ATOM   952  C  CB    . LYS C 3 71  ? 80.284 24.694  -6.859  1.00 24.17 ? 71   LYS A CB    1 
ATOM   953  C  CG    . LYS C 3 71  ? 80.818 26.081  -7.195  1.00 26.85 ? 71   LYS A CG    1 
ATOM   954  C  CD    . LYS C 3 71  ? 79.769 27.153  -6.893  1.00 28.24 ? 71   LYS A CD    1 
ATOM   955  C  CE    . LYS C 3 71  ? 80.240 28.529  -7.321  1.00 28.11 ? 71   LYS A CE    1 
ATOM   956  N  NZ    . LYS C 3 71  ? 79.205 29.582  -7.070  1.00 30.22 ? 71   LYS A NZ    1 
ATOM   957  N  N     . LEU C 3 72  ? 83.034 23.560  -6.015  1.00 20.94 ? 72   LEU A N     1 
ATOM   958  C  CA    . LEU C 3 72  ? 84.449 23.754  -5.721  1.00 21.27 ? 72   LEU A CA    1 
ATOM   959  C  C     . LEU C 3 72  ? 85.370 22.737  -6.394  1.00 21.94 ? 72   LEU A C     1 
ATOM   960  O  O     . LEU C 3 72  ? 86.503 23.079  -6.755  1.00 21.71 ? 72   LEU A O     1 
ATOM   961  C  CB    . LEU C 3 72  ? 84.681 23.753  -4.204  1.00 21.60 ? 72   LEU A CB    1 
ATOM   962  C  CG    . LEU C 3 72  ? 84.041 24.967  -3.520  1.00 22.10 ? 72   LEU A CG    1 
ATOM   963  C  CD1   . LEU C 3 72  ? 83.957 24.749  -2.027  1.00 20.17 ? 72   LEU A CD1   1 
ATOM   964  C  CD2   . LEU C 3 72  ? 84.844 26.223  -3.861  1.00 20.31 ? 72   LEU A CD2   1 
ATOM   965  N  N     . ALA C 3 73  ? 84.899 21.501  -6.576  1.00 21.45 ? 73   ALA A N     1 
ATOM   966  C  CA    . ALA C 3 73  ? 85.740 20.482  -7.217  1.00 23.24 ? 73   ALA A CA    1 
ATOM   967  C  C     . ALA C 3 73  ? 86.024 20.875  -8.662  1.00 23.60 ? 73   ALA A C     1 
ATOM   968  O  O     . ALA C 3 73  ? 87.142 20.727  -9.155  1.00 23.58 ? 73   ALA A O     1 
ATOM   969  C  CB    . ALA C 3 73  ? 85.071 19.112  -7.169  1.00 21.06 ? 73   ALA A CB    1 
ATOM   970  N  N     . LYS C 3 74  ? 85.008 21.392  -9.339  1.00 25.78 ? 74   LYS A N     1 
ATOM   971  C  CA    . LYS C 3 74  ? 85.180 21.805  -10.721 1.00 26.71 ? 74   LYS A CA    1 
ATOM   972  C  C     . LYS C 3 74  ? 86.125 23.004  -10.817 1.00 27.83 ? 74   LYS A C     1 
ATOM   973  O  O     . LYS C 3 74  ? 87.087 22.981  -11.584 1.00 28.34 ? 74   LYS A O     1 
ATOM   974  C  CB    . LYS C 3 74  ? 83.826 22.158  -11.340 1.00 27.71 ? 74   LYS A CB    1 
ATOM   975  C  CG    . LYS C 3 74  ? 83.907 22.600  -12.789 1.00 29.73 ? 74   LYS A CG    1 
ATOM   976  C  CD    . LYS C 3 74  ? 84.315 21.441  -13.686 1.00 34.34 ? 74   LYS A CD    1 
ATOM   977  C  CE    . LYS C 3 74  ? 84.272 21.836  -15.148 1.00 36.43 ? 74   LYS A CE    1 
ATOM   978  N  NZ    . LYS C 3 74  ? 84.149 20.631  -16.027 1.00 40.46 ? 74   LYS A NZ    1 
ATOM   979  N  N     . LEU C 3 75  ? 85.855 24.042  -10.030 1.00 28.10 ? 75   LEU A N     1 
ATOM   980  C  CA    . LEU C 3 75  ? 86.673 25.254  -10.042 1.00 29.50 ? 75   LEU A CA    1 
ATOM   981  C  C     . LEU C 3 75  ? 88.131 25.065  -9.591  1.00 30.68 ? 75   LEU A C     1 
ATOM   982  O  O     . LEU C 3 75  ? 89.056 25.511  -10.266 1.00 29.50 ? 75   LEU A O     1 
ATOM   983  C  CB    . LEU C 3 75  ? 86.034 26.332  -9.157  1.00 29.34 ? 75   LEU A CB    1 
ATOM   984  C  CG    . LEU C 3 75  ? 84.755 27.029  -9.628  1.00 33.48 ? 75   LEU A CG    1 
ATOM   985  C  CD1   . LEU C 3 75  ? 84.136 27.798  -8.463  1.00 35.16 ? 75   LEU A CD1   1 
ATOM   986  C  CD2   . LEU C 3 75  ? 85.072 27.980  -10.782 1.00 33.91 ? 75   LEU A CD2   1 
ATOM   987  N  N     . GLN C 3 76  ? 88.330 24.407  -8.452  1.00 31.01 ? 76   GLN A N     1 
ATOM   988  C  CA    . GLN C 3 76  ? 89.667 24.220  -7.905  1.00 30.37 ? 76   GLN A CA    1 
ATOM   989  C  C     . GLN C 3 76  ? 90.503 23.067  -8.431  1.00 30.22 ? 76   GLN A C     1 
ATOM   990  O  O     . GLN C 3 76  ? 91.721 23.184  -8.541  1.00 30.21 ? 76   GLN A O     1 
ATOM   991  C  CB    . GLN C 3 76  ? 89.593 24.114  -6.376  1.00 28.62 ? 76   GLN A CB    1 
ATOM   992  C  CG    . GLN C 3 76  ? 89.405 25.453  -5.680  1.00 31.31 ? 76   GLN A CG    1 
ATOM   993  C  CD    . GLN C 3 76  ? 89.314 25.330  -4.169  1.00 31.60 ? 76   GLN A CD    1 
ATOM   994  O  OE1   . GLN C 3 76  ? 88.271 24.971  -3.622  1.00 30.66 ? 76   GLN A OE1   1 
ATOM   995  N  NE2   . GLN C 3 76  ? 90.415 25.618  -3.487  1.00 33.73 ? 76   GLN A NE2   1 
ATOM   996  N  N     . LEU C 3 77  ? 89.862 21.951  -8.746  1.00 30.94 ? 77   LEU A N     1 
ATOM   997  C  CA    . LEU C 3 77  ? 90.595 20.781  -9.210  1.00 29.86 ? 77   LEU A CA    1 
ATOM   998  C  C     . LEU C 3 77  ? 90.201 20.331  -10.603 1.00 28.74 ? 77   LEU A C     1 
ATOM   999  O  O     . LEU C 3 77  ? 90.754 19.371  -11.127 1.00 29.49 ? 77   LEU A O     1 
ATOM   1000 C  CB    . LEU C 3 77  ? 90.370 19.636  -8.228  1.00 29.67 ? 77   LEU A CB    1 
ATOM   1001 C  CG    . LEU C 3 77  ? 90.745 19.940  -6.780  1.00 29.40 ? 77   LEU A CG    1 
ATOM   1002 C  CD1   . LEU C 3 77  ? 90.195 18.854  -5.864  1.00 28.79 ? 77   LEU A CD1   1 
ATOM   1003 C  CD2   . LEU C 3 77  ? 92.270 20.040  -6.659  1.00 29.70 ? 77   LEU A CD2   1 
ATOM   1004 N  N     . ASN C 3 78  ? 89.256 21.035  -11.207 1.00 30.45 ? 78   ASN A N     1 
ATOM   1005 C  CA    . ASN C 3 78  ? 88.769 20.658  -12.522 1.00 32.94 ? 78   ASN A CA    1 
ATOM   1006 C  C     . ASN C 3 78  ? 88.317 19.195  -12.426 1.00 32.42 ? 78   ASN A C     1 
ATOM   1007 O  O     . ASN C 3 78  ? 88.585 18.382  -13.309 1.00 33.47 ? 78   ASN A O     1 
ATOM   1008 C  CB    . ASN C 3 78  ? 89.875 20.833  -13.572 1.00 34.90 ? 78   ASN A CB    1 
ATOM   1009 C  CG    . ASN C 3 78  ? 89.377 20.597  -14.983 1.00 37.52 ? 78   ASN A CG    1 
ATOM   1010 O  OD1   . ASN C 3 78  ? 88.213 20.857  -15.292 1.00 40.47 ? 78   ASN A OD1   1 
ATOM   1011 N  ND2   . ASN C 3 78  ? 90.258 20.115  -15.853 1.00 38.47 ? 78   ASN A ND2   1 
ATOM   1012 N  N     . ARG C 3 79  ? 87.633 18.875  -11.327 1.00 32.18 ? 79   ARG A N     1 
ATOM   1013 C  CA    . ARG C 3 79  ? 87.136 17.527  -11.083 1.00 31.33 ? 79   ARG A CA    1 
ATOM   1014 C  C     . ARG C 3 79  ? 85.601 17.466  -11.060 1.00 31.64 ? 79   ARG A C     1 
ATOM   1015 O  O     . ARG C 3 79  ? 84.937 18.407  -10.611 1.00 29.78 ? 79   ARG A O     1 
ATOM   1016 C  CB    . ARG C 3 79  ? 87.656 16.995  -9.738  1.00 30.53 ? 79   ARG A CB    1 
ATOM   1017 C  CG    . ARG C 3 79  ? 87.320 15.521  -9.532  1.00 29.40 ? 79   ARG A CG    1 
ATOM   1018 C  CD    . ARG C 3 79  ? 87.175 15.083  -8.082  1.00 27.54 ? 79   ARG A CD    1 
ATOM   1019 N  NE    . ARG C 3 79  ? 88.442 14.929  -7.385  1.00 27.74 ? 79   ARG A NE    1 
ATOM   1020 C  CZ    . ARG C 3 79  ? 88.707 13.972  -6.495  1.00 25.69 ? 79   ARG A CZ    1 
ATOM   1021 N  NH1   . ARG C 3 79  ? 87.795 13.053  -6.180  1.00 21.66 ? 79   ARG A NH1   1 
ATOM   1022 N  NH2   . ARG C 3 79  ? 89.891 13.945  -5.904  1.00 24.60 ? 79   ARG A NH2   1 
ATOM   1023 N  N     . GLU C 3 80  ? 85.047 16.354  -11.545 1.00 31.53 ? 80   GLU A N     1 
ATOM   1024 C  CA    . GLU C 3 80  ? 83.599 16.144  -11.534 1.00 32.12 ? 80   GLU A CA    1 
ATOM   1025 C  C     . GLU C 3 80  ? 83.282 15.381  -10.248 1.00 30.58 ? 80   GLU A C     1 
ATOM   1026 O  O     . GLU C 3 80  ? 83.696 14.230  -10.080 1.00 31.76 ? 80   GLU A O     1 
ATOM   1027 C  CB    . GLU C 3 80  ? 83.149 15.318  -12.739 1.00 32.99 ? 80   GLU A CB    1 
ATOM   1028 C  CG    . GLU C 3 80  ? 83.154 16.064  -14.069 1.00 38.99 ? 80   GLU A CG    1 
ATOM   1029 C  CD    . GLU C 3 80  ? 82.172 17.231  -14.112 1.00 41.56 ? 80   GLU A CD    1 
ATOM   1030 O  OE1   . GLU C 3 80  ? 81.008 17.057  -13.692 1.00 43.44 ? 80   GLU A OE1   1 
ATOM   1031 O  OE2   . GLU C 3 80  ? 82.561 18.323  -14.579 1.00 44.85 ? 80   GLU A OE2   1 
ATOM   1032 N  N     . PHE C 3 81  ? 82.555 16.035  -9.347  1.00 27.57 ? 81   PHE A N     1 
ATOM   1033 C  CA    . PHE C 3 81  ? 82.188 15.456  -8.060  1.00 27.24 ? 81   PHE A CA    1 
ATOM   1034 C  C     . PHE C 3 81  ? 80.690 15.641  -7.845  1.00 28.13 ? 81   PHE A C     1 
ATOM   1035 O  O     . PHE C 3 81  ? 80.191 16.771  -7.827  1.00 28.69 ? 81   PHE A O     1 
ATOM   1036 C  CB    . PHE C 3 81  ? 82.960 16.161  -6.942  1.00 27.65 ? 81   PHE A CB    1 
ATOM   1037 C  CG    . PHE C 3 81  ? 82.674 15.628  -5.570  1.00 27.93 ? 81   PHE A CG    1 
ATOM   1038 C  CD1   . PHE C 3 81  ? 83.335 14.497  -5.093  1.00 27.00 ? 81   PHE A CD1   1 
ATOM   1039 C  CD2   . PHE C 3 81  ? 81.749 16.262  -4.745  1.00 27.93 ? 81   PHE A CD2   1 
ATOM   1040 C  CE1   . PHE C 3 81  ? 83.078 14.009  -3.809  1.00 26.61 ? 81   PHE A CE1   1 
ATOM   1041 C  CE2   . PHE C 3 81  ? 81.486 15.777  -3.456  1.00 25.18 ? 81   PHE A CE2   1 
ATOM   1042 C  CZ    . PHE C 3 81  ? 82.152 14.654  -2.991  1.00 25.39 ? 81   PHE A CZ    1 
ATOM   1043 N  N     . HIS C 3 82  ? 79.977 14.529  -7.687  1.00 28.35 ? 82   HIS A N     1 
ATOM   1044 C  CA    . HIS C 3 82  ? 78.529 14.564  -7.495  1.00 28.58 ? 82   HIS A CA    1 
ATOM   1045 C  C     . HIS C 3 82  ? 78.087 13.468  -6.527  1.00 27.22 ? 82   HIS A C     1 
ATOM   1046 O  O     . HIS C 3 82  ? 77.919 12.310  -6.925  1.00 27.43 ? 82   HIS A O     1 
ATOM   1047 C  CB    . HIS C 3 82  ? 77.823 14.354  -8.839  1.00 28.80 ? 82   HIS A CB    1 
ATOM   1048 C  CG    . HIS C 3 82  ? 78.297 15.273  -9.920  1.00 29.96 ? 82   HIS A CG    1 
ATOM   1049 N  ND1   . HIS C 3 82  ? 77.738 16.515  -10.141 1.00 29.68 ? 82   HIS A ND1   1 
ATOM   1050 C  CD2   . HIS C 3 82  ? 79.299 15.145  -10.821 1.00 27.77 ? 82   HIS A CD2   1 
ATOM   1051 C  CE1   . HIS C 3 82  ? 78.377 17.112  -11.131 1.00 28.78 ? 82   HIS A CE1   1 
ATOM   1052 N  NE2   . HIS C 3 82  ? 79.329 16.302  -11.561 1.00 30.61 ? 82   HIS A NE2   1 
ATOM   1053 N  N     . LEU C 3 83  ? 77.905 13.826  -5.262  1.00 26.66 ? 83   LEU A N     1 
ATOM   1054 C  CA    . LEU C 3 83  ? 77.469 12.852  -4.271  1.00 25.45 ? 83   LEU A CA    1 
ATOM   1055 C  C     . LEU C 3 83  ? 76.047 12.415  -4.576  1.00 23.38 ? 83   LEU A C     1 
ATOM   1056 O  O     . LEU C 3 83  ? 75.171 13.239  -4.760  1.00 22.43 ? 83   LEU A O     1 
ATOM   1057 C  CB    . LEU C 3 83  ? 77.524 13.444  -2.862  1.00 25.41 ? 83   LEU A CB    1 
ATOM   1058 C  CG    . LEU C 3 83  ? 78.920 13.656  -2.289  1.00 26.55 ? 83   LEU A CG    1 
ATOM   1059 C  CD1   . LEU C 3 83  ? 78.800 14.143  -0.849  1.00 25.50 ? 83   LEU A CD1   1 
ATOM   1060 C  CD2   . LEU C 3 83  ? 79.704 12.341  -2.354  1.00 27.64 ? 83   LEU A CD2   1 
ATOM   1061 N  N     . PRO C 3 84  ? 75.801 11.103  -4.628  1.00 23.57 ? 84   PRO A N     1 
ATOM   1062 C  CA    . PRO C 3 84  ? 74.437 10.655  -4.919  1.00 22.73 ? 84   PRO A CA    1 
ATOM   1063 C  C     . PRO C 3 84  ? 73.472 11.019  -3.783  1.00 22.96 ? 84   PRO A C     1 
ATOM   1064 O  O     . PRO C 3 84  ? 73.824 10.947  -2.610  1.00 22.99 ? 84   PRO A O     1 
ATOM   1065 C  CB    . PRO C 3 84  ? 74.588 9.138   -5.087  1.00 23.58 ? 84   PRO A CB    1 
ATOM   1066 C  CG    . PRO C 3 84  ? 76.057 8.948   -5.430  1.00 24.36 ? 84   PRO A CG    1 
ATOM   1067 C  CD    . PRO C 3 84  ? 76.733 9.966   -4.531  1.00 21.81 ? 84   PRO A CD    1 
ATOM   1068 N  N     . ARG C 3 85  ? 72.261 11.423  -4.148  1.00 23.00 ? 85   ARG A N     1 
ATOM   1069 C  CA    . ARG C 3 85  ? 71.228 11.782  -3.178  1.00 23.33 ? 85   ARG A CA    1 
ATOM   1070 C  C     . ARG C 3 85  ? 71.011 10.666  -2.152  1.00 22.81 ? 85   ARG A C     1 
ATOM   1071 O  O     . ARG C 3 85  ? 70.867 10.933  -0.955  1.00 20.43 ? 85   ARG A O     1 
ATOM   1072 C  CB    . ARG C 3 85  ? 69.908 12.064  -3.914  1.00 23.92 ? 85   ARG A CB    1 
ATOM   1073 C  CG    . ARG C 3 85  ? 68.717 12.430  -3.026  1.00 27.00 ? 85   ARG A CG    1 
ATOM   1074 C  CD    . ARG C 3 85  ? 67.555 11.483  -3.274  1.00 31.70 ? 85   ARG A CD    1 
ATOM   1075 N  NE    . ARG C 3 85  ? 67.555 10.375  -2.324  1.00 34.23 ? 85   ARG A NE    1 
ATOM   1076 C  CZ    . ARG C 3 85  ? 67.183 9.133   -2.615  1.00 34.83 ? 85   ARG A CZ    1 
ATOM   1077 N  NH1   . ARG C 3 85  ? 66.784 8.823   -3.839  1.00 35.34 ? 85   ARG A NH1   1 
ATOM   1078 N  NH2   . ARG C 3 85  ? 67.192 8.202   -1.669  1.00 34.53 ? 85   ARG A NH2   1 
ATOM   1079 N  N     . GLU C 3 86  ? 71.009 9.415   -2.613  1.00 23.53 ? 86   GLU A N     1 
ATOM   1080 C  CA    . GLU C 3 86  ? 70.775 8.285   -1.711  1.00 23.80 ? 86   GLU A CA    1 
ATOM   1081 C  C     . GLU C 3 86  ? 71.863 8.012   -0.675  1.00 23.36 ? 86   GLU A C     1 
ATOM   1082 O  O     . GLU C 3 86  ? 71.630 7.265   0.268   1.00 25.20 ? 86   GLU A O     1 
ATOM   1083 C  CB    . GLU C 3 86  ? 70.487 6.998   -2.505  1.00 25.03 ? 86   GLU A CB    1 
ATOM   1084 C  CG    . GLU C 3 86  ? 71.613 6.524   -3.406  1.00 27.24 ? 86   GLU A CG    1 
ATOM   1085 C  CD    . GLU C 3 86  ? 71.466 7.019   -4.832  1.00 31.58 ? 86   GLU A CD    1 
ATOM   1086 O  OE1   . GLU C 3 86  ? 71.037 8.185   -5.024  1.00 31.20 ? 86   GLU A OE1   1 
ATOM   1087 O  OE2   . GLU C 3 86  ? 71.789 6.243   -5.761  1.00 33.91 ? 86   GLU A OE2   1 
ATOM   1088 N  N     . ASN C 3 87  ? 73.043 8.606   -0.832  1.00 22.93 ? 87   ASN A N     1 
ATOM   1089 C  CA    . ASN C 3 87  ? 74.121 8.394   0.137   1.00 21.51 ? 87   ASN A CA    1 
ATOM   1090 C  C     . ASN C 3 87  ? 74.223 9.513   1.176   1.00 19.71 ? 87   ASN A C     1 
ATOM   1091 O  O     . ASN C 3 87  ? 75.071 9.449   2.076   1.00 18.20 ? 87   ASN A O     1 
ATOM   1092 C  CB    . ASN C 3 87  ? 75.490 8.296   -0.561  1.00 22.49 ? 87   ASN A CB    1 
ATOM   1093 C  CG    . ASN C 3 87  ? 75.580 7.138   -1.529  1.00 23.86 ? 87   ASN A CG    1 
ATOM   1094 O  OD1   . ASN C 3 87  ? 75.323 7.290   -2.722  1.00 27.24 ? 87   ASN A OD1   1 
ATOM   1095 N  ND2   . ASN C 3 87  ? 75.939 5.968   -1.016  1.00 25.44 ? 87   ASN A ND2   1 
ATOM   1096 N  N     . CYS C 3 88  ? 73.363 10.522  1.067   1.00 18.29 ? 88   CYS A N     1 
ATOM   1097 C  CA    . CYS C 3 88  ? 73.443 11.663  1.975   1.00 17.40 ? 88   CYS A CA    1 
ATOM   1098 C  C     . CYS C 3 88  ? 72.355 11.821  3.027   1.00 17.02 ? 88   CYS A C     1 
ATOM   1099 O  O     . CYS C 3 88  ? 71.162 11.711  2.742   1.00 15.45 ? 88   CYS A O     1 
ATOM   1100 C  CB    . CYS C 3 88  ? 73.521 12.957  1.154   1.00 15.98 ? 88   CYS A CB    1 
ATOM   1101 S  SG    . CYS C 3 88  ? 74.888 13.014  -0.046  1.00 21.68 ? 88   CYS A SG    1 
ATOM   1102 N  N     . ILE C 3 89  ? 72.788 12.094  4.252   1.00 18.63 ? 89   ILE A N     1 
ATOM   1103 C  CA    . ILE C 3 89  ? 71.866 12.326  5.359   1.00 18.87 ? 89   ILE A CA    1 
ATOM   1104 C  C     . ILE C 3 89  ? 72.072 13.781  5.775   1.00 18.85 ? 89   ILE A C     1 
ATOM   1105 O  O     . ILE C 3 89  ? 73.189 14.299  5.684   1.00 17.75 ? 89   ILE A O     1 
ATOM   1106 C  CB    . ILE C 3 89  ? 72.164 11.419  6.579   1.00 19.49 ? 89   ILE A CB    1 
ATOM   1107 C  CG1   . ILE C 3 89  ? 71.895 9.945   6.228   1.00 19.69 ? 89   ILE A CG1   1 
ATOM   1108 C  CG2   . ILE C 3 89  ? 71.291 11.843  7.769   1.00 16.97 ? 89   ILE A CG2   1 
ATOM   1109 N  N     . ASP C 3 90  ? 71.002 14.434  6.221   1.00 19.12 ? 90   ASP A N     1 
ATOM   1110 C  CA    . ASP C 3 90  ? 71.082 15.828  6.651   1.00 20.28 ? 90   ASP A CA    1 
ATOM   1111 C  C     . ASP C 3 90  ? 70.397 15.972  8.015   1.00 21.47 ? 90   ASP A C     1 
ATOM   1112 O  O     . ASP C 3 90  ? 69.182 15.820  8.130   1.00 19.92 ? 90   ASP A O     1 
ATOM   1113 C  CB    . ASP C 3 90  ? 70.403 16.743  5.613   1.00 21.67 ? 90   ASP A CB    1 
ATOM   1114 C  CG    . ASP C 3 90  ? 70.626 18.231  5.895   1.00 24.05 ? 90   ASP A CG    1 
ATOM   1115 O  OD1   . ASP C 3 90  ? 70.531 18.644  7.068   1.00 27.09 ? 90   ASP A OD1   1 
ATOM   1116 O  OD2   . ASP C 3 90  ? 70.887 18.993  4.941   1.00 24.85 ? 90   ASP A OD2   1 
ATOM   1117 N  N     . THR C 3 91  ? 71.176 16.266  9.050   1.00 20.64 ? 91   THR A N     1 
ATOM   1118 C  CA    . THR C 3 91  ? 70.605 16.411  10.375  1.00 20.58 ? 91   THR A CA    1 
ATOM   1119 C  C     . THR C 3 91  ? 69.654 17.600  10.533  1.00 21.62 ? 91   THR A C     1 
ATOM   1120 O  O     . THR C 3 91  ? 68.855 17.615  11.458  1.00 20.78 ? 91   THR A O     1 
ATOM   1121 C  CB    . THR C 3 91  ? 71.701 16.482  11.459  1.00 21.06 ? 91   THR A CB    1 
ATOM   1122 O  OG1   . THR C 3 91  ? 72.763 17.340  11.028  1.00 18.83 ? 91   THR A OG1   1 
ATOM   1123 C  CG2   . THR C 3 91  ? 72.247 15.063  11.753  1.00 20.52 ? 91   THR A CG2   1 
ATOM   1124 N  N     . LEU C 3 92  ? 69.730 18.594  9.651   1.00 20.78 ? 92   LEU A N     1 
ATOM   1125 C  CA    . LEU C 3 92  ? 68.815 19.733  9.754   1.00 22.57 ? 92   LEU A CA    1 
ATOM   1126 C  C     . LEU C 3 92  ? 67.469 19.249  9.222   1.00 22.40 ? 92   LEU A C     1 
ATOM   1127 O  O     . LEU C 3 92  ? 66.419 19.506  9.812   1.00 24.48 ? 92   LEU A O     1 
ATOM   1128 C  CB    . LEU C 3 92  ? 69.322 20.935  8.934   1.00 23.51 ? 92   LEU A CB    1 
ATOM   1129 C  CG    . LEU C 3 92  ? 68.418 22.182  8.885   1.00 24.78 ? 92   LEU A CG    1 
ATOM   1130 C  CD1   . LEU C 3 92  ? 68.087 22.664  10.295  1.00 25.04 ? 92   LEU A CD1   1 
ATOM   1131 C  CD2   . LEU C 3 92  ? 69.126 23.301  8.109   1.00 27.38 ? 92   LEU A CD2   1 
ATOM   1132 N  N     . VAL C 3 93  ? 67.519 18.542  8.097   1.00 23.55 ? 93   VAL A N     1 
ATOM   1133 C  CA    . VAL C 3 93  ? 66.332 17.960  7.483   1.00 22.56 ? 93   VAL A CA    1 
ATOM   1134 C  C     . VAL C 3 93  ? 65.698 17.002  8.501   1.00 23.14 ? 93   VAL A C     1 
ATOM   1135 O  O     . VAL C 3 93  ? 64.474 16.944  8.644   1.00 23.38 ? 93   VAL A O     1 
ATOM   1136 C  CB    . VAL C 3 93  ? 66.712 17.163  6.210   1.00 24.26 ? 93   VAL A CB    1 
ATOM   1137 C  CG1   . VAL C 3 93  ? 65.526 16.327  5.724   1.00 23.04 ? 93   VAL A CG1   1 
ATOM   1138 C  CG2   . VAL C 3 93  ? 67.171 18.120  5.124   1.00 24.44 ? 93   VAL A CG2   1 
ATOM   1139 N  N     . LEU C 3 94  ? 66.537 16.264  9.221   1.00 22.25 ? 94   LEU A N     1 
ATOM   1140 C  CA    . LEU C 3 94  ? 66.040 15.318  10.218  1.00 23.00 ? 94   LEU A CA    1 
ATOM   1141 C  C     . LEU C 3 94  ? 65.363 16.020  11.392  1.00 22.91 ? 94   LEU A C     1 
ATOM   1142 O  O     . LEU C 3 94  ? 64.271 15.633  11.806  1.00 22.43 ? 94   LEU A O     1 
ATOM   1143 C  CB    . LEU C 3 94  ? 67.180 14.446  10.734  1.00 24.86 ? 94   LEU A CB    1 
ATOM   1144 C  CG    . LEU C 3 94  ? 67.034 12.950  10.452  1.00 28.54 ? 94   LEU A CG    1 
ATOM   1145 C  CD1   . LEU C 3 94  ? 68.289 12.203  10.886  1.00 27.75 ? 94   LEU A CD1   1 
ATOM   1146 C  CD2   . LEU C 3 94  ? 65.808 12.428  11.180  1.00 29.94 ? 94   LEU A CD2   1 
ATOM   1147 N  N     . SER C 3 95  ? 66.018 17.048  11.924  1.00 21.11 ? 95   SER A N     1 
ATOM   1148 C  CA    . SER C 3 95  ? 65.483 17.810  13.048  1.00 21.68 ? 95   SER A CA    1 
ATOM   1149 C  C     . SER C 3 95  ? 64.172 18.476  12.698  1.00 20.41 ? 95   SER A C     1 
ATOM   1150 O  O     . SER C 3 95  ? 63.260 18.538  13.519  1.00 17.21 ? 95   SER A O     1 
ATOM   1151 C  CB    . SER C 3 95  ? 66.470 18.901  13.484  1.00 23.57 ? 95   SER A CB    1 
ATOM   1152 O  OG    . SER C 3 95  ? 67.717 18.339  13.833  1.00 28.30 ? 95   SER A OG    1 
ATOM   1153 N  N     . ARG C 3 96  ? 64.084 18.995  11.481  1.00 21.19 ? 96   ARG A N     1 
ATOM   1154 C  CA    . ARG C 3 96  ? 62.865 19.669  11.074  1.00 22.45 ? 96   ARG A CA    1 
ATOM   1155 C  C     . ARG C 3 96  ? 61.694 18.704  10.987  1.00 23.01 ? 96   ARG A C     1 
ATOM   1156 O  O     . ARG C 3 96  ? 60.542 19.121  11.072  1.00 23.72 ? 96   ARG A O     1 
ATOM   1157 C  CB    . ARG C 3 96  ? 63.088 20.416  9.761   1.00 19.09 ? 96   ARG A CB    1 
ATOM   1158 C  CG    . ARG C 3 96  ? 63.858 21.721  9.993   1.00 18.94 ? 96   ARG A CG    1 
ATOM   1159 C  CD    . ARG C 3 96  ? 64.337 22.401  8.716   1.00 17.62 ? 96   ARG A CD    1 
ATOM   1160 N  NE    . ARG C 3 96  ? 64.829 23.752  9.000   1.00 19.40 ? 96   ARG A NE    1 
ATOM   1161 C  CZ    . ARG C 3 96  ? 65.351 24.574  8.092   1.00 19.82 ? 96   ARG A CZ    1 
ATOM   1162 N  NH1   . ARG C 3 96  ? 65.459 24.194  6.826   1.00 16.65 ? 96   ARG A NH1   1 
ATOM   1163 N  NH2   . ARG C 3 96  ? 65.752 25.786  8.449   1.00 19.71 ? 96   ARG A NH2   1 
ATOM   1164 N  N     . LEU C 3 97  ? 62.003 17.417  10.847  1.00 24.36 ? 97   LEU A N     1 
ATOM   1165 C  CA    . LEU C 3 97  ? 60.983 16.378  10.777  1.00 25.87 ? 97   LEU A CA    1 
ATOM   1166 C  C     . LEU C 3 97  ? 60.597 15.921  12.175  1.00 27.21 ? 97   LEU A C     1 
ATOM   1167 O  O     . LEU C 3 97  ? 59.425 15.929  12.533  1.00 28.87 ? 97   LEU A O     1 
ATOM   1168 C  CB    . LEU C 3 97  ? 61.476 15.164  9.982   1.00 22.86 ? 97   LEU A CB    1 
ATOM   1169 C  CG    . LEU C 3 97  ? 60.578 13.916  10.094  1.00 24.75 ? 97   LEU A CG    1 
ATOM   1170 C  CD1   . LEU C 3 97  ? 59.182 14.208  9.503   1.00 22.01 ? 97   LEU A CD1   1 
ATOM   1171 C  CD2   . LEU C 3 97  ? 61.232 12.744  9.352   1.00 23.14 ? 97   LEU A CD2   1 
ATOM   1172 N  N     . ILE C 3 98  ? 61.592 15.530  12.965  1.00 29.49 ? 98   ILE A N     1 
ATOM   1173 C  CA    . ILE C 3 98  ? 61.344 15.047  14.316  1.00 30.30 ? 98   ILE A CA    1 
ATOM   1174 C  C     . ILE C 3 98  ? 60.809 16.150  15.229  1.00 30.95 ? 98   ILE A C     1 
ATOM   1175 O  O     . ILE C 3 98  ? 59.812 15.950  15.925  1.00 30.13 ? 98   ILE A O     1 
ATOM   1176 C  CB    . ILE C 3 98  ? 62.626 14.425  14.930  1.00 31.17 ? 98   ILE A CB    1 
ATOM   1177 C  CG1   . ILE C 3 98  ? 63.065 13.211  14.100  1.00 31.60 ? 98   ILE A CG1   1 
ATOM   1178 C  CG2   . ILE C 3 98  ? 62.360 13.979  16.364  1.00 30.39 ? 98   ILE A CG2   1 
ATOM   1179 N  N     . HIS C 3 99  ? 61.457 17.312  15.221  1.00 29.50 ? 99   HIS A N     1 
ATOM   1180 C  CA    . HIS C 3 99  ? 61.013 18.427  16.057  1.00 30.03 ? 99   HIS A CA    1 
ATOM   1181 C  C     . HIS C 3 99  ? 60.245 19.441  15.223  1.00 29.58 ? 99   HIS A C     1 
ATOM   1182 O  O     . HIS C 3 99  ? 60.509 20.644  15.283  1.00 30.00 ? 99   HIS A O     1 
ATOM   1183 C  CB    . HIS C 3 99  ? 62.217 19.094  16.727  1.00 31.78 ? 99   HIS A CB    1 
ATOM   1184 C  CG    . HIS C 3 99  ? 63.087 18.136  17.482  1.00 33.55 ? 99   HIS A CG    1 
ATOM   1185 N  ND1   . HIS C 3 99  ? 62.671 17.498  18.631  1.00 34.74 ? 99   HIS A ND1   1 
ATOM   1186 C  CD2   . HIS C 3 99  ? 64.327 17.661  17.217  1.00 34.06 ? 99   HIS A CD2   1 
ATOM   1187 C  CE1   . HIS C 3 99  ? 63.615 16.669  19.040  1.00 33.62 ? 99   HIS A CE1   1 
ATOM   1188 N  NE2   . HIS C 3 99  ? 64.631 16.748  18.198  1.00 34.59 ? 99   HIS A NE2   1 
ATOM   1189 N  N     . SER C 3 100 ? 59.291 18.939  14.444  1.00 28.92 ? 100  SER A N     1 
ATOM   1190 C  CA    . SER C 3 100 ? 58.464 19.772  13.578  1.00 29.35 ? 100  SER A CA    1 
ATOM   1191 C  C     . SER C 3 100 ? 57.664 20.806  14.361  1.00 29.86 ? 100  SER A C     1 
ATOM   1192 O  O     . SER C 3 100 ? 57.110 21.741  13.785  1.00 29.83 ? 100  SER A O     1 
ATOM   1193 C  CB    . SER C 3 100 ? 57.512 18.893  12.773  1.00 28.56 ? 100  SER A CB    1 
ATOM   1194 O  OG    . SER C 3 100 ? 56.895 17.949  13.623  1.00 31.29 ? 100  SER A OG    1 
ATOM   1195 N  N     . ASN C 3 101 ? 57.603 20.626  15.674  1.00 29.82 ? 101  ASN A N     1 
ATOM   1196 C  CA    . ASN C 3 101 ? 56.889 21.544  16.547  1.00 31.72 ? 101  ASN A CA    1 
ATOM   1197 C  C     . ASN C 3 101 ? 57.774 22.723  16.969  1.00 30.66 ? 101  ASN A C     1 
ATOM   1198 O  O     . ASN C 3 101 ? 57.305 23.654  17.609  1.00 30.56 ? 101  ASN A O     1 
ATOM   1199 C  CB    . ASN C 3 101 ? 56.407 20.797  17.788  1.00 33.72 ? 101  ASN A CB    1 
ATOM   1200 C  CG    . ASN C 3 101 ? 57.513 19.984  18.435  1.00 35.75 ? 101  ASN A CG    1 
ATOM   1201 O  OD1   . ASN C 3 101 ? 58.177 19.192  17.766  1.00 37.24 ? 101  ASN A OD1   1 
ATOM   1202 N  ND2   . ASN C 3 101 ? 57.714 20.170  19.737  1.00 37.16 ? 101  ASN A ND2   1 
ATOM   1203 N  N     . LEU C 3 102 ? 59.052 22.684  16.612  1.00 31.43 ? 102  LEU A N     1 
ATOM   1204 C  CA    . LEU C 3 102 ? 59.961 23.766  16.984  1.00 30.74 ? 102  LEU A CA    1 
ATOM   1205 C  C     . LEU C 3 102 ? 60.455 24.575  15.784  1.00 30.08 ? 102  LEU A C     1 
ATOM   1206 O  O     . LEU C 3 102 ? 60.579 24.061  14.668  1.00 28.47 ? 102  LEU A O     1 
ATOM   1207 C  CB    . LEU C 3 102 ? 61.183 23.213  17.725  1.00 30.76 ? 102  LEU A CB    1 
ATOM   1208 C  CG    . LEU C 3 102 ? 61.045 22.242  18.905  1.00 32.37 ? 102  LEU A CG    1 
ATOM   1209 C  CD1   . LEU C 3 102 ? 62.449 21.843  19.354  1.00 30.08 ? 102  LEU A CD1   1 
ATOM   1210 C  CD2   . LEU C 3 102 ? 60.274 22.875  20.056  1.00 31.71 ? 102  LEU A CD2   1 
ATOM   1211 N  N     . LYS C 3 103 ? 60.729 25.853  16.027  1.00 30.07 ? 103  LYS A N     1 
ATOM   1212 C  CA    . LYS C 3 103 ? 61.265 26.736  14.995  1.00 30.42 ? 103  LYS A CA    1 
ATOM   1213 C  C     . LYS C 3 103 ? 62.781 26.589  15.079  1.00 31.70 ? 103  LYS A C     1 
ATOM   1214 O  O     . LYS C 3 103 ? 63.293 25.972  16.015  1.00 32.50 ? 103  LYS A O     1 
ATOM   1215 C  CB    . LYS C 3 103 ? 60.920 28.196  15.305  1.00 30.71 ? 103  LYS A CB    1 
ATOM   1216 C  CG    . LYS C 3 103 ? 59.438 28.527  15.352  1.00 32.05 ? 103  LYS A CG    1 
ATOM   1217 C  CD    . LYS C 3 103 ? 58.831 28.587  13.957  1.00 34.26 ? 103  LYS A CD    1 
ATOM   1218 C  CE    . LYS C 3 103 ? 57.370 29.030  14.010  1.00 35.94 ? 103  LYS A CE    1 
ATOM   1219 N  NZ    . LYS C 3 103 ? 56.749 29.055  12.656  1.00 36.24 ? 103  LYS A NZ    1 
ATOM   1220 N  N     . ASP C 3 104 ? 63.492 27.135  14.094  1.00 32.02 ? 104  ASP A N     1 
ATOM   1221 C  CA    . ASP C 3 104 ? 64.955 27.150  14.104  1.00 31.88 ? 104  ASP A CA    1 
ATOM   1222 C  C     . ASP C 3 104 ? 65.357 28.451  13.413  1.00 30.62 ? 104  ASP A C     1 
ATOM   1223 O  O     . ASP C 3 104 ? 64.506 29.137  12.839  1.00 30.13 ? 104  ASP A O     1 
ATOM   1224 C  CB    . ASP C 3 104 ? 65.577 25.922  13.405  1.00 32.67 ? 104  ASP A CB    1 
ATOM   1225 C  CG    . ASP C 3 104 ? 65.147 25.778  11.964  1.00 33.66 ? 104  ASP A CG    1 
ATOM   1226 O  OD1   . ASP C 3 104 ? 65.274 26.757  11.195  1.00 34.82 ? 104  ASP A OD1   1 
ATOM   1227 O  OD2   . ASP C 3 104 ? 64.689 24.673  11.599  1.00 33.42 ? 104  ASP A OD2   1 
ATOM   1228 N  N     . THR C 3 105 ? 66.638 28.796  13.479  1.00 29.69 ? 105  THR A N     1 
ATOM   1229 C  CA    . THR C 3 105 ? 67.132 30.041  12.894  1.00 29.45 ? 105  THR A CA    1 
ATOM   1230 C  C     . THR C 3 105 ? 67.431 29.967  11.401  1.00 29.23 ? 105  THR A C     1 
ATOM   1231 O  O     . THR C 3 105 ? 67.850 30.961  10.797  1.00 28.89 ? 105  THR A O     1 
ATOM   1232 C  CB    . THR C 3 105 ? 68.417 30.505  13.606  1.00 28.50 ? 105  THR A CB    1 
ATOM   1233 O  OG1   . THR C 3 105 ? 69.446 29.532  13.400  1.00 28.89 ? 105  THR A OG1   1 
ATOM   1234 C  CG2   . THR C 3 105 ? 68.173 30.669  15.104  1.00 26.75 ? 105  THR A CG2   1 
ATOM   1235 N  N     . ASP C 3 106 ? 67.220 28.793  10.813  1.00 29.53 ? 106  ASP A N     1 
ATOM   1236 C  CA    . ASP C 3 106 ? 67.483 28.586  9.393   1.00 29.65 ? 106  ASP A CA    1 
ATOM   1237 C  C     . ASP C 3 106 ? 68.964 28.893  9.176   1.00 30.05 ? 106  ASP A C     1 
ATOM   1238 O  O     . ASP C 3 106 ? 69.350 29.686  8.306   1.00 28.84 ? 106  ASP A O     1 
ATOM   1239 C  CB    . ASP C 3 106 ? 66.583 29.502  8.546   1.00 30.37 ? 106  ASP A CB    1 
ATOM   1240 C  CG    . ASP C 3 106 ? 66.453 29.030  7.105   1.00 33.05 ? 106  ASP A CG    1 
ATOM   1241 O  OD1   . ASP C 3 106 ? 66.728 27.841  6.841   1.00 30.32 ? 106  ASP A OD1   1 
ATOM   1242 O  OD2   . ASP C 3 106 ? 66.056 29.839  6.234   1.00 35.57 ? 106  ASP A OD2   1 
ATOM   1243 N  N     . MET C 3 107 ? 69.782 28.261  10.013  1.00 29.24 ? 107  MET A N     1 
ATOM   1244 C  CA    . MET C 3 107 ? 71.228 28.403  9.975   1.00 31.97 ? 107  MET A CA    1 
ATOM   1245 C  C     . MET C 3 107 ? 71.726 29.838  10.119  1.00 33.66 ? 107  MET A C     1 
ATOM   1246 O  O     . MET C 3 107 ? 72.518 30.316  9.307   1.00 34.42 ? 107  MET A O     1 
ATOM   1247 C  CB    . MET C 3 107 ? 71.776 27.780  8.691   1.00 32.57 ? 107  MET A CB    1 
ATOM   1248 C  CG    . MET C 3 107 ? 71.618 26.263  8.652   1.00 30.73 ? 107  MET A CG    1 
ATOM   1249 S  SD    . MET C 3 107 ? 72.472 25.509  10.059  1.00 32.80 ? 107  MET A SD    1 
ATOM   1250 C  CE    . MET C 3 107 ? 74.170 25.476  9.431   1.00 28.59 ? 107  MET A CE    1 
ATOM   1251 N  N     . GLY C 3 108 ? 71.250 30.518  11.157  1.00 34.32 ? 108  GLY A N     1 
ATOM   1252 C  CA    . GLY C 3 108 ? 71.682 31.878  11.409  1.00 35.37 ? 108  GLY A CA    1 
ATOM   1253 C  C     . GLY C 3 108 ? 71.045 33.007  10.617  1.00 35.12 ? 108  GLY A C     1 
ATOM   1254 O  O     . GLY C 3 108 ? 71.332 34.166  10.899  1.00 35.81 ? 108  GLY A O     1 
ATOM   1255 N  N     . LEU C 3 109 ? 70.200 32.699  9.637   1.00 35.15 ? 109  LEU A N     1 
ATOM   1256 C  CA    . LEU C 3 109 ? 69.558 33.759  8.861   1.00 34.93 ? 109  LEU A CA    1 
ATOM   1257 C  C     . LEU C 3 109 ? 68.498 34.490  9.689   1.00 34.82 ? 109  LEU A C     1 
ATOM   1258 O  O     . LEU C 3 109 ? 68.173 35.644  9.416   1.00 36.37 ? 109  LEU A O     1 
ATOM   1259 C  CB    . LEU C 3 109 ? 68.918 33.193  7.589   1.00 33.24 ? 109  LEU A CB    1 
ATOM   1260 C  CG    . LEU C 3 109 ? 69.874 32.557  6.575   1.00 33.58 ? 109  LEU A CG    1 
ATOM   1261 C  CD1   . LEU C 3 109 ? 69.098 32.111  5.347   1.00 32.31 ? 109  LEU A CD1   1 
ATOM   1262 C  CD2   . LEU C 3 109 ? 70.958 33.560  6.185   1.00 34.63 ? 109  LEU A CD2   1 
ATOM   1263 N  N     . LEU C 3 110 ? 67.962 33.814  10.701  1.00 34.82 ? 110  LEU A N     1 
ATOM   1264 C  CA    . LEU C 3 110 ? 66.945 34.397  11.567  1.00 33.96 ? 110  LEU A CA    1 
ATOM   1265 C  C     . LEU C 3 110 ? 67.531 34.636  12.950  1.00 34.95 ? 110  LEU A C     1 
ATOM   1266 O  O     . LEU C 3 110 ? 68.332 33.831  13.439  1.00 35.05 ? 110  LEU A O     1 
ATOM   1267 C  CB    . LEU C 3 110 ? 65.749 33.454  11.696  1.00 34.14 ? 110  LEU A CB    1 
ATOM   1268 C  CG    . LEU C 3 110 ? 64.901 33.163  10.454  1.00 34.26 ? 110  LEU A CG    1 
ATOM   1269 C  CD1   . LEU C 3 110 ? 64.055 31.915  10.689  1.00 32.12 ? 110  LEU A CD1   1 
ATOM   1270 C  CD2   . LEU C 3 110 ? 64.029 34.361  10.139  1.00 31.39 ? 110  LEU A CD2   1 
ATOM   1271 N  N     . ARG C 3 111 ? 67.137 35.741  13.575  1.00 34.43 ? 111  ARG A N     1 
ATOM   1272 C  CA    . ARG C 3 111 ? 67.609 36.070  14.916  1.00 35.92 ? 111  ARG A CA    1 
ATOM   1273 C  C     . ARG C 3 111 ? 66.811 35.195  15.878  1.00 36.02 ? 111  ARG A C     1 
ATOM   1274 O  O     . ARG C 3 111 ? 65.581 35.208  15.853  1.00 35.95 ? 111  ARG A O     1 
ATOM   1275 C  CB    . ARG C 3 111 ? 67.369 37.554  15.219  1.00 35.03 ? 111  ARG A CB    1 
ATOM   1276 N  N     . SER C 3 112 ? 67.509 34.436  16.719  1.00 36.57 ? 112  SER A N     1 
ATOM   1277 C  CA    . SER C 3 112 ? 66.848 33.529  17.658  1.00 36.93 ? 112  SER A CA    1 
ATOM   1278 C  C     . SER C 3 112 ? 65.911 34.209  18.656  1.00 37.03 ? 112  SER A C     1 
ATOM   1279 O  O     . SER C 3 112 ? 64.909 33.626  19.072  1.00 36.34 ? 112  SER A O     1 
ATOM   1280 C  CB    . SER C 3 112 ? 67.897 32.681  18.397  1.00 37.33 ? 112  SER A CB    1 
ATOM   1281 O  OG    . SER C 3 112 ? 68.891 33.480  19.020  1.00 39.64 ? 112  SER A OG    1 
ATOM   1282 N  N     . GLY C 3 113 ? 66.226 35.443  19.035  1.00 38.37 ? 113  GLY A N     1 
ATOM   1283 C  CA    . GLY C 3 113 ? 65.375 36.154  19.977  1.00 38.78 ? 113  GLY A CA    1 
ATOM   1284 C  C     . GLY C 3 113 ? 63.967 36.378  19.451  1.00 39.10 ? 113  GLY A C     1 
ATOM   1285 O  O     . GLY C 3 113 ? 63.002 36.402  20.217  1.00 41.17 ? 113  GLY A O     1 
ATOM   1286 N  N     . LYS C 3 114 ? 63.847 36.524  18.137  1.00 39.80 ? 114  LYS A N     1 
ATOM   1287 C  CA    . LYS C 3 114 ? 62.561 36.764  17.486  1.00 40.85 ? 114  LYS A CA    1 
ATOM   1288 C  C     . LYS C 3 114 ? 61.687 35.514  17.345  1.00 40.58 ? 114  LYS A C     1 
ATOM   1289 O  O     . LYS C 3 114 ? 60.462 35.616  17.220  1.00 40.99 ? 114  LYS A O     1 
ATOM   1290 C  CB    . LYS C 3 114 ? 62.806 37.387  16.104  1.00 43.30 ? 114  LYS A CB    1 
ATOM   1291 C  CG    . LYS C 3 114 ? 61.559 37.598  15.252  1.00 46.93 ? 114  LYS A CG    1 
ATOM   1292 C  CD    . LYS C 3 114 ? 61.872 38.461  14.029  1.00 48.08 ? 114  LYS A CD    1 
ATOM   1293 C  CE    . LYS C 3 114 ? 60.656 38.631  13.119  1.00 50.76 ? 114  LYS A CE    1 
ATOM   1294 N  NZ    . LYS C 3 114 ? 60.282 37.373  12.407  1.00 50.32 ? 114  LYS A NZ    1 
ATOM   1295 N  N     . LEU C 3 115 ? 62.311 34.340  17.364  1.00 37.65 ? 115  LEU A N     1 
ATOM   1296 C  CA    . LEU C 3 115 ? 61.570 33.089  17.221  1.00 36.11 ? 115  LEU A CA    1 
ATOM   1297 C  C     . LEU C 3 115 ? 60.765 32.748  18.465  1.00 34.41 ? 115  LEU A C     1 
ATOM   1298 O  O     . LEU C 3 115 ? 61.194 33.003  19.589  1.00 33.08 ? 115  LEU A O     1 
ATOM   1299 C  CB    . LEU C 3 115 ? 62.528 31.927  16.915  1.00 35.17 ? 115  LEU A CB    1 
ATOM   1300 C  CG    . LEU C 3 115 ? 63.421 32.081  15.679  1.00 36.66 ? 115  LEU A CG    1 
ATOM   1301 C  CD1   . LEU C 3 115 ? 64.381 30.909  15.595  1.00 35.87 ? 115  LEU A CD1   1 
ATOM   1302 C  CD2   . LEU C 3 115 ? 62.558 32.178  14.417  1.00 36.47 ? 115  LEU A CD2   1 
ATOM   1303 N  N     . PRO C 3 116 ? 59.564 32.189  18.275  1.00 33.13 ? 116  PRO A N     1 
ATOM   1304 C  CA    . PRO C 3 116 ? 58.746 31.827  19.434  1.00 32.74 ? 116  PRO A CA    1 
ATOM   1305 C  C     . PRO C 3 116 ? 59.109 30.400  19.861  1.00 31.69 ? 116  PRO A C     1 
ATOM   1306 O  O     . PRO C 3 116 ? 59.656 29.633  19.061  1.00 31.03 ? 116  PRO A O     1 
ATOM   1307 C  CB    . PRO C 3 116 ? 57.325 31.922  18.887  1.00 32.77 ? 116  PRO A CB    1 
ATOM   1308 C  CG    . PRO C 3 116 ? 57.504 31.415  17.482  1.00 32.62 ? 116  PRO A CG    1 
ATOM   1309 C  CD    . PRO C 3 116 ? 58.765 32.146  17.036  1.00 32.04 ? 116  PRO A CD    1 
ATOM   1310 N  N     . GLY C 3 117 ? 58.821 30.063  21.115  1.00 30.81 ? 117  GLY A N     1 
ATOM   1311 C  CA    . GLY C 3 117 ? 59.103 28.729  21.622  1.00 30.21 ? 117  GLY A CA    1 
ATOM   1312 C  C     . GLY C 3 117 ? 60.560 28.404  21.907  1.00 29.68 ? 117  GLY A C     1 
ATOM   1313 O  O     . GLY C 3 117 ? 61.434 29.266  21.837  1.00 31.04 ? 117  GLY A O     1 
ATOM   1314 N  N     . ALA C 3 118 ? 60.818 27.143  22.235  1.00 28.16 ? 124  ALA A N     1 
ATOM   1315 C  CA    . ALA C 3 118 ? 62.168 26.691  22.533  1.00 26.46 ? 124  ALA A CA    1 
ATOM   1316 C  C     . ALA C 3 118 ? 62.899 26.285  21.253  1.00 25.49 ? 124  ALA A C     1 
ATOM   1317 O  O     . ALA C 3 118 ? 62.295 26.166  20.183  1.00 23.42 ? 124  ALA A O     1 
ATOM   1318 C  CB    . ALA C 3 118 ? 62.118 25.510  23.506  1.00 26.74 ? 124  ALA A CB    1 
ATOM   1319 N  N     . LEU C 3 119 ? 64.206 26.083  21.371  1.00 23.68 ? 125  LEU A N     1 
ATOM   1320 C  CA    . LEU C 3 119 ? 65.023 25.676  20.237  1.00 23.81 ? 125  LEU A CA    1 
ATOM   1321 C  C     . LEU C 3 119 ? 65.868 24.479  20.628  1.00 23.86 ? 125  LEU A C     1 
ATOM   1322 O  O     . LEU C 3 119 ? 66.421 24.440  21.725  1.00 23.55 ? 125  LEU A O     1 
ATOM   1323 C  CB    . LEU C 3 119 ? 65.941 26.820  19.787  1.00 23.47 ? 125  LEU A CB    1 
ATOM   1324 C  CG    . LEU C 3 119 ? 65.264 28.104  19.298  1.00 26.54 ? 125  LEU A CG    1 
ATOM   1325 C  CD1   . LEU C 3 119 ? 66.324 29.105  18.852  1.00 25.95 ? 125  LEU A CD1   1 
ATOM   1326 C  CD2   . LEU C 3 119 ? 64.315 27.789  18.154  1.00 28.87 ? 125  LEU A CD2   1 
ATOM   1327 N  N     . GLU C 3 120 ? 65.961 23.492  19.743  1.00 23.77 ? 126  GLU A N     1 
ATOM   1328 C  CA    . GLU C 3 120 ? 66.777 22.323  20.044  1.00 24.39 ? 126  GLU A CA    1 
ATOM   1329 C  C     . GLU C 3 120 ? 68.238 22.800  20.172  1.00 24.25 ? 126  GLU A C     1 
ATOM   1330 O  O     . GLU C 3 120 ? 68.762 23.469  19.284  1.00 24.35 ? 126  GLU A O     1 
ATOM   1331 C  CB    . GLU C 3 120 ? 66.610 21.283  18.936  1.00 25.81 ? 126  GLU A CB    1 
ATOM   1332 C  CG    . GLU C 3 120 ? 67.233 19.917  19.245  1.00 25.64 ? 126  GLU A CG    1 
ATOM   1333 C  CD    . GLU C 3 120 ? 68.733 19.920  19.064  1.00 24.75 ? 126  GLU A CD    1 
ATOM   1334 O  OE1   . GLU C 3 120 ? 69.188 20.419  18.020  1.00 24.39 ? 126  GLU A OE1   1 
ATOM   1335 O  OE2   . GLU C 3 120 ? 69.454 19.422  19.949  1.00 26.93 ? 126  GLU A OE2   1 
ATOM   1336 N  N     . ALA C 3 121 ? 68.877 22.452  21.286  1.00 24.90 ? 127  ALA A N     1 
ATOM   1337 C  CA    . ALA C 3 121 ? 70.245 22.879  21.607  1.00 23.51 ? 127  ALA A CA    1 
ATOM   1338 C  C     . ALA C 3 121 ? 71.363 22.653  20.583  1.00 24.09 ? 127  ALA A C     1 
ATOM   1339 O  O     . ALA C 3 121 ? 72.099 23.586  20.253  1.00 23.47 ? 127  ALA A O     1 
ATOM   1340 C  CB    . ALA C 3 121 ? 70.660 22.276  22.947  1.00 22.38 ? 127  ALA A CB    1 
ATOM   1341 N  N     . TRP C 3 122 ? 71.512 21.421  20.110  1.00 23.50 ? 128  TRP A N     1 
ATOM   1342 C  CA    . TRP C 3 122 ? 72.555 21.101  19.149  1.00 24.13 ? 128  TRP A CA    1 
ATOM   1343 C  C     . TRP C 3 122 ? 72.388 21.889  17.863  1.00 23.37 ? 128  TRP A C     1 
ATOM   1344 O  O     . TRP C 3 122 ? 73.341 22.484  17.364  1.00 21.92 ? 128  TRP A O     1 
ATOM   1345 C  CB    . TRP C 3 122 ? 72.547 19.603  18.834  1.00 26.47 ? 128  TRP A CB    1 
ATOM   1346 C  CG    . TRP C 3 122 ? 72.859 18.746  20.012  1.00 28.58 ? 128  TRP A CG    1 
ATOM   1347 C  CD1   . TRP C 3 122 ? 72.116 17.699  20.483  1.00 29.48 ? 128  TRP A CD1   1 
ATOM   1348 C  CD2   . TRP C 3 122 ? 74.001 18.847  20.871  1.00 29.24 ? 128  TRP A CD2   1 
ATOM   1349 N  NE1   . TRP C 3 122 ? 72.725 17.144  21.580  1.00 30.63 ? 128  TRP A NE1   1 
ATOM   1350 C  CE2   . TRP C 3 122 ? 73.883 17.828  21.842  1.00 28.69 ? 128  TRP A CE2   1 
ATOM   1351 C  CE3   . TRP C 3 122 ? 75.113 19.699  20.917  1.00 30.85 ? 128  TRP A CE3   1 
ATOM   1352 C  CZ2   . TRP C 3 122 ? 74.833 17.635  22.847  1.00 29.48 ? 128  TRP A CZ2   1 
ATOM   1353 C  CZ3   . TRP C 3 122 ? 76.061 19.506  21.919  1.00 31.71 ? 128  TRP A CZ3   1 
ATOM   1354 C  CH2   . TRP C 3 122 ? 75.912 18.480  22.870  1.00 29.50 ? 128  TRP A CH2   1 
ATOM   1355 N  N     . GLY C 3 123 ? 71.171 21.877  17.325  1.00 23.10 ? 129  GLY A N     1 
ATOM   1356 C  CA    . GLY C 3 123 ? 70.898 22.593  16.097  1.00 22.06 ? 129  GLY A CA    1 
ATOM   1357 C  C     . GLY C 3 123 ? 71.082 24.084  16.292  1.00 23.12 ? 129  GLY A C     1 
ATOM   1358 O  O     . GLY C 3 123 ? 71.454 24.804  15.357  1.00 20.78 ? 129  GLY A O     1 
ATOM   1359 N  N     . TYR C 3 124 ? 70.814 24.555  17.505  1.00 22.88 ? 130  TYR A N     1 
ATOM   1360 C  CA    . TYR C 3 124 ? 70.975 25.970  17.789  1.00 26.24 ? 130  TYR A CA    1 
ATOM   1361 C  C     . TYR C 3 124 ? 72.442 26.330  17.664  1.00 27.29 ? 130  TYR A C     1 
ATOM   1362 O  O     . TYR C 3 124 ? 72.791 27.317  17.020  1.00 28.87 ? 130  TYR A O     1 
ATOM   1363 C  CB    . TYR C 3 124 ? 70.511 26.321  19.200  1.00 25.09 ? 130  TYR A CB    1 
ATOM   1364 C  CG    . TYR C 3 124 ? 70.856 27.746  19.576  1.00 25.99 ? 130  TYR A CG    1 
ATOM   1365 C  CD1   . TYR C 3 124 ? 70.125 28.819  19.062  1.00 27.38 ? 130  TYR A CD1   1 
ATOM   1366 C  CD2   . TYR C 3 124 ? 71.941 28.026  20.412  1.00 26.60 ? 130  TYR A CD2   1 
ATOM   1367 C  CE1   . TYR C 3 124 ? 70.463 30.138  19.370  1.00 28.20 ? 130  TYR A CE1   1 
ATOM   1368 C  CE2   . TYR C 3 124 ? 72.288 29.345  20.723  1.00 30.02 ? 130  TYR A CE2   1 
ATOM   1369 C  CZ    . TYR C 3 124 ? 71.543 30.393  20.197  1.00 29.67 ? 130  TYR A CZ    1 
ATOM   1370 O  OH    . TYR C 3 124 ? 71.877 31.694  20.494  1.00 33.76 ? 130  TYR A OH    1 
ATOM   1371 N  N     . ARG C 3 125 ? 73.291 25.529  18.303  1.00 29.90 ? 131  ARG A N     1 
ATOM   1372 C  CA    . ARG C 3 125 ? 74.732 25.755  18.273  1.00 32.38 ? 131  ARG A CA    1 
ATOM   1373 C  C     . ARG C 3 125 ? 75.244 25.736  16.837  1.00 31.37 ? 131  ARG A C     1 
ATOM   1374 O  O     . ARG C 3 125 ? 76.026 26.598  16.432  1.00 32.72 ? 131  ARG A O     1 
ATOM   1375 C  CB    . ARG C 3 125 ? 75.457 24.676  19.079  1.00 35.23 ? 131  ARG A CB    1 
ATOM   1376 C  CG    . ARG C 3 125 ? 74.972 24.535  20.506  1.00 42.28 ? 131  ARG A CG    1 
ATOM   1377 C  CD    . ARG C 3 125 ? 76.097 24.766  21.492  1.00 46.80 ? 131  ARG A CD    1 
ATOM   1378 N  NE    . ARG C 3 125 ? 76.604 26.135  21.423  1.00 50.41 ? 131  ARG A NE    1 
ATOM   1379 C  CZ    . ARG C 3 125 ? 77.606 26.598  22.163  1.00 51.79 ? 131  ARG A CZ    1 
ATOM   1380 N  NH1   . ARG C 3 125 ? 78.210 25.797  23.032  1.00 52.65 ? 131  ARG A NH1   1 
ATOM   1381 N  NH2   . ARG C 3 125 ? 78.003 27.860  22.034  1.00 52.54 ? 131  ARG A NH2   1 
ATOM   1382 N  N     . LEU C 3 126 ? 74.805 24.745  16.067  1.00 29.46 ? 132  LEU A N     1 
ATOM   1383 C  CA    . LEU C 3 126 ? 75.240 24.641  14.685  1.00 27.31 ? 132  LEU A CA    1 
ATOM   1384 C  C     . LEU C 3 126 ? 74.851 25.888  13.903  1.00 26.37 ? 132  LEU A C     1 
ATOM   1385 O  O     . LEU C 3 126 ? 75.644 26.407  13.114  1.00 25.56 ? 132  LEU A O     1 
ATOM   1386 C  CB    . LEU C 3 126 ? 74.653 23.382  14.040  1.00 25.51 ? 132  LEU A CB    1 
ATOM   1387 C  CG    . LEU C 3 126 ? 75.252 22.092  14.626  1.00 24.90 ? 132  LEU A CG    1 
ATOM   1388 C  CD1   . LEU C 3 126 ? 74.477 20.889  14.164  1.00 22.92 ? 132  LEU A CD1   1 
ATOM   1389 C  CD2   . LEU C 3 126 ? 76.724 21.979  14.217  1.00 22.02 ? 132  LEU A CD2   1 
ATOM   1390 N  N     . GLY C 3 127 ? 73.642 26.381  14.144  1.00 25.83 ? 133  GLY A N     1 
ATOM   1391 C  CA    . GLY C 3 127 ? 73.171 27.560  13.442  1.00 26.48 ? 133  GLY A CA    1 
ATOM   1392 C  C     . GLY C 3 127 ? 73.862 28.844  13.860  1.00 27.68 ? 133  GLY A C     1 
ATOM   1393 O  O     . GLY C 3 127 ? 73.877 29.813  13.107  1.00 27.81 ? 133  GLY A O     1 
ATOM   1394 N  N     . GLU C 3 128 ? 74.443 28.851  15.057  1.00 28.44 ? 134  GLU A N     1 
ATOM   1395 C  CA    . GLU C 3 128 ? 75.115 30.032  15.574  1.00 30.88 ? 134  GLU A CA    1 
ATOM   1396 C  C     . GLU C 3 128 ? 76.627 30.014  15.403  1.00 32.51 ? 134  GLU A C     1 
ATOM   1397 O  O     . GLU C 3 128 ? 77.306 30.964  15.794  1.00 32.66 ? 134  GLU A O     1 
ATOM   1398 C  CB    . GLU C 3 128 ? 74.793 30.203  17.058  1.00 31.23 ? 134  GLU A CB    1 
ATOM   1399 C  CG    . GLU C 3 128 ? 73.323 30.422  17.356  1.00 33.91 ? 134  GLU A CG    1 
ATOM   1400 C  CD    . GLU C 3 128 ? 72.751 31.622  16.618  1.00 33.61 ? 134  GLU A CD    1 
ATOM   1401 O  OE1   . GLU C 3 128 ? 73.439 32.667  16.579  1.00 34.88 ? 134  GLU A OE1   1 
ATOM   1402 O  OE2   . GLU C 3 128 ? 71.616 31.521  16.091  1.00 31.06 ? 134  GLU A OE2   1 
ATOM   1403 N  N     . MET C 3 129 ? 77.151 28.941  14.818  1.00 33.85 ? 135  MET A N     1 
ATOM   1404 C  CA    . MET C 3 129 ? 78.590 28.805  14.632  1.00 34.63 ? 135  MET A CA    1 
ATOM   1405 C  C     . MET C 3 129 ? 79.256 29.921  13.843  1.00 33.22 ? 135  MET A C     1 
ATOM   1406 O  O     . MET C 3 129 ? 80.308 30.400  14.242  1.00 33.09 ? 135  MET A O     1 
ATOM   1407 C  CB    . MET C 3 129 ? 78.915 27.457  13.985  1.00 38.08 ? 135  MET A CB    1 
ATOM   1408 C  CG    . MET C 3 129 ? 78.682 26.259  14.905  1.00 43.31 ? 135  MET A CG    1 
ATOM   1409 S  SD    . MET C 3 129 ? 79.814 26.176  16.334  1.00 48.94 ? 135  MET A SD    1 
ATOM   1410 C  CE    . MET C 3 129 ? 78.776 26.847  17.660  1.00 46.77 ? 135  MET A CE    1 
ATOM   1411 N  N     . LYS C 3 130 ? 78.661 30.329  12.726  1.00 32.97 ? 136  LYS A N     1 
ATOM   1412 C  CA    . LYS C 3 130 ? 79.245 31.392  11.917  1.00 31.71 ? 136  LYS A CA    1 
ATOM   1413 C  C     . LYS C 3 130 ? 79.361 32.679  12.719  1.00 31.74 ? 136  LYS A C     1 
ATOM   1414 O  O     . LYS C 3 130 ? 80.407 33.326  12.710  1.00 31.26 ? 136  LYS A O     1 
ATOM   1415 C  CB    . LYS C 3 130 ? 78.417 31.627  10.648  1.00 32.08 ? 136  LYS A CB    1 
ATOM   1416 C  CG    . LYS C 3 130 ? 78.464 30.449  9.677   1.00 33.40 ? 136  LYS A CG    1 
ATOM   1417 C  CD    . LYS C 3 130 ? 77.644 30.686  8.413   1.00 33.24 ? 136  LYS A CD    1 
ATOM   1418 C  CE    . LYS C 3 130 ? 78.233 31.790  7.545   1.00 33.46 ? 136  LYS A CE    1 
ATOM   1419 N  NZ    . LYS C 3 130 ? 77.608 31.794  6.192   1.00 33.16 ? 136  LYS A NZ    1 
ATOM   1420 N  N     . GLY C 3 131 ? 78.287 33.037  13.417  1.00 31.67 ? 137  GLY A N     1 
ATOM   1421 C  CA    . GLY C 3 131 ? 78.279 34.242  14.230  1.00 31.47 ? 137  GLY A CA    1 
ATOM   1422 C  C     . GLY C 3 131 ? 79.278 34.184  15.375  1.00 32.33 ? 137  GLY A C     1 
ATOM   1423 O  O     . GLY C 3 131 ? 79.906 35.190  15.713  1.00 31.64 ? 137  GLY A O     1 
ATOM   1424 N  N     . GLU C 3 132 ? 79.434 33.013  15.983  1.00 32.80 ? 138  GLU A N     1 
ATOM   1425 C  CA    . GLU C 3 132 ? 80.380 32.874  17.087  1.00 34.20 ? 138  GLU A CA    1 
ATOM   1426 C  C     . GLU C 3 132 ? 81.809 32.976  16.567  1.00 33.48 ? 138  GLU A C     1 
ATOM   1427 O  O     . GLU C 3 132 ? 82.642 33.667  17.151  1.00 33.28 ? 138  GLU A O     1 
ATOM   1428 C  CB    . GLU C 3 132 ? 80.172 31.545  17.811  1.00 37.58 ? 138  GLU A CB    1 
ATOM   1429 C  CG    . GLU C 3 132 ? 78.881 31.486  18.618  1.00 41.96 ? 138  GLU A CG    1 
ATOM   1430 C  CD    . GLU C 3 132 ? 78.681 30.147  19.314  1.00 45.60 ? 138  GLU A CD    1 
ATOM   1431 O  OE1   . GLU C 3 132 ? 77.633 29.974  19.980  1.00 48.86 ? 138  GLU A OE1   1 
ATOM   1432 O  OE2   . GLU C 3 132 ? 79.565 29.270  19.198  1.00 46.61 ? 138  GLU A OE2   1 
ATOM   1433 N  N     . TYR C 3 133 ? 82.083 32.294  15.460  1.00 32.47 ? 139  TYR A N     1 
ATOM   1434 C  CA    . TYR C 3 133 ? 83.404 32.327  14.847  1.00 32.04 ? 139  TYR A CA    1 
ATOM   1435 C  C     . TYR C 3 133 ? 83.755 33.773  14.506  1.00 33.63 ? 139  TYR A C     1 
ATOM   1436 O  O     . TYR C 3 133 ? 84.881 34.217  14.716  1.00 32.69 ? 139  TYR A O     1 
ATOM   1437 C  CB    . TYR C 3 133 ? 83.423 31.467  13.580  1.00 28.47 ? 139  TYR A CB    1 
ATOM   1438 C  CG    . TYR C 3 133 ? 84.619 31.702  12.686  1.00 27.87 ? 139  TYR A CG    1 
ATOM   1439 C  CD1   . TYR C 3 133 ? 85.921 31.581  13.177  1.00 27.73 ? 139  TYR A CD1   1 
ATOM   1440 C  CD2   . TYR C 3 133 ? 84.449 32.078  11.354  1.00 25.48 ? 139  TYR A CD2   1 
ATOM   1441 C  CE1   . TYR C 3 133 ? 87.025 31.834  12.365  1.00 27.55 ? 139  TYR A CE1   1 
ATOM   1442 C  CE2   . TYR C 3 133 ? 85.544 32.333  10.532  1.00 26.47 ? 139  TYR A CE2   1 
ATOM   1443 C  CZ    . TYR C 3 133 ? 86.830 32.213  11.044  1.00 28.49 ? 139  TYR A CZ    1 
ATOM   1444 O  OH    . TYR C 3 133 ? 87.920 32.475  10.240  1.00 26.99 ? 139  TYR A OH    1 
ATOM   1445 N  N     . LYS C 3 134 ? 82.779 34.505  13.983  1.00 35.33 ? 140  LYS A N     1 
ATOM   1446 C  CA    . LYS C 3 134 ? 82.998 35.897  13.632  1.00 38.33 ? 140  LYS A CA    1 
ATOM   1447 C  C     . LYS C 3 134 ? 83.362 36.710  14.873  1.00 40.00 ? 140  LYS A C     1 
ATOM   1448 O  O     . LYS C 3 134 ? 84.279 37.530  14.832  1.00 39.99 ? 140  LYS A O     1 
ATOM   1449 C  CB    . LYS C 3 134 ? 81.751 36.494  12.987  1.00 39.12 ? 140  LYS A CB    1 
ATOM   1450 C  CG    . LYS C 3 134 ? 81.880 37.983  12.697  1.00 40.98 ? 140  LYS A CG    1 
ATOM   1451 C  CD    . LYS C 3 134 ? 80.571 38.569  12.207  1.00 42.25 ? 140  LYS A CD    1 
ATOM   1452 C  CE    . LYS C 3 134 ? 80.709 40.060  11.939  1.00 45.31 ? 140  LYS A CE    1 
ATOM   1453 N  NZ    . LYS C 3 134 ? 79.425 40.645  11.463  1.00 46.40 ? 140  LYS A NZ    1 
ATOM   1454 N  N     . ASP C 3 135 ? 82.644 36.488  15.974  1.00 41.48 ? 141  ASP A N     1 
ATOM   1455 C  CA    . ASP C 3 135 ? 82.929 37.217  17.206  1.00 42.33 ? 141  ASP A CA    1 
ATOM   1456 C  C     . ASP C 3 135 ? 84.339 36.951  17.712  1.00 42.83 ? 141  ASP A C     1 
ATOM   1457 O  O     . ASP C 3 135 ? 85.017 37.871  18.171  1.00 43.19 ? 141  ASP A O     1 
ATOM   1458 C  CB    . ASP C 3 135 ? 81.919 36.870  18.301  1.00 43.91 ? 141  ASP A CB    1 
ATOM   1459 C  CG    . ASP C 3 135 ? 80.583 37.544  18.089  1.00 44.73 ? 141  ASP A CG    1 
ATOM   1460 O  OD1   . ASP C 3 135 ? 80.560 38.616  17.453  1.00 45.92 ? 141  ASP A OD1   1 
ATOM   1461 O  OD2   . ASP C 3 135 ? 79.558 37.018  18.567  1.00 47.97 ? 141  ASP A OD2   1 
ATOM   1462 N  N     . ASP C 3 136 ? 84.779 35.699  17.629  1.00 42.23 ? 142  ASP A N     1 
ATOM   1463 C  CA    . ASP C 3 136 ? 86.122 35.338  18.068  1.00 42.74 ? 142  ASP A CA    1 
ATOM   1464 C  C     . ASP C 3 136 ? 87.139 36.067  17.202  1.00 41.81 ? 142  ASP A C     1 
ATOM   1465 O  O     . ASP C 3 136 ? 88.089 36.663  17.706  1.00 40.89 ? 142  ASP A O     1 
ATOM   1466 C  CB    . ASP C 3 136 ? 86.351 33.831  17.933  1.00 44.84 ? 142  ASP A CB    1 
ATOM   1467 C  CG    . ASP C 3 136 ? 85.446 33.019  18.832  1.00 47.84 ? 142  ASP A CG    1 
ATOM   1468 O  OD1   . ASP C 3 136 ? 84.243 33.340  18.901  1.00 50.66 ? 142  ASP A OD1   1 
ATOM   1469 O  OD2   . ASP C 3 136 ? 85.932 32.052  19.460  1.00 49.86 ? 142  ASP A OD2   1 
ATOM   1470 N  N     . PHE C 3 137 ? 86.925 36.010  15.892  1.00 41.70 ? 143  PHE A N     1 
ATOM   1471 C  CA    . PHE C 3 137 ? 87.819 36.646  14.936  1.00 42.11 ? 143  PHE A CA    1 
ATOM   1472 C  C     . PHE C 3 137 ? 87.993 38.131  15.255  1.00 43.45 ? 143  PHE A C     1 
ATOM   1473 O  O     . PHE C 3 137 ? 89.119 38.604  15.394  1.00 43.21 ? 143  PHE A O     1 
ATOM   1474 C  CB    . PHE C 3 137 ? 87.271 36.487  13.519  1.00 39.64 ? 143  PHE A CB    1 
ATOM   1475 C  CG    . PHE C 3 137 ? 88.310 36.639  12.444  1.00 38.25 ? 143  PHE A CG    1 
ATOM   1476 C  CD1   . PHE C 3 137 ? 89.140 35.575  12.111  1.00 36.83 ? 143  PHE A CD1   1 
ATOM   1477 C  CD2   . PHE C 3 137 ? 88.457 37.845  11.764  1.00 37.16 ? 143  PHE A CD2   1 
ATOM   1478 C  CE1   . PHE C 3 137 ? 90.102 35.708  11.108  1.00 37.13 ? 143  PHE A CE1   1 
ATOM   1479 C  CE2   . PHE C 3 137 ? 89.413 37.992  10.765  1.00 37.02 ? 143  PHE A CE2   1 
ATOM   1480 C  CZ    . PHE C 3 137 ? 90.238 36.920  10.433  1.00 36.52 ? 143  PHE A CZ    1 
ATOM   1481 N  N     . LYS C 3 138 ? 86.879 38.853  15.375  1.00 44.87 ? 144  LYS A N     1 
ATOM   1482 C  CA    . LYS C 3 138 ? 86.913 40.280  15.676  1.00 47.50 ? 144  LYS A CA    1 
ATOM   1483 C  C     . LYS C 3 138 ? 87.680 40.588  16.952  1.00 49.12 ? 144  LYS A C     1 
ATOM   1484 O  O     . LYS C 3 138 ? 88.670 41.323  16.915  1.00 49.72 ? 144  LYS A O     1 
ATOM   1485 C  CB    . LYS C 3 138 ? 85.498 40.854  15.792  1.00 47.36 ? 144  LYS A CB    1 
ATOM   1486 C  CG    . LYS C 3 138 ? 84.734 40.868  14.484  1.00 48.71 ? 144  LYS A CG    1 
ATOM   1487 C  CD    . LYS C 3 138 ? 83.362 41.523  14.617  1.00 50.37 ? 144  LYS A CD    1 
ATOM   1488 C  CE    . LYS C 3 138 ? 83.466 43.029  14.838  1.00 51.36 ? 144  LYS A CE    1 
ATOM   1489 N  NZ    . LYS C 3 138 ? 82.119 43.673  14.826  1.00 51.93 ? 144  LYS A NZ    1 
ATOM   1490 N  N     . ARG C 3 139 ? 87.237 40.040  18.081  1.00 50.36 ? 145  ARG A N     1 
ATOM   1491 C  CA    . ARG C 3 139 ? 87.945 40.314  19.323  1.00 52.95 ? 145  ARG A CA    1 
ATOM   1492 C  C     . ARG C 3 139 ? 89.426 39.981  19.187  1.00 53.20 ? 145  ARG A C     1 
ATOM   1493 O  O     . ARG C 3 139 ? 90.276 40.733  19.664  1.00 53.62 ? 145  ARG A O     1 
ATOM   1494 C  CB    . ARG C 3 139 ? 87.325 39.567  20.520  1.00 53.57 ? 145  ARG A CB    1 
ATOM   1495 C  CG    . ARG C 3 139 ? 86.983 38.106  20.314  1.00 56.00 ? 145  ARG A CG    1 
ATOM   1496 C  CD    . ARG C 3 139 ? 86.596 37.470  21.653  1.00 56.91 ? 145  ARG A CD    1 
ATOM   1497 N  NE    . ARG C 3 139 ? 85.673 36.343  21.511  1.00 58.26 ? 145  ARG A NE    1 
ATOM   1498 C  CZ    . ARG C 3 139 ? 84.380 36.464  21.209  1.00 59.09 ? 145  ARG A CZ    1 
ATOM   1499 N  NH1   . ARG C 3 139 ? 83.846 37.666  21.015  1.00 58.32 ? 145  ARG A NH1   1 
ATOM   1500 N  NH2   . ARG C 3 139 ? 83.616 35.382  21.103  1.00 58.91 ? 145  ARG A NH2   1 
ATOM   1501 N  N     . MET C 3 140 ? 89.744 38.878  18.518  1.00 53.24 ? 146  MET A N     1 
ATOM   1502 C  CA    . MET C 3 140 ? 91.143 38.515  18.340  1.00 53.95 ? 146  MET A CA    1 
ATOM   1503 C  C     . MET C 3 140 ? 91.883 39.576  17.532  1.00 53.77 ? 146  MET A C     1 
ATOM   1504 O  O     . MET C 3 140 ? 93.058 39.839  17.781  1.00 53.04 ? 146  MET A O     1 
ATOM   1505 C  CB    . MET C 3 140 ? 91.268 37.146  17.670  1.00 54.91 ? 146  MET A CB    1 
ATOM   1506 C  CG    . MET C 3 140 ? 90.850 35.999  18.580  1.00 57.49 ? 146  MET A CG    1 
ATOM   1507 S  SD    . MET C 3 140 ? 91.293 34.378  17.936  1.00 61.47 ? 146  MET A SD    1 
ATOM   1508 C  CE    . MET C 3 140 ? 92.907 34.135  18.722  1.00 59.57 ? 146  MET A CE    1 
ATOM   1509 N  N     . LEU C 3 141 ? 91.199 40.190  16.571  1.00 53.82 ? 147  LEU A N     1 
ATOM   1510 C  CA    . LEU C 3 141 ? 91.824 41.239  15.771  1.00 55.00 ? 147  LEU A CA    1 
ATOM   1511 C  C     . LEU C 3 141 ? 92.051 42.483  16.618  1.00 55.27 ? 147  LEU A C     1 
ATOM   1512 O  O     . LEU C 3 141 ? 93.181 42.934  16.782  1.00 54.96 ? 147  LEU A O     1 
ATOM   1513 C  CB    . LEU C 3 141 ? 90.959 41.610  14.564  1.00 55.44 ? 147  LEU A CB    1 
ATOM   1514 C  CG    . LEU C 3 141 ? 91.154 40.797  13.281  1.00 55.36 ? 147  LEU A CG    1 
ATOM   1515 C  CD1   . LEU C 3 141 ? 90.315 41.409  12.167  1.00 55.03 ? 147  LEU A CD1   1 
ATOM   1516 C  CD2   . LEU C 3 141 ? 92.628 40.792  12.892  1.00 54.87 ? 147  LEU A CD2   1 
ATOM   1517 N  N     . GLU C 3 142 ? 90.969 43.036  17.154  1.00 56.71 ? 148  GLU A N     1 
ATOM   1518 C  CA    . GLU C 3 142 ? 91.066 44.228  17.984  1.00 57.74 ? 148  GLU A CA    1 
ATOM   1519 C  C     . GLU C 3 142 ? 92.095 44.031  19.095  1.00 58.13 ? 148  GLU A C     1 
ATOM   1520 O  O     . GLU C 3 142 ? 92.712 44.992  19.554  1.00 59.22 ? 148  GLU A O     1 
ATOM   1521 C  CB    . GLU C 3 142 ? 89.690 44.579  18.557  1.00 58.16 ? 148  GLU A CB    1 
ATOM   1522 C  CG    . GLU C 3 142 ? 88.834 45.406  17.598  1.00 59.19 ? 148  GLU A CG    1 
ATOM   1523 C  CD    . GLU C 3 142 ? 87.438 44.841  17.393  1.00 59.86 ? 148  GLU A CD    1 
ATOM   1524 O  OE1   . GLU C 3 142 ? 86.736 44.592  18.396  1.00 60.14 ? 148  GLU A OE1   1 
ATOM   1525 O  OE2   . GLU C 3 142 ? 87.037 44.654  16.223  1.00 59.86 ? 148  GLU A OE2   1 
ATOM   1526 N  N     . GLU C 3 143 ? 92.285 42.783  19.515  1.00 57.83 ? 149  GLU A N     1 
ATOM   1527 C  CA    . GLU C 3 143 ? 93.266 42.460  20.548  1.00 57.52 ? 149  GLU A CA    1 
ATOM   1528 C  C     . GLU C 3 143 ? 94.666 42.771  20.023  1.00 57.09 ? 149  GLU A C     1 
ATOM   1529 O  O     . GLU C 3 143 ? 95.559 43.147  20.784  1.00 56.96 ? 149  GLU A O     1 
ATOM   1530 C  CB    . GLU C 3 143 ? 93.175 40.979  20.923  1.00 58.56 ? 149  GLU A CB    1 
ATOM   1531 C  CG    . GLU C 3 143 ? 92.240 40.681  22.085  1.00 59.78 ? 149  GLU A CG    1 
ATOM   1532 C  CD    . GLU C 3 143 ? 91.882 39.205  22.186  1.00 61.11 ? 149  GLU A CD    1 
ATOM   1533 O  OE1   . GLU C 3 143 ? 92.794 38.350  22.085  1.00 61.22 ? 149  GLU A OE1   1 
ATOM   1534 O  OE2   . GLU C 3 143 ? 90.683 38.900  22.373  1.00 61.19 ? 149  GLU A OE2   1 
ATOM   1535 N  N     . GLN C 3 144 ? 94.848 42.599  18.717  1.00 56.31 ? 150  GLN A N     1 
ATOM   1536 C  CA    . GLN C 3 144 ? 96.124 42.874  18.066  1.00 56.50 ? 150  GLN A CA    1 
ATOM   1537 C  C     . GLN C 3 144 ? 96.118 44.269  17.440  1.00 56.44 ? 150  GLN A C     1 
ATOM   1538 O  O     . GLN C 3 144 ? 96.870 44.543  16.503  1.00 55.71 ? 150  GLN A O     1 
ATOM   1539 C  CB    . GLN C 3 144 ? 96.410 41.827  16.986  1.00 56.71 ? 150  GLN A CB    1 
ATOM   1540 C  CG    . GLN C 3 144 ? 96.865 40.484  17.527  1.00 58.38 ? 150  GLN A CG    1 
ATOM   1541 C  CD    . GLN C 3 144 ? 98.119 40.599  18.377  1.00 59.37 ? 150  GLN A CD    1 
ATOM   1542 O  OE1   . GLN C 3 144 ? 99.154 41.096  17.919  1.00 59.52 ? 150  GLN A OE1   1 
ATOM   1543 N  NE2   . GLN C 3 144 ? 98.034 40.140  19.622  1.00 58.73 ? 150  GLN A NE2   1 
ATOM   1544 N  N     . GLY C 3 145 ? 95.261 45.142  17.962  1.00 55.86 ? 151  GLY A N     1 
ATOM   1545 C  CA    . GLY C 3 145 ? 95.172 46.498  17.452  1.00 56.08 ? 151  GLY A CA    1 
ATOM   1546 C  C     . GLY C 3 145 ? 94.884 46.585  15.965  1.00 55.62 ? 151  GLY A C     1 
ATOM   1547 O  O     . GLY C 3 145 ? 95.165 47.601  15.325  1.00 54.99 ? 151  GLY A O     1 
ATOM   1548 N  N     . GLU C 3 146 ? 94.320 45.519  15.410  1.00 55.88 ? 152  GLU A N     1 
ATOM   1549 C  CA    . GLU C 3 146 ? 93.992 45.485  13.990  1.00 55.34 ? 152  GLU A CA    1 
ATOM   1550 C  C     . GLU C 3 146 ? 92.521 45.803  13.759  1.00 54.59 ? 152  GLU A C     1 
ATOM   1551 O  O     . GLU C 3 146 ? 91.677 45.528  14.613  1.00 54.79 ? 152  GLU A O     1 
ATOM   1552 C  CB    . GLU C 3 146 ? 94.338 44.110  13.416  1.00 56.74 ? 152  GLU A CB    1 
ATOM   1553 C  CG    . GLU C 3 146 ? 95.833 43.880  13.276  1.00 57.43 ? 152  GLU A CG    1 
ATOM   1554 C  CD    . GLU C 3 146 ? 96.185 42.436  12.994  1.00 58.85 ? 152  GLU A CD    1 
ATOM   1555 O  OE1   . GLU C 3 146 ? 95.600 41.851  12.057  1.00 60.11 ? 152  GLU A OE1   1 
ATOM   1556 O  OE2   . GLU C 3 146 ? 97.054 41.888  13.710  1.00 58.68 ? 152  GLU A OE2   1 
ATOM   1557 N  N     . GLU C 3 147 ? 92.217 46.390  12.605  1.00 52.88 ? 153  GLU A N     1 
ATOM   1558 C  CA    . GLU C 3 147 ? 90.843 46.743  12.271  1.00 51.60 ? 153  GLU A CA    1 
ATOM   1559 C  C     . GLU C 3 147 ? 90.090 45.575  11.631  1.00 49.95 ? 153  GLU A C     1 
ATOM   1560 O  O     . GLU C 3 147 ? 90.686 44.721  10.969  1.00 49.37 ? 153  GLU A O     1 
ATOM   1561 C  CB    . GLU C 3 147 ? 90.820 47.947  11.327  1.00 52.78 ? 153  GLU A CB    1 
ATOM   1562 C  CG    . GLU C 3 147 ? 89.446 48.229  10.731  1.00 55.26 ? 153  GLU A CG    1 
ATOM   1563 C  CD    . GLU C 3 147 ? 89.418 49.481  9.874   1.00 57.66 ? 153  GLU A CD    1 
ATOM   1564 O  OE1   . GLU C 3 147 ? 89.477 50.595  10.446  1.00 57.27 ? 153  GLU A OE1   1 
ATOM   1565 O  OE2   . GLU C 3 147 ? 89.342 49.350  8.629   1.00 58.01 ? 153  GLU A OE2   1 
ATOM   1566 N  N     . TYR C 3 148 ? 88.777 45.544  11.835  1.00 47.11 ? 154  TYR A N     1 
ATOM   1567 C  CA    . TYR C 3 148 ? 87.947 44.486  11.280  1.00 45.00 ? 154  TYR A CA    1 
ATOM   1568 C  C     . TYR C 3 148 ? 87.101 44.979  10.114  1.00 44.02 ? 154  TYR A C     1 
ATOM   1569 O  O     . TYR C 3 148 ? 86.475 46.039  10.188  1.00 44.15 ? 154  TYR A O     1 
ATOM   1570 C  CB    . TYR C 3 148 ? 87.010 43.915  12.349  1.00 43.67 ? 154  TYR A CB    1 
ATOM   1571 C  CG    . TYR C 3 148 ? 85.993 42.946  11.783  1.00 41.59 ? 154  TYR A CG    1 
ATOM   1572 C  CD1   . TYR C 3 148 ? 86.366 41.658  11.409  1.00 39.58 ? 154  TYR A CD1   1 
ATOM   1573 C  CD2   . TYR C 3 148 ? 84.667 43.333  11.578  1.00 40.37 ? 154  TYR A CD2   1 
ATOM   1574 C  CE1   . TYR C 3 148 ? 85.447 40.777  10.844  1.00 39.62 ? 154  TYR A CE1   1 
ATOM   1575 C  CE2   . TYR C 3 148 ? 83.739 42.460  11.011  1.00 39.49 ? 154  TYR A CE2   1 
ATOM   1576 C  CZ    . TYR C 3 148 ? 84.138 41.181  10.646  1.00 39.23 ? 154  TYR A CZ    1 
ATOM   1577 O  OH    . TYR C 3 148 ? 83.239 40.305  10.078  1.00 38.95 ? 154  TYR A OH    1 
ATOM   1578 N  N     . VAL C 3 149 ? 87.091 44.193  9.043   1.00 42.96 ? 155  VAL A N     1 
ATOM   1579 C  CA    . VAL C 3 149 ? 86.311 44.490  7.847   1.00 41.66 ? 155  VAL A CA    1 
ATOM   1580 C  C     . VAL C 3 149 ? 85.253 43.399  7.727   1.00 42.22 ? 155  VAL A C     1 
ATOM   1581 O  O     . VAL C 3 149 ? 85.566 42.207  7.746   1.00 41.01 ? 155  VAL A O     1 
ATOM   1582 C  CB    . VAL C 3 149 ? 87.193 44.487  6.588   1.00 41.70 ? 155  VAL A CB    1 
ATOM   1583 C  CG1   . VAL C 3 149 ? 86.334 44.691  5.352   1.00 40.55 ? 155  VAL A CG1   1 
ATOM   1584 C  CG2   . VAL C 3 149 ? 88.246 45.586  6.696   1.00 41.49 ? 155  VAL A CG2   1 
ATOM   1585 N  N     . ASP C 3 150 ? 83.998 43.812  7.602   1.00 42.79 ? 156  ASP A N     1 
ATOM   1586 C  CA    . ASP C 3 150 ? 82.899 42.867  7.522   1.00 44.03 ? 156  ASP A CA    1 
ATOM   1587 C  C     . ASP C 3 150 ? 83.119 41.666  6.602   1.00 42.75 ? 156  ASP A C     1 
ATOM   1588 O  O     . ASP C 3 150 ? 83.383 41.814  5.406   1.00 42.10 ? 156  ASP A O     1 
ATOM   1589 C  CB    . ASP C 3 150 ? 81.612 43.592  7.132   1.00 46.50 ? 156  ASP A CB    1 
ATOM   1590 C  CG    . ASP C 3 150 ? 80.384 42.724  7.320   1.00 49.54 ? 156  ASP A CG    1 
ATOM   1591 O  OD1   . ASP C 3 150 ? 79.955 42.067  6.345   1.00 51.35 ? 156  ASP A OD1   1 
ATOM   1592 O  OD2   . ASP C 3 150 ? 79.860 42.686  8.455   1.00 50.06 ? 156  ASP A OD2   1 
ATOM   1593 N  N     . GLY C 3 151 ? 83.015 40.475  7.190   1.00 40.87 ? 157  GLY A N     1 
ATOM   1594 C  CA    . GLY C 3 151 ? 83.171 39.236  6.445   1.00 38.77 ? 157  GLY A CA    1 
ATOM   1595 C  C     . GLY C 3 151 ? 84.584 38.773  6.131   1.00 37.28 ? 157  GLY A C     1 
ATOM   1596 O  O     . GLY C 3 151 ? 84.756 37.857  5.326   1.00 35.68 ? 157  GLY A O     1 
ATOM   1597 N  N     . MET C 3 152 ? 85.593 39.376  6.758   1.00 35.14 ? 158  MET A N     1 
ATOM   1598 C  CA    . MET C 3 152 ? 86.972 38.989  6.480   1.00 33.70 ? 158  MET A CA    1 
ATOM   1599 C  C     . MET C 3 152 ? 87.355 37.671  7.154   1.00 31.24 ? 158  MET A C     1 
ATOM   1600 O  O     . MET C 3 152 ? 88.345 37.039  6.781   1.00 30.02 ? 158  MET A O     1 
ATOM   1601 C  CB    . MET C 3 152 ? 87.945 40.106  6.899   1.00 34.69 ? 158  MET A CB    1 
ATOM   1602 C  CG    . MET C 3 152 ? 88.292 40.152  8.381   1.00 37.45 ? 158  MET A CG    1 
ATOM   1603 S  SD    . MET C 3 152 ? 89.337 41.578  8.812   1.00 40.84 ? 158  MET A SD    1 
ATOM   1604 C  CE    . MET C 3 152 ? 90.983 40.964  8.397   1.00 39.11 ? 158  MET A CE    1 
ATOM   1605 N  N     . GLU C 3 153 ? 86.565 37.250  8.138   1.00 28.59 ? 159  GLU A N     1 
ATOM   1606 C  CA    . GLU C 3 153 ? 86.849 36.003  8.833   1.00 26.17 ? 159  GLU A CA    1 
ATOM   1607 C  C     . GLU C 3 153 ? 86.743 34.824  7.869   1.00 25.68 ? 159  GLU A C     1 
ATOM   1608 O  O     . GLU C 3 153 ? 87.249 33.743  8.157   1.00 23.79 ? 159  GLU A O     1 
ATOM   1609 C  CB    . GLU C 3 153 ? 85.875 35.790  9.998   1.00 26.02 ? 159  GLU A CB    1 
ATOM   1610 C  CG    . GLU C 3 153 ? 84.430 35.589  9.577   1.00 27.68 ? 159  GLU A CG    1 
ATOM   1611 C  CD    . GLU C 3 153 ? 83.644 36.887  9.463   1.00 29.41 ? 159  GLU A CD    1 
ATOM   1612 O  OE1   . GLU C 3 153 ? 84.242 37.946  9.163   1.00 30.31 ? 159  GLU A OE1   1 
ATOM   1613 O  OE2   . GLU C 3 153 ? 82.413 36.841  9.663   1.00 33.55 ? 159  GLU A OE2   1 
ATOM   1614 N  N     . TRP C 3 154 ? 86.100 35.039  6.724   1.00 26.12 ? 160  TRP A N     1 
ATOM   1615 C  CA    . TRP C 3 154 ? 85.918 33.973  5.741   1.00 26.18 ? 160  TRP A CA    1 
ATOM   1616 C  C     . TRP C 3 154 ? 86.836 33.983  4.521   1.00 26.39 ? 160  TRP A C     1 
ATOM   1617 O  O     . TRP C 3 154 ? 86.760 33.079  3.688   1.00 22.67 ? 160  TRP A O     1 
ATOM   1618 C  CB    . TRP C 3 154 ? 84.463 33.956  5.266   1.00 26.60 ? 160  TRP A CB    1 
ATOM   1619 C  CG    . TRP C 3 154 ? 83.534 33.496  6.340   1.00 28.05 ? 160  TRP A CG    1 
ATOM   1620 C  CD1   . TRP C 3 154 ? 82.613 34.246  7.014   1.00 26.09 ? 160  TRP A CD1   1 
ATOM   1621 C  CD2   . TRP C 3 154 ? 83.519 32.201  6.944   1.00 27.28 ? 160  TRP A CD2   1 
ATOM   1622 N  NE1   . TRP C 3 154 ? 82.033 33.498  8.010   1.00 27.50 ? 160  TRP A NE1   1 
ATOM   1623 C  CE2   . TRP C 3 154 ? 82.572 32.238  7.990   1.00 27.17 ? 160  TRP A CE2   1 
ATOM   1624 C  CE3   . TRP C 3 154 ? 84.221 31.010  6.706   1.00 28.73 ? 160  TRP A CE3   1 
ATOM   1625 C  CZ2   . TRP C 3 154 ? 82.308 31.131  8.801   1.00 27.82 ? 160  TRP A CZ2   1 
ATOM   1626 C  CZ3   . TRP C 3 154 ? 83.958 29.907  7.513   1.00 28.02 ? 160  TRP A CZ3   1 
ATOM   1627 C  CH2   . TRP C 3 154 ? 83.009 29.978  8.548   1.00 28.05 ? 160  TRP A CH2   1 
ATOM   1628 N  N     . TRP C 3 155 ? 87.706 34.984  4.412   1.00 25.83 ? 161  TRP A N     1 
ATOM   1629 C  CA    . TRP C 3 155 ? 88.583 35.071  3.252   1.00 26.07 ? 161  TRP A CA    1 
ATOM   1630 C  C     . TRP C 3 155 ? 89.725 34.068  3.283   1.00 26.20 ? 161  TRP A C     1 
ATOM   1631 O  O     . TRP C 3 155 ? 90.114 33.531  2.250   1.00 25.25 ? 161  TRP A O     1 
ATOM   1632 C  CB    . TRP C 3 155 ? 89.170 36.483  3.110   1.00 28.10 ? 161  TRP A CB    1 
ATOM   1633 C  CG    . TRP C 3 155 ? 88.149 37.595  3.068   1.00 31.42 ? 161  TRP A CG    1 
ATOM   1634 C  CD1   . TRP C 3 155 ? 86.804 37.476  2.842   1.00 32.45 ? 161  TRP A CD1   1 
ATOM   1635 C  CD2   . TRP C 3 155 ? 88.404 38.993  3.235   1.00 31.21 ? 161  TRP A CD2   1 
ATOM   1636 N  NE1   . TRP C 3 155 ? 86.208 38.716  2.861   1.00 31.92 ? 161  TRP A NE1   1 
ATOM   1637 C  CE2   . TRP C 3 155 ? 87.168 39.664  3.100   1.00 32.05 ? 161  TRP A CE2   1 
ATOM   1638 C  CE3   . TRP C 3 155 ? 89.560 39.745  3.486   1.00 32.78 ? 161  TRP A CE3   1 
ATOM   1639 C  CZ2   . TRP C 3 155 ? 87.052 41.059  3.209   1.00 32.88 ? 161  TRP A CZ2   1 
ATOM   1640 C  CZ3   . TRP C 3 155 ? 89.445 41.135  3.595   1.00 34.61 ? 161  TRP A CZ3   1 
ATOM   1641 C  CH2   . TRP C 3 155 ? 88.196 41.773  3.455   1.00 32.45 ? 161  TRP A CH2   1 
ATOM   1642 N  N     . ASN C 3 156 ? 90.262 33.813  4.467   1.00 26.87 ? 162  ASN A N     1 
ATOM   1643 C  CA    . ASN C 3 156 ? 91.380 32.893  4.579   1.00 28.62 ? 162  ASN A CA    1 
ATOM   1644 C  C     . ASN C 3 156 ? 91.183 31.806  5.619   1.00 28.93 ? 162  ASN A C     1 
ATOM   1645 O  O     . ASN C 3 156 ? 90.457 31.972  6.606   1.00 29.87 ? 162  ASN A O     1 
ATOM   1646 C  CB    . ASN C 3 156 ? 92.658 33.671  4.908   1.00 28.78 ? 162  ASN A CB    1 
ATOM   1647 C  CG    . ASN C 3 156 ? 92.975 34.732  3.871   1.00 31.35 ? 162  ASN A CG    1 
ATOM   1648 O  OD1   . ASN C 3 156 ? 93.425 34.419  2.771   1.00 30.52 ? 162  ASN A OD1   1 
ATOM   1649 N  ND2   . ASN C 3 156 ? 92.725 36.001  4.217   1.00 31.97 ? 162  ASN A ND2   1 
ATOM   1650 N  N     . PHE C 3 157 ? 91.834 30.682  5.370   1.00 28.79 ? 163  PHE A N     1 
ATOM   1651 C  CA    . PHE C 3 157 ? 91.792 29.562  6.277   1.00 28.58 ? 163  PHE A CA    1 
ATOM   1652 C  C     . PHE C 3 157 ? 92.693 29.909  7.453   1.00 29.14 ? 163  PHE A C     1 
ATOM   1653 O  O     . PHE C 3 157 ? 93.665 30.638  7.303   1.00 30.13 ? 163  PHE A O     1 
ATOM   1654 C  CB    . PHE C 3 157 ? 92.344 28.312  5.597   1.00 27.57 ? 163  PHE A CB    1 
ATOM   1655 C  CG    . PHE C 3 157 ? 92.768 27.239  6.563   1.00 27.93 ? 163  PHE A CG    1 
ATOM   1656 C  CD1   . PHE C 3 157 ? 91.832 26.398  7.143   1.00 26.48 ? 163  PHE A CD1   1 
ATOM   1657 C  CD2   . PHE C 3 157 ? 94.105 27.104  6.923   1.00 28.39 ? 163  PHE A CD2   1 
ATOM   1658 C  CE1   . PHE C 3 157 ? 92.213 25.437  8.070   1.00 29.26 ? 163  PHE A CE1   1 
ATOM   1659 C  CE2   . PHE C 3 157 ? 94.500 26.143  7.854   1.00 29.70 ? 163  PHE A CE2   1 
ATOM   1660 C  CZ    . PHE C 3 157 ? 93.549 25.308  8.429   1.00 29.10 ? 163  PHE A CZ    1 
ATOM   1661 N  N     . ASN C 3 158 ? 92.356 29.387  8.621   1.00 29.46 ? 164  ASN A N     1 
ATOM   1662 C  CA    . ASN C 3 158 ? 93.163 29.588  9.811   1.00 29.78 ? 164  ASN A CA    1 
ATOM   1663 C  C     . ASN C 3 158 ? 92.745 28.500  10.794  1.00 29.83 ? 164  ASN A C     1 
ATOM   1664 O  O     . ASN C 3 158 ? 91.654 27.931  10.676  1.00 28.90 ? 164  ASN A O     1 
ATOM   1665 C  CB    . ASN C 3 158 ? 92.965 30.999  10.388  1.00 29.89 ? 164  ASN A CB    1 
ATOM   1666 C  CG    . ASN C 3 158 ? 91.534 31.281  10.773  1.00 29.24 ? 164  ASN A CG    1 
ATOM   1667 O  OD1   . ASN C 3 158 ? 91.014 30.709  11.730  1.00 30.38 ? 164  ASN A OD1   1 
ATOM   1668 N  ND2   . ASN C 3 158 ? 90.885 32.168  10.028  1.00 27.88 ? 164  ASN A ND2   1 
ATOM   1669 N  N     . GLU C 3 159 ? 93.623 28.195  11.740  1.00 30.71 ? 165  GLU A N     1 
ATOM   1670 C  CA    . GLU C 3 159 ? 93.364 27.144  12.712  1.00 30.56 ? 165  GLU A CA    1 
ATOM   1671 C  C     . GLU C 3 159 ? 92.146 27.380  13.589  1.00 29.31 ? 165  GLU A C     1 
ATOM   1672 O  O     . GLU C 3 159 ? 91.641 26.449  14.205  1.00 28.84 ? 165  GLU A O     1 
ATOM   1673 C  CB    . GLU C 3 159 ? 94.605 26.917  13.576  1.00 33.22 ? 165  GLU A CB    1 
ATOM   1674 C  CG    . GLU C 3 159 ? 95.807 26.351  12.813  1.00 36.29 ? 165  GLU A CG    1 
ATOM   1675 C  CD    . GLU C 3 159 ? 95.517 25.019  12.106  1.00 38.78 ? 165  GLU A CD    1 
ATOM   1676 O  OE1   . GLU C 3 159 ? 94.895 24.117  12.720  1.00 36.92 ? 165  GLU A OE1   1 
ATOM   1677 O  OE2   . GLU C 3 159 ? 95.930 24.873  10.931  1.00 39.30 ? 165  GLU A OE2   1 
ATOM   1678 N  N     . GLU C 3 160 ? 91.673 28.622  13.652  1.00 30.15 ? 166  GLU A N     1 
ATOM   1679 C  CA    . GLU C 3 160 ? 90.489 28.936  14.444  1.00 29.13 ? 166  GLU A CA    1 
ATOM   1680 C  C     . GLU C 3 160 ? 89.306 28.347  13.681  1.00 28.12 ? 166  GLU A C     1 
ATOM   1681 O  O     . GLU C 3 160 ? 88.432 27.711  14.258  1.00 28.77 ? 166  GLU A O     1 
ATOM   1682 C  CB    . GLU C 3 160 ? 90.318 30.455  14.593  1.00 28.64 ? 166  GLU A CB    1 
ATOM   1683 N  N     . MET C 3 161 ? 89.302 28.566  12.373  1.00 27.34 ? 167  MET A N     1 
ATOM   1684 C  CA    . MET C 3 161 ? 88.262 28.056  11.487  1.00 27.21 ? 167  MET A CA    1 
ATOM   1685 C  C     . MET C 3 161 ? 88.322 26.526  11.512  1.00 28.38 ? 167  MET A C     1 
ATOM   1686 O  O     . MET C 3 161 ? 87.293 25.850  11.521  1.00 28.06 ? 167  MET A O     1 
ATOM   1687 C  CB    . MET C 3 161 ? 88.515 28.565  10.070  1.00 27.22 ? 167  MET A CB    1 
ATOM   1688 C  CG    . MET C 3 161 ? 87.524 28.112  9.016   1.00 24.05 ? 167  MET A CG    1 
ATOM   1689 S  SD    . MET C 3 161 ? 88.071 28.686  7.397   1.00 28.31 ? 167  MET A SD    1 
ATOM   1690 C  CE    . MET C 3 161 ? 87.698 30.455  7.497   1.00 24.18 ? 167  MET A CE    1 
ATOM   1691 N  N     . MET C 3 162 ? 89.543 25.995  11.527  1.00 28.25 ? 168  MET A N     1 
ATOM   1692 C  CA    . MET C 3 162 ? 89.770 24.555  11.568  1.00 27.57 ? 168  MET A CA    1 
ATOM   1693 C  C     . MET C 3 162 ? 89.128 23.983  12.834  1.00 28.20 ? 168  MET A C     1 
ATOM   1694 O  O     . MET C 3 162 ? 88.438 22.960  12.778  1.00 28.75 ? 168  MET A O     1 
ATOM   1695 C  CB    . MET C 3 162 ? 91.280 24.262  11.564  1.00 27.56 ? 168  MET A CB    1 
ATOM   1696 C  CG    . MET C 3 162 ? 91.667 22.776  11.461  1.00 27.95 ? 168  MET A CG    1 
ATOM   1697 S  SD    . MET C 3 162 ? 91.504 22.061  9.789   1.00 29.96 ? 168  MET A SD    1 
ATOM   1698 C  CE    . MET C 3 162 ? 89.900 21.215  9.913   1.00 26.95 ? 168  MET A CE    1 
ATOM   1699 N  N     . ASP C 3 163 ? 89.349 24.644  13.971  1.00 27.46 ? 169  ASP A N     1 
ATOM   1700 C  CA    . ASP C 3 163 ? 88.784 24.182  15.240  1.00 27.13 ? 169  ASP A CA    1 
ATOM   1701 C  C     . ASP C 3 163 ? 87.257 24.218  15.248  1.00 27.25 ? 169  ASP A C     1 
ATOM   1702 O  O     . ASP C 3 163 ? 86.618 23.369  15.864  1.00 27.40 ? 169  ASP A O     1 
ATOM   1703 C  CB    . ASP C 3 163 ? 89.304 25.016  16.420  1.00 28.44 ? 169  ASP A CB    1 
ATOM   1704 C  CG    . ASP C 3 163 ? 90.784 24.775  16.714  1.00 30.36 ? 169  ASP A CG    1 
ATOM   1705 O  OD1   . ASP C 3 163 ? 91.360 23.784  16.208  1.00 30.41 ? 169  ASP A OD1   1 
ATOM   1706 O  OD2   . ASP C 3 163 ? 91.368 25.580  17.472  1.00 29.80 ? 169  ASP A OD2   1 
ATOM   1707 N  N     . TYR C 3 164 ? 86.665 25.210  14.589  1.00 27.27 ? 170  TYR A N     1 
ATOM   1708 C  CA    . TYR C 3 164 ? 85.209 25.285  14.542  1.00 27.53 ? 170  TYR A CA    1 
ATOM   1709 C  C     . TYR C 3 164 ? 84.666 24.152  13.678  1.00 27.09 ? 170  TYR A C     1 
ATOM   1710 O  O     . TYR C 3 164 ? 83.622 23.574  13.980  1.00 27.59 ? 170  TYR A O     1 
ATOM   1711 C  CB    . TYR C 3 164 ? 84.761 26.640  13.997  1.00 28.04 ? 170  TYR A CB    1 
ATOM   1712 C  CG    . TYR C 3 164 ? 84.509 27.668  15.078  1.00 30.92 ? 170  TYR A CG    1 
ATOM   1713 C  CD1   . TYR C 3 164 ? 83.278 27.720  15.738  1.00 31.85 ? 170  TYR A CD1   1 
ATOM   1714 C  CD2   . TYR C 3 164 ? 85.498 28.585  15.451  1.00 30.59 ? 170  TYR A CD2   1 
ATOM   1715 C  CE1   . TYR C 3 164 ? 83.029 28.659  16.735  1.00 31.79 ? 170  TYR A CE1   1 
ATOM   1716 C  CE2   . TYR C 3 164 ? 85.259 29.532  16.458  1.00 31.31 ? 170  TYR A CE2   1 
ATOM   1717 C  CZ    . TYR C 3 164 ? 84.019 29.561  17.090  1.00 32.15 ? 170  TYR A CZ    1 
ATOM   1718 O  OH    . TYR C 3 164 ? 83.749 30.504  18.059  1.00 34.44 ? 170  TYR A OH    1 
ATOM   1719 N  N     . ASN C 3 165 ? 85.386 23.844  12.607  1.00 26.57 ? 171  ASN A N     1 
ATOM   1720 C  CA    . ASN C 3 165 ? 85.018 22.767  11.692  1.00 27.49 ? 171  ASN A CA    1 
ATOM   1721 C  C     . ASN C 3 165 ? 84.902 21.455  12.482  1.00 26.47 ? 171  ASN A C     1 
ATOM   1722 O  O     . ASN C 3 165 ? 83.922 20.725  12.346  1.00 27.00 ? 171  ASN A O     1 
ATOM   1723 C  CB    . ASN C 3 165 ? 86.091 22.634  10.604  1.00 27.42 ? 171  ASN A CB    1 
ATOM   1724 C  CG    . ASN C 3 165 ? 85.612 21.863  9.382   1.00 28.83 ? 171  ASN A CG    1 
ATOM   1725 O  OD1   . ASN C 3 165 ? 86.361 21.692  8.425   1.00 31.01 ? 171  ASN A OD1   1 
ATOM   1726 N  ND2   . ASN C 3 165 ? 84.363 21.405  9.405   1.00 29.73 ? 171  ASN A ND2   1 
ATOM   1727 N  N     . VAL C 3 166 ? 85.904 21.170  13.311  1.00 27.13 ? 172  VAL A N     1 
ATOM   1728 C  CA    . VAL C 3 166 ? 85.916 19.956  14.130  1.00 25.91 ? 172  VAL A CA    1 
ATOM   1729 C  C     . VAL C 3 166 ? 84.760 20.001  15.126  1.00 26.87 ? 172  VAL A C     1 
ATOM   1730 O  O     . VAL C 3 166 ? 84.113 18.982  15.388  1.00 24.30 ? 172  VAL A O     1 
ATOM   1731 C  CB    . VAL C 3 166 ? 87.246 19.810  14.923  1.00 28.74 ? 172  VAL A CB    1 
ATOM   1732 C  CG1   . VAL C 3 166 ? 87.154 18.627  15.901  1.00 28.47 ? 172  VAL A CG1   1 
ATOM   1733 C  CG2   . VAL C 3 166 ? 88.415 19.603  13.958  1.00 26.03 ? 172  VAL A CG2   1 
ATOM   1734 N  N     . GLN C 3 167 ? 84.497 21.180  15.687  1.00 27.08 ? 173  GLN A N     1 
ATOM   1735 C  CA    . GLN C 3 167 ? 83.394 21.297  16.633  1.00 28.86 ? 173  GLN A CA    1 
ATOM   1736 C  C     . GLN C 3 167 ? 82.058 21.011  15.929  1.00 27.63 ? 173  GLN A C     1 
ATOM   1737 O  O     . GLN C 3 167 ? 81.204 20.321  16.479  1.00 29.07 ? 173  GLN A O     1 
ATOM   1738 C  CB    . GLN C 3 167 ? 83.367 22.687  17.293  1.00 30.58 ? 173  GLN A CB    1 
ATOM   1739 C  CG    . GLN C 3 167 ? 82.309 22.821  18.394  1.00 34.18 ? 173  GLN A CG    1 
ATOM   1740 C  CD    . GLN C 3 167 ? 82.433 24.109  19.207  1.00 39.82 ? 173  GLN A CD    1 
ATOM   1741 O  OE1   . GLN C 3 167 ? 82.333 25.215  18.667  1.00 41.39 ? 173  GLN A OE1   1 
ATOM   1742 N  NE2   . GLN C 3 167 ? 82.645 23.967  20.517  1.00 40.63 ? 173  GLN A NE2   1 
ATOM   1743 N  N     . ASP C 3 168 ? 81.877 21.518  14.712  1.00 27.01 ? 174  ASP A N     1 
ATOM   1744 C  CA    . ASP C 3 168 ? 80.625 21.269  13.990  1.00 28.66 ? 174  ASP A CA    1 
ATOM   1745 C  C     . ASP C 3 168 ? 80.367 19.773  13.810  1.00 26.93 ? 174  ASP A C     1 
ATOM   1746 O  O     . ASP C 3 168 ? 79.236 19.315  13.964  1.00 26.37 ? 174  ASP A O     1 
ATOM   1747 C  CB    . ASP C 3 168 ? 80.616 21.942  12.614  1.00 29.31 ? 174  ASP A CB    1 
ATOM   1748 C  CG    . ASP C 3 168 ? 80.347 23.432  12.694  1.00 35.02 ? 174  ASP A CG    1 
ATOM   1749 O  OD1   . ASP C 3 168 ? 79.751 23.882  13.701  1.00 34.37 ? 174  ASP A OD1   1 
ATOM   1750 O  OD2   . ASP C 3 168 ? 80.721 24.157  11.743  1.00 37.76 ? 174  ASP A OD2   1 
ATOM   1751 N  N     . VAL C 3 169 ? 81.410 19.014  13.490  1.00 24.96 ? 175  VAL A N     1 
ATOM   1752 C  CA    . VAL C 3 169 ? 81.241 17.583  13.303  1.00 24.91 ? 175  VAL A CA    1 
ATOM   1753 C  C     . VAL C 3 169 ? 80.937 16.894  14.632  1.00 24.82 ? 175  VAL A C     1 
ATOM   1754 O  O     . VAL C 3 169 ? 80.137 15.968  14.667  1.00 26.19 ? 175  VAL A O     1 
ATOM   1755 C  CB    . VAL C 3 169 ? 82.482 16.934  12.650  1.00 25.26 ? 175  VAL A CB    1 
ATOM   1756 C  CG1   . VAL C 3 169 ? 82.249 15.438  12.471  1.00 21.00 ? 175  VAL A CG1   1 
ATOM   1757 C  CG2   . VAL C 3 169 ? 82.767 17.588  11.304  1.00 24.59 ? 175  VAL A CG2   1 
ATOM   1758 N  N     . VAL C 3 170 ? 81.551 17.343  15.727  1.00 26.49 ? 176  VAL A N     1 
ATOM   1759 C  CA    . VAL C 3 170 ? 81.271 16.724  17.022  1.00 26.98 ? 176  VAL A CA    1 
ATOM   1760 C  C     . VAL C 3 170 ? 79.808 16.956  17.418  1.00 26.69 ? 176  VAL A C     1 
ATOM   1761 O  O     . VAL C 3 170 ? 79.112 16.032  17.848  1.00 27.46 ? 176  VAL A O     1 
ATOM   1762 C  CB    . VAL C 3 170 ? 82.197 17.260  18.157  1.00 27.56 ? 176  VAL A CB    1 
ATOM   1763 C  CG1   . VAL C 3 170 ? 83.656 17.013  17.806  1.00 28.41 ? 176  VAL A CG1   1 
ATOM   1764 C  CG2   . VAL C 3 170 ? 81.970 18.736  18.375  1.00 31.67 ? 176  VAL A CG2   1 
ATOM   1765 N  N     . VAL C 3 171 ? 79.343 18.192  17.265  1.00 26.15 ? 177  VAL A N     1 
ATOM   1766 C  CA    . VAL C 3 171 ? 77.966 18.530  17.598  1.00 25.51 ? 177  VAL A CA    1 
ATOM   1767 C  C     . VAL C 3 171 ? 76.985 17.820  16.661  1.00 25.78 ? 177  VAL A C     1 
ATOM   1768 O  O     . VAL C 3 171 ? 75.956 17.312  17.099  1.00 25.61 ? 177  VAL A O     1 
ATOM   1769 C  CB    . VAL C 3 171 ? 77.741 20.051  17.518  1.00 24.98 ? 177  VAL A CB    1 
ATOM   1770 C  CG1   . VAL C 3 171 ? 76.262 20.372  17.646  1.00 22.23 ? 177  VAL A CG1   1 
ATOM   1771 C  CG2   . VAL C 3 171 ? 78.545 20.744  18.619  1.00 24.89 ? 177  VAL A CG2   1 
ATOM   1772 N  N     . THR C 3 172 ? 77.318 17.781  15.376  1.00 25.45 ? 178  THR A N     1 
ATOM   1773 C  CA    . THR C 3 172 ? 76.472 17.133  14.380  1.00 25.52 ? 178  THR A CA    1 
ATOM   1774 C  C     . THR C 3 172 ? 76.318 15.646  14.673  1.00 26.71 ? 178  THR A C     1 
ATOM   1775 O  O     . THR C 3 172 ? 75.234 15.077  14.498  1.00 28.04 ? 178  THR A O     1 
ATOM   1776 C  CB    . THR C 3 172 ? 77.057 17.332  12.978  1.00 25.75 ? 178  THR A CB    1 
ATOM   1777 O  OG1   . THR C 3 172 ? 77.057 18.733  12.675  1.00 25.02 ? 178  THR A OG1   1 
ATOM   1778 C  CG2   . THR C 3 172 ? 76.243 16.577  11.932  1.00 22.17 ? 178  THR A CG2   1 
ATOM   1779 N  N     . LYS C 3 173 ? 77.402 15.019  15.120  1.00 26.06 ? 179  LYS A N     1 
ATOM   1780 C  CA    . LYS C 3 173 ? 77.370 13.605  15.466  1.00 26.32 ? 179  LYS A CA    1 
ATOM   1781 C  C     . LYS C 3 173 ? 76.407 13.406  16.638  1.00 26.35 ? 179  LYS A C     1 
ATOM   1782 O  O     . LYS C 3 173 ? 75.599 12.477  16.643  1.00 25.61 ? 179  LYS A O     1 
ATOM   1783 C  CB    . LYS C 3 173 ? 78.764 13.113  15.867  1.00 26.35 ? 179  LYS A CB    1 
ATOM   1784 C  CG    . LYS C 3 173 ? 78.789 11.666  16.379  1.00 27.54 ? 179  LYS A CG    1 
ATOM   1785 C  CD    . LYS C 3 173 ? 80.222 11.184  16.634  1.00 30.60 ? 179  LYS A CD    1 
ATOM   1786 C  CE    . LYS C 3 173 ? 80.254 9.765   17.211  1.00 32.84 ? 179  LYS A CE    1 
ATOM   1787 N  NZ    . LYS C 3 173 ? 79.758 9.713   18.616  1.00 33.74 ? 179  LYS A NZ    1 
ATOM   1788 N  N     . ALA C 3 174 ? 76.514 14.284  17.630  1.00 26.13 ? 180  ALA A N     1 
ATOM   1789 C  CA    . ALA C 3 174 ? 75.656 14.216  18.802  1.00 26.86 ? 180  ALA A CA    1 
ATOM   1790 C  C     . ALA C 3 174 ? 74.195 14.460  18.396  1.00 26.96 ? 180  ALA A C     1 
ATOM   1791 O  O     . ALA C 3 174 ? 73.297 13.760  18.861  1.00 26.83 ? 180  ALA A O     1 
ATOM   1792 C  CB    . ALA C 3 174 ? 76.104 15.243  19.841  1.00 25.01 ? 180  ALA A CB    1 
ATOM   1793 N  N     . LEU C 3 175 ? 73.963 15.443  17.528  1.00 26.18 ? 181  LEU A N     1 
ATOM   1794 C  CA    . LEU C 3 175 ? 72.604 15.736  17.068  1.00 26.70 ? 181  LEU A CA    1 
ATOM   1795 C  C     . LEU C 3 175 ? 72.055 14.480  16.398  1.00 25.32 ? 181  LEU A C     1 
ATOM   1796 O  O     . LEU C 3 175 ? 70.970 14.016  16.732  1.00 26.16 ? 181  LEU A O     1 
ATOM   1797 C  CB    . LEU C 3 175 ? 72.599 16.878  16.048  1.00 26.43 ? 181  LEU A CB    1 
ATOM   1798 C  CG    . LEU C 3 175 ? 71.395 17.828  15.969  1.00 28.70 ? 181  LEU A CG    1 
ATOM   1799 C  CD1   . LEU C 3 175 ? 71.367 18.448  14.578  1.00 27.02 ? 181  LEU A CD1   1 
ATOM   1800 C  CD2   . LEU C 3 175 ? 70.086 17.121  16.251  1.00 27.86 ? 181  LEU A CD2   1 
ATOM   1801 N  N     . LEU C 3 176 ? 72.827 13.941  15.454  1.00 24.06 ? 182  LEU A N     1 
ATOM   1802 C  CA    . LEU C 3 176 ? 72.456 12.740  14.712  1.00 22.78 ? 182  LEU A CA    1 
ATOM   1803 C  C     . LEU C 3 176 ? 71.992 11.581  15.593  1.00 24.06 ? 182  LEU A C     1 
ATOM   1804 O  O     . LEU C 3 176 ? 70.912 11.033  15.382  1.00 24.43 ? 182  LEU A O     1 
ATOM   1805 C  CB    . LEU C 3 176 ? 73.630 12.257  13.863  1.00 20.38 ? 182  LEU A CB    1 
ATOM   1806 C  CG    . LEU C 3 176 ? 73.434 10.904  13.167  1.00 22.47 ? 182  LEU A CG    1 
ATOM   1807 C  CD1   . LEU C 3 176 ? 72.445 11.067  12.028  1.00 21.47 ? 182  LEU A CD1   1 
ATOM   1808 C  CD2   . LEU C 3 176 ? 74.777 10.384  12.642  1.00 20.35 ? 182  LEU A CD2   1 
ATOM   1809 N  N     . GLU C 3 177 ? 72.816 11.204  16.566  1.00 23.83 ? 183  GLU A N     1 
ATOM   1810 C  CA    . GLU C 3 177 ? 72.489 10.095  17.453  1.00 25.54 ? 183  GLU A CA    1 
ATOM   1811 C  C     . GLU C 3 177 ? 71.267 10.401  18.313  1.00 25.35 ? 183  GLU A C     1 
ATOM   1812 O  O     . GLU C 3 177 ? 70.531 9.499   18.700  1.00 24.38 ? 183  GLU A O     1 
ATOM   1813 C  CB    . GLU C 3 177 ? 73.709 9.745   18.315  1.00 26.45 ? 183  GLU A CB    1 
ATOM   1814 C  CG    . GLU C 3 177 ? 74.869 9.221   17.462  1.00 30.04 ? 183  GLU A CG    1 
ATOM   1815 C  CD    . GLU C 3 177 ? 76.146 8.972   18.242  1.00 33.29 ? 183  GLU A CD    1 
ATOM   1816 O  OE1   . GLU C 3 177 ? 76.181 9.281   19.456  1.00 34.34 ? 183  GLU A OE1   1 
ATOM   1817 O  OE2   . GLU C 3 177 ? 77.120 8.467   17.631  1.00 33.07 ? 183  GLU A OE2   1 
ATOM   1818 N  N     . LYS C 3 178 ? 71.049 11.679  18.598  1.00 24.59 ? 184  LYS A N     1 
ATOM   1819 C  CA    . LYS C 3 178 ? 69.894 12.077  19.382  1.00 25.14 ? 184  LYS A CA    1 
ATOM   1820 C  C     . LYS C 3 178 ? 68.645 11.866  18.506  1.00 23.29 ? 184  LYS A C     1 
ATOM   1821 O  O     . LYS C 3 178 ? 67.619 11.373  18.973  1.00 22.49 ? 184  LYS A O     1 
ATOM   1822 C  CB    . LYS C 3 178 ? 70.046 13.544  19.802  1.00 27.77 ? 184  LYS A CB    1 
ATOM   1823 C  CG    . LYS C 3 178 ? 68.885 14.129  20.598  1.00 31.63 ? 184  LYS A CG    1 
ATOM   1824 C  CD    . LYS C 3 178 ? 69.158 15.607  20.904  1.00 33.64 ? 184  LYS A CD    1 
ATOM   1825 C  CE    . LYS C 3 178 ? 67.931 16.307  21.471  1.00 36.73 ? 184  LYS A CE    1 
ATOM   1826 N  NZ    . LYS C 3 178 ? 68.136 17.787  21.575  1.00 38.32 ? 184  LYS A NZ    1 
ATOM   1827 N  N     . LEU C 3 179 ? 68.747 12.218  17.228  1.00 22.17 ? 185  LEU A N     1 
ATOM   1828 C  CA    . LEU C 3 179 ? 67.632 12.041  16.300  1.00 22.97 ? 185  LEU A CA    1 
ATOM   1829 C  C     . LEU C 3 179 ? 67.392 10.545  16.061  1.00 22.98 ? 185  LEU A C     1 
ATOM   1830 O  O     . LEU C 3 179 ? 66.245 10.076  16.042  1.00 21.73 ? 185  LEU A O     1 
ATOM   1831 C  CB    . LEU C 3 179 ? 67.930 12.751  14.975  1.00 21.57 ? 185  LEU A CB    1 
ATOM   1832 C  CG    . LEU C 3 179 ? 67.980 14.278  15.128  1.00 24.64 ? 185  LEU A CG    1 
ATOM   1833 C  CD1   . LEU C 3 179 ? 68.496 14.952  13.856  1.00 22.92 ? 185  LEU A CD1   1 
ATOM   1834 C  CD2   . LEU C 3 179 ? 66.579 14.772  15.464  1.00 24.10 ? 185  LEU A CD2   1 
ATOM   1835 N  N     . LEU C 3 180 ? 68.482 9.803   15.898  1.00 23.13 ? 186  LEU A N     1 
ATOM   1836 C  CA    . LEU C 3 180 ? 68.400 8.363   15.676  1.00 24.91 ? 186  LEU A CA    1 
ATOM   1837 C  C     . LEU C 3 180 ? 67.793 7.616   16.866  1.00 25.67 ? 186  LEU A C     1 
ATOM   1838 O  O     . LEU C 3 180 ? 67.294 6.506   16.713  1.00 26.92 ? 186  LEU A O     1 
ATOM   1839 C  CB    . LEU C 3 180 ? 69.793 7.792   15.371  1.00 22.86 ? 186  LEU A CB    1 
ATOM   1840 C  CG    . LEU C 3 180 ? 70.345 8.137   13.984  1.00 20.34 ? 186  LEU A CG    1 
ATOM   1841 C  CD1   . LEU C 3 180 ? 71.681 7.478   13.779  1.00 17.03 ? 186  LEU A CD1   1 
ATOM   1842 C  CD2   . LEU C 3 180 ? 69.353 7.676   12.923  1.00 21.97 ? 186  LEU A CD2   1 
ATOM   1843 N  N     . SER C 3 181 ? 67.830 8.222   18.047  1.00 28.09 ? 187  SER A N     1 
ATOM   1844 C  CA    . SER C 3 181 ? 67.276 7.572   19.229  1.00 28.47 ? 187  SER A CA    1 
ATOM   1845 C  C     . SER C 3 181 ? 65.752 7.680   19.295  1.00 28.82 ? 187  SER A C     1 
ATOM   1846 O  O     . SER C 3 181 ? 65.129 7.101   20.183  1.00 30.20 ? 187  SER A O     1 
ATOM   1847 C  CB    . SER C 3 181 ? 67.892 8.155   20.505  1.00 27.41 ? 187  SER A CB    1 
ATOM   1848 O  OG    . SER C 3 181 ? 67.447 9.478   20.737  1.00 31.34 ? 187  SER A OG    1 
ATOM   1849 N  N     . ASP C 3 182 ? 65.148 8.426   18.372  1.00 28.87 ? 188  ASP A N     1 
ATOM   1850 C  CA    . ASP C 3 182 ? 63.691 8.544   18.365  1.00 29.25 ? 188  ASP A CA    1 
ATOM   1851 C  C     . ASP C 3 182 ? 63.122 7.266   17.753  1.00 28.63 ? 188  ASP A C     1 
ATOM   1852 O  O     . ASP C 3 182 ? 63.082 7.115   16.532  1.00 27.37 ? 188  ASP A O     1 
ATOM   1853 C  CB    . ASP C 3 182 ? 63.233 9.742   17.543  1.00 30.91 ? 188  ASP A CB    1 
ATOM   1854 C  CG    . ASP C 3 182 ? 61.748 10.018  17.710  1.00 33.15 ? 188  ASP A CG    1 
ATOM   1855 O  OD1   . ASP C 3 182 ? 60.950 9.066   17.562  1.00 33.50 ? 188  ASP A OD1   1 
ATOM   1856 O  OD2   . ASP C 3 182 ? 61.380 11.182  17.991  1.00 33.92 ? 188  ASP A OD2   1 
ATOM   1857 N  N     . LYS C 3 183 ? 62.676 6.358   18.614  1.00 28.16 ? 189  LYS A N     1 
ATOM   1858 C  CA    . LYS C 3 183 ? 62.145 5.069   18.193  1.00 28.16 ? 189  LYS A CA    1 
ATOM   1859 C  C     . LYS C 3 183 ? 60.947 5.132   17.253  1.00 27.51 ? 189  LYS A C     1 
ATOM   1860 O  O     . LYS C 3 183 ? 60.687 4.184   16.531  1.00 28.86 ? 189  LYS A O     1 
ATOM   1861 C  CB    . LYS C 3 183 ? 61.796 4.224   19.426  1.00 28.99 ? 189  LYS A CB    1 
ATOM   1862 N  N     . HIS C 3 184 ? 60.211 6.237   17.259  1.00 27.35 ? 190  HIS A N     1 
ATOM   1863 C  CA    . HIS C 3 184 ? 59.061 6.361   16.364  1.00 27.81 ? 190  HIS A CA    1 
ATOM   1864 C  C     . HIS C 3 184 ? 59.527 6.416   14.900  1.00 26.72 ? 190  HIS A C     1 
ATOM   1865 O  O     . HIS C 3 184 ? 58.844 5.937   14.002  1.00 27.35 ? 190  HIS A O     1 
ATOM   1866 C  CB    . HIS C 3 184 ? 58.269 7.630   16.694  1.00 27.80 ? 190  HIS A CB    1 
ATOM   1867 C  CG    . HIS C 3 184 ? 57.145 7.910   15.743  1.00 30.81 ? 190  HIS A CG    1 
ATOM   1868 N  ND1   . HIS C 3 184 ? 55.834 7.580   16.017  1.00 32.19 ? 190  HIS A ND1   1 
ATOM   1869 C  CD2   . HIS C 3 184 ? 57.139 8.479   14.513  1.00 30.09 ? 190  HIS A CD2   1 
ATOM   1870 C  CE1   . HIS C 3 184 ? 55.070 7.936   14.999  1.00 30.53 ? 190  HIS A CE1   1 
ATOM   1871 N  NE2   . HIS C 3 184 ? 55.838 8.483   14.073  1.00 30.97 ? 190  HIS A NE2   1 
ATOM   1872 N  N     . TYR C 3 185 ? 60.702 6.991   14.672  1.00 26.01 ? 191  TYR A N     1 
ATOM   1873 C  CA    . TYR C 3 185 ? 61.234 7.132   13.321  1.00 25.16 ? 191  TYR A CA    1 
ATOM   1874 C  C     . TYR C 3 185 ? 62.269 6.087   12.958  1.00 25.28 ? 191  TYR A C     1 
ATOM   1875 O  O     . TYR C 3 185 ? 62.421 5.740   11.786  1.00 25.00 ? 191  TYR A O     1 
ATOM   1876 C  CB    . TYR C 3 185 ? 61.846 8.528   13.145  1.00 25.39 ? 191  TYR A CB    1 
ATOM   1877 C  CG    . TYR C 3 185 ? 60.832 9.637   13.265  1.00 24.15 ? 191  TYR A CG    1 
ATOM   1878 C  CD1   . TYR C 3 185 ? 60.447 10.132  14.512  1.00 22.58 ? 191  TYR A CD1   1 
ATOM   1879 C  CD2   . TYR C 3 185 ? 60.203 10.144  12.129  1.00 23.43 ? 191  TYR A CD2   1 
ATOM   1880 C  CE1   . TYR C 3 185 ? 59.451 11.106  14.619  1.00 22.16 ? 191  TYR A CE1   1 
ATOM   1881 C  CE2   . TYR C 3 185 ? 59.214 11.102  12.225  1.00 22.32 ? 191  TYR A CE2   1 
ATOM   1882 C  CZ    . TYR C 3 185 ? 58.840 11.578  13.469  1.00 22.22 ? 191  TYR A CZ    1 
ATOM   1883 O  OH    . TYR C 3 185 ? 57.831 12.505  13.543  1.00 22.80 ? 191  TYR A OH    1 
ATOM   1884 N  N     . PHE C 3 186 ? 62.982 5.591   13.963  1.00 25.45 ? 192  PHE A N     1 
ATOM   1885 C  CA    . PHE C 3 186 ? 64.022 4.589   13.749  1.00 27.36 ? 192  PHE A CA    1 
ATOM   1886 C  C     . PHE C 3 186 ? 63.871 3.405   14.722  1.00 29.56 ? 192  PHE A C     1 
ATOM   1887 O  O     . PHE C 3 186 ? 64.012 3.567   15.934  1.00 29.50 ? 192  PHE A O     1 
ATOM   1888 C  CB    . PHE C 3 186 ? 65.408 5.226   13.940  1.00 24.51 ? 192  PHE A CB    1 
ATOM   1889 C  CG    . PHE C 3 186 ? 65.686 6.383   13.015  1.00 24.38 ? 192  PHE A CG    1 
ATOM   1890 C  CD1   . PHE C 3 186 ? 66.176 6.165   11.734  1.00 22.33 ? 192  PHE A CD1   1 
ATOM   1891 C  CD2   . PHE C 3 186 ? 65.429 7.691   13.418  1.00 21.97 ? 192  PHE A CD2   1 
ATOM   1892 C  CE1   . PHE C 3 186 ? 66.399 7.234   10.866  1.00 24.41 ? 192  PHE A CE1   1 
ATOM   1893 C  CE2   . PHE C 3 186 ? 65.653 8.768   12.553  1.00 22.99 ? 192  PHE A CE2   1 
ATOM   1894 C  CZ    . PHE C 3 186 ? 66.135 8.537   11.277  1.00 20.34 ? 192  PHE A CZ    1 
ATOM   1895 N  N     . PRO C 3 187 ? 63.571 2.204   14.201  1.00 32.37 ? 193  PRO A N     1 
ATOM   1896 C  CA    . PRO C 3 187 ? 63.411 0.998   15.032  1.00 35.02 ? 193  PRO A CA    1 
ATOM   1897 C  C     . PRO C 3 187 ? 64.614 0.806   15.968  1.00 37.79 ? 193  PRO A C     1 
ATOM   1898 O  O     . PRO C 3 187 ? 65.765 0.783   15.523  1.00 38.17 ? 193  PRO A O     1 
ATOM   1899 C  CB    . PRO C 3 187 ? 63.302 -0.116  13.998  1.00 34.64 ? 193  PRO A CB    1 
ATOM   1900 C  CG    . PRO C 3 187 ? 62.547 0.558   12.881  1.00 35.23 ? 193  PRO A CG    1 
ATOM   1901 C  CD    . PRO C 3 187 ? 63.223 1.927   12.794  1.00 34.14 ? 193  PRO A CD    1 
ATOM   1902 N  N     . PRO C 3 188 ? 64.360 0.673   17.280  1.00 39.75 ? 194  PRO A N     1 
ATOM   1903 C  CA    . PRO C 3 188 ? 65.400 0.488   18.301  1.00 41.19 ? 194  PRO A CA    1 
ATOM   1904 C  C     . PRO C 3 188 ? 66.304 -0.737  18.100  1.00 41.72 ? 194  PRO A C     1 
ATOM   1905 O  O     . PRO C 3 188 ? 67.436 -0.756  18.577  1.00 41.95 ? 194  PRO A O     1 
ATOM   1906 C  CB    . PRO C 3 188 ? 64.596 0.386   19.599  1.00 41.83 ? 194  PRO A CB    1 
ATOM   1907 C  CG    . PRO C 3 188 ? 63.359 1.180   19.303  1.00 42.76 ? 194  PRO A CG    1 
ATOM   1908 C  CD    . PRO C 3 188 ? 63.027 0.746   17.905  1.00 41.21 ? 194  PRO A CD    1 
ATOM   1909 N  N     . GLU C 3 189 ? 65.802 -1.750  17.399  1.00 40.97 ? 195  GLU A N     1 
ATOM   1910 C  CA    . GLU C 3 189 ? 66.563 -2.974  17.164  1.00 41.50 ? 195  GLU A CA    1 
ATOM   1911 C  C     . GLU C 3 189 ? 67.657 -2.842  16.110  1.00 40.11 ? 195  GLU A C     1 
ATOM   1912 O  O     . GLU C 3 189 ? 68.447 -3.765  15.914  1.00 39.23 ? 195  GLU A O     1 
ATOM   1913 C  CB    . GLU C 3 189 ? 65.620 -4.117  16.768  1.00 44.09 ? 195  GLU A CB    1 
ATOM   1914 C  CG    . GLU C 3 189 ? 64.769 -3.832  15.539  1.00 48.62 ? 195  GLU A CG    1 
ATOM   1915 C  CD    . GLU C 3 189 ? 63.541 -2.987  15.848  1.00 51.70 ? 195  GLU A CD    1 
ATOM   1916 O  OE1   . GLU C 3 189 ? 63.673 -1.959  16.545  1.00 52.40 ? 195  GLU A OE1   1 
ATOM   1917 O  OE2   . GLU C 3 189 ? 62.439 -3.349  15.383  1.00 53.33 ? 195  GLU A OE2   1 
ATOM   1918 N  N     . ILE C 3 190 ? 67.707 -1.700  15.433  1.00 38.00 ? 196  ILE A N     1 
ATOM   1919 C  CA    . ILE C 3 190 ? 68.712 -1.474  14.400  1.00 35.46 ? 196  ILE A CA    1 
ATOM   1920 C  C     . ILE C 3 190 ? 69.664 -0.344  14.788  1.00 34.40 ? 196  ILE A C     1 
ATOM   1921 O  O     . ILE C 3 190 ? 69.228 0.704   15.257  1.00 33.13 ? 196  ILE A O     1 
ATOM   1922 C  CB    . ILE C 3 190 ? 68.052 -1.083  13.045  1.00 36.35 ? 196  ILE A CB    1 
ATOM   1923 C  CG1   . ILE C 3 190 ? 67.147 -2.209  12.541  1.00 34.24 ? 196  ILE A CG1   1 
ATOM   1924 C  CG2   . ILE C 3 190 ? 69.130 -0.763  12.015  1.00 34.60 ? 196  ILE A CG2   1 
ATOM   1925 N  N     . ASP C 3 191 ? 70.963 -0.566  14.610  1.00 32.02 ? 197  ASP A N     1 
ATOM   1926 C  CA    . ASP C 3 191 ? 71.953 0.472   14.886  1.00 31.57 ? 197  ASP A CA    1 
ATOM   1927 C  C     . ASP C 3 191 ? 72.108 1.150   13.528  1.00 29.20 ? 197  ASP A C     1 
ATOM   1928 O  O     . ASP C 3 191 ? 72.811 0.629   12.656  1.00 26.73 ? 197  ASP A O     1 
ATOM   1929 C  CB    . ASP C 3 191 ? 73.298 -0.138  15.314  1.00 32.16 ? 197  ASP A CB    1 
ATOM   1930 C  CG    . ASP C 3 191 ? 74.378 0.919   15.534  1.00 34.21 ? 197  ASP A CG    1 
ATOM   1931 O  OD1   . ASP C 3 191 ? 74.137 2.098   15.190  1.00 34.29 ? 197  ASP A OD1   1 
ATOM   1932 O  OD2   . ASP C 3 191 ? 75.470 0.577   16.044  1.00 33.35 ? 197  ASP A OD2   1 
ATOM   1933 N  N     . PHE C 3 192 ? 71.439 2.289   13.339  1.00 27.03 ? 198  PHE A N     1 
ATOM   1934 C  CA    . PHE C 3 192 ? 71.495 2.986   12.056  1.00 24.37 ? 198  PHE A CA    1 
ATOM   1935 C  C     . PHE C 3 192 ? 72.815 3.667   11.709  1.00 25.13 ? 198  PHE A C     1 
ATOM   1936 O  O     . PHE C 3 192 ? 72.949 4.225   10.623  1.00 23.69 ? 198  PHE A O     1 
ATOM   1937 C  CB    . PHE C 3 192 ? 70.346 3.992   11.930  1.00 23.03 ? 198  PHE A CB    1 
ATOM   1938 C  CG    . PHE C 3 192 ? 69.006 3.352   11.683  1.00 18.56 ? 198  PHE A CG    1 
ATOM   1939 C  CD1   . PHE C 3 192 ? 68.235 2.880   12.742  1.00 19.10 ? 198  PHE A CD1   1 
ATOM   1940 C  CD2   . PHE C 3 192 ? 68.516 3.216   10.387  1.00 21.39 ? 198  PHE A CD2   1 
ATOM   1941 C  CE1   . PHE C 3 192 ? 66.992 2.282   12.512  1.00 20.44 ? 198  PHE A CE1   1 
ATOM   1942 C  CE2   . PHE C 3 192 ? 67.271 2.617   10.141  1.00 17.75 ? 198  PHE A CE2   1 
ATOM   1943 C  CZ    . PHE C 3 192 ? 66.513 2.153   11.209  1.00 19.91 ? 198  PHE A CZ    1 
ATOM   1944 N  N     . THR C 3 193 ? 73.784 3.625   12.618  1.00 26.28 ? 199  THR A N     1 
ATOM   1945 C  CA    . THR C 3 193 ? 75.095 4.205   12.337  1.00 27.95 ? 199  THR A CA    1 
ATOM   1946 C  C     . THR C 3 193 ? 75.977 3.074   11.814  1.00 29.99 ? 199  THR A C     1 
ATOM   1947 O  O     . THR C 3 193 ? 77.155 3.279   11.518  1.00 31.13 ? 199  THR A O     1 
ATOM   1948 C  CB    . THR C 3 193 ? 75.797 4.760   13.601  1.00 27.42 ? 199  THR A CB    1 
ATOM   1949 O  OG1   . THR C 3 193 ? 76.067 3.677   14.511  1.00 27.75 ? 199  THR A OG1   1 
ATOM   1950 C  CG2   . THR C 3 193 ? 74.931 5.825   14.283  1.00 25.67 ? 199  THR A CG2   1 
ATOM   1951 N  N     . ASP C 3 194 ? 75.410 1.878   11.707  1.00 30.06 ? 200  ASP A N     1 
ATOM   1952 C  CA    . ASP C 3 194 ? 76.192 0.736   11.245  1.00 31.35 ? 200  ASP A CA    1 
ATOM   1953 C  C     . ASP C 3 194 ? 75.543 -0.058  10.115  1.00 30.73 ? 200  ASP A C     1 
ATOM   1954 O  O     . ASP C 3 194 ? 75.674 -1.283  10.052  1.00 31.20 ? 200  ASP A O     1 
ATOM   1955 C  CB    . ASP C 3 194 ? 76.489 -0.185  12.433  1.00 33.77 ? 200  ASP A CB    1 
ATOM   1956 C  CG    . ASP C 3 194 ? 77.411 -1.336  12.070  1.00 38.49 ? 200  ASP A CG    1 
ATOM   1957 O  OD1   . ASP C 3 194 ? 78.484 -1.088  11.469  1.00 40.36 ? 200  ASP A OD1   1 
ATOM   1958 O  OD2   . ASP C 3 194 ? 77.060 -2.488  12.395  1.00 38.46 ? 200  ASP A OD2   1 
ATOM   1959 N  N     . VAL C 3 195 ? 74.863 0.642   9.212   1.00 28.26 ? 201  VAL A N     1 
ATOM   1960 C  CA    . VAL C 3 195 ? 74.203 -0.007  8.080   1.00 27.58 ? 201  VAL A CA    1 
ATOM   1961 C  C     . VAL C 3 195 ? 74.462 0.742   6.775   1.00 27.91 ? 201  VAL A C     1 
ATOM   1962 O  O     . VAL C 3 195 ? 74.856 1.909   6.788   1.00 28.67 ? 201  VAL A O     1 
ATOM   1963 C  CB    . VAL C 3 195 ? 72.687 -0.073  8.296   1.00 26.31 ? 201  VAL A CB    1 
ATOM   1964 C  CG1   . VAL C 3 195 ? 72.363 -1.002  9.474   1.00 24.87 ? 201  VAL A CG1   1 
ATOM   1965 C  CG2   . VAL C 3 195 ? 72.151 1.328   8.550   1.00 25.03 ? 201  VAL A CG2   1 
ATOM   1966 N  N     . GLY C 3 196 ? 74.232 0.064   5.652   1.00 27.68 ? 202  GLY A N     1 
ATOM   1967 C  CA    . GLY C 3 196 ? 74.424 0.683   4.352   1.00 27.50 ? 202  GLY A CA    1 
ATOM   1968 C  C     . GLY C 3 196 ? 73.256 1.597   4.037   1.00 27.72 ? 202  GLY A C     1 
ATOM   1969 O  O     . GLY C 3 196 ? 72.214 1.509   4.690   1.00 28.78 ? 202  GLY A O     1 
ATOM   1970 N  N     . TYR C 3 197 ? 73.400 2.449   3.025   1.00 26.20 ? 203  TYR A N     1 
ATOM   1971 C  CA    . TYR C 3 197 ? 72.336 3.397   2.690   1.00 27.24 ? 203  TYR A CA    1 
ATOM   1972 C  C     . TYR C 3 197 ? 70.993 2.738   2.374   1.00 28.34 ? 203  TYR A C     1 
ATOM   1973 O  O     . TYR C 3 197 ? 69.938 3.203   2.821   1.00 27.78 ? 203  TYR A O     1 
ATOM   1974 C  CB    . TYR C 3 197 ? 72.772 4.298   1.521   1.00 25.98 ? 203  TYR A CB    1 
ATOM   1975 C  CG    . TYR C 3 197 ? 72.647 3.703   0.134   1.00 25.02 ? 203  TYR A CG    1 
ATOM   1976 C  CD1   . TYR C 3 197 ? 71.431 3.735   -0.547  1.00 26.12 ? 203  TYR A CD1   1 
ATOM   1977 C  CD2   . TYR C 3 197 ? 73.749 3.125   -0.508  1.00 24.12 ? 203  TYR A CD2   1 
ATOM   1978 C  CE1   . TYR C 3 197 ? 71.303 3.217   -1.834  1.00 22.90 ? 203  TYR A CE1   1 
ATOM   1979 C  CE2   . TYR C 3 197 ? 73.632 2.597   -1.793  1.00 24.72 ? 203  TYR A CE2   1 
ATOM   1980 C  CZ    . TYR C 3 197 ? 72.402 2.651   -2.449  1.00 26.65 ? 203  TYR A CZ    1 
ATOM   1981 O  OH    . TYR C 3 197 ? 72.260 2.140   -3.721  1.00 29.30 ? 203  TYR A OH    1 
ATOM   1982 N  N     . THR C 3 198 ? 71.042 1.656   1.606   1.00 27.90 ? 204  THR A N     1 
ATOM   1983 C  CA    . THR C 3 198 ? 69.846 0.930   1.215   1.00 29.29 ? 204  THR A CA    1 
ATOM   1984 C  C     . THR C 3 198 ? 69.019 0.552   2.456   1.00 27.22 ? 204  THR A C     1 
ATOM   1985 O  O     . THR C 3 198 ? 67.809 0.761   2.497   1.00 28.12 ? 204  THR A O     1 
ATOM   1986 C  CB    . THR C 3 198 ? 70.245 -0.321  0.396   1.00 32.43 ? 204  THR A CB    1 
ATOM   1987 O  OG1   . THR C 3 198 ? 69.080 -1.103  0.110   1.00 37.24 ? 204  THR A OG1   1 
ATOM   1988 C  CG2   . THR C 3 198 ? 71.276 -1.169  1.177   1.00 35.67 ? 204  THR A CG2   1 
ATOM   1989 N  N     . THR C 3 199 ? 69.688 0.030   3.477   1.00 25.93 ? 205  THR A N     1 
ATOM   1990 C  CA    . THR C 3 199 ? 69.044 -0.354  4.729   1.00 25.02 ? 205  THR A CA    1 
ATOM   1991 C  C     . THR C 3 199 ? 68.480 0.874   5.472   1.00 25.33 ? 205  THR A C     1 
ATOM   1992 O  O     . THR C 3 199 ? 67.338 0.870   5.947   1.00 24.31 ? 205  THR A O     1 
ATOM   1993 C  CB    . THR C 3 199 ? 70.060 -1.064  5.659   1.00 25.77 ? 205  THR A CB    1 
ATOM   1994 O  OG1   . THR C 3 199 ? 70.521 -2.266  5.036   1.00 26.40 ? 205  THR A OG1   1 
ATOM   1995 C  CG2   . THR C 3 199 ? 69.437 -1.396  7.006   1.00 25.59 ? 205  THR A CG2   1 
ATOM   1996 N  N     . PHE C 3 200 ? 69.297 1.915   5.578   1.00 22.85 ? 206  PHE A N     1 
ATOM   1997 C  CA    . PHE C 3 200 ? 68.898 3.143   6.263   1.00 22.92 ? 206  PHE A CA    1 
ATOM   1998 C  C     . PHE C 3 200 ? 67.538 3.694   5.812   1.00 21.28 ? 206  PHE A C     1 
ATOM   1999 O  O     . PHE C 3 200 ? 66.706 4.042   6.638   1.00 20.31 ? 206  PHE A O     1 
ATOM   2000 C  CB    . PHE C 3 200 ? 69.989 4.209   6.086   1.00 20.83 ? 206  PHE A CB    1 
ATOM   2001 C  CG    . PHE C 3 200 ? 69.736 5.471   6.856   1.00 22.19 ? 206  PHE A CG    1 
ATOM   2002 C  CD1   . PHE C 3 200 ? 68.936 6.484   6.325   1.00 21.78 ? 206  PHE A CD1   1 
ATOM   2003 C  CD2   . PHE C 3 200 ? 70.285 5.649   8.123   1.00 20.68 ? 206  PHE A CD2   1 
ATOM   2004 C  CE1   . PHE C 3 200 ? 68.690 7.652   7.051   1.00 20.84 ? 206  PHE A CE1   1 
ATOM   2005 C  CE2   . PHE C 3 200 ? 70.040 6.817   8.851   1.00 19.36 ? 206  PHE A CE2   1 
ATOM   2006 C  CZ    . PHE C 3 200 ? 69.244 7.816   8.312   1.00 17.92 ? 206  PHE A CZ    1 
ATOM   2007 N  N     . TRP C 3 201 ? 67.317 3.780   4.509   1.00 22.12 ? 207  TRP A N     1 
ATOM   2008 C  CA    . TRP C 3 201 ? 66.057 4.299   3.992   1.00 24.75 ? 207  TRP A CA    1 
ATOM   2009 C  C     . TRP C 3 201 ? 64.897 3.304   4.129   1.00 26.46 ? 207  TRP A C     1 
ATOM   2010 O  O     . TRP C 3 201 ? 63.797 3.674   4.545   1.00 27.55 ? 207  TRP A O     1 
ATOM   2011 C  CB    . TRP C 3 201 ? 66.217 4.699   2.524   1.00 25.22 ? 207  TRP A CB    1 
ATOM   2012 C  CG    . TRP C 3 201 ? 67.299 5.717   2.292   1.00 25.48 ? 207  TRP A CG    1 
ATOM   2013 C  CD1   . TRP C 3 201 ? 68.417 5.559   1.523   1.00 24.83 ? 207  TRP A CD1   1 
ATOM   2014 C  CD2   . TRP C 3 201 ? 67.372 7.040   2.838   1.00 24.38 ? 207  TRP A CD2   1 
ATOM   2015 N  NE1   . TRP C 3 201 ? 69.178 6.693   1.558   1.00 25.09 ? 207  TRP A NE1   1 
ATOM   2016 C  CE2   . TRP C 3 201 ? 68.563 7.622   2.356   1.00 26.25 ? 207  TRP A CE2   1 
ATOM   2017 C  CE3   . TRP C 3 201 ? 66.548 7.789   3.690   1.00 22.78 ? 207  TRP A CE3   1 
ATOM   2018 C  CZ2   . TRP C 3 201 ? 68.955 8.928   2.696   1.00 25.92 ? 207  TRP A CZ2   1 
ATOM   2019 C  CZ3   . TRP C 3 201 ? 66.934 9.084   4.032   1.00 23.49 ? 207  TRP A CZ3   1 
ATOM   2020 C  CH2   . TRP C 3 201 ? 68.129 9.640   3.533   1.00 26.08 ? 207  TRP A CH2   1 
ATOM   2021 N  N     . SER C 3 202 ? 65.140 2.040   3.791   1.00 28.94 ? 208  SER A N     1 
ATOM   2022 C  CA    . SER C 3 202 ? 64.087 1.034   3.879   1.00 29.47 ? 208  SER A CA    1 
ATOM   2023 C  C     . SER C 3 202 ? 63.647 0.695   5.303   1.00 29.00 ? 208  SER A C     1 
ATOM   2024 O  O     . SER C 3 202 ? 62.467 0.454   5.537   1.00 29.44 ? 208  SER A O     1 
ATOM   2025 C  CB    . SER C 3 202 ? 64.507 -0.251  3.152   1.00 29.81 ? 208  SER A CB    1 
ATOM   2026 O  OG    . SER C 3 202 ? 65.660 -0.829  3.736   1.00 35.58 ? 208  SER A OG    1 
ATOM   2027 N  N     . GLU C 3 203 ? 64.573 0.692   6.259   1.00 28.36 ? 209  GLU A N     1 
ATOM   2028 C  CA    . GLU C 3 203 ? 64.217 0.351   7.640   1.00 28.21 ? 209  GLU A CA    1 
ATOM   2029 C  C     . GLU C 3 203 ? 63.681 1.502   8.485   1.00 27.45 ? 209  GLU A C     1 
ATOM   2030 O  O     . GLU C 3 203 ? 63.028 1.266   9.497   1.00 27.07 ? 209  GLU A O     1 
ATOM   2031 C  CB    . GLU C 3 203 ? 65.412 -0.268  8.361   1.00 30.36 ? 209  GLU A CB    1 
ATOM   2032 C  CG    . GLU C 3 203 ? 65.959 -1.494  7.677   1.00 33.30 ? 209  GLU A CG    1 
ATOM   2033 C  CD    . GLU C 3 203 ? 64.966 -2.625  7.670   1.00 37.07 ? 209  GLU A CD    1 
ATOM   2034 O  OE1   . GLU C 3 203 ? 64.723 -3.202  8.752   1.00 36.71 ? 209  GLU A OE1   1 
ATOM   2035 O  OE2   . GLU C 3 203 ? 64.423 -2.928  6.584   1.00 40.66 ? 209  GLU A OE2   1 
ATOM   2036 N  N     . SER C 3 204 ? 63.959 2.743   8.095   1.00 25.60 ? 210  SER A N     1 
ATOM   2037 C  CA    . SER C 3 204 ? 63.459 3.874   8.875   1.00 23.81 ? 210  SER A CA    1 
ATOM   2038 C  C     . SER C 3 204 ? 62.068 4.231   8.375   1.00 22.96 ? 210  SER A C     1 
ATOM   2039 O  O     . SER C 3 204 ? 61.656 3.780   7.312   1.00 22.86 ? 210  SER A O     1 
ATOM   2040 C  CB    . SER C 3 204 ? 64.390 5.087   8.739   1.00 22.61 ? 210  SER A CB    1 
ATOM   2041 O  OG    . SER C 3 204 ? 64.395 5.568   7.410   1.00 21.36 ? 210  SER A OG    1 
ATOM   2042 N  N     . LEU C 3 205 ? 61.344 5.034   9.146   1.00 23.69 ? 211  LEU A N     1 
ATOM   2043 C  CA    . LEU C 3 205 ? 59.994 5.448   8.771   1.00 23.20 ? 211  LEU A CA    1 
ATOM   2044 C  C     . LEU C 3 205 ? 60.015 6.143   7.409   1.00 23.51 ? 211  LEU A C     1 
ATOM   2045 O  O     . LEU C 3 205 ? 60.949 6.880   7.097   1.00 24.21 ? 211  LEU A O     1 
ATOM   2046 C  CB    . LEU C 3 205 ? 59.432 6.411   9.820   1.00 22.46 ? 211  LEU A CB    1 
ATOM   2047 C  CG    . LEU C 3 205 ? 57.948 6.777   9.731   1.00 23.32 ? 211  LEU A CG    1 
ATOM   2048 C  CD1   . LEU C 3 205 ? 57.088 5.585   10.168  1.00 23.08 ? 211  LEU A CD1   1 
ATOM   2049 C  CD2   . LEU C 3 205 ? 57.679 7.972   10.623  1.00 25.18 ? 211  LEU A CD2   1 
ATOM   2050 N  N     . GLU C 3 206 ? 58.981 5.905   6.610   1.00 22.91 ? 212  GLU A N     1 
ATOM   2051 C  CA    . GLU C 3 206 ? 58.859 6.502   5.286   1.00 23.06 ? 212  GLU A CA    1 
ATOM   2052 C  C     . GLU C 3 206 ? 59.120 8.023   5.273   1.00 22.25 ? 212  GLU A C     1 
ATOM   2053 O  O     . GLU C 3 206 ? 59.773 8.539   4.362   1.00 20.85 ? 212  GLU A O     1 
ATOM   2054 C  CB    . GLU C 3 206 ? 57.462 6.204   4.726   1.00 24.62 ? 212  GLU A CB    1 
ATOM   2055 C  CG    . GLU C 3 206 ? 57.101 6.974   3.461   1.00 26.20 ? 212  GLU A CG    1 
ATOM   2056 C  CD    . GLU C 3 206 ? 55.767 6.538   2.859   1.00 28.46 ? 212  GLU A CD    1 
ATOM   2057 O  OE1   . GLU C 3 206 ? 54.844 6.166   3.623   1.00 27.92 ? 212  GLU A OE1   1 
ATOM   2058 O  OE2   . GLU C 3 206 ? 55.637 6.583   1.618   1.00 30.02 ? 212  GLU A OE2   1 
ATOM   2059 N  N     . ALA C 3 207 ? 58.617 8.728   6.284   1.00 21.21 ? 213  ALA A N     1 
ATOM   2060 C  CA    . ALA C 3 207 ? 58.792 10.179  6.371   1.00 22.39 ? 213  ALA A CA    1 
ATOM   2061 C  C     . ALA C 3 207 ? 60.262 10.588  6.243   1.00 21.03 ? 213  ALA A C     1 
ATOM   2062 O  O     . ALA C 3 207 ? 60.581 11.603  5.623   1.00 21.01 ? 213  ALA A O     1 
ATOM   2063 C  CB    . ALA C 3 207 ? 58.209 10.703  7.691   1.00 20.34 ? 213  ALA A CB    1 
ATOM   2064 N  N     . VAL C 3 208 ? 61.149 9.793   6.832   1.00 19.84 ? 214  VAL A N     1 
ATOM   2065 C  CA    . VAL C 3 208 ? 62.575 10.068  6.777   1.00 21.06 ? 214  VAL A CA    1 
ATOM   2066 C  C     . VAL C 3 208 ? 63.076 10.122  5.335   1.00 22.12 ? 214  VAL A C     1 
ATOM   2067 O  O     . VAL C 3 208 ? 63.798 11.040  4.954   1.00 23.81 ? 214  VAL A O     1 
ATOM   2068 C  CB    . VAL C 3 208 ? 63.359 9.009   7.585   1.00 20.76 ? 214  VAL A CB    1 
ATOM   2069 C  CG1   . VAL C 3 208 ? 64.852 9.086   7.283   1.00 20.97 ? 214  VAL A CG1   1 
ATOM   2070 C  CG2   . VAL C 3 208 ? 63.122 9.240   9.064   1.00 19.42 ? 214  VAL A CG2   1 
ATOM   2071 N  N     . ASP C 3 209 ? 62.681 9.143   4.533   1.00 22.41 ? 215  ASP A N     1 
ATOM   2072 C  CA    . ASP C 3 209 ? 63.075 9.094   3.129   1.00 22.58 ? 215  ASP A CA    1 
ATOM   2073 C  C     . ASP C 3 209 ? 62.436 10.239  2.331   1.00 23.14 ? 215  ASP A C     1 
ATOM   2074 O  O     . ASP C 3 209 ? 63.106 10.896  1.534   1.00 24.46 ? 215  ASP A O     1 
ATOM   2075 C  CB    . ASP C 3 209 ? 62.671 7.742   2.537   1.00 24.77 ? 215  ASP A CB    1 
ATOM   2076 C  CG    . ASP C 3 209 ? 62.822 7.692   1.037   1.00 28.32 ? 215  ASP A CG    1 
ATOM   2077 O  OD1   . ASP C 3 209 ? 63.939 7.935   0.531   1.00 28.74 ? 215  ASP A OD1   1 
ATOM   2078 O  OD2   . ASP C 3 209 ? 61.812 7.406   0.360   1.00 30.97 ? 215  ASP A OD2   1 
ATOM   2079 N  N     . ILE C 3 210 ? 61.145 10.472  2.556   1.00 21.85 ? 216  ILE A N     1 
ATOM   2080 C  CA    . ILE C 3 210 ? 60.402 11.525  1.872   1.00 19.72 ? 216  ILE A CA    1 
ATOM   2081 C  C     . ILE C 3 210 ? 60.991 12.936  2.105   1.00 20.13 ? 216  ILE A C     1 
ATOM   2082 O  O     . ILE C 3 210 ? 61.138 13.708  1.168   1.00 18.57 ? 216  ILE A O     1 
ATOM   2083 C  CB    . ILE C 3 210 ? 58.903 11.531  2.314   1.00 20.21 ? 216  ILE A CB    1 
ATOM   2084 C  CG1   . ILE C 3 210 ? 58.166 10.316  1.724   1.00 20.98 ? 216  ILE A CG1   1 
ATOM   2085 C  CG2   . ILE C 3 210 ? 58.223 12.840  1.873   1.00 19.61 ? 216  ILE A CG2   1 
ATOM   2086 N  N     . GLU C 3 211 ? 61.313 13.267  3.350   1.00 19.58 ? 217  GLU A N     1 
ATOM   2087 C  CA    . GLU C 3 211 ? 61.870 14.580  3.657   1.00 19.44 ? 217  GLU A CA    1 
ATOM   2088 C  C     . GLU C 3 211 ? 63.236 14.794  3.011   1.00 18.99 ? 217  GLU A C     1 
ATOM   2089 O  O     . GLU C 3 211 ? 63.562 15.906  2.614   1.00 19.10 ? 217  GLU A O     1 
ATOM   2090 C  CB    . GLU C 3 211 ? 61.984 14.783  5.169   1.00 19.22 ? 217  GLU A CB    1 
ATOM   2091 C  CG    . GLU C 3 211 ? 60.657 15.040  5.865   1.00 22.07 ? 217  GLU A CG    1 
ATOM   2092 C  CD    . GLU C 3 211 ? 59.898 16.221  5.267   1.00 25.27 ? 217  GLU A CD    1 
ATOM   2093 O  OE1   . GLU C 3 211 ? 60.503 17.308  5.119   1.00 25.67 ? 217  GLU A OE1   1 
ATOM   2094 O  OE2   . GLU C 3 211 ? 58.697 16.061  4.950   1.00 25.19 ? 217  GLU A OE2   1 
ATOM   2095 N  N     . HIS C 3 212 ? 64.044 13.742  2.915   1.00 19.87 ? 218  HIS A N     1 
ATOM   2096 C  CA    . HIS C 3 212 ? 65.358 13.891  2.289   1.00 20.54 ? 218  HIS A CA    1 
ATOM   2097 C  C     . HIS C 3 212 ? 65.226 14.100  0.786   1.00 19.97 ? 218  HIS A C     1 
ATOM   2098 O  O     . HIS C 3 212 ? 65.953 14.896  0.203   1.00 21.80 ? 218  HIS A O     1 
ATOM   2099 C  CB    . HIS C 3 212 ? 66.266 12.692  2.589   1.00 19.68 ? 218  HIS A CB    1 
ATOM   2100 C  CG    . HIS C 3 212 ? 66.952 12.782  3.917   1.00 19.65 ? 218  HIS A CG    1 
ATOM   2101 N  ND1   . HIS C 3 212 ? 66.337 12.434  5.104   1.00 19.74 ? 218  HIS A ND1   1 
ATOM   2102 C  CD2   . HIS C 3 212 ? 68.184 13.236  4.250   1.00 18.16 ? 218  HIS A CD2   1 
ATOM   2103 C  CE1   . HIS C 3 212 ? 67.162 12.672  6.109   1.00 18.10 ? 218  HIS A CE1   1 
ATOM   2104 N  NE2   . HIS C 3 212 ? 68.289 13.160  5.618   1.00 18.49 ? 218  HIS A NE2   1 
ATOM   2105 N  N     . ARG C 3 213 ? 64.283 13.408  0.157   1.00 20.95 ? 219  ARG A N     1 
ATOM   2106 C  CA    . ARG C 3 213 ? 64.088 13.593  -1.272  1.00 19.04 ? 219  ARG A CA    1 
ATOM   2107 C  C     . ARG C 3 213 ? 63.546 14.994  -1.529  1.00 18.04 ? 219  ARG A C     1 
ATOM   2108 O  O     . ARG C 3 213 ? 63.914 15.645  -2.503  1.00 16.34 ? 219  ARG A O     1 
ATOM   2109 C  CB    . ARG C 3 213 ? 63.121 12.547  -1.828  1.00 19.03 ? 219  ARG A CB    1 
ATOM   2110 C  CG    . ARG C 3 213 ? 63.696 11.119  -1.887  1.00 22.63 ? 219  ARG A CG    1 
ATOM   2111 C  CD    . ARG C 3 213 ? 62.591 10.168  -2.323  1.00 25.21 ? 219  ARG A CD    1 
ATOM   2112 N  NE    . ARG C 3 213 ? 62.993 8.773   -2.439  1.00 28.17 ? 219  ARG A NE    1 
ATOM   2113 C  CZ    . ARG C 3 213 ? 63.585 8.239   -3.504  1.00 29.78 ? 219  ARG A CZ    1 
ATOM   2114 N  NH1   . ARG C 3 213 ? 63.864 8.993   -4.563  1.00 30.99 ? 219  ARG A NH1   1 
ATOM   2115 N  NH2   . ARG C 3 213 ? 63.863 6.937   -3.525  1.00 24.75 ? 219  ARG A NH2   1 
ATOM   2116 N  N     . ALA C 3 214 ? 62.667 15.455  -0.647  1.00 18.07 ? 220  ALA A N     1 
ATOM   2117 C  CA    . ALA C 3 214 ? 62.097 16.782  -0.781  1.00 18.66 ? 220  ALA A CA    1 
ATOM   2118 C  C     . ALA C 3 214 ? 63.186 17.861  -0.638  1.00 18.45 ? 220  ALA A C     1 
ATOM   2119 O  O     . ALA C 3 214 ? 63.234 18.808  -1.413  1.00 20.35 ? 220  ALA A O     1 
ATOM   2120 C  CB    . ALA C 3 214 ? 61.010 16.988  0.274   1.00 19.07 ? 220  ALA A CB    1 
ATOM   2121 N  N     . ALA C 3 215 ? 64.048 17.719  0.360   1.00 18.44 ? 221  ALA A N     1 
ATOM   2122 C  CA    . ALA C 3 215 ? 65.108 18.696  0.579   1.00 18.51 ? 221  ALA A CA    1 
ATOM   2123 C  C     . ALA C 3 215 ? 66.081 18.704  -0.608  1.00 19.21 ? 221  ALA A C     1 
ATOM   2124 O  O     . ALA C 3 215 ? 66.501 19.767  -1.054  1.00 17.06 ? 221  ALA A O     1 
ATOM   2125 C  CB    . ALA C 3 215 ? 65.849 18.383  1.872   1.00 18.90 ? 221  ALA A CB    1 
ATOM   2126 N  N     . TRP C 3 216 ? 66.405 17.518  -1.131  1.00 18.53 ? 222  TRP A N     1 
ATOM   2127 C  CA    . TRP C 3 216 ? 67.323 17.409  -2.264  1.00 20.41 ? 222  TRP A CA    1 
ATOM   2128 C  C     . TRP C 3 216 ? 66.751 18.112  -3.493  1.00 21.59 ? 222  TRP A C     1 
ATOM   2129 O  O     . TRP C 3 216 ? 67.436 18.897  -4.152  1.00 22.49 ? 222  TRP A O     1 
ATOM   2130 C  CB    . TRP C 3 216 ? 67.612 15.931  -2.574  1.00 20.18 ? 222  TRP A CB    1 
ATOM   2131 C  CG    . TRP C 3 216 ? 68.749 15.711  -3.545  1.00 19.10 ? 222  TRP A CG    1 
ATOM   2132 C  CD1   . TRP C 3 216 ? 68.670 15.687  -4.918  1.00 19.93 ? 222  TRP A CD1   1 
ATOM   2133 C  CD2   . TRP C 3 216 ? 70.133 15.477  -3.218  1.00 18.93 ? 222  TRP A CD2   1 
ATOM   2134 N  NE1   . TRP C 3 216 ? 69.917 15.449  -5.461  1.00 18.64 ? 222  TRP A NE1   1 
ATOM   2135 C  CE2   . TRP C 3 216 ? 70.832 15.316  -4.445  1.00 20.24 ? 222  TRP A CE2   1 
ATOM   2136 C  CE3   . TRP C 3 216 ? 70.849 15.383  -2.012  1.00 18.12 ? 222  TRP A CE3   1 
ATOM   2137 C  CZ2   . TRP C 3 216 ? 72.224 15.065  -4.499  1.00 16.63 ? 222  TRP A CZ2   1 
ATOM   2138 C  CZ3   . TRP C 3 216 ? 72.235 15.133  -2.064  1.00 17.28 ? 222  TRP A CZ3   1 
ATOM   2139 C  CH2   . TRP C 3 216 ? 72.904 14.977  -3.307  1.00 15.78 ? 222  TRP A CH2   1 
ATOM   2140 N  N     . LEU C 3 217 ? 65.484 17.840  -3.789  1.00 20.68 ? 223  LEU A N     1 
ATOM   2141 C  CA    . LEU C 3 217 ? 64.818 18.450  -4.929  1.00 19.23 ? 223  LEU A CA    1 
ATOM   2142 C  C     . LEU C 3 217 ? 64.639 19.972  -4.766  1.00 20.11 ? 223  LEU A C     1 
ATOM   2143 O  O     . LEU C 3 217 ? 64.918 20.747  -5.684  1.00 19.52 ? 223  LEU A O     1 
ATOM   2144 C  CB    . LEU C 3 217 ? 63.457 17.792  -5.136  1.00 20.53 ? 223  LEU A CB    1 
ATOM   2145 C  CG    . LEU C 3 217 ? 62.556 18.431  -6.199  1.00 22.29 ? 223  LEU A CG    1 
ATOM   2146 C  CD1   . LEU C 3 217 ? 63.206 18.322  -7.577  1.00 19.73 ? 223  LEU A CD1   1 
ATOM   2147 C  CD2   . LEU C 3 217 ? 61.202 17.733  -6.175  1.00 21.93 ? 223  LEU A CD2   1 
ATOM   2148 N  N     . LEU C 3 218 ? 64.169 20.397  -3.600  1.00 19.22 ? 224  LEU A N     1 
ATOM   2149 C  CA    . LEU C 3 218 ? 63.958 21.819  -3.357  1.00 18.77 ? 224  LEU A CA    1 
ATOM   2150 C  C     . LEU C 3 218 ? 65.274 22.606  -3.341  1.00 18.35 ? 224  LEU A C     1 
ATOM   2151 O  O     . LEU C 3 218 ? 65.308 23.784  -3.705  1.00 17.70 ? 224  LEU A O     1 
ATOM   2152 C  CB    . LEU C 3 218 ? 63.165 22.006  -2.054  1.00 19.91 ? 224  LEU A CB    1 
ATOM   2153 C  CG    . LEU C 3 218 ? 61.723 21.502  -2.257  1.00 23.60 ? 224  LEU A CG    1 
ATOM   2154 C  CD1   . LEU C 3 218 ? 60.983 21.308  -0.927  1.00 24.58 ? 224  LEU A CD1   1 
ATOM   2155 C  CD2   . LEU C 3 218 ? 60.999 22.504  -3.152  1.00 23.67 ? 224  LEU A CD2   1 
ATOM   2156 N  N     . ALA C 3 219 ? 66.355 21.956  -2.929  1.00 17.03 ? 225  ALA A N     1 
ATOM   2157 C  CA    . ALA C 3 219 ? 67.657 22.616  -2.928  1.00 19.18 ? 225  ALA A CA    1 
ATOM   2158 C  C     . ALA C 3 219 ? 67.994 22.931  -4.386  1.00 19.15 ? 225  ALA A C     1 
ATOM   2159 O  O     . ALA C 3 219 ? 68.578 23.968  -4.697  1.00 19.93 ? 225  ALA A O     1 
ATOM   2160 C  CB    . ALA C 3 219 ? 68.728 21.700  -2.328  1.00 16.33 ? 225  ALA A CB    1 
ATOM   2161 N  N     . LYS C 3 220 ? 67.612 22.017  -5.272  1.00 19.60 ? 226  LYS A N     1 
ATOM   2162 C  CA    . LYS C 3 220 ? 67.833 22.169  -6.699  1.00 19.39 ? 226  LYS A CA    1 
ATOM   2163 C  C     . LYS C 3 220 ? 66.947 23.301  -7.232  1.00 20.98 ? 226  LYS A C     1 
ATOM   2164 O  O     . LYS C 3 220 ? 67.373 24.092  -8.083  1.00 20.48 ? 226  LYS A O     1 
ATOM   2165 C  CB    . LYS C 3 220 ? 67.502 20.850  -7.414  1.00 18.45 ? 226  LYS A CB    1 
ATOM   2166 C  CG    . LYS C 3 220 ? 67.491 20.930  -8.933  1.00 17.56 ? 226  LYS A CG    1 
ATOM   2167 C  CD    . LYS C 3 220 ? 68.878 21.242  -9.485  1.00 21.80 ? 226  LYS A CD    1 
ATOM   2168 C  CE    . LYS C 3 220 ? 68.862 21.234  -11.006 1.00 23.92 ? 226  LYS A CE    1 
ATOM   2169 N  NZ    . LYS C 3 220 ? 70.231 21.153  -11.590 1.00 28.42 ? 226  LYS A NZ    1 
ATOM   2170 N  N     . GLN C 3 221 ? 65.710 23.363  -6.736  1.00 21.04 ? 227  GLN A N     1 
ATOM   2171 C  CA    . GLN C 3 221 ? 64.776 24.399  -7.140  1.00 20.59 ? 227  GLN A CA    1 
ATOM   2172 C  C     . GLN C 3 221 ? 65.332 25.781  -6.773  1.00 22.01 ? 227  GLN A C     1 
ATOM   2173 O  O     . GLN C 3 221 ? 65.215 26.730  -7.551  1.00 20.59 ? 227  GLN A O     1 
ATOM   2174 C  CB    . GLN C 3 221 ? 63.412 24.185  -6.465  1.00 21.03 ? 227  GLN A CB    1 
ATOM   2175 C  CG    . GLN C 3 221 ? 62.432 25.349  -6.640  1.00 20.79 ? 227  GLN A CG    1 
ATOM   2176 C  CD    . GLN C 3 221 ? 61.031 25.041  -6.120  1.00 23.17 ? 227  GLN A CD    1 
ATOM   2177 O  OE1   . GLN C 3 221 ? 60.303 24.222  -6.685  1.00 19.35 ? 227  GLN A OE1   1 
ATOM   2178 N  NE2   . GLN C 3 221 ? 60.649 25.704  -5.036  1.00 25.66 ? 227  GLN A NE2   1 
ATOM   2179 N  N     . GLU C 3 222 ? 65.934 25.887  -5.588  1.00 23.07 ? 228  GLU A N     1 
ATOM   2180 C  CA    . GLU C 3 222 ? 66.512 27.152  -5.135  1.00 23.69 ? 228  GLU A CA    1 
ATOM   2181 C  C     . GLU C 3 222 ? 67.639 27.591  -6.068  1.00 22.49 ? 228  GLU A C     1 
ATOM   2182 O  O     . GLU C 3 222 ? 67.729 28.766  -6.435  1.00 20.38 ? 228  GLU A O     1 
ATOM   2183 C  CB    . GLU C 3 222 ? 67.064 27.030  -3.707  1.00 25.44 ? 228  GLU A CB    1 
ATOM   2184 C  CG    . GLU C 3 222 ? 66.009 26.927  -2.616  1.00 24.99 ? 228  GLU A CG    1 
ATOM   2185 C  CD    . GLU C 3 222 ? 66.594 27.101  -1.215  1.00 25.91 ? 228  GLU A CD    1 
ATOM   2186 O  OE1   . GLU C 3 222 ? 67.809 27.376  -1.091  1.00 26.16 ? 228  GLU A OE1   1 
ATOM   2187 O  OE2   . GLU C 3 222 ? 65.833 26.975  -0.235  1.00 24.10 ? 228  GLU A OE2   1 
ATOM   2188 N  N     . ARG C 3 223 ? 68.493 26.645  -6.451  1.00 21.23 ? 229  ARG A N     1 
ATOM   2189 C  CA    . ARG C 3 223 ? 69.609 26.943  -7.347  1.00 21.25 ? 229  ARG A CA    1 
ATOM   2190 C  C     . ARG C 3 223 ? 69.139 27.332  -8.746  1.00 21.07 ? 229  ARG A C     1 
ATOM   2191 O  O     . ARG C 3 223 ? 69.809 28.113  -9.424  1.00 19.33 ? 229  ARG A O     1 
ATOM   2192 C  CB    . ARG C 3 223 ? 70.555 25.748  -7.462  1.00 21.24 ? 229  ARG A CB    1 
ATOM   2193 C  CG    . ARG C 3 223 ? 71.444 25.530  -6.258  1.00 22.43 ? 229  ARG A CG    1 
ATOM   2194 C  CD    . ARG C 3 223 ? 72.264 24.265  -6.439  1.00 22.32 ? 229  ARG A CD    1 
ATOM   2195 N  NE    . ARG C 3 223 ? 71.901 23.334  -5.391  1.00 28.50 ? 229  ARG A NE    1 
ATOM   2196 C  CZ    . ARG C 3 223 ? 71.505 22.085  -5.578  1.00 22.32 ? 229  ARG A CZ    1 
ATOM   2197 N  NH1   . ARG C 3 223 ? 71.411 21.564  -6.793  1.00 26.34 ? 229  ARG A NH1   1 
ATOM   2198 N  NH2   . ARG C 3 223 ? 71.196 21.367  -4.527  1.00 30.78 ? 229  ARG A NH2   1 
ATOM   2199 N  N     . ASN C 3 224 ? 68.015 26.760  -9.186  1.00 20.48 ? 230  ASN A N     1 
ATOM   2200 C  CA    . ASN C 3 224 ? 67.462 27.091  -10.497 1.00 18.59 ? 230  ASN A CA    1 
ATOM   2201 C  C     . ASN C 3 224 ? 67.015 28.544  -10.426 1.00 20.35 ? 230  ASN A C     1 
ATOM   2202 O  O     . ASN C 3 224 ? 67.373 29.366  -11.271 1.00 21.06 ? 230  ASN A O     1 
ATOM   2203 C  CB    . ASN C 3 224 ? 66.231 26.234  -10.840 1.00 18.17 ? 230  ASN A CB    1 
ATOM   2204 C  CG    . ASN C 3 224 ? 66.558 24.754  -11.042 1.00 20.04 ? 230  ASN A CG    1 
ATOM   2205 O  OD1   . ASN C 3 224 ? 67.680 24.387  -11.396 1.00 19.62 ? 230  ASN A OD1   1 
ATOM   2206 N  ND2   . ASN C 3 224 ? 65.555 23.896  -10.838 1.00 20.69 ? 230  ASN A ND2   1 
ATOM   2207 N  N     . GLY C 3 225 ? 66.222 28.848  -9.402  1.00 21.10 ? 231  GLY A N     1 
ATOM   2208 C  CA    . GLY C 3 225 ? 65.710 30.193  -9.233  1.00 21.41 ? 231  GLY A CA    1 
ATOM   2209 C  C     . GLY C 3 225 ? 64.503 30.379  -10.133 1.00 21.36 ? 231  GLY A C     1 
ATOM   2210 O  O     . GLY C 3 225 ? 64.180 29.488  -10.923 1.00 20.57 ? 231  GLY A O     1 
ATOM   2211 N  N     . PHE C 3 226 ? 63.835 31.523  -10.013 1.00 20.00 ? 232  PHE A N     1 
ATOM   2212 C  CA    . PHE C 3 226 ? 62.658 31.817  -10.830 1.00 20.39 ? 232  PHE A CA    1 
ATOM   2213 C  C     . PHE C 3 226 ? 63.005 33.002  -11.733 1.00 20.74 ? 232  PHE A C     1 
ATOM   2214 O  O     . PHE C 3 226 ? 63.258 34.102  -11.238 1.00 19.73 ? 232  PHE A O     1 
ATOM   2215 C  CB    . PHE C 3 226 ? 61.464 32.193  -9.927  1.00 19.55 ? 232  PHE A CB    1 
ATOM   2216 C  CG    . PHE C 3 226 ? 60.103 31.886  -10.528 1.00 16.48 ? 232  PHE A CG    1 
ATOM   2217 C  CD1   . PHE C 3 226 ? 59.833 32.146  -11.868 1.00 14.45 ? 232  PHE A CD1   1 
ATOM   2218 C  CD2   . PHE C 3 226 ? 59.080 31.363  -9.727  1.00 17.90 ? 232  PHE A CD2   1 
ATOM   2219 C  CE1   . PHE C 3 226 ? 58.564 31.893  -12.412 1.00 16.77 ? 232  PHE A CE1   1 
ATOM   2220 C  CE2   . PHE C 3 226 ? 57.798 31.100  -10.254 1.00 15.44 ? 232  PHE A CE2   1 
ATOM   2221 C  CZ    . PHE C 3 226 ? 57.540 31.366  -11.599 1.00 18.47 ? 232  PHE A CZ    1 
ATOM   2222 N  N     . PRO C 3 227 ? 63.043 32.791  -13.067 1.00 21.56 ? 233  PRO A N     1 
ATOM   2223 C  CA    . PRO C 3 227 ? 63.365 33.884  -14.002 1.00 20.93 ? 233  PRO A CA    1 
ATOM   2224 C  C     . PRO C 3 227 ? 62.446 35.055  -13.671 1.00 21.37 ? 233  PRO A C     1 
ATOM   2225 O  O     . PRO C 3 227 ? 61.234 34.876  -13.523 1.00 20.23 ? 233  PRO A O     1 
ATOM   2226 C  CB    . PRO C 3 227 ? 63.074 33.267  -15.367 1.00 21.01 ? 233  PRO A CB    1 
ATOM   2227 C  CG    . PRO C 3 227 ? 63.408 31.807  -15.145 1.00 19.47 ? 233  PRO A CG    1 
ATOM   2228 C  CD    . PRO C 3 227 ? 62.754 31.544  -13.800 1.00 20.27 ? 233  PRO A CD    1 
ATOM   2229 N  N     . PHE C 3 228 ? 63.033 36.244  -13.575 1.00 21.87 ? 234  PHE A N     1 
ATOM   2230 C  CA    . PHE C 3 228 ? 62.319 37.453  -13.178 1.00 22.92 ? 234  PHE A CA    1 
ATOM   2231 C  C     . PHE C 3 228 ? 62.515 38.642  -14.127 1.00 22.59 ? 234  PHE A C     1 
ATOM   2232 O  O     . PHE C 3 228 ? 63.638 38.974  -14.478 1.00 24.35 ? 234  PHE A O     1 
ATOM   2233 C  CB    . PHE C 3 228 ? 62.809 37.813  -11.779 1.00 22.91 ? 234  PHE A CB    1 
ATOM   2234 C  CG    . PHE C 3 228 ? 62.187 39.045  -11.197 1.00 24.40 ? 234  PHE A CG    1 
ATOM   2235 C  CD1   . PHE C 3 228 ? 60.888 39.022  -10.709 1.00 22.82 ? 234  PHE A CD1   1 
ATOM   2236 C  CD2   . PHE C 3 228 ? 62.938 40.211  -11.058 1.00 23.03 ? 234  PHE A CD2   1 
ATOM   2237 C  CE1   . PHE C 3 228 ? 60.350 40.142  -10.079 1.00 25.10 ? 234  PHE A CE1   1 
ATOM   2238 C  CE2   . PHE C 3 228 ? 62.411 41.331  -10.433 1.00 23.25 ? 234  PHE A CE2   1 
ATOM   2239 C  CZ    . PHE C 3 228 ? 61.115 41.297  -9.939  1.00 22.42 ? 234  PHE A CZ    1 
ATOM   2240 N  N     . ASP C 3 229 ? 61.415 39.286  -14.518 1.00 23.66 ? 235  ASP A N     1 
ATOM   2241 C  CA    . ASP C 3 229 ? 61.452 40.437  -15.427 1.00 24.78 ? 235  ASP A CA    1 
ATOM   2242 C  C     . ASP C 3 229 ? 61.802 41.717  -14.651 1.00 25.43 ? 235  ASP A C     1 
ATOM   2243 O  O     . ASP C 3 229 ? 60.916 42.476  -14.259 1.00 27.33 ? 235  ASP A O     1 
ATOM   2244 C  CB    . ASP C 3 229 ? 60.085 40.603  -16.114 1.00 25.48 ? 235  ASP A CB    1 
ATOM   2245 C  CG    . ASP C 3 229 ? 60.148 41.463  -17.383 1.00 26.21 ? 235  ASP A CG    1 
ATOM   2246 O  OD1   . ASP C 3 229 ? 61.177 42.134  -17.603 1.00 25.70 ? 235  ASP A OD1   1 
ATOM   2247 O  OD2   . ASP C 3 229 ? 59.160 41.473  -18.161 1.00 23.09 ? 235  ASP A OD2   1 
ATOM   2248 N  N     . THR C 3 230 ? 63.096 41.944  -14.438 1.00 25.55 ? 236  THR A N     1 
ATOM   2249 C  CA    . THR C 3 230 ? 63.588 43.113  -13.709 1.00 27.85 ? 236  THR A CA    1 
ATOM   2250 C  C     . THR C 3 230 ? 63.102 44.437  -14.301 1.00 28.89 ? 236  THR A C     1 
ATOM   2251 O  O     . THR C 3 230 ? 62.533 45.276  -13.603 1.00 29.44 ? 236  THR A O     1 
ATOM   2252 C  CB    . THR C 3 230 ? 65.128 43.128  -13.686 1.00 28.08 ? 236  THR A CB    1 
ATOM   2253 O  OG1   . THR C 3 230 ? 65.601 41.906  -13.108 1.00 27.66 ? 236  THR A OG1   1 
ATOM   2254 C  CG2   . THR C 3 230 ? 65.648 44.315  -12.867 1.00 27.13 ? 236  THR A CG2   1 
ATOM   2255 N  N     . LYS C 3 231 ? 63.336 44.617  -15.594 1.00 30.16 ? 237  LYS A N     1 
ATOM   2256 C  CA    . LYS C 3 231 ? 62.918 45.832  -16.286 1.00 30.21 ? 237  LYS A CA    1 
ATOM   2257 C  C     . LYS C 3 231 ? 61.426 46.109  -16.084 1.00 30.51 ? 237  LYS A C     1 
ATOM   2258 O  O     . LYS C 3 231 ? 61.031 47.248  -15.837 1.00 31.05 ? 237  LYS A O     1 
ATOM   2259 C  CB    . LYS C 3 231 ? 63.220 45.708  -17.782 1.00 30.10 ? 237  LYS A CB    1 
ATOM   2260 C  CG    . LYS C 3 231 ? 62.963 46.963  -18.580 1.00 31.62 ? 237  LYS A CG    1 
ATOM   2261 N  N     . ALA C 3 232 ? 60.594 45.076  -16.178 1.00 29.18 ? 238  ALA A N     1 
ATOM   2262 C  CA    . ALA C 3 232 ? 59.160 45.275  -16.010 1.00 29.50 ? 238  ALA A CA    1 
ATOM   2263 C  C     . ALA C 3 232 ? 58.789 45.740  -14.612 1.00 29.15 ? 238  ALA A C     1 
ATOM   2264 O  O     . ALA C 3 232 ? 57.869 46.547  -14.444 1.00 29.72 ? 238  ALA A O     1 
ATOM   2265 C  CB    . ALA C 3 232 ? 58.407 44.006  -16.337 1.00 29.87 ? 238  ALA A CB    1 
ATOM   2266 N  N     . ILE C 3 233 ? 59.496 45.236  -13.607 1.00 28.80 ? 239  ILE A N     1 
ATOM   2267 C  CA    . ILE C 3 233 ? 59.195 45.613  -12.232 1.00 28.01 ? 239  ILE A CA    1 
ATOM   2268 C  C     . ILE C 3 233 ? 59.697 47.016  -11.906 1.00 27.55 ? 239  ILE A C     1 
ATOM   2269 O  O     . ILE C 3 233 ? 59.113 47.706  -11.074 1.00 25.68 ? 239  ILE A O     1 
ATOM   2270 C  CB    . ILE C 3 233 ? 59.766 44.580  -11.234 1.00 26.96 ? 239  ILE A CB    1 
ATOM   2271 C  CG1   . ILE C 3 233 ? 59.068 43.231  -11.457 1.00 25.56 ? 239  ILE A CG1   1 
ATOM   2272 C  CG2   . ILE C 3 233 ? 59.535 45.043  -9.797  1.00 24.01 ? 239  ILE A CG2   1 
ATOM   2273 N  N     . GLU C 3 234 ? 60.776 47.431  -12.563 1.00 27.76 ? 240  GLU A N     1 
ATOM   2274 C  CA    . GLU C 3 234 ? 61.302 48.774  -12.366 1.00 29.35 ? 240  GLU A CA    1 
ATOM   2275 C  C     . GLU C 3 234 ? 60.304 49.763  -12.988 1.00 30.03 ? 240  GLU A C     1 
ATOM   2276 O  O     . GLU C 3 234 ? 60.031 50.822  -12.422 1.00 29.89 ? 240  GLU A O     1 
ATOM   2277 C  CB    . GLU C 3 234 ? 62.676 48.918  -13.025 1.00 28.94 ? 240  GLU A CB    1 
ATOM   2278 C  CG    . GLU C 3 234 ? 63.713 47.954  -12.459 1.00 32.65 ? 240  GLU A CG    1 
ATOM   2279 C  CD    . GLU C 3 234 ? 65.077 48.068  -13.127 1.00 34.25 ? 240  GLU A CD    1 
ATOM   2280 O  OE1   . GLU C 3 234 ? 65.116 48.189  -14.371 1.00 34.09 ? 240  GLU A OE1   1 
ATOM   2281 O  OE2   . GLU C 3 234 ? 66.109 48.021  -12.413 1.00 34.39 ? 240  GLU A OE2   1 
ATOM   2282 N  N     . GLU C 3 235 ? 59.744 49.409  -14.142 1.00 30.18 ? 241  GLU A N     1 
ATOM   2283 C  CA    . GLU C 3 235 ? 58.775 50.280  -14.798 1.00 31.64 ? 241  GLU A CA    1 
ATOM   2284 C  C     . GLU C 3 235 ? 57.496 50.325  -13.964 1.00 32.05 ? 241  GLU A C     1 
ATOM   2285 O  O     . GLU C 3 235 ? 56.823 51.348  -13.903 1.00 31.02 ? 241  GLU A O     1 
ATOM   2286 C  CB    . GLU C 3 235 ? 58.467 49.776  -16.207 1.00 33.96 ? 241  GLU A CB    1 
ATOM   2287 C  CG    . GLU C 3 235 ? 59.708 49.631  -17.088 1.00 40.39 ? 241  GLU A CG    1 
ATOM   2288 C  CD    . GLU C 3 235 ? 59.395 49.018  -18.447 1.00 42.99 ? 241  GLU A CD    1 
ATOM   2289 O  OE1   . GLU C 3 235 ? 58.618 48.035  -18.495 1.00 43.79 ? 241  GLU A OE1   1 
ATOM   2290 O  OE2   . GLU C 3 235 ? 59.935 49.509  -19.463 1.00 44.84 ? 241  GLU A OE2   1 
ATOM   2291 N  N     . LEU C 3 236 ? 57.164 49.209  -13.321 1.00 31.52 ? 242  LEU A N     1 
ATOM   2292 C  CA    . LEU C 3 236 ? 55.979 49.158  -12.473 1.00 31.77 ? 242  LEU A CA    1 
ATOM   2293 C  C     . LEU C 3 236 ? 56.213 50.065  -11.273 1.00 31.07 ? 242  LEU A C     1 
ATOM   2294 O  O     . LEU C 3 236 ? 55.319 50.791  -10.841 1.00 30.91 ? 242  LEU A O     1 
ATOM   2295 C  CB    . LEU C 3 236 ? 55.716 47.732  -11.982 1.00 31.88 ? 242  LEU A CB    1 
ATOM   2296 C  CG    . LEU C 3 236 ? 54.576 47.625  -10.960 1.00 30.83 ? 242  LEU A CG    1 
ATOM   2297 C  CD1   . LEU C 3 236 ? 53.297 48.125  -11.582 1.00 30.60 ? 242  LEU A CD1   1 
ATOM   2298 C  CD2   . LEU C 3 236 ? 54.416 46.180  -10.501 1.00 31.66 ? 242  LEU A CD2   1 
ATOM   2299 N  N     . TYR C 3 237 ? 57.433 50.006  -10.747 1.00 30.54 ? 243  TYR A N     1 
ATOM   2300 C  CA    . TYR C 3 237 ? 57.843 50.804  -9.603  1.00 30.28 ? 243  TYR A CA    1 
ATOM   2301 C  C     . TYR C 3 237 ? 57.662 52.298  -9.893  1.00 30.23 ? 243  TYR A C     1 
ATOM   2302 O  O     . TYR C 3 237 ? 57.106 53.032  -9.074  1.00 29.63 ? 243  TYR A O     1 
ATOM   2303 C  CB    . TYR C 3 237 ? 59.305 50.477  -9.260  1.00 29.67 ? 243  TYR A CB    1 
ATOM   2304 C  CG    . TYR C 3 237 ? 59.881 51.223  -8.073  1.00 30.99 ? 243  TYR A CG    1 
ATOM   2305 C  CD1   . TYR C 3 237 ? 59.067 51.663  -7.028  1.00 31.25 ? 243  TYR A CD1   1 
ATOM   2306 C  CD2   . TYR C 3 237 ? 61.252 51.478  -7.989  1.00 31.85 ? 243  TYR A CD2   1 
ATOM   2307 C  CE1   . TYR C 3 237 ? 59.602 52.344  -5.927  1.00 30.65 ? 243  TYR A CE1   1 
ATOM   2308 C  CE2   . TYR C 3 237 ? 61.799 52.151  -6.894  1.00 31.67 ? 243  TYR A CE2   1 
ATOM   2309 C  CZ    . TYR C 3 237 ? 60.967 52.580  -5.869  1.00 32.25 ? 243  TYR A CZ    1 
ATOM   2310 O  OH    . TYR C 3 237 ? 61.505 53.232  -4.781  1.00 33.16 ? 243  TYR A OH    1 
ATOM   2311 N  N     . VAL C 3 238 ? 58.122 52.735  -11.062 1.00 30.83 ? 244  VAL A N     1 
ATOM   2312 C  CA    . VAL C 3 238 ? 58.008 54.133  -11.473 1.00 32.86 ? 244  VAL A CA    1 
ATOM   2313 C  C     . VAL C 3 238 ? 56.551 54.570  -11.504 1.00 34.11 ? 244  VAL A C     1 
ATOM   2314 O  O     . VAL C 3 238 ? 56.212 55.660  -11.059 1.00 36.01 ? 244  VAL A O     1 
ATOM   2315 C  CB    . VAL C 3 238 ? 58.615 54.356  -12.879 1.00 33.07 ? 244  VAL A CB    1 
ATOM   2316 C  CG1   . VAL C 3 238 ? 58.221 55.732  -13.417 1.00 32.59 ? 244  VAL A CG1   1 
ATOM   2317 C  CG2   . VAL C 3 238 ? 60.126 54.234  -12.808 1.00 31.83 ? 244  VAL A CG2   1 
ATOM   2318 N  N     . GLU C 3 239 ? 55.698 53.705  -12.036 1.00 34.56 ? 245  GLU A N     1 
ATOM   2319 C  CA    . GLU C 3 239 ? 54.273 53.979  -12.141 1.00 35.15 ? 245  GLU A CA    1 
ATOM   2320 C  C     . GLU C 3 239 ? 53.587 54.032  -10.771 1.00 35.15 ? 245  GLU A C     1 
ATOM   2321 O  O     . GLU C 3 239 ? 52.723 54.878  -10.528 1.00 36.64 ? 245  GLU A O     1 
ATOM   2322 C  CB    . GLU C 3 239 ? 53.624 52.900  -13.008 1.00 36.72 ? 245  GLU A CB    1 
ATOM   2323 C  CG    . GLU C 3 239 ? 52.106 52.962  -13.118 1.00 40.55 ? 245  GLU A CG    1 
ATOM   2324 C  CD    . GLU C 3 239 ? 51.547 51.782  -13.904 1.00 43.28 ? 245  GLU A CD    1 
ATOM   2325 O  OE1   . GLU C 3 239 ? 52.122 51.456  -14.971 1.00 43.64 ? 245  GLU A OE1   1 
ATOM   2326 O  OE2   . GLU C 3 239 ? 50.538 51.184  -13.463 1.00 43.77 ? 245  GLU A OE2   1 
ATOM   2327 N  N     . LEU C 3 240 ? 53.970 53.121  -9.884  1.00 34.14 ? 246  LEU A N     1 
ATOM   2328 C  CA    . LEU C 3 240 ? 53.385 53.056  -8.550  1.00 32.08 ? 246  LEU A CA    1 
ATOM   2329 C  C     . LEU C 3 240 ? 53.860 54.229  -7.700  1.00 30.79 ? 246  LEU A C     1 
ATOM   2330 O  O     . LEU C 3 240 ? 53.113 54.769  -6.890  1.00 30.49 ? 246  LEU A O     1 
ATOM   2331 C  CB    . LEU C 3 240 ? 53.769 51.740  -7.865  1.00 29.72 ? 246  LEU A CB    1 
ATOM   2332 C  CG    . LEU C 3 240 ? 53.289 50.411  -8.464  1.00 29.91 ? 246  LEU A CG    1 
ATOM   2333 C  CD1   . LEU C 3 240 ? 54.065 49.270  -7.830  1.00 27.93 ? 246  LEU A CD1   1 
ATOM   2334 C  CD2   . LEU C 3 240 ? 51.799 50.229  -8.234  1.00 27.51 ? 246  LEU A CD2   1 
ATOM   2335 N  N     . ALA C 3 241 ? 55.114 54.613  -7.888  1.00 31.24 ? 247  ALA A N     1 
ATOM   2336 C  CA    . ALA C 3 241 ? 55.683 55.714  -7.134  1.00 32.55 ? 247  ALA A CA    1 
ATOM   2337 C  C     . ALA C 3 241 ? 54.990 57.036  -7.488  1.00 31.98 ? 247  ALA A C     1 
ATOM   2338 O  O     . ALA C 3 241 ? 54.655 57.821  -6.603  1.00 31.79 ? 247  ALA A O     1 
ATOM   2339 C  CB    . ALA C 3 241 ? 57.183 55.805  -7.403  1.00 30.72 ? 247  ALA A CB    1 
ATOM   2340 N  N     . ALA C 3 242 ? 54.768 57.272  -8.780  1.00 33.00 ? 248  ALA A N     1 
ATOM   2341 C  CA    . ALA C 3 242 ? 54.116 58.505  -9.222  1.00 33.52 ? 248  ALA A CA    1 
ATOM   2342 C  C     . ALA C 3 242 ? 52.693 58.563  -8.689  1.00 33.57 ? 248  ALA A C     1 
ATOM   2343 O  O     . ALA C 3 242 ? 52.227 59.617  -8.253  1.00 32.64 ? 248  ALA A O     1 
ATOM   2344 C  CB    . ALA C 3 242 ? 54.108 58.590  -10.752 1.00 34.13 ? 248  ALA A CB    1 
ATOM   2345 N  N     . ARG C 3 243 ? 51.996 57.431  -8.726  1.00 33.70 ? 249  ARG A N     1 
ATOM   2346 C  CA    . ARG C 3 243 ? 50.630 57.403  -8.219  1.00 34.27 ? 249  ARG A CA    1 
ATOM   2347 C  C     . ARG C 3 243 ? 50.669 57.609  -6.707  1.00 33.67 ? 249  ARG A C     1 
ATOM   2348 O  O     . ARG C 3 243 ? 49.765 58.215  -6.126  1.00 34.27 ? 249  ARG A O     1 
ATOM   2349 C  CB    . ARG C 3 243 ? 49.948 56.078  -8.562  1.00 33.45 ? 249  ARG A CB    1 
ATOM   2350 C  CG    . ARG C 3 243 ? 48.521 55.966  -8.036  1.00 34.13 ? 249  ARG A CG    1 
ATOM   2351 C  CD    . ARG C 3 243 ? 47.635 57.124  -8.501  1.00 34.76 ? 249  ARG A CD    1 
ATOM   2352 N  NE    . ARG C 3 243 ? 46.248 56.942  -8.074  1.00 36.32 ? 249  ARG A NE    1 
ATOM   2353 C  CZ    . ARG C 3 243 ? 45.291 57.864  -8.180  1.00 37.17 ? 249  ARG A CZ    1 
ATOM   2354 N  NH1   . ARG C 3 243 ? 45.560 59.057  -8.705  1.00 35.75 ? 249  ARG A NH1   1 
ATOM   2355 N  NH2   . ARG C 3 243 ? 44.064 57.596  -7.752  1.00 34.82 ? 249  ARG A NH2   1 
ATOM   2356 N  N     . ARG C 3 244 ? 51.722 57.107  -6.072  1.00 32.55 ? 250  ARG A N     1 
ATOM   2357 C  CA    . ARG C 3 244 ? 51.868 57.280  -4.640  1.00 32.60 ? 250  ARG A CA    1 
ATOM   2358 C  C     . ARG C 3 244 ? 52.019 58.779  -4.369  1.00 33.35 ? 250  ARG A C     1 
ATOM   2359 O  O     . ARG C 3 244 ? 51.336 59.330  -3.511  1.00 35.18 ? 250  ARG A O     1 
ATOM   2360 C  CB    . ARG C 3 244 ? 53.099 56.531  -4.114  1.00 31.30 ? 250  ARG A CB    1 
ATOM   2361 C  CG    . ARG C 3 244 ? 53.325 56.750  -2.621  1.00 31.77 ? 250  ARG A CG    1 
ATOM   2362 C  CD    . ARG C 3 244 ? 54.421 55.874  -2.056  1.00 29.97 ? 250  ARG A CD    1 
ATOM   2363 N  NE    . ARG C 3 244 ? 55.689 56.048  -2.751  1.00 29.99 ? 250  ARG A NE    1 
ATOM   2364 C  CZ    . ARG C 3 244 ? 56.806 55.402  -2.430  1.00 30.77 ? 250  ARG A CZ    1 
ATOM   2365 N  NH1   . ARG C 3 244 ? 56.811 54.539  -1.416  1.00 29.19 ? 250  ARG A NH1   1 
ATOM   2366 N  NH2   . ARG C 3 244 ? 57.914 55.611  -3.126  1.00 28.99 ? 250  ARG A NH2   1 
ATOM   2367 N  N     . SER C 3 245 ? 52.911 59.433  -5.108  1.00 33.26 ? 251  SER A N     1 
ATOM   2368 C  CA    . SER C 3 245 ? 53.138 60.867  -4.939  1.00 35.33 ? 251  SER A CA    1 
ATOM   2369 C  C     . SER C 3 245 ? 51.847 61.666  -5.115  1.00 35.33 ? 251  SER A C     1 
ATOM   2370 O  O     . SER C 3 245 ? 51.524 62.524  -4.298  1.00 36.39 ? 251  SER A O     1 
ATOM   2371 C  CB    . SER C 3 245 ? 54.171 61.372  -5.950  1.00 36.67 ? 251  SER A CB    1 
ATOM   2372 O  OG    . SER C 3 245 ? 55.450 60.821  -5.704  1.00 37.09 ? 251  SER A OG    1 
ATOM   2373 N  N     . GLU C 3 246 ? 51.117 61.369  -6.185  1.00 34.57 ? 252  GLU A N     1 
ATOM   2374 C  CA    . GLU C 3 246 ? 49.870 62.056  -6.499  1.00 35.16 ? 252  GLU A CA    1 
ATOM   2375 C  C     . GLU C 3 246 ? 48.814 61.879  -5.410  1.00 35.09 ? 252  GLU A C     1 
ATOM   2376 O  O     . GLU C 3 246 ? 48.063 62.808  -5.108  1.00 35.66 ? 252  GLU A O     1 
ATOM   2377 C  CB    . GLU C 3 246 ? 49.344 61.565  -7.851  1.00 35.87 ? 252  GLU A CB    1 
ATOM   2378 C  CG    . GLU C 3 246 ? 48.048 62.221  -8.339  1.00 40.10 ? 252  GLU A CG    1 
ATOM   2379 C  CD    . GLU C 3 246 ? 48.105 63.746  -8.352  1.00 40.50 ? 252  GLU A CD    1 
ATOM   2380 O  OE1   . GLU C 3 246 ? 49.198 64.318  -8.550  1.00 41.20 ? 252  GLU A OE1   1 
ATOM   2381 O  OE2   . GLU C 3 246 ? 47.043 64.370  -8.179  1.00 40.39 ? 252  GLU A OE2   1 
ATOM   2382 N  N     . LEU C 3 247 ? 48.757 60.688  -4.821  1.00 34.57 ? 253  LEU A N     1 
ATOM   2383 C  CA    . LEU C 3 247 ? 47.799 60.415  -3.758  1.00 32.21 ? 253  LEU A CA    1 
ATOM   2384 C  C     . LEU C 3 247 ? 48.217 61.149  -2.497  1.00 31.64 ? 253  LEU A C     1 
ATOM   2385 O  O     . LEU C 3 247 ? 47.374 61.582  -1.719  1.00 31.09 ? 253  LEU A O     1 
ATOM   2386 C  CB    . LEU C 3 247 ? 47.724 58.913  -3.472  1.00 31.43 ? 253  LEU A CB    1 
ATOM   2387 C  CG    . LEU C 3 247 ? 46.952 58.071  -4.487  1.00 31.42 ? 253  LEU A CG    1 
ATOM   2388 C  CD1   . LEU C 3 247 ? 47.100 56.586  -4.168  1.00 30.08 ? 253  LEU A CD1   1 
ATOM   2389 C  CD2   . LEU C 3 247 ? 45.494 58.478  -4.457  1.00 30.47 ? 253  LEU A CD2   1 
ATOM   2390 N  N     . LEU C 3 248 ? 49.526 61.276  -2.297  1.00 32.05 ? 254  LEU A N     1 
ATOM   2391 C  CA    . LEU C 3 248 ? 50.061 61.967  -1.129  1.00 32.37 ? 254  LEU A CA    1 
ATOM   2392 C  C     . LEU C 3 248 ? 49.784 63.461  -1.262  1.00 33.78 ? 254  LEU A C     1 
ATOM   2393 O  O     . LEU C 3 248 ? 49.437 64.132  -0.287  1.00 33.62 ? 254  LEU A O     1 
ATOM   2394 C  CB    . LEU C 3 248 ? 51.566 61.721  -1.011  1.00 32.05 ? 254  LEU A CB    1 
ATOM   2395 C  CG    . LEU C 3 248 ? 52.301 62.377  0.160   1.00 30.57 ? 254  LEU A CG    1 
ATOM   2396 C  CD1   . LEU C 3 248 ? 51.644 62.020  1.487   1.00 30.69 ? 254  LEU A CD1   1 
ATOM   2397 C  CD2   . LEU C 3 248 ? 53.745 61.919  0.136   1.00 30.05 ? 254  LEU A CD2   1 
ATOM   2398 N  N     . ARG C 3 249 ? 49.937 63.979  -2.475  1.00 34.02 ? 255  ARG A N     1 
ATOM   2399 C  CA    . ARG C 3 249 ? 49.672 65.390  -2.716  1.00 36.34 ? 255  ARG A CA    1 
ATOM   2400 C  C     . ARG C 3 249 ? 48.202 65.690  -2.421  1.00 36.94 ? 255  ARG A C     1 
ATOM   2401 O  O     . ARG C 3 249 ? 47.883 66.684  -1.770  1.00 38.75 ? 255  ARG A O     1 
ATOM   2402 C  CB    . ARG C 3 249 ? 49.982 65.757  -4.169  1.00 36.73 ? 255  ARG A CB    1 
ATOM   2403 C  CG    . ARG C 3 249 ? 49.832 67.246  -4.471  1.00 37.86 ? 255  ARG A CG    1 
ATOM   2404 C  CD    . ARG C 3 249 ? 50.045 67.543  -5.950  1.00 38.09 ? 255  ARG A CD    1 
ATOM   2405 N  NE    . ARG C 3 249 ? 48.969 67.005  -6.781  1.00 40.11 ? 255  ARG A NE    1 
ATOM   2406 C  CZ    . ARG C 3 249 ? 47.698 67.391  -6.703  1.00 41.18 ? 255  ARG A CZ    1 
ATOM   2407 N  NH1   . ARG C 3 249 ? 47.342 68.322  -5.826  1.00 42.98 ? 255  ARG A NH1   1 
ATOM   2408 N  NH2   . ARG C 3 249 ? 46.783 66.856  -7.502  1.00 40.18 ? 255  ARG A NH2   1 
ATOM   2409 N  N     . LYS C 3 250 ? 47.309 64.827  -2.893  1.00 36.38 ? 256  LYS A N     1 
ATOM   2410 C  CA    . LYS C 3 250 ? 45.886 65.037  -2.668  1.00 37.88 ? 256  LYS A CA    1 
ATOM   2411 C  C     . LYS C 3 250 ? 45.510 64.916  -1.200  1.00 38.01 ? 256  LYS A C     1 
ATOM   2412 O  O     . LYS C 3 250 ? 44.698 65.689  -0.690  1.00 38.26 ? 256  LYS A O     1 
ATOM   2413 C  CB    . LYS C 3 250 ? 45.051 64.040  -3.471  1.00 38.89 ? 256  LYS A CB    1 
ATOM   2414 C  CG    . LYS C 3 250 ? 44.861 64.406  -4.926  1.00 42.61 ? 256  LYS A CG    1 
ATOM   2415 C  CD    . LYS C 3 250 ? 43.807 63.511  -5.569  1.00 45.57 ? 256  LYS A CD    1 
ATOM   2416 C  CE    . LYS C 3 250 ? 43.507 63.930  -6.998  1.00 46.82 ? 256  LYS A CE    1 
ATOM   2417 N  NZ    . LYS C 3 250 ? 42.915 65.297  -7.062  1.00 50.50 ? 256  LYS A NZ    1 
ATOM   2418 N  N     . LEU C 3 251 ? 46.102 63.940  -0.524  1.00 37.10 ? 257  LEU A N     1 
ATOM   2419 C  CA    . LEU C 3 251 ? 45.799 63.711  0.876   1.00 34.60 ? 257  LEU A CA    1 
ATOM   2420 C  C     . LEU C 3 251 ? 46.381 64.756  1.820   1.00 34.35 ? 257  LEU A C     1 
ATOM   2421 O  O     . LEU C 3 251 ? 45.765 65.078  2.831   1.00 32.69 ? 257  LEU A O     1 
ATOM   2422 C  CB    . LEU C 3 251 ? 46.245 62.300  1.279   1.00 33.14 ? 257  LEU A CB    1 
ATOM   2423 C  CG    . LEU C 3 251 ? 45.309 61.215  0.720   1.00 32.15 ? 257  LEU A CG    1 
ATOM   2424 C  CD1   . LEU C 3 251 ? 45.849 59.823  1.010   1.00 29.85 ? 257  LEU A CD1   1 
ATOM   2425 C  CD2   . LEU C 3 251 ? 43.938 61.384  1.336   1.00 27.18 ? 257  LEU A CD2   1 
ATOM   2426 N  N     . THR C 3 252 ? 47.554 65.292  1.504   1.00 35.10 ? 258  THR A N     1 
ATOM   2427 C  CA    . THR C 3 252 ? 48.134 66.298  2.377   1.00 35.69 ? 258  THR A CA    1 
ATOM   2428 C  C     . THR C 3 252 ? 47.476 67.660  2.157   1.00 37.58 ? 258  THR A C     1 
ATOM   2429 O  O     . THR C 3 252 ? 47.741 68.611  2.888   1.00 38.89 ? 258  THR A O     1 
ATOM   2430 C  CB    . THR C 3 252 ? 49.672 66.409  2.205   1.00 35.81 ? 258  THR A CB    1 
ATOM   2431 O  OG1   . THR C 3 252 ? 49.999 66.556  0.822   1.00 37.13 ? 258  THR A OG1   1 
ATOM   2432 C  CG2   . THR C 3 252 ? 50.361 65.168  2.765   1.00 34.75 ? 258  THR A CG2   1 
ATOM   2433 N  N     . GLU C 3 253 ? 46.611 67.757  1.152   1.00 38.00 ? 259  GLU A N     1 
ATOM   2434 C  CA    . GLU C 3 253 ? 45.900 69.005  0.903   1.00 38.37 ? 259  GLU A CA    1 
ATOM   2435 C  C     . GLU C 3 253 ? 44.571 68.894  1.641   1.00 39.15 ? 259  GLU A C     1 
ATOM   2436 O  O     . GLU C 3 253 ? 44.046 69.878  2.156   1.00 39.13 ? 259  GLU A O     1 
ATOM   2437 C  CB    . GLU C 3 253 ? 45.644 69.209  -0.593  1.00 39.13 ? 259  GLU A CB    1 
ATOM   2438 N  N     . THR C 3 254 ? 44.033 67.680  1.697   1.00 39.14 ? 260  THR A N     1 
ATOM   2439 C  CA    . THR C 3 254 ? 42.766 67.452  2.379   1.00 38.77 ? 260  THR A CA    1 
ATOM   2440 C  C     . THR C 3 254 ? 42.957 67.404  3.894   1.00 39.05 ? 260  THR A C     1 
ATOM   2441 O  O     . THR C 3 254 ? 42.147 67.936  4.648   1.00 38.30 ? 260  THR A O     1 
ATOM   2442 C  CB    . THR C 3 254 ? 42.122 66.133  1.921   1.00 38.40 ? 260  THR A CB    1 
ATOM   2443 O  OG1   . THR C 3 254 ? 41.904 66.176  0.504   1.00 37.60 ? 260  THR A OG1   1 
ATOM   2444 C  CG2   . THR C 3 254 ? 40.785 65.916  2.630   1.00 36.82 ? 260  THR A CG2   1 
ATOM   2445 N  N     . PHE C 3 255 ? 44.039 66.765  4.328   1.00 38.90 ? 261  PHE A N     1 
ATOM   2446 C  CA    . PHE C 3 255 ? 44.341 66.627  5.748   1.00 39.64 ? 261  PHE A CA    1 
ATOM   2447 C  C     . PHE C 3 255 ? 45.633 67.362  6.076   1.00 39.88 ? 261  PHE A C     1 
ATOM   2448 O  O     . PHE C 3 255 ? 46.720 66.792  5.975   1.00 41.02 ? 261  PHE A O     1 
ATOM   2449 C  CB    . PHE C 3 255 ? 44.488 65.146  6.112   1.00 38.20 ? 261  PHE A CB    1 
ATOM   2450 C  CG    . PHE C 3 255 ? 43.255 64.322  5.843   1.00 38.30 ? 261  PHE A CG    1 
ATOM   2451 C  CD1   . PHE C 3 255 ? 42.068 64.577  6.520   1.00 37.53 ? 261  PHE A CD1   1 
ATOM   2452 C  CD2   . PHE C 3 255 ? 43.294 63.263  4.936   1.00 38.05 ? 261  PHE A CD2   1 
ATOM   2453 C  CE1   . PHE C 3 255 ? 40.938 63.791  6.302   1.00 37.11 ? 261  PHE A CE1   1 
ATOM   2454 C  CE2   . PHE C 3 255 ? 42.171 62.471  4.711   1.00 35.95 ? 261  PHE A CE2   1 
ATOM   2455 C  CZ    . PHE C 3 255 ? 40.990 62.735  5.397   1.00 36.95 ? 261  PHE A CZ    1 
ATOM   2456 N  N     . GLY C 3 256 ? 45.508 68.623  6.478   1.00 40.17 ? 262  GLY A N     1 
ATOM   2457 C  CA    . GLY C 3 256 ? 46.675 69.430  6.796   1.00 40.52 ? 262  GLY A CA    1 
ATOM   2458 C  C     . GLY C 3 256 ? 47.522 68.959  7.965   1.00 40.43 ? 262  GLY A C     1 
ATOM   2459 O  O     . GLY C 3 256 ? 47.076 68.161  8.794   1.00 40.64 ? 262  GLY A O     1 
ATOM   2460 N  N     . SER C 3 257 ? 48.749 69.469  8.031   1.00 39.69 ? 263  SER A N     1 
ATOM   2461 C  CA    . SER C 3 257 ? 49.683 69.110  9.092   1.00 39.45 ? 263  SER A CA    1 
ATOM   2462 C  C     . SER C 3 257 ? 49.281 69.725  10.437  1.00 38.05 ? 263  SER A C     1 
ATOM   2463 O  O     . SER C 3 257 ? 48.447 70.624  10.490  1.00 37.05 ? 263  SER A O     1 
ATOM   2464 C  CB    . SER C 3 257 ? 51.092 69.574  8.722   1.00 38.64 ? 263  SER A CB    1 
ATOM   2465 O  OG    . SER C 3 257 ? 51.182 70.988  8.742   1.00 38.82 ? 263  SER A OG    1 
ATOM   2466 N  N     . TRP C 3 258 ? 49.882 69.233  11.516  1.00 37.06 ? 264  TRP A N     1 
ATOM   2467 C  CA    . TRP C 3 258 ? 49.591 69.730  12.857  1.00 37.05 ? 264  TRP A CA    1 
ATOM   2468 C  C     . TRP C 3 258 ? 50.830 69.609  13.728  1.00 36.78 ? 264  TRP A C     1 
ATOM   2469 O  O     . TRP C 3 258 ? 51.849 69.070  13.297  1.00 38.56 ? 264  TRP A O     1 
ATOM   2470 C  CB    . TRP C 3 258 ? 48.444 68.930  13.484  1.00 37.02 ? 264  TRP A CB    1 
ATOM   2471 C  CG    . TRP C 3 258 ? 48.757 67.473  13.675  1.00 39.26 ? 264  TRP A CG    1 
ATOM   2472 C  CD1   . TRP C 3 258 ? 49.196 66.866  14.820  1.00 39.65 ? 264  TRP A CD1   1 
ATOM   2473 C  CD2   . TRP C 3 258 ? 48.651 66.439  12.689  1.00 38.88 ? 264  TRP A CD2   1 
ATOM   2474 N  NE1   . TRP C 3 258 ? 49.365 65.516  14.607  1.00 40.32 ? 264  TRP A NE1   1 
ATOM   2475 C  CE2   . TRP C 3 258 ? 49.039 65.230  13.306  1.00 39.55 ? 264  TRP A CE2   1 
ATOM   2476 C  CE3   . TRP C 3 258 ? 48.266 66.418  11.343  1.00 40.12 ? 264  TRP A CE3   1 
ATOM   2477 C  CZ2   . TRP C 3 258 ? 49.052 64.011  12.621  1.00 39.07 ? 264  TRP A CZ2   1 
ATOM   2478 C  CZ3   . TRP C 3 258 ? 48.280 65.202  10.661  1.00 38.41 ? 264  TRP A CZ3   1 
ATOM   2479 C  CH2   . TRP C 3 258 ? 48.672 64.018  11.304  1.00 38.15 ? 264  TRP A CH2   1 
ATOM   2480 N  N     . TYR C 3 259 ? 50.743 70.114  14.954  1.00 36.45 ? 265  TYR A N     1 
ATOM   2481 C  CA    . TYR C 3 259 ? 51.863 70.039  15.880  1.00 35.41 ? 265  TYR A CA    1 
ATOM   2482 C  C     . TYR C 3 259 ? 51.600 69.023  16.981  1.00 35.38 ? 265  TYR A C     1 
ATOM   2483 O  O     . TYR C 3 259 ? 50.462 68.821  17.396  1.00 33.88 ? 265  TYR A O     1 
ATOM   2484 C  CB    . TYR C 3 259 ? 52.145 71.407  16.509  1.00 35.42 ? 265  TYR A CB    1 
ATOM   2485 C  CG    . TYR C 3 259 ? 52.866 72.370  15.593  1.00 37.17 ? 265  TYR A CG    1 
ATOM   2486 C  CD1   . TYR C 3 259 ? 52.163 73.213  14.736  1.00 36.88 ? 265  TYR A CD1   1 
ATOM   2487 C  CD2   . TYR C 3 259 ? 54.258 72.424  15.576  1.00 36.70 ? 265  TYR A CD2   1 
ATOM   2488 C  CE1   . TYR C 3 259 ? 52.834 74.091  13.881  1.00 36.85 ? 265  TYR A CE1   1 
ATOM   2489 C  CE2   . TYR C 3 259 ? 54.936 73.289  14.733  1.00 37.91 ? 265  TYR A CE2   1 
ATOM   2490 C  CZ    . TYR C 3 259 ? 54.222 74.121  13.888  1.00 38.10 ? 265  TYR A CZ    1 
ATOM   2491 O  OH    . TYR C 3 259 ? 54.909 74.980  13.062  1.00 38.60 ? 265  TYR A OH    1 
ATOM   2492 N  N     . GLN C 3 260 ? 52.670 68.385  17.445  1.00 35.75 ? 266  GLN A N     1 
ATOM   2493 C  CA    . GLN C 3 260 ? 52.581 67.397  18.510  1.00 37.36 ? 266  GLN A CA    1 
ATOM   2494 C  C     . GLN C 3 260 ? 53.696 67.619  19.513  1.00 37.27 ? 266  GLN A C     1 
ATOM   2495 O  O     . GLN C 3 260 ? 54.820 67.956  19.138  1.00 36.81 ? 266  GLN A O     1 
ATOM   2496 C  CB    . GLN C 3 260 ? 52.712 65.973  17.953  1.00 38.35 ? 266  GLN A CB    1 
ATOM   2497 C  CG    . GLN C 3 260 ? 51.478 65.442  17.252  1.00 40.32 ? 266  GLN A CG    1 
ATOM   2498 C  CD    . GLN C 3 260 ? 51.634 63.986  16.828  1.00 41.88 ? 266  GLN A CD    1 
ATOM   2499 O  OE1   . GLN C 3 260 ? 50.676 63.352  16.387  1.00 41.64 ? 266  GLN A OE1   1 
ATOM   2500 N  NE2   . GLN C 3 260 ? 52.846 63.454  16.962  1.00 42.99 ? 266  GLN A NE2   1 
ATOM   2501 N  N     . PRO C 3 261 ? 53.405 67.429  20.808  1.00 38.87 ? 267  PRO A N     1 
ATOM   2502 C  CA    . PRO C 3 261 ? 54.452 67.622  21.815  1.00 39.35 ? 267  PRO A CA    1 
ATOM   2503 C  C     . PRO C 3 261 ? 55.584 66.636  21.544  1.00 41.27 ? 267  PRO A C     1 
ATOM   2504 O  O     . PRO C 3 261 ? 55.336 65.507  21.118  1.00 41.45 ? 267  PRO A O     1 
ATOM   2505 C  CB    . PRO C 3 261 ? 53.726 67.336  23.125  1.00 38.89 ? 267  PRO A CB    1 
ATOM   2506 C  CG    . PRO C 3 261 ? 52.689 66.329  22.718  1.00 38.72 ? 267  PRO A CG    1 
ATOM   2507 C  CD    . PRO C 3 261 ? 52.175 66.892  21.419  1.00 38.17 ? 267  PRO A CD    1 
ATOM   2508 N  N     . LYS C 3 262 ? 56.822 67.064  21.778  1.00 42.99 ? 268  LYS A N     1 
ATOM   2509 C  CA    . LYS C 3 262 ? 57.973 66.205  21.541  1.00 43.58 ? 268  LYS A CA    1 
ATOM   2510 C  C     . LYS C 3 262 ? 59.260 66.786  22.111  1.00 45.31 ? 268  LYS A C     1 
ATOM   2511 O  O     . LYS C 3 262 ? 59.587 67.952  21.875  1.00 45.29 ? 268  LYS A O     1 
ATOM   2512 C  CB    . LYS C 3 262 ? 58.149 65.970  20.039  1.00 43.77 ? 268  LYS A CB    1 
ATOM   2513 C  CG    . LYS C 3 262 ? 59.357 65.109  19.681  1.00 42.11 ? 268  LYS A CG    1 
ATOM   2514 N  N     . GLY C 3 263 ? 59.987 65.961  22.862  1.00 45.97 ? 269  GLY A N     1 
ATOM   2515 C  CA    . GLY C 3 263 ? 61.243 66.400  23.445  1.00 47.14 ? 269  GLY A CA    1 
ATOM   2516 C  C     . GLY C 3 263 ? 61.128 66.886  24.877  1.00 47.69 ? 269  GLY A C     1 
ATOM   2517 O  O     . GLY C 3 263 ? 62.134 67.209  25.511  1.00 48.74 ? 269  GLY A O     1 
ATOM   2518 N  N     . GLY C 3 264 ? 59.904 66.949  25.386  1.00 47.47 ? 270  GLY A N     1 
ATOM   2519 C  CA    . GLY C 3 264 ? 59.704 67.397  26.749  1.00 47.72 ? 270  GLY A CA    1 
ATOM   2520 C  C     . GLY C 3 264 ? 60.366 66.438  27.717  1.00 48.25 ? 270  GLY A C     1 
ATOM   2521 O  O     . GLY C 3 264 ? 60.188 65.226  27.619  1.00 47.97 ? 270  GLY A O     1 
ATOM   2522 N  N     . THR C 3 265 ? 61.129 66.980  28.658  1.00 48.99 ? 271  THR A N     1 
ATOM   2523 C  CA    . THR C 3 265 ? 61.824 66.153  29.635  1.00 50.09 ? 271  THR A CA    1 
ATOM   2524 C  C     . THR C 3 265 ? 61.144 66.135  31.003  1.00 49.44 ? 271  THR A C     1 
ATOM   2525 O  O     . THR C 3 265 ? 60.971 65.074  31.602  1.00 50.18 ? 271  THR A O     1 
ATOM   2526 C  CB    . THR C 3 265 ? 63.287 66.626  29.814  1.00 51.15 ? 271  THR A CB    1 
ATOM   2527 O  OG1   . THR C 3 265 ? 63.303 67.958  30.345  1.00 52.02 ? 271  THR A OG1   1 
ATOM   2528 C  CG2   . THR C 3 265 ? 64.019 66.620  28.471  1.00 51.20 ? 271  THR A CG2   1 
ATOM   2529 N  N     . GLU C 3 266 ? 60.742 67.306  31.486  1.00 48.46 ? 272  GLU A N     1 
ATOM   2530 C  CA    . GLU C 3 266 ? 60.110 67.416  32.801  1.00 47.12 ? 272  GLU A CA    1 
ATOM   2531 C  C     . GLU C 3 266 ? 58.600 67.209  32.817  1.00 44.97 ? 272  GLU A C     1 
ATOM   2532 O  O     . GLU C 3 266 ? 57.918 67.356  31.808  1.00 44.54 ? 272  GLU A O     1 
ATOM   2533 C  CB    . GLU C 3 266 ? 60.429 68.781  33.405  1.00 48.65 ? 272  GLU A CB    1 
ATOM   2534 C  CG    . GLU C 3 266 ? 61.858 69.221  33.169  1.00 50.85 ? 272  GLU A CG    1 
ATOM   2535 C  CD    . GLU C 3 266 ? 62.067 70.684  33.488  1.00 52.83 ? 272  GLU A CD    1 
ATOM   2536 O  OE1   . GLU C 3 266 ? 63.114 71.237  33.080  1.00 53.20 ? 272  GLU A OE1   1 
ATOM   2537 O  OE2   . GLU C 3 266 ? 61.184 71.276  34.148  1.00 52.88 ? 272  GLU A OE2   1 
ATOM   2538 N  N     . MET C 3 267 ? 58.094 66.877  33.996  1.00 44.29 ? 273  MET A N     1 
ATOM   2539 C  CA    . MET C 3 267 ? 56.674 66.644  34.222  1.00 43.42 ? 273  MET A CA    1 
ATOM   2540 C  C     . MET C 3 267 ? 55.974 67.979  34.484  1.00 42.55 ? 273  MET A C     1 
ATOM   2541 O  O     . MET C 3 267 ? 56.484 68.806  35.243  1.00 42.53 ? 273  MET A O     1 
ATOM   2542 C  CB    . MET C 3 267 ? 56.511 65.734  35.441  1.00 45.27 ? 273  MET A CB    1 
ATOM   2543 C  CG    . MET C 3 267 ? 55.099 65.625  35.985  1.00 45.98 ? 273  MET A CG    1 
ATOM   2544 S  SD    . MET C 3 267 ? 54.064 64.603  34.958  1.00 47.25 ? 273  MET A SD    1 
ATOM   2545 C  CE    . MET C 3 267 ? 54.536 62.964  35.552  1.00 47.08 ? 273  MET A CE    1 
ATOM   2546 N  N     . PHE C 3 268 ? 54.820 68.204  33.862  1.00 40.98 ? 274  PHE A N     1 
ATOM   2547 C  CA    . PHE C 3 268 ? 54.107 69.455  34.106  1.00 40.52 ? 274  PHE A CA    1 
ATOM   2548 C  C     . PHE C 3 268 ? 53.365 69.346  35.433  1.00 40.59 ? 274  PHE A C     1 
ATOM   2549 O  O     . PHE C 3 268 ? 52.596 68.410  35.651  1.00 40.18 ? 274  PHE A O     1 
ATOM   2550 C  CB    . PHE C 3 268 ? 53.105 69.775  32.992  1.00 37.59 ? 274  PHE A CB    1 
ATOM   2551 C  CG    . PHE C 3 268 ? 52.355 71.066  33.214  1.00 36.56 ? 274  PHE A CG    1 
ATOM   2552 C  CD1   . PHE C 3 268 ? 53.036 72.282  33.272  1.00 36.62 ? 274  PHE A CD1   1 
ATOM   2553 C  CD2   . PHE C 3 268 ? 50.975 71.065  33.393  1.00 36.07 ? 274  PHE A CD2   1 
ATOM   2554 C  CE1   . PHE C 3 268 ? 52.356 73.481  33.506  1.00 35.73 ? 274  PHE A CE1   1 
ATOM   2555 C  CE2   . PHE C 3 268 ? 50.279 72.260  33.630  1.00 36.91 ? 274  PHE A CE2   1 
ATOM   2556 C  CZ    . PHE C 3 268 ? 50.974 73.471  33.687  1.00 36.41 ? 274  PHE A CZ    1 
ATOM   2557 N  N     . CYS C 3 269 ? 53.613 70.306  36.318  1.00 41.36 ? 275  CYS A N     1 
ATOM   2558 C  CA    . CYS C 3 269 ? 52.981 70.329  37.631  1.00 43.07 ? 275  CYS A CA    1 
ATOM   2559 C  C     . CYS C 3 269 ? 52.103 71.569  37.772  1.00 43.45 ? 275  CYS A C     1 
ATOM   2560 O  O     . CYS C 3 269 ? 52.464 72.655  37.310  1.00 43.60 ? 275  CYS A O     1 
ATOM   2561 C  CB    . CYS C 3 269 ? 54.050 70.332  38.732  1.00 43.99 ? 275  CYS A CB    1 
ATOM   2562 S  SG    . CYS C 3 269 ? 55.166 68.886  38.729  1.00 47.82 ? 275  CYS A SG    1 
ATOM   2563 N  N     . HIS C 3 270 ? 50.948 71.407  38.408  1.00 43.87 ? 276  HIS A N     1 
ATOM   2564 C  CA    . HIS C 3 270 ? 50.052 72.535  38.610  1.00 44.85 ? 276  HIS A CA    1 
ATOM   2565 C  C     . HIS C 3 270 ? 50.828 73.607  39.368  1.00 44.61 ? 276  HIS A C     1 
ATOM   2566 O  O     . HIS C 3 270 ? 51.311 73.369  40.471  1.00 43.56 ? 276  HIS A O     1 
ATOM   2567 C  CB    . HIS C 3 270 ? 48.818 72.099  39.403  1.00 45.91 ? 276  HIS A CB    1 
ATOM   2568 C  CG    . HIS C 3 270 ? 47.753 73.149  39.488  1.00 47.52 ? 276  HIS A CG    1 
ATOM   2569 N  ND1   . HIS C 3 270 ? 46.439 72.852  39.777  1.00 48.86 ? 276  HIS A ND1   1 
ATOM   2570 C  CD2   . HIS C 3 270 ? 47.805 74.491  39.315  1.00 48.21 ? 276  HIS A CD2   1 
ATOM   2571 C  CE1   . HIS C 3 270 ? 45.727 73.965  39.775  1.00 49.15 ? 276  HIS A CE1   1 
ATOM   2572 N  NE2   . HIS C 3 270 ? 46.532 74.974  39.498  1.00 48.61 ? 276  HIS A NE2   1 
ATOM   2573 N  N     . PRO C 3 271 ? 50.960 74.806  38.775  1.00 46.04 ? 277  PRO A N     1 
ATOM   2574 C  CA    . PRO C 3 271 ? 51.673 75.963  39.335  1.00 46.74 ? 277  PRO A CA    1 
ATOM   2575 C  C     . PRO C 3 271 ? 51.255 76.418  40.735  1.00 47.32 ? 277  PRO A C     1 
ATOM   2576 O  O     . PRO C 3 271 ? 51.965 77.196  41.374  1.00 47.43 ? 277  PRO A O     1 
ATOM   2577 C  CB    . PRO C 3 271 ? 51.432 77.051  38.292  1.00 47.03 ? 277  PRO A CB    1 
ATOM   2578 C  CG    . PRO C 3 271 ? 51.334 76.269  37.017  1.00 47.27 ? 277  PRO A CG    1 
ATOM   2579 C  CD    . PRO C 3 271 ? 50.451 75.120  37.427  1.00 46.26 ? 277  PRO A CD    1 
ATOM   2580 N  N     . ARG C 3 272 ? 50.112 75.939  41.212  1.00 47.54 ? 278  ARG A N     1 
ATOM   2581 C  CA    . ARG C 3 272 ? 49.627 76.332  42.532  1.00 49.09 ? 278  ARG A CA    1 
ATOM   2582 C  C     . ARG C 3 272 ? 49.615 75.172  43.526  1.00 49.13 ? 278  ARG A C     1 
ATOM   2583 O  O     . ARG C 3 272 ? 50.016 75.324  44.681  1.00 49.69 ? 278  ARG A O     1 
ATOM   2584 C  CB    . ARG C 3 272 ? 48.215 76.911  42.409  1.00 50.08 ? 278  ARG A CB    1 
ATOM   2585 C  CG    . ARG C 3 272 ? 47.611 77.432  43.710  1.00 50.75 ? 278  ARG A CG    1 
ATOM   2586 C  CD    . ARG C 3 272 ? 46.170 76.971  43.824  1.00 51.64 ? 278  ARG A CD    1 
ATOM   2587 N  NE    . ARG C 3 272 ? 45.500 77.038  42.528  1.00 52.05 ? 278  ARG A NE    1 
ATOM   2588 C  CZ    . ARG C 3 272 ? 44.362 76.420  42.245  1.00 50.90 ? 278  ARG A CZ    1 
ATOM   2589 N  NH1   . ARG C 3 272 ? 43.765 75.688  43.174  1.00 50.77 ? 278  ARG A NH1   1 
ATOM   2590 N  NH2   . ARG C 3 272 ? 43.834 76.518  41.029  1.00 51.23 ? 278  ARG A NH2   1 
ATOM   2591 N  N     . THR C 3 273 ? 49.161 74.014  43.063  1.00 49.05 ? 279  THR A N     1 
ATOM   2592 C  CA    . THR C 3 273 ? 49.065 72.823  43.898  1.00 49.39 ? 279  THR A CA    1 
ATOM   2593 C  C     . THR C 3 273 ? 50.340 71.986  43.963  1.00 49.55 ? 279  THR A C     1 
ATOM   2594 O  O     . THR C 3 273 ? 50.613 71.345  44.979  1.00 50.32 ? 279  THR A O     1 
ATOM   2595 C  CB    . THR C 3 273 ? 47.911 71.917  43.410  1.00 49.49 ? 279  THR A CB    1 
ATOM   2596 O  OG1   . THR C 3 273 ? 46.657 72.569  43.653  1.00 50.68 ? 279  THR A OG1   1 
ATOM   2597 C  CG2   . THR C 3 273 ? 47.928 70.587  44.129  1.00 50.94 ? 279  THR A CG2   1 
ATOM   2598 N  N     . GLY C 3 274 ? 51.117 71.993  42.884  1.00 48.99 ? 280  GLY A N     1 
ATOM   2599 C  CA    . GLY C 3 274 ? 52.331 71.197  42.849  1.00 47.66 ? 280  GLY A CA    1 
ATOM   2600 C  C     . GLY C 3 274 ? 51.970 69.816  42.334  1.00 47.10 ? 280  GLY A C     1 
ATOM   2601 O  O     . GLY C 3 274 ? 52.832 69.001  42.007  1.00 45.82 ? 280  GLY A O     1 
ATOM   2602 N  N     . LYS C 3 275 ? 50.665 69.576  42.257  1.00 47.53 ? 281  LYS A N     1 
ATOM   2603 C  CA    . LYS C 3 275 ? 50.098 68.317  41.791  1.00 47.50 ? 281  LYS A CA    1 
ATOM   2604 C  C     . LYS C 3 275 ? 50.634 67.886  40.427  1.00 47.93 ? 281  LYS A C     1 
ATOM   2605 O  O     . LYS C 3 275 ? 50.372 68.531  39.409  1.00 47.29 ? 281  LYS A O     1 
ATOM   2606 C  CB    . LYS C 3 275 ? 48.575 68.451  41.727  1.00 47.39 ? 281  LYS A CB    1 
ATOM   2607 C  CG    . LYS C 3 275 ? 47.830 67.251  41.168  1.00 46.91 ? 281  LYS A CG    1 
ATOM   2608 C  CD    . LYS C 3 275 ? 46.360 67.602  41.000  1.00 46.70 ? 281  LYS A CD    1 
ATOM   2609 C  CE    . LYS C 3 275 ? 45.579 66.478  40.352  1.00 48.82 ? 281  LYS A CE    1 
ATOM   2610 N  NZ    . LYS C 3 275 ? 44.182 66.894  40.044  1.00 49.81 ? 281  LYS A NZ    1 
ATOM   2611 N  N     . PRO C 3 276 ? 51.403 66.787  40.391  1.00 48.35 ? 282  PRO A N     1 
ATOM   2612 C  CA    . PRO C 3 276 ? 51.951 66.306  39.122  1.00 48.17 ? 282  PRO A CA    1 
ATOM   2613 C  C     . PRO C 3 276 ? 50.811 66.062  38.140  1.00 48.16 ? 282  PRO A C     1 
ATOM   2614 O  O     . PRO C 3 276 ? 49.759 65.544  38.516  1.00 47.57 ? 282  PRO A O     1 
ATOM   2615 C  CB    . PRO C 3 276 ? 52.654 65.011  39.520  1.00 48.13 ? 282  PRO A CB    1 
ATOM   2616 C  CG    . PRO C 3 276 ? 53.114 65.304  40.920  1.00 48.69 ? 282  PRO A CG    1 
ATOM   2617 C  CD    . PRO C 3 276 ? 51.896 65.974  41.519  1.00 48.66 ? 282  PRO A CD    1 
ATOM   2618 N  N     . LEU C 3 277 ? 51.015 66.450  36.887  1.00 47.94 ? 283  LEU A N     1 
ATOM   2619 C  CA    . LEU C 3 277 ? 49.996 66.257  35.867  1.00 47.55 ? 283  LEU A CA    1 
ATOM   2620 C  C     . LEU C 3 277 ? 50.561 65.360  34.765  1.00 47.91 ? 283  LEU A C     1 
ATOM   2621 O  O     . LEU C 3 277 ? 51.085 65.838  33.756  1.00 47.82 ? 283  LEU A O     1 
ATOM   2622 C  CB    . LEU C 3 277 ? 49.554 67.614  35.308  1.00 47.88 ? 283  LEU A CB    1 
ATOM   2623 C  CG    . LEU C 3 277 ? 48.823 68.516  36.316  1.00 48.35 ? 283  LEU A CG    1 
ATOM   2624 C  CD1   . LEU C 3 277 ? 48.586 69.883  35.713  1.00 48.36 ? 283  LEU A CD1   1 
ATOM   2625 C  CD2   . LEU C 3 277 ? 47.497 67.880  36.719  1.00 47.40 ? 283  LEU A CD2   1 
ATOM   2626 N  N     . PRO C 3 278 ? 50.474 64.033  34.966  1.00 47.42 ? 284  PRO A N     1 
ATOM   2627 C  CA    . PRO C 3 278 ? 50.952 62.997  34.043  1.00 47.18 ? 284  PRO A CA    1 
ATOM   2628 C  C     . PRO C 3 278 ? 50.374 63.080  32.635  1.00 45.80 ? 284  PRO A C     1 
ATOM   2629 O  O     . PRO C 3 278 ? 51.098 62.905  31.656  1.00 44.69 ? 284  PRO A O     1 
ATOM   2630 C  CB    . PRO C 3 278 ? 50.554 61.699  34.747  1.00 47.40 ? 284  PRO A CB    1 
ATOM   2631 C  CG    . PRO C 3 278 ? 50.663 62.067  36.191  1.00 48.47 ? 284  PRO A CG    1 
ATOM   2632 C  CD    . PRO C 3 278 ? 49.998 63.423  36.222  1.00 47.61 ? 284  PRO A CD    1 
ATOM   2633 N  N     . LYS C 3 279 ? 49.073 63.343  32.543  1.00 45.17 ? 285  LYS A N     1 
ATOM   2634 C  CA    . LYS C 3 279 ? 48.389 63.432  31.254  1.00 44.54 ? 285  LYS A CA    1 
ATOM   2635 C  C     . LYS C 3 279 ? 48.896 64.564  30.356  1.00 44.22 ? 285  LYS A C     1 
ATOM   2636 O  O     . LYS C 3 279 ? 49.045 64.386  29.147  1.00 43.49 ? 285  LYS A O     1 
ATOM   2637 C  CB    . LYS C 3 279 ? 46.883 63.589  31.477  1.00 45.52 ? 285  LYS A CB    1 
ATOM   2638 N  N     . TYR C 3 280 ? 49.146 65.729  30.944  1.00 43.72 ? 286  TYR A N     1 
ATOM   2639 C  CA    . TYR C 3 280 ? 49.641 66.872  30.183  1.00 43.48 ? 286  TYR A CA    1 
ATOM   2640 C  C     . TYR C 3 280 ? 50.968 66.555  29.503  1.00 43.13 ? 286  TYR A C     1 
ATOM   2641 O  O     . TYR C 3 280 ? 51.762 65.763  30.009  1.00 43.54 ? 286  TYR A O     1 
ATOM   2642 C  CB    . TYR C 3 280 ? 49.823 68.081  31.104  1.00 43.54 ? 286  TYR A CB    1 
ATOM   2643 C  CG    . TYR C 3 280 ? 48.623 69.001  31.159  1.00 44.27 ? 286  TYR A CG    1 
ATOM   2644 C  CD1   . TYR C 3 280 ? 48.410 69.962  30.171  1.00 44.37 ? 286  TYR A CD1   1 
ATOM   2645 C  CD2   . TYR C 3 280 ? 47.695 68.906  32.194  1.00 44.55 ? 286  TYR A CD2   1 
ATOM   2646 C  CE1   . TYR C 3 280 ? 47.303 70.810  30.214  1.00 45.52 ? 286  TYR A CE1   1 
ATOM   2647 C  CE2   . TYR C 3 280 ? 46.584 69.746  32.245  1.00 46.23 ? 286  TYR A CE2   1 
ATOM   2648 C  CZ    . TYR C 3 280 ? 46.395 70.696  31.253  1.00 45.49 ? 286  TYR A CZ    1 
ATOM   2649 O  OH    . TYR C 3 280 ? 45.305 71.533  31.309  1.00 45.54 ? 286  TYR A OH    1 
ATOM   2650 N  N     . PRO C 3 281 ? 51.213 67.156  28.330  1.00 42.72 ? 287  PRO A N     1 
ATOM   2651 C  CA    . PRO C 3 281 ? 52.461 66.936  27.589  1.00 42.62 ? 287  PRO A CA    1 
ATOM   2652 C  C     . PRO C 3 281 ? 53.646 67.342  28.463  1.00 42.68 ? 287  PRO A C     1 
ATOM   2653 O  O     . PRO C 3 281 ? 53.528 68.253  29.279  1.00 41.24 ? 287  PRO A O     1 
ATOM   2654 C  CB    . PRO C 3 281 ? 52.305 67.852  26.381  1.00 41.87 ? 287  PRO A CB    1 
ATOM   2655 C  CG    . PRO C 3 281 ? 50.822 67.823  26.140  1.00 42.63 ? 287  PRO A CG    1 
ATOM   2656 C  CD    . PRO C 3 281 ? 50.261 67.951  27.534  1.00 42.02 ? 287  PRO A CD    1 
ATOM   2657 N  N     . ARG C 3 282 ? 54.780 66.670  28.298  1.00 42.76 ? 288  ARG A N     1 
ATOM   2658 C  CA    . ARG C 3 282 ? 55.963 66.989  29.093  1.00 44.08 ? 288  ARG A CA    1 
ATOM   2659 C  C     . ARG C 3 282 ? 56.587 68.309  28.660  1.00 43.18 ? 288  ARG A C     1 
ATOM   2660 O  O     . ARG C 3 282 ? 56.724 68.588  27.471  1.00 43.92 ? 288  ARG A O     1 
ATOM   2661 C  CB    . ARG C 3 282 ? 56.996 65.861  28.996  1.00 45.43 ? 288  ARG A CB    1 
ATOM   2662 C  CG    . ARG C 3 282 ? 56.560 64.578  29.691  1.00 47.96 ? 288  ARG A CG    1 
ATOM   2663 C  CD    . ARG C 3 282 ? 56.392 64.800  31.191  1.00 50.34 ? 288  ARG A CD    1 
ATOM   2664 N  NE    . ARG C 3 282 ? 55.234 64.091  31.737  1.00 52.40 ? 288  ARG A NE    1 
ATOM   2665 C  CZ    . ARG C 3 282 ? 55.093 62.770  31.757  1.00 52.31 ? 288  ARG A CZ    1 
ATOM   2666 N  NH1   . ARG C 3 282 ? 56.042 61.989  31.262  1.00 52.96 ? 288  ARG A NH1   1 
ATOM   2667 N  NH2   . ARG C 3 282 ? 53.993 62.228  32.264  1.00 53.58 ? 288  ARG A NH2   1 
ATOM   2668 N  N     . ILE C 3 283 ? 56.969 69.121  29.634  1.00 42.81 ? 289  ILE A N     1 
ATOM   2669 C  CA    . ILE C 3 283 ? 57.560 70.418  29.343  1.00 43.18 ? 289  ILE A CA    1 
ATOM   2670 C  C     . ILE C 3 283 ? 59.062 70.456  29.563  1.00 43.05 ? 289  ILE A C     1 
ATOM   2671 O  O     . ILE C 3 283 ? 59.685 69.466  29.945  1.00 42.93 ? 289  ILE A O     1 
ATOM   2672 C  CB    . ILE C 3 283 ? 56.932 71.515  30.215  1.00 42.27 ? 289  ILE A CB    1 
ATOM   2673 C  CG1   . ILE C 3 283 ? 57.156 71.190  31.693  1.00 42.59 ? 289  ILE A CG1   1 
ATOM   2674 C  CG2   . ILE C 3 283 ? 55.451 71.623  29.922  1.00 42.14 ? 289  ILE A CG2   1 
ATOM   2675 N  N     . LYS C 3 284 ? 59.631 71.625  29.311  1.00 43.51 ? 290  LYS A N     1 
ATOM   2676 C  CA    . LYS C 3 284 ? 61.053 71.857  29.483  1.00 44.76 ? 290  LYS A CA    1 
ATOM   2677 C  C     . LYS C 3 284 ? 61.153 73.227  30.148  1.00 46.04 ? 290  LYS A C     1 
ATOM   2678 O  O     . LYS C 3 284 ? 60.482 74.177  29.730  1.00 45.12 ? 290  LYS A O     1 
ATOM   2679 C  CB    . LYS C 3 284 ? 61.754 71.863  28.120  1.00 45.42 ? 290  LYS A CB    1 
ATOM   2680 C  CG    . LYS C 3 284 ? 63.262 72.041  28.185  1.00 46.89 ? 290  LYS A CG    1 
ATOM   2681 N  N     . THR C 3 285 ? 61.964 73.325  31.196  1.00 46.30 ? 291  THR A N     1 
ATOM   2682 C  CA    . THR C 3 285 ? 62.123 74.592  31.898  1.00 47.67 ? 291  THR A CA    1 
ATOM   2683 C  C     . THR C 3 285 ? 63.515 75.158  31.660  1.00 48.26 ? 291  THR A C     1 
ATOM   2684 O  O     . THR C 3 285 ? 64.499 74.667  32.211  1.00 48.00 ? 291  THR A O     1 
ATOM   2685 C  CB    . THR C 3 285 ? 61.904 74.431  33.418  1.00 47.19 ? 291  THR A CB    1 
ATOM   2686 O  OG1   . THR C 3 285 ? 60.648 73.787  33.660  1.00 46.05 ? 291  THR A OG1   1 
ATOM   2687 C  CG2   . THR C 3 285 ? 61.894 75.793  34.093  1.00 47.77 ? 291  THR A CG2   1 
ATOM   2688 N  N     . PRO C 3 286 ? 63.616 76.203  30.826  1.00 49.17 ? 292  PRO A N     1 
ATOM   2689 C  CA    . PRO C 3 286 ? 64.915 76.813  30.535  1.00 49.52 ? 292  PRO A CA    1 
ATOM   2690 C  C     . PRO C 3 286 ? 65.637 77.276  31.797  1.00 49.96 ? 292  PRO A C     1 
ATOM   2691 O  O     . PRO C 3 286 ? 65.026 77.835  32.712  1.00 48.95 ? 292  PRO A O     1 
ATOM   2692 C  CB    . PRO C 3 286 ? 64.553 77.967  29.596  1.00 49.45 ? 292  PRO A CB    1 
ATOM   2693 C  CG    . PRO C 3 286 ? 63.154 78.320  30.008  1.00 49.54 ? 292  PRO A CG    1 
ATOM   2694 C  CD    . PRO C 3 286 ? 62.525 76.960  30.187  1.00 49.04 ? 292  PRO A CD    1 
ATOM   2695 N  N     . LYS C 3 287 ? 66.942 77.029  31.841  1.00 50.70 ? 293  LYS A N     1 
ATOM   2696 C  CA    . LYS C 3 287 ? 67.755 77.408  32.987  1.00 51.70 ? 293  LYS A CA    1 
ATOM   2697 C  C     . LYS C 3 287 ? 68.402 78.767  32.758  1.00 52.56 ? 293  LYS A C     1 
ATOM   2698 O  O     . LYS C 3 287 ? 68.660 79.511  33.704  1.00 53.67 ? 293  LYS A O     1 
ATOM   2699 C  CB    . LYS C 3 287 ? 68.835 76.352  33.235  1.00 51.83 ? 293  LYS A CB    1 
ATOM   2700 N  N     . VAL C 3 288 ? 68.662 79.087  31.494  1.00 52.67 ? 294  VAL A N     1 
ATOM   2701 C  CA    . VAL C 3 288 ? 69.280 80.358  31.141  1.00 52.47 ? 294  VAL A CA    1 
ATOM   2702 C  C     . VAL C 3 288 ? 68.333 81.221  30.305  1.00 51.97 ? 294  VAL A C     1 
ATOM   2703 O  O     . VAL C 3 288 ? 67.477 80.705  29.588  1.00 51.28 ? 294  VAL A O     1 
ATOM   2704 C  CB    . VAL C 3 288 ? 70.589 80.136  30.345  1.00 52.64 ? 294  VAL A CB    1 
ATOM   2705 C  CG1   . VAL C 3 288 ? 71.548 79.274  31.153  1.00 53.17 ? 294  VAL A CG1   1 
ATOM   2706 C  CG2   . VAL C 3 288 ? 70.284 79.478  29.006  1.00 53.33 ? 294  VAL A CG2   1 
ATOM   2707 N  N     . GLY C 3 289 ? 68.492 82.538  30.404  1.00 51.64 ? 295  GLY A N     1 
ATOM   2708 C  CA    . GLY C 3 289 ? 67.650 83.440  29.640  1.00 50.58 ? 295  GLY A CA    1 
ATOM   2709 C  C     . GLY C 3 289 ? 66.990 84.536  30.455  1.00 50.21 ? 295  GLY A C     1 
ATOM   2710 O  O     . GLY C 3 289 ? 66.609 84.333  31.611  1.00 50.08 ? 295  GLY A O     1 
ATOM   2711 N  N     . GLY C 3 290 ? 66.856 85.708  29.843  1.00 49.56 ? 296  GLY A N     1 
ATOM   2712 C  CA    . GLY C 3 290 ? 66.229 86.829  30.514  1.00 50.00 ? 296  GLY A CA    1 
ATOM   2713 C  C     . GLY C 3 290 ? 65.777 87.891  29.529  1.00 50.12 ? 296  GLY A C     1 
ATOM   2714 O  O     . GLY C 3 290 ? 66.006 87.775  28.325  1.00 49.86 ? 296  GLY A O     1 
ATOM   2715 N  N     . ILE C 3 291 ? 65.133 88.931  30.043  1.00 49.99 ? 297  ILE A N     1 
ATOM   2716 C  CA    . ILE C 3 291 ? 64.653 90.022  29.210  1.00 50.42 ? 297  ILE A CA    1 
ATOM   2717 C  C     . ILE C 3 291 ? 65.775 91.020  28.941  1.00 50.56 ? 297  ILE A C     1 
ATOM   2718 O  O     . ILE C 3 291 ? 66.460 90.845  27.910  1.00 51.15 ? 297  ILE A O     1 
ATOM   2719 C  CB    . ILE C 3 291 ? 63.477 90.753  29.893  1.00 51.05 ? 297  ILE A CB    1 
ATOM   2720 C  CG1   . ILE C 3 291 ? 62.322 89.773  30.117  1.00 51.05 ? 297  ILE A CG1   1 
ATOM   2721 C  CG2   . ILE C 3 291 ? 63.020 91.931  29.039  1.00 51.34 ? 297  ILE A CG2   1 
ATOM   2722 C  CD1   . ILE C 3 291 ? 61.775 89.166  28.839  1.00 51.01 ? 297  ILE A CD1   1 
ATOM   2723 N  N     . LEU C 3 309 ? 69.923 94.160  25.798  1.00 51.74 ? 315  LEU A N     1 
ATOM   2724 C  CA    . LEU C 3 309 ? 68.702 93.317  25.651  1.00 52.65 ? 315  LEU A CA    1 
ATOM   2725 C  C     . LEU C 3 309 ? 69.058 91.902  25.188  1.00 52.63 ? 315  LEU A C     1 
ATOM   2726 O  O     . LEU C 3 309 ? 69.732 91.716  24.172  1.00 53.65 ? 315  LEU A O     1 
ATOM   2727 C  CB    . LEU C 3 309 ? 67.734 93.972  24.660  1.00 52.80 ? 315  LEU A CB    1 
ATOM   2728 C  CG    . LEU C 3 309 ? 66.322 93.380  24.578  1.00 53.43 ? 315  LEU A CG    1 
ATOM   2729 C  CD1   . LEU C 3 309 ? 65.373 94.390  23.947  1.00 53.49 ? 315  LEU A CD1   1 
ATOM   2730 C  CD2   . LEU C 3 309 ? 66.350 92.086  23.781  1.00 54.95 ? 315  LEU A CD2   1 
ATOM   2731 N  N     . ASP C 3 310 ? 68.599 90.910  25.946  1.00 51.88 ? 316  ASP A N     1 
ATOM   2732 C  CA    . ASP C 3 310 ? 68.858 89.501  25.652  1.00 51.97 ? 316  ASP A CA    1 
ATOM   2733 C  C     . ASP C 3 310 ? 68.039 89.026  24.455  1.00 52.17 ? 316  ASP A C     1 
ATOM   2734 O  O     . ASP C 3 310 ? 66.829 88.817  24.565  1.00 52.43 ? 316  ASP A O     1 
ATOM   2735 C  CB    . ASP C 3 310 ? 68.521 88.655  26.880  1.00 51.59 ? 316  ASP A CB    1 
ATOM   2736 C  CG    . ASP C 3 310 ? 68.885 87.197  26.704  1.00 50.77 ? 316  ASP A CG    1 
ATOM   2737 O  OD1   . ASP C 3 310 ? 68.637 86.416  27.646  1.00 49.09 ? 316  ASP A OD1   1 
ATOM   2738 O  OD2   . ASP C 3 310 ? 69.418 86.834  25.632  1.00 50.83 ? 316  ASP A OD2   1 
ATOM   2739 N  N     . THR C 3 311 ? 68.710 88.839  23.322  1.00 51.84 ? 317  THR A N     1 
ATOM   2740 C  CA    . THR C 3 311 ? 68.051 88.418  22.088  1.00 52.29 ? 317  THR A CA    1 
ATOM   2741 C  C     . THR C 3 311 ? 67.519 86.985  22.108  1.00 51.59 ? 317  THR A C     1 
ATOM   2742 O  O     . THR C 3 311 ? 66.640 86.642  21.317  1.00 51.88 ? 317  THR A O     1 
ATOM   2743 C  CB    . THR C 3 311 ? 69.001 88.580  20.878  1.00 53.50 ? 317  THR A CB    1 
ATOM   2744 O  OG1   . THR C 3 311 ? 69.521 89.916  20.856  1.00 55.88 ? 317  THR A OG1   1 
ATOM   2745 C  CG2   . THR C 3 311 ? 68.257 88.323  19.567  1.00 54.19 ? 317  THR A CG2   1 
ATOM   2746 N  N     . ARG C 3 312 ? 68.047 86.151  23.000  1.00 50.47 ? 318  ARG A N     1 
ATOM   2747 C  CA    . ARG C 3 312 ? 67.600 84.761  23.103  1.00 49.84 ? 318  ARG A CA    1 
ATOM   2748 C  C     . ARG C 3 312 ? 66.080 84.706  23.294  1.00 49.92 ? 318  ARG A C     1 
ATOM   2749 O  O     . ARG C 3 312 ? 65.469 85.674  23.754  1.00 48.94 ? 318  ARG A O     1 
ATOM   2750 C  CB    . ARG C 3 312 ? 68.295 84.068  24.277  1.00 48.50 ? 318  ARG A CB    1 
ATOM   2751 N  N     . GLU C 3 313 ? 65.467 83.577  22.954  1.00 49.87 ? 319  GLU A N     1 
ATOM   2752 C  CA    . GLU C 3 313 ? 64.020 83.465  23.091  1.00 49.71 ? 319  GLU A CA    1 
ATOM   2753 C  C     . GLU C 3 313 ? 63.515 82.706  24.314  1.00 48.83 ? 319  GLU A C     1 
ATOM   2754 O  O     . GLU C 3 313 ? 62.321 82.421  24.421  1.00 47.71 ? 319  GLU A O     1 
ATOM   2755 C  CB    . GLU C 3 313 ? 63.413 82.870  21.815  1.00 50.14 ? 319  GLU A CB    1 
ATOM   2756 C  CG    . GLU C 3 313 ? 64.051 81.582  21.328  1.00 51.21 ? 319  GLU A CG    1 
ATOM   2757 C  CD    . GLU C 3 313 ? 63.465 81.127  20.000  1.00 51.63 ? 319  GLU A CD    1 
ATOM   2758 O  OE1   . GLU C 3 313 ? 63.482 81.924  19.036  1.00 51.24 ? 319  GLU A OE1   1 
ATOM   2759 O  OE2   . GLU C 3 313 ? 62.985 79.976  19.918  1.00 52.63 ? 319  GLU A OE2   1 
ATOM   2760 N  N     . TYR C 3 314 ? 64.410 82.396  25.247  1.00 48.07 ? 320  TYR A N     1 
ATOM   2761 C  CA    . TYR C 3 314 ? 64.011 81.679  26.453  1.00 47.55 ? 320  TYR A CA    1 
ATOM   2762 C  C     . TYR C 3 314 ? 64.232 82.516  27.710  1.00 46.64 ? 320  TYR A C     1 
ATOM   2763 O  O     . TYR C 3 314 ? 65.031 83.450  27.710  1.00 45.79 ? 320  TYR A O     1 
ATOM   2764 C  CB    . TYR C 3 314 ? 64.779 80.363  26.551  1.00 48.45 ? 320  TYR A CB    1 
ATOM   2765 C  CG    . TYR C 3 314 ? 64.463 79.407  25.423  1.00 50.55 ? 320  TYR A CG    1 
ATOM   2766 C  CD1   . TYR C 3 314 ? 63.243 78.733  25.376  1.00 51.29 ? 320  TYR A CD1   1 
ATOM   2767 C  CD2   . TYR C 3 314 ? 65.375 79.191  24.387  1.00 51.38 ? 320  TYR A CD2   1 
ATOM   2768 C  CE1   . TYR C 3 314 ? 62.937 77.861  24.325  1.00 52.34 ? 320  TYR A CE1   1 
ATOM   2769 C  CE2   . TYR C 3 314 ? 65.078 78.324  23.329  1.00 52.39 ? 320  TYR A CE2   1 
ATOM   2770 C  CZ    . TYR C 3 314 ? 63.858 77.661  23.307  1.00 52.71 ? 320  TYR A CZ    1 
ATOM   2771 O  OH    . TYR C 3 314 ? 63.565 76.788  22.281  1.00 53.81 ? 320  TYR A OH    1 
ATOM   2772 N  N     . VAL C 3 315 ? 63.501 82.180  28.771  1.00 46.14 ? 321  VAL A N     1 
ATOM   2773 C  CA    . VAL C 3 315 ? 63.600 82.879  30.049  1.00 45.48 ? 321  VAL A CA    1 
ATOM   2774 C  C     . VAL C 3 315 ? 63.628 81.861  31.187  1.00 45.17 ? 321  VAL A C     1 
ATOM   2775 O  O     . VAL C 3 315 ? 62.653 81.144  31.408  1.00 43.19 ? 321  VAL A O     1 
ATOM   2776 C  CB    . VAL C 3 315 ? 62.399 83.828  30.274  1.00 45.74 ? 321  VAL A CB    1 
ATOM   2777 C  CG1   . VAL C 3 315 ? 62.485 84.453  31.658  1.00 45.41 ? 321  VAL A CG1   1 
ATOM   2778 C  CG2   . VAL C 3 315 ? 62.382 84.914  29.210  1.00 44.94 ? 321  VAL A CG2   1 
ATOM   2779 N  N     . ALA C 3 316 ? 64.752 81.811  31.899  1.00 44.64 ? 322  ALA A N     1 
ATOM   2780 C  CA    . ALA C 3 316 ? 64.939 80.884  33.014  1.00 43.40 ? 322  ALA A CA    1 
ATOM   2781 C  C     . ALA C 3 316 ? 63.700 80.803  33.900  1.00 42.57 ? 322  ALA A C     1 
ATOM   2782 O  O     . ALA C 3 316 ? 63.200 81.822  34.379  1.00 42.09 ? 322  ALA A O     1 
ATOM   2783 C  CB    . ALA C 3 316 ? 66.148 81.315  33.846  1.00 43.60 ? 322  ALA A CB    1 
ATOM   2784 N  N     . GLY C 3 317 ? 63.203 79.587  34.111  1.00 41.29 ? 323  GLY A N     1 
ATOM   2785 C  CA    . GLY C 3 317 ? 62.027 79.410  34.946  1.00 39.86 ? 323  GLY A CA    1 
ATOM   2786 C  C     . GLY C 3 317 ? 60.703 79.521  34.207  1.00 39.51 ? 323  GLY A C     1 
ATOM   2787 O  O     . GLY C 3 317 ? 59.649 79.216  34.771  1.00 40.03 ? 323  GLY A O     1 
ATOM   2788 N  N     . ALA C 3 318 ? 60.746 79.965  32.954  1.00 38.37 ? 324  ALA A N     1 
ATOM   2789 C  CA    . ALA C 3 318 ? 59.534 80.102  32.145  1.00 37.17 ? 324  ALA A CA    1 
ATOM   2790 C  C     . ALA C 3 318 ? 59.383 78.839  31.293  1.00 36.23 ? 324  ALA A C     1 
ATOM   2791 O  O     . ALA C 3 318 ? 60.014 78.707  30.245  1.00 35.88 ? 324  ALA A O     1 
ATOM   2792 C  CB    . ALA C 3 318 ? 59.634 81.342  31.255  1.00 37.58 ? 324  ALA A CB    1 
ATOM   2793 N  N     . PRO C 3 319 ? 58.535 77.896  31.740  1.00 35.51 ? 325  PRO A N     1 
ATOM   2794 C  CA    . PRO C 3 319 ? 58.265 76.619  31.070  1.00 35.81 ? 325  PRO A CA    1 
ATOM   2795 C  C     . PRO C 3 319 ? 57.464 76.683  29.772  1.00 36.72 ? 325  PRO A C     1 
ATOM   2796 O  O     . PRO C 3 319 ? 56.510 77.457  29.646  1.00 35.91 ? 325  PRO A O     1 
ATOM   2797 C  CB    . PRO C 3 319 ? 57.525 75.832  32.140  1.00 35.34 ? 325  PRO A CB    1 
ATOM   2798 C  CG    . PRO C 3 319 ? 56.698 76.903  32.785  1.00 35.52 ? 325  PRO A CG    1 
ATOM   2799 C  CD    . PRO C 3 319 ? 57.701 78.031  32.949  1.00 35.01 ? 325  PRO A CD    1 
ATOM   2800 N  N     . TYR C 3 320 ? 57.853 75.839  28.821  1.00 36.02 ? 326  TYR A N     1 
ATOM   2801 C  CA    . TYR C 3 320 ? 57.179 75.757  27.531  1.00 35.20 ? 326  TYR A CA    1 
ATOM   2802 C  C     . TYR C 3 320 ? 57.125 74.295  27.107  1.00 34.44 ? 326  TYR A C     1 
ATOM   2803 O  O     . TYR C 3 320 ? 57.897 73.472  27.594  1.00 33.59 ? 326  TYR A O     1 
ATOM   2804 C  CB    . TYR C 3 320 ? 57.928 76.556  26.464  1.00 34.78 ? 326  TYR A CB    1 
ATOM   2805 C  CG    . TYR C 3 320 ? 59.258 75.956  26.067  1.00 35.23 ? 326  TYR A CG    1 
ATOM   2806 C  CD1   . TYR C 3 320 ? 60.403 76.157  26.846  1.00 34.87 ? 326  TYR A CD1   1 
ATOM   2807 C  CD2   . TYR C 3 320 ? 59.372 75.173  24.920  1.00 33.86 ? 326  TYR A CD2   1 
ATOM   2808 C  CE1   . TYR C 3 320 ? 61.627 75.592  26.488  1.00 34.26 ? 326  TYR A CE1   1 
ATOM   2809 C  CE2   . TYR C 3 320 ? 60.588 74.603  24.556  1.00 34.57 ? 326  TYR A CE2   1 
ATOM   2810 C  CZ    . TYR C 3 320 ? 61.711 74.817  25.345  1.00 34.41 ? 326  TYR A CZ    1 
ATOM   2811 O  OH    . TYR C 3 320 ? 62.912 74.248  24.988  1.00 37.11 ? 326  TYR A OH    1 
ATOM   2812 N  N     . THR C 3 321 ? 56.214 73.977  26.195  1.00 33.22 ? 327  THR A N     1 
ATOM   2813 C  CA    . THR C 3 321 ? 56.080 72.613  25.714  1.00 32.57 ? 327  THR A CA    1 
ATOM   2814 C  C     . THR C 3 321 ? 56.767 72.442  24.366  1.00 33.17 ? 327  THR A C     1 
ATOM   2815 O  O     . THR C 3 321 ? 56.330 73.004  23.361  1.00 34.25 ? 327  THR A O     1 
ATOM   2816 C  CB    . THR C 3 321 ? 54.602 72.212  25.550  1.00 32.83 ? 327  THR A CB    1 
ATOM   2817 O  OG1   . THR C 3 321 ? 53.910 72.379  26.797  1.00 31.28 ? 327  THR A OG1   1 
ATOM   2818 C  CG2   . THR C 3 321 ? 54.503 70.756  25.111  1.00 33.34 ? 327  THR A CG2   1 
ATOM   2819 N  N     . PRO C 3 322 ? 57.863 71.670  24.326  1.00 32.74 ? 328  PRO A N     1 
ATOM   2820 C  CA    . PRO C 3 322 ? 58.550 71.471  23.046  1.00 32.17 ? 328  PRO A CA    1 
ATOM   2821 C  C     . PRO C 3 322 ? 57.580 70.703  22.148  1.00 31.12 ? 328  PRO A C     1 
ATOM   2822 O  O     . PRO C 3 322 ? 56.875 69.817  22.625  1.00 31.43 ? 328  PRO A O     1 
ATOM   2823 C  CB    . PRO C 3 322 ? 59.765 70.625  23.427  1.00 33.52 ? 328  PRO A CB    1 
ATOM   2824 C  CG    . PRO C 3 322 ? 59.966 70.917  24.897  1.00 33.71 ? 328  PRO A CG    1 
ATOM   2825 C  CD    . PRO C 3 322 ? 58.555 70.960  25.413  1.00 32.49 ? 328  PRO A CD    1 
ATOM   2826 N  N     . VAL C 3 323 ? 57.532 71.044  20.865  1.00 30.84 ? 329  VAL A N     1 
ATOM   2827 C  CA    . VAL C 3 323 ? 56.630 70.365  19.937  1.00 31.52 ? 329  VAL A CA    1 
ATOM   2828 C  C     . VAL C 3 323 ? 57.290 70.102  18.588  1.00 32.69 ? 329  VAL A C     1 
ATOM   2829 O  O     . VAL C 3 323 ? 58.384 70.591  18.313  1.00 32.92 ? 329  VAL A O     1 
ATOM   2830 C  CB    . VAL C 3 323 ? 55.347 71.198  19.684  1.00 30.33 ? 329  VAL A CB    1 
ATOM   2831 C  CG1   . VAL C 3 323 ? 54.546 71.342  20.967  1.00 29.07 ? 329  VAL A CG1   1 
ATOM   2832 C  CG2   . VAL C 3 323 ? 55.722 72.573  19.136  1.00 28.56 ? 329  VAL A CG2   1 
ATOM   2833 N  N     . GLU C 3 324 ? 56.617 69.325  17.747  1.00 33.47 ? 330  GLU A N     1 
ATOM   2834 C  CA    . GLU C 3 324 ? 57.143 69.024  16.427  1.00 35.74 ? 330  GLU A CA    1 
ATOM   2835 C  C     . GLU C 3 324 ? 56.033 69.163  15.387  1.00 36.02 ? 330  GLU A C     1 
ATOM   2836 O  O     . GLU C 3 324 ? 54.852 68.985  15.691  1.00 35.76 ? 330  GLU A O     1 
ATOM   2837 C  CB    . GLU C 3 324 ? 57.720 67.601  16.394  1.00 37.61 ? 330  GLU A CB    1 
ATOM   2838 C  CG    . GLU C 3 324 ? 56.676 66.500  16.233  1.00 40.56 ? 330  GLU A CG    1 
ATOM   2839 C  CD    . GLU C 3 324 ? 57.246 65.105  16.446  1.00 43.55 ? 330  GLU A CD    1 
ATOM   2840 O  OE1   . GLU C 3 324 ? 58.353 64.821  15.930  1.00 43.54 ? 330  GLU A OE1   1 
ATOM   2841 O  OE2   . GLU C 3 324 ? 56.578 64.289  17.123  1.00 46.39 ? 330  GLU A OE2   1 
ATOM   2842 N  N     . HIS C 3 325 ? 56.420 69.499  14.163  1.00 36.71 ? 331  HIS A N     1 
ATOM   2843 C  CA    . HIS C 3 325 ? 55.466 69.646  13.078  1.00 37.27 ? 331  HIS A CA    1 
ATOM   2844 C  C     . HIS C 3 325 ? 55.336 68.289  12.381  1.00 37.91 ? 331  HIS A C     1 
ATOM   2845 O  O     . HIS C 3 325 ? 56.333 67.682  11.998  1.00 36.79 ? 331  HIS A O     1 
ATOM   2846 C  CB    . HIS C 3 325 ? 55.966 70.683  12.080  1.00 38.25 ? 331  HIS A CB    1 
ATOM   2847 C  CG    . HIS C 3 325 ? 54.909 71.174  11.145  1.00 39.95 ? 331  HIS A CG    1 
ATOM   2848 N  ND1   . HIS C 3 325 ? 55.196 71.666  9.892   1.00 40.78 ? 331  HIS A ND1   1 
ATOM   2849 C  CD2   . HIS C 3 325 ? 53.567 71.278  11.294  1.00 39.92 ? 331  HIS A CD2   1 
ATOM   2850 C  CE1   . HIS C 3 325 ? 54.076 72.052  9.308   1.00 41.40 ? 331  HIS A CE1   1 
ATOM   2851 N  NE2   . HIS C 3 325 ? 53.074 71.829  10.138  1.00 40.10 ? 331  HIS A NE2   1 
ATOM   2852 N  N     . VAL C 3 326 ? 54.112 67.805  12.215  1.00 38.90 ? 332  VAL A N     1 
ATOM   2853 C  CA    . VAL C 3 326 ? 53.920 66.513  11.570  1.00 39.06 ? 332  VAL A CA    1 
ATOM   2854 C  C     . VAL C 3 326 ? 52.970 66.557  10.378  1.00 38.90 ? 332  VAL A C     1 
ATOM   2855 O  O     . VAL C 3 326 ? 51.848 67.047  10.474  1.00 38.66 ? 332  VAL A O     1 
ATOM   2856 C  CB    . VAL C 3 326 ? 53.416 65.470  12.581  1.00 39.68 ? 332  VAL A CB    1 
ATOM   2857 C  CG1   . VAL C 3 326 ? 52.235 66.019  13.341  1.00 42.94 ? 332  VAL A CG1   1 
ATOM   2858 C  CG2   . VAL C 3 326 ? 53.035 64.188  11.858  1.00 41.94 ? 332  VAL A CG2   1 
ATOM   2859 N  N     . VAL C 3 327 ? 53.443 66.036  9.251   1.00 38.04 ? 333  VAL A N     1 
ATOM   2860 C  CA    . VAL C 3 327 ? 52.663 65.992  8.022   1.00 36.05 ? 333  VAL A CA    1 
ATOM   2861 C  C     . VAL C 3 327 ? 51.842 64.708  7.974   1.00 35.59 ? 333  VAL A C     1 
ATOM   2862 O  O     . VAL C 3 327 ? 52.303 63.655  8.414   1.00 34.91 ? 333  VAL A O     1 
ATOM   2863 C  CB    . VAL C 3 327 ? 53.594 66.038  6.795   1.00 36.88 ? 333  VAL A CB    1 
ATOM   2864 C  CG1   . VAL C 3 327 ? 52.778 66.131  5.511   1.00 35.48 ? 333  VAL A CG1   1 
ATOM   2865 C  CG2   . VAL C 3 327 ? 54.539 67.224  6.924   1.00 38.09 ? 333  VAL A CG2   1 
ATOM   2866 N  N     . PHE C 3 328 ? 50.625 64.796  7.442   1.00 34.22 ? 334  PHE A N     1 
ATOM   2867 C  CA    . PHE C 3 328 ? 49.755 63.631  7.345   1.00 33.31 ? 334  PHE A CA    1 
ATOM   2868 C  C     . PHE C 3 328 ? 50.473 62.516  6.585   1.00 33.19 ? 334  PHE A C     1 
ATOM   2869 O  O     . PHE C 3 328 ? 50.867 62.701  5.436   1.00 32.76 ? 334  PHE A O     1 
ATOM   2870 C  CB    . PHE C 3 328 ? 48.453 63.988  6.614   1.00 31.29 ? 334  PHE A CB    1 
ATOM   2871 C  CG    . PHE C 3 328 ? 47.463 62.855  6.550   1.00 31.88 ? 334  PHE A CG    1 
ATOM   2872 C  CD1   . PHE C 3 328 ? 46.745 62.476  7.678   1.00 30.96 ? 334  PHE A CD1   1 
ATOM   2873 C  CD2   . PHE C 3 328 ? 47.282 62.136  5.371   1.00 32.74 ? 334  PHE A CD2   1 
ATOM   2874 C  CE1   . PHE C 3 328 ? 45.861 61.393  7.637   1.00 31.70 ? 334  PHE A CE1   1 
ATOM   2875 C  CE2   . PHE C 3 328 ? 46.402 61.051  5.318   1.00 32.43 ? 334  PHE A CE2   1 
ATOM   2876 C  CZ    . PHE C 3 328 ? 45.689 60.679  6.454   1.00 32.63 ? 334  PHE A CZ    1 
ATOM   2877 N  N     . ASN C 3 329 ? 50.666 61.372  7.240   1.00 33.66 ? 335  ASN A N     1 
ATOM   2878 C  CA    . ASN C 3 329 ? 51.313 60.222  6.608   1.00 32.35 ? 335  ASN A CA    1 
ATOM   2879 C  C     . ASN C 3 329 ? 50.221 59.186  6.398   1.00 31.79 ? 335  ASN A C     1 
ATOM   2880 O  O     . ASN C 3 329 ? 49.741 58.574  7.350   1.00 31.83 ? 335  ASN A O     1 
ATOM   2881 C  CB    . ASN C 3 329 ? 52.407 59.635  7.502   1.00 33.28 ? 335  ASN A CB    1 
ATOM   2882 C  CG    . ASN C 3 329 ? 53.149 58.472  6.833   1.00 34.80 ? 335  ASN A CG    1 
ATOM   2883 O  OD1   . ASN C 3 329 ? 52.728 57.966  5.790   1.00 34.64 ? 335  ASN A OD1   1 
ATOM   2884 N  ND2   . ASN C 3 329 ? 54.255 58.044  7.439   1.00 33.00 ? 335  ASN A ND2   1 
ATOM   2885 N  N     . PRO C 3 330 ? 49.812 58.977  5.144   1.00 31.36 ? 336  PRO A N     1 
ATOM   2886 C  CA    . PRO C 3 330 ? 48.760 58.007  4.831   1.00 32.65 ? 336  PRO A CA    1 
ATOM   2887 C  C     . PRO C 3 330 ? 49.077 56.574  5.275   1.00 33.33 ? 336  PRO A C     1 
ATOM   2888 O  O     . PRO C 3 330 ? 48.168 55.756  5.409   1.00 34.37 ? 336  PRO A O     1 
ATOM   2889 C  CB    . PRO C 3 330 ? 48.610 58.127  3.312   1.00 32.19 ? 336  PRO A CB    1 
ATOM   2890 C  CG    . PRO C 3 330 ? 49.113 59.523  3.017   1.00 32.82 ? 336  PRO A CG    1 
ATOM   2891 C  CD    . PRO C 3 330 ? 50.311 59.627  3.922   1.00 31.62 ? 336  PRO A CD    1 
ATOM   2892 N  N     . SER C 3 331 ? 50.357 56.275  5.495   1.00 33.36 ? 337  SER A N     1 
ATOM   2893 C  CA    . SER C 3 331 ? 50.774 54.937  5.928   1.00 34.96 ? 337  SER A CA    1 
ATOM   2894 C  C     . SER C 3 331 ? 50.570 54.773  7.433   1.00 36.32 ? 337  SER A C     1 
ATOM   2895 O  O     . SER C 3 331 ? 50.633 53.661  7.966   1.00 35.33 ? 337  SER A O     1 
ATOM   2896 C  CB    . SER C 3 331 ? 52.255 54.686  5.594   1.00 34.40 ? 337  SER A CB    1 
ATOM   2897 O  OG    . SER C 3 331 ? 52.454 54.387  4.219   1.00 34.25 ? 337  SER A OG    1 
ATOM   2898 N  N     . SER C 3 332 ? 50.334 55.887  8.118   1.00 36.51 ? 338  SER A N     1 
ATOM   2899 C  CA    . SER C 3 332 ? 50.132 55.847  9.557   1.00 36.58 ? 338  SER A CA    1 
ATOM   2900 C  C     . SER C 3 332 ? 48.676 55.627  9.934   1.00 37.29 ? 338  SER A C     1 
ATOM   2901 O  O     . SER C 3 332 ? 47.804 56.432  9.601   1.00 37.24 ? 338  SER A O     1 
ATOM   2902 C  CB    . SER C 3 332 ? 50.630 57.142  10.202  1.00 35.23 ? 338  SER A CB    1 
ATOM   2903 O  OG    . SER C 3 332 ? 50.206 57.218  11.554  1.00 35.15 ? 338  SER A OG    1 
ATOM   2904 N  N     . ARG C 3 333 ? 48.419 54.530  10.634  1.00 38.74 ? 339  ARG A N     1 
ATOM   2905 C  CA    . ARG C 3 333 ? 47.073 54.207  11.081  1.00 39.80 ? 339  ARG A CA    1 
ATOM   2906 C  C     . ARG C 3 333 ? 46.677 55.222  12.153  1.00 38.81 ? 339  ARG A C     1 
ATOM   2907 O  O     . ARG C 3 333 ? 45.504 55.547  12.308  1.00 37.48 ? 339  ARG A O     1 
ATOM   2908 C  CB    . ARG C 3 333 ? 47.033 52.794  11.673  1.00 42.21 ? 339  ARG A CB    1 
ATOM   2909 C  CG    . ARG C 3 333 ? 47.587 51.693  10.761  1.00 44.95 ? 339  ARG A CG    1 
ATOM   2910 C  CD    . ARG C 3 333 ? 46.632 51.335  9.625   1.00 46.91 ? 339  ARG A CD    1 
ATOM   2911 N  NE    . ARG C 3 333 ? 47.160 50.245  8.806   1.00 47.32 ? 339  ARG A NE    1 
ATOM   2912 C  CZ    . ARG C 3 333 ? 46.534 49.712  7.760   1.00 46.46 ? 339  ARG A CZ    1 
ATOM   2913 N  NH1   . ARG C 3 333 ? 45.342 50.162  7.393   1.00 44.68 ? 339  ARG A NH1   1 
ATOM   2914 N  NH2   . ARG C 3 333 ? 47.107 48.729  7.073   1.00 46.23 ? 339  ARG A NH2   1 
ATOM   2915 N  N     . ASP C 3 334 ? 47.664 55.710  12.899  1.00 39.47 ? 340  ASP A N     1 
ATOM   2916 C  CA    . ASP C 3 334 ? 47.404 56.695  13.945  1.00 39.80 ? 340  ASP A CA    1 
ATOM   2917 C  C     . ASP C 3 334 ? 46.911 58.001  13.312  1.00 38.66 ? 340  ASP A C     1 
ATOM   2918 O  O     . ASP C 3 334 ? 45.936 58.590  13.779  1.00 39.47 ? 340  ASP A O     1 
ATOM   2919 C  CB    . ASP C 3 334 ? 48.668 56.949  14.771  1.00 42.05 ? 340  ASP A CB    1 
ATOM   2920 C  CG    . ASP C 3 334 ? 48.431 57.928  15.917  1.00 47.22 ? 340  ASP A CG    1 
ATOM   2921 O  OD1   . ASP C 3 334 ? 47.597 57.623  16.803  1.00 48.10 ? 340  ASP A OD1   1 
ATOM   2922 O  OD2   . ASP C 3 334 ? 49.076 59.003  15.929  1.00 47.46 ? 340  ASP A OD2   1 
ATOM   2923 N  N     . HIS C 3 335 ? 47.573 58.439  12.243  1.00 36.09 ? 341  HIS A N     1 
ATOM   2924 C  CA    . HIS C 3 335 ? 47.179 59.663  11.551  1.00 34.62 ? 341  HIS A CA    1 
ATOM   2925 C  C     . HIS C 3 335 ? 45.803 59.513  10.921  1.00 35.13 ? 341  HIS A C     1 
ATOM   2926 O  O     . HIS C 3 335 ? 44.983 60.430  10.979  1.00 35.08 ? 341  HIS A O     1 
ATOM   2927 C  CB    . HIS C 3 335 ? 48.187 60.024  10.461  1.00 31.24 ? 341  HIS A CB    1 
ATOM   2928 C  CG    . HIS C 3 335 ? 49.513 60.469  10.989  1.00 28.67 ? 341  HIS A CG    1 
ATOM   2929 N  ND1   . HIS C 3 335 ? 50.477 61.042  10.188  1.00 26.60 ? 341  HIS A ND1   1 
ATOM   2930 C  CD2   . HIS C 3 335 ? 50.042 60.411  12.234  1.00 27.77 ? 341  HIS A CD2   1 
ATOM   2931 C  CE1   . HIS C 3 335 ? 51.545 61.316  10.916  1.00 28.36 ? 341  HIS A CE1   1 
ATOM   2932 N  NE2   . HIS C 3 335 ? 51.306 60.942  12.162  1.00 30.54 ? 341  HIS A NE2   1 
ATOM   2933 N  N     . ILE C 3 336 ? 45.557 58.356  10.316  1.00 34.94 ? 342  ILE A N     1 
ATOM   2934 C  CA    . ILE C 3 336 ? 44.275 58.098  9.682   1.00 35.73 ? 342  ILE A CA    1 
ATOM   2935 C  C     . ILE C 3 336 ? 43.177 58.206  10.736  1.00 36.77 ? 342  ILE A C     1 
ATOM   2936 O  O     . ILE C 3 336 ? 42.169 58.888  10.544  1.00 35.62 ? 342  ILE A O     1 
ATOM   2937 C  CB    . ILE C 3 336 ? 44.225 56.685  9.066   1.00 35.07 ? 342  ILE A CB    1 
ATOM   2938 C  CG1   . ILE C 3 336 ? 45.336 56.526  8.023   1.00 37.43 ? 342  ILE A CG1   1 
ATOM   2939 C  CG2   . ILE C 3 336 ? 42.864 56.444  8.433   1.00 33.65 ? 342  ILE A CG2   1 
ATOM   2940 N  N     . GLN C 3 337 ? 43.389 57.522  11.853  1.00 36.85 ? 343  GLN A N     1 
ATOM   2941 C  CA    . GLN C 3 337 ? 42.429 57.523  12.943  1.00 38.29 ? 343  GLN A CA    1 
ATOM   2942 C  C     . GLN C 3 337 ? 42.197 58.920  13.537  1.00 38.44 ? 343  GLN A C     1 
ATOM   2943 O  O     . GLN C 3 337 ? 41.077 59.270  13.899  1.00 37.94 ? 343  GLN A O     1 
ATOM   2944 C  CB    . GLN C 3 337 ? 42.895 56.539  14.023  1.00 38.19 ? 343  GLN A CB    1 
ATOM   2945 C  CG    . GLN C 3 337 ? 42.214 56.709  15.355  1.00 41.86 ? 343  GLN A CG    1 
ATOM   2946 C  CD    . GLN C 3 337 ? 42.984 57.625  16.289  1.00 44.35 ? 343  GLN A CD    1 
ATOM   2947 O  OE1   . GLN C 3 337 ? 42.393 58.313  17.121  1.00 46.15 ? 343  GLN A OE1   1 
ATOM   2948 N  NE2   . GLN C 3 337 ? 44.312 57.623  16.168  1.00 44.09 ? 343  GLN A NE2   1 
ATOM   2949 N  N     . LYS C 3 338 ? 43.252 59.720  13.628  1.00 38.78 ? 344  LYS A N     1 
ATOM   2950 C  CA    . LYS C 3 338 ? 43.129 61.061  14.183  1.00 40.28 ? 344  LYS A CA    1 
ATOM   2951 C  C     . LYS C 3 338 ? 42.269 61.979  13.320  1.00 40.03 ? 344  LYS A C     1 
ATOM   2952 O  O     . LYS C 3 338 ? 41.420 62.707  13.838  1.00 39.61 ? 344  LYS A O     1 
ATOM   2953 C  CB    . LYS C 3 338 ? 44.519 61.678  14.377  1.00 41.62 ? 344  LYS A CB    1 
ATOM   2954 C  CG    . LYS C 3 338 ? 44.522 63.183  14.606  1.00 43.09 ? 344  LYS A CG    1 
ATOM   2955 C  CD    . LYS C 3 338 ? 45.921 63.693  14.948  1.00 43.10 ? 344  LYS A CD    1 
ATOM   2956 C  CE    . LYS C 3 338 ? 45.989 65.219  14.885  1.00 45.02 ? 344  LYS A CE    1 
ATOM   2957 N  NZ    . LYS C 3 338 ? 44.959 65.889  15.740  1.00 45.62 ? 344  LYS A NZ    1 
ATOM   2958 N  N     . LYS C 3 339 ? 42.477 61.938  12.006  1.00 39.44 ? 345  LYS A N     1 
ATOM   2959 C  CA    . LYS C 3 339 ? 41.719 62.795  11.101  1.00 38.79 ? 345  LYS A CA    1 
ATOM   2960 C  C     . LYS C 3 339 ? 40.274 62.371  10.894  1.00 38.18 ? 345  LYS A C     1 
ATOM   2961 O  O     . LYS C 3 339 ? 39.394 63.216  10.742  1.00 37.27 ? 345  LYS A O     1 
ATOM   2962 C  CB    . LYS C 3 339 ? 42.421 62.890  9.745   1.00 39.87 ? 345  LYS A CB    1 
ATOM   2963 C  CG    . LYS C 3 339 ? 43.770 63.589  9.804   1.00 41.50 ? 345  LYS A CG    1 
ATOM   2964 C  CD    . LYS C 3 339 ? 43.622 65.018  10.310  1.00 40.49 ? 345  LYS A CD    1 
ATOM   2965 C  CE    . LYS C 3 339 ? 44.969 65.706  10.399  1.00 42.00 ? 345  LYS A CE    1 
ATOM   2966 N  NZ    . LYS C 3 339 ? 44.847 67.161  10.713  1.00 43.41 ? 345  LYS A NZ    1 
ATOM   2967 N  N     . LEU C 3 340 ? 40.020 61.068  10.889  1.00 37.40 ? 346  LEU A N     1 
ATOM   2968 C  CA    . LEU C 3 340 ? 38.662 60.592  10.687  1.00 37.99 ? 346  LEU A CA    1 
ATOM   2969 C  C     . LEU C 3 340 ? 37.737 60.820  11.887  1.00 38.53 ? 346  LEU A C     1 
ATOM   2970 O  O     . LEU C 3 340 ? 36.541 61.068  11.712  1.00 38.44 ? 346  LEU A O     1 
ATOM   2971 C  CB    . LEU C 3 340 ? 38.676 59.111  10.300  1.00 37.41 ? 346  LEU A CB    1 
ATOM   2972 C  CG    . LEU C 3 340 ? 39.292 58.848  8.921   1.00 38.65 ? 346  LEU A CG    1 
ATOM   2973 C  CD1   . LEU C 3 340 ? 39.235 57.366  8.594   1.00 35.26 ? 346  LEU A CD1   1 
ATOM   2974 C  CD2   . LEU C 3 340 ? 38.537 59.654  7.872   1.00 37.39 ? 346  LEU A CD2   1 
ATOM   2975 N  N     . GLN C 3 341 ? 38.266 60.728  13.103  1.00 38.52 ? 347  GLN A N     1 
ATOM   2976 C  CA    . GLN C 3 341 ? 37.417 60.952  14.266  1.00 40.28 ? 347  GLN A CA    1 
ATOM   2977 C  C     . GLN C 3 341 ? 37.115 62.434  14.307  1.00 41.24 ? 347  GLN A C     1 
ATOM   2978 O  O     . GLN C 3 341 ? 36.003 62.843  14.635  1.00 41.14 ? 347  GLN A O     1 
ATOM   2979 C  CB    . GLN C 3 341 ? 38.106 60.524  15.562  1.00 40.07 ? 347  GLN A CB    1 
ATOM   2980 C  CG    . GLN C 3 341 ? 38.343 59.028  15.666  1.00 40.80 ? 347  GLN A CG    1 
ATOM   2981 C  CD    . GLN C 3 341 ? 38.498 58.566  17.096  1.00 40.61 ? 347  GLN A CD    1 
ATOM   2982 O  OE1   . GLN C 3 341 ? 37.511 58.395  17.814  1.00 40.96 ? 347  GLN A OE1   1 
ATOM   2983 N  NE2   . GLN C 3 341 ? 39.740 58.375  17.525  1.00 40.14 ? 347  GLN A NE2   1 
ATOM   2984 N  N     . GLU C 3 342 ? 38.122 63.234  13.972  1.00 41.97 ? 348  GLU A N     1 
ATOM   2985 C  CA    . GLU C 3 342 ? 37.963 64.675  13.940  1.00 41.74 ? 348  GLU A CA    1 
ATOM   2986 C  C     . GLU C 3 342 ? 36.858 65.002  12.961  1.00 41.29 ? 348  GLU A C     1 
ATOM   2987 O  O     . GLU C 3 342 ? 36.112 65.958  13.156  1.00 43.79 ? 348  GLU A O     1 
ATOM   2988 C  CB    . GLU C 3 342 ? 39.259 65.344  13.499  1.00 41.59 ? 348  GLU A CB    1 
ATOM   2989 C  CG    . GLU C 3 342 ? 40.127 65.794  14.649  1.00 43.99 ? 348  GLU A CG    1 
ATOM   2990 C  CD    . GLU C 3 342 ? 41.546 66.092  14.223  1.00 45.42 ? 348  GLU A CD    1 
ATOM   2991 O  OE1   . GLU C 3 342 ? 41.739 66.623  13.106  1.00 47.66 ? 348  GLU A OE1   1 
ATOM   2992 O  OE2   . GLU C 3 342 ? 42.468 65.803  15.014  1.00 46.24 ? 348  GLU A OE2   1 
ATOM   2993 N  N     . ALA C 3 343 ? 36.748 64.196  11.912  1.00 40.04 ? 349  ALA A N     1 
ATOM   2994 C  CA    . ALA C 3 343 ? 35.724 64.407  10.898  1.00 39.29 ? 349  ALA A CA    1 
ATOM   2995 C  C     . ALA C 3 343 ? 34.395 63.805  11.333  1.00 39.58 ? 349  ALA A C     1 
ATOM   2996 O  O     . ALA C 3 343 ? 33.451 63.734  10.545  1.00 38.85 ? 349  ALA A O     1 
ATOM   2997 C  CB    . ALA C 3 343 ? 36.163 63.806  9.576   1.00 38.16 ? 349  ALA A CB    1 
ATOM   2998 N  N     . GLY C 3 344 ? 34.329 63.369  12.588  1.00 40.51 ? 350  GLY A N     1 
ATOM   2999 C  CA    . GLY C 3 344 ? 33.099 62.802  13.112  1.00 41.12 ? 350  GLY A CA    1 
ATOM   3000 C  C     . GLY C 3 344 ? 32.977 61.288  13.123  1.00 42.13 ? 350  GLY A C     1 
ATOM   3001 O  O     . GLY C 3 344 ? 31.882 60.762  13.322  1.00 43.09 ? 350  GLY A O     1 
ATOM   3002 N  N     . TRP C 3 345 ? 34.074 60.573  12.907  1.00 41.94 ? 351  TRP A N     1 
ATOM   3003 C  CA    . TRP C 3 345 ? 33.999 59.118  12.925  1.00 42.57 ? 351  TRP A CA    1 
ATOM   3004 C  C     . TRP C 3 345 ? 34.103 58.591  14.344  1.00 43.55 ? 351  TRP A C     1 
ATOM   3005 O  O     . TRP C 3 345 ? 35.009 58.967  15.093  1.00 43.51 ? 351  TRP A O     1 
ATOM   3006 C  CB    . TRP C 3 345 ? 35.110 58.495  12.077  1.00 42.75 ? 351  TRP A CB    1 
ATOM   3007 C  CG    . TRP C 3 345 ? 35.191 56.993  12.216  1.00 42.23 ? 351  TRP A CG    1 
ATOM   3008 C  CD1   . TRP C 3 345 ? 34.171 56.095  12.055  1.00 42.54 ? 351  TRP A CD1   1 
ATOM   3009 C  CD2   . TRP C 3 345 ? 36.357 56.221  12.534  1.00 41.89 ? 351  TRP A CD2   1 
ATOM   3010 N  NE1   . TRP C 3 345 ? 34.630 54.814  12.253  1.00 42.22 ? 351  TRP A NE1   1 
ATOM   3011 C  CE2   . TRP C 3 345 ? 35.968 54.861  12.547  1.00 41.31 ? 351  TRP A CE2   1 
ATOM   3012 C  CE3   . TRP C 3 345 ? 37.694 56.545  12.807  1.00 41.51 ? 351  TRP A CE3   1 
ATOM   3013 C  CZ2   . TRP C 3 345 ? 36.867 53.825  12.822  1.00 40.35 ? 351  TRP A CZ2   1 
ATOM   3014 C  CZ3   . TRP C 3 345 ? 38.591 55.511  13.080  1.00 41.86 ? 351  TRP A CZ3   1 
ATOM   3015 C  CH2   . TRP C 3 345 ? 38.169 54.167  13.084  1.00 39.95 ? 351  TRP A CH2   1 
ATOM   3016 N  N     . VAL C 3 346 ? 33.164 57.728  14.714  1.00 44.47 ? 352  VAL A N     1 
ATOM   3017 C  CA    . VAL C 3 346 ? 33.169 57.132  16.042  1.00 46.86 ? 352  VAL A CA    1 
ATOM   3018 C  C     . VAL C 3 346 ? 33.398 55.628  15.885  1.00 48.13 ? 352  VAL A C     1 
ATOM   3019 O  O     . VAL C 3 346 ? 32.476 54.876  15.562  1.00 47.85 ? 352  VAL A O     1 
ATOM   3020 C  CB    . VAL C 3 346 ? 31.831 57.368  16.774  1.00 48.09 ? 352  VAL A CB    1 
ATOM   3021 C  CG1   . VAL C 3 346 ? 31.968 56.974  18.241  1.00 47.70 ? 352  VAL A CG1   1 
ATOM   3022 C  CG2   . VAL C 3 346 ? 31.414 58.831  16.646  1.00 48.49 ? 352  VAL A CG2   1 
ATOM   3023 N  N     . PRO C 3 347 ? 34.642 55.173  16.107  1.00 49.11 ? 353  PRO A N     1 
ATOM   3024 C  CA    . PRO C 3 347 ? 35.020 53.760  15.993  1.00 49.23 ? 353  PRO A CA    1 
ATOM   3025 C  C     . PRO C 3 347 ? 34.081 52.823  16.743  1.00 50.51 ? 353  PRO A C     1 
ATOM   3026 O  O     . PRO C 3 347 ? 33.473 53.204  17.746  1.00 49.90 ? 353  PRO A O     1 
ATOM   3027 C  CB    . PRO C 3 347 ? 36.431 53.737  16.564  1.00 49.00 ? 353  PRO A CB    1 
ATOM   3028 C  CG    . PRO C 3 347 ? 36.960 55.085  16.181  1.00 49.28 ? 353  PRO A CG    1 
ATOM   3029 C  CD    . PRO C 3 347 ? 35.798 55.988  16.522  1.00 49.09 ? 353  PRO A CD    1 
ATOM   3030 N  N     . THR C 3 348 ? 33.977 51.594  16.246  1.00 51.67 ? 354  THR A N     1 
ATOM   3031 C  CA    . THR C 3 348 ? 33.122 50.575  16.843  1.00 52.60 ? 354  THR A CA    1 
ATOM   3032 C  C     . THR C 3 348 ? 33.959 49.434  17.405  1.00 52.98 ? 354  THR A C     1 
ATOM   3033 O  O     . THR C 3 348 ? 33.596 48.823  18.410  1.00 53.50 ? 354  THR A O     1 
ATOM   3034 C  CB    . THR C 3 348 ? 32.143 49.985  15.803  1.00 53.05 ? 354  THR A CB    1 
ATOM   3035 O  OG1   . THR C 3 348 ? 31.300 51.023  15.292  1.00 53.89 ? 354  THR A OG1   1 
ATOM   3036 C  CG2   . THR C 3 348 ? 31.276 48.907  16.436  1.00 53.53 ? 354  THR A CG2   1 
ATOM   3037 N  N     . LYS C 3 349 ? 35.075 49.138  16.748  1.00 53.31 ? 355  LYS A N     1 
ATOM   3038 C  CA    . LYS C 3 349 ? 35.943 48.059  17.202  1.00 53.03 ? 355  LYS A CA    1 
ATOM   3039 C  C     . LYS C 3 349 ? 37.361 48.534  17.481  1.00 52.56 ? 355  LYS A C     1 
ATOM   3040 O  O     . LYS C 3 349 ? 37.986 49.198  16.654  1.00 52.05 ? 355  LYS A O     1 
ATOM   3041 C  CB    . LYS C 3 349 ? 35.947 46.929  16.174  1.00 52.98 ? 355  LYS A CB    1 
ATOM   3042 C  CG    . LYS C 3 349 ? 36.219 47.383  14.759  1.00 53.71 ? 355  LYS A CG    1 
ATOM   3043 C  CD    . LYS C 3 349 ? 35.720 46.357  13.754  1.00 54.89 ? 355  LYS A CD    1 
ATOM   3044 C  CE    . LYS C 3 349 ? 36.404 45.006  13.921  1.00 53.85 ? 355  LYS A CE    1 
ATOM   3045 N  NZ    . LYS C 3 349 ? 35.828 44.006  12.978  1.00 52.23 ? 355  LYS A NZ    1 
ATOM   3046 N  N     . TYR C 3 350 ? 37.854 48.191  18.665  1.00 52.64 ? 356  TYR A N     1 
ATOM   3047 C  CA    . TYR C 3 350 ? 39.190 48.581  19.081  1.00 53.49 ? 356  TYR A CA    1 
ATOM   3048 C  C     . TYR C 3 350 ? 40.102 47.370  19.241  1.00 54.37 ? 356  TYR A C     1 
ATOM   3049 O  O     . TYR C 3 350 ? 39.642 46.229  19.335  1.00 53.86 ? 356  TYR A O     1 
ATOM   3050 C  CB    . TYR C 3 350 ? 39.125 49.343  20.408  1.00 53.69 ? 356  TYR A CB    1 
ATOM   3051 C  CG    . TYR C 3 350 ? 38.392 50.665  20.336  1.00 54.24 ? 356  TYR A CG    1 
ATOM   3052 C  CD1   . TYR C 3 350 ? 37.041 50.722  19.985  1.00 53.76 ? 356  TYR A CD1   1 
ATOM   3053 C  CD2   . TYR C 3 350 ? 39.050 51.862  20.621  1.00 53.81 ? 356  TYR A CD2   1 
ATOM   3054 C  CE1   . TYR C 3 350 ? 36.364 51.942  19.919  1.00 54.26 ? 356  TYR A CE1   1 
ATOM   3055 C  CE2   . TYR C 3 350 ? 38.381 53.087  20.559  1.00 54.45 ? 356  TYR A CE2   1 
ATOM   3056 C  CZ    . TYR C 3 350 ? 37.040 53.120  20.208  1.00 54.19 ? 356  TYR A CZ    1 
ATOM   3057 O  OH    . TYR C 3 350 ? 36.376 54.328  20.143  1.00 54.82 ? 356  TYR A OH    1 
ATOM   3058 N  N     . THR C 3 351 ? 41.403 47.634  19.269  1.00 55.29 ? 357  THR A N     1 
ATOM   3059 C  CA    . THR C 3 351 ? 42.402 46.591  19.433  1.00 56.01 ? 357  THR A CA    1 
ATOM   3060 C  C     . THR C 3 351 ? 42.526 46.289  20.923  1.00 57.28 ? 357  THR A C     1 
ATOM   3061 O  O     . THR C 3 351 ? 42.388 47.189  21.752  1.00 58.38 ? 357  THR A O     1 
ATOM   3062 C  CB    . THR C 3 351 ? 43.773 47.059  18.912  1.00 55.96 ? 357  THR A CB    1 
ATOM   3063 O  OG1   . THR C 3 351 ? 44.183 48.227  19.636  1.00 54.24 ? 357  THR A OG1   1 
ATOM   3064 C  CG2   . THR C 3 351 ? 43.698 47.393  17.425  1.00 54.89 ? 357  THR A CG2   1 
ATOM   3065 N  N     . ASP C 3 352 ? 42.774 45.027  21.261  1.00 57.76 ? 358  ASP A N     1 
ATOM   3066 C  CA    . ASP C 3 352 ? 42.924 44.631  22.659  1.00 58.25 ? 358  ASP A CA    1 
ATOM   3067 C  C     . ASP C 3 352 ? 44.208 45.240  23.219  1.00 58.43 ? 358  ASP A C     1 
ATOM   3068 O  O     . ASP C 3 352 ? 45.077 44.526  23.725  1.00 58.69 ? 358  ASP A O     1 
ATOM   3069 C  CB    . ASP C 3 352 ? 42.982 43.104  22.778  1.00 58.67 ? 358  ASP A CB    1 
ATOM   3070 N  N     . LYS C 3 353 ? 44.319 46.563  23.116  1.00 58.02 ? 359  LYS A N     1 
ATOM   3071 C  CA    . LYS C 3 353 ? 45.487 47.292  23.596  1.00 57.48 ? 359  LYS A CA    1 
ATOM   3072 C  C     . LYS C 3 353 ? 45.230 48.797  23.565  1.00 57.63 ? 359  LYS A C     1 
ATOM   3073 O  O     . LYS C 3 353 ? 46.165 49.594  23.497  1.00 57.62 ? 359  LYS A O     1 
ATOM   3074 C  CB    . LYS C 3 353 ? 46.709 46.960  22.735  1.00 56.87 ? 359  LYS A CB    1 
ATOM   3075 N  N     . GLY C 3 354 ? 43.957 49.178  23.609  1.00 57.70 ? 360  GLY A N     1 
ATOM   3076 C  CA    . GLY C 3 354 ? 43.601 50.586  23.594  1.00 57.36 ? 360  GLY A CA    1 
ATOM   3077 C  C     . GLY C 3 354 ? 43.984 51.295  22.308  1.00 56.67 ? 360  GLY A C     1 
ATOM   3078 O  O     . GLY C 3 354 ? 44.930 52.088  22.282  1.00 57.79 ? 360  GLY A O     1 
ATOM   3079 N  N     . ALA C 3 355 ? 43.247 51.009  21.240  1.00 54.70 ? 361  ALA A N     1 
ATOM   3080 C  CA    . ALA C 3 355 ? 43.500 51.614  19.939  1.00 51.63 ? 361  ALA A CA    1 
ATOM   3081 C  C     . ALA C 3 355 ? 42.410 51.188  18.964  1.00 49.79 ? 361  ALA A C     1 
ATOM   3082 O  O     . ALA C 3 355 ? 42.085 50.006  18.853  1.00 47.84 ? 361  ALA A O     1 
ATOM   3083 C  CB    . ALA C 3 355 ? 44.870 51.190  19.417  1.00 52.17 ? 361  ALA A CB    1 
ATOM   3084 N  N     . PRO C 3 356 ? 41.827 52.156  18.243  1.00 48.39 ? 362  PRO A N     1 
ATOM   3085 C  CA    . PRO C 3 356 ? 40.765 51.880  17.273  1.00 47.28 ? 362  PRO A CA    1 
ATOM   3086 C  C     . PRO C 3 356 ? 41.254 51.126  16.045  1.00 46.53 ? 362  PRO A C     1 
ATOM   3087 O  O     . PRO C 3 356 ? 42.195 51.550  15.380  1.00 47.65 ? 362  PRO A O     1 
ATOM   3088 C  CB    . PRO C 3 356 ? 40.254 53.273  16.925  1.00 47.15 ? 362  PRO A CB    1 
ATOM   3089 C  CG    . PRO C 3 356 ? 41.492 54.100  17.022  1.00 46.39 ? 362  PRO A CG    1 
ATOM   3090 C  CD    . PRO C 3 356 ? 42.131 53.598  18.292  1.00 47.42 ? 362  PRO A CD    1 
ATOM   3091 N  N     . VAL C 3 357 ? 40.612 50.004  15.749  1.00 45.87 ? 363  VAL A N     1 
ATOM   3092 C  CA    . VAL C 3 357 ? 40.981 49.213  14.588  1.00 45.20 ? 363  VAL A CA    1 
ATOM   3093 C  C     . VAL C 3 357 ? 40.840 50.065  13.335  1.00 45.20 ? 363  VAL A C     1 
ATOM   3094 O  O     . VAL C 3 357 ? 39.814 50.707  13.115  1.00 44.51 ? 363  VAL A O     1 
ATOM   3095 C  CB    . VAL C 3 357 ? 40.084 47.968  14.452  1.00 45.11 ? 363  VAL A CB    1 
ATOM   3096 C  CG1   . VAL C 3 357 ? 40.351 47.269  13.124  1.00 43.68 ? 363  VAL A CG1   1 
ATOM   3097 C  CG2   . VAL C 3 357 ? 40.351 47.017  15.610  1.00 44.90 ? 363  VAL A CG2   1 
ATOM   3098 N  N     . VAL C 3 358 ? 41.882 50.075  12.517  1.00 46.02 ? 364  VAL A N     1 
ATOM   3099 C  CA    . VAL C 3 358 ? 41.857 50.852  11.291  1.00 46.53 ? 364  VAL A CA    1 
ATOM   3100 C  C     . VAL C 3 358 ? 42.306 50.025  10.091  1.00 45.95 ? 364  VAL A C     1 
ATOM   3101 O  O     . VAL C 3 358 ? 43.316 50.328  9.465   1.00 46.95 ? 364  VAL A O     1 
ATOM   3102 C  CB    . VAL C 3 358 ? 42.762 52.103  11.404  1.00 46.19 ? 364  VAL A CB    1 
ATOM   3103 C  CG1   . VAL C 3 358 ? 42.586 52.983  10.176  1.00 45.04 ? 364  VAL A CG1   1 
ATOM   3104 C  CG2   . VAL C 3 358 ? 42.428 52.877  12.670  1.00 46.00 ? 364  VAL A CG2   1 
ATOM   3105 N  N     . ASP C 3 359 ? 41.569 48.967  9.778   1.00 46.81 ? 365  ASP A N     1 
ATOM   3106 C  CA    . ASP C 3 359 ? 41.926 48.153  8.626   1.00 47.64 ? 365  ASP A CA    1 
ATOM   3107 C  C     . ASP C 3 359 ? 40.983 48.449  7.473   1.00 48.14 ? 365  ASP A C     1 
ATOM   3108 O  O     . ASP C 3 359 ? 39.958 49.105  7.648   1.00 47.21 ? 365  ASP A O     1 
ATOM   3109 C  CB    . ASP C 3 359 ? 41.915 46.653  8.958   1.00 48.33 ? 365  ASP A CB    1 
ATOM   3110 C  CG    . ASP C 3 359 ? 40.580 46.167  9.487   1.00 50.50 ? 365  ASP A CG    1 
ATOM   3111 O  OD1   . ASP C 3 359 ? 39.524 46.601  8.976   1.00 52.12 ? 365  ASP A OD1   1 
ATOM   3112 O  OD2   . ASP C 3 359 ? 40.594 45.324  10.411  1.00 51.17 ? 365  ASP A OD2   1 
ATOM   3113 N  N     . ASP C 3 360 ? 41.348 47.970  6.291   1.00 49.20 ? 366  ASP A N     1 
ATOM   3114 C  CA    . ASP C 3 360 ? 40.566 48.189  5.084   1.00 50.53 ? 366  ASP A CA    1 
ATOM   3115 C  C     . ASP C 3 360 ? 39.070 47.930  5.283   1.00 49.82 ? 366  ASP A C     1 
ATOM   3116 O  O     . ASP C 3 360 ? 38.230 48.661  4.754   1.00 49.56 ? 366  ASP A O     1 
ATOM   3117 C  CB    . ASP C 3 360 ? 41.108 47.294  3.962   1.00 52.64 ? 366  ASP A CB    1 
ATOM   3118 C  CG    . ASP C 3 360 ? 40.592 47.693  2.591   1.00 54.50 ? 366  ASP A CG    1 
ATOM   3119 O  OD1   . ASP C 3 360 ? 40.981 48.777  2.093   1.00 54.56 ? 366  ASP A OD1   1 
ATOM   3120 O  OD2   . ASP C 3 360 ? 39.794 46.921  2.014   1.00 55.55 ? 366  ASP A OD2   1 
ATOM   3121 N  N     . GLU C 3 361 ? 38.740 46.898  6.052   1.00 49.12 ? 367  GLU A N     1 
ATOM   3122 C  CA    . GLU C 3 361 ? 37.345 46.550  6.286   1.00 49.05 ? 367  GLU A CA    1 
ATOM   3123 C  C     . GLU C 3 361 ? 36.556 47.623  7.034   1.00 47.60 ? 367  GLU A C     1 
ATOM   3124 O  O     . GLU C 3 361 ? 35.394 47.871  6.718   1.00 47.46 ? 367  GLU A O     1 
ATOM   3125 C  CB    . GLU C 3 361 ? 37.240 45.223  7.044   1.00 50.70 ? 367  GLU A CB    1 
ATOM   3126 C  CG    . GLU C 3 361 ? 35.803 44.726  7.177   1.00 53.35 ? 367  GLU A CG    1 
ATOM   3127 C  CD    . GLU C 3 361 ? 35.690 43.418  7.941   1.00 56.16 ? 367  GLU A CD    1 
ATOM   3128 O  OE1   . GLU C 3 361 ? 36.003 43.399  9.153   1.00 56.54 ? 367  GLU A OE1   1 
ATOM   3129 O  OE2   . GLU C 3 361 ? 35.285 42.406  7.326   1.00 57.10 ? 367  GLU A OE2   1 
ATOM   3130 N  N     . VAL C 3 362 ? 37.171 48.254  8.028   1.00 45.59 ? 368  VAL A N     1 
ATOM   3131 C  CA    . VAL C 3 362 ? 36.471 49.288  8.774   1.00 44.71 ? 368  VAL A CA    1 
ATOM   3132 C  C     . VAL C 3 362 ? 36.481 50.583  7.969   1.00 43.70 ? 368  VAL A C     1 
ATOM   3133 O  O     . VAL C 3 362 ? 35.517 51.354  8.006   1.00 42.62 ? 368  VAL A O     1 
ATOM   3134 C  CB    . VAL C 3 362 ? 37.111 49.527  10.167  1.00 44.81 ? 368  VAL A CB    1 
ATOM   3135 C  CG1   . VAL C 3 362 ? 37.505 48.195  10.780  1.00 44.94 ? 368  VAL A CG1   1 
ATOM   3136 C  CG2   . VAL C 3 362 ? 38.299 50.466  10.066  1.00 43.34 ? 368  VAL A CG2   1 
ATOM   3137 N  N     . LEU C 3 363 ? 37.571 50.811  7.238   1.00 42.46 ? 369  LEU A N     1 
ATOM   3138 C  CA    . LEU C 3 363 ? 37.698 52.005  6.414   1.00 41.64 ? 369  LEU A CA    1 
ATOM   3139 C  C     . LEU C 3 363 ? 36.579 52.001  5.390   1.00 42.15 ? 369  LEU A C     1 
ATOM   3140 O  O     . LEU C 3 363 ? 35.991 53.037  5.099   1.00 43.83 ? 369  LEU A O     1 
ATOM   3141 C  CB    . LEU C 3 363 ? 39.062 52.041  5.709   1.00 39.78 ? 369  LEU A CB    1 
ATOM   3142 C  CG    . LEU C 3 363 ? 40.269 52.366  6.596   1.00 38.45 ? 369  LEU A CG    1 
ATOM   3143 C  CD1   . LEU C 3 363 ? 41.537 52.409  5.761   1.00 39.56 ? 369  LEU A CD1   1 
ATOM   3144 C  CD2   . LEU C 3 363 ? 40.052 53.705  7.278   1.00 37.77 ? 369  LEU A CD2   1 
ATOM   3145 N  N     . GLU C 3 364 ? 36.278 50.825  4.854   1.00 42.68 ? 370  GLU A N     1 
ATOM   3146 C  CA    . GLU C 3 364 ? 35.213 50.695  3.874   1.00 43.38 ? 370  GLU A CA    1 
ATOM   3147 C  C     . GLU C 3 364 ? 33.863 51.091  4.470   1.00 43.24 ? 370  GLU A C     1 
ATOM   3148 O  O     . GLU C 3 364 ? 32.971 51.541  3.751   1.00 43.10 ? 370  GLU A O     1 
ATOM   3149 C  CB    . GLU C 3 364 ? 35.154 49.253  3.355   1.00 45.64 ? 370  GLU A CB    1 
ATOM   3150 C  CG    . GLU C 3 364 ? 33.936 48.925  2.488   1.00 47.02 ? 370  GLU A CG    1 
ATOM   3151 C  CD    . GLU C 3 364 ? 33.656 49.979  1.424   1.00 50.38 ? 370  GLU A CD    1 
ATOM   3152 O  OE1   . GLU C 3 364 ? 34.582 50.320  0.648   1.00 51.52 ? 370  GLU A OE1   1 
ATOM   3153 O  OE2   . GLU C 3 364 ? 32.500 50.462  1.363   1.00 50.64 ? 370  GLU A OE2   1 
ATOM   3154 N  N     . GLY C 3 365 ? 33.718 50.939  5.783   1.00 41.93 ? 371  GLY A N     1 
ATOM   3155 C  CA    . GLY C 3 365 ? 32.456 51.273  6.418   1.00 41.60 ? 371  GLY A CA    1 
ATOM   3156 C  C     . GLY C 3 365 ? 32.362 52.632  7.093   1.00 42.22 ? 371  GLY A C     1 
ATOM   3157 O  O     . GLY C 3 365 ? 31.289 53.009  7.571   1.00 41.70 ? 371  GLY A O     1 
ATOM   3158 N  N     . VAL C 3 366 ? 33.469 53.369  7.133   1.00 41.21 ? 372  VAL A N     1 
ATOM   3159 C  CA    . VAL C 3 366 ? 33.492 54.682  7.767   1.00 41.32 ? 372  VAL A CA    1 
ATOM   3160 C  C     . VAL C 3 366 ? 32.714 55.738  6.985   1.00 42.73 ? 372  VAL A C     1 
ATOM   3161 O  O     . VAL C 3 366 ? 32.950 55.948  5.796   1.00 43.29 ? 372  VAL A O     1 
ATOM   3162 C  CB    . VAL C 3 366 ? 34.941 55.178  7.965   1.00 39.95 ? 372  VAL A CB    1 
ATOM   3163 C  CG1   . VAL C 3 366 ? 34.943 56.628  8.421   1.00 38.66 ? 372  VAL A CG1   1 
ATOM   3164 C  CG2   . VAL C 3 366 ? 35.645 54.305  8.995   1.00 38.39 ? 372  VAL A CG2   1 
ATOM   3165 N  N     . ARG C 3 367 ? 31.780 56.395  7.667   1.00 43.83 ? 373  ARG A N     1 
ATOM   3166 C  CA    . ARG C 3 367 ? 30.966 57.442  7.052   1.00 45.15 ? 373  ARG A CA    1 
ATOM   3167 C  C     . ARG C 3 367 ? 31.162 58.767  7.787   1.00 44.82 ? 373  ARG A C     1 
ATOM   3168 O  O     . ARG C 3 367 ? 31.156 58.805  9.016   1.00 45.33 ? 373  ARG A O     1 
ATOM   3169 C  CB    . ARG C 3 367 ? 29.486 57.052  7.095   1.00 45.37 ? 373  ARG A CB    1 
ATOM   3170 C  CG    . ARG C 3 367 ? 29.136 55.815  6.284   1.00 46.44 ? 373  ARG A CG    1 
ATOM   3171 C  CD    . ARG C 3 367 ? 29.144 56.105  4.792   1.00 47.71 ? 373  ARG A CD    1 
ATOM   3172 N  NE    . ARG C 3 367 ? 28.861 54.910  3.998   1.00 48.59 ? 373  ARG A NE    1 
ATOM   3173 C  CZ    . ARG C 3 367 ? 29.732 53.930  3.775   1.00 49.04 ? 373  ARG A CZ    1 
ATOM   3174 N  NH1   . ARG C 3 367 ? 30.958 53.991  4.281   1.00 47.27 ? 373  ARG A NH1   1 
ATOM   3175 N  NH2   . ARG C 3 367 ? 29.372 52.881  3.048   1.00 50.36 ? 373  ARG A NH2   1 
ATOM   3176 N  N     . VAL C 3 368 ? 31.356 59.846  7.032   1.00 44.23 ? 374  VAL A N     1 
ATOM   3177 C  CA    . VAL C 3 368 ? 31.526 61.176  7.611   1.00 43.15 ? 374  VAL A CA    1 
ATOM   3178 C  C     . VAL C 3 368 ? 30.722 62.156  6.768   1.00 43.17 ? 374  VAL A C     1 
ATOM   3179 O  O     . VAL C 3 368 ? 30.350 61.838  5.639   1.00 43.21 ? 374  VAL A O     1 
ATOM   3180 C  CB    . VAL C 3 368 ? 33.015 61.621  7.637   1.00 43.11 ? 374  VAL A CB    1 
ATOM   3181 C  CG1   . VAL C 3 368 ? 33.796 60.770  8.624   1.00 43.49 ? 374  VAL A CG1   1 
ATOM   3182 C  CG2   . VAL C 3 368 ? 33.619 61.520  6.249   1.00 41.95 ? 374  VAL A CG2   1 
ATOM   3183 N  N     . ASP C 3 369 ? 30.462 63.343  7.310   1.00 43.28 ? 375  ASP A N     1 
ATOM   3184 C  CA    . ASP C 3 369 ? 29.678 64.357  6.606   1.00 43.92 ? 375  ASP A CA    1 
ATOM   3185 C  C     . ASP C 3 369 ? 30.378 65.032  5.440   1.00 43.29 ? 375  ASP A C     1 
ATOM   3186 O  O     . ASP C 3 369 ? 29.820 65.133  4.352   1.00 43.40 ? 375  ASP A O     1 
ATOM   3187 C  CB    . ASP C 3 369 ? 29.208 65.435  7.579   1.00 44.95 ? 375  ASP A CB    1 
ATOM   3188 C  CG    . ASP C 3 369 ? 28.143 64.937  8.514   1.00 47.23 ? 375  ASP A CG    1 
ATOM   3189 O  OD1   . ASP C 3 369 ? 27.124 64.411  8.013   1.00 50.07 ? 375  ASP A OD1   1 
ATOM   3190 O  OD2   . ASP C 3 369 ? 28.319 65.072  9.745   1.00 48.51 ? 375  ASP A OD2   1 
ATOM   3191 N  N     . ASP C 3 370 ? 31.589 65.519  5.669   1.00 43.45 ? 376  ASP A N     1 
ATOM   3192 C  CA    . ASP C 3 370 ? 32.322 66.184  4.602   1.00 44.29 ? 376  ASP A CA    1 
ATOM   3193 C  C     . ASP C 3 370 ? 32.532 65.225  3.432   1.00 42.76 ? 376  ASP A C     1 
ATOM   3194 O  O     . ASP C 3 370 ? 33.148 64.173  3.588   1.00 43.58 ? 376  ASP A O     1 
ATOM   3195 C  CB    . ASP C 3 370 ? 33.674 66.677  5.108   1.00 45.08 ? 376  ASP A CB    1 
ATOM   3196 C  CG    . ASP C 3 370 ? 34.374 67.556  4.106   1.00 46.80 ? 376  ASP A CG    1 
ATOM   3197 O  OD1   . ASP C 3 370 ? 34.503 67.132  2.938   1.00 48.44 ? 376  ASP A OD1   1 
ATOM   3198 O  OD2   . ASP C 3 370 ? 34.796 68.670  4.482   1.00 48.62 ? 376  ASP A OD2   1 
ATOM   3199 N  N     . PRO C 3 371 ? 32.015 65.578  2.244   1.00 41.66 ? 377  PRO A N     1 
ATOM   3200 C  CA    . PRO C 3 371 ? 32.155 64.735  1.052   1.00 40.33 ? 377  PRO A CA    1 
ATOM   3201 C  C     . PRO C 3 371 ? 33.595 64.582  0.565   1.00 39.44 ? 377  PRO A C     1 
ATOM   3202 O  O     . PRO C 3 371 ? 33.958 63.547  0.005   1.00 40.11 ? 377  PRO A O     1 
ATOM   3203 C  CB    . PRO C 3 371 ? 31.258 65.433  0.029   1.00 41.12 ? 377  PRO A CB    1 
ATOM   3204 C  CG    . PRO C 3 371 ? 31.325 66.886  0.454   1.00 40.82 ? 377  PRO A CG    1 
ATOM   3205 C  CD    . PRO C 3 371 ? 31.201 66.773  1.951   1.00 41.20 ? 377  PRO A CD    1 
ATOM   3206 N  N     . GLU C 3 372 ? 34.412 65.607  0.778   1.00 37.50 ? 378  GLU A N     1 
ATOM   3207 C  CA    . GLU C 3 372 ? 35.804 65.551  0.352   1.00 38.23 ? 378  GLU A CA    1 
ATOM   3208 C  C     . GLU C 3 372 ? 36.608 64.571  1.202   1.00 37.67 ? 378  GLU A C     1 
ATOM   3209 O  O     . GLU C 3 372 ? 37.443 63.829  0.686   1.00 36.28 ? 378  GLU A O     1 
ATOM   3210 C  CB    . GLU C 3 372 ? 36.463 66.926  0.439   1.00 37.73 ? 378  GLU A CB    1 
ATOM   3211 C  CG    . GLU C 3 372 ? 37.837 66.949  -0.204  1.00 39.56 ? 378  GLU A CG    1 
ATOM   3212 C  CD    . GLU C 3 372 ? 38.558 68.264  -0.028  1.00 43.04 ? 378  GLU A CD    1 
ATOM   3213 O  OE1   . GLU C 3 372 ? 37.910 69.327  -0.153  1.00 42.19 ? 378  GLU A OE1   1 
ATOM   3214 O  OE2   . GLU C 3 372 ? 39.784 68.234  0.224   1.00 45.74 ? 378  GLU A OE2   1 
ATOM   3215 N  N     . LYS C 3 373 ? 36.361 64.590  2.508   1.00 37.43 ? 379  LYS A N     1 
ATOM   3216 C  CA    . LYS C 3 373 ? 37.055 63.706  3.435   1.00 37.32 ? 379  LYS A CA    1 
ATOM   3217 C  C     . LYS C 3 373 ? 36.546 62.287  3.256   1.00 37.18 ? 379  LYS A C     1 
ATOM   3218 O  O     . LYS C 3 373 ? 37.302 61.325  3.381   1.00 35.71 ? 379  LYS A O     1 
ATOM   3219 C  CB    . LYS C 3 373 ? 36.817 64.160  4.872   1.00 36.51 ? 379  LYS A CB    1 
ATOM   3220 C  CG    . LYS C 3 373 ? 37.354 65.550  5.167   1.00 38.61 ? 379  LYS A CG    1 
ATOM   3221 C  CD    . LYS C 3 373 ? 36.858 66.052  6.509   1.00 40.82 ? 379  LYS A CD    1 
ATOM   3222 C  CE    . LYS C 3 373 ? 37.511 67.370  6.885   1.00 41.20 ? 379  LYS A CE    1 
ATOM   3223 N  NZ    . LYS C 3 373 ? 38.980 67.208  6.936   1.00 41.13 ? 379  LYS A NZ    1 
ATOM   3224 N  N     . GLN C 3 374 ? 35.254 62.170  2.963   1.00 36.91 ? 380  GLN A N     1 
ATOM   3225 C  CA    . GLN C 3 374 ? 34.636 60.872  2.752   1.00 36.11 ? 380  GLN A CA    1 
ATOM   3226 C  C     . GLN C 3 374 ? 35.283 60.235  1.522   1.00 35.67 ? 380  GLN A C     1 
ATOM   3227 O  O     . GLN C 3 374 ? 35.577 59.039  1.512   1.00 35.24 ? 380  GLN A O     1 
ATOM   3228 C  CB    . GLN C 3 374 ? 33.128 61.046  2.543   1.00 35.51 ? 380  GLN A CB    1 
ATOM   3229 C  CG    . GLN C 3 374 ? 32.365 59.762  2.238   1.00 36.10 ? 380  GLN A CG    1 
ATOM   3230 C  CD    . GLN C 3 374 ? 32.418 58.749  3.372   1.00 37.25 ? 380  GLN A CD    1 
ATOM   3231 O  OE1   . GLN C 3 374 ? 31.993 59.027  4.493   1.00 34.51 ? 380  GLN A OE1   1 
ATOM   3232 N  NE2   . GLN C 3 374 ? 32.936 57.557  3.077   1.00 37.59 ? 380  GLN A NE2   1 
ATOM   3233 N  N     . ALA C 3 375 ? 35.519 61.048  0.495   1.00 34.72 ? 381  ALA A N     1 
ATOM   3234 C  CA    . ALA C 3 375 ? 36.136 60.569  -0.740  1.00 34.83 ? 381  ALA A CA    1 
ATOM   3235 C  C     . ALA C 3 375 ? 37.622 60.287  -0.534  1.00 34.53 ? 381  ALA A C     1 
ATOM   3236 O  O     . ALA C 3 375 ? 38.213 59.453  -1.228  1.00 35.27 ? 381  ALA A O     1 
ATOM   3237 C  CB    . ALA C 3 375 ? 35.955 61.593  -1.848  1.00 34.87 ? 381  ALA A CB    1 
ATOM   3238 N  N     . ALA C 3 376 ? 38.218 60.989  0.423   1.00 33.22 ? 382  ALA A N     1 
ATOM   3239 C  CA    . ALA C 3 376 ? 39.626 60.816  0.731   1.00 32.77 ? 382  ALA A CA    1 
ATOM   3240 C  C     . ALA C 3 376 ? 39.867 59.452  1.362   1.00 32.36 ? 382  ALA A C     1 
ATOM   3241 O  O     . ALA C 3 376 ? 40.991 58.959  1.359   1.00 33.87 ? 382  ALA A O     1 
ATOM   3242 C  CB    . ALA C 3 376 ? 40.100 61.918  1.671   1.00 31.93 ? 382  ALA A CB    1 
ATOM   3243 N  N     . ILE C 3 377 ? 38.818 58.850  1.913   1.00 32.36 ? 383  ILE A N     1 
ATOM   3244 C  CA    . ILE C 3 377 ? 38.947 57.528  2.527   1.00 32.85 ? 383  ILE A CA    1 
ATOM   3245 C  C     . ILE C 3 377 ? 39.373 56.549  1.436   1.00 32.47 ? 383  ILE A C     1 
ATOM   3246 O  O     . ILE C 3 377 ? 40.248 55.708  1.642   1.00 32.70 ? 383  ILE A O     1 
ATOM   3247 C  CB    . ILE C 3 377 ? 37.605 57.055  3.151   1.00 32.63 ? 383  ILE A CB    1 
ATOM   3248 C  CG1   . ILE C 3 377 ? 37.295 57.868  4.414   1.00 31.16 ? 383  ILE A CG1   1 
ATOM   3249 C  CG2   . ILE C 3 377 ? 37.671 55.571  3.485   1.00 33.63 ? 383  ILE A CG2   1 
ATOM   3250 N  N     . ASP C 3 378 ? 38.761 56.678  0.265   1.00 32.54 ? 384  ASP A N     1 
ATOM   3251 C  CA    . ASP C 3 378 ? 39.091 55.807  -0.854  1.00 32.90 ? 384  ASP A CA    1 
ATOM   3252 C  C     . ASP C 3 378 ? 40.533 56.008  -1.297  1.00 32.44 ? 384  ASP A C     1 
ATOM   3253 O  O     . ASP C 3 378 ? 41.209 55.044  -1.666  1.00 31.68 ? 384  ASP A O     1 
ATOM   3254 C  CB    . ASP C 3 378 ? 38.138 56.050  -2.029  1.00 33.65 ? 384  ASP A CB    1 
ATOM   3255 C  CG    . ASP C 3 378 ? 36.769 55.432  -1.800  1.00 36.20 ? 384  ASP A CG    1 
ATOM   3256 O  OD1   . ASP C 3 378 ? 36.720 54.258  -1.377  1.00 37.65 ? 384  ASP A OD1   1 
ATOM   3257 O  OD2   . ASP C 3 378 ? 35.744 56.105  -2.046  1.00 37.78 ? 384  ASP A OD2   1 
ATOM   3258 N  N     . LEU C 3 379 ? 41.006 57.252  -1.250  1.00 32.19 ? 385  LEU A N     1 
ATOM   3259 C  CA    . LEU C 3 379 ? 42.380 57.554  -1.640  1.00 32.66 ? 385  LEU A CA    1 
ATOM   3260 C  C     . LEU C 3 379 ? 43.351 56.949  -0.643  1.00 32.44 ? 385  LEU A C     1 
ATOM   3261 O  O     . LEU C 3 379 ? 44.460 56.555  -0.999  1.00 30.74 ? 385  LEU A O     1 
ATOM   3262 C  CB    . LEU C 3 379 ? 42.610 59.065  -1.713  1.00 33.55 ? 385  LEU A CB    1 
ATOM   3263 C  CG    . LEU C 3 379 ? 41.781 59.814  -2.755  1.00 35.44 ? 385  LEU A CG    1 
ATOM   3264 C  CD1   . LEU C 3 379 ? 42.243 61.258  -2.815  1.00 34.70 ? 385  LEU A CD1   1 
ATOM   3265 C  CD2   . LEU C 3 379 ? 41.928 59.138  -4.115  1.00 35.40 ? 385  LEU A CD2   1 
ATOM   3266 N  N     . ILE C 3 380 ? 42.930 56.897  0.614   1.00 32.82 ? 386  ILE A N     1 
ATOM   3267 C  CA    . ILE C 3 380 ? 43.755 56.326  1.663   1.00 34.54 ? 386  ILE A CA    1 
ATOM   3268 C  C     . ILE C 3 380 ? 43.900 54.818  1.422   1.00 35.04 ? 386  ILE A C     1 
ATOM   3269 O  O     . ILE C 3 380 ? 44.990 54.265  1.559   1.00 34.90 ? 386  ILE A O     1 
ATOM   3270 C  CB    . ILE C 3 380 ? 43.128 56.569  3.060   1.00 35.23 ? 386  ILE A CB    1 
ATOM   3271 C  CG1   . ILE C 3 380 ? 43.253 58.050  3.444   1.00 32.89 ? 386  ILE A CG1   1 
ATOM   3272 C  CG2   . ILE C 3 380 ? 43.793 55.673  4.099   1.00 33.50 ? 386  ILE A CG2   1 
ATOM   3273 N  N     . LYS C 3 381 ? 42.797 54.165  1.061   1.00 35.70 ? 387  LYS A N     1 
ATOM   3274 C  CA    . LYS C 3 381 ? 42.812 52.731  0.805   1.00 36.14 ? 387  LYS A CA    1 
ATOM   3275 C  C     . LYS C 3 381 ? 43.665 52.425  -0.418  1.00 35.88 ? 387  LYS A C     1 
ATOM   3276 O  O     . LYS C 3 381 ? 44.425 51.456  -0.425  1.00 36.46 ? 387  LYS A O     1 
ATOM   3277 C  CB    . LYS C 3 381 ? 41.389 52.196  0.599   1.00 37.65 ? 387  LYS A CB    1 
ATOM   3278 C  CG    . LYS C 3 381 ? 40.505 52.304  1.836   1.00 39.70 ? 387  LYS A CG    1 
ATOM   3279 C  CD    . LYS C 3 381 ? 39.285 51.394  1.750   1.00 42.92 ? 387  LYS A CD    1 
ATOM   3280 C  CE    . LYS C 3 381 ? 38.342 51.810  0.637   1.00 44.90 ? 387  LYS A CE    1 
ATOM   3281 N  NZ    . LYS C 3 381 ? 37.835 53.197  0.856   1.00 46.97 ? 387  LYS A NZ    1 
ATOM   3282 N  N     . GLU C 3 382 ? 43.545 53.257  -1.447  1.00 34.35 ? 388  GLU A N     1 
ATOM   3283 C  CA    . GLU C 3 382 ? 44.331 53.064  -2.656  1.00 34.34 ? 388  GLU A CA    1 
ATOM   3284 C  C     . GLU C 3 382 ? 45.805 53.274  -2.312  1.00 33.96 ? 388  GLU A C     1 
ATOM   3285 O  O     . GLU C 3 382 ? 46.678 52.541  -2.782  1.00 36.05 ? 388  GLU A O     1 
ATOM   3286 C  CB    . GLU C 3 382 ? 43.906 54.058  -3.744  1.00 34.66 ? 388  GLU A CB    1 
ATOM   3287 C  CG    . GLU C 3 382 ? 44.332 53.656  -5.156  1.00 35.33 ? 388  GLU A CG    1 
ATOM   3288 C  CD    . GLU C 3 382 ? 44.213 54.790  -6.169  1.00 37.26 ? 388  GLU A CD    1 
ATOM   3289 O  OE1   . GLU C 3 382 ? 43.318 55.654  -6.016  1.00 36.96 ? 388  GLU A OE1   1 
ATOM   3290 O  OE2   . GLU C 3 382 ? 45.012 54.807  -7.133  1.00 37.97 ? 388  GLU A OE2   1 
ATOM   3291 N  N     . TYR C 3 383 ? 46.083 54.270  -1.479  1.00 31.35 ? 389  TYR A N     1 
ATOM   3292 C  CA    . TYR C 3 383 ? 47.456 54.552  -1.090  1.00 30.05 ? 389  TYR A CA    1 
ATOM   3293 C  C     . TYR C 3 383 ? 48.095 53.420  -0.277  1.00 29.92 ? 389  TYR A C     1 
ATOM   3294 O  O     . TYR C 3 383 ? 49.245 53.054  -0.521  1.00 30.36 ? 389  TYR A O     1 
ATOM   3295 C  CB    . TYR C 3 383 ? 47.520 55.861  -0.304  1.00 28.36 ? 389  TYR A CB    1 
ATOM   3296 C  CG    . TYR C 3 383 ? 48.922 56.286  0.082   1.00 26.74 ? 389  TYR A CG    1 
ATOM   3297 C  CD1   . TYR C 3 383 ? 49.572 55.713  1.174   1.00 27.24 ? 389  TYR A CD1   1 
ATOM   3298 C  CD2   . TYR C 3 383 ? 49.591 57.276  -0.637  1.00 25.97 ? 389  TYR A CD2   1 
ATOM   3299 C  CE1   . TYR C 3 383 ? 50.854 56.118  1.546   1.00 26.67 ? 389  TYR A CE1   1 
ATOM   3300 C  CE2   . TYR C 3 383 ? 50.872 57.689  -0.278  1.00 26.81 ? 389  TYR A CE2   1 
ATOM   3301 C  CZ    . TYR C 3 383 ? 51.498 57.106  0.817   1.00 27.03 ? 389  TYR A CZ    1 
ATOM   3302 O  OH    . TYR C 3 383 ? 52.758 57.523  1.186   1.00 25.71 ? 389  TYR A OH    1 
ATOM   3303 N  N     . LEU C 3 384 ? 47.363 52.870  0.687   1.00 29.81 ? 390  LEU A N     1 
ATOM   3304 C  CA    . LEU C 3 384 ? 47.903 51.782  1.505   1.00 30.70 ? 390  LEU A CA    1 
ATOM   3305 C  C     . LEU C 3 384 ? 48.263 50.591  0.617   1.00 30.90 ? 390  LEU A C     1 
ATOM   3306 O  O     . LEU C 3 384 ? 49.323 49.986  0.763   1.00 31.05 ? 390  LEU A O     1 
ATOM   3307 C  CB    . LEU C 3 384 ? 46.883 51.351  2.569   1.00 29.98 ? 390  LEU A CB    1 
ATOM   3308 C  CG    . LEU C 3 384 ? 46.638 52.376  3.688   1.00 32.31 ? 390  LEU A CG    1 
ATOM   3309 C  CD1   . LEU C 3 384 ? 45.410 51.995  4.472   1.00 32.40 ? 390  LEU A CD1   1 
ATOM   3310 C  CD2   . LEU C 3 384 ? 47.862 52.466  4.603   1.00 32.23 ? 390  LEU A CD2   1 
ATOM   3311 N  N     . MET C 3 385 ? 47.368 50.276  -0.310  1.00 30.90 ? 391  MET A N     1 
ATOM   3312 C  CA    . MET C 3 385 ? 47.560 49.174  -1.228  1.00 30.96 ? 391  MET A CA    1 
ATOM   3313 C  C     . MET C 3 385 ? 48.772 49.388  -2.140  1.00 31.80 ? 391  MET A C     1 
ATOM   3314 O  O     . MET C 3 385 ? 49.572 48.469  -2.333  1.00 31.02 ? 391  MET A O     1 
ATOM   3315 C  CB    . MET C 3 385 ? 46.283 48.977  -2.048  1.00 32.04 ? 391  MET A CB    1 
ATOM   3316 C  CG    . MET C 3 385 ? 46.357 47.872  -3.083  1.00 33.97 ? 391  MET A CG    1 
ATOM   3317 S  SD    . MET C 3 385 ? 46.707 48.522  -4.714  1.00 37.30 ? 391  MET A SD    1 
ATOM   3318 C  CE    . MET C 3 385 ? 48.396 48.245  -4.858  1.00 36.92 ? 391  MET A CE    1 
ATOM   3319 N  N     . ILE C 3 386 ? 48.908 50.594  -2.690  1.00 30.43 ? 392  ILE A N     1 
ATOM   3320 C  CA    . ILE C 3 386 ? 50.024 50.920  -3.569  1.00 30.38 ? 392  ILE A CA    1 
ATOM   3321 C  C     . ILE C 3 386 ? 51.329 50.764  -2.799  1.00 31.03 ? 392  ILE A C     1 
ATOM   3322 O  O     . ILE C 3 386 ? 52.362 50.396  -3.365  1.00 30.77 ? 392  ILE A O     1 
ATOM   3323 C  CB    . ILE C 3 386 ? 49.917 52.380  -4.109  1.00 32.02 ? 392  ILE A CB    1 
ATOM   3324 C  CG1   . ILE C 3 386 ? 48.775 52.480  -5.132  1.00 29.99 ? 392  ILE A CG1   1 
ATOM   3325 C  CG2   . ILE C 3 386 ? 51.241 52.816  -4.732  1.00 28.74 ? 392  ILE A CG2   1 
ATOM   3326 N  N     . GLN C 3 387 ? 51.277 51.050  -1.503  1.00 31.17 ? 393  GLN A N     1 
ATOM   3327 C  CA    . GLN C 3 387 ? 52.445 50.920  -0.651  1.00 31.14 ? 393  GLN A CA    1 
ATOM   3328 C  C     . GLN C 3 387 ? 52.769 49.455  -0.410  1.00 30.01 ? 393  GLN A C     1 
ATOM   3329 O  O     . GLN C 3 387 ? 53.940 49.080  -0.277  1.00 29.77 ? 393  GLN A O     1 
ATOM   3330 C  CB    . GLN C 3 387 ? 52.217 51.624  0.687   1.00 32.47 ? 393  GLN A CB    1 
ATOM   3331 C  CG    . GLN C 3 387 ? 52.827 53.012  0.721   1.00 35.69 ? 393  GLN A CG    1 
ATOM   3332 C  CD    . GLN C 3 387 ? 54.339 52.973  0.572   1.00 36.39 ? 393  GLN A CD    1 
ATOM   3333 O  OE1   . GLN C 3 387 ? 54.960 53.962  0.181   1.00 36.57 ? 393  GLN A OE1   1 
ATOM   3334 N  NE2   . GLN C 3 387 ? 54.941 51.829  0.898   1.00 36.77 ? 393  GLN A NE2   1 
ATOM   3335 N  N     . LYS C 3 388 ? 51.731 48.629  -0.345  1.00 29.19 ? 394  LYS A N     1 
ATOM   3336 C  CA    . LYS C 3 388 ? 51.928 47.201  -0.133  1.00 29.83 ? 394  LYS A CA    1 
ATOM   3337 C  C     . LYS C 3 388 ? 52.703 46.634  -1.330  1.00 29.04 ? 394  LYS A C     1 
ATOM   3338 O  O     . LYS C 3 388 ? 53.622 45.835  -1.164  1.00 30.61 ? 394  LYS A O     1 
ATOM   3339 C  CB    . LYS C 3 388 ? 50.572 46.494  0.004   1.00 31.74 ? 394  LYS A CB    1 
ATOM   3340 C  CG    . LYS C 3 388 ? 50.621 45.178  0.790   1.00 33.06 ? 394  LYS A CG    1 
ATOM   3341 C  CD    . LYS C 3 388 ? 51.313 45.377  2.141   1.00 33.80 ? 394  LYS A CD    1 
ATOM   3342 C  CE    . LYS C 3 388 ? 50.979 44.263  3.127   1.00 34.77 ? 394  LYS A CE    1 
ATOM   3343 N  NZ    . LYS C 3 388 ? 51.276 42.929  2.565   1.00 36.98 ? 394  LYS A NZ    1 
ATOM   3344 N  N     . ARG C 3 389 ? 52.343 47.073  -2.534  1.00 27.63 ? 395  ARG A N     1 
ATOM   3345 C  CA    . ARG C 3 389 ? 53.006 46.610  -3.751  1.00 25.30 ? 395  ARG A CA    1 
ATOM   3346 C  C     . ARG C 3 389 ? 54.410 47.159  -3.910  1.00 25.49 ? 395  ARG A C     1 
ATOM   3347 O  O     . ARG C 3 389 ? 55.310 46.451  -4.352  1.00 26.15 ? 395  ARG A O     1 
ATOM   3348 C  CB    . ARG C 3 389 ? 52.185 46.990  -4.973  1.00 22.93 ? 395  ARG A CB    1 
ATOM   3349 C  CG    . ARG C 3 389 ? 50.820 46.376  -4.968  1.00 22.43 ? 395  ARG A CG    1 
ATOM   3350 C  CD    . ARG C 3 389 ? 50.860 44.876  -5.186  1.00 20.49 ? 395  ARG A CD    1 
ATOM   3351 N  NE    . ARG C 3 389 ? 49.495 44.390  -5.300  1.00 24.80 ? 395  ARG A NE    1 
ATOM   3352 C  CZ    . ARG C 3 389 ? 48.681 44.215  -4.264  1.00 24.54 ? 395  ARG A CZ    1 
ATOM   3353 N  NH1   . ARG C 3 389 ? 49.104 44.466  -3.027  1.00 25.37 ? 395  ARG A NH1   1 
ATOM   3354 N  NH2   . ARG C 3 389 ? 47.424 43.850  -4.471  1.00 22.55 ? 395  ARG A NH2   1 
ATOM   3355 N  N     . ILE C 3 390 ? 54.594 48.428  -3.570  1.00 25.55 ? 396  ILE A N     1 
ATOM   3356 C  CA    . ILE C 3 390 ? 55.904 49.037  -3.684  1.00 25.57 ? 396  ILE A CA    1 
ATOM   3357 C  C     . ILE C 3 390 ? 56.833 48.358  -2.691  1.00 25.12 ? 396  ILE A C     1 
ATOM   3358 O  O     . ILE C 3 390 ? 57.959 47.998  -3.029  1.00 24.91 ? 396  ILE A O     1 
ATOM   3359 C  CB    . ILE C 3 390 ? 55.865 50.553  -3.371  1.00 25.78 ? 396  ILE A CB    1 
ATOM   3360 C  CG1   . ILE C 3 390 ? 55.030 51.292  -4.425  1.00 26.38 ? 396  ILE A CG1   1 
ATOM   3361 C  CG2   . ILE C 3 390 ? 57.291 51.103  -3.318  1.00 24.93 ? 396  ILE A CG2   1 
ATOM   3362 N  N     . GLY C 3 391 ? 56.349 48.189  -1.465  1.00 24.43 ? 397  GLY A N     1 
ATOM   3363 C  CA    . GLY C 3 391 ? 57.146 47.554  -0.432  1.00 25.82 ? 397  GLY A CA    1 
ATOM   3364 C  C     . GLY C 3 391 ? 57.592 46.157  -0.822  1.00 26.81 ? 397  GLY A C     1 
ATOM   3365 O  O     . GLY C 3 391 ? 58.766 45.816  -0.700  1.00 27.44 ? 397  GLY A O     1 
ATOM   3366 N  N     . GLN C 3 392 ? 56.660 45.352  -1.312  1.00 26.80 ? 398  GLN A N     1 
ATOM   3367 C  CA    . GLN C 3 392 ? 56.977 43.988  -1.705  1.00 28.24 ? 398  GLN A CA    1 
ATOM   3368 C  C     . GLN C 3 392 ? 57.818 43.892  -2.975  1.00 27.89 ? 398  GLN A C     1 
ATOM   3369 O  O     . GLN C 3 392 ? 58.731 43.076  -3.064  1.00 27.51 ? 398  GLN A O     1 
ATOM   3370 C  CB    . GLN C 3 392 ? 55.688 43.183  -1.883  1.00 29.34 ? 398  GLN A CB    1 
ATOM   3371 C  CG    . GLN C 3 392 ? 55.921 41.770  -2.390  1.00 31.46 ? 398  GLN A CG    1 
ATOM   3372 C  CD    . GLN C 3 392 ? 54.673 40.921  -2.345  1.00 31.33 ? 398  GLN A CD    1 
ATOM   3373 O  OE1   . GLN C 3 392 ? 53.564 41.427  -2.496  1.00 31.47 ? 398  GLN A OE1   1 
ATOM   3374 N  NE2   . GLN C 3 392 ? 54.849 39.612  -2.154  1.00 30.21 ? 398  GLN A NE2   1 
ATOM   3375 N  N     . SER C 3 393 ? 57.527 44.743  -3.950  1.00 28.50 ? 399  SER A N     1 
ATOM   3376 C  CA    . SER C 3 393 ? 58.248 44.709  -5.215  1.00 29.25 ? 399  SER A CA    1 
ATOM   3377 C  C     . SER C 3 393 ? 59.571 45.467  -5.257  1.00 29.65 ? 399  SER A C     1 
ATOM   3378 O  O     . SER C 3 393 ? 60.517 45.026  -5.910  1.00 29.55 ? 399  SER A O     1 
ATOM   3379 C  CB    . SER C 3 393 ? 57.357 45.247  -6.342  1.00 29.84 ? 399  SER A CB    1 
ATOM   3380 O  OG    . SER C 3 393 ? 57.205 46.660  -6.243  1.00 28.88 ? 399  SER A OG    1 
ATOM   3381 N  N     . ALA C 3 394 ? 59.654 46.590  -4.551  1.00 30.28 ? 400  ALA A N     1 
ATOM   3382 C  CA    . ALA C 3 394 ? 60.860 47.396  -4.644  1.00 30.66 ? 400  ALA A CA    1 
ATOM   3383 C  C     . ALA C 3 394 ? 61.529 47.980  -3.407  1.00 30.27 ? 400  ALA A C     1 
ATOM   3384 O  O     . ALA C 3 394 ? 62.757 47.980  -3.328  1.00 30.08 ? 400  ALA A O     1 
ATOM   3385 C  CB    . ALA C 3 394 ? 60.601 48.533  -5.638  1.00 31.19 ? 400  ALA A CB    1 
ATOM   3386 N  N     . GLU C 3 395 ? 60.753 48.488  -2.453  1.00 29.62 ? 401  GLU A N     1 
ATOM   3387 C  CA    . GLU C 3 395 ? 61.362 49.142  -1.298  1.00 29.98 ? 401  GLU A CA    1 
ATOM   3388 C  C     . GLU C 3 395 ? 61.620 48.332  -0.038  1.00 29.50 ? 401  GLU A C     1 
ATOM   3389 O  O     . GLU C 3 395 ? 62.559 48.631  0.695   1.00 29.64 ? 401  GLU A O     1 
ATOM   3390 C  CB    . GLU C 3 395 ? 60.562 50.403  -0.942  1.00 30.51 ? 401  GLU A CB    1 
ATOM   3391 C  CG    . GLU C 3 395 ? 60.393 51.360  -2.112  1.00 32.78 ? 401  GLU A CG    1 
ATOM   3392 C  CD    . GLU C 3 395 ? 59.813 52.706  -1.702  1.00 33.98 ? 401  GLU A CD    1 
ATOM   3393 O  OE1   . GLU C 3 395 ? 58.993 52.750  -0.760  1.00 35.60 ? 401  GLU A OE1   1 
ATOM   3394 O  OE2   . GLU C 3 395 ? 60.165 53.721  -2.338  1.00 33.51 ? 401  GLU A OE2   1 
ATOM   3395 N  N     . GLY C 3 396 ? 60.798 47.322  0.222   1.00 29.34 ? 402  GLY A N     1 
ATOM   3396 C  CA    . GLY C 3 396 ? 60.995 46.513  1.413   1.00 29.54 ? 402  GLY A CA    1 
ATOM   3397 C  C     . GLY C 3 396 ? 62.381 45.893  1.460   1.00 28.23 ? 402  GLY A C     1 
ATOM   3398 O  O     . GLY C 3 396 ? 63.080 45.866  0.448   1.00 27.73 ? 402  GLY A O     1 
ATOM   3399 N  N     . ASP C 3 397 ? 62.786 45.405  2.631   1.00 29.12 ? 403  ASP A N     1 
ATOM   3400 C  CA    . ASP C 3 397 ? 64.093 44.765  2.777   1.00 31.09 ? 403  ASP A CA    1 
ATOM   3401 C  C     . ASP C 3 397 ? 64.143 43.462  1.982   1.00 30.23 ? 403  ASP A C     1 
ATOM   3402 O  O     . ASP C 3 397 ? 65.211 43.042  1.533   1.00 28.98 ? 403  ASP A O     1 
ATOM   3403 C  CB    . ASP C 3 397 ? 64.399 44.442  4.245   1.00 35.56 ? 403  ASP A CB    1 
ATOM   3404 C  CG    . ASP C 3 397 ? 64.554 45.684  5.102   1.00 38.83 ? 403  ASP A CG    1 
ATOM   3405 O  OD1   . ASP C 3 397 ? 65.010 46.723  4.570   1.00 39.34 ? 403  ASP A OD1   1 
ATOM   3406 O  OD2   . ASP C 3 397 ? 64.235 45.611  6.312   1.00 40.20 ? 403  ASP A OD2   1 
ATOM   3407 N  N     . LYS C 3 398 ? 62.980 42.833  1.823   1.00 29.13 ? 404  LYS A N     1 
ATOM   3408 C  CA    . LYS C 3 398 ? 62.850 41.570  1.096   1.00 28.76 ? 404  LYS A CA    1 
ATOM   3409 C  C     . LYS C 3 398 ? 62.291 41.800  -0.311  1.00 27.70 ? 404  LYS A C     1 
ATOM   3410 O  O     . LYS C 3 398 ? 61.767 40.878  -0.933  1.00 27.07 ? 404  LYS A O     1 
ATOM   3411 C  CB    . LYS C 3 398 ? 61.903 40.626  1.846   1.00 29.68 ? 404  LYS A CB    1 
ATOM   3412 C  CG    . LYS C 3 398 ? 62.182 40.463  3.332   1.00 31.25 ? 404  LYS A CG    1 
ATOM   3413 C  CD    . LYS C 3 398 ? 63.451 39.674  3.598   1.00 34.22 ? 404  LYS A CD    1 
ATOM   3414 C  CE    . LYS C 3 398 ? 63.720 39.565  5.098   1.00 36.79 ? 404  LYS A CE    1 
ATOM   3415 N  NZ    . LYS C 3 398 ? 62.570 38.965  5.858   1.00 36.64 ? 404  LYS A NZ    1 
ATOM   3416 N  N     . ALA C 3 399 ? 62.404 43.025  -0.809  1.00 25.91 ? 405  ALA A N     1 
ATOM   3417 C  CA    . ALA C 3 399 ? 61.889 43.359  -2.133  1.00 25.68 ? 405  ALA A CA    1 
ATOM   3418 C  C     . ALA C 3 399 ? 62.503 42.538  -3.262  1.00 25.24 ? 405  ALA A C     1 
ATOM   3419 O  O     . ALA C 3 399 ? 63.689 42.217  -3.244  1.00 25.28 ? 405  ALA A O     1 
ATOM   3420 C  CB    . ALA C 3 399 ? 62.086 44.849  -2.410  1.00 25.22 ? 405  ALA A CB    1 
ATOM   3421 N  N     . TRP C 3 400 ? 61.678 42.217  -4.254  1.00 26.17 ? 406  TRP A N     1 
ATOM   3422 C  CA    . TRP C 3 400 ? 62.118 41.441  -5.406  1.00 25.61 ? 406  TRP A CA    1 
ATOM   3423 C  C     . TRP C 3 400 ? 63.325 42.061  -6.104  1.00 28.00 ? 406  TRP A C     1 
ATOM   3424 O  O     . TRP C 3 400 ? 64.280 41.352  -6.443  1.00 28.04 ? 406  TRP A O     1 
ATOM   3425 C  CB    . TRP C 3 400 ? 60.980 41.292  -6.420  1.00 22.93 ? 406  TRP A CB    1 
ATOM   3426 C  CG    . TRP C 3 400 ? 59.723 40.700  -5.848  1.00 20.85 ? 406  TRP A CG    1 
ATOM   3427 C  CD1   . TRP C 3 400 ? 59.632 39.774  -4.845  1.00 20.41 ? 406  TRP A CD1   1 
ATOM   3428 C  CD2   . TRP C 3 400 ? 58.381 40.978  -6.260  1.00 20.73 ? 406  TRP A CD2   1 
ATOM   3429 N  NE1   . TRP C 3 400 ? 58.315 39.459  -4.604  1.00 17.92 ? 406  TRP A NE1   1 
ATOM   3430 C  CE2   . TRP C 3 400 ? 57.525 40.185  -5.459  1.00 21.08 ? 406  TRP A CE2   1 
ATOM   3431 C  CE3   . TRP C 3 400 ? 57.816 41.820  -7.227  1.00 21.25 ? 406  TRP A CE3   1 
ATOM   3432 C  CZ2   . TRP C 3 400 ? 56.130 40.211  -5.597  1.00 20.18 ? 406  TRP A CZ2   1 
ATOM   3433 C  CZ3   . TRP C 3 400 ? 56.425 41.845  -7.365  1.00 21.63 ? 406  TRP A CZ3   1 
ATOM   3434 C  CH2   . TRP C 3 400 ? 55.600 41.046  -6.553  1.00 21.67 ? 406  TRP A CH2   1 
ATOM   3435 N  N     . LEU C 3 401 ? 63.276 43.376  -6.324  1.00 27.52 ? 407  LEU A N     1 
ATOM   3436 C  CA    . LEU C 3 401 ? 64.359 44.082  -6.993  1.00 26.86 ? 407  LEU A CA    1 
ATOM   3437 C  C     . LEU C 3 401 ? 65.659 44.000  -6.204  1.00 27.49 ? 407  LEU A C     1 
ATOM   3438 O  O     . LEU C 3 401 ? 66.742 44.188  -6.760  1.00 27.73 ? 407  LEU A O     1 
ATOM   3439 C  CB    . LEU C 3 401 ? 63.983 45.554  -7.223  1.00 26.87 ? 407  LEU A CB    1 
ATOM   3440 C  CG    . LEU C 3 401 ? 62.873 45.862  -8.244  1.00 26.79 ? 407  LEU A CG    1 
ATOM   3441 C  CD1   . LEU C 3 401 ? 62.597 47.355  -8.242  1.00 25.70 ? 407  LEU A CD1   1 
ATOM   3442 C  CD2   . LEU C 3 401 ? 63.281 45.396  -9.649  1.00 24.34 ? 407  LEU A CD2   1 
ATOM   3443 N  N     . ARG C 3 402 ? 65.549 43.727  -4.908  1.00 27.64 ? 408  ARG A N     1 
ATOM   3444 C  CA    . ARG C 3 402 ? 66.723 43.609  -4.050  1.00 27.80 ? 408  ARG A CA    1 
ATOM   3445 C  C     . ARG C 3 402 ? 67.250 42.180  -4.097  1.00 27.93 ? 408  ARG A C     1 
ATOM   3446 O  O     . ARG C 3 402 ? 68.401 41.926  -3.752  1.00 27.95 ? 408  ARG A O     1 
ATOM   3447 C  CB    . ARG C 3 402 ? 66.380 43.975  -2.601  1.00 28.88 ? 408  ARG A CB    1 
ATOM   3448 C  CG    . ARG C 3 402 ? 65.995 45.442  -2.405  1.00 32.89 ? 408  ARG A CG    1 
ATOM   3449 C  CD    . ARG C 3 402 ? 65.737 45.777  -0.941  1.00 33.86 ? 408  ARG A CD    1 
ATOM   3450 N  NE    . ARG C 3 402 ? 65.218 47.137  -0.763  1.00 38.35 ? 408  ARG A NE    1 
ATOM   3451 C  CZ    . ARG C 3 402 ? 65.921 48.252  -0.965  1.00 39.34 ? 408  ARG A CZ    1 
ATOM   3452 N  NH1   . ARG C 3 402 ? 67.186 48.188  -1.355  1.00 40.08 ? 408  ARG A NH1   1 
ATOM   3453 N  NH2   . ARG C 3 402 ? 65.357 49.439  -0.776  1.00 39.31 ? 408  ARG A NH2   1 
ATOM   3454 N  N     . TYR C 3 403 ? 66.411 41.246  -4.535  1.00 26.58 ? 409  TYR A N     1 
ATOM   3455 C  CA    . TYR C 3 403 ? 66.832 39.857  -4.590  1.00 28.12 ? 409  TYR A CA    1 
ATOM   3456 C  C     . TYR C 3 403 ? 67.232 39.292  -5.946  1.00 28.64 ? 409  TYR A C     1 
ATOM   3457 O  O     . TYR C 3 403 ? 67.909 38.272  -5.994  1.00 28.51 ? 409  TYR A O     1 
ATOM   3458 C  CB    . TYR C 3 403 ? 65.771 38.963  -3.949  1.00 27.66 ? 409  TYR A CB    1 
ATOM   3459 C  CG    . TYR C 3 403 ? 66.003 38.781  -2.474  1.00 29.37 ? 409  TYR A CG    1 
ATOM   3460 C  CD1   . TYR C 3 403 ? 67.091 38.035  -2.008  1.00 30.13 ? 409  TYR A CD1   1 
ATOM   3461 C  CD2   . TYR C 3 403 ? 65.191 39.413  -1.540  1.00 29.27 ? 409  TYR A CD2   1 
ATOM   3462 C  CE1   . TYR C 3 403 ? 67.368 37.935  -0.646  1.00 29.97 ? 409  TYR A CE1   1 
ATOM   3463 C  CE2   . TYR C 3 403 ? 65.459 39.320  -0.180  1.00 31.99 ? 409  TYR A CE2   1 
ATOM   3464 C  CZ    . TYR C 3 403 ? 66.550 38.585  0.260   1.00 31.17 ? 409  TYR A CZ    1 
ATOM   3465 O  OH    . TYR C 3 403 ? 66.839 38.543  1.601   1.00 32.23 ? 409  TYR A OH    1 
ATOM   3466 N  N     . VAL C 3 404 ? 66.840 39.936  -7.044  1.00 29.24 ? 410  VAL A N     1 
ATOM   3467 C  CA    . VAL C 3 404 ? 67.212 39.415  -8.360  1.00 31.72 ? 410  VAL A CA    1 
ATOM   3468 C  C     . VAL C 3 404 ? 68.732 39.295  -8.453  1.00 31.49 ? 410  VAL A C     1 
ATOM   3469 O  O     . VAL C 3 404 ? 69.453 40.259  -8.192  1.00 30.46 ? 410  VAL A O     1 
ATOM   3470 C  CB    . VAL C 3 404 ? 66.762 40.333  -9.512  1.00 33.00 ? 410  VAL A CB    1 
ATOM   3471 C  CG1   . VAL C 3 404 ? 66.782 39.552  -10.827 1.00 30.72 ? 410  VAL A CG1   1 
ATOM   3472 C  CG2   . VAL C 3 404 ? 65.395 40.884  -9.234  1.00 35.22 ? 410  VAL A CG2   1 
ATOM   3473 N  N     . ALA C 3 405 ? 69.211 38.117  -8.836  1.00 30.37 ? 411  ALA A N     1 
ATOM   3474 C  CA    . ALA C 3 405 ? 70.645 37.878  -8.951  1.00 30.15 ? 411  ALA A CA    1 
ATOM   3475 C  C     . ALA C 3 405 ? 71.157 38.222  -10.343 1.00 30.10 ? 411  ALA A C     1 
ATOM   3476 O  O     . ALA C 3 405 ? 70.391 38.633  -11.208 1.00 30.26 ? 411  ALA A O     1 
ATOM   3477 C  CB    . ALA C 3 405 ? 70.957 36.416  -8.619  1.00 26.98 ? 411  ALA A CB    1 
ATOM   3478 N  N     . GLU C 3 406 ? 72.459 38.047  -10.552 1.00 31.39 ? 412  GLU A N     1 
ATOM   3479 C  CA    . GLU C 3 406 ? 73.078 38.345  -11.842 1.00 32.02 ? 412  GLU A CA    1 
ATOM   3480 C  C     . GLU C 3 406 ? 72.526 37.469  -12.968 1.00 31.22 ? 412  GLU A C     1 
ATOM   3481 O  O     . GLU C 3 406 ? 72.420 37.911  -14.111 1.00 32.37 ? 412  GLU A O     1 
ATOM   3482 C  CB    . GLU C 3 406 ? 74.600 38.170  -11.749 1.00 32.04 ? 412  GLU A CB    1 
ATOM   3483 N  N     . ASP C 3 407 ? 72.168 36.232  -12.646 1.00 31.23 ? 413  ASP A N     1 
ATOM   3484 C  CA    . ASP C 3 407 ? 71.624 35.319  -13.650 1.00 30.53 ? 413  ASP A CA    1 
ATOM   3485 C  C     . ASP C 3 407 ? 70.203 35.691  -14.078 1.00 30.09 ? 413  ASP A C     1 
ATOM   3486 O  O     . ASP C 3 407 ? 69.563 34.953  -14.829 1.00 32.14 ? 413  ASP A O     1 
ATOM   3487 C  CB    . ASP C 3 407 ? 71.631 33.882  -13.126 1.00 30.95 ? 413  ASP A CB    1 
ATOM   3488 C  CG    . ASP C 3 407 ? 70.902 33.739  -11.798 1.00 31.11 ? 413  ASP A CG    1 
ATOM   3489 O  OD1   . ASP C 3 407 ? 70.182 34.676  -11.404 1.00 30.45 ? 413  ASP A OD1   1 
ATOM   3490 O  OD2   . ASP C 3 407 ? 71.054 32.682  -11.152 1.00 33.11 ? 413  ASP A OD2   1 
ATOM   3491 N  N     . GLY C 3 408 ? 69.708 36.827  -13.597 1.00 28.30 ? 414  GLY A N     1 
ATOM   3492 C  CA    . GLY C 3 408 ? 68.366 37.260  -13.959 1.00 27.25 ? 414  GLY A CA    1 
ATOM   3493 C  C     . GLY C 3 408 ? 67.240 36.492  -13.276 1.00 26.65 ? 414  GLY A C     1 
ATOM   3494 O  O     . GLY C 3 408 ? 66.098 36.494  -13.740 1.00 25.34 ? 414  GLY A O     1 
ATOM   3495 N  N     . LYS C 3 409 ? 67.551 35.839  -12.164 1.00 24.35 ? 415  LYS A N     1 
ATOM   3496 C  CA    . LYS C 3 409 ? 66.536 35.072  -11.462 1.00 24.49 ? 415  LYS A CA    1 
ATOM   3497 C  C     . LYS C 3 409 ? 66.517 35.387  -9.974  1.00 22.32 ? 415  LYS A C     1 
ATOM   3498 O  O     . LYS C 3 409 ? 67.486 35.911  -9.426  1.00 21.43 ? 415  LYS A O     1 
ATOM   3499 C  CB    . LYS C 3 409 ? 66.790 33.573  -11.665 1.00 25.08 ? 415  LYS A CB    1 
ATOM   3500 C  CG    . LYS C 3 409 ? 66.876 33.158  -13.130 1.00 27.65 ? 415  LYS A CG    1 
ATOM   3501 C  CD    . LYS C 3 409 ? 67.428 31.749  -13.290 1.00 28.91 ? 415  LYS A CD    1 
ATOM   3502 C  CE    . LYS C 3 409 ? 67.413 31.313  -14.760 1.00 31.29 ? 415  LYS A CE    1 
ATOM   3503 N  NZ    . LYS C 3 409 ? 68.161 32.244  -15.665 1.00 32.05 ? 415  LYS A NZ    1 
ATOM   3504 N  N     . ILE C 3 410 ? 65.392 35.080  -9.339  1.00 21.35 ? 416  ILE A N     1 
ATOM   3505 C  CA    . ILE C 3 410 ? 65.233 35.263  -7.904  1.00 20.42 ? 416  ILE A CA    1 
ATOM   3506 C  C     . ILE C 3 410 ? 65.315 33.858  -7.319  1.00 19.87 ? 416  ILE A C     1 
ATOM   3507 O  O     . ILE C 3 410 ? 64.529 32.979  -7.678  1.00 19.10 ? 416  ILE A O     1 
ATOM   3508 C  CB    . ILE C 3 410 ? 63.860 35.872  -7.525  1.00 21.34 ? 416  ILE A CB    1 
ATOM   3509 C  CG1   . ILE C 3 410 ? 63.794 37.350  -7.947  1.00 19.25 ? 416  ILE A CG1   1 
ATOM   3510 C  CG2   . ILE C 3 410 ? 63.631 35.740  -6.010  1.00 18.90 ? 416  ILE A CG2   1 
ATOM   3511 N  N     . HIS C 3 411 ? 66.280 33.654  -6.431  1.00 20.03 ? 417  HIS A N     1 
ATOM   3512 C  CA    . HIS C 3 411 ? 66.486 32.366  -5.789  1.00 20.48 ? 417  HIS A CA    1 
ATOM   3513 C  C     . HIS C 3 411 ? 65.919 32.370  -4.371  1.00 21.42 ? 417  HIS A C     1 
ATOM   3514 O  O     . HIS C 3 411 ? 66.667 32.439  -3.397  1.00 21.93 ? 417  HIS A O     1 
ATOM   3515 C  CB    . HIS C 3 411 ? 67.977 32.058  -5.748  1.00 20.37 ? 417  HIS A CB    1 
ATOM   3516 C  CG    . HIS C 3 411 ? 68.630 32.102  -7.091  1.00 21.64 ? 417  HIS A CG    1 
ATOM   3517 N  ND1   . HIS C 3 411 ? 68.955 30.965  -7.800  1.00 21.77 ? 417  HIS A ND1   1 
ATOM   3518 C  CD2   . HIS C 3 411 ? 68.991 33.149  -7.870  1.00 22.22 ? 417  HIS A CD2   1 
ATOM   3519 C  CE1   . HIS C 3 411 ? 69.486 31.309  -8.959  1.00 20.66 ? 417  HIS A CE1   1 
ATOM   3520 N  NE2   . HIS C 3 411 ? 69.519 32.629  -9.026  1.00 24.18 ? 417  HIS A NE2   1 
ATOM   3521 N  N     . GLY C 3 412 ? 64.595 32.303  -4.269  1.00 20.75 ? 418  GLY A N     1 
ATOM   3522 C  CA    . GLY C 3 412 ? 63.947 32.295  -2.972  1.00 21.49 ? 418  GLY A CA    1 
ATOM   3523 C  C     . GLY C 3 412 ? 64.254 31.029  -2.198  1.00 23.09 ? 418  GLY A C     1 
ATOM   3524 O  O     . GLY C 3 412 ? 64.383 29.947  -2.772  1.00 22.96 ? 418  GLY A O     1 
ATOM   3525 N  N     . SER C 3 413 ? 64.376 31.163  -0.886  1.00 22.68 ? 419  SER A N     1 
ATOM   3526 C  CA    . SER C 3 413 ? 64.684 30.020  -0.039  1.00 22.33 ? 419  SER A CA    1 
ATOM   3527 C  C     . SER C 3 413 ? 63.411 29.275  0.357   1.00 21.93 ? 419  SER A C     1 
ATOM   3528 O  O     . SER C 3 413 ? 62.334 29.858  0.405   1.00 21.77 ? 419  SER A O     1 
ATOM   3529 C  CB    . SER C 3 413 ? 65.430 30.498  1.208   1.00 22.25 ? 419  SER A CB    1 
ATOM   3530 O  OG    . SER C 3 413 ? 65.600 29.441  2.129   1.00 24.09 ? 419  SER A OG    1 
ATOM   3531 N  N     . VAL C 3 414 ? 63.545 27.980  0.627   1.00 21.30 ? 420  VAL A N     1 
ATOM   3532 C  CA    . VAL C 3 414 ? 62.416 27.155  1.024   1.00 20.52 ? 420  VAL A CA    1 
ATOM   3533 C  C     . VAL C 3 414 ? 62.794 26.232  2.178   1.00 20.81 ? 420  VAL A C     1 
ATOM   3534 O  O     . VAL C 3 414 ? 63.808 25.546  2.125   1.00 21.70 ? 420  VAL A O     1 
ATOM   3535 C  CB    . VAL C 3 414 ? 61.906 26.257  -0.155  1.00 21.22 ? 420  VAL A CB    1 
ATOM   3536 C  CG1   . VAL C 3 414 ? 60.802 25.331  0.336   1.00 19.38 ? 420  VAL A CG1   1 
ATOM   3537 C  CG2   . VAL C 3 414 ? 61.381 27.120  -1.305  1.00 18.11 ? 420  VAL A CG2   1 
ATOM   3538 N  N     . ASN C 3 415 ? 61.991 26.246  3.232   1.00 21.78 ? 421  ASN A N     1 
ATOM   3539 C  CA    . ASN C 3 415 ? 62.203 25.355  4.368   1.00 22.00 ? 421  ASN A CA    1 
ATOM   3540 C  C     . ASN C 3 415 ? 61.175 24.276  4.028   1.00 21.20 ? 421  ASN A C     1 
ATOM   3541 O  O     . ASN C 3 415 ? 59.991 24.456  4.279   1.00 21.25 ? 421  ASN A O     1 
ATOM   3542 C  CB    . ASN C 3 415 ? 61.819 26.044  5.674   1.00 23.65 ? 421  ASN A CB    1 
ATOM   3543 C  CG    . ASN C 3 415 ? 61.963 25.128  6.883   1.00 25.14 ? 421  ASN A CG    1 
ATOM   3544 O  OD1   . ASN C 3 415 ? 61.808 23.910  6.777   1.00 21.87 ? 421  ASN A OD1   1 
ATOM   3545 N  ND2   . ASN C 3 415 ? 62.248 25.719  8.044   1.00 26.01 ? 421  ASN A ND2   1 
ATOM   3546 N  N     . PRO C 3 416 ? 61.619 23.155  3.434   1.00 21.55 ? 422  PRO A N     1 
ATOM   3547 C  CA    . PRO C 3 416 ? 60.749 22.041  3.030   1.00 22.10 ? 422  PRO A CA    1 
ATOM   3548 C  C     . PRO C 3 416 ? 59.745 21.546  4.056   1.00 23.96 ? 422  PRO A C     1 
ATOM   3549 O  O     . PRO C 3 416 ? 58.699 20.994  3.693   1.00 25.65 ? 422  PRO A O     1 
ATOM   3550 C  CB    . PRO C 3 416 ? 61.741 20.953  2.629   1.00 22.55 ? 422  PRO A CB    1 
ATOM   3551 C  CG    . PRO C 3 416 ? 62.940 21.727  2.189   1.00 23.42 ? 422  PRO A CG    1 
ATOM   3552 C  CD    . PRO C 3 416 ? 63.034 22.790  3.251   1.00 20.91 ? 422  PRO A CD    1 
ATOM   3553 N  N     . ASN C 3 417 ? 60.050 21.752  5.332   1.00 24.06 ? 423  ASN A N     1 
ATOM   3554 C  CA    . ASN C 3 417 ? 59.169 21.288  6.392   1.00 24.07 ? 423  ASN A CA    1 
ATOM   3555 C  C     . ASN C 3 417 ? 59.025 22.347  7.479   1.00 24.40 ? 423  ASN A C     1 
ATOM   3556 O  O     . ASN C 3 417 ? 58.991 22.021  8.665   1.00 23.95 ? 423  ASN A O     1 
ATOM   3557 C  CB    . ASN C 3 417 ? 59.734 19.991  6.992   1.00 23.49 ? 423  ASN A CB    1 
ATOM   3558 C  CG    . ASN C 3 417 ? 58.665 19.125  7.612   1.00 23.39 ? 423  ASN A CG    1 
ATOM   3559 O  OD1   . ASN C 3 417 ? 57.724 18.721  6.940   1.00 21.99 ? 423  ASN A OD1   1 
ATOM   3560 N  ND2   . ASN C 3 417 ? 58.796 18.843  8.904   1.00 25.41 ? 423  ASN A ND2   1 
ATOM   3561 N  N     . GLY C 3 418 ? 58.932 23.609  7.063   1.00 23.25 ? 424  GLY A N     1 
ATOM   3562 C  CA    . GLY C 3 418 ? 58.808 24.704  8.008   1.00 24.12 ? 424  GLY A CA    1 
ATOM   3563 C  C     . GLY C 3 418 ? 57.509 24.802  8.795   1.00 24.65 ? 424  GLY A C     1 
ATOM   3564 O  O     . GLY C 3 418 ? 57.487 25.389  9.873   1.00 26.07 ? 424  GLY A O     1 
ATOM   3565 N  N     . ALA C 3 419 ? 56.420 24.254  8.269   1.00 24.54 ? 425  ALA A N     1 
ATOM   3566 C  CA    . ALA C 3 419 ? 55.148 24.310  8.985   1.00 23.37 ? 425  ALA A CA    1 
ATOM   3567 C  C     . ALA C 3 419 ? 54.934 23.019  9.757   1.00 22.99 ? 425  ALA A C     1 
ATOM   3568 O  O     . ALA C 3 419 ? 55.324 21.943  9.302   1.00 22.59 ? 425  ALA A O     1 
ATOM   3569 C  CB    . ALA C 3 419 ? 53.986 24.532  8.005   1.00 21.37 ? 425  ALA A CB    1 
ATOM   3570 N  N     . VAL C 3 420 ? 54.302 23.134  10.920  1.00 24.67 ? 426  VAL A N     1 
ATOM   3571 C  CA    . VAL C 3 420 ? 54.017 21.986  11.770  1.00 26.62 ? 426  VAL A CA    1 
ATOM   3572 C  C     . VAL C 3 420 ? 53.280 20.856  11.052  1.00 26.31 ? 426  VAL A C     1 
ATOM   3573 O  O     . VAL C 3 420 ? 53.546 19.684  11.298  1.00 29.21 ? 426  VAL A O     1 
ATOM   3574 C  CB    . VAL C 3 420 ? 53.178 22.405  13.001  1.00 29.66 ? 426  VAL A CB    1 
ATOM   3575 C  CG1   . VAL C 3 420 ? 53.975 23.356  13.869  1.00 31.62 ? 426  VAL A CG1   1 
ATOM   3576 C  CG2   . VAL C 3 420 ? 51.880 23.072  12.552  1.00 28.93 ? 426  VAL A CG2   1 
ATOM   3577 N  N     . THR C 3 421 ? 52.359 21.217  10.165  1.00 26.29 ? 427  THR A N     1 
ATOM   3578 C  CA    . THR C 3 421 ? 51.557 20.253  9.410   1.00 26.45 ? 427  THR A CA    1 
ATOM   3579 C  C     . THR C 3 421 ? 52.336 19.459  8.356   1.00 27.74 ? 427  THR A C     1 
ATOM   3580 O  O     . THR C 3 421 ? 51.839 18.462  7.824   1.00 27.20 ? 427  THR A O     1 
ATOM   3581 C  CB    . THR C 3 421 ? 50.421 20.972  8.683   1.00 26.80 ? 427  THR A CB    1 
ATOM   3582 O  OG1   . THR C 3 421 ? 50.962 22.120  8.018   1.00 25.14 ? 427  THR A OG1   1 
ATOM   3583 C  CG2   . THR C 3 421 ? 49.338 21.419  9.664   1.00 26.64 ? 427  THR A CG2   1 
ATOM   3584 N  N     . GLY C 3 422 ? 53.544 19.914  8.039   1.00 26.72 ? 428  GLY A N     1 
ATOM   3585 C  CA    . GLY C 3 422 ? 54.333 19.226  7.043   1.00 25.19 ? 428  GLY A CA    1 
ATOM   3586 C  C     . GLY C 3 422 ? 54.478 20.082  5.810   1.00 24.55 ? 428  GLY A C     1 
ATOM   3587 O  O     . GLY C 3 422 ? 55.213 19.736  4.889   1.00 25.48 ? 428  GLY A O     1 
ATOM   3588 N  N     . ARG C 3 423 ? 53.753 21.193  5.779   1.00 23.89 ? 429  ARG A N     1 
ATOM   3589 C  CA    . ARG C 3 423 ? 53.845 22.111  4.660   1.00 24.39 ? 429  ARG A CA    1 
ATOM   3590 C  C     . ARG C 3 423 ? 55.206 22.772  4.735   1.00 24.30 ? 429  ARG A C     1 
ATOM   3591 O  O     . ARG C 3 423 ? 55.835 22.791  5.786   1.00 23.77 ? 429  ARG A O     1 
ATOM   3592 C  CB    . ARG C 3 423 ? 52.780 23.203  4.755   1.00 26.37 ? 429  ARG A CB    1 
ATOM   3593 C  CG    . ARG C 3 423 ? 51.496 22.935  4.001   1.00 28.23 ? 429  ARG A CG    1 
ATOM   3594 C  CD    . ARG C 3 423 ? 50.562 24.127  4.163   1.00 30.19 ? 429  ARG A CD    1 
ATOM   3595 N  NE    . ARG C 3 423 ? 49.396 24.053  3.288   1.00 32.31 ? 429  ARG A NE    1 
ATOM   3596 C  CZ    . ARG C 3 423 ? 48.621 25.097  3.000   1.00 33.77 ? 429  ARG A CZ    1 
ATOM   3597 N  NH1   . ARG C 3 423 ? 48.890 26.295  3.517   1.00 34.21 ? 429  ARG A NH1   1 
ATOM   3598 N  NH2   . ARG C 3 423 ? 47.580 24.947  2.193   1.00 33.37 ? 429  ARG A NH2   1 
ATOM   3599 N  N     . ALA C 3 424 ? 55.656 23.324  3.619   1.00 25.01 ? 430  ALA A N     1 
ATOM   3600 C  CA    . ALA C 3 424 ? 56.935 24.010  3.586   1.00 24.74 ? 430  ALA A CA    1 
ATOM   3601 C  C     . ALA C 3 424 ? 56.695 25.508  3.782   1.00 25.22 ? 430  ALA A C     1 
ATOM   3602 O  O     . ALA C 3 424 ? 55.557 25.978  3.689   1.00 24.68 ? 430  ALA A O     1 
ATOM   3603 C  CB    . ALA C 3 424 ? 57.612 23.766  2.255   1.00 26.68 ? 430  ALA A CB    1 
ATOM   3604 N  N     . THR C 3 425 ? 57.765 26.244  4.079   1.00 24.33 ? 431  THR A N     1 
ATOM   3605 C  CA    . THR C 3 425 ? 57.690 27.689  4.245   1.00 23.42 ? 431  THR A CA    1 
ATOM   3606 C  C     . THR C 3 425 ? 58.630 28.308  3.217   1.00 23.04 ? 431  THR A C     1 
ATOM   3607 O  O     . THR C 3 425 ? 59.584 27.665  2.766   1.00 23.31 ? 431  THR A O     1 
ATOM   3608 C  CB    . THR C 3 425 ? 58.086 28.140  5.671   1.00 26.22 ? 431  THR A CB    1 
ATOM   3609 O  OG1   . THR C 3 425 ? 59.391 27.643  6.008   1.00 25.72 ? 431  THR A OG1   1 
ATOM   3610 C  CG2   . THR C 3 425 ? 57.059 27.630  6.688   1.00 26.49 ? 431  THR A CG2   1 
ATOM   3611 N  N     . HIS C 3 426 ? 58.350 29.548  2.838   1.00 22.24 ? 432  HIS A N     1 
ATOM   3612 C  CA    . HIS C 3 426 ? 59.134 30.236  1.832   1.00 22.55 ? 432  HIS A CA    1 
ATOM   3613 C  C     . HIS C 3 426 ? 59.522 31.635  2.295   1.00 24.14 ? 432  HIS A C     1 
ATOM   3614 O  O     . HIS C 3 426 ? 58.699 32.352  2.866   1.00 22.65 ? 432  HIS A O     1 
ATOM   3615 C  CB    . HIS C 3 426 ? 58.316 30.340  0.544   1.00 22.55 ? 432  HIS A CB    1 
ATOM   3616 C  CG    . HIS C 3 426 ? 57.636 29.066  0.162   1.00 22.41 ? 432  HIS A CG    1 
ATOM   3617 N  ND1   . HIS C 3 426 ? 56.556 28.561  0.856   1.00 21.80 ? 432  HIS A ND1   1 
ATOM   3618 C  CD2   . HIS C 3 426 ? 57.900 28.177  -0.824  1.00 21.88 ? 432  HIS A CD2   1 
ATOM   3619 C  CE1   . HIS C 3 426 ? 56.184 27.417  0.313   1.00 21.57 ? 432  HIS A CE1   1 
ATOM   3620 N  NE2   . HIS C 3 426 ? 56.984 27.160  -0.708  1.00 23.68 ? 432  HIS A NE2   1 
ATOM   3621 N  N     . ALA C 3 427 ? 60.770 32.019  2.030   1.00 23.61 ? 433  ALA A N     1 
ATOM   3622 C  CA    . ALA C 3 427 ? 61.268 33.338  2.423   1.00 23.01 ? 433  ALA A CA    1 
ATOM   3623 C  C     . ALA C 3 427 ? 62.494 33.768  1.618   1.00 22.76 ? 433  ALA A C     1 
ATOM   3624 O  O     . ALA C 3 427 ? 63.096 32.968  0.902   1.00 21.23 ? 433  ALA A O     1 
ATOM   3625 C  CB    . ALA C 3 427 ? 61.604 33.343  3.913   1.00 22.38 ? 433  ALA A CB    1 
ATOM   3626 N  N     . PHE C 3 428 ? 62.837 35.050  1.748   1.00 23.39 ? 434  PHE A N     1 
ATOM   3627 C  CA    . PHE C 3 428 ? 63.995 35.662  1.098   1.00 23.61 ? 434  PHE A CA    1 
ATOM   3628 C  C     . PHE C 3 428 ? 64.061 35.659  -0.421  1.00 22.63 ? 434  PHE A C     1 
ATOM   3629 O  O     . PHE C 3 428 ? 65.030 35.171  -1.000  1.00 24.19 ? 434  PHE A O     1 
ATOM   3630 C  CB    . PHE C 3 428 ? 65.294 35.048  1.642   1.00 26.20 ? 434  PHE A CB    1 
ATOM   3631 C  CG    . PHE C 3 428 ? 65.278 34.813  3.127   1.00 28.70 ? 434  PHE A CG    1 
ATOM   3632 C  CD1   . PHE C 3 428 ? 64.803 35.792  3.995   1.00 29.42 ? 434  PHE A CD1   1 
ATOM   3633 C  CD2   . PHE C 3 428 ? 65.745 33.615  3.658   1.00 28.92 ? 434  PHE A CD2   1 
ATOM   3634 C  CE1   . PHE C 3 428 ? 64.793 35.583  5.374   1.00 30.93 ? 434  PHE A CE1   1 
ATOM   3635 C  CE2   . PHE C 3 428 ? 65.742 33.392  5.034   1.00 29.81 ? 434  PHE A CE2   1 
ATOM   3636 C  CZ    . PHE C 3 428 ? 65.264 34.379  5.896   1.00 31.05 ? 434  PHE A CZ    1 
ATOM   3637 N  N     . PRO C 3 429 ? 63.007 36.135  -1.095  1.00 21.90 ? 435  PRO A N     1 
ATOM   3638 C  CA    . PRO C 3 429 ? 61.768 36.651  -0.517  1.00 21.67 ? 435  PRO A CA    1 
ATOM   3639 C  C     . PRO C 3 429 ? 60.780 35.484  -0.523  1.00 21.38 ? 435  PRO A C     1 
ATOM   3640 O  O     . PRO C 3 429 ? 61.104 34.410  -1.027  1.00 20.77 ? 435  PRO A O     1 
ATOM   3641 C  CB    . PRO C 3 429 ? 61.367 37.755  -1.493  1.00 21.97 ? 435  PRO A CB    1 
ATOM   3642 C  CG    . PRO C 3 429 ? 61.813 37.190  -2.809  1.00 22.78 ? 435  PRO A CG    1 
ATOM   3643 C  CD    . PRO C 3 429 ? 63.177 36.616  -2.478  1.00 20.81 ? 435  PRO A CD    1 
ATOM   3644 N  N     . ASN C 3 430 ? 59.592 35.691  0.038   1.00 20.97 ? 436  ASN A N     1 
ATOM   3645 C  CA    . ASN C 3 430 ? 58.574 34.649  0.070   1.00 21.91 ? 436  ASN A CA    1 
ATOM   3646 C  C     . ASN C 3 430 ? 57.836 34.574  -1.276  1.00 23.56 ? 436  ASN A C     1 
ATOM   3647 O  O     . ASN C 3 430 ? 56.956 35.397  -1.564  1.00 25.43 ? 436  ASN A O     1 
ATOM   3648 C  CB    . ASN C 3 430 ? 57.565 34.929  1.192   1.00 21.32 ? 436  ASN A CB    1 
ATOM   3649 C  CG    . ASN C 3 430 ? 56.483 33.863  1.272   1.00 22.04 ? 436  ASN A CG    1 
ATOM   3650 O  OD1   . ASN C 3 430 ? 56.412 32.980  0.419   1.00 19.24 ? 436  ASN A OD1   1 
ATOM   3651 N  ND2   . ASN C 3 430 ? 55.637 33.939  2.296   1.00 20.75 ? 436  ASN A ND2   1 
ATOM   3652 N  N     . LEU C 3 431 ? 58.181 33.577  -2.087  1.00 23.04 ? 437  LEU A N     1 
ATOM   3653 C  CA    . LEU C 3 431 ? 57.561 33.403  -3.399  1.00 24.21 ? 437  LEU A CA    1 
ATOM   3654 C  C     . LEU C 3 431 ? 56.189 32.746  -3.348  1.00 25.22 ? 437  LEU A C     1 
ATOM   3655 O  O     . LEU C 3 431 ? 55.578 32.486  -4.389  1.00 25.85 ? 437  LEU A O     1 
ATOM   3656 C  CB    . LEU C 3 431 ? 58.486 32.598  -4.321  1.00 23.23 ? 437  LEU A CB    1 
ATOM   3657 C  CG    . LEU C 3 431 ? 59.855 33.248  -4.552  1.00 24.71 ? 437  LEU A CG    1 
ATOM   3658 C  CD1   . LEU C 3 431 ? 60.623 32.467  -5.605  1.00 26.99 ? 437  LEU A CD1   1 
ATOM   3659 C  CD2   . LEU C 3 431 ? 59.670 34.699  -4.993  1.00 24.52 ? 437  LEU A CD2   1 
ATOM   3660 N  N     . ALA C 3 432 ? 55.712 32.472  -2.138  1.00 25.96 ? 438  ALA A N     1 
ATOM   3661 C  CA    . ALA C 3 432 ? 54.400 31.870  -1.941  1.00 24.41 ? 438  ALA A CA    1 
ATOM   3662 C  C     . ALA C 3 432 ? 53.398 32.943  -1.527  1.00 25.46 ? 438  ALA A C     1 
ATOM   3663 O  O     . ALA C 3 432 ? 52.298 32.620  -1.077  1.00 27.24 ? 438  ALA A O     1 
ATOM   3664 C  CB    . ALA C 3 432 ? 54.467 30.787  -0.873  1.00 25.32 ? 438  ALA A CB    1 
ATOM   3665 N  N     . GLN C 3 433 ? 53.783 34.212  -1.659  1.00 23.47 ? 439  GLN A N     1 
ATOM   3666 C  CA    . GLN C 3 433 ? 52.886 35.315  -1.309  1.00 24.10 ? 439  GLN A CA    1 
ATOM   3667 C  C     . GLN C 3 433 ? 52.866 36.430  -2.368  1.00 23.77 ? 439  GLN A C     1 
ATOM   3668 O  O     . GLN C 3 433 ? 52.567 37.584  -2.058  1.00 24.78 ? 439  GLN A O     1 
ATOM   3669 C  CB    . GLN C 3 433 ? 53.237 35.909  0.072   1.00 21.85 ? 439  GLN A CB    1 
ATOM   3670 C  CG    . GLN C 3 433 ? 54.531 36.720  0.134   1.00 21.56 ? 439  GLN A CG    1 
ATOM   3671 C  CD    . GLN C 3 433 ? 54.827 37.274  1.530   1.00 21.89 ? 439  GLN A CD    1 
ATOM   3672 O  OE1   . GLN C 3 433 ? 55.928 37.752  1.795   1.00 22.51 ? 439  GLN A OE1   1 
ATOM   3673 N  NE2   . GLN C 3 433 ? 53.840 37.219  2.422   1.00 22.35 ? 439  GLN A NE2   1 
ATOM   3674 N  N     . ILE C 3 434 ? 53.182 36.085  -3.613  1.00 22.59 ? 440  ILE A N     1 
ATOM   3675 C  CA    . ILE C 3 434 ? 53.160 37.067  -4.697  1.00 22.13 ? 440  ILE A CA    1 
ATOM   3676 C  C     . ILE C 3 434 ? 51.690 37.394  -4.964  1.00 22.39 ? 440  ILE A C     1 
ATOM   3677 O  O     . ILE C 3 434 ? 50.846 36.498  -5.002  1.00 20.99 ? 440  ILE A O     1 
ATOM   3678 C  CB    . ILE C 3 434 ? 53.799 36.516  -6.003  1.00 21.97 ? 440  ILE A CB    1 
ATOM   3679 C  CG1   . ILE C 3 434 ? 55.316 36.350  -5.818  1.00 22.31 ? 440  ILE A CG1   1 
ATOM   3680 C  CG2   . ILE C 3 434 ? 53.514 37.464  -7.165  1.00 17.98 ? 440  ILE A CG2   1 
ATOM   3681 N  N     . PRO C 3 435 ? 51.368 38.685  -5.148  1.00 21.80 ? 441  PRO A N     1 
ATOM   3682 C  CA    . PRO C 3 435 ? 49.979 39.084  -5.403  1.00 22.92 ? 441  PRO A CA    1 
ATOM   3683 C  C     . PRO C 3 435 ? 49.299 38.272  -6.512  1.00 23.84 ? 441  PRO A C     1 
ATOM   3684 O  O     . PRO C 3 435 ? 49.869 38.060  -7.577  1.00 25.35 ? 441  PRO A O     1 
ATOM   3685 C  CB    . PRO C 3 435 ? 50.106 40.570  -5.749  1.00 22.41 ? 441  PRO A CB    1 
ATOM   3686 C  CG    . PRO C 3 435 ? 51.287 41.008  -4.913  1.00 23.23 ? 441  PRO A CG    1 
ATOM   3687 C  CD    . PRO C 3 435 ? 52.266 39.856  -5.113  1.00 21.38 ? 441  PRO A CD    1 
ATOM   3688 N  N     . GLY C 3 436 ? 48.075 37.831  -6.252  1.00 23.77 ? 442  GLY A N     1 
ATOM   3689 C  CA    . GLY C 3 436 ? 47.343 37.048  -7.236  1.00 26.08 ? 442  GLY A CA    1 
ATOM   3690 C  C     . GLY C 3 436 ? 46.897 37.876  -8.431  1.00 27.03 ? 442  GLY A C     1 
ATOM   3691 O  O     . GLY C 3 436 ? 46.779 39.101  -8.336  1.00 25.02 ? 442  GLY A O     1 
ATOM   3692 N  N     . VAL C 3 437 ? 46.638 37.218  -9.556  1.00 28.16 ? 443  VAL A N     1 
ATOM   3693 C  CA    . VAL C 3 437 ? 46.217 37.940  -10.753 1.00 32.38 ? 443  VAL A CA    1 
ATOM   3694 C  C     . VAL C 3 437 ? 44.921 38.713  -10.576 1.00 32.83 ? 443  VAL A C     1 
ATOM   3695 O  O     . VAL C 3 437 ? 44.714 39.732  -11.229 1.00 34.13 ? 443  VAL A O     1 
ATOM   3696 C  CB    . VAL C 3 437 ? 46.044 37.002  -11.961 1.00 33.25 ? 443  VAL A CB    1 
ATOM   3697 C  CG1   . VAL C 3 437 ? 47.399 36.578  -12.481 1.00 31.96 ? 443  VAL A CG1   1 
ATOM   3698 C  CG2   . VAL C 3 437 ? 45.205 35.789  -11.566 1.00 33.81 ? 443  VAL A CG2   1 
ATOM   3699 N  N     . ARG C 3 438 ? 44.049 38.239  -9.693  1.00 35.31 ? 444  ARG A N     1 
ATOM   3700 C  CA    . ARG C 3 438 ? 42.774 38.909  -9.470  1.00 37.15 ? 444  ARG A CA    1 
ATOM   3701 C  C     . ARG C 3 438 ? 42.857 40.149  -8.585  1.00 37.93 ? 444  ARG A C     1 
ATOM   3702 O  O     . ARG C 3 438 ? 41.896 40.914  -8.513  1.00 39.15 ? 444  ARG A O     1 
ATOM   3703 C  CB    . ARG C 3 438 ? 41.747 37.929  -8.894  1.00 38.42 ? 444  ARG A CB    1 
ATOM   3704 C  CG    . ARG C 3 438 ? 41.283 36.866  -9.885  1.00 39.40 ? 444  ARG A CG    1 
ATOM   3705 N  N     . SER C 3 439 ? 43.992 40.355  -7.918  1.00 36.61 ? 445  SER A N     1 
ATOM   3706 C  CA    . SER C 3 439 ? 44.154 41.531  -7.071  1.00 36.02 ? 445  SER A CA    1 
ATOM   3707 C  C     . SER C 3 439 ? 44.845 42.643  -7.871  1.00 37.21 ? 445  SER A C     1 
ATOM   3708 O  O     . SER C 3 439 ? 45.484 42.378  -8.890  1.00 37.65 ? 445  SER A O     1 
ATOM   3709 C  CB    . SER C 3 439 ? 44.979 41.188  -5.829  1.00 36.14 ? 445  SER A CB    1 
ATOM   3710 O  OG    . SER C 3 439 ? 46.362 41.132  -6.121  1.00 35.89 ? 445  SER A OG    1 
ATOM   3711 N  N     . PRO C 3 440 ? 44.714 43.906  -7.425  1.00 36.88 ? 446  PRO A N     1 
ATOM   3712 C  CA    . PRO C 3 440 ? 45.313 45.075  -8.081  1.00 36.45 ? 446  PRO A CA    1 
ATOM   3713 C  C     . PRO C 3 440 ? 46.805 44.943  -8.376  1.00 36.66 ? 446  PRO A C     1 
ATOM   3714 O  O     . PRO C 3 440 ? 47.610 44.733  -7.466  1.00 36.45 ? 446  PRO A O     1 
ATOM   3715 C  CB    . PRO C 3 440 ? 45.028 46.206  -7.094  1.00 35.55 ? 446  PRO A CB    1 
ATOM   3716 C  CG    . PRO C 3 440 ? 43.716 45.807  -6.524  1.00 36.30 ? 446  PRO A CG    1 
ATOM   3717 C  CD    . PRO C 3 440 ? 43.900 44.323  -6.269  1.00 36.78 ? 446  PRO A CD    1 
ATOM   3718 N  N     . TYR C 3 441 ? 47.158 45.082  -9.654  1.00 36.94 ? 447  TYR A N     1 
ATOM   3719 C  CA    . TYR C 3 441 ? 48.545 44.988  -10.116 1.00 35.98 ? 447  TYR A CA    1 
ATOM   3720 C  C     . TYR C 3 441 ? 49.091 43.560  -10.097 1.00 35.37 ? 447  TYR A C     1 
ATOM   3721 O  O     . TYR C 3 441 ? 50.256 43.327  -10.422 1.00 34.57 ? 447  TYR A O     1 
ATOM   3722 C  CB    . TYR C 3 441 ? 49.444 45.896  -9.273  1.00 36.80 ? 447  TYR A CB    1 
ATOM   3723 C  CG    . TYR C 3 441 ? 49.149 47.372  -9.433  1.00 37.43 ? 447  TYR A CG    1 
ATOM   3724 C  CD1   . TYR C 3 441 ? 49.458 48.042  -10.619 1.00 37.25 ? 447  TYR A CD1   1 
ATOM   3725 C  CD2   . TYR C 3 441 ? 48.551 48.096  -8.404  1.00 37.78 ? 447  TYR A CD2   1 
ATOM   3726 C  CE1   . TYR C 3 441 ? 49.180 49.395  -10.776 1.00 36.00 ? 447  TYR A CE1   1 
ATOM   3727 C  CE2   . TYR C 3 441 ? 48.266 49.452  -8.551  1.00 37.90 ? 447  TYR A CE2   1 
ATOM   3728 C  CZ    . TYR C 3 441 ? 48.583 50.092  -9.739  1.00 37.44 ? 447  TYR A CZ    1 
ATOM   3729 O  OH    . TYR C 3 441 ? 48.290 51.424  -9.888  1.00 38.07 ? 447  TYR A OH    1 
ATOM   3730 N  N     . GLY C 3 442 ? 48.245 42.608  -9.724  1.00 35.34 ? 448  GLY A N     1 
ATOM   3731 C  CA    . GLY C 3 442 ? 48.672 41.221  -9.672  1.00 36.30 ? 448  GLY A CA    1 
ATOM   3732 C  C     . GLY C 3 442 ? 49.130 40.672  -11.012 1.00 36.67 ? 448  GLY A C     1 
ATOM   3733 O  O     . GLY C 3 442 ? 50.063 39.875  -11.077 1.00 36.33 ? 448  GLY A O     1 
ATOM   3734 N  N     . GLU C 3 443 ? 48.479 41.100  -12.088 1.00 37.13 ? 449  GLU A N     1 
ATOM   3735 C  CA    . GLU C 3 443 ? 48.841 40.627  -13.416 1.00 36.90 ? 449  GLU A CA    1 
ATOM   3736 C  C     . GLU C 3 443 ? 50.254 41.030  -13.801 1.00 35.09 ? 449  GLU A C     1 
ATOM   3737 O  O     . GLU C 3 443 ? 50.969 40.260  -14.433 1.00 34.91 ? 449  GLU A O     1 
ATOM   3738 C  CB    . GLU C 3 443 ? 47.850 41.138  -14.459 1.00 38.39 ? 449  GLU A CB    1 
ATOM   3739 C  CG    . GLU C 3 443 ? 46.505 40.449  -14.372 1.00 43.83 ? 449  GLU A CG    1 
ATOM   3740 C  CD    . GLU C 3 443 ? 45.882 40.215  -15.737 1.00 47.68 ? 449  GLU A CD    1 
ATOM   3741 O  OE1   . GLU C 3 443 ? 45.569 41.209  -16.434 1.00 48.07 ? 449  GLU A OE1   1 
ATOM   3742 O  OE2   . GLU C 3 443 ? 45.716 39.030  -16.110 1.00 48.68 ? 449  GLU A OE2   1 
ATOM   3743 N  N     . GLN C 3 444 ? 50.656 42.235  -13.420 1.00 33.17 ? 450  GLN A N     1 
ATOM   3744 C  CA    . GLN C 3 444 ? 52.001 42.697  -13.721 1.00 33.26 ? 450  GLN A CA    1 
ATOM   3745 C  C     . GLN C 3 444 ? 53.004 41.985  -12.815 1.00 30.84 ? 450  GLN A C     1 
ATOM   3746 O  O     . GLN C 3 444 ? 54.060 41.553  -13.268 1.00 29.73 ? 450  GLN A O     1 
ATOM   3747 C  CB    . GLN C 3 444 ? 52.091 44.220  -13.548 1.00 33.53 ? 450  GLN A CB    1 
ATOM   3748 C  CG    . GLN C 3 444 ? 51.419 45.001  -14.676 1.00 35.89 ? 450  GLN A CG    1 
ATOM   3749 C  CD    . GLN C 3 444 ? 51.340 46.496  -14.399 1.00 38.18 ? 450  GLN A CD    1 
ATOM   3750 O  OE1   . GLN C 3 444 ? 50.509 46.954  -13.614 1.00 40.12 ? 450  GLN A OE1   1 
ATOM   3751 N  NE2   . GLN C 3 444 ? 52.214 47.259  -15.034 1.00 37.94 ? 450  GLN A NE2   1 
ATOM   3752 N  N     . CYS C 3 445 ? 52.666 41.858  -11.536 1.00 30.48 ? 451  CYS A N     1 
ATOM   3753 C  CA    . CYS C 3 445 ? 53.535 41.177  -10.581 1.00 30.45 ? 451  CYS A CA    1 
ATOM   3754 C  C     . CYS C 3 445 ? 53.758 39.735  -11.026 1.00 30.17 ? 451  CYS A C     1 
ATOM   3755 O  O     . CYS C 3 445 ? 54.890 39.287  -11.224 1.00 31.13 ? 451  CYS A O     1 
ATOM   3756 C  CB    . CYS C 3 445 ? 52.891 41.163  -9.196  1.00 30.12 ? 451  CYS A CB    1 
ATOM   3757 S  SG    . CYS C 3 445 ? 52.703 42.793  -8.421  1.00 31.64 ? 451  CYS A SG    1 
ATOM   3758 N  N     . ARG C 3 446 ? 52.649 39.028  -11.189 1.00 29.91 ? 452  ARG A N     1 
ATOM   3759 C  CA    . ARG C 3 446 ? 52.640 37.628  -11.577 1.00 28.79 ? 452  ARG A CA    1 
ATOM   3760 C  C     . ARG C 3 446 ? 53.350 37.386  -12.919 1.00 28.92 ? 452  ARG A C     1 
ATOM   3761 O  O     . ARG C 3 446 ? 54.087 36.411  -13.071 1.00 28.58 ? 452  ARG A O     1 
ATOM   3762 C  CB    . ARG C 3 446 ? 51.187 37.150  -11.641 1.00 28.92 ? 452  ARG A CB    1 
ATOM   3763 C  CG    . ARG C 3 446 ? 50.923 35.786  -11.024 1.00 33.28 ? 452  ARG A CG    1 
ATOM   3764 C  CD    . ARG C 3 446 ? 50.844 35.763  -9.484  1.00 30.71 ? 452  ARG A CD    1 
ATOM   3765 N  NE    . ARG C 3 446 ? 50.727 34.372  -9.068  1.00 35.24 ? 452  ARG A NE    1 
ATOM   3766 C  CZ    . ARG C 3 446 ? 50.382 33.934  -7.861  1.00 33.02 ? 452  ARG A CZ    1 
ATOM   3767 N  NH1   . ARG C 3 446 ? 50.102 34.772  -6.878  1.00 34.06 ? 452  ARG A NH1   1 
ATOM   3768 N  NH2   . ARG C 3 446 ? 50.305 32.630  -7.654  1.00 36.42 ? 452  ARG A NH2   1 
ATOM   3769 N  N     . ALA C 3 447 ? 53.140 38.280  -13.882 1.00 27.53 ? 453  ALA A N     1 
ATOM   3770 C  CA    . ALA C 3 447 ? 53.754 38.146  -15.201 1.00 27.19 ? 453  ALA A CA    1 
ATOM   3771 C  C     . ALA C 3 447 ? 55.276 38.316  -15.180 1.00 27.15 ? 453  ALA A C     1 
ATOM   3772 O  O     . ALA C 3 447 ? 55.976 37.814  -16.064 1.00 27.04 ? 453  ALA A O     1 
ATOM   3773 C  CB    . ALA C 3 447 ? 53.131 39.156  -16.172 1.00 28.00 ? 453  ALA A CB    1 
ATOM   3774 N  N     . ALA C 3 448 ? 55.780 39.019  -14.171 1.00 26.32 ? 454  ALA A N     1 
ATOM   3775 C  CA    . ALA C 3 448 ? 57.213 39.257  -14.034 1.00 25.56 ? 454  ALA A CA    1 
ATOM   3776 C  C     . ALA C 3 448 ? 57.968 37.975  -13.671 1.00 25.00 ? 454  ALA A C     1 
ATOM   3777 O  O     . ALA C 3 448 ? 59.175 37.858  -13.919 1.00 25.60 ? 454  ALA A O     1 
ATOM   3778 C  CB    . ALA C 3 448 ? 57.463 40.339  -12.982 1.00 25.01 ? 454  ALA A CB    1 
ATOM   3779 N  N     . PHE C 3 449 ? 57.262 37.026  -13.065 1.00 24.25 ? 455  PHE A N     1 
ATOM   3780 C  CA    . PHE C 3 449 ? 57.864 35.746  -12.706 1.00 23.92 ? 455  PHE A CA    1 
ATOM   3781 C  C     . PHE C 3 449 ? 57.493 34.747  -13.794 1.00 23.46 ? 455  PHE A C     1 
ATOM   3782 O  O     . PHE C 3 449 ? 56.361 34.252  -13.830 1.00 23.85 ? 455  PHE A O     1 
ATOM   3783 C  CB    . PHE C 3 449 ? 57.345 35.246  -11.350 1.00 23.40 ? 455  PHE A CB    1 
ATOM   3784 C  CG    . PHE C 3 449 ? 57.817 36.063  -10.181 1.00 23.93 ? 455  PHE A CG    1 
ATOM   3785 C  CD1   . PHE C 3 449 ? 57.169 37.244  -9.829  1.00 22.69 ? 455  PHE A CD1   1 
ATOM   3786 C  CD2   . PHE C 3 449 ? 58.946 35.677  -9.458  1.00 23.87 ? 455  PHE A CD2   1 
ATOM   3787 C  CE1   . PHE C 3 449 ? 57.637 38.030  -8.777  1.00 22.33 ? 455  PHE A CE1   1 
ATOM   3788 C  CE2   . PHE C 3 449 ? 59.425 36.458  -8.405  1.00 24.13 ? 455  PHE A CE2   1 
ATOM   3789 C  CZ    . PHE C 3 449 ? 58.769 37.637  -8.064  1.00 22.29 ? 455  PHE A CZ    1 
ATOM   3790 N  N     . GLY C 3 450 ? 58.431 34.453  -14.689 1.00 22.22 ? 456  GLY A N     1 
ATOM   3791 C  CA    . GLY C 3 450 ? 58.110 33.518  -15.752 1.00 22.69 ? 456  GLY A CA    1 
ATOM   3792 C  C     . GLY C 3 450 ? 59.258 32.894  -16.525 1.00 22.40 ? 456  GLY A C     1 
ATOM   3793 O  O     . GLY C 3 450 ? 60.349 33.478  -16.655 1.00 21.82 ? 456  GLY A O     1 
ATOM   3794 N  N     . ALA C 3 451 ? 58.995 31.693  -17.041 1.00 21.26 ? 457  ALA A N     1 
ATOM   3795 C  CA    . ALA C 3 451 ? 59.964 30.932  -17.827 1.00 21.11 ? 457  ALA A CA    1 
ATOM   3796 C  C     . ALA C 3 451 ? 60.389 31.731  -19.053 1.00 21.43 ? 457  ALA A C     1 
ATOM   3797 O  O     . ALA C 3 451 ? 61.537 31.649  -19.489 1.00 20.79 ? 457  ALA A O     1 
ATOM   3798 C  CB    . ALA C 3 451 ? 59.351 29.589  -18.255 1.00 18.56 ? 457  ALA A CB    1 
ATOM   3799 N  N     . GLU C 3 452 ? 59.459 32.510  -19.599 1.00 21.52 ? 458  GLU A N     1 
ATOM   3800 C  CA    . GLU C 3 452 ? 59.741 33.322  -20.775 1.00 25.03 ? 458  GLU A CA    1 
ATOM   3801 C  C     . GLU C 3 452 ? 60.892 34.297  -20.529 1.00 27.16 ? 458  GLU A C     1 
ATOM   3802 O  O     . GLU C 3 452 ? 61.541 34.746  -21.473 1.00 27.23 ? 458  GLU A O     1 
ATOM   3803 C  CB    . GLU C 3 452 ? 58.504 34.128  -21.181 1.00 25.88 ? 458  GLU A CB    1 
ATOM   3804 C  CG    . GLU C 3 452 ? 58.283 35.361  -20.320 1.00 29.04 ? 458  GLU A CG    1 
ATOM   3805 C  CD    . GLU C 3 452 ? 57.126 36.226  -20.796 1.00 31.26 ? 458  GLU A CD    1 
ATOM   3806 O  OE1   . GLU C 3 452 ? 57.124 36.623  -21.981 1.00 33.88 ? 458  GLU A OE1   1 
ATOM   3807 O  OE2   . GLU C 3 452 ? 56.222 36.517  -19.983 1.00 29.96 ? 458  GLU A OE2   1 
ATOM   3808 N  N     . HIS C 3 453 ? 61.137 34.632  -19.266 1.00 26.92 ? 459  HIS A N     1 
ATOM   3809 C  CA    . HIS C 3 453 ? 62.202 35.576  -18.930 1.00 27.14 ? 459  HIS A CA    1 
ATOM   3810 C  C     . HIS C 3 453 ? 63.590 34.939  -18.878 1.00 26.79 ? 459  HIS A C     1 
ATOM   3811 O  O     . HIS C 3 453 ? 64.579 35.613  -18.573 1.00 27.01 ? 459  HIS A O     1 
ATOM   3812 C  CB    . HIS C 3 453 ? 61.870 36.288  -17.614 1.00 23.85 ? 459  HIS A CB    1 
ATOM   3813 C  CG    . HIS C 3 453 ? 60.522 36.935  -17.625 1.00 24.28 ? 459  HIS A CG    1 
ATOM   3814 N  ND1   . HIS C 3 453 ? 60.132 37.813  -18.615 1.00 26.04 ? 459  HIS A ND1   1 
ATOM   3815 C  CD2   . HIS C 3 453 ? 59.451 36.786  -16.812 1.00 25.05 ? 459  HIS A CD2   1 
ATOM   3816 C  CE1   . HIS C 3 453 ? 58.877 38.173  -18.415 1.00 25.31 ? 459  HIS A CE1   1 
ATOM   3817 N  NE2   . HIS C 3 453 ? 58.440 37.564  -17.327 1.00 26.05 ? 459  HIS A NE2   1 
ATOM   3818 N  N     . HIS C 3 454 ? 63.650 33.639  -19.162 1.00 26.31 ? 460  HIS A N     1 
ATOM   3819 C  CA    . HIS C 3 454 ? 64.919 32.921  -19.214 1.00 23.97 ? 460  HIS A CA    1 
ATOM   3820 C  C     . HIS C 3 454 ? 65.181 32.567  -20.679 1.00 22.97 ? 460  HIS A C     1 
ATOM   3821 O  O     . HIS C 3 454 ? 64.358 31.922  -21.321 1.00 22.82 ? 460  HIS A O     1 
ATOM   3822 C  CB    . HIS C 3 454 ? 64.875 31.626  -18.404 1.00 24.76 ? 460  HIS A CB    1 
ATOM   3823 C  CG    . HIS C 3 454 ? 66.097 30.771  -18.581 1.00 24.99 ? 460  HIS A CG    1 
ATOM   3824 N  ND1   . HIS C 3 454 ? 67.295 31.042  -17.953 1.00 25.51 ? 460  HIS A ND1   1 
ATOM   3825 C  CD2   . HIS C 3 454 ? 66.322 29.691  -19.366 1.00 24.38 ? 460  HIS A CD2   1 
ATOM   3826 C  CE1   . HIS C 3 454 ? 68.205 30.168  -18.342 1.00 22.47 ? 460  HIS A CE1   1 
ATOM   3827 N  NE2   . HIS C 3 454 ? 67.641 29.337  -19.201 1.00 25.35 ? 460  HIS A NE2   1 
ATOM   3828 N  N     . LEU C 3 455 ? 66.327 32.989  -21.197 1.00 23.99 ? 461  LEU A N     1 
ATOM   3829 C  CA    . LEU C 3 455 ? 66.703 32.717  -22.578 1.00 23.36 ? 461  LEU A CA    1 
ATOM   3830 C  C     . LEU C 3 455 ? 67.612 31.486  -22.578 1.00 22.82 ? 461  LEU A C     1 
ATOM   3831 O  O     . LEU C 3 455 ? 68.617 31.452  -21.865 1.00 22.98 ? 461  LEU A O     1 
ATOM   3832 C  CB    . LEU C 3 455 ? 67.444 33.930  -23.166 1.00 23.22 ? 461  LEU A CB    1 
ATOM   3833 C  CG    . LEU C 3 455 ? 66.746 35.281  -22.950 1.00 25.65 ? 461  LEU A CG    1 
ATOM   3834 C  CD1   . LEU C 3 455 ? 67.596 36.402  -23.538 1.00 26.95 ? 461  LEU A CD1   1 
ATOM   3835 C  CD2   . LEU C 3 455 ? 65.365 35.267  -23.595 1.00 26.28 ? 461  LEU A CD2   1 
ATOM   3836 N  N     . ASP C 3 456 ? 67.263 30.478  -23.372 1.00 21.71 ? 462  ASP A N     1 
ATOM   3837 C  CA    . ASP C 3 456 ? 68.064 29.261  -23.421 1.00 22.06 ? 462  ASP A CA    1 
ATOM   3838 C  C     . ASP C 3 456 ? 69.544 29.558  -23.635 1.00 22.46 ? 462  ASP A C     1 
ATOM   3839 O  O     . ASP C 3 456 ? 69.910 30.330  -24.524 1.00 21.45 ? 462  ASP A O     1 
ATOM   3840 C  CB    . ASP C 3 456 ? 67.591 28.333  -24.534 1.00 22.22 ? 462  ASP A CB    1 
ATOM   3841 C  CG    . ASP C 3 456 ? 68.255 26.975  -24.460 1.00 23.67 ? 462  ASP A CG    1 
ATOM   3842 O  OD1   . ASP C 3 456 ? 67.829 26.151  -23.626 1.00 21.94 ? 462  ASP A OD1   1 
ATOM   3843 O  OD2   . ASP C 3 456 ? 69.220 26.740  -25.218 1.00 25.47 ? 462  ASP A OD2   1 
ATOM   3844 N  N     . GLY C 3 457 ? 70.384 28.910  -22.834 1.00 22.16 ? 463  GLY A N     1 
ATOM   3845 C  CA    . GLY C 3 457 ? 71.818 29.117  -22.911 1.00 23.68 ? 463  GLY A CA    1 
ATOM   3846 C  C     . GLY C 3 457 ? 72.467 28.811  -24.250 1.00 24.55 ? 463  GLY A C     1 
ATOM   3847 O  O     . GLY C 3 457 ? 73.572 29.280  -24.522 1.00 25.12 ? 463  GLY A O     1 
ATOM   3848 N  N     . ILE C 3 458 ? 71.797 28.027  -25.086 1.00 24.12 ? 464  ILE A N     1 
ATOM   3849 C  CA    . ILE C 3 458 ? 72.342 27.686  -26.390 1.00 23.68 ? 464  ILE A CA    1 
ATOM   3850 C  C     . ILE C 3 458 ? 71.654 28.458  -27.525 1.00 24.62 ? 464  ILE A C     1 
ATOM   3851 O  O     . ILE C 3 458 ? 72.311 29.165  -28.293 1.00 25.85 ? 464  ILE A O     1 
ATOM   3852 C  CB    . ILE C 3 458 ? 72.227 26.155  -26.657 1.00 25.01 ? 464  ILE A CB    1 
ATOM   3853 C  CG1   . ILE C 3 458 ? 73.149 25.386  -25.710 1.00 26.47 ? 464  ILE A CG1   1 
ATOM   3854 C  CG2   . ILE C 3 458 ? 72.603 25.829  -28.096 1.00 24.87 ? 464  ILE A CG2   1 
ATOM   3855 N  N     . THR C 3 459 ? 70.332 28.348  -27.611 1.00 23.32 ? 465  THR A N     1 
ATOM   3856 C  CA    . THR C 3 459 ? 69.575 28.997  -28.681 1.00 22.64 ? 465  THR A CA    1 
ATOM   3857 C  C     . THR C 3 459 ? 69.125 30.428  -28.408 1.00 23.07 ? 465  THR A C     1 
ATOM   3858 O  O     . THR C 3 459 ? 68.674 31.115  -29.320 1.00 23.20 ? 465  THR A O     1 
ATOM   3859 C  CB    . THR C 3 459 ? 68.302 28.212  -29.001 1.00 23.16 ? 465  THR A CB    1 
ATOM   3860 O  OG1   . THR C 3 459 ? 67.413 28.318  -27.889 1.00 23.58 ? 465  THR A OG1   1 
ATOM   3861 C  CG2   . THR C 3 459 ? 68.603 26.742  -29.256 1.00 23.72 ? 465  THR A CG2   1 
ATOM   3862 N  N     . GLY C 3 460 ? 69.219 30.871  -27.159 1.00 24.54 ? 466  GLY A N     1 
ATOM   3863 C  CA    . GLY C 3 460 ? 68.775 32.215  -26.828 1.00 24.20 ? 466  GLY A CA    1 
ATOM   3864 C  C     . GLY C 3 460 ? 67.258 32.362  -26.843 1.00 26.17 ? 466  GLY A C     1 
ATOM   3865 O  O     . GLY C 3 460 ? 66.741 33.459  -26.618 1.00 27.58 ? 466  GLY A O     1 
ATOM   3866 N  N     . LYS C 3 461 ? 66.531 31.274  -27.105 1.00 26.14 ? 467  LYS A N     1 
ATOM   3867 C  CA    . LYS C 3 461 ? 65.062 31.345  -27.146 1.00 25.60 ? 467  LYS A CA    1 
ATOM   3868 C  C     . LYS C 3 461 ? 64.440 31.224  -25.758 1.00 24.86 ? 467  LYS A C     1 
ATOM   3869 O  O     . LYS C 3 461 ? 64.905 30.451  -24.928 1.00 23.64 ? 467  LYS A O     1 
ATOM   3870 C  CB    . LYS C 3 461 ? 64.476 30.237  -28.039 1.00 24.42 ? 467  LYS A CB    1 
ATOM   3871 C  CG    . LYS C 3 461 ? 64.971 30.263  -29.473 1.00 27.11 ? 467  LYS A CG    1 
ATOM   3872 C  CD    . LYS C 3 461 ? 64.726 31.623  -30.123 1.00 26.42 ? 467  LYS A CD    1 
ATOM   3873 C  CE    . LYS C 3 461 ? 63.245 31.935  -30.274 1.00 25.51 ? 467  LYS A CE    1 
ATOM   3874 N  NZ    . LYS C 3 461 ? 63.053 33.318  -30.825 1.00 29.46 ? 467  LYS A NZ    1 
ATOM   3875 N  N     . PRO C 3 462 ? 63.366 31.979  -25.498 1.00 25.07 ? 468  PRO A N     1 
ATOM   3876 C  CA    . PRO C 3 462 ? 62.735 31.893  -24.177 1.00 24.49 ? 468  PRO A CA    1 
ATOM   3877 C  C     . PRO C 3 462 ? 62.152 30.517  -23.877 1.00 25.49 ? 468  PRO A C     1 
ATOM   3878 O  O     . PRO C 3 462 ? 61.742 29.793  -24.784 1.00 25.98 ? 468  PRO A O     1 
ATOM   3879 C  CB    . PRO C 3 462 ? 61.661 32.987  -24.216 1.00 24.86 ? 468  PRO A CB    1 
ATOM   3880 C  CG    . PRO C 3 462 ? 61.406 33.214  -25.688 1.00 28.27 ? 468  PRO A CG    1 
ATOM   3881 C  CD    . PRO C 3 462 ? 62.764 33.046  -26.322 1.00 25.11 ? 468  PRO A CD    1 
ATOM   3882 N  N     . TRP C 3 463 ? 62.152 30.147  -22.602 1.00 23.54 ? 469  TRP A N     1 
ATOM   3883 C  CA    . TRP C 3 463 ? 61.598 28.869  -22.195 1.00 23.78 ? 469  TRP A CA    1 
ATOM   3884 C  C     . TRP C 3 463 ? 60.098 29.058  -22.024 1.00 23.98 ? 469  TRP A C     1 
ATOM   3885 O  O     . TRP C 3 463 ? 59.596 30.182  -22.111 1.00 22.62 ? 469  TRP A O     1 
ATOM   3886 C  CB    . TRP C 3 463 ? 62.234 28.399  -20.879 1.00 22.79 ? 469  TRP A CB    1 
ATOM   3887 C  CG    . TRP C 3 463 ? 63.533 27.678  -21.070 1.00 21.28 ? 469  TRP A CG    1 
ATOM   3888 C  CD1   . TRP C 3 463 ? 64.495 27.960  -21.995 1.00 20.72 ? 469  TRP A CD1   1 
ATOM   3889 C  CD2   . TRP C 3 463 ? 64.008 26.543  -20.333 1.00 21.28 ? 469  TRP A CD2   1 
ATOM   3890 N  NE1   . TRP C 3 463 ? 65.535 27.071  -21.886 1.00 19.15 ? 469  TRP A NE1   1 
ATOM   3891 C  CE2   . TRP C 3 463 ? 65.265 26.191  -20.874 1.00 20.28 ? 469  TRP A CE2   1 
ATOM   3892 C  CE3   . TRP C 3 463 ? 63.493 25.787  -19.271 1.00 20.41 ? 469  TRP A CE3   1 
ATOM   3893 C  CZ2   . TRP C 3 463 ? 66.019 25.112  -20.389 1.00 21.57 ? 469  TRP A CZ2   1 
ATOM   3894 C  CZ3   . TRP C 3 463 ? 64.241 24.712  -18.789 1.00 19.60 ? 469  TRP A CZ3   1 
ATOM   3895 C  CH2   . TRP C 3 463 ? 65.488 24.386  -19.349 1.00 21.06 ? 469  TRP A CH2   1 
ATOM   3896 N  N     . VAL C 3 464 ? 59.392 27.955  -21.806 1.00 23.42 ? 470  VAL A N     1 
ATOM   3897 C  CA    . VAL C 3 464 ? 57.950 27.981  -21.615 1.00 25.49 ? 470  VAL A CA    1 
ATOM   3898 C  C     . VAL C 3 464 ? 57.630 27.430  -20.225 1.00 25.32 ? 470  VAL A C     1 
ATOM   3899 O  O     . VAL C 3 464 ? 58.386 26.632  -19.670 1.00 26.12 ? 470  VAL A O     1 
ATOM   3900 C  CB    . VAL C 3 464 ? 57.223 27.142  -22.694 1.00 27.58 ? 470  VAL A CB    1 
ATOM   3901 C  CG1   . VAL C 3 464 ? 55.723 27.138  -22.432 1.00 27.38 ? 470  VAL A CG1   1 
ATOM   3902 C  CG2   . VAL C 3 464 ? 57.491 27.736  -24.067 1.00 28.47 ? 470  VAL A CG2   1 
ATOM   3903 N  N     . GLN C 3 465 ? 56.494 27.849  -19.683 1.00 23.73 ? 471  GLN A N     1 
ATOM   3904 C  CA    . GLN C 3 465 ? 56.085 27.459  -18.345 1.00 22.33 ? 471  GLN A CA    1 
ATOM   3905 C  C     . GLN C 3 465 ? 54.923 26.476  -18.261 1.00 21.86 ? 471  GLN A C     1 
ATOM   3906 O  O     . GLN C 3 465 ? 53.919 26.603  -18.979 1.00 19.78 ? 471  GLN A O     1 
ATOM   3907 C  CB    . GLN C 3 465 ? 55.725 28.724  -17.569 1.00 21.77 ? 471  GLN A CB    1 
ATOM   3908 C  CG    . GLN C 3 465 ? 55.635 28.576  -16.072 1.00 21.60 ? 471  GLN A CG    1 
ATOM   3909 C  CD    . GLN C 3 465 ? 55.641 29.938  -15.387 1.00 22.03 ? 471  GLN A CD    1 
ATOM   3910 O  OE1   . GLN C 3 465 ? 56.461 30.794  -15.717 1.00 19.13 ? 471  GLN A OE1   1 
ATOM   3911 N  NE2   . GLN C 3 465 ? 54.733 30.139  -14.430 1.00 20.36 ? 471  GLN A NE2   1 
ATOM   3912 N  N     . ALA C 3 466 ? 55.073 25.508  -17.361 1.00 19.85 ? 472  ALA A N     1 
ATOM   3913 C  CA    . ALA C 3 466 ? 54.050 24.502  -17.105 1.00 22.40 ? 472  ALA A CA    1 
ATOM   3914 C  C     . ALA C 3 466 ? 53.620 24.672  -15.641 1.00 23.04 ? 472  ALA A C     1 
ATOM   3915 O  O     . ALA C 3 466 ? 54.422 24.507  -14.727 1.00 23.58 ? 472  ALA A O     1 
ATOM   3916 C  CB    . ALA C 3 466 ? 54.614 23.091  -17.341 1.00 20.77 ? 472  ALA A CB    1 
ATOM   3917 N  N     . GLY C 3 467 ? 52.364 25.046  -15.427 1.00 24.85 ? 473  GLY A N     1 
ATOM   3918 C  CA    . GLY C 3 467 ? 51.871 25.226  -14.074 1.00 23.68 ? 473  GLY A CA    1 
ATOM   3919 C  C     . GLY C 3 467 ? 50.869 24.138  -13.755 1.00 23.63 ? 473  GLY A C     1 
ATOM   3920 O  O     . GLY C 3 467 ? 49.903 23.957  -14.494 1.00 23.73 ? 473  GLY A O     1 
ATOM   3921 N  N     . ILE C 3 468 ? 51.100 23.393  -12.678 1.00 22.63 ? 474  ILE A N     1 
ATOM   3922 C  CA    . ILE C 3 468 ? 50.177 22.328  -12.294 1.00 23.05 ? 474  ILE A CA    1 
ATOM   3923 C  C     . ILE C 3 468 ? 49.724 22.520  -10.844 1.00 24.06 ? 474  ILE A C     1 
ATOM   3924 O  O     . ILE C 3 468 ? 50.544 22.781  -9.953  1.00 22.46 ? 474  ILE A O     1 
ATOM   3925 C  CB    . ILE C 3 468 ? 50.818 20.931  -12.459 1.00 23.06 ? 474  ILE A CB    1 
ATOM   3926 C  CG1   . ILE C 3 468 ? 51.379 20.767  -13.881 1.00 23.12 ? 474  ILE A CG1   1 
ATOM   3927 C  CG2   . ILE C 3 468 ? 49.780 19.851  -12.212 1.00 22.02 ? 474  ILE A CG2   1 
ATOM   3928 N  N     . ASP C 3 469 ? 48.416 22.391  -10.617 1.00 25.23 ? 475  ASP A N     1 
ATOM   3929 C  CA    . ASP C 3 469 ? 47.826 22.575  -9.287  1.00 27.80 ? 475  ASP A CA    1 
ATOM   3930 C  C     . ASP C 3 469 ? 46.952 21.378  -8.918  1.00 27.09 ? 475  ASP A C     1 
ATOM   3931 O  O     . ASP C 3 469 ? 46.191 20.883  -9.746  1.00 29.05 ? 475  ASP A O     1 
ATOM   3932 C  CB    . ASP C 3 469 ? 46.966 23.853  -9.282  1.00 30.19 ? 475  ASP A CB    1 
ATOM   3933 C  CG    . ASP C 3 469 ? 46.677 24.378  -7.876  1.00 34.34 ? 475  ASP A CG    1 
ATOM   3934 O  OD1   . ASP C 3 469 ? 46.045 23.674  -7.056  1.00 36.65 ? 475  ASP A OD1   1 
ATOM   3935 O  OD2   . ASP C 3 469 ? 47.084 25.520  -7.593  1.00 37.37 ? 475  ASP A OD2   1 
ATOM   3936 N  N     . ALA C 3 470 ? 47.070 20.902  -7.684  1.00 26.64 ? 476  ALA A N     1 
ATOM   3937 C  CA    . ALA C 3 470 ? 46.248 19.780  -7.241  1.00 26.83 ? 476  ALA A CA    1 
ATOM   3938 C  C     . ALA C 3 470 ? 44.819 20.324  -7.196  1.00 26.96 ? 476  ALA A C     1 
ATOM   3939 O  O     . ALA C 3 470 ? 44.590 21.448  -6.740  1.00 28.18 ? 476  ALA A O     1 
ATOM   3940 C  CB    . ALA C 3 470 ? 46.688 19.313  -5.868  1.00 25.81 ? 476  ALA A CB    1 
ATOM   3941 N  N     . SER C 3 471 ? 43.864 19.543  -7.681  1.00 27.65 ? 477  SER A N     1 
ATOM   3942 C  CA    . SER C 3 471 ? 42.472 19.991  -7.723  1.00 28.61 ? 477  SER A CA    1 
ATOM   3943 C  C     . SER C 3 471 ? 41.680 19.670  -6.455  1.00 29.60 ? 477  SER A C     1 
ATOM   3944 O  O     . SER C 3 471 ? 41.676 18.527  -5.989  1.00 29.90 ? 477  SER A O     1 
ATOM   3945 C  CB    . SER C 3 471 ? 41.781 19.382  -8.943  1.00 30.36 ? 477  SER A CB    1 
ATOM   3946 O  OG    . SER C 3 471 ? 42.534 19.621  -10.126 1.00 28.70 ? 477  SER A OG    1 
ATOM   3947 N  N     . GLY C 3 472 ? 41.025 20.691  -5.899  1.00 28.43 ? 478  GLY A N     1 
ATOM   3948 C  CA    . GLY C 3 472 ? 40.228 20.519  -4.691  1.00 29.53 ? 478  GLY A CA    1 
ATOM   3949 C  C     . GLY C 3 472 ? 40.915 19.650  -3.655  1.00 30.61 ? 478  GLY A C     1 
ATOM   3950 O  O     . GLY C 3 472 ? 40.265 18.880  -2.941  1.00 31.55 ? 478  GLY A O     1 
ATOM   3951 N  N     . LEU C 3 473 ? 42.233 19.796  -3.557  1.00 31.32 ? 479  LEU A N     1 
ATOM   3952 C  CA    . LEU C 3 473 ? 43.045 18.991  -2.646  1.00 31.89 ? 479  LEU A CA    1 
ATOM   3953 C  C     . LEU C 3 473 ? 42.506 18.682  -1.251  1.00 30.05 ? 479  LEU A C     1 
ATOM   3954 O  O     . LEU C 3 473 ? 42.258 17.526  -0.933  1.00 28.37 ? 479  LEU A O     1 
ATOM   3955 C  CB    . LEU C 3 473 ? 44.438 19.598  -2.516  1.00 31.58 ? 479  LEU A CB    1 
ATOM   3956 C  CG    . LEU C 3 473 ? 45.446 18.737  -1.749  1.00 35.01 ? 479  LEU A CG    1 
ATOM   3957 C  CD1   . LEU C 3 473 ? 45.510 17.326  -2.341  1.00 33.51 ? 479  LEU A CD1   1 
ATOM   3958 C  CD2   . LEU C 3 473 ? 46.807 19.403  -1.810  1.00 35.40 ? 479  LEU A CD2   1 
ATOM   3959 N  N     . GLU C 3 474 ? 42.322 19.695  -0.413  1.00 30.85 ? 480  GLU A N     1 
ATOM   3960 C  CA    . GLU C 3 474 ? 41.861 19.416  0.935   1.00 31.13 ? 480  GLU A CA    1 
ATOM   3961 C  C     . GLU C 3 474 ? 40.397 18.977  1.062   1.00 31.44 ? 480  GLU A C     1 
ATOM   3962 O  O     . GLU C 3 474 ? 40.018 18.380  2.072   1.00 29.80 ? 480  GLU A O     1 
ATOM   3963 C  CB    . GLU C 3 474 ? 42.217 20.586  1.866   1.00 33.62 ? 480  GLU A CB    1 
ATOM   3964 C  CG    . GLU C 3 474 ? 43.692 20.482  2.345   1.00 37.05 ? 480  GLU A CG    1 
ATOM   3965 C  CD    . GLU C 3 474 ? 44.219 21.710  3.085   1.00 39.22 ? 480  GLU A CD    1 
ATOM   3966 O  OE1   . GLU C 3 474 ? 43.544 22.196  4.016   1.00 41.55 ? 480  GLU A OE1   1 
ATOM   3967 O  OE2   . GLU C 3 474 ? 45.328 22.183  2.744   1.00 40.22 ? 480  GLU A OE2   1 
ATOM   3968 N  N     . LEU C 3 475 ? 39.584 19.242  0.043   1.00 29.98 ? 481  LEU A N     1 
ATOM   3969 C  CA    . LEU C 3 475 ? 38.201 18.788  0.084   1.00 30.56 ? 481  LEU A CA    1 
ATOM   3970 C  C     . LEU C 3 475 ? 38.225 17.289  -0.212  1.00 30.04 ? 481  LEU A C     1 
ATOM   3971 O  O     . LEU C 3 475 ? 37.389 16.540  0.289   1.00 30.88 ? 481  LEU A O     1 
ATOM   3972 C  CB    . LEU C 3 475 ? 37.333 19.505  -0.954  1.00 32.93 ? 481  LEU A CB    1 
ATOM   3973 C  CG    . LEU C 3 475 ? 36.820 20.898  -0.584  1.00 35.63 ? 481  LEU A CG    1 
ATOM   3974 C  CD1   . LEU C 3 475 ? 35.803 21.365  -1.633  1.00 36.00 ? 481  LEU A CD1   1 
ATOM   3975 C  CD2   . LEU C 3 475 ? 36.175 20.861  0.795   1.00 35.61 ? 481  LEU A CD2   1 
ATOM   3976 N  N     . ARG C 3 476 ? 39.194 16.863  -1.023  1.00 28.07 ? 482  ARG A N     1 
ATOM   3977 C  CA    . ARG C 3 476 ? 39.348 15.450  -1.364  1.00 26.89 ? 482  ARG A CA    1 
ATOM   3978 C  C     . ARG C 3 476 ? 39.988 14.694  -0.202  1.00 27.12 ? 482  ARG A C     1 
ATOM   3979 O  O     . ARG C 3 476 ? 39.756 13.489  -0.031  1.00 24.24 ? 482  ARG A O     1 
ATOM   3980 C  CB    . ARG C 3 476 ? 40.199 15.278  -2.628  1.00 26.42 ? 482  ARG A CB    1 
ATOM   3981 C  CG    . ARG C 3 476 ? 39.592 15.939  -3.857  1.00 27.56 ? 482  ARG A CG    1 
ATOM   3982 C  CD    . ARG C 3 476 ? 40.224 15.453  -5.161  1.00 26.46 ? 482  ARG A CD    1 
ATOM   3983 N  NE    . ARG C 3 476 ? 39.737 16.227  -6.296  1.00 27.10 ? 482  ARG A NE    1 
ATOM   3984 C  CZ    . ARG C 3 476 ? 39.670 15.782  -7.548  1.00 27.26 ? 482  ARG A CZ    1 
ATOM   3985 N  NH1   . ARG C 3 476 ? 40.055 14.551  -7.849  1.00 28.43 ? 482  ARG A NH1   1 
ATOM   3986 N  NH2   . ARG C 3 476 ? 39.221 16.575  -8.505  1.00 27.13 ? 482  ARG A NH2   1 
ATOM   3987 N  N     . CYS C 3 477 ? 40.809 15.396  0.586   1.00 25.83 ? 483  CYS A N     1 
ATOM   3988 C  CA    . CYS C 3 477 ? 41.436 14.777  1.745   1.00 24.71 ? 483  CYS A CA    1 
ATOM   3989 C  C     . CYS C 3 477 ? 40.313 14.562  2.758   1.00 24.77 ? 483  CYS A C     1 
ATOM   3990 O  O     . CYS C 3 477 ? 40.294 13.568  3.485   1.00 26.24 ? 483  CYS A O     1 
ATOM   3991 C  CB    . CYS C 3 477 ? 42.516 15.688  2.345   1.00 24.96 ? 483  CYS A CB    1 
ATOM   3992 S  SG    . CYS C 3 477 ? 44.026 15.859  1.341   1.00 26.24 ? 483  CYS A SG    1 
ATOM   3993 N  N     . LEU C 3 478 ? 39.383 15.509  2.802   1.00 24.21 ? 484  LEU A N     1 
ATOM   3994 C  CA    . LEU C 3 478 ? 38.238 15.418  3.701   1.00 25.05 ? 484  LEU A CA    1 
ATOM   3995 C  C     . LEU C 3 478 ? 37.375 14.228  3.294   1.00 23.83 ? 484  LEU A C     1 
ATOM   3996 O  O     . LEU C 3 478 ? 36.908 13.485  4.137   1.00 24.02 ? 484  LEU A O     1 
ATOM   3997 C  CB    . LEU C 3 478 ? 37.376 16.683  3.634   1.00 25.21 ? 484  LEU A CB    1 
ATOM   3998 C  CG    . LEU C 3 478 ? 36.057 16.543  4.413   1.00 25.80 ? 484  LEU A CG    1 
ATOM   3999 C  CD1   . LEU C 3 478 ? 36.373 16.574  5.909   1.00 25.12 ? 484  LEU A CD1   1 
ATOM   4000 C  CD2   . LEU C 3 478 ? 35.070 17.646  4.036   1.00 24.17 ? 484  LEU A CD2   1 
ATOM   4001 N  N     . ALA C 3 479 ? 37.158 14.075  1.994   1.00 23.69 ? 485  ALA A N     1 
ATOM   4002 C  CA    . ALA C 3 479 ? 36.353 12.978  1.480   1.00 26.31 ? 485  ALA A CA    1 
ATOM   4003 C  C     . ALA C 3 479 ? 37.018 11.655  1.851   1.00 27.20 ? 485  ALA A C     1 
ATOM   4004 O  O     . ALA C 3 479 ? 36.350 10.685  2.222   1.00 27.57 ? 485  ALA A O     1 
ATOM   4005 C  CB    . ALA C 3 479 ? 36.220 13.094  -0.037  1.00 24.70 ? 485  ALA A CB    1 
ATOM   4006 N  N     . HIS C 3 480 ? 38.343 11.630  1.758   1.00 27.15 ? 486  HIS A N     1 
ATOM   4007 C  CA    . HIS C 3 480 ? 39.103 10.432  2.086   1.00 26.11 ? 486  HIS A CA    1 
ATOM   4008 C  C     . HIS C 3 480 ? 38.890 10.026  3.535   1.00 26.26 ? 486  HIS A C     1 
ATOM   4009 O  O     . HIS C 3 480 ? 38.611 8.867   3.826   1.00 26.03 ? 486  HIS A O     1 
ATOM   4010 C  CB    . HIS C 3 480 ? 40.597 10.662  1.852   1.00 22.20 ? 486  HIS A CB    1 
ATOM   4011 C  CG    . HIS C 3 480 ? 41.475 9.681   2.564   1.00 21.63 ? 486  HIS A CG    1 
ATOM   4012 N  ND1   . HIS C 3 480 ? 41.638 8.380   2.136   1.00 21.29 ? 486  HIS A ND1   1 
ATOM   4013 C  CD2   . HIS C 3 480 ? 42.236 9.810   3.677   1.00 18.88 ? 486  HIS A CD2   1 
ATOM   4014 C  CE1   . HIS C 3 480 ? 42.468 7.752   2.952   1.00 21.13 ? 486  HIS A CE1   1 
ATOM   4015 N  NE2   . HIS C 3 480 ? 42.844 8.598   3.896   1.00 19.40 ? 486  HIS A NE2   1 
ATOM   4016 N  N     . PHE C 3 481 ? 39.025 10.986  4.441   1.00 26.52 ? 487  PHE A N     1 
ATOM   4017 C  CA    . PHE C 3 481 ? 38.874 10.701  5.856   1.00 26.59 ? 487  PHE A CA    1 
ATOM   4018 C  C     . PHE C 3 481 ? 37.453 10.418  6.338   1.00 27.80 ? 487  PHE A C     1 
ATOM   4019 O  O     . PHE C 3 481 ? 37.270 9.759   7.358   1.00 27.08 ? 487  PHE A O     1 
ATOM   4020 C  CB    . PHE C 3 481 ? 39.512 11.828  6.666   1.00 27.67 ? 487  PHE A CB    1 
ATOM   4021 C  CG    . PHE C 3 481 ? 41.018 11.779  6.671   1.00 27.90 ? 487  PHE A CG    1 
ATOM   4022 C  CD1   . PHE C 3 481 ? 41.687 10.782  7.368   1.00 27.49 ? 487  PHE A CD1   1 
ATOM   4023 C  CD2   . PHE C 3 481 ? 41.765 12.720  5.967   1.00 28.43 ? 487  PHE A CD2   1 
ATOM   4024 C  CE1   . PHE C 3 481 ? 43.086 10.721  7.367   1.00 29.26 ? 487  PHE A CE1   1 
ATOM   4025 C  CE2   . PHE C 3 481 ? 43.164 12.670  5.959   1.00 27.29 ? 487  PHE A CE2   1 
ATOM   4026 C  CZ    . PHE C 3 481 ? 43.824 11.672  6.657   1.00 27.59 ? 487  PHE A CZ    1 
ATOM   4027 N  N     . MET C 3 482 ? 36.445 10.902  5.619   1.00 29.15 ? 488  MET A N     1 
ATOM   4028 C  CA    . MET C 3 482 ? 35.083 10.623  6.037   1.00 31.88 ? 488  MET A CA    1 
ATOM   4029 C  C     . MET C 3 482 ? 34.546 9.359   5.362   1.00 31.25 ? 488  MET A C     1 
ATOM   4030 O  O     . MET C 3 482 ? 33.459 8.895   5.682   1.00 30.50 ? 488  MET A O     1 
ATOM   4031 C  CB    . MET C 3 482 ? 34.163 11.831  5.780   1.00 33.54 ? 488  MET A CB    1 
ATOM   4032 C  CG    . MET C 3 482 ? 34.138 12.405  4.379   1.00 36.63 ? 488  MET A CG    1 
ATOM   4033 S  SD    . MET C 3 482 ? 33.385 14.094  4.393   1.00 40.28 ? 488  MET A SD    1 
ATOM   4034 C  CE    . MET C 3 482 ? 31.625 13.688  4.203   1.00 40.64 ? 488  MET A CE    1 
ATOM   4035 N  N     . ALA C 3 483 ? 35.337 8.792   4.455   1.00 29.40 ? 489  ALA A N     1 
ATOM   4036 C  CA    . ALA C 3 483 ? 34.948 7.581   3.739   1.00 31.24 ? 489  ALA A CA    1 
ATOM   4037 C  C     . ALA C 3 483 ? 34.551 6.422   4.656   1.00 31.73 ? 489  ALA A C     1 
ATOM   4038 O  O     . ALA C 3 483 ? 33.714 5.601   4.293   1.00 32.45 ? 489  ALA A O     1 
ATOM   4039 C  CB    . ALA C 3 483 ? 36.072 7.136   2.809   1.00 30.70 ? 489  ALA A CB    1 
ATOM   4040 N  N     . ARG C 3 484 ? 35.137 6.341   5.843   1.00 32.71 ? 490  ARG A N     1 
ATOM   4041 C  CA    . ARG C 3 484 ? 34.774 5.246   6.726   1.00 33.92 ? 490  ARG A CA    1 
ATOM   4042 C  C     . ARG C 3 484 ? 33.498 5.539   7.508   1.00 33.86 ? 490  ARG A C     1 
ATOM   4043 O  O     . ARG C 3 484 ? 33.009 4.689   8.247   1.00 34.57 ? 490  ARG A O     1 
ATOM   4044 C  CB    . ARG C 3 484 ? 35.930 4.905   7.669   1.00 34.61 ? 490  ARG A CB    1 
ATOM   4045 C  CG    . ARG C 3 484 ? 36.106 5.771   8.891   1.00 35.49 ? 490  ARG A CG    1 
ATOM   4046 C  CD    . ARG C 3 484 ? 37.454 5.436   9.498   1.00 38.04 ? 490  ARG A CD    1 
ATOM   4047 N  NE    . ARG C 3 484 ? 37.622 5.882   10.873  1.00 41.45 ? 490  ARG A NE    1 
ATOM   4048 C  CZ    . ARG C 3 484 ? 38.781 5.840   11.526  1.00 42.00 ? 490  ARG A CZ    1 
ATOM   4049 N  NH1   . ARG C 3 484 ? 39.873 5.378   10.924  1.00 40.85 ? 490  ARG A NH1   1 
ATOM   4050 N  NH2   . ARG C 3 484 ? 38.847 6.253   12.784  1.00 41.93 ? 490  ARG A NH2   1 
ATOM   4051 N  N     . PHE C 3 485 ? 32.961 6.743   7.328   1.00 34.02 ? 491  PHE A N     1 
ATOM   4052 C  CA    . PHE C 3 485 ? 31.727 7.156   7.992   1.00 32.81 ? 491  PHE A CA    1 
ATOM   4053 C  C     . PHE C 3 485 ? 30.578 7.227   6.977   1.00 32.53 ? 491  PHE A C     1 
ATOM   4054 O  O     . PHE C 3 485 ? 29.421 6.971   7.325   1.00 32.07 ? 491  PHE A O     1 
ATOM   4055 C  CB    . PHE C 3 485 ? 31.906 8.527   8.652   1.00 31.51 ? 491  PHE A CB    1 
ATOM   4056 C  CG    . PHE C 3 485 ? 32.931 8.545   9.752   1.00 33.13 ? 491  PHE A CG    1 
ATOM   4057 C  CD1   . PHE C 3 485 ? 32.698 7.881   10.952  1.00 33.76 ? 491  PHE A CD1   1 
ATOM   4058 C  CD2   . PHE C 3 485 ? 34.141 9.219   9.584   1.00 32.93 ? 491  PHE A CD2   1 
ATOM   4059 C  CE1   . PHE C 3 485 ? 33.657 7.887   11.974  1.00 33.97 ? 491  PHE A CE1   1 
ATOM   4060 C  CE2   . PHE C 3 485 ? 35.102 9.231   10.595  1.00 34.02 ? 491  PHE A CE2   1 
ATOM   4061 C  CZ    . PHE C 3 485 ? 34.859 8.562   11.795  1.00 34.10 ? 491  PHE A CZ    1 
ATOM   4062 N  N     . ASP C 3 486 ? 30.899 7.569   5.728   1.00 30.15 ? 492  ASP A N     1 
ATOM   4063 C  CA    . ASP C 3 486 ? 29.888 7.675   4.676   1.00 31.57 ? 492  ASP A CA    1 
ATOM   4064 C  C     . ASP C 3 486 ? 30.153 6.722   3.507   1.00 31.61 ? 492  ASP A C     1 
ATOM   4065 O  O     . ASP C 3 486 ? 29.590 6.875   2.426   1.00 30.98 ? 492  ASP A O     1 
ATOM   4066 C  CB    . ASP C 3 486 ? 29.816 9.122   4.164   1.00 33.16 ? 492  ASP A CB    1 
ATOM   4067 C  CG    . ASP C 3 486 ? 30.977 9.482   3.242   1.00 33.42 ? 492  ASP A CG    1 
ATOM   4068 O  OD1   . ASP C 3 486 ? 32.055 8.862   3.366   1.00 31.11 ? 492  ASP A OD1   1 
ATOM   4069 O  OD2   . ASP C 3 486 ? 30.808 10.394  2.401   1.00 33.12 ? 492  ASP A OD2   1 
ATOM   4070 N  N     . ASN C 3 487 ? 31.027 5.748   3.730   1.00 32.32 ? 493  ASN A N     1 
ATOM   4071 C  CA    . ASN C 3 487 ? 31.370 4.754   2.716   1.00 33.51 ? 493  ASN A CA    1 
ATOM   4072 C  C     . ASN C 3 487 ? 31.777 5.289   1.349   1.00 33.81 ? 493  ASN A C     1 
ATOM   4073 O  O     . ASN C 3 487 ? 31.680 4.577   0.346   1.00 34.92 ? 493  ASN A O     1 
ATOM   4074 C  CB    . ASN C 3 487 ? 30.214 3.765   2.556   1.00 32.03 ? 493  ASN A CB    1 
ATOM   4075 C  CG    . ASN C 3 487 ? 29.863 3.097   3.854   1.00 32.68 ? 493  ASN A CG    1 
ATOM   4076 O  OD1   . ASN C 3 487 ? 30.725 2.500   4.507   1.00 34.14 ? 493  ASN A OD1   1 
ATOM   4077 N  ND2   . ASN C 3 487 ? 28.599 3.197   4.252   1.00 33.34 ? 493  ASN A ND2   1 
ATOM   4078 N  N     . GLY C 3 488 ? 32.242 6.533   1.308   1.00 33.99 ? 494  GLY A N     1 
ATOM   4079 C  CA    . GLY C 3 488 ? 32.673 7.104   0.046   1.00 32.46 ? 494  GLY A CA    1 
ATOM   4080 C  C     . GLY C 3 488 ? 31.671 7.985   -0.669  1.00 31.91 ? 494  GLY A C     1 
ATOM   4081 O  O     . GLY C 3 488 ? 31.927 8.417   -1.794  1.00 31.45 ? 494  GLY A O     1 
ATOM   4082 N  N     . GLU C 3 489 ? 30.536 8.263   -0.035  1.00 31.49 ? 495  GLU A N     1 
ATOM   4083 C  CA    . GLU C 3 489 ? 29.524 9.105   -0.669  1.00 32.94 ? 495  GLU A CA    1 
ATOM   4084 C  C     . GLU C 3 489 ? 30.113 10.446  -1.095  1.00 32.01 ? 495  GLU A C     1 
ATOM   4085 O  O     . GLU C 3 489 ? 29.961 10.858  -2.246  1.00 31.63 ? 495  GLU A O     1 
ATOM   4086 C  CB    . GLU C 3 489 ? 28.332 9.345   0.271   1.00 32.31 ? 495  GLU A CB    1 
ATOM   4087 C  CG    . GLU C 3 489 ? 27.281 8.249   0.239   1.00 33.30 ? 495  GLU A CG    1 
ATOM   4088 N  N     . TYR C 3 490 ? 30.793 11.114  -0.168  1.00 31.63 ? 496  TYR A N     1 
ATOM   4089 C  CA    . TYR C 3 490 ? 31.397 12.411  -0.453  1.00 33.29 ? 496  TYR A CA    1 
ATOM   4090 C  C     . TYR C 3 490 ? 32.441 12.337  -1.566  1.00 33.86 ? 496  TYR A C     1 
ATOM   4091 O  O     . TYR C 3 490 ? 32.393 13.115  -2.517  1.00 32.20 ? 496  TYR A O     1 
ATOM   4092 C  CB    . TYR C 3 490 ? 32.043 12.979  0.806   1.00 36.36 ? 496  TYR A CB    1 
ATOM   4093 C  CG    . TYR C 3 490 ? 31.993 14.483  0.865   1.00 40.47 ? 496  TYR A CG    1 
ATOM   4094 C  CD1   . TYR C 3 490 ? 30.783 15.147  1.036   1.00 42.60 ? 496  TYR A CD1   1 
ATOM   4095 C  CD2   . TYR C 3 490 ? 33.149 15.247  0.731   1.00 41.70 ? 496  TYR A CD2   1 
ATOM   4096 C  CE1   . TYR C 3 490 ? 30.722 16.538  1.074   1.00 45.00 ? 496  TYR A CE1   1 
ATOM   4097 C  CE2   . TYR C 3 490 ? 33.099 16.635  0.766   1.00 44.26 ? 496  TYR A CE2   1 
ATOM   4098 C  CZ    . TYR C 3 490 ? 31.882 17.273  0.938   1.00 44.44 ? 496  TYR A CZ    1 
ATOM   4099 O  OH    . TYR C 3 490 ? 31.821 18.647  0.981   1.00 46.88 ? 496  TYR A OH    1 
ATOM   4100 N  N     . ALA C 3 491 ? 33.386 11.403  -1.449  1.00 35.23 ? 497  ALA A N     1 
ATOM   4101 C  CA    . ALA C 3 491 ? 34.429 11.257  -2.466  1.00 35.84 ? 497  ALA A CA    1 
ATOM   4102 C  C     . ALA C 3 491 ? 33.778 11.079  -3.833  1.00 37.64 ? 497  ALA A C     1 
ATOM   4103 O  O     . ALA C 3 491 ? 34.248 11.626  -4.836  1.00 37.78 ? 497  ALA A O     1 
ATOM   4104 C  CB    . ALA C 3 491 ? 35.322 10.068  -2.149  1.00 32.42 ? 497  ALA A CB    1 
ATOM   4105 N  N     . HIS C 3 492 ? 32.684 10.324  -3.870  1.00 39.17 ? 498  HIS A N     1 
ATOM   4106 C  CA    . HIS C 3 492 ? 31.984 10.102  -5.126  1.00 41.04 ? 498  HIS A CA    1 
ATOM   4107 C  C     . HIS C 3 492 ? 31.293 11.375  -5.605  1.00 41.27 ? 498  HIS A C     1 
ATOM   4108 O  O     . HIS C 3 492 ? 31.349 11.717  -6.784  1.00 41.60 ? 498  HIS A O     1 
ATOM   4109 C  CB    . HIS C 3 492 ? 30.946 8.996   -4.975  1.00 42.31 ? 498  HIS A CB    1 
ATOM   4110 C  CG    . HIS C 3 492 ? 30.126 8.777   -6.206  1.00 45.45 ? 498  HIS A CG    1 
ATOM   4111 N  ND1   . HIS C 3 492 ? 30.656 8.267   -7.372  1.00 47.73 ? 498  HIS A ND1   1 
ATOM   4112 C  CD2   . HIS C 3 492 ? 28.821 9.031   -6.465  1.00 46.57 ? 498  HIS A CD2   1 
ATOM   4113 C  CE1   . HIS C 3 492 ? 29.712 8.214   -8.296  1.00 48.26 ? 498  HIS A CE1   1 
ATOM   4114 N  NE2   . HIS C 3 492 ? 28.590 8.672   -7.772  1.00 47.58 ? 498  HIS A NE2   1 
ATOM   4115 N  N     . GLU C 3 493 ? 30.634 12.072  -4.689  1.00 41.28 ? 499  GLU A N     1 
ATOM   4116 C  CA    . GLU C 3 493 ? 29.937 13.297  -5.047  1.00 43.25 ? 499  GLU A CA    1 
ATOM   4117 C  C     . GLU C 3 493 ? 30.909 14.345  -5.582  1.00 43.30 ? 499  GLU A C     1 
ATOM   4118 O  O     . GLU C 3 493 ? 30.547 15.157  -6.431  1.00 42.53 ? 499  GLU A O     1 
ATOM   4119 C  CB    . GLU C 3 493 ? 29.192 13.856  -3.835  1.00 44.77 ? 499  GLU A CB    1 
ATOM   4120 C  CG    . GLU C 3 493 ? 28.344 15.081  -4.146  1.00 47.99 ? 499  GLU A CG    1 
ATOM   4121 C  CD    . GLU C 3 493 ? 27.287 14.802  -5.201  1.00 50.24 ? 499  GLU A CD    1 
ATOM   4122 O  OE1   . GLU C 3 493 ? 26.521 13.827  -5.032  1.00 50.97 ? 499  GLU A OE1   1 
ATOM   4123 O  OE2   . GLU C 3 493 ? 27.221 15.558  -6.197  1.00 50.47 ? 499  GLU A OE2   1 
ATOM   4124 N  N     . ILE C 3 494 ? 32.143 14.318  -5.086  1.00 44.06 ? 500  ILE A N     1 
ATOM   4125 C  CA    . ILE C 3 494 ? 33.162 15.268  -5.515  1.00 44.50 ? 500  ILE A CA    1 
ATOM   4126 C  C     . ILE C 3 494 ? 33.546 15.149  -6.989  1.00 44.35 ? 500  ILE A C     1 
ATOM   4127 O  O     . ILE C 3 494 ? 33.567 16.146  -7.701  1.00 44.01 ? 500  ILE A O     1 
ATOM   4128 C  CB    . ILE C 3 494 ? 34.450 15.145  -4.665  1.00 44.47 ? 500  ILE A CB    1 
ATOM   4129 C  CG1   . ILE C 3 494 ? 34.221 15.760  -3.281  1.00 45.27 ? 500  ILE A CG1   1 
ATOM   4130 C  CG2   . ILE C 3 494 ? 35.606 15.848  -5.364  1.00 45.99 ? 500  ILE A CG2   1 
ATOM   4131 C  CD1   . ILE C 3 494 ? 35.466 15.836  -2.427  1.00 45.18 ? 500  ILE A CD1   1 
ATOM   4132 N  N     . LEU C 3 495 ? 33.857 13.944  -7.453  1.00 46.01 ? 501  LEU A N     1 
ATOM   4133 C  CA    . LEU C 3 495 ? 34.238 13.787  -8.849  1.00 48.58 ? 501  LEU A CA    1 
ATOM   4134 C  C     . LEU C 3 495 ? 33.059 13.942  -9.818  1.00 50.18 ? 501  LEU A C     1 
ATOM   4135 O  O     . LEU C 3 495 ? 33.050 13.352  -10.902 1.00 50.06 ? 501  LEU A O     1 
ATOM   4136 C  CB    . LEU C 3 495 ? 34.953 12.444  -9.064  1.00 49.68 ? 501  LEU A CB    1 
ATOM   4137 C  CG    . LEU C 3 495 ? 34.338 11.109  -8.631  1.00 51.23 ? 501  LEU A CG    1 
ATOM   4138 C  CD1   . LEU C 3 495 ? 33.064 10.809  -9.420  1.00 51.18 ? 501  LEU A CD1   1 
ATOM   4139 C  CD2   . LEU C 3 495 ? 35.369 10.000  -8.854  1.00 50.98 ? 501  LEU A CD2   1 
ATOM   4140 N  N     . ASN C 3 496 ? 32.073 14.746  -9.417  1.00 51.31 ? 502  ASN A N     1 
ATOM   4141 C  CA    . ASN C 3 496 ? 30.891 15.025  -10.238 1.00 52.37 ? 502  ASN A CA    1 
ATOM   4142 C  C     . ASN C 3 496 ? 30.876 16.526  -10.567 1.00 52.31 ? 502  ASN A C     1 
ATOM   4143 O  O     . ASN C 3 496 ? 29.968 17.259  -10.162 1.00 52.00 ? 502  ASN A O     1 
ATOM   4144 C  CB    . ASN C 3 496 ? 29.610 14.641  -9.485  1.00 51.33 ? 502  ASN A CB    1 
ATOM   4145 N  N     . GLY C 3 497 ? 31.892 16.968  -11.304 1.00 52.76 ? 503  GLY A N     1 
ATOM   4146 C  CA    . GLY C 3 497 ? 32.018 18.373  -11.659 1.00 53.86 ? 503  GLY A CA    1 
ATOM   4147 C  C     . GLY C 3 497 ? 32.988 19.027  -10.688 1.00 54.22 ? 503  GLY A C     1 
ATOM   4148 O  O     . GLY C 3 497 ? 33.565 18.335  -9.846  1.00 55.01 ? 503  GLY A O     1 
ATOM   4149 N  N     . ASP C 3 498 ? 33.182 20.340  -10.786 1.00 54.07 ? 504  ASP A N     1 
ATOM   4150 C  CA    . ASP C 3 498 ? 34.096 21.018  -9.868  1.00 53.32 ? 504  ASP A CA    1 
ATOM   4151 C  C     . ASP C 3 498 ? 33.391 21.391  -8.573  1.00 52.64 ? 504  ASP A C     1 
ATOM   4152 O  O     . ASP C 3 498 ? 32.474 22.215  -8.567  1.00 52.79 ? 504  ASP A O     1 
ATOM   4153 C  CB    . ASP C 3 498 ? 34.685 22.287  -10.486 1.00 53.29 ? 504  ASP A CB    1 
ATOM   4154 C  CG    . ASP C 3 498 ? 35.628 23.008  -9.527  1.00 53.93 ? 504  ASP A CG    1 
ATOM   4155 O  OD1   . ASP C 3 498 ? 36.638 22.393  -9.121  1.00 54.02 ? 504  ASP A OD1   1 
ATOM   4156 O  OD2   . ASP C 3 498 ? 35.358 24.176  -9.170  1.00 52.50 ? 504  ASP A OD2   1 
ATOM   4157 N  N     . ILE C 3 499 ? 33.841 20.786  -7.479  1.00 51.46 ? 505  ILE A N     1 
ATOM   4158 C  CA    . ILE C 3 499 ? 33.271 21.025  -6.159  1.00 51.20 ? 505  ILE A CA    1 
ATOM   4159 C  C     . ILE C 3 499 ? 33.191 22.511  -5.796  1.00 49.71 ? 505  ILE A C     1 
ATOM   4160 O  O     . ILE C 3 499 ? 32.163 22.983  -5.306  1.00 47.61 ? 505  ILE A O     1 
ATOM   4161 C  CB    . ILE C 3 499 ? 34.090 20.283  -5.067  1.00 51.13 ? 505  ILE A CB    1 
ATOM   4162 N  N     . HIS C 3 500 ? 34.273 23.245  -6.038  1.00 50.24 ? 506  HIS A N     1 
ATOM   4163 C  CA    . HIS C 3 500 ? 34.305 24.666  -5.717  1.00 51.31 ? 506  HIS A CA    1 
ATOM   4164 C  C     . HIS C 3 500 ? 33.294 25.476  -6.524  1.00 51.51 ? 506  HIS A C     1 
ATOM   4165 O  O     . HIS C 3 500 ? 32.706 26.430  -6.009  1.00 51.52 ? 506  HIS A O     1 
ATOM   4166 C  CB    . HIS C 3 500 ? 35.724 25.213  -5.901  1.00 51.21 ? 506  HIS A CB    1 
ATOM   4167 C  CG    . HIS C 3 500 ? 36.702 24.670  -4.904  1.00 51.33 ? 506  HIS A CG    1 
ATOM   4168 N  ND1   . HIS C 3 500 ? 36.492 24.745  -3.543  1.00 51.01 ? 506  HIS A ND1   1 
ATOM   4169 C  CD2   . HIS C 3 500 ? 37.882 24.026  -5.067  1.00 51.31 ? 506  HIS A CD2   1 
ATOM   4170 C  CE1   . HIS C 3 500 ? 37.500 24.170  -2.911  1.00 51.67 ? 506  HIS A CE1   1 
ATOM   4171 N  NE2   . HIS C 3 500 ? 38.357 23.725  -3.812  1.00 51.48 ? 506  HIS A NE2   1 
ATOM   4172 N  N     . THR C 3 501 ? 33.090 25.094  -7.782  1.00 51.73 ? 507  THR A N     1 
ATOM   4173 C  CA    . THR C 3 501 ? 32.119 25.779  -8.635  1.00 51.73 ? 507  THR A CA    1 
ATOM   4174 C  C     . THR C 3 501 ? 30.729 25.368  -8.144  1.00 51.88 ? 507  THR A C     1 
ATOM   4175 O  O     . THR C 3 501 ? 29.797 26.173  -8.103  1.00 51.17 ? 507  THR A O     1 
ATOM   4176 C  CB    . THR C 3 501 ? 32.272 25.360  -10.112 1.00 51.00 ? 507  THR A CB    1 
ATOM   4177 N  N     . LYS C 3 502 ? 30.614 24.099  -7.763  1.00 52.08 ? 508  LYS A N     1 
ATOM   4178 C  CA    . LYS C 3 502 ? 29.366 23.542  -7.255  1.00 52.61 ? 508  LYS A CA    1 
ATOM   4179 C  C     . LYS C 3 502 ? 29.029 24.189  -5.909  1.00 52.80 ? 508  LYS A C     1 
ATOM   4180 O  O     . LYS C 3 502 ? 27.859 24.278  -5.531  1.00 53.12 ? 508  LYS A O     1 
ATOM   4181 C  CB    . LYS C 3 502 ? 29.510 22.020  -7.121  1.00 52.63 ? 508  LYS A CB    1 
ATOM   4182 C  CG    . LYS C 3 502 ? 28.279 21.279  -6.630  1.00 51.83 ? 508  LYS A CG    1 
ATOM   4183 C  CD    . LYS C 3 502 ? 28.486 19.774  -6.783  1.00 51.66 ? 508  LYS A CD    1 
ATOM   4184 C  CE    . LYS C 3 502 ? 27.857 19.002  -5.636  1.00 51.57 ? 508  LYS A CE    1 
ATOM   4185 N  NZ    . LYS C 3 502 ? 28.494 19.349  -4.327  1.00 50.13 ? 508  LYS A NZ    1 
ATOM   4186 N  N     . ASN C 3 503 ? 30.062 24.639  -5.195  1.00 53.06 ? 509  ASN A N     1 
ATOM   4187 C  CA    . ASN C 3 503 ? 29.890 25.313  -3.904  1.00 53.71 ? 509  ASN A CA    1 
ATOM   4188 C  C     . ASN C 3 503 ? 29.396 26.741  -4.144  1.00 53.80 ? 509  ASN A C     1 
ATOM   4189 O  O     . ASN C 3 503 ? 28.356 27.156  -3.624  1.00 53.38 ? 509  ASN A O     1 
ATOM   4190 C  CB    . ASN C 3 503 ? 31.220 25.404  -3.143  1.00 54.15 ? 509  ASN A CB    1 
ATOM   4191 C  CG    . ASN C 3 503 ? 31.655 24.083  -2.544  1.00 54.56 ? 509  ASN A CG    1 
ATOM   4192 O  OD1   . ASN C 3 503 ? 30.945 23.486  -1.735  1.00 53.47 ? 509  ASN A OD1   1 
ATOM   4193 N  ND2   . ASN C 3 503 ? 32.840 23.628  -2.927  1.00 55.02 ? 509  ASN A ND2   1 
ATOM   4194 N  N     . GLN C 3 504 ? 30.174 27.484  -4.928  1.00 53.33 ? 510  GLN A N     1 
ATOM   4195 C  CA    . GLN C 3 504 ? 29.869 28.872  -5.259  1.00 53.63 ? 510  GLN A CA    1 
ATOM   4196 C  C     . GLN C 3 504 ? 28.396 29.057  -5.615  1.00 53.62 ? 510  GLN A C     1 
ATOM   4197 O  O     . GLN C 3 504 ? 27.750 29.989  -5.142  1.00 52.54 ? 510  GLN A O     1 
ATOM   4198 C  CB    . GLN C 3 504 ? 30.764 29.331  -6.417  1.00 52.31 ? 510  GLN A CB    1 
ATOM   4199 C  CG    . GLN C 3 504 ? 30.420 30.697  -6.992  1.00 51.58 ? 510  GLN A CG    1 
ATOM   4200 C  CD    . GLN C 3 504 ? 31.374 31.111  -8.092  1.00 50.88 ? 510  GLN A CD    1 
ATOM   4201 O  OE1   . GLN C 3 504 ? 31.892 30.270  -8.829  1.00 50.24 ? 510  GLN A OE1   1 
ATOM   4202 N  NE2   . GLN C 3 504 ? 31.604 32.412  -8.219  1.00 49.10 ? 510  GLN A NE2   1 
ATOM   4203 N  N     . ILE C 3 505 ? 27.876 28.156  -6.442  1.00 54.73 ? 511  ILE A N     1 
ATOM   4204 C  CA    . ILE C 3 505 ? 26.479 28.203  -6.861  1.00 55.74 ? 511  ILE A CA    1 
ATOM   4205 C  C     . ILE C 3 505 ? 25.566 28.159  -5.638  1.00 55.89 ? 511  ILE A C     1 
ATOM   4206 O  O     . ILE C 3 505 ? 24.811 29.099  -5.376  1.00 56.50 ? 511  ILE A O     1 
ATOM   4207 C  CB    . ILE C 3 505 ? 26.133 27.009  -7.788  1.00 55.69 ? 511  ILE A CB    1 
ATOM   4208 N  N     . ALA C 3 506 ? 25.640 27.064  -4.890  1.00 56.26 ? 512  ALA A N     1 
ATOM   4209 C  CA    . ALA C 3 506 ? 24.818 26.912  -3.697  1.00 56.75 ? 512  ALA A CA    1 
ATOM   4210 C  C     . ALA C 3 506 ? 25.000 28.132  -2.804  1.00 57.09 ? 512  ALA A C     1 
ATOM   4211 O  O     . ALA C 3 506 ? 24.084 28.943  -2.656  1.00 57.65 ? 512  ALA A O     1 
ATOM   4212 C  CB    . ALA C 3 506 ? 25.210 25.641  -2.942  1.00 56.68 ? 512  ALA A CB    1 
ATOM   4213 N  N     . ALA C 3 507 ? 26.192 28.267  -2.225  1.00 57.01 ? 513  ALA A N     1 
ATOM   4214 C  CA    . ALA C 3 507 ? 26.497 29.390  -1.342  1.00 56.66 ? 513  ALA A CA    1 
ATOM   4215 C  C     . ALA C 3 507 ? 26.129 30.726  -1.990  1.00 56.45 ? 513  ALA A C     1 
ATOM   4216 O  O     . ALA C 3 507 ? 26.156 31.772  -1.335  1.00 55.68 ? 513  ALA A O     1 
ATOM   4217 C  CB    . ALA C 3 507 ? 27.982 29.376  -0.972  1.00 55.93 ? 513  ALA A CB    1 
ATOM   4218 N  N     . GLU C 3 508 ? 25.778 30.683  -3.273  1.00 56.47 ? 514  GLU A N     1 
ATOM   4219 C  CA    . GLU C 3 508 ? 25.415 31.890  -4.006  1.00 57.07 ? 514  GLU A CA    1 
ATOM   4220 C  C     . GLU C 3 508 ? 26.551 32.902  -3.851  1.00 57.19 ? 514  GLU A C     1 
ATOM   4221 O  O     . GLU C 3 508 ? 26.321 34.108  -3.713  1.00 57.44 ? 514  GLU A O     1 
ATOM   4222 C  CB    . GLU C 3 508 ? 24.107 32.469  -3.455  1.00 56.54 ? 514  GLU A CB    1 
ATOM   4223 N  N     . LEU C 3 509 ? 27.779 32.389  -3.878  1.00 57.37 ? 515  LEU A N     1 
ATOM   4224 C  CA    . LEU C 3 509 ? 28.979 33.204  -3.731  1.00 57.69 ? 515  LEU A CA    1 
ATOM   4225 C  C     . LEU C 3 509 ? 29.382 33.908  -5.030  1.00 57.85 ? 515  LEU A C     1 
ATOM   4226 O  O     . LEU C 3 509 ? 29.054 33.449  -6.124  1.00 57.61 ? 515  LEU A O     1 
ATOM   4227 C  CB    . LEU C 3 509 ? 30.135 32.329  -3.235  1.00 57.99 ? 515  LEU A CB    1 
ATOM   4228 N  N     . PRO C 3 510 ? 30.105 35.039  -4.917  1.00 58.16 ? 516  PRO A N     1 
ATOM   4229 C  CA    . PRO C 3 510 ? 30.568 35.829  -6.064  1.00 58.21 ? 516  PRO A CA    1 
ATOM   4230 C  C     . PRO C 3 510 ? 31.618 35.153  -6.951  1.00 58.24 ? 516  PRO A C     1 
ATOM   4231 O  O     . PRO C 3 510 ? 31.396 34.975  -8.151  1.00 58.88 ? 516  PRO A O     1 
ATOM   4232 C  CB    . PRO C 3 510 ? 31.098 37.107  -5.411  1.00 58.22 ? 516  PRO A CB    1 
ATOM   4233 C  CG    . PRO C 3 510 ? 31.593 36.620  -4.083  1.00 58.26 ? 516  PRO A CG    1 
ATOM   4234 C  CD    . PRO C 3 510 ? 30.472 35.700  -3.650  1.00 58.46 ? 516  PRO A CD    1 
ATOM   4235 N  N     . THR C 3 511 ? 32.759 34.790  -6.364  1.00 57.02 ? 517  THR A N     1 
ATOM   4236 C  CA    . THR C 3 511 ? 33.837 34.146  -7.116  1.00 55.78 ? 517  THR A CA    1 
ATOM   4237 C  C     . THR C 3 511 ? 34.079 32.702  -6.683  1.00 54.55 ? 517  THR A C     1 
ATOM   4238 O  O     . THR C 3 511 ? 33.568 32.254  -5.656  1.00 53.70 ? 517  THR A O     1 
ATOM   4239 C  CB    . THR C 3 511 ? 35.167 34.919  -6.961  1.00 54.85 ? 517  THR A CB    1 
ATOM   4240 N  N     . ARG C 3 512 ? 34.853 31.975  -7.484  1.00 53.88 ? 518  ARG A N     1 
ATOM   4241 C  CA    . ARG C 3 512 ? 35.182 30.592  -7.172  1.00 53.14 ? 518  ARG A CA    1 
ATOM   4242 C  C     . ARG C 3 512 ? 36.225 30.583  -6.050  1.00 52.79 ? 518  ARG A C     1 
ATOM   4243 O  O     . ARG C 3 512 ? 36.395 29.580  -5.352  1.00 52.41 ? 518  ARG A O     1 
ATOM   4244 C  CB    . ARG C 3 512 ? 35.728 29.877  -8.411  1.00 53.40 ? 518  ARG A CB    1 
ATOM   4245 C  CG    . ARG C 3 512 ? 36.088 28.419  -8.163  1.00 53.79 ? 518  ARG A CG    1 
ATOM   4246 C  CD    . ARG C 3 512 ? 36.518 27.715  -9.432  1.00 53.06 ? 518  ARG A CD    1 
ATOM   4247 N  NE    . ARG C 3 512 ? 36.912 26.332  -9.170  1.00 53.80 ? 518  ARG A NE    1 
ATOM   4248 C  CZ    . ARG C 3 512 ? 38.004 25.976  -8.497  1.00 53.17 ? 518  ARG A CZ    1 
ATOM   4249 N  NH1   . ARG C 3 512 ? 38.823 26.900  -8.015  1.00 53.32 ? 518  ARG A NH1   1 
ATOM   4250 N  NH2   . ARG C 3 512 ? 38.275 24.689  -8.303  1.00 52.49 ? 518  ARG A NH2   1 
ATOM   4251 N  N     . ASP C 3 513 ? 36.923 31.706  -5.887  1.00 52.01 ? 519  ASP A N     1 
ATOM   4252 C  CA    . ASP C 3 513 ? 37.922 31.839  -4.832  1.00 52.65 ? 519  ASP A CA    1 
ATOM   4253 C  C     . ASP C 3 513 ? 37.209 32.110  -3.514  1.00 52.37 ? 519  ASP A C     1 
ATOM   4254 O  O     . ASP C 3 513 ? 37.612 31.609  -2.460  1.00 51.75 ? 519  ASP A O     1 
ATOM   4255 C  CB    . ASP C 3 513 ? 38.892 32.986  -5.133  1.00 53.51 ? 519  ASP A CB    1 
ATOM   4256 C  CG    . ASP C 3 513 ? 39.878 32.642  -6.230  1.00 54.03 ? 519  ASP A CG    1 
ATOM   4257 O  OD1   . ASP C 3 513 ? 40.392 31.500  -6.223  1.00 53.58 ? 519  ASP A OD1   1 
ATOM   4258 O  OD2   . ASP C 3 513 ? 40.149 33.514  -7.086  1.00 53.80 ? 519  ASP A OD2   1 
ATOM   4259 N  N     . ASN C 3 514 ? 36.147 32.909  -3.583  1.00 52.03 ? 520  ASN A N     1 
ATOM   4260 C  CA    . ASN C 3 514 ? 35.358 33.235  -2.401  1.00 51.44 ? 520  ASN A CA    1 
ATOM   4261 C  C     . ASN C 3 514 ? 34.681 31.959  -1.907  1.00 50.22 ? 520  ASN A C     1 
ATOM   4262 O  O     . ASN C 3 514 ? 34.451 31.795  -0.712  1.00 50.29 ? 520  ASN A O     1 
ATOM   4263 C  CB    . ASN C 3 514 ? 34.302 34.297  -2.733  1.00 50.96 ? 520  ASN A CB    1 
ATOM   4264 N  N     . ALA C 3 515 ? 34.379 31.054  -2.835  1.00 49.52 ? 521  ALA A N     1 
ATOM   4265 C  CA    . ALA C 3 515 ? 33.736 29.784  -2.500  1.00 48.98 ? 521  ALA A CA    1 
ATOM   4266 C  C     . ALA C 3 515 ? 34.738 28.843  -1.840  1.00 48.52 ? 521  ALA A C     1 
ATOM   4267 O  O     . ALA C 3 515 ? 34.368 28.017  -1.007  1.00 48.11 ? 521  ALA A O     1 
ATOM   4268 C  CB    . ALA C 3 515 ? 33.162 29.135  -3.756  1.00 48.06 ? 521  ALA A CB    1 
ATOM   4269 N  N     . LYS C 3 516 ? 36.005 28.972  -2.227  1.00 48.70 ? 522  LYS A N     1 
ATOM   4270 C  CA    . LYS C 3 516 ? 37.077 28.146  -1.667  1.00 48.25 ? 522  LYS A CA    1 
ATOM   4271 C  C     . LYS C 3 516 ? 37.388 28.620  -0.249  1.00 47.68 ? 522  LYS A C     1 
ATOM   4272 O  O     . LYS C 3 516 ? 37.424 27.822  0.697   1.00 45.91 ? 522  LYS A O     1 
ATOM   4273 C  CB    . LYS C 3 516 ? 38.329 28.245  -2.547  1.00 46.62 ? 522  LYS A CB    1 
ATOM   4274 C  CG    . LYS C 3 516 ? 38.133 27.660  -3.938  1.00 45.65 ? 522  LYS A CG    1 
ATOM   4275 C  CD    . LYS C 3 516 ? 39.204 28.119  -4.917  1.00 45.54 ? 522  LYS A CD    1 
ATOM   4276 C  CE    . LYS C 3 516 ? 40.590 27.679  -4.482  1.00 44.01 ? 522  LYS A CE    1 
ATOM   4277 N  NZ    . LYS C 3 516 ? 41.601 27.910  -5.546  1.00 44.07 ? 522  LYS A NZ    1 
ATOM   4278 N  N     . THR C 3 517 ? 37.599 29.927  -0.112  1.00 47.99 ? 523  THR A N     1 
ATOM   4279 C  CA    . THR C 3 517 ? 37.889 30.532  1.185   1.00 48.59 ? 523  THR A CA    1 
ATOM   4280 C  C     . THR C 3 517 ? 36.724 30.266  2.151   1.00 47.92 ? 523  THR A C     1 
ATOM   4281 O  O     . THR C 3 517 ? 36.920 30.152  3.367   1.00 48.02 ? 523  THR A O     1 
ATOM   4282 C  CB    . THR C 3 517 ? 38.111 32.063  1.050   1.00 48.40 ? 523  THR A CB    1 
ATOM   4283 N  N     . PHE C 3 518 ? 35.516 30.159  1.603   1.00 47.32 ? 524  PHE A N     1 
ATOM   4284 C  CA    . PHE C 3 518 ? 34.328 29.883  2.408   1.00 45.84 ? 524  PHE A CA    1 
ATOM   4285 C  C     . PHE C 3 518 ? 34.345 28.452  2.929   1.00 46.68 ? 524  PHE A C     1 
ATOM   4286 O  O     . PHE C 3 518 ? 34.311 28.210  4.138   1.00 46.28 ? 524  PHE A O     1 
ATOM   4287 C  CB    . PHE C 3 518 ? 33.046 30.068  1.586   1.00 43.40 ? 524  PHE A CB    1 
ATOM   4288 C  CG    . PHE C 3 518 ? 31.883 29.266  2.108   1.00 42.96 ? 524  PHE A CG    1 
ATOM   4289 C  CD1   . PHE C 3 518 ? 31.275 29.599  3.313   1.00 43.73 ? 524  PHE A CD1   1 
ATOM   4290 C  CD2   . PHE C 3 518 ? 31.453 28.124  1.438   1.00 42.94 ? 524  PHE A CD2   1 
ATOM   4291 C  CE1   . PHE C 3 518 ? 30.253 28.798  3.852   1.00 43.83 ? 524  PHE A CE1   1 
ATOM   4292 C  CE2   . PHE C 3 518 ? 30.436 27.320  1.963   1.00 42.24 ? 524  PHE A CE2   1 
ATOM   4293 C  CZ    . PHE C 3 518 ? 29.836 27.657  3.174   1.00 43.07 ? 524  PHE A CZ    1 
ATOM   4294 N  N     . ILE C 3 519 ? 34.377 27.507  1.995   1.00 47.22 ? 525  ILE A N     1 
ATOM   4295 C  CA    . ILE C 3 519 ? 34.358 26.092  2.332   1.00 46.75 ? 525  ILE A CA    1 
ATOM   4296 C  C     . ILE C 3 519 ? 35.480 25.714  3.287   1.00 47.02 ? 525  ILE A C     1 
ATOM   4297 O  O     . ILE C 3 519 ? 35.294 24.873  4.161   1.00 46.81 ? 525  ILE A O     1 
ATOM   4298 C  CB    . ILE C 3 519 ? 34.450 25.214  1.062   1.00 45.56 ? 525  ILE A CB    1 
ATOM   4299 C  CG1   . ILE C 3 519 ? 34.005 23.787  1.386   1.00 45.34 ? 525  ILE A CG1   1 
ATOM   4300 C  CG2   . ILE C 3 519 ? 35.865 25.230  0.511   1.00 44.72 ? 525  ILE A CG2   1 
ATOM   4301 C  CD1   . ILE C 3 519 ? 32.546 23.685  1.776   1.00 42.83 ? 525  ILE A CD1   1 
ATOM   4302 N  N     . TYR C 3 520 ? 36.644 26.338  3.138   1.00 47.88 ? 526  TYR A N     1 
ATOM   4303 C  CA    . TYR C 3 520 ? 37.748 26.010  4.026   1.00 48.20 ? 526  TYR A CA    1 
ATOM   4304 C  C     . TYR C 3 520 ? 37.634 26.710  5.373   1.00 47.99 ? 526  TYR A C     1 
ATOM   4305 O  O     . TYR C 3 520 ? 38.141 26.217  6.381   1.00 49.15 ? 526  TYR A O     1 
ATOM   4306 C  CB    . TYR C 3 520 ? 39.091 26.314  3.353   1.00 49.51 ? 526  TYR A CB    1 
ATOM   4307 C  CG    . TYR C 3 520 ? 39.471 25.271  2.316   1.00 49.98 ? 526  TYR A CG    1 
ATOM   4308 C  CD1   . TYR C 3 520 ? 39.416 23.905  2.624   1.00 50.93 ? 526  TYR A CD1   1 
ATOM   4309 C  CD2   . TYR C 3 520 ? 39.864 25.640  1.026   1.00 50.84 ? 526  TYR A CD2   1 
ATOM   4310 C  CE1   . TYR C 3 520 ? 39.740 22.927  1.671   1.00 51.04 ? 526  TYR A CE1   1 
ATOM   4311 C  CE2   . TYR C 3 520 ? 40.193 24.672  0.062   1.00 51.41 ? 526  TYR A CE2   1 
ATOM   4312 C  CZ    . TYR C 3 520 ? 40.127 23.317  0.394   1.00 51.77 ? 526  TYR A CZ    1 
ATOM   4313 O  OH    . TYR C 3 520 ? 40.448 22.356  -0.542  1.00 50.67 ? 526  TYR A OH    1 
ATOM   4314 N  N     . GLY C 3 521 ? 36.965 27.855  5.398   1.00 46.98 ? 527  GLY A N     1 
ATOM   4315 C  CA    . GLY C 3 521 ? 36.791 28.548  6.657   1.00 46.13 ? 527  GLY A CA    1 
ATOM   4316 C  C     . GLY C 3 521 ? 35.767 27.753  7.441   1.00 46.18 ? 527  GLY A C     1 
ATOM   4317 O  O     . GLY C 3 521 ? 35.907 27.531  8.648   1.00 45.80 ? 527  GLY A O     1 
ATOM   4318 N  N     . PHE C 3 522 ? 34.738 27.305  6.726   1.00 46.07 ? 528  PHE A N     1 
ATOM   4319 C  CA    . PHE C 3 522 ? 33.656 26.516  7.303   1.00 45.97 ? 528  PHE A CA    1 
ATOM   4320 C  C     . PHE C 3 522 ? 34.139 25.150  7.777   1.00 45.50 ? 528  PHE A C     1 
ATOM   4321 O  O     . PHE C 3 522 ? 33.943 24.785  8.934   1.00 44.99 ? 528  PHE A O     1 
ATOM   4322 C  CB    . PHE C 3 522 ? 32.536 26.319  6.276   1.00 45.56 ? 528  PHE A CB    1 
ATOM   4323 N  N     . LEU C 3 523 ? 34.760 24.397  6.875   1.00 45.47 ? 529  LEU A N     1 
ATOM   4324 C  CA    . LEU C 3 523 ? 35.258 23.064  7.207   1.00 46.25 ? 529  LEU A CA    1 
ATOM   4325 C  C     . LEU C 3 523 ? 36.195 23.086  8.412   1.00 46.37 ? 529  LEU A C     1 
ATOM   4326 O  O     . LEU C 3 523 ? 36.179 22.169  9.232   1.00 46.09 ? 529  LEU A O     1 
ATOM   4327 C  CB    . LEU C 3 523 ? 35.983 22.450  6.003   1.00 45.68 ? 529  LEU A CB    1 
ATOM   4328 C  CG    . LEU C 3 523 ? 36.642 21.084  6.217   1.00 46.01 ? 529  LEU A CG    1 
ATOM   4329 C  CD1   . LEU C 3 523 ? 35.604 20.066  6.673   1.00 44.59 ? 529  LEU A CD1   1 
ATOM   4330 C  CD2   . LEU C 3 523 ? 37.309 20.632  4.922   1.00 44.73 ? 529  LEU A CD2   1 
ATOM   4331 N  N     . TYR C 3 524 ? 37.001 24.138  8.523   1.00 46.61 ? 530  TYR A N     1 
ATOM   4332 C  CA    . TYR C 3 524 ? 37.939 24.258  9.635   1.00 48.01 ? 530  TYR A CA    1 
ATOM   4333 C  C     . TYR C 3 524 ? 37.439 25.196  10.734  1.00 49.09 ? 530  TYR A C     1 
ATOM   4334 O  O     . TYR C 3 524 ? 38.156 25.305  11.756  1.00 48.41 ? 530  TYR A O     1 
ATOM   4335 C  CB    . TYR C 3 524 ? 39.300 24.743  9.122   1.00 47.97 ? 530  TYR A CB    1 
ATOM   4336 C  CG    . TYR C 3 524 ? 39.933 23.802  8.120   1.00 48.82 ? 530  TYR A CG    1 
ATOM   4337 C  CD1   . TYR C 3 524 ? 39.972 22.430  8.360   1.00 48.03 ? 530  TYR A CD1   1 
ATOM   4338 C  CD2   . TYR C 3 524 ? 40.505 24.283  6.941   1.00 48.31 ? 530  TYR A CD2   1 
ATOM   4339 C  CE1   . TYR C 3 524 ? 40.563 21.559  7.453   1.00 49.84 ? 530  TYR A CE1   1 
ATOM   4340 C  CE2   . TYR C 3 524 ? 41.102 23.419  6.027   1.00 49.14 ? 530  TYR A CE2   1 
ATOM   4341 C  CZ    . TYR C 3 524 ? 41.127 22.057  6.289   1.00 50.08 ? 530  TYR A CZ    1 
ATOM   4342 O  OH    . TYR C 3 524 ? 41.716 21.188  5.399   1.00 49.16 ? 530  TYR A OH    1 
ATOM   4343 N  N     . ASP C 3 528 ? 30.275 32.075  13.062  1.00 58.81 ? 534  ASP A N     1 
ATOM   4344 C  CA    . ASP C 3 528 ? 29.293 32.497  12.019  1.00 58.26 ? 534  ASP A CA    1 
ATOM   4345 C  C     . ASP C 3 528 ? 29.672 33.850  11.430  1.00 57.61 ? 534  ASP A C     1 
ATOM   4346 O  O     . ASP C 3 528 ? 29.455 34.102  10.246  1.00 57.70 ? 534  ASP A O     1 
ATOM   4347 C  CB    . ASP C 3 528 ? 27.881 32.576  12.613  1.00 58.48 ? 534  ASP A CB    1 
ATOM   4348 C  CG    . ASP C 3 528 ? 27.403 31.245  13.170  1.00 58.94 ? 534  ASP A CG    1 
ATOM   4349 O  OD1   . ASP C 3 528 ? 27.511 30.223  12.458  1.00 57.94 ? 534  ASP A OD1   1 
ATOM   4350 O  OD2   . ASP C 3 528 ? 26.907 31.222  14.318  1.00 60.03 ? 534  ASP A OD2   1 
ATOM   4351 N  N     . GLU C 3 529 ? 30.240 34.716  12.265  1.00 57.37 ? 535  GLU A N     1 
ATOM   4352 C  CA    . GLU C 3 529 ? 30.655 36.047  11.832  1.00 57.50 ? 535  GLU A CA    1 
ATOM   4353 C  C     . GLU C 3 529 ? 31.736 35.973  10.751  1.00 57.09 ? 535  GLU A C     1 
ATOM   4354 O  O     . GLU C 3 529 ? 31.562 36.507  9.652   1.00 57.04 ? 535  GLU A O     1 
ATOM   4355 C  CB    . GLU C 3 529 ? 31.174 36.853  13.029  1.00 58.22 ? 535  GLU A CB    1 
ATOM   4356 N  N     . LYS C 3 530 ? 32.849 35.314  11.067  1.00 55.94 ? 536  LYS A N     1 
ATOM   4357 C  CA    . LYS C 3 530 ? 33.946 35.168  10.116  1.00 55.07 ? 536  LYS A CA    1 
ATOM   4358 C  C     . LYS C 3 530 ? 33.407 34.634  8.789   1.00 54.64 ? 536  LYS A C     1 
ATOM   4359 O  O     . LYS C 3 530 ? 33.787 35.111  7.718   1.00 53.91 ? 536  LYS A O     1 
ATOM   4360 C  CB    . LYS C 3 530 ? 35.005 34.210  10.670  1.00 55.11 ? 536  LYS A CB    1 
ATOM   4361 N  N     . ILE C 3 531 ? 32.520 33.643  8.871   1.00 53.58 ? 537  ILE A N     1 
ATOM   4362 C  CA    . ILE C 3 531 ? 31.914 33.051  7.684   1.00 53.65 ? 537  ILE A CA    1 
ATOM   4363 C  C     . ILE C 3 531 ? 31.139 34.128  6.928   1.00 53.60 ? 537  ILE A C     1 
ATOM   4364 O  O     . ILE C 3 531 ? 31.290 34.281  5.713   1.00 52.30 ? 537  ILE A O     1 
ATOM   4365 C  CB    . ILE C 3 531 ? 30.945 31.912  8.057   1.00 52.94 ? 537  ILE A CB    1 
ATOM   4366 N  N     . GLY C 3 532 ? 30.314 34.875  7.661   1.00 54.10 ? 538  GLY A N     1 
ATOM   4367 C  CA    . GLY C 3 532 ? 29.531 35.941  7.058   1.00 54.02 ? 538  GLY A CA    1 
ATOM   4368 C  C     . GLY C 3 532 ? 30.408 37.017  6.443   1.00 53.61 ? 538  GLY A C     1 
ATOM   4369 O  O     . GLY C 3 532 ? 30.137 37.493  5.343   1.00 52.68 ? 538  GLY A O     1 
ATOM   4370 N  N     . GLN C 3 533 ? 31.463 37.403  7.154   1.00 54.75 ? 539  GLN A N     1 
ATOM   4371 C  CA    . GLN C 3 533 ? 32.386 38.421  6.662   1.00 56.14 ? 539  GLN A CA    1 
ATOM   4372 C  C     . GLN C 3 533 ? 33.008 37.977  5.334   1.00 57.20 ? 539  GLN A C     1 
ATOM   4373 O  O     . GLN C 3 533 ? 33.053 38.748  4.372   1.00 57.63 ? 539  GLN A O     1 
ATOM   4374 C  CB    . GLN C 3 533 ? 33.492 38.675  7.691   1.00 56.01 ? 539  GLN A CB    1 
ATOM   4375 N  N     . ILE C 3 534 ? 33.487 36.734  5.291   1.00 57.36 ? 540  ILE A N     1 
ATOM   4376 C  CA    . ILE C 3 534 ? 34.095 36.181  4.083   1.00 57.31 ? 540  ILE A CA    1 
ATOM   4377 C  C     . ILE C 3 534 ? 33.070 36.118  2.947   1.00 57.59 ? 540  ILE A C     1 
ATOM   4378 O  O     . ILE C 3 534 ? 33.405 36.371  1.787   1.00 57.86 ? 540  ILE A O     1 
ATOM   4379 C  CB    . ILE C 3 534 ? 34.649 34.756  4.331   1.00 56.39 ? 540  ILE A CB    1 
ATOM   4380 N  N     . VAL C 3 535 ? 31.826 35.781  3.287   1.00 57.70 ? 541  VAL A N     1 
ATOM   4381 C  CA    . VAL C 3 535 ? 30.744 35.688  2.304   1.00 58.26 ? 541  VAL A CA    1 
ATOM   4382 C  C     . VAL C 3 535 ? 30.135 37.058  2.007   1.00 59.00 ? 541  VAL A C     1 
ATOM   4383 O  O     . VAL C 3 535 ? 29.377 37.211  1.049   1.00 59.17 ? 541  VAL A O     1 
ATOM   4384 C  CB    . VAL C 3 535 ? 29.614 34.752  2.788   1.00 57.55 ? 541  VAL A CB    1 
ATOM   4385 N  N     . GLY C 3 536 ? 30.463 38.045  2.838   1.00 59.78 ? 542  GLY A N     1 
ATOM   4386 C  CA    . GLY C 3 536 ? 29.951 39.391  2.637   1.00 60.35 ? 542  GLY A CA    1 
ATOM   4387 C  C     . GLY C 3 536 ? 28.712 39.756  3.440   1.00 61.08 ? 542  GLY A C     1 
ATOM   4388 O  O     . GLY C 3 536 ? 28.203 40.873  3.319   1.00 61.38 ? 542  GLY A O     1 
ATOM   4389 N  N     . ALA C 3 537 ? 28.221 38.831  4.261   1.00 61.34 ? 543  ALA A N     1 
ATOM   4390 C  CA    . ALA C 3 537 ? 27.031 39.091  5.071   1.00 60.80 ? 543  ALA A CA    1 
ATOM   4391 C  C     . ALA C 3 537 ? 27.332 39.112  6.571   1.00 60.63 ? 543  ALA A C     1 
ATOM   4392 O  O     . ALA C 3 537 ? 28.493 39.146  6.982   1.00 59.98 ? 543  ALA A O     1 
ATOM   4393 C  CB    . ALA C 3 537 ? 25.958 38.053  4.764   1.00 61.16 ? 543  ALA A CB    1 
ATOM   4394 N  N     . GLY C 3 538 ? 26.278 39.094  7.384   1.00 60.40 ? 544  GLY A N     1 
ATOM   4395 C  CA    . GLY C 3 538 ? 26.450 39.118  8.827   1.00 60.60 ? 544  GLY A CA    1 
ATOM   4396 C  C     . GLY C 3 538 ? 26.428 37.746  9.476   1.00 60.78 ? 544  GLY A C     1 
ATOM   4397 O  O     . GLY C 3 538 ? 26.291 36.726  8.793   1.00 60.92 ? 544  GLY A O     1 
ATOM   4398 N  N     . LYS C 3 539 ? 26.557 37.721  10.801  1.00 60.65 ? 545  LYS A N     1 
ATOM   4399 C  CA    . LYS C 3 539 ? 26.565 36.471  11.559  1.00 60.68 ? 545  LYS A CA    1 
ATOM   4400 C  C     . LYS C 3 539 ? 25.356 35.584  11.264  1.00 60.78 ? 545  LYS A C     1 
ATOM   4401 O  O     . LYS C 3 539 ? 25.397 34.373  11.500  1.00 61.10 ? 545  LYS A O     1 
ATOM   4402 C  CB    . LYS C 3 539 ? 26.624 36.767  13.060  1.00 60.16 ? 545  LYS A CB    1 
ATOM   4403 N  N     . GLU C 3 540 ? 24.286 36.188  10.752  1.00 60.66 ? 546  GLU A N     1 
ATOM   4404 C  CA    . GLU C 3 540 ? 23.063 35.452  10.431  1.00 59.66 ? 546  GLU A CA    1 
ATOM   4405 C  C     . GLU C 3 540 ? 23.254 34.550  9.217   1.00 59.04 ? 546  GLU A C     1 
ATOM   4406 O  O     . GLU C 3 540 ? 22.933 33.361  9.262   1.00 58.85 ? 546  GLU A O     1 
ATOM   4407 C  CB    . GLU C 3 540 ? 21.910 36.428  10.172  1.00 59.78 ? 546  GLU A CB    1 
ATOM   4408 N  N     . ARG C 3 541 ? 23.767 35.123  8.131   1.00 58.66 ? 547  ARG A N     1 
ATOM   4409 C  CA    . ARG C 3 541 ? 24.014 34.361  6.910   1.00 58.28 ? 547  ARG A CA    1 
ATOM   4410 C  C     . ARG C 3 541 ? 25.090 33.327  7.218   1.00 58.56 ? 547  ARG A C     1 
ATOM   4411 O  O     . ARG C 3 541 ? 24.981 32.164  6.818   1.00 58.43 ? 547  ARG A O     1 
ATOM   4412 C  CB    . ARG C 3 541 ? 24.488 35.280  5.781   1.00 56.72 ? 547  ARG A CB    1 
ATOM   4413 N  N     . GLY C 3 542 ? 26.127 33.759  7.933   1.00 58.43 ? 548  GLY A N     1 
ATOM   4414 C  CA    . GLY C 3 542 ? 27.200 32.853  8.300   1.00 58.52 ? 548  GLY A CA    1 
ATOM   4415 C  C     . GLY C 3 542 ? 26.640 31.615  8.980   1.00 58.37 ? 548  GLY A C     1 
ATOM   4416 O  O     . GLY C 3 542 ? 27.048 30.490  8.683   1.00 58.18 ? 548  GLY A O     1 
ATOM   4417 N  N     . LYS C 3 543 ? 25.690 31.827  9.888   1.00 57.64 ? 549  LYS A N     1 
ATOM   4418 C  CA    . LYS C 3 543 ? 25.058 30.732  10.613  1.00 57.09 ? 549  LYS A CA    1 
ATOM   4419 C  C     . LYS C 3 543 ? 24.277 29.831  9.657   1.00 57.02 ? 549  LYS A C     1 
ATOM   4420 O  O     . LYS C 3 543 ? 24.548 28.629  9.559   1.00 56.24 ? 549  LYS A O     1 
ATOM   4421 C  CB    . LYS C 3 543 ? 24.117 31.285  11.688  1.00 56.70 ? 549  LYS A CB    1 
ATOM   4422 N  N     . GLU C 3 544 ? 23.311 30.419  8.955   1.00 56.90 ? 550  GLU A N     1 
ATOM   4423 C  CA    . GLU C 3 544 ? 22.484 29.677  8.005   1.00 57.02 ? 550  GLU A CA    1 
ATOM   4424 C  C     . GLU C 3 544 ? 23.332 28.823  7.063   1.00 57.00 ? 550  GLU A C     1 
ATOM   4425 O  O     . GLU C 3 544 ? 23.061 27.635  6.870   1.00 56.95 ? 550  GLU A O     1 
ATOM   4426 C  CB    . GLU C 3 544 ? 21.622 30.647  7.187   1.00 56.56 ? 550  GLU A CB    1 
ATOM   4427 N  N     . LEU C 3 545 ? 24.359 29.436  6.481   1.00 57.20 ? 551  LEU A N     1 
ATOM   4428 C  CA    . LEU C 3 545 ? 25.248 28.744  5.554   1.00 57.22 ? 551  LEU A CA    1 
ATOM   4429 C  C     . LEU C 3 545 ? 26.033 27.633  6.253   1.00 56.97 ? 551  LEU A C     1 
ATOM   4430 O  O     . LEU C 3 545 ? 26.248 26.560  5.682   1.00 56.70 ? 551  LEU A O     1 
ATOM   4431 C  CB    . LEU C 3 545 ? 26.218 29.742  4.910   1.00 57.51 ? 551  LEU A CB    1 
ATOM   4432 N  N     . LYS C 3 546 ? 26.452 27.894  7.489   1.00 57.05 ? 552  LYS A N     1 
ATOM   4433 C  CA    . LYS C 3 546 ? 27.211 26.920  8.272   1.00 56.77 ? 552  LYS A CA    1 
ATOM   4434 C  C     . LYS C 3 546 ? 26.404 25.642  8.493   1.00 56.67 ? 552  LYS A C     1 
ATOM   4435 O  O     . LYS C 3 546 ? 26.951 24.535  8.460   1.00 56.37 ? 552  LYS A O     1 
ATOM   4436 C  CB    . LYS C 3 546 ? 27.600 27.518  9.626   1.00 56.47 ? 552  LYS A CB    1 
ATOM   4437 N  N     . LYS C 3 547 ? 25.101 25.803  8.714   1.00 55.80 ? 553  LYS A N     1 
ATOM   4438 C  CA    . LYS C 3 547 ? 24.207 24.670  8.948   1.00 55.80 ? 553  LYS A CA    1 
ATOM   4439 C  C     . LYS C 3 547 ? 23.805 23.975  7.646   1.00 55.45 ? 553  LYS A C     1 
ATOM   4440 O  O     . LYS C 3 547 ? 23.864 22.744  7.545   1.00 54.87 ? 553  LYS A O     1 
ATOM   4441 C  CB    . LYS C 3 547 ? 22.951 25.137  9.692   1.00 55.42 ? 553  LYS A CB    1 
ATOM   4442 N  N     . LYS C 3 548 ? 23.394 24.769  6.658   1.00 54.44 ? 554  LYS A N     1 
ATOM   4443 C  CA    . LYS C 3 548 ? 22.981 24.240  5.360   1.00 53.71 ? 554  LYS A CA    1 
ATOM   4444 C  C     . LYS C 3 548 ? 24.079 23.361  4.774   1.00 53.49 ? 554  LYS A C     1 
ATOM   4445 O  O     . LYS C 3 548 ? 23.801 22.359  4.109   1.00 52.26 ? 554  LYS A O     1 
ATOM   4446 C  CB    . LYS C 3 548 ? 22.671 25.388  4.393   1.00 52.23 ? 554  LYS A CB    1 
ATOM   4447 N  N     . PHE C 3 549 ? 25.324 23.747  5.040   1.00 54.33 ? 555  PHE A N     1 
ATOM   4448 C  CA    . PHE C 3 549 ? 26.492 23.018  4.553   1.00 55.02 ? 555  PHE A CA    1 
ATOM   4449 C  C     . PHE C 3 549 ? 26.861 21.833  5.447   1.00 54.69 ? 555  PHE A C     1 
ATOM   4450 O  O     . PHE C 3 549 ? 27.358 20.816  4.957   1.00 55.22 ? 555  PHE A O     1 
ATOM   4451 C  CB    . PHE C 3 549 ? 27.690 23.965  4.432   1.00 55.58 ? 555  PHE A CB    1 
ATOM   4452 N  N     . LEU C 3 550 ? 26.629 21.964  6.751   1.00 54.14 ? 556  LEU A N     1 
ATOM   4453 C  CA    . LEU C 3 550 ? 26.934 20.878  7.681   1.00 54.46 ? 556  LEU A CA    1 
ATOM   4454 C  C     . LEU C 3 550 ? 25.872 19.789  7.540   1.00 54.66 ? 556  LEU A C     1 
ATOM   4455 O  O     . LEU C 3 550 ? 26.189 18.596  7.459   1.00 55.18 ? 556  LEU A O     1 
ATOM   4456 C  CB    . LEU C 3 550 ? 26.964 21.388  9.125   1.00 53.27 ? 556  LEU A CB    1 
ATOM   4457 N  N     . GLU C 3 551 ? 24.610 20.210  7.501   1.00 55.05 ? 557  GLU A N     1 
ATOM   4458 C  CA    . GLU C 3 551 ? 23.491 19.281  7.356   1.00 55.06 ? 557  GLU A CA    1 
ATOM   4459 C  C     . GLU C 3 551 ? 23.638 18.489  6.059   1.00 55.26 ? 557  GLU A C     1 
ATOM   4460 O  O     . GLU C 3 551 ? 23.238 17.324  5.979   1.00 55.03 ? 557  GLU A O     1 
ATOM   4461 C  CB    . GLU C 3 551 ? 22.167 20.049  7.346   1.00 55.05 ? 557  GLU A CB    1 
ATOM   4462 N  N     . ASN C 3 552 ? 24.216 19.131  5.045   1.00 55.01 ? 558  ASN A N     1 
ATOM   4463 C  CA    . ASN C 3 552 ? 24.434 18.491  3.752   1.00 54.23 ? 558  ASN A CA    1 
ATOM   4464 C  C     . ASN C 3 552 ? 25.420 17.337  3.916   1.00 54.06 ? 558  ASN A C     1 
ATOM   4465 O  O     . ASN C 3 552 ? 25.239 16.269  3.328   1.00 53.36 ? 558  ASN A O     1 
ATOM   4466 C  CB    . ASN C 3 552 ? 24.979 19.505  2.742   1.00 54.35 ? 558  ASN A CB    1 
ATOM   4467 N  N     . THR C 3 553 ? 26.461 17.558  4.718   1.00 53.61 ? 559  THR A N     1 
ATOM   4468 C  CA    . THR C 3 553 ? 27.467 16.529  4.976   1.00 53.84 ? 559  THR A CA    1 
ATOM   4469 C  C     . THR C 3 553 ? 27.595 16.266  6.478   1.00 53.20 ? 559  THR A C     1 
ATOM   4470 O  O     . THR C 3 553 ? 28.438 16.859  7.150   1.00 54.16 ? 559  THR A O     1 
ATOM   4471 C  CB    . THR C 3 553 ? 28.851 16.942  4.427   1.00 53.58 ? 559  THR A CB    1 
ATOM   4472 N  N     . PRO C 3 554 ? 26.746 15.378  7.025   1.00 51.74 ? 560  PRO A N     1 
ATOM   4473 C  CA    . PRO C 3 554 ? 26.758 15.031  8.452   1.00 50.82 ? 560  PRO A CA    1 
ATOM   4474 C  C     . PRO C 3 554 ? 27.973 14.244  8.954   1.00 49.38 ? 560  PRO A C     1 
ATOM   4475 O  O     . PRO C 3 554 ? 28.377 14.407  10.105  1.00 49.60 ? 560  PRO A O     1 
ATOM   4476 C  CB    . PRO C 3 554 ? 25.450 14.255  8.629   1.00 51.23 ? 560  PRO A CB    1 
ATOM   4477 C  CG    . PRO C 3 554 ? 25.254 13.615  7.291   1.00 51.64 ? 560  PRO A CG    1 
ATOM   4478 C  CD    . PRO C 3 554 ? 25.596 14.750  6.350   1.00 52.21 ? 560  PRO A CD    1 
ATOM   4479 N  N     . ALA C 3 555 ? 28.547 13.392  8.103   1.00 48.04 ? 561  ALA A N     1 
ATOM   4480 C  CA    . ALA C 3 555 ? 29.713 12.587  8.482   1.00 45.26 ? 561  ALA A CA    1 
ATOM   4481 C  C     . ALA C 3 555 ? 30.900 13.439  8.936   1.00 43.46 ? 561  ALA A C     1 
ATOM   4482 O  O     . ALA C 3 555 ? 31.852 12.926  9.525   1.00 42.42 ? 561  ALA A O     1 
ATOM   4483 C  CB    . ALA C 3 555 ? 30.134 11.693  7.323   1.00 45.73 ? 561  ALA A CB    1 
ATOM   4484 N  N     . ILE C 3 556 ? 30.848 14.733  8.641   1.00 42.47 ? 562  ILE A N     1 
ATOM   4485 C  CA    . ILE C 3 556 ? 31.904 15.650  9.047   1.00 41.34 ? 562  ILE A CA    1 
ATOM   4486 C  C     . ILE C 3 556 ? 31.944 15.688  10.576  1.00 41.16 ? 562  ILE A C     1 
ATOM   4487 O  O     . ILE C 3 556 ? 33.008 15.830  11.177  1.00 40.80 ? 562  ILE A O     1 
ATOM   4488 C  CB    . ILE C 3 556 ? 31.644 17.089  8.522   1.00 41.25 ? 562  ILE A CB    1 
ATOM   4489 C  CG1   . ILE C 3 556 ? 31.776 17.127  6.996   1.00 40.79 ? 562  ILE A CG1   1 
ATOM   4490 C  CG2   . ILE C 3 556 ? 32.618 18.068  9.167   1.00 39.84 ? 562  ILE A CG2   1 
ATOM   4491 N  N     . ALA C 3 557 ? 30.775 15.557  11.198  1.00 40.07 ? 563  ALA A N     1 
ATOM   4492 C  CA    . ALA C 3 557 ? 30.675 15.577  12.653  1.00 39.13 ? 563  ALA A CA    1 
ATOM   4493 C  C     . ALA C 3 557 ? 31.297 14.313  13.234  1.00 37.94 ? 563  ALA A C     1 
ATOM   4494 O  O     . ALA C 3 557 ? 32.031 14.364  14.219  1.00 38.69 ? 563  ALA A O     1 
ATOM   4495 C  CB    . ALA C 3 557 ? 29.204 15.691  13.077  1.00 40.23 ? 563  ALA A CB    1 
ATOM   4496 N  N     . ALA C 3 558 ? 30.999 13.176  12.619  1.00 37.26 ? 564  ALA A N     1 
ATOM   4497 C  CA    . ALA C 3 558 ? 31.550 11.906  13.073  1.00 36.57 ? 564  ALA A CA    1 
ATOM   4498 C  C     . ALA C 3 558 ? 33.084 11.942  13.021  1.00 35.85 ? 564  ALA A C     1 
ATOM   4499 O  O     . ALA C 3 558 ? 33.752 11.506  13.963  1.00 34.81 ? 564  ALA A O     1 
ATOM   4500 C  CB    . ALA C 3 558 ? 31.017 10.773  12.211  1.00 35.34 ? 564  ALA A CB    1 
ATOM   4501 N  N     . LEU C 3 559 ? 33.639 12.465  11.927  1.00 36.06 ? 565  LEU A N     1 
ATOM   4502 C  CA    . LEU C 3 559 ? 35.094 12.561  11.783  1.00 34.84 ? 565  LEU A CA    1 
ATOM   4503 C  C     . LEU C 3 559 ? 35.666 13.418  12.905  1.00 37.02 ? 565  LEU A C     1 
ATOM   4504 O  O     . LEU C 3 559 ? 36.671 13.061  13.517  1.00 37.24 ? 565  LEU A O     1 
ATOM   4505 C  CB    . LEU C 3 559 ? 35.461 13.168  10.427  1.00 33.02 ? 565  LEU A CB    1 
ATOM   4506 C  CG    . LEU C 3 559 ? 36.937 13.494  10.150  1.00 32.24 ? 565  LEU A CG    1 
ATOM   4507 C  CD1   . LEU C 3 559 ? 37.819 12.278  10.382  1.00 30.42 ? 565  LEU A CD1   1 
ATOM   4508 C  CD2   . LEU C 3 559 ? 37.067 13.967  8.717   1.00 31.05 ? 565  LEU A CD2   1 
ATOM   4509 N  N     . ARG C 3 560 ? 35.015 14.547  13.176  1.00 37.71 ? 566  ARG A N     1 
ATOM   4510 C  CA    . ARG C 3 560 ? 35.451 15.446  14.236  1.00 40.06 ? 566  ARG A CA    1 
ATOM   4511 C  C     . ARG C 3 560 ? 35.460 14.720  15.576  1.00 40.38 ? 566  ARG A C     1 
ATOM   4512 O  O     . ARG C 3 560 ? 36.462 14.720  16.292  1.00 40.12 ? 566  ARG A O     1 
ATOM   4513 C  CB    . ARG C 3 560 ? 34.523 16.659  14.324  1.00 41.49 ? 566  ARG A CB    1 
ATOM   4514 C  CG    . ARG C 3 560 ? 34.798 17.734  13.300  1.00 42.82 ? 566  ARG A CG    1 
ATOM   4515 C  CD    . ARG C 3 560 ? 33.699 18.785  13.313  1.00 47.34 ? 566  ARG A CD    1 
ATOM   4516 N  NE    . ARG C 3 560 ? 34.030 19.930  12.467  1.00 48.96 ? 566  ARG A NE    1 
ATOM   4517 C  CZ    . ARG C 3 560 ? 33.130 20.706  11.872  1.00 49.79 ? 566  ARG A CZ    1 
ATOM   4518 N  NH1   . ARG C 3 560 ? 31.832 20.464  12.026  1.00 49.77 ? 566  ARG A NH1   1 
ATOM   4519 N  NH2   . ARG C 3 560 ? 33.528 21.722  11.117  1.00 51.06 ? 566  ARG A NH2   1 
ATOM   4520 N  N     . GLU C 3 561 ? 34.326 14.114  15.910  1.00 41.29 ? 567  GLU A N     1 
ATOM   4521 C  CA    . GLU C 3 561 ? 34.187 13.367  17.155  1.00 41.95 ? 567  GLU A CA    1 
ATOM   4522 C  C     . GLU C 3 561 ? 35.347 12.383  17.302  1.00 41.27 ? 567  GLU A C     1 
ATOM   4523 O  O     . GLU C 3 561 ? 36.102 12.425  18.274  1.00 41.87 ? 567  GLU A O     1 
ATOM   4524 C  CB    . GLU C 3 561 ? 32.874 12.575  17.153  1.00 42.58 ? 567  GLU A CB    1 
ATOM   4525 C  CG    . GLU C 3 561 ? 31.602 13.395  17.251  1.00 44.70 ? 567  GLU A CG    1 
ATOM   4526 C  CD    . GLU C 3 561 ? 30.366 12.553  16.955  1.00 45.66 ? 567  GLU A CD    1 
ATOM   4527 O  OE1   . GLU C 3 561 ? 30.312 11.394  17.430  1.00 44.35 ? 567  GLU A OE1   1 
ATOM   4528 O  OE2   . GLU C 3 561 ? 29.452 13.049  16.251  1.00 46.41 ? 567  GLU A OE2   1 
ATOM   4529 N  N     . SER C 3 562 ? 35.472 11.497  16.321  1.00 40.58 ? 568  SER A N     1 
ATOM   4530 C  CA    . SER C 3 562 ? 36.511 10.484  16.327  1.00 40.92 ? 568  SER A CA    1 
ATOM   4531 C  C     . SER C 3 562 ? 37.895 11.102  16.553  1.00 41.37 ? 568  SER A C     1 
ATOM   4532 O  O     . SER C 3 562 ? 38.734 10.524  17.246  1.00 41.47 ? 568  SER A O     1 
ATOM   4533 C  CB    . SER C 3 562 ? 36.476 9.714   15.009  1.00 40.69 ? 568  SER A CB    1 
ATOM   4534 O  OG    . SER C 3 562 ? 37.177 8.490   15.117  1.00 45.85 ? 568  SER A OG    1 
ATOM   4535 N  N     . ILE C 3 563 ? 38.131 12.278  15.976  1.00 41.29 ? 569  ILE A N     1 
ATOM   4536 C  CA    . ILE C 3 563 ? 39.414 12.949  16.150  1.00 41.90 ? 569  ILE A CA    1 
ATOM   4537 C  C     . ILE C 3 563 ? 39.581 13.378  17.603  1.00 42.39 ? 569  ILE A C     1 
ATOM   4538 O  O     . ILE C 3 563 ? 40.594 13.087  18.235  1.00 42.15 ? 569  ILE A O     1 
ATOM   4539 C  CB    . ILE C 3 563 ? 39.535 14.194  15.244  1.00 40.59 ? 569  ILE A CB    1 
ATOM   4540 C  CG1   . ILE C 3 563 ? 39.620 13.768  13.777  1.00 39.42 ? 569  ILE A CG1   1 
ATOM   4541 C  CG2   . ILE C 3 563 ? 40.772 14.997  15.627  1.00 41.85 ? 569  ILE A CG2   1 
ATOM   4542 N  N     . GLN C 3 564 ? 38.575 14.076  18.121  1.00 43.82 ? 570  GLN A N     1 
ATOM   4543 C  CA    . GLN C 3 564 ? 38.578 14.553  19.499  1.00 45.24 ? 570  GLN A CA    1 
ATOM   4544 C  C     . GLN C 3 564 ? 38.809 13.421  20.497  1.00 45.34 ? 570  GLN A C     1 
ATOM   4545 O  O     . GLN C 3 564 ? 39.668 13.516  21.379  1.00 44.88 ? 570  GLN A O     1 
ATOM   4546 C  CB    . GLN C 3 564 ? 37.242 15.233  19.812  1.00 46.97 ? 570  GLN A CB    1 
ATOM   4547 C  CG    . GLN C 3 564 ? 37.232 16.741  19.630  1.00 49.74 ? 570  GLN A CG    1 
ATOM   4548 C  CD    . GLN C 3 564 ? 38.016 17.457  20.715  1.00 49.95 ? 570  GLN A CD    1 
ATOM   4549 O  OE1   . GLN C 3 564 ? 37.755 17.279  21.908  1.00 50.80 ? 570  GLN A OE1   1 
ATOM   4550 N  NE2   . GLN C 3 564 ? 38.980 18.273  20.309  1.00 51.28 ? 570  GLN A NE2   1 
ATOM   4551 N  N     . GLN C 3 565 ? 38.033 12.352  20.354  1.00 45.37 ? 571  GLN A N     1 
ATOM   4552 C  CA    . GLN C 3 565 ? 38.132 11.202  21.247  1.00 45.88 ? 571  GLN A CA    1 
ATOM   4553 C  C     . GLN C 3 565 ? 39.519 10.566  21.239  1.00 45.75 ? 571  GLN A C     1 
ATOM   4554 O  O     . GLN C 3 565 ? 39.971 10.022  22.247  1.00 46.64 ? 571  GLN A O     1 
ATOM   4555 C  CB    . GLN C 3 565 ? 37.082 10.152  20.867  1.00 45.73 ? 571  GLN A CB    1 
ATOM   4556 N  N     . THR C 3 566 ? 40.196 10.633  20.102  1.00 45.25 ? 572  THR A N     1 
ATOM   4557 C  CA    . THR C 3 566 ? 41.520 10.049  19.991  1.00 44.72 ? 572  THR A CA    1 
ATOM   4558 C  C     . THR C 3 566 ? 42.593 10.911  20.651  1.00 43.33 ? 572  THR A C     1 
ATOM   4559 O  O     . THR C 3 566 ? 43.574 10.389  21.177  1.00 42.42 ? 572  THR A O     1 
ATOM   4560 C  CB    . THR C 3 566 ? 41.900 9.835   18.514  1.00 45.45 ? 572  THR A CB    1 
ATOM   4561 O  OG1   . THR C 3 566 ? 40.998 8.895   17.922  1.00 47.45 ? 572  THR A OG1   1 
ATOM   4562 C  CG2   . THR C 3 566 ? 43.318 9.308   18.393  1.00 45.48 ? 572  THR A CG2   1 
ATOM   4563 N  N     . LEU C 3 567 ? 42.396 12.225  20.638  1.00 42.56 ? 573  LEU A N     1 
ATOM   4564 C  CA    . LEU C 3 567 ? 43.380 13.148  21.201  1.00 42.07 ? 573  LEU A CA    1 
ATOM   4565 C  C     . LEU C 3 567 ? 43.113 13.635  22.620  1.00 43.53 ? 573  LEU A C     1 
ATOM   4566 O  O     . LEU C 3 567 ? 43.998 13.587  23.473  1.00 43.12 ? 573  LEU A O     1 
ATOM   4567 C  CB    . LEU C 3 567 ? 43.529 14.367  20.287  1.00 41.06 ? 573  LEU A CB    1 
ATOM   4568 C  CG    . LEU C 3 567 ? 43.823 14.123  18.805  1.00 38.29 ? 573  LEU A CG    1 
ATOM   4569 C  CD1   . LEU C 3 567 ? 43.959 15.456  18.110  1.00 38.58 ? 573  LEU A CD1   1 
ATOM   4570 C  CD2   . LEU C 3 567 ? 45.095 13.307  18.640  1.00 39.43 ? 573  LEU A CD2   1 
ATOM   4571 N  N     . VAL C 3 568 ? 41.899 14.117  22.866  1.00 44.87 ? 574  VAL A N     1 
ATOM   4572 C  CA    . VAL C 3 568 ? 41.527 14.643  24.177  1.00 46.09 ? 574  VAL A CA    1 
ATOM   4573 C  C     . VAL C 3 568 ? 40.900 13.587  25.086  1.00 48.26 ? 574  VAL A C     1 
ATOM   4574 O  O     . VAL C 3 568 ? 40.412 12.557  24.619  1.00 49.27 ? 574  VAL A O     1 
ATOM   4575 C  CB    . VAL C 3 568 ? 40.535 15.824  24.021  1.00 44.90 ? 574  VAL A CB    1 
ATOM   4576 C  CG1   . VAL C 3 568 ? 40.242 16.454  25.373  1.00 44.90 ? 574  VAL A CG1   1 
ATOM   4577 C  CG2   . VAL C 3 568 ? 41.114 16.863  23.067  1.00 44.21 ? 574  VAL A CG2   1 
ATOM   4578 N  N     . GLU C 3 569 ? 40.925 13.847  26.391  1.00 50.14 ? 575  GLU A N     1 
ATOM   4579 C  CA    . GLU C 3 569 ? 40.341 12.934  27.371  1.00 51.23 ? 575  GLU A CA    1 
ATOM   4580 C  C     . GLU C 3 569 ? 39.803 13.720  28.563  1.00 50.98 ? 575  GLU A C     1 
ATOM   4581 O  O     . GLU C 3 569 ? 39.666 14.955  28.417  1.00 51.08 ? 575  GLU A O     1 
ATOM   4582 C  CB    . GLU C 3 569 ? 41.384 11.917  27.850  1.00 51.01 ? 575  GLU A CB    1 
ATOM   4583 N  N     . LYS C 3 581 ? 44.110 18.534  29.053  1.00 43.96 ? 587  LYS A N     1 
ATOM   4584 C  CA    . LYS C 3 581 ? 44.531 17.136  29.377  1.00 44.98 ? 587  LYS A CA    1 
ATOM   4585 C  C     . LYS C 3 581 ? 44.496 16.278  28.123  1.00 45.26 ? 587  LYS A C     1 
ATOM   4586 O  O     . LYS C 3 581 ? 43.427 15.870  27.662  1.00 45.17 ? 587  LYS A O     1 
ATOM   4587 C  CB    . LYS C 3 581 ? 43.608 16.530  30.433  1.00 46.23 ? 587  LYS A CB    1 
ATOM   4588 N  N     . TRP C 3 582 ? 45.674 16.000  27.577  1.00 44.51 ? 588  TRP A N     1 
ATOM   4589 C  CA    . TRP C 3 582 ? 45.774 15.209  26.363  1.00 43.51 ? 588  TRP A CA    1 
ATOM   4590 C  C     . TRP C 3 582 ? 45.986 13.719  26.568  1.00 43.41 ? 588  TRP A C     1 
ATOM   4591 O  O     . TRP C 3 582 ? 46.640 13.280  27.515  1.00 43.49 ? 588  TRP A O     1 
ATOM   4592 C  CB    . TRP C 3 582 ? 46.899 15.741  25.479  1.00 41.68 ? 588  TRP A CB    1 
ATOM   4593 C  CG    . TRP C 3 582 ? 46.733 17.165  25.079  1.00 39.37 ? 588  TRP A CG    1 
ATOM   4594 C  CD1   . TRP C 3 582 ? 47.100 18.265  25.795  1.00 39.78 ? 588  TRP A CD1   1 
ATOM   4595 C  CD2   . TRP C 3 582 ? 46.175 17.651  23.855  1.00 39.44 ? 588  TRP A CD2   1 
ATOM   4596 N  NE1   . TRP C 3 582 ? 46.813 19.408  25.090  1.00 39.19 ? 588  TRP A NE1   1 
ATOM   4597 C  CE2   . TRP C 3 582 ? 46.242 19.060  23.896  1.00 38.99 ? 588  TRP A CE2   1 
ATOM   4598 C  CE3   . TRP C 3 582 ? 45.627 17.032  22.725  1.00 37.94 ? 588  TRP A CE3   1 
ATOM   4599 C  CZ2   . TRP C 3 582 ? 45.780 19.864  22.848  1.00 39.20 ? 588  TRP A CZ2   1 
ATOM   4600 C  CZ3   . TRP C 3 582 ? 45.168 17.832  21.683  1.00 38.58 ? 588  TRP A CZ3   1 
ATOM   4601 C  CH2   . TRP C 3 582 ? 45.249 19.234  21.754  1.00 38.70 ? 588  TRP A CH2   1 
ATOM   4602 N  N     . LYS C 3 583 ? 45.417 12.953  25.648  1.00 43.09 ? 589  LYS A N     1 
ATOM   4603 C  CA    . LYS C 3 583 ? 45.534 11.505  25.641  1.00 43.79 ? 589  LYS A CA    1 
ATOM   4604 C  C     . LYS C 3 583 ? 46.779 11.267  24.792  1.00 43.80 ? 589  LYS A C     1 
ATOM   4605 O  O     . LYS C 3 583 ? 47.575 10.362  25.052  1.00 44.31 ? 589  LYS A O     1 
ATOM   4606 C  CB    . LYS C 3 583 ? 44.295 10.908  24.972  1.00 44.35 ? 589  LYS A CB    1 
ATOM   4607 C  CG    . LYS C 3 583 ? 44.154 9.401   25.077  1.00 45.33 ? 589  LYS A CG    1 
ATOM   4608 C  CD    . LYS C 3 583 ? 42.775 8.960   24.588  1.00 44.19 ? 589  LYS A CD    1 
ATOM   4609 C  CE    . LYS C 3 583 ? 41.659 9.607   25.407  1.00 44.35 ? 589  LYS A CE    1 
ATOM   4610 N  NZ    . LYS C 3 583 ? 40.297 9.241   24.923  1.00 42.76 ? 589  LYS A NZ    1 
ATOM   4611 N  N     . ARG C 3 584 ? 46.930 12.126  23.787  1.00 43.50 ? 590  ARG A N     1 
ATOM   4612 C  CA    . ARG C 3 584 ? 48.047 12.123  22.843  1.00 41.91 ? 590  ARG A CA    1 
ATOM   4613 C  C     . ARG C 3 584 ? 47.964 13.472  22.139  1.00 40.78 ? 590  ARG A C     1 
ATOM   4614 O  O     . ARG C 3 584 ? 46.900 13.852  21.646  1.00 40.50 ? 590  ARG A O     1 
ATOM   4615 C  CB    . ARG C 3 584 ? 47.900 10.985  21.829  1.00 42.60 ? 590  ARG A CB    1 
ATOM   4616 C  CG    . ARG C 3 584 ? 48.915 11.028  20.697  1.00 44.86 ? 590  ARG A CG    1 
ATOM   4617 C  CD    . ARG C 3 584 ? 49.239 9.641   20.185  1.00 46.10 ? 590  ARG A CD    1 
ATOM   4618 N  NE    . ARG C 3 584 ? 48.050 8.913   19.760  1.00 49.09 ? 590  ARG A NE    1 
ATOM   4619 C  CZ    . ARG C 3 584 ? 47.428 9.087   18.598  1.00 49.05 ? 590  ARG A CZ    1 
ATOM   4620 N  NH1   . ARG C 3 584 ? 47.881 9.973   17.722  1.00 48.67 ? 590  ARG A NH1   1 
ATOM   4621 N  NH2   . ARG C 3 584 ? 46.347 8.371   18.315  1.00 49.30 ? 590  ARG A NH2   1 
ATOM   4622 N  N     . ARG C 3 585 ? 49.067 14.207  22.084  1.00 38.67 ? 591  ARG A N     1 
ATOM   4623 C  CA    . ARG C 3 585 ? 49.008 15.517  21.457  1.00 37.59 ? 591  ARG A CA    1 
ATOM   4624 C  C     . ARG C 3 585 ? 49.506 15.589  20.012  1.00 35.11 ? 591  ARG A C     1 
ATOM   4625 O  O     . ARG C 3 585 ? 49.871 16.658  19.531  1.00 32.81 ? 591  ARG A O     1 
ATOM   4626 C  CB    . ARG C 3 585 ? 49.736 16.547  22.325  1.00 40.39 ? 591  ARG A CB    1 
ATOM   4627 C  CG    . ARG C 3 585 ? 49.282 17.986  22.050  1.00 43.62 ? 591  ARG A CG    1 
ATOM   4628 C  CD    . ARG C 3 585 ? 49.957 18.995  22.965  1.00 46.25 ? 591  ARG A CD    1 
ATOM   4629 N  NE    . ARG C 3 585 ? 49.524 20.362  22.680  1.00 46.53 ? 591  ARG A NE    1 
ATOM   4630 C  CZ    . ARG C 3 585 ? 49.951 21.431  23.342  1.00 48.27 ? 591  ARG A CZ    1 
ATOM   4631 N  NH1   . ARG C 3 585 ? 50.826 21.294  24.333  1.00 50.26 ? 591  ARG A NH1   1 
ATOM   4632 N  NH2   . ARG C 3 585 ? 49.502 22.638  23.019  1.00 49.75 ? 591  ARG A NH2   1 
ATOM   4633 N  N     . TRP C 3 586 ? 49.520 14.452  19.322  1.00 32.68 ? 592  TRP A N     1 
ATOM   4634 C  CA    . TRP C 3 586 ? 49.934 14.427  17.923  1.00 31.41 ? 592  TRP A CA    1 
ATOM   4635 C  C     . TRP C 3 586 ? 49.092 13.451  17.121  1.00 31.13 ? 592  TRP A C     1 
ATOM   4636 O  O     . TRP C 3 586 ? 48.513 12.515  17.671  1.00 32.16 ? 592  TRP A O     1 
ATOM   4637 C  CB    . TRP C 3 586 ? 51.416 14.054  17.765  1.00 28.14 ? 592  TRP A CB    1 
ATOM   4638 C  CG    . TRP C 3 586 ? 51.813 12.768  18.418  1.00 26.84 ? 592  TRP A CG    1 
ATOM   4639 C  CD1   . TRP C 3 586 ? 52.304 12.611  19.684  1.00 26.17 ? 592  TRP A CD1   1 
ATOM   4640 C  CD2   . TRP C 3 586 ? 51.740 11.456  17.852  1.00 26.93 ? 592  TRP A CD2   1 
ATOM   4641 N  NE1   . TRP C 3 586 ? 52.542 11.287  19.941  1.00 26.65 ? 592  TRP A NE1   1 
ATOM   4642 C  CE2   . TRP C 3 586 ? 52.204 10.551  18.836  1.00 27.85 ? 592  TRP A CE2   1 
ATOM   4643 C  CE3   . TRP C 3 586 ? 51.330 10.953  16.611  1.00 27.42 ? 592  TRP A CE3   1 
ATOM   4644 C  CZ2   . TRP C 3 586 ? 52.268 9.174   18.619  1.00 25.94 ? 592  TRP A CZ2   1 
ATOM   4645 C  CZ3   . TRP C 3 586 ? 51.395 9.577   16.393  1.00 28.43 ? 592  TRP A CZ3   1 
ATOM   4646 C  CH2   . TRP C 3 586 ? 51.861 8.705   17.395  1.00 28.71 ? 592  TRP A CH2   1 
ATOM   4647 N  N     . ILE C 3 587 ? 49.031 13.691  15.816  1.00 30.32 ? 593  ILE A N     1 
ATOM   4648 C  CA    . ILE C 3 587 ? 48.288 12.855  14.892  1.00 29.97 ? 593  ILE A CA    1 
ATOM   4649 C  C     . ILE C 3 587 ? 49.283 12.226  13.923  1.00 29.85 ? 593  ILE A C     1 
ATOM   4650 O  O     . ILE C 3 587 ? 50.296 12.839  13.580  1.00 30.21 ? 593  ILE A O     1 
ATOM   4651 C  CB    . ILE C 3 587 ? 47.250 13.686  14.111  1.00 30.70 ? 593  ILE A CB    1 
ATOM   4652 C  CG1   . ILE C 3 587 ? 46.073 14.025  15.025  1.00 30.43 ? 593  ILE A CG1   1 
ATOM   4653 C  CG2   . ILE C 3 587 ? 46.768 12.918  12.894  1.00 33.38 ? 593  ILE A CG2   1 
ATOM   4654 N  N     . LYS C 3 588 ? 48.989 11.004  13.490  1.00 28.68 ? 594  LYS A N     1 
ATOM   4655 C  CA    . LYS C 3 588 ? 49.856 10.273  12.575  1.00 28.23 ? 594  LYS A CA    1 
ATOM   4656 C  C     . LYS C 3 588 ? 49.628 10.693  11.129  1.00 27.53 ? 594  LYS A C     1 
ATOM   4657 O  O     . LYS C 3 588 ? 48.540 10.503  10.585  1.00 27.19 ? 594  LYS A O     1 
ATOM   4658 C  CB    . LYS C 3 588 ? 49.611 8.767   12.733  1.00 31.28 ? 594  LYS A CB    1 
ATOM   4659 C  CG    . LYS C 3 588 ? 50.456 7.882   11.829  1.00 32.44 ? 594  LYS A CG    1 
ATOM   4660 C  CD    . LYS C 3 588 ? 50.293 6.413   12.204  1.00 35.21 ? 594  LYS A CD    1 
ATOM   4661 C  CE    . LYS C 3 588 ? 50.925 6.119   13.566  1.00 37.89 ? 594  LYS A CE    1 
ATOM   4662 N  NZ    . LYS C 3 588 ? 50.821 4.671   13.954  1.00 39.86 ? 594  LYS A NZ    1 
ATOM   4663 N  N     . GLY C 3 589 ? 50.662 11.260  10.510  1.00 26.18 ? 595  GLY A N     1 
ATOM   4664 C  CA    . GLY C 3 589 ? 50.553 11.711  9.132   1.00 25.33 ? 595  GLY A CA    1 
ATOM   4665 C  C     . GLY C 3 589 ? 50.524 10.569  8.138   1.00 24.78 ? 595  GLY A C     1 
ATOM   4666 O  O     . GLY C 3 589 ? 50.751 9.418   8.504   1.00 26.41 ? 595  GLY A O     1 
ATOM   4667 N  N     . LEU C 3 590 ? 50.257 10.885  6.874   1.00 23.65 ? 596  LEU A N     1 
ATOM   4668 C  CA    . LEU C 3 590 ? 50.185 9.867   5.831   1.00 23.98 ? 596  LEU A CA    1 
ATOM   4669 C  C     . LEU C 3 590 ? 51.444 9.008   5.689   1.00 24.69 ? 596  LEU A C     1 
ATOM   4670 O  O     . LEU C 3 590 ? 51.366 7.866   5.236   1.00 24.17 ? 596  LEU A O     1 
ATOM   4671 C  CB    . LEU C 3 590 ? 49.854 10.511  4.481   1.00 24.29 ? 596  LEU A CB    1 
ATOM   4672 C  CG    . LEU C 3 590 ? 48.481 11.182  4.354   1.00 22.92 ? 596  LEU A CG    1 
ATOM   4673 C  CD1   . LEU C 3 590 ? 48.355 11.819  2.987   1.00 23.34 ? 596  LEU A CD1   1 
ATOM   4674 C  CD2   . LEU C 3 590 ? 47.375 10.156  4.561   1.00 24.79 ? 596  LEU A CD2   1 
ATOM   4675 N  N     . ASP C 3 591 ? 52.602 9.543   6.063   1.00 23.21 ? 597  ASP A N     1 
ATOM   4676 C  CA    . ASP C 3 591 ? 53.817 8.756   5.947   1.00 22.93 ? 597  ASP A CA    1 
ATOM   4677 C  C     . ASP C 3 591 ? 54.272 8.250   7.305   1.00 22.35 ? 597  ASP A C     1 
ATOM   4678 O  O     . ASP C 3 591 ? 55.404 7.802   7.456   1.00 21.34 ? 597  ASP A O     1 
ATOM   4679 C  CB    . ASP C 3 591 ? 54.937 9.555   5.267   1.00 24.71 ? 597  ASP A CB    1 
ATOM   4680 C  CG    . ASP C 3 591 ? 55.305 10.822  6.021   1.00 24.47 ? 597  ASP A CG    1 
ATOM   4681 O  OD1   . ASP C 3 591 ? 54.926 10.970  7.200   1.00 28.76 ? 597  ASP A OD1   1 
ATOM   4682 O  OD2   . ASP C 3 591 ? 55.991 11.669  5.431   1.00 26.16 ? 597  ASP A OD2   1 
ATOM   4683 N  N     . GLY C 3 592 ? 53.379 8.343   8.290   1.00 23.66 ? 598  GLY A N     1 
ATOM   4684 C  CA    . GLY C 3 592 ? 53.672 7.855   9.630   1.00 23.45 ? 598  GLY A CA    1 
ATOM   4685 C  C     . GLY C 3 592 ? 54.261 8.801   10.666  1.00 24.82 ? 598  GLY A C     1 
ATOM   4686 O  O     . GLY C 3 592 ? 54.281 8.472   11.848  1.00 24.41 ? 598  GLY A O     1 
ATOM   4687 N  N     . ARG C 3 593 ? 54.735 9.970   10.251  1.00 25.83 ? 599  ARG A N     1 
ATOM   4688 C  CA    . ARG C 3 593 ? 55.337 10.899  11.204  1.00 25.78 ? 599  ARG A CA    1 
ATOM   4689 C  C     . ARG C 3 593 ? 54.319 11.431  12.199  1.00 26.15 ? 599  ARG A C     1 
ATOM   4690 O  O     . ARG C 3 593 ? 53.118 11.304  11.983  1.00 24.14 ? 599  ARG A O     1 
ATOM   4691 C  CB    . ARG C 3 593 ? 55.968 12.081  10.469  1.00 24.49 ? 599  ARG A CB    1 
ATOM   4692 C  CG    . ARG C 3 593 ? 54.965 13.063  9.888   1.00 24.91 ? 599  ARG A CG    1 
ATOM   4693 C  CD    . ARG C 3 593 ? 55.290 13.309  8.440   1.00 25.96 ? 599  ARG A CD    1 
ATOM   4694 N  NE    . ARG C 3 593 ? 55.801 14.641  8.212   1.00 28.99 ? 599  ARG A NE    1 
ATOM   4695 C  CZ    . ARG C 3 593 ? 56.561 14.976  7.176   1.00 28.54 ? 599  ARG A CZ    1 
ATOM   4696 N  NH1   . ARG C 3 593 ? 56.900 14.066  6.272   1.00 23.23 ? 599  ARG A NH1   1 
ATOM   4697 N  NH2   . ARG C 3 593 ? 56.977 16.224  7.051   1.00 27.22 ? 599  ARG A NH2   1 
ATOM   4698 N  N     . LYS C 3 594 ? 54.811 12.016  13.289  1.00 25.85 ? 600  LYS A N     1 
ATOM   4699 C  CA    . LYS C 3 594 ? 53.942 12.625  14.295  1.00 26.63 ? 600  LYS A CA    1 
ATOM   4700 C  C     . LYS C 3 594 ? 53.642 14.035  13.818  1.00 27.52 ? 600  LYS A C     1 
ATOM   4701 O  O     . LYS C 3 594 ? 54.549 14.764  13.400  1.00 27.07 ? 600  LYS A O     1 
ATOM   4702 C  CB    . LYS C 3 594 ? 54.634 12.758  15.653  1.00 26.12 ? 600  LYS A CB    1 
ATOM   4703 C  CG    . LYS C 3 594 ? 55.066 11.472  16.327  1.00 27.01 ? 600  LYS A CG    1 
ATOM   4704 C  CD    . LYS C 3 594 ? 55.616 11.805  17.716  1.00 29.57 ? 600  LYS A CD    1 
ATOM   4705 C  CE    . LYS C 3 594 ? 56.152 10.585  18.429  1.00 30.16 ? 600  LYS A CE    1 
ATOM   4706 N  NZ    . LYS C 3 594 ? 56.580 10.931  19.806  1.00 31.97 ? 600  LYS A NZ    1 
ATOM   4707 N  N     . VAL C 3 595 ? 52.376 14.422  13.876  1.00 26.71 ? 601  VAL A N     1 
ATOM   4708 C  CA    . VAL C 3 595 ? 51.991 15.761  13.477  1.00 26.02 ? 601  VAL A CA    1 
ATOM   4709 C  C     . VAL C 3 595 ? 51.417 16.419  14.719  1.00 26.78 ? 601  VAL A C     1 
ATOM   4710 O  O     . VAL C 3 595 ? 50.307 16.098  15.161  1.00 25.25 ? 601  VAL A O     1 
ATOM   4711 C  CB    . VAL C 3 595 ? 50.935 15.740  12.361  1.00 27.00 ? 601  VAL A CB    1 
ATOM   4712 C  CG1   . VAL C 3 595 ? 50.686 17.167  11.861  1.00 24.37 ? 601  VAL A CG1   1 
ATOM   4713 C  CG2   . VAL C 3 595 ? 51.406 14.840  11.221  1.00 25.42 ? 601  VAL A CG2   1 
ATOM   4714 N  N     . HIS C 3 596 ? 52.191 17.333  15.290  1.00 26.05 ? 602  HIS A N     1 
ATOM   4715 C  CA    . HIS C 3 596 ? 51.790 18.029  16.501  1.00 27.45 ? 602  HIS A CA    1 
ATOM   4716 C  C     . HIS C 3 596 ? 50.458 18.763  16.366  1.00 27.64 ? 602  HIS A C     1 
ATOM   4717 O  O     . HIS C 3 596 ? 50.227 19.464  15.388  1.00 27.11 ? 602  HIS A O     1 
ATOM   4718 C  CB    . HIS C 3 596 ? 52.884 19.015  16.899  1.00 28.04 ? 602  HIS A CB    1 
ATOM   4719 C  CG    . HIS C 3 596 ? 52.621 19.718  18.190  1.00 29.61 ? 602  HIS A CG    1 
ATOM   4720 N  ND1   . HIS C 3 596 ? 52.634 19.069  19.405  1.00 30.26 ? 602  HIS A ND1   1 
ATOM   4721 C  CD2   . HIS C 3 596 ? 52.334 21.015  18.458  1.00 29.90 ? 602  HIS A CD2   1 
ATOM   4722 C  CE1   . HIS C 3 596 ? 52.365 19.935  20.366  1.00 30.30 ? 602  HIS A CE1   1 
ATOM   4723 N  NE2   . HIS C 3 596 ? 52.179 21.122  19.818  1.00 29.41 ? 602  HIS A NE2   1 
ATOM   4724 N  N     . VAL C 3 597 ? 49.578 18.586  17.347  1.00 27.70 ? 603  VAL A N     1 
ATOM   4725 C  CA    . VAL C 3 597 ? 48.287 19.262  17.331  1.00 28.48 ? 603  VAL A CA    1 
ATOM   4726 C  C     . VAL C 3 597 ? 48.346 20.368  18.382  1.00 30.93 ? 603  VAL A C     1 
ATOM   4727 O  O     . VAL C 3 597 ? 48.509 20.092  19.566  1.00 31.67 ? 603  VAL A O     1 
ATOM   4728 C  CB    . VAL C 3 597 ? 47.128 18.295  17.671  1.00 29.35 ? 603  VAL A CB    1 
ATOM   4729 C  CG1   . VAL C 3 597 ? 45.810 19.056  17.695  1.00 27.35 ? 603  VAL A CG1   1 
ATOM   4730 C  CG2   . VAL C 3 597 ? 47.059 17.177  16.639  1.00 25.26 ? 603  VAL A CG2   1 
ATOM   4731 N  N     . ARG C 3 598 ? 48.230 21.617  17.941  1.00 32.17 ? 604  ARG A N     1 
ATOM   4732 C  CA    . ARG C 3 598 ? 48.291 22.762  18.848  1.00 35.43 ? 604  ARG A CA    1 
ATOM   4733 C  C     . ARG C 3 598 ? 47.054 22.897  19.728  1.00 36.70 ? 604  ARG A C     1 
ATOM   4734 O  O     . ARG C 3 598 ? 47.168 23.189  20.917  1.00 38.68 ? 604  ARG A O     1 
ATOM   4735 C  CB    . ARG C 3 598 ? 48.529 24.052  18.047  1.00 35.08 ? 604  ARG A CB    1 
ATOM   4736 C  CG    . ARG C 3 598 ? 49.954 24.143  17.503  1.00 37.21 ? 604  ARG A CG    1 
ATOM   4737 C  CD    . ARG C 3 598 ? 50.132 25.203  16.424  1.00 38.12 ? 604  ARG A CD    1 
ATOM   4738 N  NE    . ARG C 3 598 ? 51.535 25.306  16.028  1.00 37.20 ? 604  ARG A NE    1 
ATOM   4739 C  CZ    . ARG C 3 598 ? 51.976 25.989  14.975  1.00 36.81 ? 604  ARG A CZ    1 
ATOM   4740 N  NH1   . ARG C 3 598 ? 51.127 26.640  14.191  1.00 36.42 ? 604  ARG A NH1   1 
ATOM   4741 N  NH2   . ARG C 3 598 ? 53.272 26.025  14.709  1.00 36.05 ? 604  ARG A NH2   1 
ATOM   4742 N  N     . SER C 3 599 ? 45.874 22.688  19.153  1.00 36.74 ? 605  SER A N     1 
ATOM   4743 C  CA    . SER C 3 599 ? 44.647 22.778  19.937  1.00 37.64 ? 605  SER A CA    1 
ATOM   4744 C  C     . SER C 3 599 ? 43.570 21.837  19.432  1.00 37.07 ? 605  SER A C     1 
ATOM   4745 O  O     . SER C 3 599 ? 43.491 21.543  18.243  1.00 37.03 ? 605  SER A O     1 
ATOM   4746 C  CB    . SER C 3 599 ? 44.102 24.210  19.940  1.00 37.70 ? 605  SER A CB    1 
ATOM   4747 O  OG    . SER C 3 599 ? 43.636 24.585  18.657  1.00 38.82 ? 605  SER A OG    1 
ATOM   4748 N  N     . PRO C 3 600 ? 42.722 21.349  20.346  1.00 37.37 ? 606  PRO A N     1 
ATOM   4749 C  CA    . PRO C 3 600 ? 41.627 20.435  20.020  1.00 37.56 ? 606  PRO A CA    1 
ATOM   4750 C  C     . PRO C 3 600 ? 40.752 20.966  18.882  1.00 37.27 ? 606  PRO A C     1 
ATOM   4751 O  O     . PRO C 3 600 ? 40.217 20.193  18.088  1.00 37.43 ? 606  PRO A O     1 
ATOM   4752 C  CB    . PRO C 3 600 ? 40.868 20.336  21.340  1.00 37.36 ? 606  PRO A CB    1 
ATOM   4753 C  CG    . PRO C 3 600 ? 41.965 20.445  22.348  1.00 37.85 ? 606  PRO A CG    1 
ATOM   4754 C  CD    . PRO C 3 600 ? 42.792 21.585  21.800  1.00 37.02 ? 606  PRO A CD    1 
ATOM   4755 N  N     . HIS C 3 601 ? 40.618 22.286  18.803  1.00 37.06 ? 607  HIS A N     1 
ATOM   4756 C  CA    . HIS C 3 601 ? 39.803 22.907  17.763  1.00 37.87 ? 607  HIS A CA    1 
ATOM   4757 C  C     . HIS C 3 601 ? 40.477 22.895  16.389  1.00 37.08 ? 607  HIS A C     1 
ATOM   4758 O  O     . HIS C 3 601 ? 39.809 22.814  15.363  1.00 36.54 ? 607  HIS A O     1 
ATOM   4759 C  CB    . HIS C 3 601 ? 39.464 24.354  18.140  1.00 38.91 ? 607  HIS A CB    1 
ATOM   4760 C  CG    . HIS C 3 601 ? 38.513 25.015  17.190  1.00 41.09 ? 607  HIS A CG    1 
ATOM   4761 N  ND1   . HIS C 3 601 ? 38.803 26.201  16.547  1.00 40.97 ? 607  HIS A ND1   1 
ATOM   4762 C  CD2   . HIS C 3 601 ? 37.274 24.656  16.774  1.00 40.93 ? 607  HIS A CD2   1 
ATOM   4763 C  CE1   . HIS C 3 601 ? 37.784 26.544  15.778  1.00 40.15 ? 607  HIS A CE1   1 
ATOM   4764 N  NE2   . HIS C 3 601 ? 36.844 25.623  15.897  1.00 41.15 ? 607  HIS A NE2   1 
ATOM   4765 N  N     . ALA C 3 602 ? 41.800 22.981  16.366  1.00 35.83 ? 608  ALA A N     1 
ATOM   4766 C  CA    . ALA C 3 602 ? 42.512 22.984  15.097  1.00 35.94 ? 608  ALA A CA    1 
ATOM   4767 C  C     . ALA C 3 602 ? 42.851 21.568  14.612  1.00 34.43 ? 608  ALA A C     1 
ATOM   4768 O  O     . ALA C 3 602 ? 43.476 21.401  13.571  1.00 35.48 ? 608  ALA A O     1 
ATOM   4769 C  CB    . ALA C 3 602 ? 43.781 23.817  15.226  1.00 35.81 ? 608  ALA A CB    1 
ATOM   4770 N  N     . ALA C 3 603 ? 42.412 20.561  15.362  1.00 32.97 ? 609  ALA A N     1 
ATOM   4771 C  CA    . ALA C 3 603 ? 42.678 19.158  15.038  1.00 32.32 ? 609  ALA A CA    1 
ATOM   4772 C  C     . ALA C 3 603 ? 42.305 18.705  13.623  1.00 31.68 ? 609  ALA A C     1 
ATOM   4773 O  O     . ALA C 3 603 ? 43.133 18.116  12.916  1.00 29.60 ? 609  ALA A O     1 
ATOM   4774 C  CB    . ALA C 3 603 ? 41.992 18.260  16.059  1.00 31.23 ? 609  ALA A CB    1 
ATOM   4775 N  N     . LEU C 3 604 ? 41.064 18.955  13.214  1.00 30.46 ? 610  LEU A N     1 
ATOM   4776 C  CA    . LEU C 3 604 ? 40.633 18.549  11.883  1.00 30.75 ? 610  LEU A CA    1 
ATOM   4777 C  C     . LEU C 3 604 ? 41.515 19.196  10.826  1.00 30.67 ? 610  LEU A C     1 
ATOM   4778 O  O     . LEU C 3 604 ? 41.967 18.526  9.892   1.00 29.99 ? 610  LEU A O     1 
ATOM   4779 C  CB    . LEU C 3 604 ? 39.179 18.942  11.634  1.00 31.74 ? 610  LEU A CB    1 
ATOM   4780 C  CG    . LEU C 3 604 ? 38.665 18.623  10.226  1.00 32.82 ? 610  LEU A CG    1 
ATOM   4781 C  CD1   . LEU C 3 604 ? 38.678 17.116  9.992   1.00 32.90 ? 610  LEU A CD1   1 
ATOM   4782 C  CD2   . LEU C 3 604 ? 37.258 19.179  10.059  1.00 34.72 ? 610  LEU A CD2   1 
ATOM   4783 N  N     . ASN C 3 605 ? 41.755 20.497  10.982  1.00 29.95 ? 611  ASN A N     1 
ATOM   4784 C  CA    . ASN C 3 605 ? 42.588 21.239  10.046  1.00 31.12 ? 611  ASN A CA    1 
ATOM   4785 C  C     . ASN C 3 605 ? 43.981 20.643  10.002  1.00 29.80 ? 611  ASN A C     1 
ATOM   4786 O  O     . ASN C 3 605 ? 44.545 20.453  8.930   1.00 31.37 ? 611  ASN A O     1 
ATOM   4787 C  CB    . ASN C 3 605 ? 42.676 22.725  10.433  1.00 32.22 ? 611  ASN A CB    1 
ATOM   4788 C  CG    . ASN C 3 605 ? 43.757 23.464  9.652   1.00 34.14 ? 611  ASN A CG    1 
ATOM   4789 O  OD1   . ASN C 3 605 ? 44.910 23.551  10.089  1.00 35.50 ? 611  ASN A OD1   1 
ATOM   4790 N  ND2   . ASN C 3 605 ? 43.395 23.977  8.476   1.00 33.38 ? 611  ASN A ND2   1 
ATOM   4791 N  N     . THR C 3 606 ? 44.536 20.348  11.169  1.00 28.58 ? 612  THR A N     1 
ATOM   4792 C  CA    . THR C 3 606 ? 45.858 19.757  11.219  1.00 29.81 ? 612  THR A CA    1 
ATOM   4793 C  C     . THR C 3 606 ? 45.834 18.497  10.359  1.00 29.11 ? 612  THR A C     1 
ATOM   4794 O  O     . THR C 3 606 ? 46.655 18.335  9.457   1.00 29.86 ? 612  THR A O     1 
ATOM   4795 C  CB    . THR C 3 606 ? 46.258 19.387  12.667  1.00 29.67 ? 612  THR A CB    1 
ATOM   4796 O  OG1   . THR C 3 606 ? 46.198 20.556  13.490  1.00 32.19 ? 612  THR A OG1   1 
ATOM   4797 C  CG2   . THR C 3 606 ? 47.673 18.845  12.710  1.00 29.85 ? 612  THR A CG2   1 
ATOM   4798 N  N     . LEU C 3 607 ? 44.866 17.626  10.623  1.00 28.17 ? 613  LEU A N     1 
ATOM   4799 C  CA    . LEU C 3 607 ? 44.738 16.373  9.886   1.00 27.93 ? 613  LEU A CA    1 
ATOM   4800 C  C     . LEU C 3 607 ? 44.616 16.541  8.372   1.00 27.85 ? 613  LEU A C     1 
ATOM   4801 O  O     . LEU C 3 607 ? 45.265 15.821  7.622   1.00 29.35 ? 613  LEU A O     1 
ATOM   4802 C  CB    . LEU C 3 607 ? 43.540 15.568  10.398  1.00 26.35 ? 613  LEU A CB    1 
ATOM   4803 C  CG    . LEU C 3 607 ? 43.309 14.237  9.674   1.00 27.55 ? 613  LEU A CG    1 
ATOM   4804 C  CD1   . LEU C 3 607 ? 44.404 13.232  10.054  1.00 23.83 ? 613  LEU A CD1   1 
ATOM   4805 C  CD2   . LEU C 3 607 ? 41.935 13.693  10.039  1.00 27.02 ? 613  LEU A CD2   1 
ATOM   4806 N  N     . LEU C 3 608 ? 43.792 17.480  7.916   1.00 27.15 ? 614  LEU A N     1 
ATOM   4807 C  CA    . LEU C 3 608 ? 43.623 17.683  6.477   1.00 26.38 ? 614  LEU A CA    1 
ATOM   4808 C  C     . LEU C 3 608 ? 44.786 18.441  5.822   1.00 25.13 ? 614  LEU A C     1 
ATOM   4809 O  O     . LEU C 3 608 ? 45.231 18.066  4.741   1.00 23.77 ? 614  LEU A O     1 
ATOM   4810 C  CB    . LEU C 3 608 ? 42.296 18.403  6.183   1.00 26.98 ? 614  LEU A CB    1 
ATOM   4811 C  CG    . LEU C 3 608 ? 41.005 17.757  6.710   1.00 27.58 ? 614  LEU A CG    1 
ATOM   4812 C  CD1   . LEU C 3 608 ? 39.812 18.603  6.313   1.00 29.26 ? 614  LEU A CD1   1 
ATOM   4813 C  CD2   . LEU C 3 608 ? 40.846 16.352  6.162   1.00 26.53 ? 614  LEU A CD2   1 
ATOM   4814 N  N     . GLN C 3 609 ? 45.280 19.502  6.461   1.00 25.67 ? 615  GLN A N     1 
ATOM   4815 C  CA    . GLN C 3 609 ? 46.394 20.255  5.877   1.00 24.98 ? 615  GLN A CA    1 
ATOM   4816 C  C     . GLN C 3 609 ? 47.644 19.372  5.805   1.00 24.51 ? 615  GLN A C     1 
ATOM   4817 O  O     . GLN C 3 609 ? 48.414 19.448  4.849   1.00 24.09 ? 615  GLN A O     1 
ATOM   4818 C  CB    . GLN C 3 609 ? 46.709 21.528  6.687   1.00 26.23 ? 615  GLN A CB    1 
ATOM   4819 C  CG    . GLN C 3 609 ? 47.730 22.448  5.990   1.00 29.17 ? 615  GLN A CG    1 
ATOM   4820 C  CD    . GLN C 3 609 ? 48.083 23.703  6.791   1.00 30.77 ? 615  GLN A CD    1 
ATOM   4821 O  OE1   . GLN C 3 609 ? 49.091 23.746  7.501   1.00 33.00 ? 615  GLN A OE1   1 
ATOM   4822 N  NE2   . GLN C 3 609 ? 47.250 24.723  6.681   1.00 31.15 ? 615  GLN A NE2   1 
ATOM   4823 N  N     . SER C 3 610 ? 47.846 18.530  6.813   1.00 23.03 ? 616  SER A N     1 
ATOM   4824 C  CA    . SER C 3 610 ? 49.006 17.650  6.801   1.00 24.38 ? 616  SER A CA    1 
ATOM   4825 C  C     . SER C 3 610 ? 48.886 16.664  5.643   1.00 24.61 ? 616  SER A C     1 
ATOM   4826 O  O     . SER C 3 610 ? 49.854 16.422  4.918   1.00 25.99 ? 616  SER A O     1 
ATOM   4827 C  CB    . SER C 3 610 ? 49.116 16.885  8.113   1.00 23.51 ? 616  SER A CB    1 
ATOM   4828 O  OG    . SER C 3 610 ? 50.275 16.082  8.105   1.00 26.53 ? 616  SER A OG    1 
ATOM   4829 N  N     . ALA C 3 611 ? 47.693 16.101  5.476   1.00 24.28 ? 617  ALA A N     1 
ATOM   4830 C  CA    . ALA C 3 611 ? 47.440 15.154  4.398   1.00 24.37 ? 617  ALA A CA    1 
ATOM   4831 C  C     . ALA C 3 611 ? 47.710 15.844  3.067   1.00 23.96 ? 617  ALA A C     1 
ATOM   4832 O  O     . ALA C 3 611 ? 48.357 15.278  2.186   1.00 23.09 ? 617  ALA A O     1 
ATOM   4833 C  CB    . ALA C 3 611 ? 45.989 14.659  4.452   1.00 26.43 ? 617  ALA A CB    1 
ATOM   4834 N  N     . GLY C 3 612 ? 47.206 17.069  2.927   1.00 22.40 ? 618  GLY A N     1 
ATOM   4835 C  CA    . GLY C 3 612 ? 47.427 17.821  1.707   1.00 21.53 ? 618  GLY A CA    1 
ATOM   4836 C  C     . GLY C 3 612 ? 48.911 18.084  1.469   1.00 21.57 ? 618  GLY A C     1 
ATOM   4837 O  O     . GLY C 3 612 ? 49.429 17.867  0.371   1.00 21.69 ? 618  GLY A O     1 
ATOM   4838 N  N     . ALA C 3 613 ? 49.591 18.558  2.506   1.00 20.81 ? 619  ALA A N     1 
ATOM   4839 C  CA    . ALA C 3 613 ? 51.016 18.847  2.439   1.00 20.84 ? 619  ALA A CA    1 
ATOM   4840 C  C     . ALA C 3 613 ? 51.810 17.604  2.050   1.00 22.52 ? 619  ALA A C     1 
ATOM   4841 O  O     . ALA C 3 613 ? 52.613 17.640  1.122   1.00 24.11 ? 619  ALA A O     1 
ATOM   4842 C  CB    . ALA C 3 613 ? 51.508 19.357  3.792   1.00 19.84 ? 619  ALA A CB    1 
ATOM   4843 N  N     . LEU C 3 614 ? 51.587 16.505  2.762   1.00 21.67 ? 620  LEU A N     1 
ATOM   4844 C  CA    . LEU C 3 614 ? 52.314 15.283  2.466   1.00 23.02 ? 620  LEU A CA    1 
ATOM   4845 C  C     . LEU C 3 614 ? 51.981 14.715  1.092   1.00 23.09 ? 620  LEU A C     1 
ATOM   4846 O  O     . LEU C 3 614 ? 52.854 14.171  0.424   1.00 21.30 ? 620  LEU A O     1 
ATOM   4847 C  CB    . LEU C 3 614 ? 52.081 14.235  3.559   1.00 24.24 ? 620  LEU A CB    1 
ATOM   4848 C  CG    . LEU C 3 614 ? 52.502 14.683  4.964   1.00 25.63 ? 620  LEU A CG    1 
ATOM   4849 C  CD1   . LEU C 3 614 ? 52.621 13.462  5.872   1.00 25.72 ? 620  LEU A CD1   1 
ATOM   4850 C  CD2   . LEU C 3 614 ? 53.837 15.416  4.904   1.00 24.07 ? 620  LEU A CD2   1 
ATOM   4851 N  N     . ILE C 3 615 ? 50.730 14.842  0.658   1.00 24.09 ? 621  ILE A N     1 
ATOM   4852 C  CA    . ILE C 3 615 ? 50.375 14.348  -0.666  1.00 24.55 ? 621  ILE A CA    1 
ATOM   4853 C  C     . ILE C 3 615 ? 51.186 15.150  -1.682  1.00 24.94 ? 621  ILE A C     1 
ATOM   4854 O  O     . ILE C 3 615 ? 51.855 14.582  -2.540  1.00 26.20 ? 621  ILE A O     1 
ATOM   4855 C  CB    . ILE C 3 615 ? 48.857 14.515  -0.963  1.00 25.52 ? 621  ILE A CB    1 
ATOM   4856 C  CG1   . ILE C 3 615 ? 48.063 13.354  -0.333  1.00 25.46 ? 621  ILE A CG1   1 
ATOM   4857 C  CG2   . ILE C 3 615 ? 48.620 14.582  -2.470  1.00 22.04 ? 621  ILE A CG2   1 
ATOM   4858 N  N     . CYS C 3 616 ? 51.138 16.475  -1.563  1.00 25.52 ? 622  CYS A N     1 
ATOM   4859 C  CA    . CYS C 3 616 ? 51.865 17.352  -2.471  1.00 26.95 ? 622  CYS A CA    1 
ATOM   4860 C  C     . CYS C 3 616 ? 53.362 17.126  -2.471  1.00 25.85 ? 622  CYS A C     1 
ATOM   4861 O  O     . CYS C 3 616 ? 54.004 17.196  -3.516  1.00 28.12 ? 622  CYS A O     1 
ATOM   4862 C  CB    . CYS C 3 616 ? 51.600 18.812  -2.128  1.00 28.74 ? 622  CYS A CB    1 
ATOM   4863 S  SG    . CYS C 3 616 ? 49.949 19.321  -2.536  1.00 35.45 ? 622  CYS A SG    1 
ATOM   4864 N  N     . LYS C 3 617 ? 53.912 16.847  -1.296  1.00 24.82 ? 623  LYS A N     1 
ATOM   4865 C  CA    . LYS C 3 617 ? 55.337 16.640  -1.167  1.00 25.11 ? 623  LYS A CA    1 
ATOM   4866 C  C     . LYS C 3 617 ? 55.798 15.386  -1.913  1.00 23.62 ? 623  LYS A C     1 
ATOM   4867 O  O     . LYS C 3 617 ? 56.784 15.433  -2.646  1.00 25.66 ? 623  LYS A O     1 
ATOM   4868 C  CB    . LYS C 3 617 ? 55.719 16.592  0.319   1.00 24.84 ? 623  LYS A CB    1 
ATOM   4869 C  CG    . LYS C 3 617 ? 57.210 16.700  0.594   1.00 26.69 ? 623  LYS A CG    1 
ATOM   4870 C  CD    . LYS C 3 617 ? 57.504 16.909  2.076   1.00 26.04 ? 623  LYS A CD    1 
ATOM   4871 C  CE    . LYS C 3 617 ? 57.193 18.328  2.524   1.00 27.17 ? 623  LYS A CE    1 
ATOM   4872 N  NZ    . LYS C 3 617 ? 57.486 18.550  3.975   1.00 27.59 ? 623  LYS A NZ    1 
ATOM   4873 N  N     . LEU C 3 618 ? 55.089 14.274  -1.747  1.00 23.09 ? 624  LEU A N     1 
ATOM   4874 C  CA    . LEU C 3 618 ? 55.462 13.042  -2.447  1.00 22.29 ? 624  LEU A CA    1 
ATOM   4875 C  C     . LEU C 3 618 ? 55.190 13.249  -3.935  1.00 20.27 ? 624  LEU A C     1 
ATOM   4876 O  O     . LEU C 3 618 ? 55.889 12.725  -4.793  1.00 21.25 ? 624  LEU A O     1 
ATOM   4877 C  CB    . LEU C 3 618 ? 54.638 11.848  -1.944  1.00 22.27 ? 624  LEU A CB    1 
ATOM   4878 C  CG    . LEU C 3 618 ? 55.361 10.496  -1.854  1.00 24.10 ? 624  LEU A CG    1 
ATOM   4879 C  CD1   . LEU C 3 618 ? 54.350 9.393   -1.549  1.00 25.45 ? 624  LEU A CD1   1 
ATOM   4880 C  CD2   . LEU C 3 618 ? 56.092 10.198  -3.139  1.00 24.63 ? 624  LEU A CD2   1 
ATOM   4881 N  N     . TRP C 3 619 ? 54.158 14.023  -4.229  1.00 20.31 ? 625  TRP A N     1 
ATOM   4882 C  CA    . TRP C 3 619 ? 53.793 14.317  -5.600  1.00 20.07 ? 625  TRP A CA    1 
ATOM   4883 C  C     . TRP C 3 619 ? 54.913 15.021  -6.382  1.00 20.43 ? 625  TRP A C     1 
ATOM   4884 O  O     . TRP C 3 619 ? 55.289 14.578  -7.467  1.00 21.21 ? 625  TRP A O     1 
ATOM   4885 C  CB    . TRP C 3 619 ? 52.533 15.176  -5.608  1.00 20.38 ? 625  TRP A CB    1 
ATOM   4886 C  CG    . TRP C 3 619 ? 52.157 15.700  -6.946  1.00 19.23 ? 625  TRP A CG    1 
ATOM   4887 C  CD1   . TRP C 3 619 ? 51.958 14.977  -8.085  1.00 17.80 ? 625  TRP A CD1   1 
ATOM   4888 C  CD2   . TRP C 3 619 ? 51.851 17.063  -7.272  1.00 18.83 ? 625  TRP A CD2   1 
ATOM   4889 N  NE1   . TRP C 3 619 ? 51.538 15.804  -9.100  1.00 20.49 ? 625  TRP A NE1   1 
ATOM   4890 C  CE2   . TRP C 3 619 ? 51.463 17.089  -8.629  1.00 17.94 ? 625  TRP A CE2   1 
ATOM   4891 C  CE3   . TRP C 3 619 ? 51.861 18.263  -6.545  1.00 19.00 ? 625  TRP A CE3   1 
ATOM   4892 C  CZ2   . TRP C 3 619 ? 51.088 18.269  -9.281  1.00 20.44 ? 625  TRP A CZ2   1 
ATOM   4893 C  CZ3   . TRP C 3 619 ? 51.483 19.441  -7.193  1.00 21.19 ? 625  TRP A CZ3   1 
ATOM   4894 C  CH2   . TRP C 3 619 ? 51.102 19.433  -8.549  1.00 21.56 ? 625  TRP A CH2   1 
ATOM   4895 N  N     . ILE C 3 620 ? 55.452 16.110  -5.847  1.00 20.65 ? 626  ILE A N     1 
ATOM   4896 C  CA    . ILE C 3 620 ? 56.506 16.801  -6.577  1.00 21.87 ? 626  ILE A CA    1 
ATOM   4897 C  C     . ILE C 3 620 ? 57.755 15.938  -6.668  1.00 22.06 ? 626  ILE A C     1 
ATOM   4898 O  O     . ILE C 3 620 ? 58.511 16.042  -7.627  1.00 21.47 ? 626  ILE A O     1 
ATOM   4899 C  CB    . ILE C 3 620 ? 56.846 18.186  -5.957  1.00 22.41 ? 626  ILE A CB    1 
ATOM   4900 C  CG1   . ILE C 3 620 ? 57.488 18.030  -4.577  1.00 21.85 ? 626  ILE A CG1   1 
ATOM   4901 C  CG2   . ILE C 3 620 ? 55.585 19.010  -5.872  1.00 21.03 ? 626  ILE A CG2   1 
ATOM   4902 N  N     . ILE C 3 621 ? 57.960 15.068  -5.681  1.00 23.85 ? 627  ILE A N     1 
ATOM   4903 C  CA    . ILE C 3 621 ? 59.118 14.185  -5.716  1.00 21.94 ? 627  ILE A CA    1 
ATOM   4904 C  C     . ILE C 3 621 ? 58.930 13.185  -6.852  1.00 22.58 ? 627  ILE A C     1 
ATOM   4905 O  O     . ILE C 3 621 ? 59.827 12.993  -7.669  1.00 21.99 ? 627  ILE A O     1 
ATOM   4906 C  CB    . ILE C 3 621 ? 59.306 13.423  -4.379  1.00 23.01 ? 627  ILE A CB    1 
ATOM   4907 C  CG1   . ILE C 3 621 ? 59.826 14.383  -3.298  1.00 22.46 ? 627  ILE A CG1   1 
ATOM   4908 C  CG2   . ILE C 3 621 ? 60.305 12.270  -4.556  1.00 19.85 ? 627  ILE A CG2   1 
ATOM   4909 N  N     . LYS C 3 622 ? 57.751 12.574  -6.919  1.00 22.66 ? 628  LYS A N     1 
ATOM   4910 C  CA    . LYS C 3 622 ? 57.467 11.573  -7.955  1.00 22.92 ? 628  LYS A CA    1 
ATOM   4911 C  C     . LYS C 3 622 ? 57.439 12.162  -9.362  1.00 21.90 ? 628  LYS A C     1 
ATOM   4912 O  O     . LYS C 3 622 ? 57.864 11.520  -10.323 1.00 21.86 ? 628  LYS A O     1 
ATOM   4913 C  CB    . LYS C 3 622 ? 56.132 10.866  -7.667  1.00 23.18 ? 628  LYS A CB    1 
ATOM   4914 C  CG    . LYS C 3 622 ? 55.843 9.657   -8.576  1.00 26.04 ? 628  LYS A CG    1 
ATOM   4915 C  CD    . LYS C 3 622 ? 56.883 8.539   -8.402  1.00 23.80 ? 628  LYS A CD    1 
ATOM   4916 C  CE    . LYS C 3 622 ? 56.495 7.303   -9.202  1.00 29.45 ? 628  LYS A CE    1 
ATOM   4917 N  NZ    . LYS C 3 622 ? 57.443 6.150   -9.032  1.00 31.59 ? 628  LYS A NZ    1 
ATOM   4918 N  N     . THR C 3 623 ? 56.949 13.392  -9.479  1.00 22.69 ? 629  THR A N     1 
ATOM   4919 C  CA    . THR C 3 623 ? 56.869 14.047  -10.771 1.00 21.49 ? 629  THR A CA    1 
ATOM   4920 C  C     . THR C 3 623 ? 58.265 14.222  -11.363 1.00 22.17 ? 629  THR A C     1 
ATOM   4921 O  O     . THR C 3 623 ? 58.501 13.892  -12.532 1.00 23.91 ? 629  THR A O     1 
ATOM   4922 C  CB    . THR C 3 623 ? 56.168 15.412  -10.658 1.00 22.47 ? 629  THR A CB    1 
ATOM   4923 O  OG1   . THR C 3 623 ? 54.818 15.219  -10.211 1.00 21.82 ? 629  THR A OG1   1 
ATOM   4924 C  CG2   . THR C 3 623 ? 56.154 16.120  -12.007 1.00 20.50 ? 629  THR A CG2   1 
ATOM   4925 N  N     . GLU C 3 624 ? 59.196 14.709  -10.553 1.00 21.31 ? 630  GLU A N     1 
ATOM   4926 C  CA    . GLU C 3 624 ? 60.559 14.907  -11.022 1.00 23.26 ? 630  GLU A CA    1 
ATOM   4927 C  C     . GLU C 3 624 ? 61.226 13.565  -11.318 1.00 23.01 ? 630  GLU A C     1 
ATOM   4928 O  O     . GLU C 3 624 ? 61.945 13.432  -12.306 1.00 22.44 ? 630  GLU A O     1 
ATOM   4929 C  CB    . GLU C 3 624 ? 61.392 15.675  -9.986  1.00 23.69 ? 630  GLU A CB    1 
ATOM   4930 C  CG    . GLU C 3 624 ? 62.670 16.258  -10.580 1.00 26.89 ? 630  GLU A CG    1 
ATOM   4931 C  CD    . GLU C 3 624 ? 63.947 15.744  -9.922  1.00 27.37 ? 630  GLU A CD    1 
ATOM   4932 O  OE1   . GLU C 3 624 ? 63.882 14.760  -9.163  1.00 29.54 ? 630  GLU A OE1   1 
ATOM   4933 O  OE2   . GLU C 3 624 ? 65.024 16.323  -10.175 1.00 27.07 ? 630  GLU A OE2   1 
ATOM   4934 N  N     . GLU C 3 625 ? 60.988 12.572  -10.465 1.00 24.07 ? 631  GLU A N     1 
ATOM   4935 C  CA    . GLU C 3 625 ? 61.580 11.257  -10.674 1.00 26.36 ? 631  GLU A CA    1 
ATOM   4936 C  C     . GLU C 3 625 ? 61.089 10.635  -11.978 1.00 26.30 ? 631  GLU A C     1 
ATOM   4937 O  O     . GLU C 3 625 ? 61.859 10.000  -12.697 1.00 24.68 ? 631  GLU A O     1 
ATOM   4938 C  CB    . GLU C 3 625 ? 61.262 10.318  -9.506  1.00 29.13 ? 631  GLU A CB    1 
ATOM   4939 C  CG    . GLU C 3 625 ? 61.998 8.988   -9.602  1.00 35.66 ? 631  GLU A CG    1 
ATOM   4940 C  CD    . GLU C 3 625 ? 61.777 8.084   -8.398  1.00 40.05 ? 631  GLU A CD    1 
ATOM   4941 O  OE1   . GLU C 3 625 ? 60.640 7.594   -8.214  1.00 38.19 ? 631  GLU A OE1   1 
ATOM   4942 O  OE2   . GLU C 3 625 ? 62.749 7.869   -7.636  1.00 43.33 ? 631  GLU A OE2   1 
ATOM   4943 N  N     . MET C 3 626 ? 59.812 10.832  -12.292 1.00 25.78 ? 632  MET A N     1 
ATOM   4944 C  CA    . MET C 3 626 ? 59.255 10.286  -13.522 1.00 26.32 ? 632  MET A CA    1 
ATOM   4945 C  C     . MET C 3 626 ? 59.830 10.981  -14.762 1.00 26.29 ? 632  MET A C     1 
ATOM   4946 O  O     . MET C 3 626 ? 60.133 10.327  -15.766 1.00 24.84 ? 632  MET A O     1 
ATOM   4947 C  CB    . MET C 3 626 ? 57.726 10.398  -13.503 1.00 27.40 ? 632  MET A CB    1 
ATOM   4948 C  CG    . MET C 3 626 ? 57.059 9.488   -12.467 1.00 28.49 ? 632  MET A CG    1 
ATOM   4949 S  SD    . MET C 3 626 ? 55.248 9.593   -12.450 1.00 34.92 ? 632  MET A SD    1 
ATOM   4950 C  CE    . MET C 3 626 ? 54.837 8.653   -13.929 1.00 35.23 ? 632  MET A CE    1 
ATOM   4951 N  N     . LEU C 3 627 ? 59.976 12.303  -14.698 1.00 26.29 ? 633  LEU A N     1 
ATOM   4952 C  CA    . LEU C 3 627 ? 60.531 13.047  -15.822 1.00 25.30 ? 633  LEU A CA    1 
ATOM   4953 C  C     . LEU C 3 627 ? 61.959 12.561  -16.098 1.00 26.33 ? 633  LEU A C     1 
ATOM   4954 O  O     . LEU C 3 627 ? 62.374 12.422  -17.253 1.00 24.10 ? 633  LEU A O     1 
ATOM   4955 C  CB    . LEU C 3 627 ? 60.534 14.547  -15.523 1.00 24.77 ? 633  LEU A CB    1 
ATOM   4956 C  CG    . LEU C 3 627 ? 59.153 15.200  -15.423 1.00 23.96 ? 633  LEU A CG    1 
ATOM   4957 C  CD1   . LEU C 3 627 ? 59.294 16.638  -14.944 1.00 23.04 ? 633  LEU A CD1   1 
ATOM   4958 C  CD2   . LEU C 3 627 ? 58.465 15.138  -16.785 1.00 21.76 ? 633  LEU A CD2   1 
ATOM   4959 N  N     . VAL C 3 628 ? 62.702 12.296  -15.027 1.00 27.27 ? 634  VAL A N     1 
ATOM   4960 C  CA    . VAL C 3 628 ? 64.065 11.813  -15.157 1.00 28.65 ? 634  VAL A CA    1 
ATOM   4961 C  C     . VAL C 3 628 ? 64.085 10.386  -15.705 1.00 30.57 ? 634  VAL A C     1 
ATOM   4962 O  O     . VAL C 3 628 ? 64.974 10.039  -16.484 1.00 32.26 ? 634  VAL A O     1 
ATOM   4963 C  CB    . VAL C 3 628 ? 64.816 11.844  -13.798 1.00 29.47 ? 634  VAL A CB    1 
ATOM   4964 C  CG1   . VAL C 3 628 ? 66.156 11.126  -13.924 1.00 28.11 ? 634  VAL A CG1   1 
ATOM   4965 C  CG2   . VAL C 3 628 ? 65.049 13.282  -13.362 1.00 26.00 ? 634  VAL A CG2   1 
ATOM   4966 N  N     . GLU C 3 629 ? 63.119 9.555   -15.312 1.00 31.85 ? 635  GLU A N     1 
ATOM   4967 C  CA    . GLU C 3 629 ? 63.101 8.188   -15.820 1.00 33.64 ? 635  GLU A CA    1 
ATOM   4968 C  C     . GLU C 3 629 ? 62.703 8.209   -17.290 1.00 32.94 ? 635  GLU A C     1 
ATOM   4969 O  O     . GLU C 3 629 ? 62.933 7.244   -18.021 1.00 33.41 ? 635  GLU A O     1 
ATOM   4970 C  CB    . GLU C 3 629 ? 62.151 7.286   -15.008 1.00 38.03 ? 635  GLU A CB    1 
ATOM   4971 C  CG    . GLU C 3 629 ? 60.657 7.519   -15.206 1.00 44.75 ? 635  GLU A CG    1 
ATOM   4972 C  CD    . GLU C 3 629 ? 59.797 6.596   -14.333 1.00 49.19 ? 635  GLU A CD    1 
ATOM   4973 O  OE1   . GLU C 3 629 ? 59.988 6.590   -13.092 1.00 50.42 ? 635  GLU A OE1   1 
ATOM   4974 O  OE2   . GLU C 3 629 ? 58.927 5.880   -14.885 1.00 51.14 ? 635  GLU A OE2   1 
ATOM   4975 N  N     . LYS C 3 630 ? 62.111 9.317   -17.726 1.00 30.95 ? 636  LYS A N     1 
ATOM   4976 C  CA    . LYS C 3 630 ? 61.722 9.453   -19.125 1.00 29.85 ? 636  LYS A CA    1 
ATOM   4977 C  C     . LYS C 3 630 ? 62.880 9.986   -19.968 1.00 28.67 ? 636  LYS A C     1 
ATOM   4978 O  O     . LYS C 3 630 ? 62.741 10.156  -21.178 1.00 29.58 ? 636  LYS A O     1 
ATOM   4979 C  CB    . LYS C 3 630 ? 60.516 10.384  -19.274 1.00 29.26 ? 636  LYS A CB    1 
ATOM   4980 C  CG    . LYS C 3 630 ? 59.213 9.789   -18.776 1.00 31.78 ? 636  LYS A CG    1 
ATOM   4981 C  CD    . LYS C 3 630 ? 58.038 10.702  -19.098 1.00 33.68 ? 636  LYS A CD    1 
ATOM   4982 C  CE    . LYS C 3 630 ? 56.718 10.075  -18.692 1.00 34.65 ? 636  LYS A CE    1 
ATOM   4983 N  NZ    . LYS C 3 630 ? 55.562 10.947  -19.049 1.00 38.08 ? 636  LYS A NZ    1 
ATOM   4984 N  N     . GLY C 3 631 ? 64.017 10.252  -19.329 1.00 27.64 ? 637  GLY A N     1 
ATOM   4985 C  CA    . GLY C 3 631 ? 65.170 10.755  -20.059 1.00 26.88 ? 637  GLY A CA    1 
ATOM   4986 C  C     . GLY C 3 631 ? 65.353 12.273  -20.074 1.00 27.71 ? 637  GLY A C     1 
ATOM   4987 O  O     . GLY C 3 631 ? 66.250 12.772  -20.755 1.00 27.66 ? 637  GLY A O     1 
ATOM   4988 N  N     . LEU C 3 632 ? 64.532 13.010  -19.327 1.00 25.95 ? 638  LEU A N     1 
ATOM   4989 C  CA    . LEU C 3 632 ? 64.646 14.476  -19.286 1.00 26.77 ? 638  LEU A CA    1 
ATOM   4990 C  C     . LEU C 3 632 ? 65.651 14.940  -18.233 1.00 26.66 ? 638  LEU A C     1 
ATOM   4991 O  O     . LEU C 3 632 ? 65.730 14.378  -17.142 1.00 26.86 ? 638  LEU A O     1 
ATOM   4992 C  CB    . LEU C 3 632 ? 63.277 15.112  -19.015 1.00 27.25 ? 638  LEU A CB    1 
ATOM   4993 C  CG    . LEU C 3 632 ? 62.267 15.052  -20.165 1.00 28.80 ? 638  LEU A CG    1 
ATOM   4994 C  CD1   . LEU C 3 632 ? 62.151 13.623  -20.676 1.00 32.92 ? 638  LEU A CD1   1 
ATOM   4995 C  CD2   . LEU C 3 632 ? 60.909 15.564  -19.699 1.00 30.06 ? 638  LEU A CD2   1 
ATOM   4996 N  N     . LYS C 3 633 ? 66.416 15.972  -18.566 1.00 26.98 ? 639  LYS A N     1 
ATOM   4997 C  CA    . LYS C 3 633 ? 67.432 16.504  -17.665 1.00 28.75 ? 639  LYS A CA    1 
ATOM   4998 C  C     . LYS C 3 633 ? 66.954 17.718  -16.855 1.00 27.10 ? 639  LYS A C     1 
ATOM   4999 O  O     . LYS C 3 633 ? 66.394 18.663  -17.407 1.00 26.92 ? 639  LYS A O     1 
ATOM   5000 C  CB    . LYS C 3 633 ? 68.675 16.884  -18.475 1.00 31.87 ? 639  LYS A CB    1 
ATOM   5001 C  CG    . LYS C 3 633 ? 69.872 17.334  -17.638 1.00 35.73 ? 639  LYS A CG    1 
ATOM   5002 C  CD    . LYS C 3 633 ? 71.063 17.674  -18.531 1.00 38.10 ? 639  LYS A CD    1 
ATOM   5003 C  CE    . LYS C 3 633 ? 72.274 18.064  -17.707 1.00 41.52 ? 639  LYS A CE    1 
ATOM   5004 N  NZ    . LYS C 3 633 ? 72.656 16.966  -16.774 1.00 44.60 ? 639  LYS A NZ    1 
ATOM   5005 N  N     . HIS C 3 634 ? 67.209 17.695  -15.551 1.00 26.29 ? 640  HIS A N     1 
ATOM   5006 C  CA    . HIS C 3 634 ? 66.799 18.782  -14.663 1.00 25.77 ? 640  HIS A CA    1 
ATOM   5007 C  C     . HIS C 3 634 ? 67.855 19.884  -14.557 1.00 24.54 ? 640  HIS A C     1 
ATOM   5008 O  O     . HIS C 3 634 ? 68.910 19.694  -13.954 1.00 23.48 ? 640  HIS A O     1 
ATOM   5009 C  CB    . HIS C 3 634 ? 66.493 18.232  -13.261 1.00 23.23 ? 640  HIS A CB    1 
ATOM   5010 C  CG    . HIS C 3 634 ? 65.742 19.187  -12.385 1.00 23.98 ? 640  HIS A CG    1 
ATOM   5011 N  ND1   . HIS C 3 634 ? 65.204 18.817  -11.170 1.00 24.51 ? 640  HIS A ND1   1 
ATOM   5012 C  CD2   . HIS C 3 634 ? 65.420 20.492  -12.556 1.00 23.80 ? 640  HIS A CD2   1 
ATOM   5013 C  CE1   . HIS C 3 634 ? 64.580 19.851  -10.633 1.00 23.25 ? 640  HIS A CE1   1 
ATOM   5014 N  NE2   . HIS C 3 634 ? 64.695 20.879  -11.455 1.00 23.92 ? 640  HIS A NE2   1 
ATOM   5015 N  N     . GLY C 3 635 ? 67.546 21.040  -15.134 1.00 24.90 ? 641  GLY A N     1 
ATOM   5016 C  CA    . GLY C 3 635 ? 68.457 22.167  -15.096 1.00 22.60 ? 641  GLY A CA    1 
ATOM   5017 C  C     . GLY C 3 635 ? 68.236 23.085  -16.282 1.00 21.35 ? 641  GLY A C     1 
ATOM   5018 O  O     . GLY C 3 635 ? 67.550 22.715  -17.230 1.00 20.48 ? 641  GLY A O     1 
ATOM   5019 N  N     . TRP C 3 636 ? 68.809 24.284  -16.223 1.00 19.89 ? 642  TRP A N     1 
ATOM   5020 C  CA    . TRP C 3 636 ? 68.695 25.241  -17.309 1.00 21.62 ? 642  TRP A CA    1 
ATOM   5021 C  C     . TRP C 3 636 ? 69.528 24.732  -18.484 1.00 22.84 ? 642  TRP A C     1 
ATOM   5022 O  O     . TRP C 3 636 ? 69.317 25.121  -19.633 1.00 23.64 ? 642  TRP A O     1 
ATOM   5023 C  CB    . TRP C 3 636 ? 69.198 26.621  -16.855 1.00 21.05 ? 642  TRP A CB    1 
ATOM   5024 C  CG    . TRP C 3 636 ? 68.347 27.229  -15.767 1.00 21.15 ? 642  TRP A CG    1 
ATOM   5025 C  CD1   . TRP C 3 636 ? 68.746 27.575  -14.502 1.00 20.43 ? 642  TRP A CD1   1 
ATOM   5026 C  CD2   . TRP C 3 636 ? 66.947 27.535  -15.843 1.00 19.00 ? 642  TRP A CD2   1 
ATOM   5027 N  NE1   . TRP C 3 636 ? 67.681 28.072  -13.789 1.00 20.41 ? 642  TRP A NE1   1 
ATOM   5028 C  CE2   . TRP C 3 636 ? 66.566 28.060  -14.588 1.00 19.56 ? 642  TRP A CE2   1 
ATOM   5029 C  CE3   . TRP C 3 636 ? 65.979 27.418  -16.852 1.00 19.41 ? 642  TRP A CE3   1 
ATOM   5030 C  CZ2   . TRP C 3 636 ? 65.257 28.468  -14.313 1.00 20.02 ? 642  TRP A CZ2   1 
ATOM   5031 C  CZ3   . TRP C 3 636 ? 64.672 27.824  -16.580 1.00 18.03 ? 642  TRP A CZ3   1 
ATOM   5032 C  CH2   . TRP C 3 636 ? 64.326 28.343  -15.317 1.00 20.25 ? 642  TRP A CH2   1 
ATOM   5033 N  N     . ASP C 3 637 ? 70.475 23.851  -18.181 1.00 23.00 ? 643  ASP A N     1 
ATOM   5034 C  CA    . ASP C 3 637 ? 71.329 23.273  -19.206 1.00 25.20 ? 643  ASP A CA    1 
ATOM   5035 C  C     . ASP C 3 637 ? 70.701 21.959  -19.645 1.00 25.40 ? 643  ASP A C     1 
ATOM   5036 O  O     . ASP C 3 637 ? 71.323 21.164  -20.346 1.00 24.90 ? 643  ASP A O     1 
ATOM   5037 C  CB    . ASP C 3 637 ? 72.734 23.029  -18.647 1.00 26.06 ? 643  ASP A CB    1 
ATOM   5038 C  CG    . ASP C 3 637 ? 72.735 22.066  -17.468 1.00 28.39 ? 643  ASP A CG    1 
ATOM   5039 O  OD1   . ASP C 3 637 ? 71.667 21.844  -16.861 1.00 29.34 ? 643  ASP A OD1   1 
ATOM   5040 O  OD2   . ASP C 3 637 ? 73.813 21.541  -17.135 1.00 30.09 ? 643  ASP A OD2   1 
ATOM   5041 N  N     . GLY C 3 638 ? 69.456 21.745  -19.227 1.00 24.96 ? 644  GLY A N     1 
ATOM   5042 C  CA    . GLY C 3 638 ? 68.761 20.527  -19.586 1.00 25.11 ? 644  GLY A CA    1 
ATOM   5043 C  C     . GLY C 3 638 ? 67.442 20.721  -20.307 1.00 25.98 ? 644  GLY A C     1 
ATOM   5044 O  O     . GLY C 3 638 ? 67.387 21.403  -21.334 1.00 27.04 ? 644  GLY A O     1 
ATOM   5045 N  N     . ASP C 3 639 ? 66.380 20.140  -19.745 1.00 25.08 ? 645  ASP A N     1 
ATOM   5046 C  CA    . ASP C 3 639 ? 65.042 20.190  -20.332 1.00 24.84 ? 645  ASP A CA    1 
ATOM   5047 C  C     . ASP C 3 639 ? 63.966 20.874  -19.492 1.00 24.59 ? 645  ASP A C     1 
ATOM   5048 O  O     . ASP C 3 639 ? 62.999 21.406  -20.028 1.00 24.62 ? 645  ASP A O     1 
ATOM   5049 C  CB    . ASP C 3 639 ? 64.601 18.763  -20.654 1.00 27.04 ? 645  ASP A CB    1 
ATOM   5050 C  CG    . ASP C 3 639 ? 65.627 18.028  -21.485 1.00 27.05 ? 645  ASP A CG    1 
ATOM   5051 O  OD1   . ASP C 3 639 ? 65.844 18.445  -22.643 1.00 27.93 ? 645  ASP A OD1   1 
ATOM   5052 O  OD2   . ASP C 3 639 ? 66.224 17.053  -20.975 1.00 28.31 ? 645  ASP A OD2   1 
ATOM   5053 N  N     . PHE C 3 640 ? 64.113 20.845  -18.174 1.00 24.07 ? 646  PHE A N     1 
ATOM   5054 C  CA    . PHE C 3 640 ? 63.134 21.495  -17.319 1.00 22.29 ? 646  PHE A CA    1 
ATOM   5055 C  C     . PHE C 3 640 ? 63.803 21.964  -16.045 1.00 20.57 ? 646  PHE A C     1 
ATOM   5056 O  O     . PHE C 3 640 ? 64.891 21.505  -15.694 1.00 20.68 ? 646  PHE A O     1 
ATOM   5057 C  CB    . PHE C 3 640 ? 61.990 20.541  -16.962 1.00 22.27 ? 646  PHE A CB    1 
ATOM   5058 C  CG    . PHE C 3 640 ? 62.413 19.395  -16.095 1.00 23.06 ? 646  PHE A CG    1 
ATOM   5059 C  CD1   . PHE C 3 640 ? 62.919 18.224  -16.662 1.00 20.84 ? 646  PHE A CD1   1 
ATOM   5060 C  CD2   . PHE C 3 640 ? 62.325 19.491  -14.705 1.00 20.13 ? 646  PHE A CD2   1 
ATOM   5061 C  CE1   . PHE C 3 640 ? 63.327 17.166  -15.858 1.00 19.90 ? 646  PHE A CE1   1 
ATOM   5062 C  CE2   . PHE C 3 640 ? 62.727 18.446  -13.898 1.00 20.68 ? 646  PHE A CE2   1 
ATOM   5063 C  CZ    . PHE C 3 640 ? 63.231 17.276  -14.474 1.00 20.30 ? 646  PHE A CZ    1 
ATOM   5064 N  N     . ALA C 3 641 ? 63.142 22.882  -15.353 1.00 19.91 ? 647  ALA A N     1 
ATOM   5065 C  CA    . ALA C 3 641 ? 63.667 23.402  -14.101 1.00 20.09 ? 647  ALA A CA    1 
ATOM   5066 C  C     . ALA C 3 641 ? 62.519 23.800  -13.184 1.00 18.89 ? 647  ALA A C     1 
ATOM   5067 O  O     . ALA C 3 641 ? 61.674 24.603  -13.565 1.00 20.37 ? 647  ALA A O     1 
ATOM   5068 C  CB    . ALA C 3 641 ? 64.568 24.612  -14.369 1.00 18.71 ? 647  ALA A CB    1 
ATOM   5069 N  N     . TYR C 3 642 ? 62.474 23.209  -11.994 1.00 20.62 ? 648  TYR A N     1 
ATOM   5070 C  CA    . TYR C 3 642 ? 61.454 23.554  -11.010 1.00 19.75 ? 648  TYR A CA    1 
ATOM   5071 C  C     . TYR C 3 642 ? 61.780 24.991  -10.616 1.00 21.11 ? 648  TYR A C     1 
ATOM   5072 O  O     . TYR C 3 642 ? 62.917 25.293  -10.243 1.00 19.88 ? 648  TYR A O     1 
ATOM   5073 C  CB    . TYR C 3 642 ? 61.576 22.672  -9.769  1.00 19.58 ? 648  TYR A CB    1 
ATOM   5074 C  CG    . TYR C 3 642 ? 60.804 21.372  -9.816  1.00 23.56 ? 648  TYR A CG    1 
ATOM   5075 C  CD1   . TYR C 3 642 ? 60.882 20.529  -10.923 1.00 22.04 ? 648  TYR A CD1   1 
ATOM   5076 C  CD2   . TYR C 3 642 ? 60.007 20.979  -8.740  1.00 23.45 ? 648  TYR A CD2   1 
ATOM   5077 C  CE1   . TYR C 3 642 ? 60.191 19.334  -10.963 1.00 23.78 ? 648  TYR A CE1   1 
ATOM   5078 C  CE2   . TYR C 3 642 ? 59.305 19.775  -8.770  1.00 26.80 ? 648  TYR A CE2   1 
ATOM   5079 C  CZ    . TYR C 3 642 ? 59.403 18.961  -9.888  1.00 25.79 ? 648  TYR A CZ    1 
ATOM   5080 O  OH    . TYR C 3 642 ? 58.706 17.784  -9.941  1.00 26.05 ? 648  TYR A OH    1 
ATOM   5081 N  N     . MET C 3 643 ? 60.799 25.877  -10.708 1.00 20.77 ? 649  MET A N     1 
ATOM   5082 C  CA    . MET C 3 643 ? 61.029 27.263  -10.352 1.00 22.54 ? 649  MET A CA    1 
ATOM   5083 C  C     . MET C 3 643 ? 60.363 27.571  -9.019  1.00 23.40 ? 649  MET A C     1 
ATOM   5084 O  O     . MET C 3 643 ? 60.908 28.316  -8.201  1.00 23.06 ? 649  MET A O     1 
ATOM   5085 C  CB    . MET C 3 643 ? 60.494 28.186  -11.456 1.00 24.11 ? 649  MET A CB    1 
ATOM   5086 C  CG    . MET C 3 643 ? 61.061 27.856  -12.833 1.00 21.90 ? 649  MET A CG    1 
ATOM   5087 S  SD    . MET C 3 643 ? 60.478 28.923  -14.164 1.00 22.19 ? 649  MET A SD    1 
ATOM   5088 C  CE    . MET C 3 643 ? 58.731 28.632  -14.087 1.00 18.32 ? 649  MET A CE    1 
ATOM   5089 N  N     . ALA C 3 644 ? 59.197 26.973  -8.788  1.00 23.76 ? 650  ALA A N     1 
ATOM   5090 C  CA    . ALA C 3 644 ? 58.486 27.211  -7.545  1.00 23.37 ? 650  ALA A CA    1 
ATOM   5091 C  C     . ALA C 3 644 ? 57.497 26.133  -7.134  1.00 24.23 ? 650  ALA A C     1 
ATOM   5092 O  O     . ALA C 3 644 ? 56.861 25.475  -7.964  1.00 24.99 ? 650  ALA A O     1 
ATOM   5093 C  CB    . ALA C 3 644 ? 57.766 28.558  -7.614  1.00 23.91 ? 650  ALA A CB    1 
ATOM   5094 N  N     . TRP C 3 645 ? 57.371 25.976  -5.826  1.00 23.62 ? 651  TRP A N     1 
ATOM   5095 C  CA    . TRP C 3 645 ? 56.437 25.035  -5.247  1.00 24.46 ? 651  TRP A CA    1 
ATOM   5096 C  C     . TRP C 3 645 ? 55.680 25.796  -4.172  1.00 24.13 ? 651  TRP A C     1 
ATOM   5097 O  O     . TRP C 3 645 ? 56.229 26.111  -3.115  1.00 24.23 ? 651  TRP A O     1 
ATOM   5098 C  CB    . TRP C 3 645 ? 57.166 23.831  -4.643  1.00 24.63 ? 651  TRP A CB    1 
ATOM   5099 C  CG    . TRP C 3 645 ? 56.232 22.922  -3.881  1.00 25.11 ? 651  TRP A CG    1 
ATOM   5100 C  CD1   . TRP C 3 645 ? 54.975 22.556  -4.244  1.00 25.52 ? 651  TRP A CD1   1 
ATOM   5101 C  CD2   . TRP C 3 645 ? 56.478 22.309  -2.608  1.00 23.91 ? 651  TRP A CD2   1 
ATOM   5102 N  NE1   . TRP C 3 645 ? 54.410 21.759  -3.274  1.00 26.82 ? 651  TRP A NE1   1 
ATOM   5103 C  CE2   . TRP C 3 645 ? 55.315 21.590  -2.260  1.00 25.36 ? 651  TRP A CE2   1 
ATOM   5104 C  CE3   . TRP C 3 645 ? 57.566 22.301  -1.729  1.00 20.69 ? 651  TRP A CE3   1 
ATOM   5105 C  CZ2   . TRP C 3 645 ? 55.207 20.868  -1.066  1.00 24.55 ? 651  TRP A CZ2   1 
ATOM   5106 C  CZ3   . TRP C 3 645 ? 57.461 21.586  -0.544  1.00 23.31 ? 651  TRP A CZ3   1 
ATOM   5107 C  CH2   . TRP C 3 645 ? 56.290 20.878  -0.223  1.00 24.77 ? 651  TRP A CH2   1 
ATOM   5108 N  N     . VAL C 3 646 ? 54.422 26.111  -4.464  1.00 24.32 ? 652  VAL A N     1 
ATOM   5109 C  CA    . VAL C 3 646 ? 53.578 26.852  -3.536  1.00 25.48 ? 652  VAL A CA    1 
ATOM   5110 C  C     . VAL C 3 646 ? 52.455 25.961  -3.011  1.00 26.51 ? 652  VAL A C     1 
ATOM   5111 O  O     . VAL C 3 646 ? 51.328 25.987  -3.512  1.00 26.74 ? 652  VAL A O     1 
ATOM   5112 C  CB    . VAL C 3 646 ? 52.995 28.123  -4.221  1.00 26.49 ? 652  VAL A CB    1 
ATOM   5113 C  CG1   . VAL C 3 646 ? 52.082 28.887  -3.260  1.00 25.85 ? 652  VAL A CG1   1 
ATOM   5114 C  CG2   . VAL C 3 646 ? 54.143 29.022  -4.685  1.00 23.89 ? 652  VAL A CG2   1 
ATOM   5115 N  N     . HIS C 3 647 ? 52.803 25.157  -2.009  1.00 27.24 ? 653  HIS A N     1 
ATOM   5116 C  CA    . HIS C 3 647 ? 51.886 24.232  -1.355  1.00 27.95 ? 653  HIS A CA    1 
ATOM   5117 C  C     . HIS C 3 647 ? 51.352 23.142  -2.280  1.00 28.78 ? 653  HIS A C     1 
ATOM   5118 O  O     . HIS C 3 647 ? 51.877 22.028  -2.277  1.00 30.31 ? 653  HIS A O     1 
ATOM   5119 C  CB    . HIS C 3 647 ? 50.764 25.033  -0.690  1.00 28.42 ? 653  HIS A CB    1 
ATOM   5120 C  CG    . HIS C 3 647 ? 51.282 26.074  0.251   1.00 29.57 ? 653  HIS A CG    1 
ATOM   5121 N  ND1   . HIS C 3 647 ? 51.986 25.752  1.394   1.00 28.74 ? 653  HIS A ND1   1 
ATOM   5122 C  CD2   . HIS C 3 647 ? 51.318 27.425  0.156   1.00 29.83 ? 653  HIS A CD2   1 
ATOM   5123 C  CE1   . HIS C 3 647 ? 52.439 26.858  1.956   1.00 28.75 ? 653  HIS A CE1   1 
ATOM   5124 N  NE2   . HIS C 3 647 ? 52.048 27.887  1.224   1.00 29.32 ? 653  HIS A NE2   1 
ATOM   5125 N  N     . ASP C 3 648 ? 50.337 23.433  -3.084  1.00 29.06 ? 654  ASP A N     1 
ATOM   5126 C  CA    . ASP C 3 648 ? 49.831 22.392  -3.976  1.00 30.40 ? 654  ASP A CA    1 
ATOM   5127 C  C     . ASP C 3 648 ? 49.949 22.723  -5.465  1.00 29.21 ? 654  ASP A C     1 
ATOM   5128 O  O     . ASP C 3 648 ? 49.209 22.184  -6.293  1.00 29.01 ? 654  ASP A O     1 
ATOM   5129 C  CB    . ASP C 3 648 ? 48.383 22.072  -3.638  1.00 33.88 ? 654  ASP A CB    1 
ATOM   5130 C  CG    . ASP C 3 648 ? 47.483 23.210  -3.942  1.00 35.59 ? 654  ASP A CG    1 
ATOM   5131 O  OD1   . ASP C 3 648 ? 47.885 24.345  -3.610  1.00 38.47 ? 654  ASP A OD1   1 
ATOM   5132 O  OD2   . ASP C 3 648 ? 46.393 22.978  -4.502  1.00 40.19 ? 654  ASP A OD2   1 
ATOM   5133 N  N     . GLU C 3 649 ? 50.867 23.622  -5.807  1.00 27.99 ? 655  GLU A N     1 
ATOM   5134 C  CA    . GLU C 3 649 ? 51.094 23.949  -7.206  1.00 27.29 ? 655  GLU A CA    1 
ATOM   5135 C  C     . GLU C 3 649 ? 52.591 24.015  -7.493  1.00 25.80 ? 655  GLU A C     1 
ATOM   5136 O  O     . GLU C 3 649 ? 53.403 24.330  -6.622  1.00 24.94 ? 655  GLU A O     1 
ATOM   5137 C  CB    . GLU C 3 649 ? 50.433 25.283  -7.601  1.00 26.50 ? 655  GLU A CB    1 
ATOM   5138 C  CG    . GLU C 3 649 ? 51.259 26.520  -7.328  1.00 32.29 ? 655  GLU A CG    1 
ATOM   5139 C  CD    . GLU C 3 649 ? 50.634 27.798  -7.882  1.00 30.53 ? 655  GLU A CD    1 
ATOM   5140 O  OE1   . GLU C 3 649 ? 50.724 28.048  -9.097  1.00 35.08 ? 655  GLU A OE1   1 
ATOM   5141 O  OE2   . GLU C 3 649 ? 50.044 28.560  -7.098  1.00 34.07 ? 655  GLU A OE2   1 
ATOM   5142 N  N     . ILE C 3 650 ? 52.962 23.665  -8.712  1.00 25.06 ? 656  ILE A N     1 
ATOM   5143 C  CA    . ILE C 3 650 ? 54.351 23.762  -9.096  1.00 24.80 ? 656  ILE A CA    1 
ATOM   5144 C  C     . ILE C 3 650 ? 54.389 24.531  -10.395 1.00 23.73 ? 656  ILE A C     1 
ATOM   5145 O  O     . ILE C 3 650 ? 53.491 24.407  -11.234 1.00 22.12 ? 656  ILE A O     1 
ATOM   5146 C  CB    . ILE C 3 650 ? 55.022 22.381  -9.292  1.00 25.53 ? 656  ILE A CB    1 
ATOM   5147 C  CG1   . ILE C 3 650 ? 54.039 21.394  -9.931  1.00 27.12 ? 656  ILE A CG1   1 
ATOM   5148 C  CG2   . ILE C 3 650 ? 55.546 21.872  -7.963  1.00 26.19 ? 656  ILE A CG2   1 
ATOM   5149 N  N     . GLN C 3 651 ? 55.403 25.376  -10.523 1.00 21.21 ? 657  GLN A N     1 
ATOM   5150 C  CA    . GLN C 3 651 ? 55.603 26.145  -11.735 1.00 21.57 ? 657  GLN A CA    1 
ATOM   5151 C  C     . GLN C 3 651 ? 56.920 25.607  -12.273 1.00 21.42 ? 657  GLN A C     1 
ATOM   5152 O  O     . GLN C 3 651 ? 57.958 25.715  -11.621 1.00 21.49 ? 657  GLN A O     1 
ATOM   5153 C  CB    . GLN C 3 651 ? 55.706 27.636  -11.420 1.00 20.05 ? 657  GLN A CB    1 
ATOM   5154 C  CG    . GLN C 3 651 ? 54.397 28.249  -10.962 1.00 20.91 ? 657  GLN A CG    1 
ATOM   5155 C  CD    . GLN C 3 651 ? 53.268 28.020  -11.959 1.00 22.51 ? 657  GLN A CD    1 
ATOM   5156 O  OE1   . GLN C 3 651 ? 53.485 28.033  -13.172 1.00 27.01 ? 657  GLN A OE1   1 
ATOM   5157 N  NE2   . GLN C 3 651 ? 52.059 27.827  -11.453 1.00 20.26 ? 657  GLN A NE2   1 
ATOM   5158 N  N     . VAL C 3 652 ? 56.872 25.010  -13.454 1.00 23.72 ? 658  VAL A N     1 
ATOM   5159 C  CA    . VAL C 3 652 ? 58.062 24.414  -14.049 1.00 24.32 ? 658  VAL A CA    1 
ATOM   5160 C  C     . VAL C 3 652 ? 58.469 25.074  -15.356 1.00 24.24 ? 658  VAL A C     1 
ATOM   5161 O  O     . VAL C 3 652 ? 57.645 25.255  -16.248 1.00 23.98 ? 658  VAL A O     1 
ATOM   5162 C  CB    . VAL C 3 652 ? 57.832 22.901  -14.290 1.00 24.57 ? 658  VAL A CB    1 
ATOM   5163 C  CG1   . VAL C 3 652 ? 59.097 22.239  -14.825 1.00 24.31 ? 658  VAL A CG1   1 
ATOM   5164 C  CG2   . VAL C 3 652 ? 57.396 22.247  -12.993 1.00 26.27 ? 658  VAL A CG2   1 
ATOM   5165 N  N     . GLY C 3 653 ? 59.746 25.443  -15.444 1.00 25.49 ? 659  GLY A N     1 
ATOM   5166 C  CA    . GLY C 3 653 ? 60.273 26.056  -16.652 1.00 24.43 ? 659  GLY A CA    1 
ATOM   5167 C  C     . GLY C 3 653 ? 60.633 24.934  -17.605 1.00 25.00 ? 659  GLY A C     1 
ATOM   5168 O  O     . GLY C 3 653 ? 61.287 23.964  -17.210 1.00 23.61 ? 659  GLY A O     1 
ATOM   5169 N  N     . CYS C 3 654 ? 60.209 25.055  -18.859 1.00 25.03 ? 660  CYS A N     1 
ATOM   5170 C  CA    . CYS C 3 654 ? 60.479 24.022  -19.852 1.00 24.19 ? 660  CYS A CA    1 
ATOM   5171 C  C     . CYS C 3 654 ? 61.149 24.554  -21.108 1.00 24.35 ? 660  CYS A C     1 
ATOM   5172 O  O     . CYS C 3 654 ? 60.740 25.576  -21.654 1.00 26.18 ? 660  CYS A O     1 
ATOM   5173 C  CB    . CYS C 3 654 ? 59.172 23.326  -20.220 1.00 24.05 ? 660  CYS A CB    1 
ATOM   5174 S  SG    . CYS C 3 654 ? 58.357 22.619  -18.789 1.00 25.49 ? 660  CYS A SG    1 
ATOM   5175 N  N     . ARG C 3 655 ? 62.171 23.844  -21.576 1.00 24.43 ? 661  ARG A N     1 
ATOM   5176 C  CA    . ARG C 3 655 ? 62.901 24.262  -22.766 1.00 23.78 ? 661  ARG A CA    1 
ATOM   5177 C  C     . ARG C 3 655 ? 62.015 24.364  -24.009 1.00 23.91 ? 661  ARG A C     1 
ATOM   5178 O  O     . ARG C 3 655 ? 62.237 25.230  -24.846 1.00 26.34 ? 661  ARG A O     1 
ATOM   5179 C  CB    . ARG C 3 655 ? 64.077 23.315  -23.032 1.00 20.75 ? 661  ARG A CB    1 
ATOM   5180 C  CG    . ARG C 3 655 ? 65.008 23.780  -24.153 1.00 20.64 ? 661  ARG A CG    1 
ATOM   5181 C  CD    . ARG C 3 655 ? 66.335 23.035  -24.136 1.00 21.75 ? 661  ARG A CD    1 
ATOM   5182 N  NE    . ARG C 3 655 ? 66.174 21.585  -24.236 1.00 22.82 ? 661  ARG A NE    1 
ATOM   5183 C  CZ    . ARG C 3 655 ? 65.704 20.946  -25.305 1.00 23.54 ? 661  ARG A CZ    1 
ATOM   5184 N  NH1   . ARG C 3 655 ? 65.342 21.622  -26.386 1.00 23.15 ? 661  ARG A NH1   1 
ATOM   5185 N  NH2   . ARG C 3 655 ? 65.590 19.624  -25.290 1.00 25.26 ? 661  ARG A NH2   1 
ATOM   5186 N  N     . THR C 3 656 ? 61.004 23.505  -24.120 1.00 23.38 ? 662  THR A N     1 
ATOM   5187 C  CA    . THR C 3 656 ? 60.101 23.524  -25.283 1.00 23.58 ? 662  THR A CA    1 
ATOM   5188 C  C     . THR C 3 656 ? 58.640 23.282  -24.885 1.00 25.20 ? 662  THR A C     1 
ATOM   5189 O  O     . THR C 3 656 ? 58.351 22.829  -23.773 1.00 25.81 ? 662  THR A O     1 
ATOM   5190 C  CB    . THR C 3 656 ? 60.453 22.417  -26.294 1.00 23.69 ? 662  THR A CB    1 
ATOM   5191 O  OG1   . THR C 3 656 ? 60.096 21.153  -25.726 1.00 23.33 ? 662  THR A OG1   1 
ATOM   5192 C  CG2   . THR C 3 656 ? 61.948 22.414  -26.622 1.00 21.54 ? 662  THR A CG2   1 
ATOM   5193 N  N     . GLU C 3 657 ? 57.723 23.566  -25.805 1.00 25.61 ? 663  GLU A N     1 
ATOM   5194 C  CA    . GLU C 3 657 ? 56.300 23.363  -25.550 1.00 27.59 ? 663  GLU A CA    1 
ATOM   5195 C  C     . GLU C 3 657 ? 55.989 21.891  -25.352 1.00 25.82 ? 663  GLU A C     1 
ATOM   5196 O  O     . GLU C 3 657 ? 55.172 21.528  -24.504 1.00 26.64 ? 663  GLU A O     1 
ATOM   5197 C  CB    . GLU C 3 657 ? 55.453 23.892  -26.706 1.00 29.30 ? 663  GLU A CB    1 
ATOM   5198 C  CG    . GLU C 3 657 ? 55.481 25.395  -26.857 1.00 35.01 ? 663  GLU A CG    1 
ATOM   5199 C  CD    . GLU C 3 657 ? 54.151 25.942  -27.346 1.00 39.36 ? 663  GLU A CD    1 
ATOM   5200 O  OE1   . GLU C 3 657 ? 53.405 25.186  -28.016 1.00 39.98 ? 663  GLU A OE1   1 
ATOM   5201 O  OE2   . GLU C 3 657 ? 53.856 27.125  -27.063 1.00 40.06 ? 663  GLU A OE2   1 
ATOM   5202 N  N     . GLU C 3 658 ? 56.645 21.054  -26.144 1.00 24.99 ? 664  GLU A N     1 
ATOM   5203 C  CA    . GLU C 3 658 ? 56.463 19.611  -26.067 1.00 25.92 ? 664  GLU A CA    1 
ATOM   5204 C  C     . GLU C 3 658 ? 56.859 19.110  -24.681 1.00 25.79 ? 664  GLU A C     1 
ATOM   5205 O  O     . GLU C 3 658 ? 56.179 18.263  -24.111 1.00 28.00 ? 664  GLU A O     1 
ATOM   5206 C  CB    . GLU C 3 658 ? 57.317 18.912  -27.138 1.00 24.67 ? 664  GLU A CB    1 
ATOM   5207 N  N     . ILE C 3 659 ? 57.965 19.627  -24.145 1.00 25.79 ? 665  ILE A N     1 
ATOM   5208 C  CA    . ILE C 3 659 ? 58.419 19.226  -22.816 1.00 25.11 ? 665  ILE A CA    1 
ATOM   5209 C  C     . ILE C 3 659 ? 57.402 19.718  -21.792 1.00 24.54 ? 665  ILE A C     1 
ATOM   5210 O  O     . ILE C 3 659 ? 57.113 19.039  -20.808 1.00 24.52 ? 665  ILE A O     1 
ATOM   5211 C  CB    . ILE C 3 659 ? 59.821 19.820  -22.483 1.00 24.71 ? 665  ILE A CB    1 
ATOM   5212 C  CG1   . ILE C 3 659 ? 60.905 19.121  -23.313 1.00 25.40 ? 665  ILE A CG1   1 
ATOM   5213 C  CG2   . ILE C 3 659 ? 60.137 19.642  -21.003 1.00 23.92 ? 665  ILE A CG2   1 
ATOM   5214 N  N     . ALA C 3 660 ? 56.855 20.902  -22.030 1.00 24.35 ? 666  ALA A N     1 
ATOM   5215 C  CA    . ALA C 3 660 ? 55.876 21.454  -21.119 1.00 25.57 ? 666  ALA A CA    1 
ATOM   5216 C  C     . ALA C 3 660 ? 54.671 20.512  -21.082 1.00 26.64 ? 666  ALA A C     1 
ATOM   5217 O  O     . ALA C 3 660 ? 54.121 20.251  -20.013 1.00 27.80 ? 666  ALA A O     1 
ATOM   5218 C  CB    . ALA C 3 660 ? 55.464 22.853  -21.566 1.00 25.42 ? 666  ALA A CB    1 
ATOM   5219 N  N     . GLN C 3 661 ? 54.275 19.993  -22.244 1.00 27.32 ? 667  GLN A N     1 
ATOM   5220 C  CA    . GLN C 3 661 ? 53.147 19.064  -22.327 1.00 28.39 ? 667  GLN A CA    1 
ATOM   5221 C  C     . GLN C 3 661 ? 53.464 17.770  -21.574 1.00 28.24 ? 667  GLN A C     1 
ATOM   5222 O  O     . GLN C 3 661 ? 52.600 17.211  -20.888 1.00 28.26 ? 667  GLN A O     1 
ATOM   5223 C  CB    . GLN C 3 661 ? 52.818 18.728  -23.792 1.00 30.24 ? 667  GLN A CB    1 
ATOM   5224 C  CG    . GLN C 3 661 ? 52.447 19.930  -24.656 1.00 31.68 ? 667  GLN A CG    1 
ATOM   5225 N  N     . VAL C 3 662 ? 54.698 17.287  -21.717 1.00 25.94 ? 668  VAL A N     1 
ATOM   5226 C  CA    . VAL C 3 662 ? 55.119 16.072  -21.027 1.00 24.21 ? 668  VAL A CA    1 
ATOM   5227 C  C     . VAL C 3 662 ? 55.112 16.303  -19.511 1.00 23.85 ? 668  VAL A C     1 
ATOM   5228 O  O     . VAL C 3 662 ? 54.693 15.436  -18.746 1.00 24.27 ? 668  VAL A O     1 
ATOM   5229 C  CB    . VAL C 3 662 ? 56.540 15.627  -21.489 1.00 25.14 ? 668  VAL A CB    1 
ATOM   5230 C  CG1   . VAL C 3 662 ? 57.043 14.467  -20.627 1.00 25.63 ? 668  VAL A CG1   1 
ATOM   5231 C  CG2   . VAL C 3 662 ? 56.496 15.190  -22.955 1.00 24.03 ? 668  VAL A CG2   1 
ATOM   5232 N  N     . VAL C 3 663 ? 55.582 17.474  -19.081 1.00 23.33 ? 669  VAL A N     1 
ATOM   5233 C  CA    . VAL C 3 663 ? 55.609 17.815  -17.658 1.00 21.61 ? 669  VAL A CA    1 
ATOM   5234 C  C     . VAL C 3 663 ? 54.182 17.808  -17.083 1.00 22.42 ? 669  VAL A C     1 
ATOM   5235 O  O     . VAL C 3 663 ? 53.932 17.239  -16.022 1.00 22.88 ? 669  VAL A O     1 
ATOM   5236 C  CB    . VAL C 3 663 ? 56.248 19.223  -17.418 1.00 20.64 ? 669  VAL A CB    1 
ATOM   5237 C  CG1   . VAL C 3 663 ? 55.995 19.667  -15.991 1.00 19.34 ? 669  VAL A CG1   1 
ATOM   5238 C  CG2   . VAL C 3 663 ? 57.768 19.180  -17.681 1.00 18.00 ? 669  VAL A CG2   1 
ATOM   5239 N  N     . ILE C 3 664 ? 53.250 18.440  -17.788 1.00 23.48 ? 670  ILE A N     1 
ATOM   5240 C  CA    . ILE C 3 664 ? 51.859 18.491  -17.334 1.00 24.89 ? 670  ILE A CA    1 
ATOM   5241 C  C     . ILE C 3 664 ? 51.230 17.094  -17.223 1.00 26.61 ? 670  ILE A C     1 
ATOM   5242 O  O     . ILE C 3 664 ? 50.594 16.768  -16.216 1.00 25.82 ? 670  ILE A O     1 
ATOM   5243 C  CB    . ILE C 3 664 ? 50.993 19.351  -18.283 1.00 24.78 ? 670  ILE A CB    1 
ATOM   5244 C  CG1   . ILE C 3 664 ? 51.411 20.822  -18.188 1.00 25.55 ? 670  ILE A CG1   1 
ATOM   5245 C  CG2   . ILE C 3 664 ? 49.518 19.197  -17.938 1.00 24.91 ? 670  ILE A CG2   1 
ATOM   5246 N  N     . GLU C 3 665 ? 51.413 16.270  -18.250 1.00 25.75 ? 671  GLU A N     1 
ATOM   5247 C  CA    . GLU C 3 665 ? 50.840 14.925  -18.247 1.00 28.05 ? 671  GLU A CA    1 
ATOM   5248 C  C     . GLU C 3 665 ? 51.508 14.050  -17.199 1.00 27.17 ? 671  GLU A C     1 
ATOM   5249 O  O     . GLU C 3 665 ? 50.858 13.222  -16.573 1.00 28.13 ? 671  GLU A O     1 
ATOM   5250 C  CB    . GLU C 3 665 ? 50.987 14.276  -19.629 1.00 28.67 ? 671  GLU A CB    1 
ATOM   5251 C  CG    . GLU C 3 665 ? 50.377 15.106  -20.749 1.00 32.25 ? 671  GLU A CG    1 
ATOM   5252 C  CD    . GLU C 3 665 ? 50.773 14.622  -22.134 1.00 35.18 ? 671  GLU A CD    1 
ATOM   5253 O  OE1   . GLU C 3 665 ? 51.920 14.154  -22.307 1.00 36.38 ? 671  GLU A OE1   1 
ATOM   5254 O  OE2   . GLU C 3 665 ? 49.940 14.731  -23.058 1.00 37.13 ? 671  GLU A OE2   1 
ATOM   5255 N  N     . THR C 3 666 ? 52.810 14.240  -17.013 1.00 27.10 ? 672  THR A N     1 
ATOM   5256 C  CA    . THR C 3 666 ? 53.560 13.458  -16.037 1.00 25.09 ? 672  THR A CA    1 
ATOM   5257 C  C     . THR C 3 666 ? 53.145 13.813  -14.613 1.00 25.35 ? 672  THR A C     1 
ATOM   5258 O  O     . THR C 3 666 ? 53.029 12.931  -13.762 1.00 25.92 ? 672  THR A O     1 
ATOM   5259 C  CB    . THR C 3 666 ? 55.073 13.673  -16.217 1.00 24.69 ? 672  THR A CB    1 
ATOM   5260 O  OG1   . THR C 3 666 ? 55.416 13.422  -17.584 1.00 24.93 ? 672  THR A OG1   1 
ATOM   5261 C  CG2   . THR C 3 666 ? 55.866 12.722  -15.345 1.00 19.72 ? 672  THR A CG2   1 
ATOM   5262 N  N     . ALA C 3 667 ? 52.902 15.098  -14.357 1.00 24.97 ? 673  ALA A N     1 
ATOM   5263 C  CA    . ALA C 3 667 ? 52.480 15.538  -13.031 1.00 24.05 ? 673  ALA A CA    1 
ATOM   5264 C  C     . ALA C 3 667 ? 51.140 14.877  -12.660 1.00 24.51 ? 673  ALA A C     1 
ATOM   5265 O  O     . ALA C 3 667 ? 50.925 14.489  -11.513 1.00 22.90 ? 673  ALA A O     1 
ATOM   5266 C  CB    . ALA C 3 667 ? 52.350 17.065  -13.000 1.00 24.45 ? 673  ALA A CB    1 
ATOM   5267 N  N     . GLN C 3 668 ? 50.243 14.756  -13.637 1.00 26.41 ? 674  GLN A N     1 
ATOM   5268 C  CA    . GLN C 3 668 ? 48.947 14.120  -13.407 1.00 27.57 ? 674  GLN A CA    1 
ATOM   5269 C  C     . GLN C 3 668 ? 49.145 12.643  -13.064 1.00 28.26 ? 674  GLN A C     1 
ATOM   5270 O  O     . GLN C 3 668 ? 48.480 12.110  -12.168 1.00 29.53 ? 674  GLN A O     1 
ATOM   5271 C  CB    . GLN C 3 668 ? 48.054 14.267  -14.650 1.00 28.52 ? 674  GLN A CB    1 
ATOM   5272 C  CG    . GLN C 3 668 ? 46.781 13.404  -14.657 1.00 27.95 ? 674  GLN A CG    1 
ATOM   5273 C  CD    . GLN C 3 668 ? 45.799 13.743  -13.541 1.00 29.29 ? 674  GLN A CD    1 
ATOM   5274 O  OE1   . GLN C 3 668 ? 45.853 14.826  -12.947 1.00 26.69 ? 674  GLN A OE1   1 
ATOM   5275 N  NE2   . GLN C 3 668 ? 44.877 12.819  -13.266 1.00 27.37 ? 674  GLN A NE2   1 
ATOM   5276 N  N     . GLU C 3 669 ? 50.067 11.981  -13.761 1.00 28.23 ? 675  GLU A N     1 
ATOM   5277 C  CA    . GLU C 3 669 ? 50.328 10.565  -13.492 1.00 29.69 ? 675  GLU A CA    1 
ATOM   5278 C  C     . GLU C 3 669 ? 50.956 10.378  -12.108 1.00 27.19 ? 675  GLU A C     1 
ATOM   5279 O  O     . GLU C 3 669 ? 50.630 9.430   -11.396 1.00 27.96 ? 675  GLU A O     1 
ATOM   5280 C  CB    . GLU C 3 669 ? 51.248 9.971   -14.574 1.00 33.14 ? 675  GLU A CB    1 
ATOM   5281 C  CG    . GLU C 3 669 ? 50.540 9.653   -15.893 1.00 38.84 ? 675  GLU A CG    1 
ATOM   5282 C  CD    . GLU C 3 669 ? 51.495 9.568   -17.084 1.00 43.49 ? 675  GLU A CD    1 
ATOM   5283 O  OE1   . GLU C 3 669 ? 52.594 8.983   -16.938 1.00 44.94 ? 675  GLU A OE1   1 
ATOM   5284 O  OE2   . GLU C 3 669 ? 51.138 10.082  -18.173 1.00 45.41 ? 675  GLU A OE2   1 
ATOM   5285 N  N     . ALA C 3 670 ? 51.850 11.283  -11.725 1.00 23.51 ? 676  ALA A N     1 
ATOM   5286 C  CA    . ALA C 3 670 ? 52.499 11.192  -10.416 1.00 22.49 ? 676  ALA A CA    1 
ATOM   5287 C  C     . ALA C 3 670 ? 51.461 11.331  -9.293  1.00 20.66 ? 676  ALA A C     1 
ATOM   5288 O  O     . ALA C 3 670 ? 51.558 10.659  -8.263  1.00 18.89 ? 676  ALA A O     1 
ATOM   5289 C  CB    . ALA C 3 670 ? 53.589 12.275  -10.281 1.00 17.35 ? 676  ALA A CB    1 
ATOM   5290 N  N     . MET C 3 671 ? 50.473 12.200  -9.502  1.00 20.41 ? 677  MET A N     1 
ATOM   5291 C  CA    . MET C 3 671 ? 49.410 12.413  -8.520  1.00 23.32 ? 677  MET A CA    1 
ATOM   5292 C  C     . MET C 3 671 ? 48.599 11.127  -8.357  1.00 23.94 ? 677  MET A C     1 
ATOM   5293 O  O     . MET C 3 671 ? 48.299 10.710  -7.241  1.00 24.76 ? 677  MET A O     1 
ATOM   5294 C  CB    . MET C 3 671 ? 48.480 13.548  -8.961  1.00 24.91 ? 677  MET A CB    1 
ATOM   5295 C  CG    . MET C 3 671 ? 47.384 13.884  -7.940  1.00 26.48 ? 677  MET A CG    1 
ATOM   5296 S  SD    . MET C 3 671 ? 48.058 14.453  -6.340  1.00 29.52 ? 677  MET A SD    1 
ATOM   5297 C  CE    . MET C 3 671 ? 48.497 16.169  -6.759  1.00 27.61 ? 677  MET A CE    1 
ATOM   5298 N  N     . ARG C 3 672 ? 48.246 10.501  -9.476  1.00 24.11 ? 678  ARG A N     1 
ATOM   5299 C  CA    . ARG C 3 672 ? 47.493 9.253   -9.432  1.00 24.71 ? 678  ARG A CA    1 
ATOM   5300 C  C     . ARG C 3 672 ? 48.333 8.207   -8.712  1.00 24.11 ? 678  ARG A C     1 
ATOM   5301 O  O     . ARG C 3 672 ? 47.806 7.393   -7.961  1.00 24.68 ? 678  ARG A O     1 
ATOM   5302 C  CB    . ARG C 3 672 ? 47.150 8.782   -10.848 1.00 26.17 ? 678  ARG A CB    1 
ATOM   5303 C  CG    . ARG C 3 672 ? 45.927 9.470   -11.462 1.00 28.90 ? 678  ARG A CG    1 
ATOM   5304 C  CD    . ARG C 3 672 ? 44.665 8.599   -11.296 1.00 36.76 ? 678  ARG A CD    1 
ATOM   5305 N  NE    . ARG C 3 672 ? 43.559 9.040   -12.154 1.00 37.40 ? 678  ARG A NE    1 
ATOM   5306 C  CZ    . ARG C 3 672 ? 42.934 10.197  -11.994 1.00 37.06 ? 678  ARG A CZ    1 
ATOM   5307 N  NH1   . ARG C 3 672 ? 43.309 10.994  -11.013 1.00 38.35 ? 678  ARG A NH1   1 
ATOM   5308 N  NH2   . ARG C 3 672 ? 41.963 10.568  -12.819 1.00 37.64 ? 678  ARG A NH2   1 
ATOM   5309 N  N     . TRP C 3 673 ? 49.647 8.246   -8.927  1.00 22.49 ? 679  TRP A N     1 
ATOM   5310 C  CA    . TRP C 3 673 ? 50.555 7.307   -8.272  1.00 21.49 ? 679  TRP A CA    1 
ATOM   5311 C  C     . TRP C 3 673 ? 50.559 7.499   -6.749  1.00 20.95 ? 679  TRP A C     1 
ATOM   5312 O  O     . TRP C 3 673 ? 50.594 6.532   -5.982  1.00 21.29 ? 679  TRP A O     1 
ATOM   5313 C  CB    . TRP C 3 673 ? 51.978 7.487   -8.809  1.00 22.85 ? 679  TRP A CB    1 
ATOM   5314 C  CG    . TRP C 3 673 ? 52.948 6.509   -8.239  1.00 22.55 ? 679  TRP A CG    1 
ATOM   5315 C  CD1   . TRP C 3 673 ? 53.246 5.265   -8.725  1.00 23.43 ? 679  TRP A CD1   1 
ATOM   5316 C  CD2   . TRP C 3 673 ? 53.726 6.670   -7.047  1.00 23.77 ? 679  TRP A CD2   1 
ATOM   5317 N  NE1   . TRP C 3 673 ? 54.163 4.645   -7.908  1.00 23.98 ? 679  TRP A NE1   1 
ATOM   5318 C  CE2   . TRP C 3 673 ? 54.473 5.483   -6.870  1.00 23.44 ? 679  TRP A CE2   1 
ATOM   5319 C  CE3   . TRP C 3 673 ? 53.864 7.706   -6.107  1.00 23.58 ? 679  TRP A CE3   1 
ATOM   5320 C  CZ2   . TRP C 3 673 ? 55.346 5.299   -5.793  1.00 23.79 ? 679  TRP A CZ2   1 
ATOM   5321 C  CZ3   . TRP C 3 673 ? 54.733 7.524   -5.036  1.00 23.68 ? 679  TRP A CZ3   1 
ATOM   5322 C  CH2   . TRP C 3 673 ? 55.464 6.325   -4.890  1.00 26.04 ? 679  TRP A CH2   1 
ATOM   5323 N  N     . VAL C 3 674 ? 50.539 8.755   -6.321  1.00 21.92 ? 680  VAL A N     1 
ATOM   5324 C  CA    . VAL C 3 674 ? 50.532 9.091   -4.902  1.00 21.78 ? 680  VAL A CA    1 
ATOM   5325 C  C     . VAL C 3 674 ? 49.230 8.603   -4.274  1.00 22.17 ? 680  VAL A C     1 
ATOM   5326 O  O     . VAL C 3 674 ? 49.238 7.976   -3.216  1.00 22.26 ? 680  VAL A O     1 
ATOM   5327 C  CB    . VAL C 3 674 ? 50.681 10.627  -4.710  1.00 23.78 ? 680  VAL A CB    1 
ATOM   5328 C  CG1   . VAL C 3 674 ? 50.397 11.025  -3.269  1.00 21.31 ? 680  VAL A CG1   1 
ATOM   5329 C  CG2   . VAL C 3 674 ? 52.094 11.049  -5.104  1.00 21.32 ? 680  VAL A CG2   1 
ATOM   5330 N  N     . GLY C 3 675 ? 48.114 8.882   -4.941  1.00 22.47 ? 681  GLY A N     1 
ATOM   5331 C  CA    . GLY C 3 675 ? 46.827 8.450   -4.436  1.00 23.65 ? 681  GLY A CA    1 
ATOM   5332 C  C     . GLY C 3 675 ? 46.775 6.941   -4.244  1.00 25.43 ? 681  GLY A C     1 
ATOM   5333 O  O     . GLY C 3 675 ? 46.194 6.451   -3.272  1.00 25.81 ? 681  GLY A O     1 
ATOM   5334 N  N     . ASP C 3 676 ? 47.382 6.200   -5.167  1.00 25.92 ? 682  ASP A N     1 
ATOM   5335 C  CA    . ASP C 3 676 ? 47.405 4.740   -5.071  1.00 28.56 ? 682  ASP A CA    1 
ATOM   5336 C  C     . ASP C 3 676 ? 48.391 4.296   -4.000  1.00 27.60 ? 682  ASP A C     1 
ATOM   5337 O  O     . ASP C 3 676 ? 48.131 3.358   -3.245  1.00 28.41 ? 682  ASP A O     1 
ATOM   5338 C  CB    . ASP C 3 676 ? 47.813 4.114   -6.405  1.00 29.56 ? 682  ASP A CB    1 
ATOM   5339 C  CG    . ASP C 3 676 ? 47.959 2.604   -6.314  1.00 36.49 ? 682  ASP A CG    1 
ATOM   5340 O  OD1   . ASP C 3 676 ? 46.925 1.906   -6.190  1.00 39.27 ? 682  ASP A OD1   1 
ATOM   5341 O  OD2   . ASP C 3 676 ? 49.111 2.110   -6.350  1.00 39.67 ? 682  ASP A OD2   1 
ATOM   5342 N  N     . HIS C 3 677 ? 49.529 4.981   -3.944  1.00 28.21 ? 683  HIS A N     1 
ATOM   5343 C  CA    . HIS C 3 677 ? 50.581 4.666   -2.980  1.00 25.62 ? 683  HIS A CA    1 
ATOM   5344 C  C     . HIS C 3 677 ? 50.058 4.615   -1.553  1.00 24.77 ? 683  HIS A C     1 
ATOM   5345 O  O     . HIS C 3 677 ? 50.408 3.723   -0.788  1.00 24.65 ? 683  HIS A O     1 
ATOM   5346 C  CB    . HIS C 3 677 ? 51.699 5.707   -3.067  1.00 25.79 ? 683  HIS A CB    1 
ATOM   5347 C  CG    . HIS C 3 677 ? 52.786 5.500   -2.065  1.00 25.27 ? 683  HIS A CG    1 
ATOM   5348 N  ND1   . HIS C 3 677 ? 53.698 4.472   -2.160  1.00 26.07 ? 683  HIS A ND1   1 
ATOM   5349 C  CD2   . HIS C 3 677 ? 53.093 6.175   -0.932  1.00 24.96 ? 683  HIS A CD2   1 
ATOM   5350 C  CE1   . HIS C 3 677 ? 54.520 4.522   -1.129  1.00 25.64 ? 683  HIS A CE1   1 
ATOM   5351 N  NE2   . HIS C 3 677 ? 54.174 5.546   -0.368  1.00 26.40 ? 683  HIS A NE2   1 
ATOM   5352 N  N     . TRP C 3 678 ? 49.225 5.582   -1.192  1.00 25.53 ? 684  TRP A N     1 
ATOM   5353 C  CA    . TRP C 3 678 ? 48.669 5.630   0.153   1.00 26.22 ? 684  TRP A CA    1 
ATOM   5354 C  C     . TRP C 3 678 ? 47.205 5.168   0.234   1.00 25.87 ? 684  TRP A C     1 
ATOM   5355 O  O     . TRP C 3 678 ? 46.490 5.537   1.160   1.00 26.55 ? 684  TRP A O     1 
ATOM   5356 C  CB    . TRP C 3 678 ? 48.811 7.049   0.737   1.00 24.27 ? 684  TRP A CB    1 
ATOM   5357 C  CG    . TRP C 3 678 ? 50.218 7.382   1.208   1.00 24.04 ? 684  TRP A CG    1 
ATOM   5358 C  CD1   . TRP C 3 678 ? 51.116 6.521   1.776   1.00 24.67 ? 684  TRP A CD1   1 
ATOM   5359 C  CD2   . TRP C 3 678 ? 50.860 8.673   1.190   1.00 22.02 ? 684  TRP A CD2   1 
ATOM   5360 N  NE1   . TRP C 3 678 ? 52.274 7.191   2.110   1.00 25.17 ? 684  TRP A NE1   1 
ATOM   5361 C  CE2   . TRP C 3 678 ? 52.144 8.510   1.762   1.00 22.19 ? 684  TRP A CE2   1 
ATOM   5362 C  CE3   . TRP C 3 678 ? 50.473 9.944   0.750   1.00 21.56 ? 684  TRP A CE3   1 
ATOM   5363 C  CZ2   . TRP C 3 678 ? 53.046 9.573   1.904   1.00 22.98 ? 684  TRP A CZ2   1 
ATOM   5364 C  CZ3   . TRP C 3 678 ? 51.369 11.005  0.891   1.00 23.90 ? 684  TRP A CZ3   1 
ATOM   5365 C  CH2   . TRP C 3 678 ? 52.643 10.808  1.466   1.00 23.26 ? 684  TRP A CH2   1 
ATOM   5366 N  N     . ASN C 3 679 ? 46.771 4.360   -0.730  1.00 25.76 ? 685  ASN A N     1 
ATOM   5367 C  CA    . ASN C 3 679 ? 45.400 3.845   -0.748  1.00 26.42 ? 685  ASN A CA    1 
ATOM   5368 C  C     . ASN C 3 679 ? 44.381 4.933   -0.418  1.00 25.77 ? 685  ASN A C     1 
ATOM   5369 O  O     . ASN C 3 679 ? 43.514 4.737   0.428   1.00 25.77 ? 685  ASN A O     1 
ATOM   5370 C  CB    . ASN C 3 679 ? 45.256 2.709   0.272   1.00 27.61 ? 685  ASN A CB    1 
ATOM   5371 C  CG    . ASN C 3 679 ? 46.229 1.572   0.025   1.00 30.06 ? 685  ASN A CG    1 
ATOM   5372 O  OD1   . ASN C 3 679 ? 46.231 0.966   -1.048  1.00 33.75 ? 685  ASN A OD1   1 
ATOM   5373 N  ND2   . ASN C 3 679 ? 47.058 1.271   1.019   1.00 29.56 ? 685  ASN A ND2   1 
ATOM   5374 N  N     . PHE C 3 680 ? 44.472 6.077   -1.084  1.00 26.57 ? 686  PHE A N     1 
ATOM   5375 C  CA    . PHE C 3 680 ? 43.546 7.163   -0.786  1.00 25.85 ? 686  PHE A CA    1 
ATOM   5376 C  C     . PHE C 3 680 ? 42.130 6.819   -1.220  1.00 25.93 ? 686  PHE A C     1 
ATOM   5377 O  O     . PHE C 3 680 ? 41.917 6.267   -2.297  1.00 24.93 ? 686  PHE A O     1 
ATOM   5378 C  CB    . PHE C 3 680 ? 44.008 8.456   -1.449  1.00 24.93 ? 686  PHE A CB    1 
ATOM   5379 C  CG    . PHE C 3 680 ? 43.976 9.642   -0.530  1.00 25.56 ? 686  PHE A CG    1 
ATOM   5380 C  CD1   . PHE C 3 680 ? 44.673 9.620   0.672   1.00 24.23 ? 686  PHE A CD1   1 
ATOM   5381 C  CD2   . PHE C 3 680 ? 43.258 10.785  -0.867  1.00 24.48 ? 686  PHE A CD2   1 
ATOM   5382 C  CE1   . PHE C 3 680 ? 44.653 10.718  1.519   1.00 23.76 ? 686  PHE A CE1   1 
ATOM   5383 C  CE2   . PHE C 3 680 ? 43.234 11.889  -0.024  1.00 23.64 ? 686  PHE A CE2   1 
ATOM   5384 C  CZ    . PHE C 3 680 ? 43.931 11.856  1.170   1.00 23.82 ? 686  PHE A CZ    1 
ATOM   5385 N  N     . ARG C 3 681 ? 41.165 7.169   -0.375  1.00 27.39 ? 687  ARG A N     1 
ATOM   5386 C  CA    . ARG C 3 681 ? 39.763 6.863   -0.632  1.00 27.84 ? 687  ARG A CA    1 
ATOM   5387 C  C     . ARG C 3 681 ? 39.027 7.845   -1.526  1.00 28.05 ? 687  ARG A C     1 
ATOM   5388 O  O     . ARG C 3 681 ? 37.815 7.768   -1.676  1.00 27.77 ? 687  ARG A O     1 
ATOM   5389 C  CB    . ARG C 3 681 ? 39.034 6.702   0.696   1.00 26.86 ? 687  ARG A CB    1 
ATOM   5390 C  CG    . ARG C 3 681 ? 39.418 5.422   1.396   1.00 29.30 ? 687  ARG A CG    1 
ATOM   5391 C  CD    . ARG C 3 681 ? 38.343 4.369   1.204   1.00 30.37 ? 687  ARG A CD    1 
ATOM   5392 N  NE    . ARG C 3 681 ? 37.688 4.121   2.481   1.00 32.80 ? 687  ARG A NE    1 
ATOM   5393 C  CZ    . ARG C 3 681 ? 36.472 3.619   2.621   1.00 31.45 ? 687  ARG A CZ    1 
ATOM   5394 N  NH1   . ARG C 3 681 ? 35.746 3.300   1.559   1.00 31.82 ? 687  ARG A NH1   1 
ATOM   5395 N  NH2   . ARG C 3 681 ? 35.987 3.445   3.835   1.00 34.31 ? 687  ARG A NH2   1 
ATOM   5396 N  N     . CYS C 3 682 ? 39.764 8.771   -2.118  1.00 28.30 ? 688  CYS A N     1 
ATOM   5397 C  CA    . CYS C 3 682 ? 39.174 9.728   -3.042  1.00 28.23 ? 688  CYS A CA    1 
ATOM   5398 C  C     . CYS C 3 682 ? 40.174 9.872   -4.174  1.00 28.63 ? 688  CYS A C     1 
ATOM   5399 O  O     . CYS C 3 682 ? 41.378 9.961   -3.935  1.00 30.70 ? 688  CYS A O     1 
ATOM   5400 C  CB    . CYS C 3 682 ? 38.940 11.084  -2.373  1.00 24.54 ? 688  CYS A CB    1 
ATOM   5401 S  SG    . CYS C 3 682 ? 38.193 12.307  -3.487  1.00 31.07 ? 688  CYS A SG    1 
ATOM   5402 N  N     . LEU C 3 683 ? 39.683 9.868   -5.404  1.00 28.30 ? 689  LEU A N     1 
ATOM   5403 C  CA    . LEU C 3 683 ? 40.555 10.005  -6.557  1.00 28.42 ? 689  LEU A CA    1 
ATOM   5404 C  C     . LEU C 3 683 ? 41.218 11.390  -6.538  1.00 28.00 ? 689  LEU A C     1 
ATOM   5405 O  O     . LEU C 3 683 ? 40.551 12.404  -6.326  1.00 28.02 ? 689  LEU A O     1 
ATOM   5406 C  CB    . LEU C 3 683 ? 39.741 9.829   -7.836  1.00 29.90 ? 689  LEU A CB    1 
ATOM   5407 C  CG    . LEU C 3 683 ? 40.551 9.729   -9.125  1.00 32.35 ? 689  LEU A CG    1 
ATOM   5408 C  CD1   . LEU C 3 683 ? 41.451 8.498   -9.068  1.00 32.26 ? 689  LEU A CD1   1 
ATOM   5409 C  CD2   . LEU C 3 683 ? 39.601 9.654   -10.313 1.00 34.30 ? 689  LEU A CD2   1 
ATOM   5410 N  N     . LEU C 3 684 ? 42.531 11.431  -6.745  1.00 26.02 ? 690  LEU A N     1 
ATOM   5411 C  CA    . LEU C 3 684 ? 43.252 12.705  -6.743  1.00 24.13 ? 690  LEU A CA    1 
ATOM   5412 C  C     . LEU C 3 684 ? 43.592 13.141  -8.165  1.00 23.57 ? 690  LEU A C     1 
ATOM   5413 O  O     . LEU C 3 684 ? 43.973 12.311  -8.994  1.00 20.62 ? 690  LEU A O     1 
ATOM   5414 C  CB    . LEU C 3 684 ? 44.540 12.575  -5.926  1.00 21.96 ? 690  LEU A CB    1 
ATOM   5415 C  CG    . LEU C 3 684 ? 44.375 12.171  -4.461  1.00 21.37 ? 690  LEU A CG    1 
ATOM   5416 C  CD1   . LEU C 3 684 ? 45.753 11.993  -3.844  1.00 21.71 ? 690  LEU A CD1   1 
ATOM   5417 C  CD2   . LEU C 3 684 ? 43.576 13.229  -3.705  1.00 16.15 ? 690  LEU A CD2   1 
ATOM   5418 N  N     . ASP C 3 685 ? 43.457 14.438  -8.441  1.00 23.08 ? 691  ASP A N     1 
ATOM   5419 C  CA    . ASP C 3 685 ? 43.752 14.979  -9.766  1.00 24.46 ? 691  ASP A CA    1 
ATOM   5420 C  C     . ASP C 3 685 ? 44.540 16.282  -9.756  1.00 25.32 ? 691  ASP A C     1 
ATOM   5421 O  O     . ASP C 3 685 ? 44.708 16.923  -8.716  1.00 24.83 ? 691  ASP A O     1 
ATOM   5422 C  CB    . ASP C 3 685 ? 42.460 15.210  -10.556 1.00 26.63 ? 691  ASP A CB    1 
ATOM   5423 C  CG    . ASP C 3 685 ? 41.759 13.921  -10.913 1.00 30.04 ? 691  ASP A CG    1 
ATOM   5424 O  OD1   . ASP C 3 685 ? 42.381 13.085  -11.606 1.00 27.40 ? 691  ASP A OD1   1 
ATOM   5425 O  OD2   . ASP C 3 685 ? 40.589 13.747  -10.499 1.00 32.98 ? 691  ASP A OD2   1 
ATOM   5426 N  N     . THR C 3 686 ? 45.011 16.665  -10.939 1.00 26.74 ? 692  THR A N     1 
ATOM   5427 C  CA    . THR C 3 686 ? 45.765 17.902  -11.118 1.00 29.03 ? 692  THR A CA    1 
ATOM   5428 C  C     . THR C 3 686 ? 45.244 18.633  -12.352 1.00 30.36 ? 692  THR A C     1 
ATOM   5429 O  O     . THR C 3 686 ? 44.596 18.041  -13.213 1.00 29.96 ? 692  THR A O     1 
ATOM   5430 C  CB    . THR C 3 686 ? 47.264 17.642  -11.349 1.00 28.97 ? 692  THR A CB    1 
ATOM   5431 O  OG1   . THR C 3 686 ? 47.447 17.037  -12.634 1.00 30.35 ? 692  THR A OG1   1 
ATOM   5432 C  CG2   . THR C 3 686 ? 47.824 16.732  -10.270 1.00 29.20 ? 692  THR A CG2   1 
ATOM   5433 N  N     . GLU C 3 687 ? 45.536 19.923  -12.429 1.00 31.92 ? 693  GLU A N     1 
ATOM   5434 C  CA    . GLU C 3 687 ? 45.120 20.735  -13.562 1.00 33.57 ? 693  GLU A CA    1 
ATOM   5435 C  C     . GLU C 3 687 ? 46.387 21.437  -14.045 1.00 32.38 ? 693  GLU A C     1 
ATOM   5436 O  O     . GLU C 3 687 ? 47.098 22.057  -13.255 1.00 31.62 ? 693  GLU A O     1 
ATOM   5437 C  CB    . GLU C 3 687 ? 44.071 21.755  -13.109 1.00 37.73 ? 693  GLU A CB    1 
ATOM   5438 C  CG    . GLU C 3 687 ? 43.169 22.270  -14.211 1.00 42.22 ? 693  GLU A CG    1 
ATOM   5439 C  CD    . GLU C 3 687 ? 43.420 23.730  -14.541 1.00 47.86 ? 693  GLU A CD    1 
ATOM   5440 O  OE1   . GLU C 3 687 ? 44.523 24.052  -15.044 1.00 50.63 ? 693  GLU A OE1   1 
ATOM   5441 O  OE2   . GLU C 3 687 ? 42.511 24.559  -14.296 1.00 48.75 ? 693  GLU A OE2   1 
ATOM   5442 N  N     . GLY C 3 688 ? 46.673 21.326  -15.337 1.00 32.84 ? 694  GLY A N     1 
ATOM   5443 C  CA    . GLY C 3 688 ? 47.869 21.942  -15.879 1.00 31.63 ? 694  GLY A CA    1 
ATOM   5444 C  C     . GLY C 3 688 ? 47.620 23.018  -16.918 1.00 31.63 ? 694  GLY A C     1 
ATOM   5445 O  O     . GLY C 3 688 ? 46.698 22.918  -17.734 1.00 32.19 ? 694  GLY A O     1 
ATOM   5446 N  N     . LYS C 3 689 ? 48.457 24.049  -16.884 1.00 30.07 ? 695  LYS A N     1 
ATOM   5447 C  CA    . LYS C 3 689 ? 48.370 25.161  -17.816 1.00 30.48 ? 695  LYS A CA    1 
ATOM   5448 C  C     . LYS C 3 689 ? 49.743 25.462  -18.399 1.00 29.99 ? 695  LYS A C     1 
ATOM   5449 O  O     . LYS C 3 689 ? 50.743 25.478  -17.679 1.00 28.77 ? 695  LYS A O     1 
ATOM   5450 C  CB    . LYS C 3 689 ? 47.853 26.413  -17.106 1.00 32.86 ? 695  LYS A CB    1 
ATOM   5451 C  CG    . LYS C 3 689 ? 46.412 26.335  -16.629 1.00 36.43 ? 695  LYS A CG    1 
ATOM   5452 C  CD    . LYS C 3 689 ? 46.004 27.644  -15.961 1.00 36.97 ? 695  LYS A CD    1 
ATOM   5453 C  CE    . LYS C 3 689 ? 44.518 27.700  -15.676 1.00 38.32 ? 695  LYS A CE    1 
ATOM   5454 N  NZ    . LYS C 3 689 ? 44.125 29.075  -15.241 1.00 41.19 ? 695  LYS A NZ    1 
ATOM   5455 N  N     . MET C 3 690 ? 49.789 25.699  -19.706 1.00 30.01 ? 696  MET A N     1 
ATOM   5456 C  CA    . MET C 3 690 ? 51.044 26.026  -20.372 1.00 29.69 ? 696  MET A CA    1 
ATOM   5457 C  C     . MET C 3 690 ? 51.022 27.491  -20.798 1.00 29.28 ? 696  MET A C     1 
ATOM   5458 O  O     . MET C 3 690 ? 50.061 27.959  -21.402 1.00 29.45 ? 696  MET A O     1 
ATOM   5459 C  CB    . MET C 3 690 ? 51.258 25.148  -21.599 1.00 28.34 ? 696  MET A CB    1 
ATOM   5460 C  CG    . MET C 3 690 ? 52.598 25.383  -22.279 1.00 33.52 ? 696  MET A CG    1 
ATOM   5461 S  SD    . MET C 3 690 ? 52.806 24.420  -23.797 1.00 37.90 ? 696  MET A SD    1 
ATOM   5462 C  CE    . MET C 3 690 ? 51.855 22.919  -23.359 1.00 36.80 ? 696  MET A CE    1 
ATOM   5463 N  N     . GLY C 3 691 ? 52.091 28.209  -20.489 1.00 28.24 ? 697  GLY A N     1 
ATOM   5464 C  CA    . GLY C 3 691 ? 52.150 29.609  -20.845 1.00 28.02 ? 697  GLY A CA    1 
ATOM   5465 C  C     . GLY C 3 691 ? 53.540 30.168  -20.638 1.00 26.99 ? 697  GLY A C     1 
ATOM   5466 O  O     . GLY C 3 691 ? 54.442 29.443  -20.229 1.00 27.33 ? 697  GLY A O     1 
ATOM   5467 N  N     . PRO C 3 692 ? 53.740 31.464  -20.905 1.00 27.01 ? 698  PRO A N     1 
ATOM   5468 C  CA    . PRO C 3 692 ? 55.030 32.138  -20.754 1.00 25.90 ? 698  PRO A CA    1 
ATOM   5469 C  C     . PRO C 3 692 ? 55.385 32.544  -19.320 1.00 25.01 ? 698  PRO A C     1 
ATOM   5470 O  O     . PRO C 3 692 ? 56.563 32.639  -18.971 1.00 24.70 ? 698  PRO A O     1 
ATOM   5471 C  CB    . PRO C 3 692 ? 54.874 33.354  -21.662 1.00 26.30 ? 698  PRO A CB    1 
ATOM   5472 C  CG    . PRO C 3 692 ? 53.456 33.721  -21.437 1.00 26.61 ? 698  PRO A CG    1 
ATOM   5473 C  CD    . PRO C 3 692 ? 52.743 32.377  -21.492 1.00 26.91 ? 698  PRO A CD    1 
ATOM   5474 N  N     . ASN C 3 693 ? 54.377 32.786  -18.489 1.00 24.33 ? 699  ASN A N     1 
ATOM   5475 C  CA    . ASN C 3 693 ? 54.639 33.220  -17.121 1.00 24.41 ? 699  ASN A CA    1 
ATOM   5476 C  C     . ASN C 3 693 ? 53.556 32.816  -16.123 1.00 23.67 ? 699  ASN A C     1 
ATOM   5477 O  O     . ASN C 3 693 ? 52.555 32.197  -16.491 1.00 23.16 ? 699  ASN A O     1 
ATOM   5478 C  CB    . ASN C 3 693 ? 54.829 34.744  -17.090 1.00 23.82 ? 699  ASN A CB    1 
ATOM   5479 C  CG    . ASN C 3 693 ? 53.636 35.491  -17.662 1.00 25.98 ? 699  ASN A CG    1 
ATOM   5480 O  OD1   . ASN C 3 693 ? 52.496 35.262  -17.255 1.00 24.93 ? 699  ASN A OD1   1 
ATOM   5481 N  ND2   . ASN C 3 693 ? 53.894 36.392  -18.609 1.00 25.05 ? 699  ASN A ND2   1 
ATOM   5482 N  N     . TRP C 3 694 ? 53.766 33.185  -14.859 1.00 23.87 ? 700  TRP A N     1 
ATOM   5483 C  CA    . TRP C 3 694 ? 52.843 32.849  -13.773 1.00 24.81 ? 700  TRP A CA    1 
ATOM   5484 C  C     . TRP C 3 694 ? 51.455 33.479  -13.920 1.00 24.82 ? 700  TRP A C     1 
ATOM   5485 O  O     . TRP C 3 694 ? 50.470 32.938  -13.422 1.00 24.86 ? 700  TRP A O     1 
ATOM   5486 C  CB    . TRP C 3 694 ? 53.447 33.257  -12.421 1.00 23.28 ? 700  TRP A CB    1 
ATOM   5487 C  CG    . TRP C 3 694 ? 53.135 32.302  -11.288 1.00 24.32 ? 700  TRP A CG    1 
ATOM   5488 C  CD1   . TRP C 3 694 ? 52.132 31.368  -11.245 1.00 23.66 ? 700  TRP A CD1   1 
ATOM   5489 C  CD2   . TRP C 3 694 ? 53.830 32.196  -10.039 1.00 23.93 ? 700  TRP A CD2   1 
ATOM   5490 N  NE1   . TRP C 3 694 ? 52.163 30.693  -10.056 1.00 21.95 ? 700  TRP A NE1   1 
ATOM   5491 C  CE2   . TRP C 3 694 ? 53.193 31.175  -9.293  1.00 21.64 ? 700  TRP A CE2   1 
ATOM   5492 C  CE3   . TRP C 3 694 ? 54.931 32.865  -9.476  1.00 22.13 ? 700  TRP A CE3   1 
ATOM   5493 C  CZ2   . TRP C 3 694 ? 53.618 30.800  -8.012  1.00 21.66 ? 700  TRP A CZ2   1 
ATOM   5494 C  CZ3   . TRP C 3 694 ? 55.356 32.494  -8.202  1.00 23.77 ? 700  TRP A CZ3   1 
ATOM   5495 C  CH2   . TRP C 3 694 ? 54.696 31.466  -7.483  1.00 23.97 ? 700  TRP A CH2   1 
ATOM   5496 N  N     . ALA C 3 695 ? 51.376 34.619  -14.599 1.00 25.88 ? 701  ALA A N     1 
ATOM   5497 C  CA    . ALA C 3 695 ? 50.095 35.284  -14.792 1.00 27.68 ? 701  ALA A CA    1 
ATOM   5498 C  C     . ALA C 3 695 ? 49.179 34.364  -15.591 1.00 28.76 ? 701  ALA A C     1 
ATOM   5499 O  O     . ALA C 3 695 ? 47.985 34.247  -15.308 1.00 28.49 ? 701  ALA A O     1 
ATOM   5500 C  CB    . ALA C 3 695 ? 50.291 36.614  -15.532 1.00 26.67 ? 701  ALA A CB    1 
ATOM   5501 N  N     . ILE C 3 696 ? 49.758 33.695  -16.581 1.00 29.71 ? 702  ILE A N     1 
ATOM   5502 C  CA    . ILE C 3 696 ? 49.013 32.788  -17.439 1.00 31.31 ? 702  ILE A CA    1 
ATOM   5503 C  C     . ILE C 3 696 ? 48.939 31.348  -16.919 1.00 33.69 ? 702  ILE A C     1 
ATOM   5504 O  O     . ILE C 3 696 ? 48.043 30.597  -17.305 1.00 36.92 ? 702  ILE A O     1 
ATOM   5505 C  CB    . ILE C 3 696 ? 49.626 32.765  -18.855 1.00 30.48 ? 702  ILE A CB    1 
ATOM   5506 C  CG1   . ILE C 3 696 ? 49.611 34.172  -19.455 1.00 32.41 ? 702  ILE A CG1   1 
ATOM   5507 C  CG2   . ILE C 3 696 ? 48.853 31.819  -19.746 1.00 30.97 ? 702  ILE A CG2   1 
ATOM   5508 N  N     . CYS C 3 697 ? 49.852 30.956  -16.036 1.00 33.66 ? 703  CYS A N     1 
ATOM   5509 C  CA    . CYS C 3 697 ? 49.851 29.581  -15.548 1.00 35.93 ? 703  CYS A CA    1 
ATOM   5510 C  C     . CYS C 3 697 ? 49.283 29.284  -14.162 1.00 38.66 ? 703  CYS A C     1 
ATOM   5511 O  O     . CYS C 3 697 ? 49.783 28.401  -13.463 1.00 39.52 ? 703  CYS A O     1 
ATOM   5512 C  CB    . CYS C 3 697 ? 51.264 29.006  -15.637 1.00 33.80 ? 703  CYS A CB    1 
ATOM   5513 S  SG    . CYS C 3 697 ? 51.893 28.950  -17.325 1.00 32.11 ? 703  CYS A SG    1 
ATOM   5514 N  N     . HIS C 3 698 ? 48.245 30.004  -13.759 1.00 41.52 ? 704  HIS A N     1 
ATOM   5515 C  CA    . HIS C 3 698 ? 47.624 29.737  -12.460 1.00 45.67 ? 704  HIS A CA    1 
ATOM   5516 C  C     . HIS C 3 698 ? 46.287 30.445  -12.358 1.00 45.56 ? 704  HIS A C     1 
ATOM   5517 O  O     . HIS C 3 698 ? 45.319 29.799  -12.808 1.00 47.53 ? 704  HIS A O     1 
ATOM   5518 C  CB    . HIS C 3 698 ? 48.531 30.166  -11.292 1.00 46.59 ? 704  HIS A CB    1 
ATOM   5519 C  CG    . HIS C 3 698 ? 48.012 29.757  -9.944  1.00 49.34 ? 704  HIS A CG    1 
ATOM   5520 N  ND1   . HIS C 3 698 ? 47.968 28.441  -9.527  1.00 49.31 ? 704  HIS A ND1   1 
ATOM   5521 C  CD2   . HIS C 3 698 ? 47.475 30.487  -8.935  1.00 49.54 ? 704  HIS A CD2   1 
ATOM   5522 C  CE1   . HIS C 3 698 ? 47.425 28.378  -8.324  1.00 48.63 ? 704  HIS A CE1   1 
ATOM   5523 N  NE2   . HIS C 3 698 ? 47.116 29.606  -7.941  1.00 49.50 ? 704  HIS A NE2   1 
ATOM   5524 N  N     . LYS D 4 3   ? 39.846 92.376  25.038  1.00 44.10 ? 3    LYS B N     1 
ATOM   5525 C  CA    . LYS D 4 3   ? 40.409 93.157  23.902  1.00 44.02 ? 3    LYS B CA    1 
ATOM   5526 C  C     . LYS D 4 3   ? 41.433 92.359  23.103  1.00 43.52 ? 3    LYS B C     1 
ATOM   5527 O  O     . LYS D 4 3   ? 42.228 92.921  22.344  1.00 43.32 ? 3    LYS B O     1 
ATOM   5528 C  CB    . LYS D 4 3   ? 41.044 94.455  24.413  1.00 45.34 ? 3    LYS B CB    1 
ATOM   5529 C  CG    . LYS D 4 3   ? 40.020 95.524  24.788  1.00 46.75 ? 3    LYS B CG    1 
ATOM   5530 C  CD    . LYS D 4 3   ? 40.682 96.849  25.113  1.00 48.09 ? 3    LYS B CD    1 
ATOM   5531 C  CE    . LYS D 4 3   ? 39.659 97.978  25.158  1.00 49.54 ? 3    LYS B CE    1 
ATOM   5532 N  NZ    . LYS D 4 3   ? 38.549 97.694  26.108  1.00 50.35 ? 3    LYS B NZ    1 
ATOM   5533 N  N     . ILE D 4 4   ? 41.406 91.042  23.268  1.00 42.20 ? 4    ILE B N     1 
ATOM   5534 C  CA    . ILE D 4 4   ? 42.331 90.184  22.547  1.00 39.67 ? 4    ILE B CA    1 
ATOM   5535 C  C     . ILE D 4 4   ? 41.806 89.880  21.144  1.00 38.91 ? 4    ILE B C     1 
ATOM   5536 O  O     . ILE D 4 4   ? 40.616 89.625  20.952  1.00 36.22 ? 4    ILE B O     1 
ATOM   5537 C  CB    . ILE D 4 4   ? 42.561 88.866  23.305  1.00 39.87 ? 4    ILE B CB    1 
ATOM   5538 C  CG1   . ILE D 4 4   ? 43.391 89.132  24.568  1.00 39.31 ? 4    ILE B CG1   1 
ATOM   5539 C  CG2   . ILE D 4 4   ? 43.251 87.861  22.395  1.00 39.56 ? 4    ILE B CG2   1 
ATOM   5540 N  N     . ILE D 4 5   ? 42.706 89.927  20.167  1.00 37.50 ? 5    ILE B N     1 
ATOM   5541 C  CA    . ILE D 4 5   ? 42.351 89.653  18.784  1.00 37.76 ? 5    ILE B CA    1 
ATOM   5542 C  C     . ILE D 4 5   ? 42.562 88.176  18.474  1.00 37.57 ? 5    ILE B C     1 
ATOM   5543 O  O     . ILE D 4 5   ? 43.686 87.671  18.532  1.00 37.35 ? 5    ILE B O     1 
ATOM   5544 C  CB    . ILE D 4 5   ? 43.204 90.487  17.801  1.00 38.08 ? 5    ILE B CB    1 
ATOM   5545 C  CG1   . ILE D 4 5   ? 42.928 91.980  17.998  1.00 38.00 ? 5    ILE B CG1   1 
ATOM   5546 C  CG2   . ILE D 4 5   ? 42.890 90.071  16.367  1.00 38.45 ? 5    ILE B CG2   1 
ATOM   5547 N  N     . HIS D 4 6   ? 41.474 87.491  18.142  1.00 37.08 ? 6    HIS B N     1 
ATOM   5548 C  CA    . HIS D 4 6   ? 41.530 86.074  17.823  1.00 37.75 ? 6    HIS B CA    1 
ATOM   5549 C  C     . HIS D 4 6   ? 41.719 85.889  16.320  1.00 35.84 ? 6    HIS B C     1 
ATOM   5550 O  O     . HIS D 4 6   ? 40.780 86.044  15.537  1.00 34.21 ? 6    HIS B O     1 
ATOM   5551 C  CB    . HIS D 4 6   ? 40.248 85.395  18.301  1.00 40.02 ? 6    HIS B CB    1 
ATOM   5552 C  CG    . HIS D 4 6   ? 39.972 85.603  19.758  1.00 42.59 ? 6    HIS B CG    1 
ATOM   5553 N  ND1   . HIS D 4 6   ? 40.679 84.956  20.751  1.00 44.55 ? 6    HIS B ND1   1 
ATOM   5554 C  CD2   . HIS D 4 6   ? 39.087 86.409  20.392  1.00 44.01 ? 6    HIS B CD2   1 
ATOM   5555 C  CE1   . HIS D 4 6   ? 40.240 85.354  21.932  1.00 44.58 ? 6    HIS B CE1   1 
ATOM   5556 N  NE2   . HIS D 4 6   ? 39.274 86.235  21.742  1.00 45.91 ? 6    HIS B NE2   1 
ATOM   5557 N  N     . LEU D 4 7   ? 42.948 85.552  15.938  1.00 33.09 ? 7    LEU B N     1 
ATOM   5558 C  CA    . LEU D 4 7   ? 43.327 85.357  14.542  1.00 31.06 ? 7    LEU B CA    1 
ATOM   5559 C  C     . LEU D 4 7   ? 42.942 83.993  13.972  1.00 29.86 ? 7    LEU B C     1 
ATOM   5560 O  O     . LEU D 4 7   ? 42.588 83.070  14.703  1.00 29.59 ? 7    LEU B O     1 
ATOM   5561 C  CB    . LEU D 4 7   ? 44.849 85.509  14.396  1.00 30.46 ? 7    LEU B CB    1 
ATOM   5562 C  CG    . LEU D 4 7   ? 45.562 86.747  14.956  1.00 29.77 ? 7    LEU B CG    1 
ATOM   5563 C  CD1   . LEU D 4 7   ? 47.061 86.474  15.038  1.00 28.39 ? 7    LEU B CD1   1 
ATOM   5564 C  CD2   . LEU D 4 7   ? 45.276 87.959  14.073  1.00 29.34 ? 7    LEU B CD2   1 
ATOM   5565 N  N     . THR D 4 8   ? 43.029 83.889  12.649  1.00 28.90 ? 8    THR B N     1 
ATOM   5566 C  CA    . THR D 4 8   ? 42.782 82.646  11.927  1.00 28.09 ? 8    THR B CA    1 
ATOM   5567 C  C     . THR D 4 8   ? 43.818 82.667  10.813  1.00 28.08 ? 8    THR B C     1 
ATOM   5568 O  O     . THR D 4 8   ? 44.364 83.728  10.493  1.00 29.09 ? 8    THR B O     1 
ATOM   5569 C  CB    . THR D 4 8   ? 41.383 82.584  11.262  1.00 29.21 ? 8    THR B CB    1 
ATOM   5570 O  OG1   . THR D 4 8   ? 41.288 83.602  10.261  1.00 27.35 ? 8    THR B OG1   1 
ATOM   5571 C  CG2   . THR D 4 8   ? 40.262 82.762  12.301  1.00 29.81 ? 8    THR B CG2   1 
ATOM   5572 N  N     . ASP D 4 9   ? 44.093 81.514  10.220  1.00 28.50 ? 9    ASP B N     1 
ATOM   5573 C  CA    . ASP D 4 9   ? 45.064 81.461  9.132   1.00 29.51 ? 9    ASP B CA    1 
ATOM   5574 C  C     . ASP D 4 9   ? 44.794 82.497  8.044   1.00 30.06 ? 9    ASP B C     1 
ATOM   5575 O  O     . ASP D 4 9   ? 45.719 83.160  7.576   1.00 30.20 ? 9    ASP B O     1 
ATOM   5576 C  CB    . ASP D 4 9   ? 45.088 80.070  8.483   1.00 30.12 ? 9    ASP B CB    1 
ATOM   5577 C  CG    . ASP D 4 9   ? 45.899 79.068  9.280   1.00 32.92 ? 9    ASP B CG    1 
ATOM   5578 O  OD1   . ASP D 4 9   ? 46.987 79.440  9.772   1.00 36.51 ? 9    ASP B OD1   1 
ATOM   5579 O  OD2   . ASP D 4 9   ? 45.458 77.909  9.406   1.00 34.86 ? 9    ASP B OD2   1 
ATOM   5580 N  N     . ASP D 4 10  ? 43.528 82.632  7.652   1.00 30.13 ? 10   ASP B N     1 
ATOM   5581 C  CA    . ASP D 4 10  ? 43.137 83.553  6.589   1.00 30.27 ? 10   ASP B CA    1 
ATOM   5582 C  C     . ASP D 4 10  ? 43.134 85.048  6.912   1.00 30.90 ? 10   ASP B C     1 
ATOM   5583 O  O     . ASP D 4 10  ? 43.170 85.871  5.997   1.00 29.58 ? 10   ASP B O     1 
ATOM   5584 C  CB    . ASP D 4 10  ? 41.761 83.158  6.050   1.00 32.79 ? 10   ASP B CB    1 
ATOM   5585 C  CG    . ASP D 4 10  ? 41.785 81.843  5.290   1.00 34.89 ? 10   ASP B CG    1 
ATOM   5586 O  OD1   . ASP D 4 10  ? 40.699 81.308  4.999   1.00 34.66 ? 10   ASP B OD1   1 
ATOM   5587 O  OD2   . ASP D 4 10  ? 42.890 81.347  4.975   1.00 36.57 ? 10   ASP B OD2   1 
ATOM   5588 N  N     . SER D 4 11  ? 43.091 85.407  8.192   1.00 31.17 ? 11   SER B N     1 
ATOM   5589 C  CA    . SER D 4 11  ? 43.075 86.821  8.568   1.00 32.11 ? 11   SER B CA    1 
ATOM   5590 C  C     . SER D 4 11  ? 44.445 87.325  9.023   1.00 31.83 ? 11   SER B C     1 
ATOM   5591 O  O     . SER D 4 11  ? 44.712 88.527  9.021   1.00 31.65 ? 11   SER B O     1 
ATOM   5592 C  CB    . SER D 4 11  ? 42.068 87.060  9.698   1.00 32.17 ? 11   SER B CB    1 
ATOM   5593 O  OG    . SER D 4 11  ? 42.540 86.531  10.927  1.00 30.55 ? 11   SER B OG    1 
ATOM   5594 N  N     . PHE D 4 12  ? 45.308 86.395  9.406   1.00 31.75 ? 12   PHE B N     1 
ATOM   5595 C  CA    . PHE D 4 12  ? 46.637 86.733  9.902   1.00 31.33 ? 12   PHE B CA    1 
ATOM   5596 C  C     . PHE D 4 12  ? 47.392 87.784  9.092   1.00 31.72 ? 12   PHE B C     1 
ATOM   5597 O  O     . PHE D 4 12  ? 47.924 88.734  9.657   1.00 31.37 ? 12   PHE B O     1 
ATOM   5598 C  CB    . PHE D 4 12  ? 47.478 85.462  10.020  1.00 30.49 ? 12   PHE B CB    1 
ATOM   5599 C  CG    . PHE D 4 12  ? 48.717 85.625  10.862  1.00 29.61 ? 12   PHE B CG    1 
ATOM   5600 C  CD1   . PHE D 4 12  ? 49.903 86.092  10.301  1.00 27.86 ? 12   PHE B CD1   1 
ATOM   5601 C  CD2   . PHE D 4 12  ? 48.700 85.291  12.215  1.00 28.41 ? 12   PHE B CD2   1 
ATOM   5602 C  CE1   . PHE D 4 12  ? 51.057 86.219  11.073  1.00 29.28 ? 12   PHE B CE1   1 
ATOM   5603 C  CE2   . PHE D 4 12  ? 49.845 85.416  12.996  1.00 29.32 ? 12   PHE B CE2   1 
ATOM   5604 C  CZ    . PHE D 4 12  ? 51.027 85.881  12.424  1.00 28.92 ? 12   PHE B CZ    1 
ATOM   5605 N  N     . ASP D 4 13  ? 47.429 87.630  7.777   1.00 32.46 ? 13   ASP B N     1 
ATOM   5606 C  CA    . ASP D 4 13  ? 48.153 88.578  6.941   1.00 35.22 ? 13   ASP B CA    1 
ATOM   5607 C  C     . ASP D 4 13  ? 47.753 90.045  7.132   1.00 35.46 ? 13   ASP B C     1 
ATOM   5608 O  O     . ASP D 4 13  ? 48.613 90.891  7.370   1.00 35.47 ? 13   ASP B O     1 
ATOM   5609 C  CB    . ASP D 4 13  ? 48.011 88.206  5.464   1.00 37.73 ? 13   ASP B CB    1 
ATOM   5610 C  CG    . ASP D 4 13  ? 49.130 88.771  4.614   1.00 41.50 ? 13   ASP B CG    1 
ATOM   5611 O  OD1   . ASP D 4 13  ? 49.330 90.007  4.615   1.00 42.06 ? 13   ASP B OD1   1 
ATOM   5612 O  OD2   . ASP D 4 13  ? 49.820 87.969  3.944   1.00 45.25 ? 13   ASP B OD2   1 
ATOM   5613 N  N     . THR D 4 14  ? 46.460 90.347  7.040   1.00 35.50 ? 14   THR B N     1 
ATOM   5614 C  CA    . THR D 4 14  ? 46.004 91.728  7.182   1.00 35.14 ? 14   THR B CA    1 
ATOM   5615 C  C     . THR D 4 14  ? 45.906 92.208  8.631   1.00 34.88 ? 14   THR B C     1 
ATOM   5616 O  O     . THR D 4 14  ? 46.111 93.390  8.902   1.00 36.03 ? 14   THR B O     1 
ATOM   5617 C  CB    . THR D 4 14  ? 44.624 91.953  6.487   1.00 36.53 ? 14   THR B CB    1 
ATOM   5618 O  OG1   . THR D 4 14  ? 43.569 91.506  7.345   1.00 38.41 ? 14   THR B OG1   1 
ATOM   5619 C  CG2   . THR D 4 14  ? 44.551 91.184  5.170   1.00 34.86 ? 14   THR B CG2   1 
ATOM   5620 N  N     . ASP D 4 15  ? 45.588 91.309  9.558   1.00 33.84 ? 15   ASP B N     1 
ATOM   5621 C  CA    . ASP D 4 15  ? 45.480 91.690  10.967  1.00 34.23 ? 15   ASP B CA    1 
ATOM   5622 C  C     . ASP D 4 15  ? 46.834 91.873  11.647  1.00 34.29 ? 15   ASP B C     1 
ATOM   5623 O  O     . ASP D 4 15  ? 46.983 92.725  12.519  1.00 34.69 ? 15   ASP B O     1 
ATOM   5624 C  CB    . ASP D 4 15  ? 44.679 90.656  11.768  1.00 34.70 ? 15   ASP B CB    1 
ATOM   5625 C  CG    . ASP D 4 15  ? 43.191 90.715  11.484  1.00 37.49 ? 15   ASP B CG    1 
ATOM   5626 O  OD1   . ASP D 4 15  ? 42.687 91.817  11.167  1.00 37.67 ? 15   ASP B OD1   1 
ATOM   5627 O  OD2   . ASP D 4 15  ? 42.521 89.664  11.595  1.00 38.65 ? 15   ASP B OD2   1 
ATOM   5628 N  N     . VAL D 4 16  ? 47.817 91.075  11.249  1.00 34.29 ? 16   VAL B N     1 
ATOM   5629 C  CA    . VAL D 4 16  ? 49.141 91.153  11.850  1.00 34.19 ? 16   VAL B CA    1 
ATOM   5630 C  C     . VAL D 4 16  ? 50.172 91.843  10.965  1.00 35.80 ? 16   VAL B C     1 
ATOM   5631 O  O     . VAL D 4 16  ? 50.686 92.911  11.305  1.00 37.41 ? 16   VAL B O     1 
ATOM   5632 C  CB    . VAL D 4 16  ? 49.693 89.741  12.192  1.00 33.74 ? 16   VAL B CB    1 
ATOM   5633 C  CG1   . VAL D 4 16  ? 51.043 89.865  12.883  1.00 33.87 ? 16   VAL B CG1   1 
ATOM   5634 C  CG2   . VAL D 4 16  ? 48.716 88.982  13.074  1.00 32.00 ? 16   VAL B CG2   1 
ATOM   5635 N  N     . LEU D 4 17  ? 50.468 91.224  9.828   1.00 35.96 ? 17   LEU B N     1 
ATOM   5636 C  CA    . LEU D 4 17  ? 51.475 91.733  8.904   1.00 38.03 ? 17   LEU B CA    1 
ATOM   5637 C  C     . LEU D 4 17  ? 51.208 93.089  8.253   1.00 41.20 ? 17   LEU B C     1 
ATOM   5638 O  O     . LEU D 4 17  ? 52.150 93.828  7.951   1.00 41.85 ? 17   LEU B O     1 
ATOM   5639 C  CB    . LEU D 4 17  ? 51.730 90.692  7.817   1.00 36.45 ? 17   LEU B CB    1 
ATOM   5640 C  CG    . LEU D 4 17  ? 51.999 89.289  8.365   1.00 35.19 ? 17   LEU B CG    1 
ATOM   5641 C  CD1   . LEU D 4 17  ? 52.209 88.328  7.218   1.00 33.90 ? 17   LEU B CD1   1 
ATOM   5642 C  CD2   . LEU D 4 17  ? 53.219 89.321  9.283   1.00 36.30 ? 17   LEU B CD2   1 
ATOM   5643 N  N     . LYS D 4 18  ? 49.939 93.416  8.026   1.00 43.04 ? 18   LYS B N     1 
ATOM   5644 C  CA    . LYS D 4 18  ? 49.597 94.685  7.397   1.00 45.12 ? 18   LYS B CA    1 
ATOM   5645 C  C     . LYS D 4 18  ? 49.075 95.701  8.397   1.00 45.87 ? 18   LYS B C     1 
ATOM   5646 O  O     . LYS D 4 18  ? 48.631 96.785  8.018   1.00 46.15 ? 18   LYS B O     1 
ATOM   5647 C  CB    . LYS D 4 18  ? 48.554 94.464  6.300   1.00 45.69 ? 18   LYS B CB    1 
ATOM   5648 C  CG    . LYS D 4 18  ? 49.063 93.654  5.127   1.00 46.91 ? 18   LYS B CG    1 
ATOM   5649 C  CD    . LYS D 4 18  ? 47.952 93.366  4.129   1.00 49.71 ? 18   LYS B CD    1 
ATOM   5650 C  CE    . LYS D 4 18  ? 48.441 92.449  3.008   1.00 52.03 ? 18   LYS B CE    1 
ATOM   5651 N  NZ    . LYS D 4 18  ? 47.333 92.017  2.107   1.00 53.34 ? 18   LYS B NZ    1 
ATOM   5652 N  N     . ALA D 4 19  ? 49.127 95.352  9.676   1.00 46.49 ? 19   ALA B N     1 
ATOM   5653 C  CA    . ALA D 4 19  ? 48.642 96.255  10.709  1.00 46.99 ? 19   ALA B CA    1 
ATOM   5654 C  C     . ALA D 4 19  ? 49.656 97.342  11.029  1.00 47.56 ? 19   ALA B C     1 
ATOM   5655 O  O     . ALA D 4 19  ? 50.825 97.268  10.633  1.00 47.89 ? 19   ALA B O     1 
ATOM   5656 C  CB    . ALA D 4 19  ? 48.305 95.475  11.968  1.00 46.93 ? 19   ALA B CB    1 
ATOM   5657 N  N     . ASP D 4 20  ? 49.192 98.359  11.744  1.00 47.51 ? 20   ASP B N     1 
ATOM   5658 C  CA    . ASP D 4 20  ? 50.046 99.462  12.149  1.00 48.31 ? 20   ASP B CA    1 
ATOM   5659 C  C     . ASP D 4 20  ? 50.251 99.304  13.645  1.00 48.37 ? 20   ASP B C     1 
ATOM   5660 O  O     . ASP D 4 20  ? 49.365 98.816  14.350  1.00 48.68 ? 20   ASP B O     1 
ATOM   5661 C  CB    . ASP D 4 20  ? 49.369 100.803 11.847  1.00 48.91 ? 20   ASP B CB    1 
ATOM   5662 N  N     . GLY D 4 21  ? 51.420 99.707  14.130  1.00 48.36 ? 21   GLY B N     1 
ATOM   5663 C  CA    . GLY D 4 21  ? 51.699 99.582  15.548  1.00 47.59 ? 21   GLY B CA    1 
ATOM   5664 C  C     . GLY D 4 21  ? 52.160 98.183  15.912  1.00 47.38 ? 21   GLY B C     1 
ATOM   5665 O  O     . GLY D 4 21  ? 52.130 97.265  15.083  1.00 47.96 ? 21   GLY B O     1 
ATOM   5666 N  N     . ALA D 4 22  ? 52.582 98.019  17.162  1.00 46.16 ? 22   ALA B N     1 
ATOM   5667 C  CA    . ALA D 4 22  ? 53.066 96.736  17.648  1.00 44.03 ? 22   ALA B CA    1 
ATOM   5668 C  C     . ALA D 4 22  ? 51.925 95.769  17.926  1.00 42.51 ? 22   ALA B C     1 
ATOM   5669 O  O     . ALA D 4 22  ? 50.889 96.146  18.484  1.00 43.37 ? 22   ALA B O     1 
ATOM   5670 C  CB    . ALA D 4 22  ? 53.900 96.937  18.917  1.00 44.37 ? 22   ALA B CB    1 
ATOM   5671 N  N     . ILE D 4 23  ? 52.130 94.517  17.532  1.00 39.46 ? 23   ILE B N     1 
ATOM   5672 C  CA    . ILE D 4 23  ? 51.144 93.466  17.741  1.00 36.25 ? 23   ILE B CA    1 
ATOM   5673 C  C     . ILE D 4 23  ? 51.836 92.257  18.369  1.00 33.62 ? 23   ILE B C     1 
ATOM   5674 O  O     . ILE D 4 23  ? 52.821 91.753  17.836  1.00 31.29 ? 23   ILE B O     1 
ATOM   5675 C  CB    . ILE D 4 23  ? 50.493 93.027  16.401  1.00 36.15 ? 23   ILE B CB    1 
ATOM   5676 C  CG1   . ILE D 4 23  ? 49.800 94.217  15.736  1.00 37.81 ? 23   ILE B CG1   1 
ATOM   5677 C  CG2   . ILE D 4 23  ? 49.475 91.925  16.651  1.00 36.21 ? 23   ILE B CG2   1 
ATOM   5678 N  N     . LEU D 4 24  ? 51.329 91.801  19.509  1.00 32.36 ? 24   LEU B N     1 
ATOM   5679 C  CA    . LEU D 4 24  ? 51.908 90.636  20.165  1.00 31.95 ? 24   LEU B CA    1 
ATOM   5680 C  C     . LEU D 4 24  ? 51.058 89.426  19.813  1.00 31.61 ? 24   LEU B C     1 
ATOM   5681 O  O     . LEU D 4 24  ? 49.868 89.395  20.119  1.00 31.66 ? 24   LEU B O     1 
ATOM   5682 C  CB    . LEU D 4 24  ? 51.935 90.817  21.685  1.00 32.13 ? 24   LEU B CB    1 
ATOM   5683 C  CG    . LEU D 4 24  ? 52.495 89.630  22.485  1.00 31.87 ? 24   LEU B CG    1 
ATOM   5684 C  CD1   . LEU D 4 24  ? 53.945 89.383  22.087  1.00 30.84 ? 24   LEU B CD1   1 
ATOM   5685 C  CD2   . LEU D 4 24  ? 52.395 89.911  23.978  1.00 31.47 ? 24   LEU B CD2   1 
ATOM   5686 N  N     . VAL D 4 25  ? 51.673 88.438  19.168  1.00 30.84 ? 25   VAL B N     1 
ATOM   5687 C  CA    . VAL D 4 25  ? 50.966 87.227  18.769  1.00 31.11 ? 25   VAL B CA    1 
ATOM   5688 C  C     . VAL D 4 25  ? 51.350 86.023  19.613  1.00 30.00 ? 25   VAL B C     1 
ATOM   5689 O  O     . VAL D 4 25  ? 52.529 85.709  19.766  1.00 29.30 ? 25   VAL B O     1 
ATOM   5690 C  CB    . VAL D 4 25  ? 51.247 86.874  17.306  1.00 32.54 ? 25   VAL B CB    1 
ATOM   5691 C  CG1   . VAL D 4 25  ? 50.493 85.592  16.927  1.00 31.62 ? 25   VAL B CG1   1 
ATOM   5692 C  CG2   . VAL D 4 25  ? 50.845 88.025  16.420  1.00 31.06 ? 25   VAL B CG2   1 
ATOM   5693 N  N     . ASP D 4 26  ? 50.339 85.350  20.149  1.00 29.40 ? 26   ASP B N     1 
ATOM   5694 C  CA    . ASP D 4 26  ? 50.545 84.177  20.981  1.00 28.99 ? 26   ASP B CA    1 
ATOM   5695 C  C     . ASP D 4 26  ? 50.111 82.880  20.290  1.00 28.96 ? 26   ASP B C     1 
ATOM   5696 O  O     . ASP D 4 26  ? 48.917 82.630  20.113  1.00 28.43 ? 26   ASP B O     1 
ATOM   5697 C  CB    . ASP D 4 26  ? 49.783 84.345  22.302  1.00 28.56 ? 26   ASP B CB    1 
ATOM   5698 C  CG    . ASP D 4 26  ? 49.708 83.056  23.108  1.00 28.61 ? 26   ASP B CG    1 
ATOM   5699 O  OD1   . ASP D 4 26  ? 50.682 82.277  23.078  1.00 29.13 ? 26   ASP B OD1   1 
ATOM   5700 O  OD2   . ASP D 4 26  ? 48.682 82.826  23.786  1.00 28.99 ? 26   ASP B OD2   1 
ATOM   5701 N  N     . PHE D 4 27  ? 51.084 82.071  19.881  1.00 29.42 ? 27   PHE B N     1 
ATOM   5702 C  CA    . PHE D 4 27  ? 50.784 80.786  19.250  1.00 28.95 ? 27   PHE B CA    1 
ATOM   5703 C  C     . PHE D 4 27  ? 50.562 79.787  20.372  1.00 28.81 ? 27   PHE B C     1 
ATOM   5704 O  O     . PHE D 4 27  ? 51.470 79.492  21.156  1.00 28.14 ? 27   PHE B O     1 
ATOM   5705 C  CB    . PHE D 4 27  ? 51.935 80.341  18.350  1.00 29.32 ? 27   PHE B CB    1 
ATOM   5706 C  CG    . PHE D 4 27  ? 52.134 81.230  17.159  1.00 31.98 ? 27   PHE B CG    1 
ATOM   5707 C  CD1   . PHE D 4 27  ? 52.828 82.427  17.277  1.00 32.73 ? 27   PHE B CD1   1 
ATOM   5708 C  CD2   . PHE D 4 27  ? 51.578 80.897  15.929  1.00 31.93 ? 27   PHE B CD2   1 
ATOM   5709 C  CE1   . PHE D 4 27  ? 52.961 83.280  16.187  1.00 34.33 ? 27   PHE B CE1   1 
ATOM   5710 C  CE2   . PHE D 4 27  ? 51.707 81.742  14.837  1.00 32.69 ? 27   PHE B CE2   1 
ATOM   5711 C  CZ    . PHE D 4 27  ? 52.399 82.937  14.966  1.00 34.55 ? 27   PHE B CZ    1 
ATOM   5712 N  N     . TRP D 4 28  ? 49.347 79.262  20.452  1.00 28.18 ? 28   TRP B N     1 
ATOM   5713 C  CA    . TRP D 4 28  ? 49.019 78.348  21.526  1.00 28.83 ? 28   TRP B CA    1 
ATOM   5714 C  C     . TRP D 4 28  ? 48.159 77.161  21.123  1.00 29.89 ? 28   TRP B C     1 
ATOM   5715 O  O     . TRP D 4 28  ? 47.594 77.114  20.022  1.00 28.72 ? 28   TRP B O     1 
ATOM   5716 C  CB    . TRP D 4 28  ? 48.295 79.115  22.633  1.00 27.63 ? 28   TRP B CB    1 
ATOM   5717 C  CG    . TRP D 4 28  ? 46.939 79.610  22.210  1.00 27.93 ? 28   TRP B CG    1 
ATOM   5718 C  CD1   . TRP D 4 28  ? 46.669 80.625  21.334  1.00 27.88 ? 28   TRP B CD1   1 
ATOM   5719 C  CD2   . TRP D 4 28  ? 45.667 79.085  22.619  1.00 27.67 ? 28   TRP B CD2   1 
ATOM   5720 N  NE1   . TRP D 4 28  ? 45.309 80.764  21.172  1.00 27.17 ? 28   TRP B NE1   1 
ATOM   5721 C  CE2   . TRP D 4 28  ? 44.670 79.833  21.949  1.00 27.85 ? 28   TRP B CE2   1 
ATOM   5722 C  CE3   . TRP D 4 28  ? 45.272 78.057  23.486  1.00 27.85 ? 28   TRP B CE3   1 
ATOM   5723 C  CZ2   . TRP D 4 28  ? 43.300 79.585  22.121  1.00 28.15 ? 28   TRP B CZ2   1 
ATOM   5724 C  CZ3   . TRP D 4 28  ? 43.913 77.810  23.658  1.00 28.26 ? 28   TRP B CZ3   1 
ATOM   5725 C  CH2   . TRP D 4 28  ? 42.941 78.573  22.976  1.00 27.22 ? 28   TRP B CH2   1 
ATOM   5726 N  N     . ALA D 4 29  ? 48.064 76.209  22.047  1.00 30.23 ? 29   ALA B N     1 
ATOM   5727 C  CA    . ALA D 4 29  ? 47.255 75.009  21.868  1.00 33.05 ? 29   ALA B CA    1 
ATOM   5728 C  C     . ALA D 4 29  ? 46.528 74.766  23.185  1.00 34.26 ? 29   ALA B C     1 
ATOM   5729 O  O     . ALA D 4 29  ? 47.060 75.047  24.260  1.00 34.39 ? 29   ALA B O     1 
ATOM   5730 C  CB    . ALA D 4 29  ? 48.132 73.816  21.516  1.00 31.84 ? 29   ALA B CB    1 
ATOM   5731 N  N     . GLU D 4 30  ? 45.308 74.256  23.093  1.00 37.08 ? 30   GLU B N     1 
ATOM   5732 C  CA    . GLU D 4 30  ? 44.487 73.987  24.264  1.00 38.95 ? 30   GLU B CA    1 
ATOM   5733 C  C     . GLU D 4 30  ? 45.089 72.908  25.165  1.00 38.60 ? 30   GLU B C     1 
ATOM   5734 O  O     . GLU D 4 30  ? 44.850 72.902  26.376  1.00 37.89 ? 30   GLU B O     1 
ATOM   5735 C  CB    . GLU D 4 30  ? 43.087 73.559  23.816  1.00 43.28 ? 30   GLU B CB    1 
ATOM   5736 C  CG    . GLU D 4 30  ? 42.086 73.371  24.947  1.00 49.80 ? 30   GLU B CG    1 
ATOM   5737 C  CD    . GLU D 4 30  ? 41.675 74.683  25.593  1.00 53.68 ? 30   GLU B CD    1 
ATOM   5738 O  OE1   . GLU D 4 30  ? 41.205 75.581  24.858  1.00 55.54 ? 30   GLU B OE1   1 
ATOM   5739 O  OE2   . GLU D 4 30  ? 41.814 74.817  26.832  1.00 55.83 ? 30   GLU B OE2   1 
ATOM   5740 N  N     . TRP D 4 31  ? 45.875 72.007  24.576  1.00 36.63 ? 31   TRP B N     1 
ATOM   5741 C  CA    . TRP D 4 31  ? 46.484 70.914  25.327  1.00 36.43 ? 31   TRP B CA    1 
ATOM   5742 C  C     . TRP D 4 31  ? 47.814 71.240  26.004  1.00 35.88 ? 31   TRP B C     1 
ATOM   5743 O  O     . TRP D 4 31  ? 48.419 70.370  26.623  1.00 34.81 ? 31   TRP B O     1 
ATOM   5744 C  CB    . TRP D 4 31  ? 46.673 69.683  24.423  1.00 35.95 ? 31   TRP B CB    1 
ATOM   5745 C  CG    . TRP D 4 31  ? 47.129 70.003  23.020  1.00 36.08 ? 31   TRP B CG    1 
ATOM   5746 C  CD1   . TRP D 4 31  ? 46.334 70.174  21.924  1.00 36.06 ? 31   TRP B CD1   1 
ATOM   5747 C  CD2   . TRP D 4 31  ? 48.478 70.194  22.569  1.00 34.57 ? 31   TRP B CD2   1 
ATOM   5748 N  NE1   . TRP D 4 31  ? 47.101 70.456  20.819  1.00 36.94 ? 31   TRP B NE1   1 
ATOM   5749 C  CE2   . TRP D 4 31  ? 48.420 70.475  21.184  1.00 34.88 ? 31   TRP B CE2   1 
ATOM   5750 C  CE3   . TRP D 4 31  ? 49.729 70.156  23.198  1.00 34.18 ? 31   TRP B CE3   1 
ATOM   5751 C  CZ2   . TRP D 4 31  ? 49.563 70.714  20.415  1.00 34.59 ? 31   TRP B CZ2   1 
ATOM   5752 C  CZ3   . TRP D 4 31  ? 50.872 70.395  22.430  1.00 33.92 ? 31   TRP B CZ3   1 
ATOM   5753 C  CH2   . TRP D 4 31  ? 50.778 70.670  21.053  1.00 34.32 ? 31   TRP B CH2   1 
ATOM   5754 N  N     . CYS D 4 32  ? 48.266 72.484  25.898  1.00 35.63 ? 32   CYS B N     1 
ATOM   5755 C  CA    . CYS D 4 32  ? 49.534 72.874  26.510  1.00 34.72 ? 32   CYS B CA    1 
ATOM   5756 C  C     . CYS D 4 32  ? 49.362 73.503  27.887  1.00 34.80 ? 32   CYS B C     1 
ATOM   5757 O  O     . CYS D 4 32  ? 48.618 74.471  28.052  1.00 34.84 ? 32   CYS B O     1 
ATOM   5758 C  CB    . CYS D 4 32  ? 50.279 73.850  25.598  1.00 34.46 ? 32   CYS B CB    1 
ATOM   5759 S  SG    . CYS D 4 32  ? 51.756 74.573  26.341  1.00 34.22 ? 32   CYS B SG    1 
ATOM   5760 N  N     . GLY D 4 33  ? 50.061 72.951  28.874  1.00 34.50 ? 33   GLY B N     1 
ATOM   5761 C  CA    . GLY D 4 33  ? 49.981 73.478  30.221  1.00 33.81 ? 33   GLY B CA    1 
ATOM   5762 C  C     . GLY D 4 33  ? 50.474 74.913  30.275  1.00 34.52 ? 33   GLY B C     1 
ATOM   5763 O  O     . GLY D 4 33  ? 49.763 75.795  30.755  1.00 33.73 ? 33   GLY B O     1 
ATOM   5764 N  N     . PRO D 4 34  ? 51.700 75.178  29.794  1.00 34.38 ? 34   PRO B N     1 
ATOM   5765 C  CA    . PRO D 4 34  ? 52.283 76.523  29.790  1.00 33.63 ? 34   PRO B CA    1 
ATOM   5766 C  C     . PRO D 4 34  ? 51.376 77.558  29.112  1.00 33.98 ? 34   PRO B C     1 
ATOM   5767 O  O     . PRO D 4 34  ? 51.276 78.709  29.562  1.00 32.38 ? 34   PRO B O     1 
ATOM   5768 C  CB    . PRO D 4 34  ? 53.597 76.319  29.041  1.00 33.38 ? 34   PRO B CB    1 
ATOM   5769 C  CG    . PRO D 4 34  ? 53.995 74.938  29.472  1.00 34.10 ? 34   PRO B CG    1 
ATOM   5770 C  CD    . PRO D 4 34  ? 52.691 74.176  29.358  1.00 34.03 ? 34   PRO B CD    1 
ATOM   5771 N  N     . CYS D 4 35  ? 50.728 77.146  28.025  1.00 33.92 ? 35   CYS B N     1 
ATOM   5772 C  CA    . CYS D 4 35  ? 49.822 78.030  27.296  1.00 34.40 ? 35   CYS B CA    1 
ATOM   5773 C  C     . CYS D 4 35  ? 48.686 78.461  28.208  1.00 34.02 ? 35   CYS B C     1 
ATOM   5774 O  O     . CYS D 4 35  ? 48.336 79.640  28.272  1.00 34.33 ? 35   CYS B O     1 
ATOM   5775 C  CB    . CYS D 4 35  ? 49.240 77.317  26.072  1.00 32.45 ? 35   CYS B CB    1 
ATOM   5776 S  SG    . CYS D 4 35  ? 50.368 77.202  24.682  1.00 32.34 ? 35   CYS B SG    1 
ATOM   5777 N  N     . LYS D 4 36  ? 48.118 77.486  28.909  1.00 34.57 ? 36   LYS B N     1 
ATOM   5778 C  CA    . LYS D 4 36  ? 47.019 77.728  29.830  1.00 36.15 ? 36   LYS B CA    1 
ATOM   5779 C  C     . LYS D 4 36  ? 47.485 78.650  30.956  1.00 37.47 ? 36   LYS B C     1 
ATOM   5780 O  O     . LYS D 4 36  ? 46.692 79.408  31.515  1.00 37.42 ? 36   LYS B O     1 
ATOM   5781 C  CB    . LYS D 4 36  ? 46.520 76.392  30.390  1.00 36.46 ? 36   LYS B CB    1 
ATOM   5782 C  CG    . LYS D 4 36  ? 45.280 76.476  31.270  1.00 39.72 ? 36   LYS B CG    1 
ATOM   5783 C  CD    . LYS D 4 36  ? 44.694 75.080  31.508  1.00 40.31 ? 36   LYS B CD    1 
ATOM   5784 C  CE    . LYS D 4 36  ? 43.450 75.118  32.397  1.00 43.62 ? 36   LYS B CE    1 
ATOM   5785 N  NZ    . LYS D 4 36  ? 43.753 75.496  33.809  1.00 42.01 ? 36   LYS B NZ    1 
ATOM   5786 N  N     . MET D 4 37  ? 48.776 78.590  31.275  1.00 37.47 ? 37   MET B N     1 
ATOM   5787 C  CA    . MET D 4 37  ? 49.342 79.426  32.326  1.00 37.58 ? 37   MET B CA    1 
ATOM   5788 C  C     . MET D 4 37  ? 49.474 80.902  31.946  1.00 37.48 ? 37   MET B C     1 
ATOM   5789 O  O     . MET D 4 37  ? 49.091 81.775  32.717  1.00 37.85 ? 37   MET B O     1 
ATOM   5790 C  CB    . MET D 4 37  ? 50.719 78.906  32.739  1.00 38.03 ? 37   MET B CB    1 
ATOM   5791 C  CG    . MET D 4 37  ? 50.695 77.722  33.696  1.00 38.75 ? 37   MET B CG    1 
ATOM   5792 S  SD    . MET D 4 37  ? 52.358 77.066  33.969  1.00 40.86 ? 37   MET B SD    1 
ATOM   5793 C  CE    . MET D 4 37  ? 53.165 78.460  34.785  1.00 37.18 ? 37   MET B CE    1 
ATOM   5794 N  N     . ILE D 4 38  ? 50.013 81.186  30.764  1.00 36.83 ? 38   ILE B N     1 
ATOM   5795 C  CA    . ILE D 4 38  ? 50.203 82.574  30.360  1.00 37.95 ? 38   ILE B CA    1 
ATOM   5796 C  C     . ILE D 4 38  ? 48.929 83.257  29.830  1.00 37.81 ? 38   ILE B C     1 
ATOM   5797 O  O     . ILE D 4 38  ? 48.852 84.485  29.786  1.00 37.52 ? 38   ILE B O     1 
ATOM   5798 C  CB    . ILE D 4 38  ? 51.344 82.693  29.303  1.00 37.43 ? 38   ILE B CB    1 
ATOM   5799 C  CG1   . ILE D 4 38  ? 51.814 84.146  29.197  1.00 36.59 ? 38   ILE B CG1   1 
ATOM   5800 C  CG2   . ILE D 4 38  ? 50.861 82.218  27.945  1.00 35.96 ? 38   ILE B CG2   1 
ATOM   5801 N  N     . ALA D 4 39  ? 47.929 82.467  29.449  1.00 37.15 ? 39   ALA B N     1 
ATOM   5802 C  CA    . ALA D 4 39  ? 46.681 83.022  28.926  1.00 37.54 ? 39   ALA B CA    1 
ATOM   5803 C  C     . ALA D 4 39  ? 46.110 84.130  29.823  1.00 38.03 ? 39   ALA B C     1 
ATOM   5804 O  O     . ALA D 4 39  ? 45.839 85.237  29.356  1.00 36.72 ? 39   ALA B O     1 
ATOM   5805 C  CB    . ALA D 4 39  ? 45.649 81.914  28.741  1.00 37.10 ? 39   ALA B CB    1 
ATOM   5806 N  N     . PRO D 4 40  ? 45.926 83.844  31.126  1.00 38.47 ? 40   PRO B N     1 
ATOM   5807 C  CA    . PRO D 4 40  ? 45.384 84.860  32.035  1.00 38.23 ? 40   PRO B CA    1 
ATOM   5808 C  C     . PRO D 4 40  ? 46.225 86.132  31.982  1.00 37.86 ? 40   PRO B C     1 
ATOM   5809 O  O     . PRO D 4 40  ? 45.693 87.241  31.928  1.00 38.37 ? 40   PRO B O     1 
ATOM   5810 C  CB    . PRO D 4 40  ? 45.463 84.182  33.402  1.00 38.71 ? 40   PRO B CB    1 
ATOM   5811 C  CG    . PRO D 4 40  ? 45.371 82.721  33.070  1.00 38.27 ? 40   PRO B CG    1 
ATOM   5812 C  CD    . PRO D 4 40  ? 46.259 82.612  31.862  1.00 37.56 ? 40   PRO B CD    1 
ATOM   5813 N  N     . ILE D 4 41  ? 47.543 85.955  31.995  1.00 37.62 ? 41   ILE B N     1 
ATOM   5814 C  CA    . ILE D 4 41  ? 48.472 87.075  31.954  1.00 37.46 ? 41   ILE B CA    1 
ATOM   5815 C  C     . ILE D 4 41  ? 48.235 87.943  30.721  1.00 37.98 ? 41   ILE B C     1 
ATOM   5816 O  O     . ILE D 4 41  ? 48.240 89.174  30.805  1.00 37.92 ? 41   ILE B O     1 
ATOM   5817 C  CB    . ILE D 4 41  ? 49.935 86.578  31.952  1.00 37.19 ? 41   ILE B CB    1 
ATOM   5818 C  CG1   . ILE D 4 41  ? 50.219 85.794  33.235  1.00 38.15 ? 41   ILE B CG1   1 
ATOM   5819 C  CG2   . ILE D 4 41  ? 50.891 87.755  31.840  1.00 37.07 ? 41   ILE B CG2   1 
ATOM   5820 N  N     . LEU D 4 42  ? 48.025 87.298  29.577  1.00 38.80 ? 42   LEU B N     1 
ATOM   5821 C  CA    . LEU D 4 42  ? 47.789 88.015  28.331  1.00 40.22 ? 42   LEU B CA    1 
ATOM   5822 C  C     . LEU D 4 42  ? 46.516 88.868  28.369  1.00 40.61 ? 42   LEU B C     1 
ATOM   5823 O  O     . LEU D 4 42  ? 46.492 89.969  27.817  1.00 39.08 ? 42   LEU B O     1 
ATOM   5824 C  CB    . LEU D 4 42  ? 47.749 87.027  27.157  1.00 38.67 ? 42   LEU B CB    1 
ATOM   5825 C  CG    . LEU D 4 42  ? 49.124 86.467  26.768  1.00 38.89 ? 42   LEU B CG    1 
ATOM   5826 C  CD1   . LEU D 4 42  ? 48.975 85.303  25.805  1.00 38.22 ? 42   LEU B CD1   1 
ATOM   5827 C  CD2   . LEU D 4 42  ? 49.965 87.572  26.149  1.00 38.49 ? 42   LEU B CD2   1 
ATOM   5828 N  N     . ASP D 4 43  ? 45.466 88.369  29.019  1.00 42.62 ? 43   ASP B N     1 
ATOM   5829 C  CA    . ASP D 4 43  ? 44.215 89.122  29.128  1.00 44.70 ? 43   ASP B CA    1 
ATOM   5830 C  C     . ASP D 4 43  ? 44.461 90.440  29.864  1.00 45.58 ? 43   ASP B C     1 
ATOM   5831 O  O     . ASP D 4 43  ? 43.902 91.480  29.506  1.00 45.81 ? 43   ASP B O     1 
ATOM   5832 C  CB    . ASP D 4 43  ? 43.152 88.327  29.897  1.00 46.54 ? 43   ASP B CB    1 
ATOM   5833 C  CG    . ASP D 4 43  ? 42.656 87.106  29.139  1.00 48.42 ? 43   ASP B CG    1 
ATOM   5834 O  OD1   . ASP D 4 43  ? 42.456 87.201  27.910  1.00 49.91 ? 43   ASP B OD1   1 
ATOM   5835 O  OD2   . ASP D 4 43  ? 42.443 86.051  29.777  1.00 50.01 ? 43   ASP B OD2   1 
ATOM   5836 N  N     . GLU D 4 44  ? 45.297 90.384  30.898  1.00 45.74 ? 44   GLU B N     1 
ATOM   5837 C  CA    . GLU D 4 44  ? 45.617 91.561  31.698  1.00 46.62 ? 44   GLU B CA    1 
ATOM   5838 C  C     . GLU D 4 44  ? 46.507 92.525  30.930  1.00 45.81 ? 44   GLU B C     1 
ATOM   5839 O  O     . GLU D 4 44  ? 46.365 93.740  31.054  1.00 46.26 ? 44   GLU B O     1 
ATOM   5840 C  CB    . GLU D 4 44  ? 46.305 91.150  33.006  1.00 48.70 ? 44   GLU B CB    1 
ATOM   5841 C  CG    . GLU D 4 44  ? 45.432 90.306  33.929  1.00 51.46 ? 44   GLU B CG    1 
ATOM   5842 C  CD    . GLU D 4 44  ? 46.158 89.874  35.193  1.00 54.20 ? 44   GLU B CD    1 
ATOM   5843 O  OE1   . GLU D 4 44  ? 47.224 89.221  35.085  1.00 55.94 ? 44   GLU B OE1   1 
ATOM   5844 O  OE2   . GLU D 4 44  ? 45.662 90.185  36.296  1.00 54.81 ? 44   GLU B OE2   1 
ATOM   5845 N  N     . ILE D 4 45  ? 47.433 91.988  30.145  1.00 44.40 ? 45   ILE B N     1 
ATOM   5846 C  CA    . ILE D 4 45  ? 48.311 92.843  29.360  1.00 44.15 ? 45   ILE B CA    1 
ATOM   5847 C  C     . ILE D 4 45  ? 47.467 93.601  28.337  1.00 44.67 ? 45   ILE B C     1 
ATOM   5848 O  O     . ILE D 4 45  ? 47.581 94.822  28.208  1.00 44.55 ? 45   ILE B O     1 
ATOM   5849 C  CB    . ILE D 4 45  ? 49.390 92.024  28.612  1.00 43.71 ? 45   ILE B CB    1 
ATOM   5850 C  CG1   . ILE D 4 45  ? 50.404 91.459  29.611  1.00 44.58 ? 45   ILE B CG1   1 
ATOM   5851 C  CG2   . ILE D 4 45  ? 50.092 92.901  27.582  1.00 43.31 ? 45   ILE B CG2   1 
ATOM   5852 N  N     . ALA D 4 46  ? 46.617 92.871  27.621  1.00 43.99 ? 46   ALA B N     1 
ATOM   5853 C  CA    . ALA D 4 46  ? 45.754 93.465  26.607  1.00 44.81 ? 46   ALA B CA    1 
ATOM   5854 C  C     . ALA D 4 46  ? 45.049 94.715  27.133  1.00 45.54 ? 46   ALA B C     1 
ATOM   5855 O  O     . ALA D 4 46  ? 45.063 95.763  26.482  1.00 44.46 ? 46   ALA B O     1 
ATOM   5856 C  CB    . ALA D 4 46  ? 44.728 92.442  26.128  1.00 44.17 ? 46   ALA B CB    1 
ATOM   5857 N  N     . ASP D 4 47  ? 44.435 94.607  28.310  1.00 46.61 ? 47   ASP B N     1 
ATOM   5858 C  CA    . ASP D 4 47  ? 43.739 95.749  28.902  1.00 48.59 ? 47   ASP B CA    1 
ATOM   5859 C  C     . ASP D 4 47  ? 44.709 96.823  29.373  1.00 47.84 ? 47   ASP B C     1 
ATOM   5860 O  O     . ASP D 4 47  ? 44.490 98.009  29.145  1.00 48.59 ? 47   ASP B O     1 
ATOM   5861 C  CB    . ASP D 4 47  ? 42.864 95.307  30.082  1.00 49.65 ? 47   ASP B CB    1 
ATOM   5862 C  CG    . ASP D 4 47  ? 41.623 94.557  29.639  1.00 52.65 ? 47   ASP B CG    1 
ATOM   5863 O  OD1   . ASP D 4 47  ? 40.857 95.109  28.815  1.00 53.92 ? 47   ASP B OD1   1 
ATOM   5864 O  OD2   . ASP D 4 47  ? 41.411 93.419  30.114  1.00 54.37 ? 47   ASP B OD2   1 
ATOM   5865 N  N     . GLU D 4 48  ? 45.787 96.407  30.025  1.00 48.10 ? 48   GLU B N     1 
ATOM   5866 C  CA    . GLU D 4 48  ? 46.777 97.354  30.525  1.00 48.28 ? 48   GLU B CA    1 
ATOM   5867 C  C     . GLU D 4 48  ? 47.496 98.147  29.433  1.00 48.25 ? 48   GLU B C     1 
ATOM   5868 O  O     . GLU D 4 48  ? 47.720 99.347  29.587  1.00 49.53 ? 48   GLU B O     1 
ATOM   5869 C  CB    . GLU D 4 48  ? 47.790 96.628  31.420  1.00 48.40 ? 48   GLU B CB    1 
ATOM   5870 C  CG    . GLU D 4 48  ? 47.270 96.402  32.840  1.00 50.38 ? 48   GLU B CG    1 
ATOM   5871 C  CD    . GLU D 4 48  ? 48.152 95.493  33.685  1.00 51.96 ? 48   GLU B CD    1 
ATOM   5872 O  OE1   . GLU D 4 48  ? 49.392 95.682  33.695  1.00 51.54 ? 48   GLU B OE1   1 
ATOM   5873 O  OE2   . GLU D 4 48  ? 47.595 94.594  34.356  1.00 51.49 ? 48   GLU B OE2   1 
ATOM   5874 N  N     . TYR D 4 49  ? 47.838 97.491  28.327  1.00 47.54 ? 49   TYR B N     1 
ATOM   5875 C  CA    . TYR D 4 49  ? 48.542 98.161  27.231  1.00 47.74 ? 49   TYR B CA    1 
ATOM   5876 C  C     . TYR D 4 49  ? 47.653 98.700  26.107  1.00 48.56 ? 49   TYR B C     1 
ATOM   5877 O  O     . TYR D 4 49  ? 48.118 98.890  24.982  1.00 48.20 ? 49   TYR B O     1 
ATOM   5878 C  CB    . TYR D 4 49  ? 49.591 97.225  26.620  1.00 46.84 ? 49   TYR B CB    1 
ATOM   5879 C  CG    . TYR D 4 49  ? 50.852 97.080  27.439  1.00 46.16 ? 49   TYR B CG    1 
ATOM   5880 C  CD1   . TYR D 4 49  ? 50.828 96.494  28.704  1.00 45.42 ? 49   TYR B CD1   1 
ATOM   5881 C  CD2   . TYR D 4 49  ? 52.073 97.547  26.950  1.00 46.22 ? 49   TYR B CD2   1 
ATOM   5882 C  CE1   . TYR D 4 49  ? 51.992 96.379  29.466  1.00 46.57 ? 49   TYR B CE1   1 
ATOM   5883 C  CE2   . TYR D 4 49  ? 53.242 97.437  27.701  1.00 46.87 ? 49   TYR B CE2   1 
ATOM   5884 C  CZ    . TYR D 4 49  ? 53.195 96.854  28.958  1.00 47.23 ? 49   TYR B CZ    1 
ATOM   5885 O  OH    . TYR D 4 49  ? 54.350 96.764  29.707  1.00 49.03 ? 49   TYR B OH    1 
ATOM   5886 N  N     . GLN D 4 50  ? 46.382 98.951  26.405  1.00 50.46 ? 50   GLN B N     1 
ATOM   5887 C  CA    . GLN D 4 50  ? 45.469 99.475  25.393  1.00 52.02 ? 50   GLN B CA    1 
ATOM   5888 C  C     . GLN D 4 50  ? 46.081 100.688 24.692  1.00 52.40 ? 50   GLN B C     1 
ATOM   5889 O  O     . GLN D 4 50  ? 46.790 101.484 25.310  1.00 52.06 ? 50   GLN B O     1 
ATOM   5890 C  CB    . GLN D 4 50  ? 44.138 99.879  26.032  1.00 53.12 ? 50   GLN B CB    1 
ATOM   5891 C  CG    . GLN D 4 50  ? 43.355 98.730  26.641  1.00 56.17 ? 50   GLN B CG    1 
ATOM   5892 C  CD    . GLN D 4 50  ? 42.085 99.192  27.336  1.00 58.02 ? 50   GLN B CD    1 
ATOM   5893 O  OE1   . GLN D 4 50  ? 41.366 98.394  27.942  1.00 59.07 ? 50   GLN B OE1   1 
ATOM   5894 N  NE2   . GLN D 4 50  ? 41.802 100.489 27.251  1.00 58.93 ? 50   GLN B NE2   1 
ATOM   5895 N  N     . GLY D 4 51  ? 45.813 100.813 23.396  1.00 52.70 ? 51   GLY B N     1 
ATOM   5896 C  CA    . GLY D 4 51  ? 46.331 101.937 22.636  1.00 53.45 ? 51   GLY B CA    1 
ATOM   5897 C  C     . GLY D 4 51  ? 47.828 101.948 22.383  1.00 53.81 ? 51   GLY B C     1 
ATOM   5898 O  O     . GLY D 4 51  ? 48.302 102.672 21.504  1.00 53.47 ? 51   GLY B O     1 
ATOM   5899 N  N     . LYS D 4 52  ? 48.581 101.158 23.143  1.00 53.37 ? 52   LYS B N     1 
ATOM   5900 C  CA    . LYS D 4 52  ? 50.029 101.111 22.965  1.00 53.00 ? 52   LYS B CA    1 
ATOM   5901 C  C     . LYS D 4 52  ? 50.488 99.762  22.418  1.00 51.78 ? 52   LYS B C     1 
ATOM   5902 O  O     . LYS D 4 52  ? 51.634 99.613  21.993  1.00 51.75 ? 52   LYS B O     1 
ATOM   5903 C  CB    . LYS D 4 52  ? 50.732 101.393 24.294  1.00 54.57 ? 52   LYS B CB    1 
ATOM   5904 C  CG    . LYS D 4 52  ? 52.226 101.641 24.161  1.00 55.82 ? 52   LYS B CG    1 
ATOM   5905 C  CD    . LYS D 4 52  ? 52.832 102.048 25.497  1.00 57.64 ? 52   LYS B CD    1 
ATOM   5906 C  CE    . LYS D 4 52  ? 54.236 102.612 25.322  1.00 57.64 ? 52   LYS B CE    1 
ATOM   5907 N  NZ    . LYS D 4 52  ? 54.822 103.031 26.625  1.00 57.67 ? 52   LYS B NZ    1 
ATOM   5908 N  N     . LEU D 4 53  ? 49.585 98.786  22.428  1.00 49.78 ? 53   LEU B N     1 
ATOM   5909 C  CA    . LEU D 4 53  ? 49.887 97.446  21.935  1.00 47.22 ? 53   LEU B CA    1 
ATOM   5910 C  C     . LEU D 4 53  ? 48.622 96.646  21.640  1.00 45.58 ? 53   LEU B C     1 
ATOM   5911 O  O     . LEU D 4 53  ? 47.587 96.852  22.269  1.00 45.27 ? 53   LEU B O     1 
ATOM   5912 C  CB    . LEU D 4 53  ? 50.714 96.673  22.965  1.00 46.65 ? 53   LEU B CB    1 
ATOM   5913 C  CG    . LEU D 4 53  ? 50.902 95.183  22.650  1.00 46.13 ? 53   LEU B CG    1 
ATOM   5914 C  CD1   . LEU D 4 53  ? 51.948 95.016  21.549  1.00 44.45 ? 53   LEU B CD1   1 
ATOM   5915 C  CD2   . LEU D 4 53  ? 51.323 94.441  23.907  1.00 44.83 ? 53   LEU B CD2   1 
ATOM   5916 N  N     . THR D 4 54  ? 48.717 95.728  20.684  1.00 44.33 ? 54   THR B N     1 
ATOM   5917 C  CA    . THR D 4 54  ? 47.588 94.871  20.335  1.00 42.28 ? 54   THR B CA    1 
ATOM   5918 C  C     . THR D 4 54  ? 47.948 93.406  20.612  1.00 40.86 ? 54   THR B C     1 
ATOM   5919 O  O     . THR D 4 54  ? 48.966 92.903  20.134  1.00 39.76 ? 54   THR B O     1 
ATOM   5920 C  CB    . THR D 4 54  ? 47.194 95.041  18.852  1.00 42.51 ? 54   THR B CB    1 
ATOM   5921 O  OG1   . THR D 4 54  ? 46.632 96.345  18.659  1.00 44.11 ? 54   THR B OG1   1 
ATOM   5922 C  CG2   . THR D 4 54  ? 46.158 93.993  18.439  1.00 42.87 ? 54   THR B CG2   1 
ATOM   5923 N  N     . VAL D 4 55  ? 47.117 92.730  21.399  1.00 39.76 ? 55   VAL B N     1 
ATOM   5924 C  CA    . VAL D 4 55  ? 47.361 91.328  21.730  1.00 37.97 ? 55   VAL B CA    1 
ATOM   5925 C  C     . VAL D 4 55  ? 46.489 90.412  20.878  1.00 37.11 ? 55   VAL B C     1 
ATOM   5926 O  O     . VAL D 4 55  ? 45.259 90.490  20.918  1.00 36.15 ? 55   VAL B O     1 
ATOM   5927 C  CB    . VAL D 4 55  ? 47.091 91.050  23.236  1.00 37.26 ? 55   VAL B CB    1 
ATOM   5928 C  CG1   . VAL D 4 55  ? 47.313 89.568  23.559  1.00 35.97 ? 55   VAL B CG1   1 
ATOM   5929 C  CG2   . VAL D 4 55  ? 48.018 91.915  24.087  1.00 38.19 ? 55   VAL B CG2   1 
ATOM   5930 N  N     . ALA D 4 56  ? 47.147 89.552  20.106  1.00 34.99 ? 56   ALA B N     1 
ATOM   5931 C  CA    . ALA D 4 56  ? 46.474 88.604  19.231  1.00 32.59 ? 56   ALA B CA    1 
ATOM   5932 C  C     . ALA D 4 56  ? 46.837 87.172  19.610  1.00 32.84 ? 56   ALA B C     1 
ATOM   5933 O  O     . ALA D 4 56  ? 47.898 86.910  20.184  1.00 32.01 ? 56   ALA B O     1 
ATOM   5934 C  CB    . ALA D 4 56  ? 46.863 88.865  17.792  1.00 32.15 ? 56   ALA B CB    1 
ATOM   5935 N  N     . LYS D 4 57  ? 45.953 86.244  19.273  1.00 31.68 ? 57   LYS B N     1 
ATOM   5936 C  CA    . LYS D 4 57  ? 46.170 84.842  19.581  1.00 31.78 ? 57   LYS B CA    1 
ATOM   5937 C  C     . LYS D 4 57  ? 45.803 83.956  18.408  1.00 31.24 ? 57   LYS B C     1 
ATOM   5938 O  O     . LYS D 4 57  ? 44.789 84.171  17.742  1.00 32.65 ? 57   LYS B O     1 
ATOM   5939 C  CB    . LYS D 4 57  ? 45.339 84.438  20.795  1.00 31.73 ? 57   LYS B CB    1 
ATOM   5940 C  CG    . LYS D 4 57  ? 45.668 85.223  22.042  1.00 31.87 ? 57   LYS B CG    1 
ATOM   5941 C  CD    . LYS D 4 57  ? 44.784 84.799  23.200  1.00 31.78 ? 57   LYS B CD    1 
ATOM   5942 C  CE    . LYS D 4 57  ? 44.981 83.334  23.544  1.00 30.07 ? 57   LYS B CE    1 
ATOM   5943 N  NZ    . LYS D 4 57  ? 44.148 82.958  24.711  1.00 30.57 ? 57   LYS B NZ    1 
ATOM   5944 N  N     . LEU D 4 58  ? 46.645 82.965  18.151  1.00 31.19 ? 58   LEU B N     1 
ATOM   5945 C  CA    . LEU D 4 58  ? 46.403 82.027  17.070  1.00 30.03 ? 58   LEU B CA    1 
ATOM   5946 C  C     . LEU D 4 58  ? 46.526 80.610  17.604  1.00 28.67 ? 58   LEU B C     1 
ATOM   5947 O  O     . LEU D 4 58  ? 47.610 80.178  17.993  1.00 27.88 ? 58   LEU B O     1 
ATOM   5948 C  CB    . LEU D 4 58  ? 47.413 82.223  15.933  1.00 30.68 ? 58   LEU B CB    1 
ATOM   5949 C  CG    . LEU D 4 58  ? 47.111 81.369  14.696  1.00 31.19 ? 58   LEU B CG    1 
ATOM   5950 C  CD1   . LEU D 4 58  ? 46.053 82.073  13.849  1.00 32.63 ? 58   LEU B CD1   1 
ATOM   5951 C  CD2   . LEU D 4 58  ? 48.371 81.157  13.871  1.00 32.05 ? 58   LEU B CD2   1 
ATOM   5952 N  N     . ASN D 4 59  ? 45.407 79.900  17.637  1.00 28.01 ? 59   ASN B N     1 
ATOM   5953 C  CA    . ASN D 4 59  ? 45.392 78.521  18.090  1.00 29.16 ? 59   ASN B CA    1 
ATOM   5954 C  C     . ASN D 4 59  ? 45.940 77.680  16.938  1.00 29.07 ? 59   ASN B C     1 
ATOM   5955 O  O     . ASN D 4 59  ? 45.295 77.556  15.904  1.00 29.10 ? 59   ASN B O     1 
ATOM   5956 C  CB    . ASN D 4 59  ? 43.968 78.093  18.413  1.00 30.34 ? 59   ASN B CB    1 
ATOM   5957 C  CG    . ASN D 4 59  ? 43.864 76.616  18.704  1.00 31.39 ? 59   ASN B CG    1 
ATOM   5958 O  OD1   . ASN D 4 59  ? 44.203 75.780  17.864  1.00 32.71 ? 59   ASN B OD1   1 
ATOM   5959 N  ND2   . ASN D 4 59  ? 43.394 76.282  19.899  1.00 32.75 ? 59   ASN B ND2   1 
ATOM   5960 N  N     . ILE D 4 60  ? 47.122 77.100  17.122  1.00 29.69 ? 60   ILE B N     1 
ATOM   5961 C  CA    . ILE D 4 60  ? 47.751 76.310  16.065  1.00 29.99 ? 60   ILE B CA    1 
ATOM   5962 C  C     . ILE D 4 60  ? 47.001 75.053  15.597  1.00 30.57 ? 60   ILE B C     1 
ATOM   5963 O  O     . ILE D 4 60  ? 47.281 74.547  14.515  1.00 29.91 ? 60   ILE B O     1 
ATOM   5964 C  CB    . ILE D 4 60  ? 49.212 75.949  16.444  1.00 28.86 ? 60   ILE B CB    1 
ATOM   5965 C  CG1   . ILE D 4 60  ? 49.244 75.005  17.649  1.00 28.37 ? 60   ILE B CG1   1 
ATOM   5966 C  CG2   . ILE D 4 60  ? 49.982 77.238  16.772  1.00 28.68 ? 60   ILE B CG2   1 
ATOM   5967 N  N     . ASP D 4 61  ? 46.050 74.554  16.388  1.00 30.97 ? 61   ASP B N     1 
ATOM   5968 C  CA    . ASP D 4 61  ? 45.274 73.385  15.967  1.00 32.07 ? 61   ASP B CA    1 
ATOM   5969 C  C     . ASP D 4 61  ? 44.142 73.784  15.026  1.00 32.30 ? 61   ASP B C     1 
ATOM   5970 O  O     . ASP D 4 61  ? 43.815 73.051  14.093  1.00 31.81 ? 61   ASP B O     1 
ATOM   5971 C  CB    . ASP D 4 61  ? 44.674 72.643  17.164  1.00 34.67 ? 61   ASP B CB    1 
ATOM   5972 C  CG    . ASP D 4 61  ? 45.706 71.850  17.928  1.00 35.42 ? 61   ASP B CG    1 
ATOM   5973 O  OD1   . ASP D 4 61  ? 46.771 71.562  17.350  1.00 37.11 ? 61   ASP B OD1   1 
ATOM   5974 O  OD2   . ASP D 4 61  ? 45.451 71.505  19.097  1.00 37.17 ? 61   ASP B OD2   1 
ATOM   5975 N  N     . GLN D 4 62  ? 43.540 74.945  15.273  1.00 30.84 ? 62   GLN B N     1 
ATOM   5976 C  CA    . GLN D 4 62  ? 42.450 75.417  14.427  1.00 31.03 ? 62   GLN B CA    1 
ATOM   5977 C  C     . GLN D 4 62  ? 42.991 76.115  13.180  1.00 30.43 ? 62   GLN B C     1 
ATOM   5978 O  O     . GLN D 4 62  ? 42.328 76.153  12.143  1.00 29.62 ? 62   GLN B O     1 
ATOM   5979 C  CB    . GLN D 4 62  ? 41.544 76.369  15.216  1.00 33.02 ? 62   GLN B CB    1 
ATOM   5980 C  CG    . GLN D 4 62  ? 40.826 75.688  16.373  1.00 37.23 ? 62   GLN B CG    1 
ATOM   5981 C  CD    . GLN D 4 62  ? 40.152 76.672  17.307  1.00 39.94 ? 62   GLN B CD    1 
ATOM   5982 O  OE1   . GLN D 4 62  ? 40.817 77.471  17.970  1.00 42.22 ? 62   GLN B OE1   1 
ATOM   5983 N  NE2   . GLN D 4 62  ? 38.823 76.621  17.366  1.00 41.59 ? 62   GLN B NE2   1 
ATOM   5984 N  N     . ASN D 4 63  ? 44.204 76.647  13.293  1.00 28.81 ? 63   ASN B N     1 
ATOM   5985 C  CA    . ASN D 4 63  ? 44.863 77.355  12.199  1.00 29.26 ? 63   ASN B CA    1 
ATOM   5986 C  C     . ASN D 4 63  ? 46.279 76.794  12.066  1.00 30.22 ? 63   ASN B C     1 
ATOM   5987 O  O     . ASN D 4 63  ? 47.236 77.367  12.579  1.00 30.16 ? 63   ASN B O     1 
ATOM   5988 C  CB    . ASN D 4 63  ? 44.918 78.845  12.526  1.00 28.94 ? 63   ASN B CB    1 
ATOM   5989 C  CG    . ASN D 4 63  ? 43.561 79.402  12.877  1.00 27.60 ? 63   ASN B CG    1 
ATOM   5990 O  OD1   . ASN D 4 63  ? 42.735 79.651  12.002  1.00 26.27 ? 63   ASN B OD1   1 
ATOM   5991 N  ND2   . ASN D 4 63  ? 43.315 79.581  14.168  1.00 29.04 ? 63   ASN B ND2   1 
ATOM   5992 N  N     . PRO D 4 64  ? 46.423 75.666  11.360  1.00 30.93 ? 64   PRO B N     1 
ATOM   5993 C  CA    . PRO D 4 64  ? 47.704 74.984  11.146  1.00 32.64 ? 64   PRO B CA    1 
ATOM   5994 C  C     . PRO D 4 64  ? 48.691 75.533  10.117  1.00 32.45 ? 64   PRO B C     1 
ATOM   5995 O  O     . PRO D 4 64  ? 49.848 75.115  10.090  1.00 32.05 ? 64   PRO B O     1 
ATOM   5996 C  CB    . PRO D 4 64  ? 47.266 73.562  10.803  1.00 32.04 ? 64   PRO B CB    1 
ATOM   5997 C  CG    . PRO D 4 64  ? 46.025 73.811  9.986   1.00 32.81 ? 64   PRO B CG    1 
ATOM   5998 C  CD    . PRO D 4 64  ? 45.308 74.898  10.768  1.00 31.20 ? 64   PRO B CD    1 
ATOM   5999 N  N     . GLY D 4 65  ? 48.250 76.464  9.281   1.00 33.88 ? 65   GLY B N     1 
ATOM   6000 C  CA    . GLY D 4 65  ? 49.128 76.989  8.248   1.00 34.08 ? 65   GLY B CA    1 
ATOM   6001 C  C     . GLY D 4 65  ? 50.155 78.047  8.611   1.00 34.45 ? 65   GLY B C     1 
ATOM   6002 O  O     . GLY D 4 65  ? 51.262 78.047  8.070   1.00 33.11 ? 65   GLY B O     1 
ATOM   6003 N  N     . THR D 4 66  ? 49.801 78.943  9.528   1.00 35.09 ? 66   THR B N     1 
ATOM   6004 C  CA    . THR D 4 66  ? 50.692 80.030  9.921   1.00 35.26 ? 66   THR B CA    1 
ATOM   6005 C  C     . THR D 4 66  ? 51.946 79.670  10.725  1.00 35.64 ? 66   THR B C     1 
ATOM   6006 O  O     . THR D 4 66  ? 53.060 79.992  10.310  1.00 36.13 ? 66   THR B O     1 
ATOM   6007 C  CB    . THR D 4 66  ? 49.912 81.104  10.697  1.00 34.65 ? 66   THR B CB    1 
ATOM   6008 O  OG1   . THR D 4 66  ? 48.757 81.488  9.938   1.00 36.38 ? 66   THR B OG1   1 
ATOM   6009 C  CG2   . THR D 4 66  ? 50.783 82.331  10.934  1.00 34.19 ? 66   THR B CG2   1 
ATOM   6010 N  N     . ALA D 4 67  ? 51.772 79.007  11.864  1.00 35.76 ? 67   ALA B N     1 
ATOM   6011 C  CA    . ALA D 4 67  ? 52.902 78.652  12.726  1.00 36.16 ? 67   ALA B CA    1 
ATOM   6012 C  C     . ALA D 4 67  ? 54.168 78.151  12.029  1.00 35.92 ? 67   ALA B C     1 
ATOM   6013 O  O     . ALA D 4 67  ? 55.255 78.677  12.268  1.00 35.61 ? 67   ALA B O     1 
ATOM   6014 C  CB    . ALA D 4 67  ? 52.464 77.639  13.777  1.00 35.03 ? 67   ALA B CB    1 
ATOM   6015 N  N     . PRO D 4 68  ? 54.045 77.141  11.151  1.00 36.56 ? 68   PRO B N     1 
ATOM   6016 C  CA    . PRO D 4 68  ? 55.210 76.594  10.444  1.00 37.06 ? 68   PRO B CA    1 
ATOM   6017 C  C     . PRO D 4 68  ? 56.064 77.638  9.725   1.00 38.60 ? 68   PRO B C     1 
ATOM   6018 O  O     . PRO D 4 68  ? 57.293 77.523  9.682   1.00 37.42 ? 68   PRO B O     1 
ATOM   6019 C  CB    . PRO D 4 68  ? 54.587 75.595  9.470   1.00 37.32 ? 68   PRO B CB    1 
ATOM   6020 C  CG    . PRO D 4 68  ? 53.315 75.184  10.166  1.00 37.48 ? 68   PRO B CG    1 
ATOM   6021 C  CD    . PRO D 4 68  ? 52.804 76.491  10.693  1.00 36.06 ? 68   PRO B CD    1 
ATOM   6022 N  N     . LYS D 4 69  ? 55.417 78.653  9.160   1.00 38.62 ? 69   LYS B N     1 
ATOM   6023 C  CA    . LYS D 4 69  ? 56.143 79.688  8.438   1.00 39.26 ? 69   LYS B CA    1 
ATOM   6024 C  C     . LYS D 4 69  ? 57.084 80.458  9.354   1.00 38.87 ? 69   LYS B C     1 
ATOM   6025 O  O     . LYS D 4 69  ? 57.982 81.158  8.884   1.00 38.53 ? 69   LYS B O     1 
ATOM   6026 C  CB    . LYS D 4 69  ? 55.170 80.658  7.764   1.00 39.79 ? 69   LYS B CB    1 
ATOM   6027 C  CG    . LYS D 4 69  ? 54.243 80.004  6.745   1.00 42.09 ? 69   LYS B CG    1 
ATOM   6028 C  CD    . LYS D 4 69  ? 53.285 81.031  6.153   1.00 42.83 ? 69   LYS B CD    1 
ATOM   6029 C  CE    . LYS D 4 69  ? 52.263 80.387  5.237   1.00 42.86 ? 69   LYS B CE    1 
ATOM   6030 N  NZ    . LYS D 4 69  ? 51.398 81.427  4.619   1.00 44.86 ? 69   LYS B NZ    1 
ATOM   6031 N  N     . TYR D 4 70  ? 56.879 80.325  10.660  1.00 38.49 ? 70   TYR B N     1 
ATOM   6032 C  CA    . TYR D 4 70  ? 57.728 81.011  11.623  1.00 39.17 ? 70   TYR B CA    1 
ATOM   6033 C  C     . TYR D 4 70  ? 58.629 80.059  12.404  1.00 38.63 ? 70   TYR B C     1 
ATOM   6034 O  O     . TYR D 4 70  ? 59.266 80.451  13.380  1.00 38.95 ? 70   TYR B O     1 
ATOM   6035 C  CB    . TYR D 4 70  ? 56.859 81.846  12.565  1.00 40.18 ? 70   TYR B CB    1 
ATOM   6036 C  CG    . TYR D 4 70  ? 56.253 83.041  11.865  1.00 38.86 ? 70   TYR B CG    1 
ATOM   6037 C  CD1   . TYR D 4 70  ? 57.026 84.166  11.572  1.00 39.02 ? 70   TYR B CD1   1 
ATOM   6038 C  CD2   . TYR D 4 70  ? 54.924 83.026  11.441  1.00 38.94 ? 70   TYR B CD2   1 
ATOM   6039 C  CE1   . TYR D 4 70  ? 56.489 85.251  10.869  1.00 39.44 ? 70   TYR B CE1   1 
ATOM   6040 C  CE2   . TYR D 4 70  ? 54.377 84.098  10.738  1.00 39.38 ? 70   TYR B CE2   1 
ATOM   6041 C  CZ    . TYR D 4 70  ? 55.162 85.207  10.455  1.00 40.15 ? 70   TYR B CZ    1 
ATOM   6042 O  OH    . TYR D 4 70  ? 54.614 86.264  9.763   1.00 41.38 ? 70   TYR B OH    1 
ATOM   6043 N  N     . GLY D 4 71  ? 58.678 78.807  11.955  1.00 38.30 ? 71   GLY B N     1 
ATOM   6044 C  CA    . GLY D 4 71  ? 59.519 77.807  12.593  1.00 38.78 ? 71   GLY B CA    1 
ATOM   6045 C  C     . GLY D 4 71  ? 59.270 77.534  14.065  1.00 39.08 ? 71   GLY B C     1 
ATOM   6046 O  O     . GLY D 4 71  ? 60.215 77.370  14.836  1.00 39.21 ? 71   GLY B O     1 
ATOM   6047 N  N     . ILE D 4 72  ? 58.006 77.480  14.466  1.00 38.30 ? 72   ILE B N     1 
ATOM   6048 C  CA    . ILE D 4 72  ? 57.678 77.202  15.857  1.00 38.53 ? 72   ILE B CA    1 
ATOM   6049 C  C     . ILE D 4 72  ? 58.254 75.837  16.274  1.00 38.62 ? 72   ILE B C     1 
ATOM   6050 O  O     . ILE D 4 72  ? 58.182 74.870  15.517  1.00 37.57 ? 72   ILE B O     1 
ATOM   6051 C  CB    . ILE D 4 72  ? 56.140 77.205  16.061  1.00 38.42 ? 72   ILE B CB    1 
ATOM   6052 C  CG1   . ILE D 4 72  ? 55.599 78.627  15.893  1.00 40.21 ? 72   ILE B CG1   1 
ATOM   6053 C  CG2   . ILE D 4 72  ? 55.781 76.668  17.432  1.00 38.50 ? 72   ILE B CG2   1 
ATOM   6054 N  N     . ARG D 4 73  ? 58.837 75.776  17.472  1.00 38.90 ? 73   ARG B N     1 
ATOM   6055 C  CA    . ARG D 4 73  ? 59.406 74.536  18.004  1.00 38.70 ? 73   ARG B CA    1 
ATOM   6056 C  C     . ARG D 4 73  ? 58.947 74.320  19.450  1.00 39.00 ? 73   ARG B C     1 
ATOM   6057 O  O     . ARG D 4 73  ? 59.221 73.279  20.055  1.00 39.86 ? 73   ARG B O     1 
ATOM   6058 C  CB    . ARG D 4 73  ? 60.936 74.571  17.944  1.00 38.46 ? 73   ARG B CB    1 
ATOM   6059 N  N     . GLY D 4 74  ? 58.242 75.309  19.997  1.00 38.47 ? 74   GLY B N     1 
ATOM   6060 C  CA    . GLY D 4 74  ? 57.739 75.212  21.357  1.00 36.85 ? 74   GLY B CA    1 
ATOM   6061 C  C     . GLY D 4 74  ? 56.619 76.211  21.608  1.00 36.79 ? 74   GLY B C     1 
ATOM   6062 O  O     . GLY D 4 74  ? 56.566 77.259  20.968  1.00 36.71 ? 74   GLY B O     1 
ATOM   6063 N  N     . ILE D 4 75  ? 55.719 75.894  22.534  1.00 35.22 ? 75   ILE B N     1 
ATOM   6064 C  CA    . ILE D 4 75  ? 54.611 76.791  22.849  1.00 34.04 ? 75   ILE B CA    1 
ATOM   6065 C  C     . ILE D 4 75  ? 54.455 76.971  24.358  1.00 33.27 ? 75   ILE B C     1 
ATOM   6066 O  O     . ILE D 4 75  ? 54.804 76.084  25.135  1.00 33.93 ? 75   ILE B O     1 
ATOM   6067 C  CB    . ILE D 4 75  ? 53.281 76.269  22.257  1.00 32.54 ? 75   ILE B CB    1 
ATOM   6068 C  CG1   . ILE D 4 75  ? 53.060 74.811  22.658  1.00 33.03 ? 75   ILE B CG1   1 
ATOM   6069 C  CG2   . ILE D 4 75  ? 53.302 76.396  20.742  1.00 32.30 ? 75   ILE B CG2   1 
ATOM   6070 N  N     . PRO D 4 76  ? 53.940 78.132  24.792  1.00 32.06 ? 76   PRO B N     1 
ATOM   6071 C  CA    . PRO D 4 76  ? 53.509 79.255  23.954  1.00 32.21 ? 76   PRO B CA    1 
ATOM   6072 C  C     . PRO D 4 76  ? 54.658 80.038  23.322  1.00 32.77 ? 76   PRO B C     1 
ATOM   6073 O  O     . PRO D 4 76  ? 55.716 80.209  23.934  1.00 33.28 ? 76   PRO B O     1 
ATOM   6074 C  CB    . PRO D 4 76  ? 52.724 80.117  24.931  1.00 31.85 ? 76   PRO B CB    1 
ATOM   6075 C  CG    . PRO D 4 76  ? 53.515 79.955  26.194  1.00 30.12 ? 76   PRO B CG    1 
ATOM   6076 C  CD    . PRO D 4 76  ? 53.740 78.449  26.219  1.00 30.75 ? 76   PRO B CD    1 
ATOM   6077 N  N     . THR D 4 77  ? 54.444 80.511  22.098  1.00 32.54 ? 77   THR B N     1 
ATOM   6078 C  CA    . THR D 4 77  ? 55.446 81.314  21.408  1.00 33.88 ? 77   THR B CA    1 
ATOM   6079 C  C     . THR D 4 77  ? 54.910 82.736  21.281  1.00 34.22 ? 77   THR B C     1 
ATOM   6080 O  O     . THR D 4 77  ? 53.854 82.964  20.695  1.00 35.02 ? 77   THR B O     1 
ATOM   6081 C  CB    . THR D 4 77  ? 55.752 80.781  19.992  1.00 34.74 ? 77   THR B CB    1 
ATOM   6082 O  OG1   . THR D 4 77  ? 56.417 79.518  20.088  1.00 35.52 ? 77   THR B OG1   1 
ATOM   6083 C  CG2   . THR D 4 77  ? 56.653 81.763  19.231  1.00 32.75 ? 77   THR B CG2   1 
ATOM   6084 N  N     . LEU D 4 78  ? 55.631 83.689  21.850  1.00 35.30 ? 78   LEU B N     1 
ATOM   6085 C  CA    . LEU D 4 78  ? 55.216 85.077  21.788  1.00 35.67 ? 78   LEU B CA    1 
ATOM   6086 C  C     . LEU D 4 78  ? 56.043 85.754  20.718  1.00 36.57 ? 78   LEU B C     1 
ATOM   6087 O  O     . LEU D 4 78  ? 57.255 85.915  20.856  1.00 35.70 ? 78   LEU B O     1 
ATOM   6088 C  CB    . LEU D 4 78  ? 55.427 85.755  23.135  1.00 35.18 ? 78   LEU B CB    1 
ATOM   6089 C  CG    . LEU D 4 78  ? 54.777 85.018  24.305  1.00 37.26 ? 78   LEU B CG    1 
ATOM   6090 C  CD1   . LEU D 4 78  ? 55.153 85.712  25.609  1.00 35.94 ? 78   LEU B CD1   1 
ATOM   6091 C  CD2   . LEU D 4 78  ? 53.262 84.967  24.117  1.00 34.31 ? 78   LEU B CD2   1 
ATOM   6092 N  N     . LEU D 4 79  ? 55.373 86.135  19.639  1.00 37.32 ? 79   LEU B N     1 
ATOM   6093 C  CA    . LEU D 4 79  ? 56.025 86.785  18.520  1.00 38.49 ? 79   LEU B CA    1 
ATOM   6094 C  C     . LEU D 4 79  ? 55.556 88.236  18.440  1.00 39.76 ? 79   LEU B C     1 
ATOM   6095 O  O     . LEU D 4 79  ? 54.355 88.511  18.373  1.00 39.59 ? 79   LEU B O     1 
ATOM   6096 C  CB    . LEU D 4 79  ? 55.672 86.030  17.240  1.00 39.51 ? 79   LEU B CB    1 
ATOM   6097 C  CG    . LEU D 4 79  ? 56.799 85.655  16.281  1.00 40.83 ? 79   LEU B CG    1 
ATOM   6098 C  CD1   . LEU D 4 79  ? 57.983 85.094  17.053  1.00 40.59 ? 79   LEU B CD1   1 
ATOM   6099 C  CD2   . LEU D 4 79  ? 56.269 84.641  15.268  1.00 40.31 ? 79   LEU B CD2   1 
ATOM   6100 N  N     . LEU D 4 80  ? 56.501 89.168  18.466  1.00 40.43 ? 80   LEU B N     1 
ATOM   6101 C  CA    . LEU D 4 80  ? 56.143 90.574  18.392  1.00 40.86 ? 80   LEU B CA    1 
ATOM   6102 C  C     . LEU D 4 80  ? 56.390 91.099  16.984  1.00 40.83 ? 80   LEU B C     1 
ATOM   6103 O  O     . LEU D 4 80  ? 57.505 91.020  16.464  1.00 41.77 ? 80   LEU B O     1 
ATOM   6104 C  CB    . LEU D 4 80  ? 56.948 91.384  19.412  1.00 41.55 ? 80   LEU B CB    1 
ATOM   6105 C  CG    . LEU D 4 80  ? 56.341 92.731  19.827  1.00 41.62 ? 80   LEU B CG    1 
ATOM   6106 C  CD1   . LEU D 4 80  ? 57.163 93.333  20.950  1.00 42.74 ? 80   LEU B CD1   1 
ATOM   6107 C  CD2   . LEU D 4 80  ? 56.288 93.672  18.638  1.00 43.03 ? 80   LEU B CD2   1 
ATOM   6108 N  N     . PHE D 4 81  ? 55.336 91.623  16.366  1.00 40.34 ? 81   PHE B N     1 
ATOM   6109 C  CA    . PHE D 4 81  ? 55.439 92.169  15.020  1.00 39.62 ? 81   PHE B CA    1 
ATOM   6110 C  C     . PHE D 4 81  ? 55.383 93.690  15.039  1.00 40.24 ? 81   PHE B C     1 
ATOM   6111 O  O     . PHE D 4 81  ? 54.569 94.284  15.751  1.00 41.00 ? 81   PHE B O     1 
ATOM   6112 C  CB    . PHE D 4 81  ? 54.309 91.646  14.130  1.00 36.08 ? 81   PHE B CB    1 
ATOM   6113 C  CG    . PHE D 4 81  ? 54.397 90.181  13.826  1.00 33.80 ? 81   PHE B CG    1 
ATOM   6114 C  CD1   . PHE D 4 81  ? 53.937 89.238  14.740  1.00 31.46 ? 81   PHE B CD1   1 
ATOM   6115 C  CD2   . PHE D 4 81  ? 54.920 89.744  12.616  1.00 31.32 ? 81   PHE B CD2   1 
ATOM   6116 C  CE1   . PHE D 4 81  ? 53.994 87.880  14.449  1.00 31.06 ? 81   PHE B CE1   1 
ATOM   6117 C  CE2   . PHE D 4 81  ? 54.983 88.390  12.317  1.00 31.79 ? 81   PHE B CE2   1 
ATOM   6118 C  CZ    . PHE D 4 81  ? 54.517 87.453  13.237  1.00 30.62 ? 81   PHE B CZ    1 
ATOM   6119 N  N     . LYS D 4 82  ? 56.248 94.311  14.249  1.00 41.01 ? 82   LYS B N     1 
ATOM   6120 C  CA    . LYS D 4 82  ? 56.296 95.766  14.147  1.00 42.78 ? 82   LYS B CA    1 
ATOM   6121 C  C     . LYS D 4 82  ? 56.245 96.123  12.670  1.00 44.25 ? 82   LYS B C     1 
ATOM   6122 O  O     . LYS D 4 82  ? 57.174 95.831  11.922  1.00 44.62 ? 82   LYS B O     1 
ATOM   6123 C  CB    . LYS D 4 82  ? 57.586 96.311  14.766  1.00 42.63 ? 82   LYS B CB    1 
ATOM   6124 N  N     . ASN D 4 83  ? 55.146 96.744  12.257  1.00 46.67 ? 83   ASN B N     1 
ATOM   6125 C  CA    . ASN D 4 83  ? 54.949 97.133  10.870  1.00 47.94 ? 83   ASN B CA    1 
ATOM   6126 C  C     . ASN D 4 83  ? 55.272 96.031  9.871   1.00 47.85 ? 83   ASN B C     1 
ATOM   6127 O  O     . ASN D 4 83  ? 56.026 96.240  8.919   1.00 48.74 ? 83   ASN B O     1 
ATOM   6128 C  CB    . ASN D 4 83  ? 55.756 98.396  10.548  1.00 50.41 ? 83   ASN B CB    1 
ATOM   6129 C  CG    . ASN D 4 83  ? 54.897 99.659  10.575  1.00 52.97 ? 83   ASN B CG    1 
ATOM   6130 O  OD1   . ASN D 4 83  ? 54.112 99.875  11.505  1.00 52.79 ? 83   ASN B OD1   1 
ATOM   6131 N  ND2   . ASN D 4 83  ? 55.049 100.503 9.555   1.00 53.85 ? 83   ASN B ND2   1 
ATOM   6132 N  N     . GLY D 4 84  ? 54.711 94.847  10.103  1.00 47.52 ? 84   GLY B N     1 
ATOM   6133 C  CA    . GLY D 4 84  ? 54.909 93.747  9.178   1.00 46.98 ? 84   GLY B CA    1 
ATOM   6134 C  C     . GLY D 4 84  ? 55.954 92.689  9.456   1.00 47.04 ? 84   GLY B C     1 
ATOM   6135 O  O     . GLY D 4 84  ? 55.964 91.654  8.789   1.00 47.46 ? 84   GLY B O     1 
ATOM   6136 N  N     . GLU D 4 85  ? 56.836 92.916  10.421  1.00 47.62 ? 85   GLU B N     1 
ATOM   6137 C  CA    . GLU D 4 85  ? 57.860 91.917  10.698  1.00 46.96 ? 85   GLU B CA    1 
ATOM   6138 C  C     . GLU D 4 85  ? 58.104 91.650  12.173  1.00 45.77 ? 85   GLU B C     1 
ATOM   6139 O  O     . GLU D 4 85  ? 57.711 92.436  13.034  1.00 45.89 ? 85   GLU B O     1 
ATOM   6140 C  CB    . GLU D 4 85  ? 59.162 92.316  10.001  1.00 48.52 ? 85   GLU B CB    1 
ATOM   6141 C  CG    . GLU D 4 85  ? 59.023 92.321  8.489   1.00 50.82 ? 85   GLU B CG    1 
ATOM   6142 C  CD    . GLU D 4 85  ? 60.311 92.642  7.773   1.00 53.14 ? 85   GLU B CD    1 
ATOM   6143 O  OE1   . GLU D 4 85  ? 60.771 93.803  7.864   1.00 54.11 ? 85   GLU B OE1   1 
ATOM   6144 O  OE2   . GLU D 4 85  ? 60.863 91.728  7.119   1.00 53.09 ? 85   GLU B OE2   1 
ATOM   6145 N  N     . VAL D 4 86  ? 58.741 90.516  12.450  1.00 45.00 ? 86   VAL B N     1 
ATOM   6146 C  CA    . VAL D 4 86  ? 59.051 90.108  13.812  1.00 44.74 ? 86   VAL B CA    1 
ATOM   6147 C  C     . VAL D 4 86  ? 60.210 90.927  14.368  1.00 44.97 ? 86   VAL B C     1 
ATOM   6148 O  O     . VAL D 4 86  ? 61.301 90.947  13.795  1.00 43.67 ? 86   VAL B O     1 
ATOM   6149 C  CB    . VAL D 4 86  ? 59.429 88.610  13.870  1.00 44.87 ? 86   VAL B CB    1 
ATOM   6150 C  CG1   . VAL D 4 86  ? 59.851 88.228  15.286  1.00 43.56 ? 86   VAL B CG1   1 
ATOM   6151 C  CG2   . VAL D 4 86  ? 58.243 87.758  13.427  1.00 45.02 ? 86   VAL B CG2   1 
ATOM   6152 N  N     . ALA D 4 87  ? 59.968 91.600  15.487  1.00 45.47 ? 87   ALA B N     1 
ATOM   6153 C  CA    . ALA D 4 87  ? 60.998 92.419  16.115  1.00 46.69 ? 87   ALA B CA    1 
ATOM   6154 C  C     . ALA D 4 87  ? 61.705 91.622  17.201  1.00 46.54 ? 87   ALA B C     1 
ATOM   6155 O  O     . ALA D 4 87  ? 62.935 91.628  17.293  1.00 47.34 ? 87   ALA B O     1 
ATOM   6156 C  CB    . ALA D 4 87  ? 60.376 93.678  16.711  1.00 46.49 ? 87   ALA B CB    1 
ATOM   6157 N  N     . ALA D 4 88  ? 60.912 90.937  18.018  1.00 45.80 ? 88   ALA B N     1 
ATOM   6158 C  CA    . ALA D 4 88  ? 61.433 90.127  19.112  1.00 44.66 ? 88   ALA B CA    1 
ATOM   6159 C  C     . ALA D 4 88  ? 60.612 88.856  19.259  1.00 43.60 ? 88   ALA B C     1 
ATOM   6160 O  O     . ALA D 4 88  ? 59.484 88.768  18.769  1.00 42.54 ? 88   ALA B O     1 
ATOM   6161 C  CB    . ALA D 4 88  ? 61.399 90.920  20.416  1.00 43.65 ? 88   ALA B CB    1 
ATOM   6162 N  N     . THR D 4 89  ? 61.184 87.874  19.944  1.00 43.38 ? 89   THR B N     1 
ATOM   6163 C  CA    . THR D 4 89  ? 60.509 86.608  20.168  1.00 42.41 ? 89   THR B CA    1 
ATOM   6164 C  C     . THR D 4 89  ? 60.899 85.971  21.494  1.00 41.77 ? 89   THR B C     1 
ATOM   6165 O  O     . THR D 4 89  ? 62.073 85.938  21.866  1.00 41.83 ? 89   THR B O     1 
ATOM   6166 C  CB    . THR D 4 89  ? 60.803 85.620  19.031  1.00 43.47 ? 89   THR B CB    1 
ATOM   6167 O  OG1   . THR D 4 89  ? 60.467 84.291  19.455  1.00 45.64 ? 89   THR B OG1   1 
ATOM   6168 C  CG2   . THR D 4 89  ? 62.271 85.677  18.643  1.00 45.08 ? 89   THR B CG2   1 
ATOM   6169 N  N     . LYS D 4 90  ? 59.897 85.474  22.210  1.00 41.01 ? 90   LYS B N     1 
ATOM   6170 C  CA    . LYS D 4 90  ? 60.109 84.817  23.490  1.00 39.85 ? 90   LYS B CA    1 
ATOM   6171 C  C     . LYS D 4 90  ? 59.210 83.583  23.548  1.00 39.80 ? 90   LYS B C     1 
ATOM   6172 O  O     . LYS D 4 90  ? 58.035 83.642  23.169  1.00 40.95 ? 90   LYS B O     1 
ATOM   6173 C  CB    . LYS D 4 90  ? 59.761 85.771  24.633  1.00 40.31 ? 90   LYS B CB    1 
ATOM   6174 C  CG    . LYS D 4 90  ? 60.819 85.846  25.726  1.00 41.25 ? 90   LYS B CG    1 
ATOM   6175 C  CD    . LYS D 4 90  ? 62.134 86.421  25.196  1.00 41.96 ? 90   LYS B CD    1 
ATOM   6176 C  CE    . LYS D 4 90  ? 63.195 86.476  26.292  1.00 44.23 ? 90   LYS B CE    1 
ATOM   6177 N  NZ    . LYS D 4 90  ? 64.455 87.131  25.846  1.00 43.50 ? 90   LYS B NZ    1 
ATOM   6178 N  N     . VAL D 4 91  ? 59.763 82.468  24.014  1.00 37.83 ? 91   VAL B N     1 
ATOM   6179 C  CA    . VAL D 4 91  ? 59.012 81.218  24.124  1.00 35.92 ? 91   VAL B CA    1 
ATOM   6180 C  C     . VAL D 4 91  ? 58.903 80.827  25.600  1.00 36.98 ? 91   VAL B C     1 
ATOM   6181 O  O     . VAL D 4 91  ? 59.873 80.949  26.347  1.00 36.89 ? 91   VAL B O     1 
ATOM   6182 C  CB    . VAL D 4 91  ? 59.729 80.080  23.362  1.00 35.27 ? 91   VAL B CB    1 
ATOM   6183 C  CG1   . VAL D 4 91  ? 58.907 78.813  23.418  1.00 34.13 ? 91   VAL B CG1   1 
ATOM   6184 C  CG2   . VAL D 4 91  ? 59.992 80.497  21.924  1.00 33.73 ? 91   VAL B CG2   1 
ATOM   6185 N  N     . GLY D 4 92  ? 57.729 80.362  26.021  1.00 37.05 ? 92   GLY B N     1 
ATOM   6186 C  CA    . GLY D 4 92  ? 57.560 79.964  27.409  1.00 37.44 ? 92   GLY B CA    1 
ATOM   6187 C  C     . GLY D 4 92  ? 56.531 80.783  28.168  1.00 38.40 ? 92   GLY B C     1 
ATOM   6188 O  O     . GLY D 4 92  ? 56.125 81.862  27.726  1.00 38.43 ? 92   GLY B O     1 
ATOM   6189 N  N     . ALA D 4 93  ? 56.121 80.273  29.326  1.00 37.75 ? 93   ALA B N     1 
ATOM   6190 C  CA    . ALA D 4 93  ? 55.122 80.933  30.160  1.00 37.99 ? 93   ALA B CA    1 
ATOM   6191 C  C     . ALA D 4 93  ? 55.687 82.043  31.047  1.00 38.52 ? 93   ALA B C     1 
ATOM   6192 O  O     . ALA D 4 93  ? 55.845 81.866  32.258  1.00 38.43 ? 93   ALA B O     1 
ATOM   6193 C  CB    . ALA D 4 93  ? 54.407 79.896  31.022  1.00 37.79 ? 93   ALA B CB    1 
ATOM   6194 N  N     . LEU D 4 94  ? 55.977 83.194  30.449  1.00 38.94 ? 94   LEU B N     1 
ATOM   6195 C  CA    . LEU D 4 94  ? 56.504 84.319  31.214  1.00 39.45 ? 94   LEU B CA    1 
ATOM   6196 C  C     . LEU D 4 94  ? 55.470 84.789  32.239  1.00 40.31 ? 94   LEU B C     1 
ATOM   6197 O  O     . LEU D 4 94  ? 54.267 84.556  32.078  1.00 39.60 ? 94   LEU B O     1 
ATOM   6198 C  CB    . LEU D 4 94  ? 56.852 85.480  30.280  1.00 39.91 ? 94   LEU B CB    1 
ATOM   6199 C  CG    . LEU D 4 94  ? 57.872 85.216  29.170  1.00 40.87 ? 94   LEU B CG    1 
ATOM   6200 C  CD1   . LEU D 4 94  ? 58.130 86.501  28.389  1.00 41.53 ? 94   LEU B CD1   1 
ATOM   6201 C  CD2   . LEU D 4 94  ? 59.161 84.712  29.780  1.00 42.73 ? 94   LEU B CD2   1 
ATOM   6202 N  N     . SER D 4 95  ? 55.949 85.436  33.298  1.00 41.14 ? 95   SER B N     1 
ATOM   6203 C  CA    . SER D 4 95  ? 55.076 85.974  34.339  1.00 42.11 ? 95   SER B CA    1 
ATOM   6204 C  C     . SER D 4 95  ? 54.660 87.356  33.845  1.00 42.13 ? 95   SER B C     1 
ATOM   6205 O  O     . SER D 4 95  ? 55.224 87.859  32.871  1.00 41.68 ? 95   SER B O     1 
ATOM   6206 C  CB    . SER D 4 95  ? 55.833 86.127  35.663  1.00 41.61 ? 95   SER B CB    1 
ATOM   6207 O  OG    . SER D 4 95  ? 56.740 87.222  35.606  1.00 40.11 ? 95   SER B OG    1 
ATOM   6208 N  N     . LYS D 4 96  ? 53.685 87.974  34.507  1.00 43.28 ? 96   LYS B N     1 
ATOM   6209 C  CA    . LYS D 4 96  ? 53.255 89.305  34.092  1.00 44.06 ? 96   LYS B CA    1 
ATOM   6210 C  C     . LYS D 4 96  ? 54.450 90.247  34.144  1.00 44.01 ? 96   LYS B C     1 
ATOM   6211 O  O     . LYS D 4 96  ? 54.680 91.030  33.217  1.00 43.75 ? 96   LYS B O     1 
ATOM   6212 C  CB    . LYS D 4 96  ? 52.147 89.844  35.005  1.00 45.35 ? 96   LYS B CB    1 
ATOM   6213 C  CG    . LYS D 4 96  ? 51.756 91.290  34.678  1.00 45.35 ? 96   LYS B CG    1 
ATOM   6214 C  CD    . LYS D 4 96  ? 50.847 91.895  35.741  1.00 47.52 ? 96   LYS B CD    1 
ATOM   6215 C  CE    . LYS D 4 96  ? 49.390 91.549  35.506  1.00 48.08 ? 96   LYS B CE    1 
ATOM   6216 N  NZ    . LYS D 4 96  ? 48.911 92.171  34.242  1.00 48.72 ? 96   LYS B NZ    1 
ATOM   6217 N  N     . GLY D 4 97  ? 55.213 90.157  35.230  1.00 43.98 ? 97   GLY B N     1 
ATOM   6218 C  CA    . GLY D 4 97  ? 56.376 91.011  35.389  1.00 43.70 ? 97   GLY B CA    1 
ATOM   6219 C  C     . GLY D 4 97  ? 57.380 90.849  34.267  1.00 44.07 ? 97   GLY B C     1 
ATOM   6220 O  O     . GLY D 4 97  ? 57.841 91.831  33.678  1.00 43.47 ? 97   GLY B O     1 
ATOM   6221 N  N     . GLN D 4 98  ? 57.726 89.601  33.973  1.00 45.09 ? 98   GLN B N     1 
ATOM   6222 C  CA    . GLN D 4 98  ? 58.683 89.303  32.914  1.00 45.52 ? 98   GLN B CA    1 
ATOM   6223 C  C     . GLN D 4 98  ? 58.137 89.752  31.562  1.00 45.70 ? 98   GLN B C     1 
ATOM   6224 O  O     . GLN D 4 98  ? 58.889 90.179  30.684  1.00 44.88 ? 98   GLN B O     1 
ATOM   6225 C  CB    . GLN D 4 98  ? 58.979 87.800  32.887  1.00 46.47 ? 98   GLN B CB    1 
ATOM   6226 C  CG    . GLN D 4 98  ? 59.572 87.269  34.178  1.00 46.84 ? 98   GLN B CG    1 
ATOM   6227 C  CD    . GLN D 4 98  ? 59.808 85.772  34.140  1.00 47.17 ? 98   GLN B CD    1 
ATOM   6228 O  OE1   . GLN D 4 98  ? 58.867 84.980  34.052  1.00 46.41 ? 98   GLN B OE1   1 
ATOM   6229 N  NE2   . GLN D 4 98  ? 61.070 85.375  34.204  1.00 47.09 ? 98   GLN B NE2   1 
ATOM   6230 N  N     . LEU D 4 99  ? 56.821 89.653  31.400  1.00 45.90 ? 99   LEU B N     1 
ATOM   6231 C  CA    . LEU D 4 99  ? 56.184 90.054  30.154  1.00 46.69 ? 99   LEU B CA    1 
ATOM   6232 C  C     . LEU D 4 99  ? 56.215 91.573  30.013  1.00 46.66 ? 99   LEU B C     1 
ATOM   6233 O  O     . LEU D 4 99  ? 56.586 92.095  28.961  1.00 46.83 ? 99   LEU B O     1 
ATOM   6234 C  CB    . LEU D 4 99  ? 54.737 89.548  30.109  1.00 45.70 ? 99   LEU B CB    1 
ATOM   6235 C  CG    . LEU D 4 99  ? 54.394 88.667  28.906  1.00 45.99 ? 99   LEU B CG    1 
ATOM   6236 C  CD1   . LEU D 4 99  ? 52.989 88.111  29.063  1.00 47.01 ? 99   LEU B CD1   1 
ATOM   6237 C  CD2   . LEU D 4 99  ? 54.524 89.465  27.621  1.00 43.95 ? 99   LEU B CD2   1 
ATOM   6238 N  N     . LYS D 4 100 ? 55.824 92.278  31.072  1.00 47.22 ? 100  LYS B N     1 
ATOM   6239 C  CA    . LYS D 4 100 ? 55.826 93.738  31.049  1.00 47.62 ? 100  LYS B CA    1 
ATOM   6240 C  C     . LYS D 4 100 ? 57.208 94.237  30.656  1.00 47.49 ? 100  LYS B C     1 
ATOM   6241 O  O     . LYS D 4 100 ? 57.336 95.180  29.878  1.00 47.31 ? 100  LYS B O     1 
ATOM   6242 C  CB    . LYS D 4 100 ? 55.442 94.305  32.420  1.00 47.81 ? 100  LYS B CB    1 
ATOM   6243 C  CG    . LYS D 4 100 ? 54.007 94.017  32.836  1.00 49.56 ? 100  LYS B CG    1 
ATOM   6244 C  CD    . LYS D 4 100 ? 53.703 94.558  34.232  1.00 51.80 ? 100  LYS B CD    1 
ATOM   6245 C  CE    . LYS D 4 100 ? 52.794 95.777  34.182  1.00 51.62 ? 100  LYS B CE    1 
ATOM   6246 N  NZ    . LYS D 4 100 ? 53.356 96.869  33.339  1.00 52.32 ? 100  LYS B NZ    1 
ATOM   6247 N  N     . GLU D 4 101 ? 58.241 93.592  31.190  1.00 48.41 ? 101  GLU B N     1 
ATOM   6248 C  CA    . GLU D 4 101 ? 59.622 93.970  30.888  1.00 48.88 ? 101  GLU B CA    1 
ATOM   6249 C  C     . GLU D 4 101 ? 59.923 93.755  29.411  1.00 48.35 ? 101  GLU B C     1 
ATOM   6250 O  O     . GLU D 4 101 ? 60.537 94.602  28.755  1.00 47.87 ? 101  GLU B O     1 
ATOM   6251 C  CB    . GLU D 4 101 ? 60.600 93.131  31.713  1.00 50.50 ? 101  GLU B CB    1 
ATOM   6252 C  CG    . GLU D 4 101 ? 60.521 93.343  33.211  1.00 53.60 ? 101  GLU B CG    1 
ATOM   6253 C  CD    . GLU D 4 101 ? 61.419 92.379  33.974  1.00 55.82 ? 101  GLU B CD    1 
ATOM   6254 O  OE1   . GLU D 4 101 ? 62.652 92.406  33.751  1.00 55.15 ? 101  GLU B OE1   1 
ATOM   6255 O  OE2   . GLU D 4 101 ? 60.888 91.590  34.792  1.00 56.09 ? 101  GLU B OE2   1 
ATOM   6256 N  N     . PHE D 4 102 ? 59.497 92.602  28.902  1.00 47.60 ? 102  PHE B N     1 
ATOM   6257 C  CA    . PHE D 4 102 ? 59.712 92.244  27.507  1.00 46.76 ? 102  PHE B CA    1 
ATOM   6258 C  C     . PHE D 4 102 ? 59.071 93.282  26.598  1.00 46.20 ? 102  PHE B C     1 
ATOM   6259 O  O     . PHE D 4 102 ? 59.666 93.712  25.610  1.00 45.21 ? 102  PHE B O     1 
ATOM   6260 C  CB    . PHE D 4 102 ? 59.110 90.866  27.217  1.00 46.10 ? 102  PHE B CB    1 
ATOM   6261 C  CG    . PHE D 4 102 ? 59.337 90.391  25.813  1.00 45.10 ? 102  PHE B CG    1 
ATOM   6262 C  CD1   . PHE D 4 102 ? 60.628 90.181  25.336  1.00 44.12 ? 102  PHE B CD1   1 
ATOM   6263 C  CD2   . PHE D 4 102 ? 58.259 90.151  24.963  1.00 45.49 ? 102  PHE B CD2   1 
ATOM   6264 C  CE1   . PHE D 4 102 ? 60.847 89.739  24.035  1.00 43.65 ? 102  PHE B CE1   1 
ATOM   6265 C  CE2   . PHE D 4 102 ? 58.468 89.706  23.654  1.00 45.08 ? 102  PHE B CE2   1 
ATOM   6266 C  CZ    . PHE D 4 102 ? 59.766 89.500  23.191  1.00 44.00 ? 102  PHE B CZ    1 
ATOM   6267 N  N     . LEU D 4 103 ? 57.848 93.674  26.937  1.00 45.96 ? 103  LEU B N     1 
ATOM   6268 C  CA    . LEU D 4 103 ? 57.124 94.668  26.159  1.00 46.65 ? 103  LEU B CA    1 
ATOM   6269 C  C     . LEU D 4 103 ? 57.786 96.040  26.275  1.00 46.96 ? 103  LEU B C     1 
ATOM   6270 O  O     . LEU D 4 103 ? 58.333 96.555  25.300  1.00 46.78 ? 103  LEU B O     1 
ATOM   6271 C  CB    . LEU D 4 103 ? 55.669 94.739  26.628  1.00 46.20 ? 103  LEU B CB    1 
ATOM   6272 C  CG    . LEU D 4 103 ? 54.892 93.439  26.407  1.00 46.03 ? 103  LEU B CG    1 
ATOM   6273 C  CD1   . LEU D 4 103 ? 53.494 93.559  26.979  1.00 46.29 ? 103  LEU B CD1   1 
ATOM   6274 C  CD2   . LEU D 4 103 ? 54.845 93.131  24.913  1.00 46.49 ? 103  LEU B CD2   1 
ATOM   6275 N  N     . ASP D 4 104 ? 57.747 96.623  27.470  1.00 47.54 ? 104  ASP B N     1 
ATOM   6276 C  CA    . ASP D 4 104 ? 58.347 97.936  27.692  1.00 49.05 ? 104  ASP B CA    1 
ATOM   6277 C  C     . ASP D 4 104 ? 59.697 98.078  26.979  1.00 48.82 ? 104  ASP B C     1 
ATOM   6278 O  O     . ASP D 4 104 ? 59.890 98.989  26.176  1.00 48.33 ? 104  ASP B O     1 
ATOM   6279 C  CB    . ASP D 4 104 ? 58.525 98.198  29.194  1.00 50.20 ? 104  ASP B CB    1 
ATOM   6280 C  CG    . ASP D 4 104 ? 57.214 98.113  29.964  1.00 51.62 ? 104  ASP B CG    1 
ATOM   6281 O  OD1   . ASP D 4 104 ? 56.185 98.601  29.449  1.00 51.47 ? 104  ASP B OD1   1 
ATOM   6282 O  OD2   . ASP D 4 104 ? 57.212 97.569  31.089  1.00 53.97 ? 104  ASP B OD2   1 
ATOM   6283 N  N     . ALA D 4 105 ? 60.617 97.162  27.263  1.00 48.82 ? 105  ALA B N     1 
ATOM   6284 C  CA    . ALA D 4 105 ? 61.947 97.189  26.657  1.00 48.67 ? 105  ALA B CA    1 
ATOM   6285 C  C     . ALA D 4 105 ? 61.922 97.092  25.136  1.00 48.34 ? 105  ALA B C     1 
ATOM   6286 O  O     . ALA D 4 105 ? 62.789 97.645  24.459  1.00 48.42 ? 105  ALA B O     1 
ATOM   6287 C  CB    . ALA D 4 105 ? 62.800 96.057  27.227  1.00 48.35 ? 105  ALA B CB    1 
ATOM   6288 N  N     . ASN D 4 106 ? 60.936 96.385  24.594  1.00 48.41 ? 106  ASN B N     1 
ATOM   6289 C  CA    . ASN D 4 106 ? 60.845 96.222  23.146  1.00 48.35 ? 106  ASN B CA    1 
ATOM   6290 C  C     . ASN D 4 106 ? 59.969 97.254  22.434  1.00 48.27 ? 106  ASN B C     1 
ATOM   6291 O  O     . ASN D 4 106 ? 60.207 97.568  21.267  1.00 48.36 ? 106  ASN B O     1 
ATOM   6292 C  CB    . ASN D 4 106 ? 60.375 94.803  22.813  1.00 47.80 ? 106  ASN B CB    1 
ATOM   6293 C  CG    . ASN D 4 106 ? 61.480 93.775  22.973  1.00 47.86 ? 106  ASN B CG    1 
ATOM   6294 O  OD1   . ASN D 4 106 ? 62.447 93.759  22.204  1.00 48.02 ? 106  ASN B OD1   1 
ATOM   6295 N  ND2   . ASN D 4 106 ? 61.351 92.918  23.978  1.00 46.79 ? 106  ASN B ND2   1 
ATOM   6296 N  N     . LEU D 4 107 ? 58.966 97.783  23.131  1.00 48.49 ? 107  LEU B N     1 
ATOM   6297 C  CA    . LEU D 4 107 ? 58.080 98.785  22.543  1.00 49.16 ? 107  LEU B CA    1 
ATOM   6298 C  C     . LEU D 4 107 ? 58.852 100.061 22.204  1.00 49.26 ? 107  LEU B C     1 
ATOM   6299 O  O     . LEU D 4 107 ? 59.039 100.886 23.126  1.00 49.06 ? 107  LEU B O     1 
ATOM   6300 C  CB    . LEU D 4 107 ? 56.929 99.121  23.502  1.00 49.67 ? 107  LEU B CB    1 
ATOM   6301 C  CG    . LEU D 4 107 ? 55.601 98.356  23.383  1.00 51.43 ? 107  LEU B CG    1 
ATOM   6302 C  CD1   . LEU D 4 107 ? 55.019 98.560  21.987  1.00 51.08 ? 107  LEU B CD1   1 
ATOM   6303 C  CD2   . LEU D 4 107 ? 55.809 96.878  23.659  1.00 51.67 ? 107  LEU B CD2   1 
HETATM 6304 MG MG    . MG  E 5 .   ? 43.855 22.690  -4.687  1.00 39.03 ? 4001 MG  A MG    1 
HETATM 6305 MG MG    . MG  F 5 .   ? 47.078 25.870  -5.237  1.00 36.82 ? 4002 MG  A MG    1 
HETATM 6306 MG MG    . MG  G 5 .   ? 78.017 24.547  7.727   1.00 47.28 ? 4003 MG  A MG    1 
HETATM 6307 P  PG    . DAD H 6 .   ? 41.697 24.120  -6.706  1.00 54.16 ? 4004 DAD A PG    1 
HETATM 6308 O  O1G   . DAD H 6 .   ? 43.137 23.828  -6.937  1.00 55.25 ? 4004 DAD A O1G   1 
HETATM 6309 O  O2G   . DAD H 6 .   ? 40.685 23.051  -6.903  1.00 54.82 ? 4004 DAD A O2G   1 
HETATM 6310 O  O3G   . DAD H 6 .   ? 41.296 25.303  -7.577  1.00 56.46 ? 4004 DAD A O3G   1 
HETATM 6311 P  PB    . DAD H 6 .   ? 41.553 24.286  -3.745  1.00 56.72 ? 4004 DAD A PB    1 
HETATM 6312 O  O1B   . DAD H 6 .   ? 40.597 25.147  -2.991  1.00 58.56 ? 4004 DAD A O1B   1 
HETATM 6313 O  O2B   . DAD H 6 .   ? 41.372 22.820  -3.726  1.00 55.37 ? 4004 DAD A O2B   1 
HETATM 6314 O  O3B   . DAD H 6 .   ? 41.515 24.782  -5.264  1.00 56.12 ? 4004 DAD A O3B   1 
HETATM 6315 P  PA    . DAD H 6 .   ? 43.934 25.820  -3.398  1.00 53.10 ? 4004 DAD A PA    1 
HETATM 6316 O  O1A   . DAD H 6 .   ? 44.687 25.546  -4.645  1.00 52.93 ? 4004 DAD A O1A   1 
HETATM 6317 O  O2A   . DAD H 6 .   ? 43.167 27.084  -3.260  1.00 55.63 ? 4004 DAD A O2A   1 
HETATM 6318 O  O3A   . DAD H 6 .   ? 42.986 24.571  -3.116  1.00 55.55 ? 4004 DAD A O3A   1 
HETATM 6319 O  "O5'" . DAD H 6 .   ? 44.894 25.688  -2.130  1.00 53.56 ? 4004 DAD A "O5'" 1 
HETATM 6320 C  "C5'" . DAD H 6 .   ? 45.521 24.446  -1.796  1.00 52.98 ? 4004 DAD A "C5'" 1 
HETATM 6321 C  "C4'" . DAD H 6 .   ? 45.034 23.954  -0.449  1.00 52.96 ? 4004 DAD A "C4'" 1 
HETATM 6322 O  "O4'" . DAD H 6 .   ? 45.342 24.949  0.563   1.00 52.47 ? 4004 DAD A "O4'" 1 
HETATM 6323 C  "C3'" . DAD H 6 .   ? 43.531 23.741  -0.331  1.00 52.36 ? 4004 DAD A "C3'" 1 
HETATM 6324 C  "C2'" . DAD H 6 .   ? 43.289 23.899  1.165   1.00 52.63 ? 4004 DAD A "C2'" 1 
HETATM 6325 C  "C1'" . DAD H 6 .   ? 44.319 24.966  1.542   1.00 51.17 ? 4004 DAD A "C1'" 1 
HETATM 6326 N  N9    . DAD H 6 .   ? 43.765 26.319  1.622   1.00 51.26 ? 4004 DAD A N9    1 
HETATM 6327 C  C8    . DAD H 6 .   ? 43.608 27.242  0.616   1.00 51.11 ? 4004 DAD A C8    1 
HETATM 6328 N  N7    . DAD H 6 .   ? 43.078 28.374  1.014   1.00 51.78 ? 4004 DAD A N7    1 
HETATM 6329 C  C5    . DAD H 6 .   ? 42.872 28.185  2.374   1.00 51.72 ? 4004 DAD A C5    1 
HETATM 6330 C  C6    . DAD H 6 .   ? 42.330 29.016  3.377   1.00 52.44 ? 4004 DAD A C6    1 
HETATM 6331 N  N6    . DAD H 6 .   ? 41.880 30.255  3.153   1.00 51.10 ? 4004 DAD A N6    1 
HETATM 6332 N  N1    . DAD H 6 .   ? 42.265 28.520  4.635   1.00 51.99 ? 4004 DAD A N1    1 
HETATM 6333 C  C2    . DAD H 6 .   ? 42.710 27.277  4.857   1.00 51.63 ? 4004 DAD A C2    1 
HETATM 6334 N  N3    . DAD H 6 .   ? 43.235 26.403  4.000   1.00 50.96 ? 4004 DAD A N3    1 
HETATM 6335 C  C4    . DAD H 6 .   ? 43.289 26.924  2.762   1.00 50.81 ? 4004 DAD A C4    1 
HETATM 6336 O  O     . HOH I 7 .   ? 51.713 30.790  1.147   1.00 34.16 ? 5203 HOH P O     1 
HETATM 6337 O  O     . HOH J 7 .   ? 53.410 32.189  3.160   1.00 20.18 ? 5020 HOH T O     1 
HETATM 6338 O  O     . HOH J 7 .   ? 61.252 32.468  8.224   1.00 34.17 ? 5040 HOH T O     1 
HETATM 6339 O  O     . HOH J 7 .   ? 54.009 29.591  13.612  1.00 36.18 ? 5065 HOH T O     1 
HETATM 6340 O  O     . HOH J 7 .   ? 51.078 27.344  4.896   1.00 32.59 ? 5082 HOH T O     1 
HETATM 6341 O  O     . HOH J 7 .   ? 62.064 41.532  7.105   1.00 42.34 ? 5140 HOH T O     1 
HETATM 6342 O  O     . HOH J 7 .   ? 59.412 49.861  6.464   1.00 53.86 ? 5143 HOH T O     1 
HETATM 6343 O  O     . HOH J 7 .   ? 56.362 26.277  12.685  1.00 28.86 ? 5202 HOH T O     1 
HETATM 6344 O  O     . HOH J 7 .   ? 59.594 28.959  8.348   1.00 43.51 ? 5210 HOH T O     1 
HETATM 6345 O  O     . HOH J 7 .   ? 61.804 35.448  7.996   1.00 35.91 ? 5246 HOH T O     1 
HETATM 6346 O  O     . HOH J 7 .   ? 51.197 30.459  11.519  1.00 48.41 ? 5252 HOH T O     1 
HETATM 6347 O  O     . HOH J 7 .   ? 53.035 51.919  16.379  1.00 36.95 ? 5263 HOH T O     1 
HETATM 6348 O  O     . HOH J 7 .   ? 54.652 59.028  9.987   1.00 44.06 ? 5274 HOH T O     1 
HETATM 6349 O  O     . HOH K 7 .   ? 72.784 20.058  -10.049 1.00 36.47 ? 5001 HOH A O     1 
HETATM 6350 O  O     . HOH K 7 .   ? 69.406 12.317  0.940   1.00 16.99 ? 5002 HOH A O     1 
HETATM 6351 O  O     . HOH K 7 .   ? 42.987 75.302  38.480  1.00 35.44 ? 5003 HOH A O     1 
HETATM 6352 O  O     . HOH K 7 .   ? 82.398 18.869  -9.760  1.00 23.81 ? 5004 HOH A O     1 
HETATM 6353 O  O     . HOH K 7 .   ? 66.271 21.891  0.641   1.00 17.50 ? 5006 HOH A O     1 
HETATM 6354 O  O     . HOH K 7 .   ? 71.342 24.303  -2.564  1.00 20.73 ? 5007 HOH A O     1 
HETATM 6355 O  O     . HOH K 7 .   ? 80.516 34.802  10.034  1.00 26.77 ? 5008 HOH A O     1 
HETATM 6356 O  O     . HOH K 7 .   ? 69.097 24.332  -26.428 1.00 19.38 ? 5009 HOH A O     1 
HETATM 6357 O  O     . HOH K 7 .   ? 52.944 33.282  -4.732  1.00 27.72 ? 5011 HOH A O     1 
HETATM 6358 O  O     . HOH K 7 .   ? 65.554 26.717  -28.005 1.00 19.64 ? 5013 HOH A O     1 
HETATM 6359 O  O     . HOH K 7 .   ? 66.505 23.983  24.382  1.00 24.52 ? 5015 HOH A O     1 
HETATM 6360 O  O     . HOH K 7 .   ? 58.056 22.017  -28.835 1.00 19.01 ? 5016 HOH A O     1 
HETATM 6361 O  O     . HOH K 7 .   ? 71.002 28.949  15.656  1.00 28.21 ? 5017 HOH A O     1 
HETATM 6362 O  O     . HOH K 7 .   ? 69.584 27.736  -20.587 1.00 20.81 ? 5018 HOH A O     1 
HETATM 6363 O  O     . HOH K 7 .   ? 70.381 24.095  12.876  1.00 25.70 ? 5019 HOH A O     1 
HETATM 6364 O  O     . HOH K 7 .   ? 68.141 34.225  -19.308 1.00 31.06 ? 5021 HOH A O     1 
HETATM 6365 O  O     . HOH K 7 .   ? 54.095 28.028  5.033   1.00 15.07 ? 5022 HOH A O     1 
HETATM 6366 O  O     . HOH K 7 .   ? 71.600 11.866  -6.694  1.00 27.97 ? 5023 HOH A O     1 
HETATM 6367 O  O     . HOH K 7 .   ? 62.401 18.247  3.534   1.00 29.26 ? 5024 HOH A O     1 
HETATM 6368 O  O     . HOH K 7 .   ? 73.426 16.558  3.719   1.00 21.38 ? 5025 HOH A O     1 
HETATM 6369 O  O     . HOH K 7 .   ? 75.603 32.057  12.812  1.00 26.67 ? 5026 HOH A O     1 
HETATM 6370 O  O     . HOH K 7 .   ? 76.609 3.645   -2.643  1.00 22.62 ? 5027 HOH A O     1 
HETATM 6371 O  O     . HOH K 7 .   ? 70.368 3.862   15.858  1.00 29.07 ? 5028 HOH A O     1 
HETATM 6372 O  O     . HOH K 7 .   ? 59.201 52.083  1.723   1.00 39.88 ? 5029 HOH A O     1 
HETATM 6373 O  O     . HOH K 7 .   ? 61.279 46.802  4.927   1.00 24.33 ? 5030 HOH A O     1 
HETATM 6374 O  O     . HOH K 7 .   ? 64.043 28.917  4.281   1.00 27.23 ? 5031 HOH A O     1 
HETATM 6375 O  O     . HOH K 7 .   ? 77.865 19.567  8.186   1.00 26.56 ? 5032 HOH A O     1 
HETATM 6376 O  O     . HOH K 7 .   ? 60.898 31.506  -1.444  1.00 21.71 ? 5033 HOH A O     1 
HETATM 6377 O  O     . HOH K 7 .   ? 38.440 7.151   5.689   1.00 25.15 ? 5034 HOH A O     1 
HETATM 6378 O  O     . HOH K 7 .   ? 51.345 3.694   -6.232  1.00 37.27 ? 5035 HOH A O     1 
HETATM 6379 O  O     . HOH K 7 .   ? 62.022 24.583  11.058  1.00 24.70 ? 5036 HOH A O     1 
HETATM 6380 O  O     . HOH K 7 .   ? 68.020 35.538  -5.465  1.00 23.63 ? 5037 HOH A O     1 
HETATM 6381 O  O     . HOH K 7 .   ? 69.957 21.484  3.745   1.00 23.78 ? 5038 HOH A O     1 
HETATM 6382 O  O     . HOH K 7 .   ? 66.309 47.876  -9.822  1.00 35.91 ? 5039 HOH A O     1 
HETATM 6383 O  O     . HOH K 7 .   ? 82.471 36.853  3.895   1.00 31.20 ? 5041 HOH A O     1 
HETATM 6384 O  O     . HOH K 7 .   ? 79.616 23.726  5.912   1.00 29.81 ? 5043 HOH A O     1 
HETATM 6385 O  O     . HOH K 7 .   ? 43.323 16.253  -6.224  1.00 33.78 ? 5044 HOH A O     1 
HETATM 6386 O  O     . HOH K 7 .   ? 67.995 20.420  15.637  1.00 25.65 ? 5045 HOH A O     1 
HETATM 6387 O  O     . HOH K 7 .   ? 49.277 27.187  -5.056  1.00 26.90 ? 5046 HOH A O     1 
HETATM 6388 O  O     . HOH K 7 .   ? 75.540 5.522   -5.028  1.00 41.36 ? 5048 HOH A O     1 
HETATM 6389 O  O     . HOH K 7 .   ? 53.667 23.642  1.382   1.00 30.17 ? 5049 HOH A O     1 
HETATM 6390 O  O     . HOH K 7 .   ? 49.299 6.262   4.771   1.00 26.44 ? 5050 HOH A O     1 
HETATM 6391 O  O     . HOH K 7 .   ? 46.919 10.988  8.764   1.00 23.86 ? 5051 HOH A O     1 
HETATM 6392 O  O     . HOH K 7 .   ? 89.099 7.569   9.928   1.00 33.03 ? 5052 HOH A O     1 
HETATM 6393 O  O     . HOH K 7 .   ? 68.391 15.532  -13.824 1.00 23.76 ? 5053 HOH A O     1 
HETATM 6394 O  O     . HOH K 7 .   ? 59.192 40.618  -1.384  1.00 28.62 ? 5054 HOH A O     1 
HETATM 6395 O  O     . HOH K 7 .   ? 68.365 27.052  15.266  1.00 26.19 ? 5055 HOH A O     1 
HETATM 6396 O  O     . HOH K 7 .   ? 44.771 24.290  5.247   1.00 36.14 ? 5056 HOH A O     1 
HETATM 6397 O  O     . HOH K 7 .   ? 71.004 24.583  -13.948 1.00 27.80 ? 5057 HOH A O     1 
HETATM 6398 O  O     . HOH K 7 .   ? 57.901 6.923   -0.135  1.00 29.64 ? 5058 HOH A O     1 
HETATM 6399 O  O     . HOH K 7 .   ? 62.499 6.019   5.236   1.00 25.31 ? 5059 HOH A O     1 
HETATM 6400 O  O     . HOH K 7 .   ? 78.168 16.576  -4.681  1.00 32.44 ? 5060 HOH A O     1 
HETATM 6401 O  O     . HOH K 7 .   ? 56.034 17.366  9.902   1.00 32.57 ? 5061 HOH A O     1 
HETATM 6402 O  O     . HOH K 7 .   ? 58.053 13.815  15.889  1.00 19.78 ? 5064 HOH A O     1 
HETATM 6403 O  O     . HOH K 7 .   ? 67.342 5.070   -2.525  1.00 34.66 ? 5066 HOH A O     1 
HETATM 6404 O  O     . HOH K 7 .   ? 57.145 38.074  -2.370  1.00 22.27 ? 5067 HOH A O     1 
HETATM 6405 O  O     . HOH K 7 .   ? 63.995 27.226  -25.620 1.00 23.51 ? 5070 HOH A O     1 
HETATM 6406 O  O     . HOH K 7 .   ? 85.369 12.746  -8.356  1.00 33.65 ? 5071 HOH A O     1 
HETATM 6407 O  O     . HOH K 7 .   ? 55.276 24.613  -0.960  1.00 24.67 ? 5072 HOH A O     1 
HETATM 6408 O  O     . HOH K 7 .   ? 79.651 14.090  19.625  1.00 29.33 ? 5073 HOH A O     1 
HETATM 6409 O  O     . HOH K 7 .   ? 62.175 17.821  7.245   1.00 21.80 ? 5074 HOH A O     1 
HETATM 6410 O  O     . HOH K 7 .   ? 35.751 69.990  1.095   1.00 35.91 ? 5076 HOH A O     1 
HETATM 6411 O  O     . HOH K 7 .   ? 64.868 24.004  17.062  1.00 34.82 ? 5077 HOH A O     1 
HETATM 6412 O  O     . HOH K 7 .   ? 94.756 16.401  -1.264  1.00 30.84 ? 5078 HOH A O     1 
HETATM 6413 O  O     . HOH K 7 .   ? 65.839 38.112  8.547   1.00 40.01 ? 5079 HOH A O     1 
HETATM 6414 O  O     . HOH K 7 .   ? 56.727 40.812  -17.414 1.00 28.25 ? 5080 HOH A O     1 
HETATM 6415 O  O     . HOH K 7 .   ? 54.585 74.229  36.776  1.00 42.41 ? 5081 HOH A O     1 
HETATM 6416 O  O     . HOH K 7 .   ? 57.683 57.855  -10.609 1.00 45.28 ? 5084 HOH A O     1 
HETATM 6417 O  O     . HOH K 7 .   ? 69.312 26.033  5.214   1.00 31.32 ? 5086 HOH A O     1 
HETATM 6418 O  O     . HOH K 7 .   ? 65.161 14.107  -4.310  1.00 26.49 ? 5087 HOH A O     1 
HETATM 6419 O  O     . HOH K 7 .   ? 69.240 26.551  12.016  1.00 26.80 ? 5088 HOH A O     1 
HETATM 6420 O  O     . HOH K 7 .   ? 70.294 26.987  -2.255  1.00 23.40 ? 5089 HOH A O     1 
HETATM 6421 O  O     . HOH K 7 .   ? 75.092 3.696   8.887   1.00 30.49 ? 5090 HOH A O     1 
HETATM 6422 O  O     . HOH K 7 .   ? 58.780 27.341  -3.968  1.00 30.77 ? 5091 HOH A O     1 
HETATM 6423 O  O     . HOH K 7 .   ? 44.021 9.039   -6.382  1.00 28.77 ? 5092 HOH A O     1 
HETATM 6424 O  O     . HOH K 7 .   ? 48.655 44.705  -13.354 1.00 41.92 ? 5095 HOH A O     1 
HETATM 6425 O  O     . HOH K 7 .   ? 77.247 25.028  11.744  1.00 29.12 ? 5096 HOH A O     1 
HETATM 6426 O  O     . HOH K 7 .   ? 65.430 22.312  12.865  1.00 30.85 ? 5097 HOH A O     1 
HETATM 6427 O  O     . HOH K 7 .   ? 61.215 29.706  4.891   1.00 31.25 ? 5098 HOH A O     1 
HETATM 6428 O  O     . HOH K 7 .   ? 65.007 5.938   -1.021  1.00 40.33 ? 5101 HOH A O     1 
HETATM 6429 O  O     . HOH K 7 .   ? 82.439 4.412   7.097   1.00 33.88 ? 5102 HOH A O     1 
HETATM 6430 O  O     . HOH K 7 .   ? 49.508 67.177  6.410   1.00 32.88 ? 5103 HOH A O     1 
HETATM 6431 O  O     . HOH K 7 .   ? 51.865 43.676  -2.343  1.00 30.21 ? 5104 HOH A O     1 
HETATM 6432 O  O     . HOH K 7 .   ? 64.790 24.351  -0.206  1.00 22.48 ? 5105 HOH A O     1 
HETATM 6433 O  O     . HOH K 7 .   ? 57.643 31.398  -23.425 1.00 25.84 ? 5109 HOH A O     1 
HETATM 6434 O  O     . HOH K 7 .   ? 57.223 3.620   7.128   1.00 27.59 ? 5112 HOH A O     1 
HETATM 6435 O  O     . HOH K 7 .   ? 45.025 6.813   -8.394  1.00 34.15 ? 5115 HOH A O     1 
HETATM 6436 O  O     . HOH K 7 .   ? 66.052 26.602  4.739   1.00 29.79 ? 5117 HOH A O     1 
HETATM 6437 O  O     . HOH K 7 .   ? 63.680 42.557  -17.810 1.00 37.01 ? 5118 HOH A O     1 
HETATM 6438 O  O     . HOH K 7 .   ? 68.473 30.572  -1.866  1.00 46.39 ? 5119 HOH A O     1 
HETATM 6439 O  O     . HOH K 7 .   ? 68.540 18.373  -23.653 1.00 50.17 ? 5120 HOH A O     1 
HETATM 6440 O  O     . HOH K 7 .   ? 91.505 24.356  -1.252  1.00 25.99 ? 5121 HOH A O     1 
HETATM 6441 O  O     . HOH K 7 .   ? 62.470 28.530  8.608   1.00 24.51 ? 5124 HOH A O     1 
HETATM 6442 O  O     . HOH K 7 .   ? 58.575 27.717  10.835  1.00 33.06 ? 5125 HOH A O     1 
HETATM 6443 O  O     . HOH K 7 .   ? 63.444 30.710  6.708   1.00 37.17 ? 5126 HOH A O     1 
HETATM 6444 O  O     . HOH K 7 .   ? 61.633 38.732  -20.821 1.00 41.29 ? 5127 HOH A O     1 
HETATM 6445 O  O     . HOH K 7 .   ? 53.545 66.484  31.993  1.00 32.10 ? 5129 HOH A O     1 
HETATM 6446 O  O     . HOH K 7 .   ? 70.700 14.511  -7.952  1.00 46.13 ? 5130 HOH A O     1 
HETATM 6447 O  O     . HOH K 7 .   ? 63.149 12.479  19.821  1.00 36.77 ? 5132 HOH A O     1 
HETATM 6448 O  O     . HOH K 7 .   ? 69.593 24.823  -22.404 1.00 32.55 ? 5133 HOH A O     1 
HETATM 6449 O  O     . HOH K 7 .   ? 93.968 18.768  -3.311  1.00 36.00 ? 5134 HOH A O     1 
HETATM 6450 O  O     . HOH K 7 .   ? 48.426 18.215  -15.150 1.00 26.93 ? 5135 HOH A O     1 
HETATM 6451 O  O     . HOH K 7 .   ? 56.846 15.638  12.105  1.00 25.83 ? 5138 HOH A O     1 
HETATM 6452 O  O     . HOH K 7 .   ? 64.635 21.373  15.594  1.00 34.24 ? 5139 HOH A O     1 
HETATM 6453 O  O     . HOH K 7 .   ? 46.530 23.067  12.145  1.00 42.20 ? 5141 HOH A O     1 
HETATM 6454 O  O     . HOH K 7 .   ? 86.828 14.293  -13.044 1.00 33.70 ? 5144 HOH A O     1 
HETATM 6455 O  O     . HOH K 7 .   ? 44.517 10.796  -15.250 1.00 46.52 ? 5145 HOH A O     1 
HETATM 6456 O  O     . HOH K 7 .   ? 45.115 43.466  -2.896  1.00 41.37 ? 5146 HOH A O     1 
HETATM 6457 O  O     . HOH K 7 .   ? 49.643 13.760  6.695   1.00 23.66 ? 5150 HOH A O     1 
HETATM 6458 O  O     . HOH K 7 .   ? 46.668 6.622   3.601   1.00 35.55 ? 5151 HOH A O     1 
HETATM 6459 O  O     . HOH K 7 .   ? 92.437 19.703  13.522  1.00 33.82 ? 5152 HOH A O     1 
HETATM 6460 O  O     . HOH K 7 .   ? 97.150 23.366  3.608   1.00 34.17 ? 5153 HOH A O     1 
HETATM 6461 O  O     . HOH K 7 .   ? 67.626 24.684  16.887  1.00 28.04 ? 5154 HOH A O     1 
HETATM 6462 O  O     . HOH K 7 .   ? 48.455 33.067  -11.677 1.00 52.46 ? 5155 HOH A O     1 
HETATM 6463 O  O     . HOH K 7 .   ? 50.571 49.525  2.956   1.00 29.30 ? 5157 HOH A O     1 
HETATM 6464 O  O     . HOH K 7 .   ? 54.716 30.687  -23.652 1.00 41.43 ? 5158 HOH A O     1 
HETATM 6465 O  O     . HOH K 7 .   ? 59.081 12.383  18.313  1.00 31.30 ? 5160 HOH A O     1 
HETATM 6466 O  O     . HOH K 7 .   ? 53.150 28.410  -24.578 1.00 35.42 ? 5161 HOH A O     1 
HETATM 6467 O  O     . HOH K 7 .   ? 47.529 34.602  -9.188  1.00 24.20 ? 5162 HOH A O     1 
HETATM 6468 O  O     . HOH K 7 .   ? 53.951 5.706   12.570  1.00 41.46 ? 5163 HOH A O     1 
HETATM 6469 O  O     . HOH K 7 .   ? 73.414 12.468  21.265  1.00 29.33 ? 5166 HOH A O     1 
HETATM 6470 O  O     . HOH K 7 .   ? 32.006 62.083  -1.615  1.00 33.29 ? 5167 HOH A O     1 
HETATM 6471 O  O     . HOH K 7 .   ? 48.331 26.376  -11.360 1.00 37.49 ? 5168 HOH A O     1 
HETATM 6472 O  O     . HOH K 7 .   ? 44.146 26.747  -7.505  1.00 45.03 ? 5173 HOH A O     1 
HETATM 6473 O  O     . HOH K 7 .   ? 71.171 27.587  -12.187 1.00 39.66 ? 5174 HOH A O     1 
HETATM 6474 O  O     . HOH K 7 .   ? 46.823 13.605  7.575   1.00 27.81 ? 5178 HOH A O     1 
HETATM 6475 O  O     . HOH K 7 .   ? 39.482 8.633   9.125   1.00 34.23 ? 5179 HOH A O     1 
HETATM 6476 O  O     . HOH K 7 .   ? 67.487 20.572  23.158  1.00 37.21 ? 5181 HOH A O     1 
HETATM 6477 O  O     . HOH K 7 .   ? 67.656 2.868   16.786  1.00 37.98 ? 5183 HOH A O     1 
HETATM 6478 O  O     . HOH K 7 .   ? 88.739 33.682  -4.489  1.00 47.80 ? 5184 HOH A O     1 
HETATM 6479 O  O     . HOH K 7 .   ? 55.663 30.034  3.194   1.00 47.40 ? 5186 HOH A O     1 
HETATM 6480 O  O     . HOH K 7 .   ? 37.836 17.197  16.146  1.00 47.81 ? 5187 HOH A O     1 
HETATM 6481 O  O     . HOH K 7 .   ? 72.132 27.170  3.213   1.00 43.00 ? 5188 HOH A O     1 
HETATM 6482 O  O     . HOH K 7 .   ? 58.138 38.227  0.410   1.00 31.07 ? 5190 HOH A O     1 
HETATM 6483 O  O     . HOH K 7 .   ? 75.711 -4.783  10.779  1.00 32.15 ? 5195 HOH A O     1 
HETATM 6484 O  O     . HOH K 7 .   ? 63.481 19.937  5.640   1.00 18.87 ? 5196 HOH A O     1 
HETATM 6485 O  O     . HOH K 7 .   ? 33.678 9.926   1.256   1.00 20.19 ? 5198 HOH A O     1 
HETATM 6486 O  O     . HOH K 7 .   ? 72.291 23.282  -9.941  1.00 33.46 ? 5199 HOH A O     1 
HETATM 6487 O  O     . HOH K 7 .   ? 66.888 21.500  3.445   1.00 32.62 ? 5201 HOH A O     1 
HETATM 6488 O  O     . HOH K 7 .   ? 58.414 25.135  -28.758 1.00 38.53 ? 5204 HOH A O     1 
HETATM 6489 O  O     . HOH K 7 .   ? 72.766 26.946  0.132   1.00 25.52 ? 5206 HOH A O     1 
HETATM 6490 O  O     . HOH K 7 .   ? 67.994 23.130  14.308  1.00 30.43 ? 5207 HOH A O     1 
HETATM 6491 O  O     . HOH K 7 .   ? 63.460 28.798  -7.585  1.00 21.07 ? 5208 HOH A O     1 
HETATM 6492 O  O     . HOH K 7 .   ? 55.081 42.417  -15.503 1.00 30.57 ? 5211 HOH A O     1 
HETATM 6493 O  O     . HOH K 7 .   ? 60.800 29.504  -3.863  1.00 31.28 ? 5212 HOH A O     1 
HETATM 6494 O  O     . HOH K 7 .   ? 43.992 49.138  1.309   1.00 32.90 ? 5216 HOH A O     1 
HETATM 6495 O  O     . HOH K 7 .   ? 44.746 7.426   5.870   1.00 31.15 ? 5220 HOH A O     1 
HETATM 6496 O  O     . HOH K 7 .   ? 35.716 5.824   -1.279  1.00 36.54 ? 5221 HOH A O     1 
HETATM 6497 O  O     . HOH K 7 .   ? 65.267 49.515  -5.055  1.00 42.98 ? 5222 HOH A O     1 
HETATM 6498 O  O     . HOH K 7 .   ? 72.013 17.541  -7.536  1.00 28.01 ? 5224 HOH A O     1 
HETATM 6499 O  O     . HOH K 7 .   ? 45.098 19.821  -17.199 1.00 25.12 ? 5226 HOH A O     1 
HETATM 6500 O  O     . HOH K 7 .   ? 60.267 27.068  18.538  1.00 31.80 ? 5227 HOH A O     1 
HETATM 6501 O  O     . HOH K 7 .   ? 71.403 30.549  -12.819 1.00 38.20 ? 5228 HOH A O     1 
HETATM 6502 O  O     . HOH K 7 .   ? 88.309 7.433   -3.217  1.00 32.39 ? 5230 HOH A O     1 
HETATM 6503 O  O     . HOH K 7 .   ? 93.562 15.016  11.034  1.00 36.20 ? 5232 HOH A O     1 
HETATM 6504 O  O     . HOH K 7 .   ? 43.946 5.034   -6.151  1.00 35.17 ? 5234 HOH A O     1 
HETATM 6505 O  O     . HOH K 7 .   ? 69.655 21.756  -22.771 1.00 52.20 ? 5235 HOH A O     1 
HETATM 6506 O  O     . HOH K 7 .   ? 38.343 18.734  -6.893  1.00 40.02 ? 5236 HOH A O     1 
HETATM 6507 O  O     . HOH K 7 .   ? 70.302 19.037  -4.720  1.00 24.05 ? 5237 HOH A O     1 
HETATM 6508 O  O     . HOH K 7 .   ? 62.538 13.743  -7.028  1.00 28.83 ? 5238 HOH A O     1 
HETATM 6509 O  O     . HOH K 7 .   ? 65.703 15.071  -7.122  1.00 34.80 ? 5243 HOH A O     1 
HETATM 6510 O  O     . HOH K 7 .   ? 33.867 6.635   -3.888  1.00 47.25 ? 5244 HOH A O     1 
HETATM 6511 O  O     . HOH K 7 .   ? 52.116 51.484  4.758   1.00 47.71 ? 5245 HOH A O     1 
HETATM 6512 O  O     . HOH K 7 .   ? 69.464 21.351  26.087  1.00 45.94 ? 5247 HOH A O     1 
HETATM 6513 O  O     . HOH K 7 .   ? 60.068 22.083  11.217  1.00 36.16 ? 5248 HOH A O     1 
HETATM 6514 O  O     . HOH K 7 .   ? 74.491 29.381  0.751   1.00 32.08 ? 5251 HOH A O     1 
HETATM 6515 O  O     . HOH K 7 .   ? 67.584 33.613  -30.429 1.00 35.64 ? 5254 HOH A O     1 
HETATM 6516 O  O     . HOH K 7 .   ? 54.283 44.642  1.476   1.00 32.24 ? 5255 HOH A O     1 
HETATM 6517 O  O     . HOH K 7 .   ? 37.778 59.300  -3.885  1.00 34.41 ? 5256 HOH A O     1 
HETATM 6518 O  O     . HOH K 7 .   ? 62.219 -4.507  12.810  1.00 45.29 ? 5257 HOH A O     1 
HETATM 6519 O  O     . HOH K 7 .   ? 69.295 46.700  -2.329  1.00 38.52 ? 5258 HOH A O     1 
HETATM 6520 O  O     . HOH K 7 .   ? 53.672 64.033  -3.300  1.00 44.55 ? 5259 HOH A O     1 
HETATM 6521 O  O     . HOH K 7 .   ? 72.630 25.407  -22.051 1.00 38.53 ? 5260 HOH A O     1 
HETATM 6522 O  O     . HOH K 7 .   ? 54.146 23.862  17.149  1.00 44.52 ? 5262 HOH A O     1 
HETATM 6523 O  O     . HOH K 7 .   ? 48.061 21.478  2.671   1.00 33.94 ? 5264 HOH A O     1 
HETATM 6524 O  O     . HOH K 7 .   ? 53.520 2.558   -4.390  1.00 40.43 ? 5265 HOH A O     1 
HETATM 6525 O  O     . HOH K 7 .   ? 86.302 7.079   3.418   1.00 28.59 ? 5266 HOH A O     1 
HETATM 6526 O  O     . HOH K 7 .   ? 33.053 59.190  -2.056  1.00 39.63 ? 5269 HOH A O     1 
HETATM 6527 O  O     . HOH K 7 .   ? 34.804 56.034  0.743   1.00 45.20 ? 5270 HOH A O     1 
HETATM 6528 O  O     . HOH K 7 .   ? 54.693 64.533  26.393  1.00 44.38 ? 5272 HOH A O     1 
HETATM 6529 O  O     . HOH K 7 .   ? 93.311 10.338  -1.429  1.00 35.22 ? 5273 HOH A O     1 
HETATM 6530 O  O     . HOH K 7 .   ? 55.396 6.790   19.065  1.00 56.85 ? 5275 HOH A O     1 
HETATM 6531 O  O     . HOH K 7 .   ? 91.521 10.523  3.962   1.00 45.50 ? 5276 HOH A O     1 
HETATM 6532 O  O     . HOH K 7 .   ? 72.166 18.376  -2.289  1.00 29.30 ? 5277 HOH A O     1 
HETATM 6533 O  O     . HOH K 7 .   ? 29.617 62.104  2.002   1.00 38.58 ? 5279 HOH A O     1 
HETATM 6534 O  O     . HOH K 7 .   ? 77.610 26.891  9.144   1.00 42.23 ? 5280 HOH A O     1 
HETATM 6535 O  O     . HOH K 7 .   ? 76.122 28.593  11.305  1.00 40.52 ? 5281 HOH A O     1 
HETATM 6536 O  O     . HOH K 7 .   ? 68.198 36.874  3.213   1.00 46.33 ? 5282 HOH A O     1 
HETATM 6537 O  O     . HOH K 7 .   ? 82.373 4.743   16.279  1.00 39.23 ? 5284 HOH A O     1 
HETATM 6538 O  O     . HOH K 7 .   ? 62.055 7.153   21.207  1.00 42.90 ? 5287 HOH A O     1 
HETATM 6539 O  O     . HOH K 7 .   ? 45.337 28.310  -4.972  1.00 54.75 ? 5288 HOH A O     1 
HETATM 6540 O  O     . HOH K 7 .   ? 80.402 24.687  8.925   1.00 28.00 ? 5289 HOH A O     1 
HETATM 6541 O  O     . HOH K 7 .   ? 77.543 23.020  9.690   1.00 25.01 ? 5290 HOH A O     1 
HETATM 6542 O  O     . HOH K 7 .   ? 76.902 22.375  6.845   1.00 24.84 ? 5291 HOH A O     1 
HETATM 6543 O  O     . HOH L 7 .   ? 40.155 89.446  13.330  1.00 35.99 ? 5005 HOH B O     1 
HETATM 6544 O  O     . HOH L 7 .   ? 49.704 77.507  12.765  1.00 27.95 ? 5062 HOH B O     1 
HETATM 6545 O  O     . HOH L 7 .   ? 48.575 81.007  5.792   1.00 41.81 ? 5068 HOH B O     1 
HETATM 6546 O  O     . HOH L 7 .   ? 46.319 85.313  6.317   1.00 33.55 ? 5083 HOH B O     1 
HETATM 6547 O  O     . HOH L 7 .   ? 43.110 81.234  16.791  1.00 31.38 ? 5093 HOH B O     1 
HETATM 6548 O  O     . HOH L 7 .   ? 49.996 83.625  7.053   1.00 53.40 ? 5114 HOH B O     1 
HETATM 6549 O  O     . HOH L 7 .   ? 47.787 80.980  25.772  1.00 34.05 ? 5128 HOH B O     1 
HETATM 6550 O  O     . HOH L 7 .   ? 41.374 79.627  2.101   1.00 46.19 ? 5169 HOH B O     1 
HETATM 6551 O  O     . HOH L 7 .   ? 44.021 73.535  20.460  1.00 40.74 ? 5185 HOH B O     1 
HETATM 6552 O  O     . HOH L 7 .   ? 45.780 95.919  23.971  1.00 38.54 ? 5189 HOH B O     1 
HETATM 6553 O  O     . HOH L 7 .   ? 41.311 80.514  8.603   1.00 30.12 ? 5192 HOH B O     1 
HETATM 6554 O  O     . HOH L 7 .   ? 42.741 82.058  19.762  1.00 27.98 ? 5197 HOH B O     1 
HETATM 6555 O  O     . HOH L 7 .   ? 45.094 88.106  5.174   1.00 27.92 ? 5229 HOH B O     1 
HETATM 6556 O  O     . HOH L 7 .   ? 59.013 78.581  18.949  1.00 41.54 ? 5253 HOH B O     1 
HETATM 6557 O  O     . HOH L 7 .   ? 49.691 79.162  2.929   1.00 44.50 ? 5271 HOH B O     1 
HETATM 6558 O  O     . HOH L 7 .   ? 48.978 71.908  16.139  1.00 38.26 ? 5285 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   1   ?   ?   ?   P . n 
A 1 2   DG  2   2   ?   ?   ?   P . n 
A 1 3   DA  3   3   ?   ?   ?   P . n 
A 1 4   DA  4   4   ?   ?   ?   P . n 
A 1 5   DA  5   5   ?   ?   ?   P . n 
A 1 6   DA  6   6   ?   ?   ?   P . n 
A 1 7   DC  7   7   ?   ?   ?   P . n 
A 1 8   DG  8   8   ?   ?   ?   P . n 
A 1 9   DA  9   9   ?   ?   ?   P . n 
A 1 10  DC  10  10  ?   ?   ?   P . n 
A 1 11  DG  11  11  ?   ?   ?   P . n 
A 1 12  DG  12  12  ?   ?   ?   P . n 
A 1 13  DC  13  13  ?   ?   ?   P . n 
A 1 14  DC  14  14  14  DC  CYT P . n 
A 1 15  DA  15  15  15  DA  ADE P . n 
A 1 16  DG  16  16  16  DG  GUA P . n 
A 1 17  DT  17  17  17  DT  THY P . n 
A 1 18  DG  18  18  18  DG  GUA P . n 
A 1 19  DC  19  19  19  DC  CYT P . n 
A 1 20  DC  20  20  20  DC  CYT P . n 
A 1 21  DT  21  21  21  DT  THY P . n 
A 1 22  2DA 22  22  22  2DA 2DA P . n 
B 2 1   DC  1   2   ?   ?   ?   T . n 
B 2 2   DC  2   3   ?   ?   ?   T . n 
B 2 3   DC  3   4   ?   ?   ?   T . n 
B 2 4   TTD 4   5   5   TTD TTD T . n 
B 2 5   DA  5   6   6   DA  ADE T . n 
B 2 6   DG  6   7   7   DG  GUA T . n 
B 2 7   DG  7   8   8   DG  GUA T . n 
B 2 8   DC  8   9   9   DC  CYT T . n 
B 2 9   DA  9   10  10  DA  ADE T . n 
B 2 10  DC  10  11  11  DC  CYT T . n 
B 2 11  DT  11  12  12  DT  THY T . n 
B 2 12  DG  12  13  13  DG  GUA T . n 
B 2 13  DG  13  14  14  DG  GUA T . n 
B 2 14  DC  14  15  ?   ?   ?   T . n 
B 2 15  DC  15  16  ?   ?   ?   T . n 
B 2 16  DG  16  17  ?   ?   ?   T . n 
B 2 17  DT  17  18  ?   ?   ?   T . n 
B 2 18  DC  18  19  ?   ?   ?   T . n 
B 2 19  DG  19  20  ?   ?   ?   T . n 
B 2 20  DT  20  21  ?   ?   ?   T . n 
B 2 21  DT  21  22  ?   ?   ?   T . n 
B 2 22  DT  22  23  ?   ?   ?   T . n 
B 2 23  DT  23  24  ?   ?   ?   T . n 
B 2 24  DC  24  25  ?   ?   ?   T . n 
B 2 25  DG  25  26  ?   ?   ?   T . n 
C 3 1   MET 1   1   1   MET MET A . n 
C 3 2   ILE 2   2   2   ILE ILE A . n 
C 3 3   VAL 3   3   3   VAL VAL A . n 
C 3 4   SER 4   4   4   SER SER A . n 
C 3 5   ASP 5   5   5   ASP ASP A . n 
C 3 6   ILE 6   6   6   ILE ILE A . n 
C 3 7   GLU 7   7   7   GLU GLU A . n 
C 3 8   ALA 8   8   8   ALA ALA A . n 
C 3 9   ASN 9   9   9   ASN ASN A . n 
C 3 10  ALA 10  10  10  ALA ALA A . n 
C 3 11  LEU 11  11  11  LEU LEU A . n 
C 3 12  LEU 12  12  12  LEU LEU A . n 
C 3 13  GLU 13  13  13  GLU GLU A . n 
C 3 14  SER 14  14  14  SER SER A . n 
C 3 15  VAL 15  15  15  VAL VAL A . n 
C 3 16  THR 16  16  16  THR THR A . n 
C 3 17  LYS 17  17  17  LYS LYS A . n 
C 3 18  PHE 18  18  18  PHE PHE A . n 
C 3 19  HIS 19  19  19  HIS HIS A . n 
C 3 20  CYS 20  20  20  CYS CYS A . n 
C 3 21  GLY 21  21  21  GLY GLY A . n 
C 3 22  VAL 22  22  22  VAL VAL A . n 
C 3 23  ILE 23  23  23  ILE ILE A . n 
C 3 24  TYR 24  24  24  TYR TYR A . n 
C 3 25  ASP 25  25  25  ASP ASP A . n 
C 3 26  TYR 26  26  26  TYR TYR A . n 
C 3 27  SER 27  27  27  SER SER A . n 
C 3 28  THR 28  28  28  THR THR A . n 
C 3 29  ALA 29  29  29  ALA ALA A . n 
C 3 30  GLU 30  30  30  GLU GLU A . n 
C 3 31  TYR 31  31  31  TYR TYR A . n 
C 3 32  VAL 32  32  32  VAL VAL A . n 
C 3 33  SER 33  33  33  SER SER A . n 
C 3 34  TYR 34  34  34  TYR TYR A . n 
C 3 35  ARG 35  35  35  ARG ARG A . n 
C 3 36  PRO 36  36  36  PRO PRO A . n 
C 3 37  SER 37  37  37  SER SER A . n 
C 3 38  ASP 38  38  38  ASP ASP A . n 
C 3 39  PHE 39  39  39  PHE PHE A . n 
C 3 40  GLY 40  40  40  GLY GLY A . n 
C 3 41  ALA 41  41  41  ALA ALA A . n 
C 3 42  TYR 42  42  42  TYR TYR A . n 
C 3 43  LEU 43  43  43  LEU LEU A . n 
C 3 44  ASP 44  44  44  ASP ASP A . n 
C 3 45  ALA 45  45  45  ALA ALA A . n 
C 3 46  LEU 46  46  46  LEU LEU A . n 
C 3 47  GLU 47  47  47  GLU GLU A . n 
C 3 48  ALA 48  48  48  ALA ALA A . n 
C 3 49  GLU 49  49  49  GLU GLU A . n 
C 3 50  VAL 50  50  50  VAL VAL A . n 
C 3 51  ALA 51  51  51  ALA ALA A . n 
C 3 52  ARG 52  52  52  ARG ARG A . n 
C 3 53  GLY 53  53  53  GLY GLY A . n 
C 3 54  GLY 54  54  54  GLY GLY A . n 
C 3 55  LEU 55  55  55  LEU LEU A . n 
C 3 56  ILE 56  56  56  ILE ILE A . n 
C 3 57  VAL 57  57  57  VAL VAL A . n 
C 3 58  PHE 58  58  58  PHE PHE A . n 
C 3 59  HIS 59  59  59  HIS HIS A . n 
C 3 60  ASN 60  60  60  ASN ASN A . n 
C 3 61  GLY 61  61  61  GLY GLY A . n 
C 3 62  HIS 62  62  62  HIS HIS A . n 
C 3 63  LYS 63  63  63  LYS LYS A . n 
C 3 64  TYR 64  64  64  TYR TYR A . n 
C 3 65  ASP 65  65  65  ASP ASP A . n 
C 3 66  VAL 66  66  66  VAL VAL A . n 
C 3 67  PRO 67  67  67  PRO PRO A . n 
C 3 68  ALA 68  68  68  ALA ALA A . n 
C 3 69  LEU 69  69  69  LEU LEU A . n 
C 3 70  THR 70  70  70  THR THR A . n 
C 3 71  LYS 71  71  71  LYS LYS A . n 
C 3 72  LEU 72  72  72  LEU LEU A . n 
C 3 73  ALA 73  73  73  ALA ALA A . n 
C 3 74  LYS 74  74  74  LYS LYS A . n 
C 3 75  LEU 75  75  75  LEU LEU A . n 
C 3 76  GLN 76  76  76  GLN GLN A . n 
C 3 77  LEU 77  77  77  LEU LEU A . n 
C 3 78  ASN 78  78  78  ASN ASN A . n 
C 3 79  ARG 79  79  79  ARG ARG A . n 
C 3 80  GLU 80  80  80  GLU GLU A . n 
C 3 81  PHE 81  81  81  PHE PHE A . n 
C 3 82  HIS 82  82  82  HIS HIS A . n 
C 3 83  LEU 83  83  83  LEU LEU A . n 
C 3 84  PRO 84  84  84  PRO PRO A . n 
C 3 85  ARG 85  85  85  ARG ARG A . n 
C 3 86  GLU 86  86  86  GLU GLU A . n 
C 3 87  ASN 87  87  87  ASN ASN A . n 
C 3 88  CYS 88  88  88  CYS CYS A . n 
C 3 89  ILE 89  89  89  ILE ILE A . n 
C 3 90  ASP 90  90  90  ASP ASP A . n 
C 3 91  THR 91  91  91  THR THR A . n 
C 3 92  LEU 92  92  92  LEU LEU A . n 
C 3 93  VAL 93  93  93  VAL VAL A . n 
C 3 94  LEU 94  94  94  LEU LEU A . n 
C 3 95  SER 95  95  95  SER SER A . n 
C 3 96  ARG 96  96  96  ARG ARG A . n 
C 3 97  LEU 97  97  97  LEU LEU A . n 
C 3 98  ILE 98  98  98  ILE ILE A . n 
C 3 99  HIS 99  99  99  HIS HIS A . n 
C 3 100 SER 100 100 100 SER SER A . n 
C 3 101 ASN 101 101 101 ASN ASN A . n 
C 3 102 LEU 102 102 102 LEU LEU A . n 
C 3 103 LYS 103 103 103 LYS LYS A . n 
C 3 104 ASP 104 104 104 ASP ASP A . n 
C 3 105 THR 105 105 105 THR THR A . n 
C 3 106 ASP 106 106 106 ASP ASP A . n 
C 3 107 MET 107 107 107 MET MET A . n 
C 3 108 GLY 108 108 108 GLY GLY A . n 
C 3 109 LEU 109 109 109 LEU LEU A . n 
C 3 110 LEU 110 110 110 LEU LEU A . n 
C 3 111 ARG 111 111 111 ARG ARG A . n 
C 3 112 SER 112 112 112 SER SER A . n 
C 3 113 GLY 113 113 113 GLY GLY A . n 
C 3 114 LYS 114 114 114 LYS LYS A . n 
C 3 115 LEU 115 115 115 LEU LEU A . n 
C 3 116 PRO 116 116 116 PRO PRO A . n 
C 3 117 GLY 117 117 117 GLY GLY A . n 
C 3 118 ALA 118 124 124 ALA ALA A . n 
C 3 119 LEU 119 125 125 LEU LEU A . n 
C 3 120 GLU 120 126 126 GLU GLU A . n 
C 3 121 ALA 121 127 127 ALA ALA A . n 
C 3 122 TRP 122 128 128 TRP TRP A . n 
C 3 123 GLY 123 129 129 GLY GLY A . n 
C 3 124 TYR 124 130 130 TYR TYR A . n 
C 3 125 ARG 125 131 131 ARG ARG A . n 
C 3 126 LEU 126 132 132 LEU LEU A . n 
C 3 127 GLY 127 133 133 GLY GLY A . n 
C 3 128 GLU 128 134 134 GLU GLU A . n 
C 3 129 MET 129 135 135 MET MET A . n 
C 3 130 LYS 130 136 136 LYS LYS A . n 
C 3 131 GLY 131 137 137 GLY GLY A . n 
C 3 132 GLU 132 138 138 GLU GLU A . n 
C 3 133 TYR 133 139 139 TYR TYR A . n 
C 3 134 LYS 134 140 140 LYS LYS A . n 
C 3 135 ASP 135 141 141 ASP ASP A . n 
C 3 136 ASP 136 142 142 ASP ASP A . n 
C 3 137 PHE 137 143 143 PHE PHE A . n 
C 3 138 LYS 138 144 144 LYS LYS A . n 
C 3 139 ARG 139 145 145 ARG ARG A . n 
C 3 140 MET 140 146 146 MET MET A . n 
C 3 141 LEU 141 147 147 LEU LEU A . n 
C 3 142 GLU 142 148 148 GLU GLU A . n 
C 3 143 GLU 143 149 149 GLU GLU A . n 
C 3 144 GLN 144 150 150 GLN GLN A . n 
C 3 145 GLY 145 151 151 GLY GLY A . n 
C 3 146 GLU 146 152 152 GLU GLU A . n 
C 3 147 GLU 147 153 153 GLU GLU A . n 
C 3 148 TYR 148 154 154 TYR TYR A . n 
C 3 149 VAL 149 155 155 VAL VAL A . n 
C 3 150 ASP 150 156 156 ASP ASP A . n 
C 3 151 GLY 151 157 157 GLY GLY A . n 
C 3 152 MET 152 158 158 MET MET A . n 
C 3 153 GLU 153 159 159 GLU GLU A . n 
C 3 154 TRP 154 160 160 TRP TRP A . n 
C 3 155 TRP 155 161 161 TRP TRP A . n 
C 3 156 ASN 156 162 162 ASN ASN A . n 
C 3 157 PHE 157 163 163 PHE PHE A . n 
C 3 158 ASN 158 164 164 ASN ASN A . n 
C 3 159 GLU 159 165 165 GLU GLU A . n 
C 3 160 GLU 160 166 166 GLU GLU A . n 
C 3 161 MET 161 167 167 MET MET A . n 
C 3 162 MET 162 168 168 MET MET A . n 
C 3 163 ASP 163 169 169 ASP ASP A . n 
C 3 164 TYR 164 170 170 TYR TYR A . n 
C 3 165 ASN 165 171 171 ASN ASN A . n 
C 3 166 VAL 166 172 172 VAL VAL A . n 
C 3 167 GLN 167 173 173 GLN GLN A . n 
C 3 168 ASP 168 174 174 ASP ASP A . n 
C 3 169 VAL 169 175 175 VAL VAL A . n 
C 3 170 VAL 170 176 176 VAL VAL A . n 
C 3 171 VAL 171 177 177 VAL VAL A . n 
C 3 172 THR 172 178 178 THR THR A . n 
C 3 173 LYS 173 179 179 LYS LYS A . n 
C 3 174 ALA 174 180 180 ALA ALA A . n 
C 3 175 LEU 175 181 181 LEU LEU A . n 
C 3 176 LEU 176 182 182 LEU LEU A . n 
C 3 177 GLU 177 183 183 GLU GLU A . n 
C 3 178 LYS 178 184 184 LYS LYS A . n 
C 3 179 LEU 179 185 185 LEU LEU A . n 
C 3 180 LEU 180 186 186 LEU LEU A . n 
C 3 181 SER 181 187 187 SER SER A . n 
C 3 182 ASP 182 188 188 ASP ASP A . n 
C 3 183 LYS 183 189 189 LYS LYS A . n 
C 3 184 HIS 184 190 190 HIS HIS A . n 
C 3 185 TYR 185 191 191 TYR TYR A . n 
C 3 186 PHE 186 192 192 PHE PHE A . n 
C 3 187 PRO 187 193 193 PRO PRO A . n 
C 3 188 PRO 188 194 194 PRO PRO A . n 
C 3 189 GLU 189 195 195 GLU GLU A . n 
C 3 190 ILE 190 196 196 ILE ILE A . n 
C 3 191 ASP 191 197 197 ASP ASP A . n 
C 3 192 PHE 192 198 198 PHE PHE A . n 
C 3 193 THR 193 199 199 THR THR A . n 
C 3 194 ASP 194 200 200 ASP ASP A . n 
C 3 195 VAL 195 201 201 VAL VAL A . n 
C 3 196 GLY 196 202 202 GLY GLY A . n 
C 3 197 TYR 197 203 203 TYR TYR A . n 
C 3 198 THR 198 204 204 THR THR A . n 
C 3 199 THR 199 205 205 THR THR A . n 
C 3 200 PHE 200 206 206 PHE PHE A . n 
C 3 201 TRP 201 207 207 TRP TRP A . n 
C 3 202 SER 202 208 208 SER SER A . n 
C 3 203 GLU 203 209 209 GLU GLU A . n 
C 3 204 SER 204 210 210 SER SER A . n 
C 3 205 LEU 205 211 211 LEU LEU A . n 
C 3 206 GLU 206 212 212 GLU GLU A . n 
C 3 207 ALA 207 213 213 ALA ALA A . n 
C 3 208 VAL 208 214 214 VAL VAL A . n 
C 3 209 ASP 209 215 215 ASP ASP A . n 
C 3 210 ILE 210 216 216 ILE ILE A . n 
C 3 211 GLU 211 217 217 GLU GLU A . n 
C 3 212 HIS 212 218 218 HIS HIS A . n 
C 3 213 ARG 213 219 219 ARG ARG A . n 
C 3 214 ALA 214 220 220 ALA ALA A . n 
C 3 215 ALA 215 221 221 ALA ALA A . n 
C 3 216 TRP 216 222 222 TRP TRP A . n 
C 3 217 LEU 217 223 223 LEU LEU A . n 
C 3 218 LEU 218 224 224 LEU LEU A . n 
C 3 219 ALA 219 225 225 ALA ALA A . n 
C 3 220 LYS 220 226 226 LYS LYS A . n 
C 3 221 GLN 221 227 227 GLN GLN A . n 
C 3 222 GLU 222 228 228 GLU GLU A . n 
C 3 223 ARG 223 229 229 ARG ARG A . n 
C 3 224 ASN 224 230 230 ASN ASN A . n 
C 3 225 GLY 225 231 231 GLY GLY A . n 
C 3 226 PHE 226 232 232 PHE PHE A . n 
C 3 227 PRO 227 233 233 PRO PRO A . n 
C 3 228 PHE 228 234 234 PHE PHE A . n 
C 3 229 ASP 229 235 235 ASP ASP A . n 
C 3 230 THR 230 236 236 THR THR A . n 
C 3 231 LYS 231 237 237 LYS LYS A . n 
C 3 232 ALA 232 238 238 ALA ALA A . n 
C 3 233 ILE 233 239 239 ILE ILE A . n 
C 3 234 GLU 234 240 240 GLU GLU A . n 
C 3 235 GLU 235 241 241 GLU GLU A . n 
C 3 236 LEU 236 242 242 LEU LEU A . n 
C 3 237 TYR 237 243 243 TYR TYR A . n 
C 3 238 VAL 238 244 244 VAL VAL A . n 
C 3 239 GLU 239 245 245 GLU GLU A . n 
C 3 240 LEU 240 246 246 LEU LEU A . n 
C 3 241 ALA 241 247 247 ALA ALA A . n 
C 3 242 ALA 242 248 248 ALA ALA A . n 
C 3 243 ARG 243 249 249 ARG ARG A . n 
C 3 244 ARG 244 250 250 ARG ARG A . n 
C 3 245 SER 245 251 251 SER SER A . n 
C 3 246 GLU 246 252 252 GLU GLU A . n 
C 3 247 LEU 247 253 253 LEU LEU A . n 
C 3 248 LEU 248 254 254 LEU LEU A . n 
C 3 249 ARG 249 255 255 ARG ARG A . n 
C 3 250 LYS 250 256 256 LYS LYS A . n 
C 3 251 LEU 251 257 257 LEU LEU A . n 
C 3 252 THR 252 258 258 THR THR A . n 
C 3 253 GLU 253 259 259 GLU GLU A . n 
C 3 254 THR 254 260 260 THR THR A . n 
C 3 255 PHE 255 261 261 PHE PHE A . n 
C 3 256 GLY 256 262 262 GLY GLY A . n 
C 3 257 SER 257 263 263 SER SER A . n 
C 3 258 TRP 258 264 264 TRP TRP A . n 
C 3 259 TYR 259 265 265 TYR TYR A . n 
C 3 260 GLN 260 266 266 GLN GLN A . n 
C 3 261 PRO 261 267 267 PRO PRO A . n 
C 3 262 LYS 262 268 268 LYS LYS A . n 
C 3 263 GLY 263 269 269 GLY GLY A . n 
C 3 264 GLY 264 270 270 GLY GLY A . n 
C 3 265 THR 265 271 271 THR THR A . n 
C 3 266 GLU 266 272 272 GLU GLU A . n 
C 3 267 MET 267 273 273 MET MET A . n 
C 3 268 PHE 268 274 274 PHE PHE A . n 
C 3 269 CYS 269 275 275 CYS CYS A . n 
C 3 270 HIS 270 276 276 HIS HIS A . n 
C 3 271 PRO 271 277 277 PRO PRO A . n 
C 3 272 ARG 272 278 278 ARG ARG A . n 
C 3 273 THR 273 279 279 THR THR A . n 
C 3 274 GLY 274 280 280 GLY GLY A . n 
C 3 275 LYS 275 281 281 LYS LYS A . n 
C 3 276 PRO 276 282 282 PRO PRO A . n 
C 3 277 LEU 277 283 283 LEU LEU A . n 
C 3 278 PRO 278 284 284 PRO PRO A . n 
C 3 279 LYS 279 285 285 LYS LYS A . n 
C 3 280 TYR 280 286 286 TYR TYR A . n 
C 3 281 PRO 281 287 287 PRO PRO A . n 
C 3 282 ARG 282 288 288 ARG ARG A . n 
C 3 283 ILE 283 289 289 ILE ILE A . n 
C 3 284 LYS 284 290 290 LYS LYS A . n 
C 3 285 THR 285 291 291 THR THR A . n 
C 3 286 PRO 286 292 292 PRO PRO A . n 
C 3 287 LYS 287 293 293 LYS LYS A . n 
C 3 288 VAL 288 294 294 VAL VAL A . n 
C 3 289 GLY 289 295 295 GLY GLY A . n 
C 3 290 GLY 290 296 296 GLY GLY A . n 
C 3 291 ILE 291 297 297 ILE ILE A . n 
C 3 292 PHE 292 298 ?   ?   ?   A . n 
C 3 293 LYS 293 299 ?   ?   ?   A . n 
C 3 294 LYS 294 300 ?   ?   ?   A . n 
C 3 295 PRO 295 301 ?   ?   ?   A . n 
C 3 296 LYS 296 302 ?   ?   ?   A . n 
C 3 297 ASN 297 303 ?   ?   ?   A . n 
C 3 298 LYS 298 304 ?   ?   ?   A . n 
C 3 299 ALA 299 305 ?   ?   ?   A . n 
C 3 300 GLN 300 306 ?   ?   ?   A . n 
C 3 301 ARG 301 307 ?   ?   ?   A . n 
C 3 302 GLU 302 308 ?   ?   ?   A . n 
C 3 303 GLY 303 309 ?   ?   ?   A . n 
C 3 304 ARG 304 310 ?   ?   ?   A . n 
C 3 305 GLU 305 311 ?   ?   ?   A . n 
C 3 306 PRO 306 312 ?   ?   ?   A . n 
C 3 307 CYS 307 313 ?   ?   ?   A . n 
C 3 308 GLU 308 314 ?   ?   ?   A . n 
C 3 309 LEU 309 315 315 LEU LEU A . n 
C 3 310 ASP 310 316 316 ASP ASP A . n 
C 3 311 THR 311 317 317 THR THR A . n 
C 3 312 ARG 312 318 318 ARG ARG A . n 
C 3 313 GLU 313 319 319 GLU GLU A . n 
C 3 314 TYR 314 320 320 TYR TYR A . n 
C 3 315 VAL 315 321 321 VAL VAL A . n 
C 3 316 ALA 316 322 322 ALA ALA A . n 
C 3 317 GLY 317 323 323 GLY GLY A . n 
C 3 318 ALA 318 324 324 ALA ALA A . n 
C 3 319 PRO 319 325 325 PRO PRO A . n 
C 3 320 TYR 320 326 326 TYR TYR A . n 
C 3 321 THR 321 327 327 THR THR A . n 
C 3 322 PRO 322 328 328 PRO PRO A . n 
C 3 323 VAL 323 329 329 VAL VAL A . n 
C 3 324 GLU 324 330 330 GLU GLU A . n 
C 3 325 HIS 325 331 331 HIS HIS A . n 
C 3 326 VAL 326 332 332 VAL VAL A . n 
C 3 327 VAL 327 333 333 VAL VAL A . n 
C 3 328 PHE 328 334 334 PHE PHE A . n 
C 3 329 ASN 329 335 335 ASN ASN A . n 
C 3 330 PRO 330 336 336 PRO PRO A . n 
C 3 331 SER 331 337 337 SER SER A . n 
C 3 332 SER 332 338 338 SER SER A . n 
C 3 333 ARG 333 339 339 ARG ARG A . n 
C 3 334 ASP 334 340 340 ASP ASP A . n 
C 3 335 HIS 335 341 341 HIS HIS A . n 
C 3 336 ILE 336 342 342 ILE ILE A . n 
C 3 337 GLN 337 343 343 GLN GLN A . n 
C 3 338 LYS 338 344 344 LYS LYS A . n 
C 3 339 LYS 339 345 345 LYS LYS A . n 
C 3 340 LEU 340 346 346 LEU LEU A . n 
C 3 341 GLN 341 347 347 GLN GLN A . n 
C 3 342 GLU 342 348 348 GLU GLU A . n 
C 3 343 ALA 343 349 349 ALA ALA A . n 
C 3 344 GLY 344 350 350 GLY GLY A . n 
C 3 345 TRP 345 351 351 TRP TRP A . n 
C 3 346 VAL 346 352 352 VAL VAL A . n 
C 3 347 PRO 347 353 353 PRO PRO A . n 
C 3 348 THR 348 354 354 THR THR A . n 
C 3 349 LYS 349 355 355 LYS LYS A . n 
C 3 350 TYR 350 356 356 TYR TYR A . n 
C 3 351 THR 351 357 357 THR THR A . n 
C 3 352 ASP 352 358 358 ASP ASP A . n 
C 3 353 LYS 353 359 359 LYS LYS A . n 
C 3 354 GLY 354 360 360 GLY GLY A . n 
C 3 355 ALA 355 361 361 ALA ALA A . n 
C 3 356 PRO 356 362 362 PRO PRO A . n 
C 3 357 VAL 357 363 363 VAL VAL A . n 
C 3 358 VAL 358 364 364 VAL VAL A . n 
C 3 359 ASP 359 365 365 ASP ASP A . n 
C 3 360 ASP 360 366 366 ASP ASP A . n 
C 3 361 GLU 361 367 367 GLU GLU A . n 
C 3 362 VAL 362 368 368 VAL VAL A . n 
C 3 363 LEU 363 369 369 LEU LEU A . n 
C 3 364 GLU 364 370 370 GLU GLU A . n 
C 3 365 GLY 365 371 371 GLY GLY A . n 
C 3 366 VAL 366 372 372 VAL VAL A . n 
C 3 367 ARG 367 373 373 ARG ARG A . n 
C 3 368 VAL 368 374 374 VAL VAL A . n 
C 3 369 ASP 369 375 375 ASP ASP A . n 
C 3 370 ASP 370 376 376 ASP ASP A . n 
C 3 371 PRO 371 377 377 PRO PRO A . n 
C 3 372 GLU 372 378 378 GLU GLU A . n 
C 3 373 LYS 373 379 379 LYS LYS A . n 
C 3 374 GLN 374 380 380 GLN GLN A . n 
C 3 375 ALA 375 381 381 ALA ALA A . n 
C 3 376 ALA 376 382 382 ALA ALA A . n 
C 3 377 ILE 377 383 383 ILE ILE A . n 
C 3 378 ASP 378 384 384 ASP ASP A . n 
C 3 379 LEU 379 385 385 LEU LEU A . n 
C 3 380 ILE 380 386 386 ILE ILE A . n 
C 3 381 LYS 381 387 387 LYS LYS A . n 
C 3 382 GLU 382 388 388 GLU GLU A . n 
C 3 383 TYR 383 389 389 TYR TYR A . n 
C 3 384 LEU 384 390 390 LEU LEU A . n 
C 3 385 MET 385 391 391 MET MET A . n 
C 3 386 ILE 386 392 392 ILE ILE A . n 
C 3 387 GLN 387 393 393 GLN GLN A . n 
C 3 388 LYS 388 394 394 LYS LYS A . n 
C 3 389 ARG 389 395 395 ARG ARG A . n 
C 3 390 ILE 390 396 396 ILE ILE A . n 
C 3 391 GLY 391 397 397 GLY GLY A . n 
C 3 392 GLN 392 398 398 GLN GLN A . n 
C 3 393 SER 393 399 399 SER SER A . n 
C 3 394 ALA 394 400 400 ALA ALA A . n 
C 3 395 GLU 395 401 401 GLU GLU A . n 
C 3 396 GLY 396 402 402 GLY GLY A . n 
C 3 397 ASP 397 403 403 ASP ASP A . n 
C 3 398 LYS 398 404 404 LYS LYS A . n 
C 3 399 ALA 399 405 405 ALA ALA A . n 
C 3 400 TRP 400 406 406 TRP TRP A . n 
C 3 401 LEU 401 407 407 LEU LEU A . n 
C 3 402 ARG 402 408 408 ARG ARG A . n 
C 3 403 TYR 403 409 409 TYR TYR A . n 
C 3 404 VAL 404 410 410 VAL VAL A . n 
C 3 405 ALA 405 411 411 ALA ALA A . n 
C 3 406 GLU 406 412 412 GLU GLU A . n 
C 3 407 ASP 407 413 413 ASP ASP A . n 
C 3 408 GLY 408 414 414 GLY GLY A . n 
C 3 409 LYS 409 415 415 LYS LYS A . n 
C 3 410 ILE 410 416 416 ILE ILE A . n 
C 3 411 HIS 411 417 417 HIS HIS A . n 
C 3 412 GLY 412 418 418 GLY GLY A . n 
C 3 413 SER 413 419 419 SER SER A . n 
C 3 414 VAL 414 420 420 VAL VAL A . n 
C 3 415 ASN 415 421 421 ASN ASN A . n 
C 3 416 PRO 416 422 422 PRO PRO A . n 
C 3 417 ASN 417 423 423 ASN ASN A . n 
C 3 418 GLY 418 424 424 GLY GLY A . n 
C 3 419 ALA 419 425 425 ALA ALA A . n 
C 3 420 VAL 420 426 426 VAL VAL A . n 
C 3 421 THR 421 427 427 THR THR A . n 
C 3 422 GLY 422 428 428 GLY GLY A . n 
C 3 423 ARG 423 429 429 ARG ARG A . n 
C 3 424 ALA 424 430 430 ALA ALA A . n 
C 3 425 THR 425 431 431 THR THR A . n 
C 3 426 HIS 426 432 432 HIS HIS A . n 
C 3 427 ALA 427 433 433 ALA ALA A . n 
C 3 428 PHE 428 434 434 PHE PHE A . n 
C 3 429 PRO 429 435 435 PRO PRO A . n 
C 3 430 ASN 430 436 436 ASN ASN A . n 
C 3 431 LEU 431 437 437 LEU LEU A . n 
C 3 432 ALA 432 438 438 ALA ALA A . n 
C 3 433 GLN 433 439 439 GLN GLN A . n 
C 3 434 ILE 434 440 440 ILE ILE A . n 
C 3 435 PRO 435 441 441 PRO PRO A . n 
C 3 436 GLY 436 442 442 GLY GLY A . n 
C 3 437 VAL 437 443 443 VAL VAL A . n 
C 3 438 ARG 438 444 444 ARG ARG A . n 
C 3 439 SER 439 445 445 SER SER A . n 
C 3 440 PRO 440 446 446 PRO PRO A . n 
C 3 441 TYR 441 447 447 TYR TYR A . n 
C 3 442 GLY 442 448 448 GLY GLY A . n 
C 3 443 GLU 443 449 449 GLU GLU A . n 
C 3 444 GLN 444 450 450 GLN GLN A . n 
C 3 445 CYS 445 451 451 CYS CYS A . n 
C 3 446 ARG 446 452 452 ARG ARG A . n 
C 3 447 ALA 447 453 453 ALA ALA A . n 
C 3 448 ALA 448 454 454 ALA ALA A . n 
C 3 449 PHE 449 455 455 PHE PHE A . n 
C 3 450 GLY 450 456 456 GLY GLY A . n 
C 3 451 ALA 451 457 457 ALA ALA A . n 
C 3 452 GLU 452 458 458 GLU GLU A . n 
C 3 453 HIS 453 459 459 HIS HIS A . n 
C 3 454 HIS 454 460 460 HIS HIS A . n 
C 3 455 LEU 455 461 461 LEU LEU A . n 
C 3 456 ASP 456 462 462 ASP ASP A . n 
C 3 457 GLY 457 463 463 GLY GLY A . n 
C 3 458 ILE 458 464 464 ILE ILE A . n 
C 3 459 THR 459 465 465 THR THR A . n 
C 3 460 GLY 460 466 466 GLY GLY A . n 
C 3 461 LYS 461 467 467 LYS LYS A . n 
C 3 462 PRO 462 468 468 PRO PRO A . n 
C 3 463 TRP 463 469 469 TRP TRP A . n 
C 3 464 VAL 464 470 470 VAL VAL A . n 
C 3 465 GLN 465 471 471 GLN GLN A . n 
C 3 466 ALA 466 472 472 ALA ALA A . n 
C 3 467 GLY 467 473 473 GLY GLY A . n 
C 3 468 ILE 468 474 474 ILE ILE A . n 
C 3 469 ASP 469 475 475 ASP ASP A . n 
C 3 470 ALA 470 476 476 ALA ALA A . n 
C 3 471 SER 471 477 477 SER SER A . n 
C 3 472 GLY 472 478 478 GLY GLY A . n 
C 3 473 LEU 473 479 479 LEU LEU A . n 
C 3 474 GLU 474 480 480 GLU GLU A . n 
C 3 475 LEU 475 481 481 LEU LEU A . n 
C 3 476 ARG 476 482 482 ARG ARG A . n 
C 3 477 CYS 477 483 483 CYS CYS A . n 
C 3 478 LEU 478 484 484 LEU LEU A . n 
C 3 479 ALA 479 485 485 ALA ALA A . n 
C 3 480 HIS 480 486 486 HIS HIS A . n 
C 3 481 PHE 481 487 487 PHE PHE A . n 
C 3 482 MET 482 488 488 MET MET A . n 
C 3 483 ALA 483 489 489 ALA ALA A . n 
C 3 484 ARG 484 490 490 ARG ARG A . n 
C 3 485 PHE 485 491 491 PHE PHE A . n 
C 3 486 ASP 486 492 492 ASP ASP A . n 
C 3 487 ASN 487 493 493 ASN ASN A . n 
C 3 488 GLY 488 494 494 GLY GLY A . n 
C 3 489 GLU 489 495 495 GLU GLU A . n 
C 3 490 TYR 490 496 496 TYR TYR A . n 
C 3 491 ALA 491 497 497 ALA ALA A . n 
C 3 492 HIS 492 498 498 HIS HIS A . n 
C 3 493 GLU 493 499 499 GLU GLU A . n 
C 3 494 ILE 494 500 500 ILE ILE A . n 
C 3 495 LEU 495 501 501 LEU LEU A . n 
C 3 496 ASN 496 502 502 ASN ASN A . n 
C 3 497 GLY 497 503 503 GLY GLY A . n 
C 3 498 ASP 498 504 504 ASP ASP A . n 
C 3 499 ILE 499 505 505 ILE ILE A . n 
C 3 500 HIS 500 506 506 HIS HIS A . n 
C 3 501 THR 501 507 507 THR THR A . n 
C 3 502 LYS 502 508 508 LYS LYS A . n 
C 3 503 ASN 503 509 509 ASN ASN A . n 
C 3 504 GLN 504 510 510 GLN GLN A . n 
C 3 505 ILE 505 511 511 ILE ILE A . n 
C 3 506 ALA 506 512 512 ALA ALA A . n 
C 3 507 ALA 507 513 513 ALA ALA A . n 
C 3 508 GLU 508 514 514 GLU GLU A . n 
C 3 509 LEU 509 515 515 LEU LEU A . n 
C 3 510 PRO 510 516 516 PRO PRO A . n 
C 3 511 THR 511 517 517 THR THR A . n 
C 3 512 ARG 512 518 518 ARG ARG A . n 
C 3 513 ASP 513 519 519 ASP ASP A . n 
C 3 514 ASN 514 520 520 ASN ASN A . n 
C 3 515 ALA 515 521 521 ALA ALA A . n 
C 3 516 LYS 516 522 522 LYS LYS A . n 
C 3 517 THR 517 523 523 THR THR A . n 
C 3 518 PHE 518 524 524 PHE PHE A . n 
C 3 519 ILE 519 525 525 ILE ILE A . n 
C 3 520 TYR 520 526 526 TYR TYR A . n 
C 3 521 GLY 521 527 527 GLY GLY A . n 
C 3 522 PHE 522 528 528 PHE PHE A . n 
C 3 523 LEU 523 529 529 LEU LEU A . n 
C 3 524 TYR 524 530 530 TYR TYR A . n 
C 3 525 GLY 525 531 ?   ?   ?   A . n 
C 3 526 ALA 526 532 ?   ?   ?   A . n 
C 3 527 GLY 527 533 ?   ?   ?   A . n 
C 3 528 ASP 528 534 534 ASP ASP A . n 
C 3 529 GLU 529 535 535 GLU GLU A . n 
C 3 530 LYS 530 536 536 LYS LYS A . n 
C 3 531 ILE 531 537 537 ILE ILE A . n 
C 3 532 GLY 532 538 538 GLY GLY A . n 
C 3 533 GLN 533 539 539 GLN GLN A . n 
C 3 534 ILE 534 540 540 ILE ILE A . n 
C 3 535 VAL 535 541 541 VAL VAL A . n 
C 3 536 GLY 536 542 542 GLY GLY A . n 
C 3 537 ALA 537 543 543 ALA ALA A . n 
C 3 538 GLY 538 544 544 GLY GLY A . n 
C 3 539 LYS 539 545 545 LYS LYS A . n 
C 3 540 GLU 540 546 546 GLU GLU A . n 
C 3 541 ARG 541 547 547 ARG ARG A . n 
C 3 542 GLY 542 548 548 GLY GLY A . n 
C 3 543 LYS 543 549 549 LYS LYS A . n 
C 3 544 GLU 544 550 550 GLU GLU A . n 
C 3 545 LEU 545 551 551 LEU LEU A . n 
C 3 546 LYS 546 552 552 LYS LYS A . n 
C 3 547 LYS 547 553 553 LYS LYS A . n 
C 3 548 LYS 548 554 554 LYS LYS A . n 
C 3 549 PHE 549 555 555 PHE PHE A . n 
C 3 550 LEU 550 556 556 LEU LEU A . n 
C 3 551 GLU 551 557 557 GLU GLU A . n 
C 3 552 ASN 552 558 558 ASN ASN A . n 
C 3 553 THR 553 559 559 THR THR A . n 
C 3 554 PRO 554 560 560 PRO PRO A . n 
C 3 555 ALA 555 561 561 ALA ALA A . n 
C 3 556 ILE 556 562 562 ILE ILE A . n 
C 3 557 ALA 557 563 563 ALA ALA A . n 
C 3 558 ALA 558 564 564 ALA ALA A . n 
C 3 559 LEU 559 565 565 LEU LEU A . n 
C 3 560 ARG 560 566 566 ARG ARG A . n 
C 3 561 GLU 561 567 567 GLU GLU A . n 
C 3 562 SER 562 568 568 SER SER A . n 
C 3 563 ILE 563 569 569 ILE ILE A . n 
C 3 564 GLN 564 570 570 GLN GLN A . n 
C 3 565 GLN 565 571 571 GLN GLN A . n 
C 3 566 THR 566 572 572 THR THR A . n 
C 3 567 LEU 567 573 573 LEU LEU A . n 
C 3 568 VAL 568 574 574 VAL VAL A . n 
C 3 569 GLU 569 575 575 GLU GLU A . n 
C 3 570 SER 570 576 ?   ?   ?   A . n 
C 3 571 SER 571 577 ?   ?   ?   A . n 
C 3 572 GLN 572 578 ?   ?   ?   A . n 
C 3 573 TRP 573 579 ?   ?   ?   A . n 
C 3 574 VAL 574 580 ?   ?   ?   A . n 
C 3 575 ALA 575 581 ?   ?   ?   A . n 
C 3 576 GLY 576 582 ?   ?   ?   A . n 
C 3 577 GLU 577 583 ?   ?   ?   A . n 
C 3 578 GLN 578 584 ?   ?   ?   A . n 
C 3 579 GLN 579 585 ?   ?   ?   A . n 
C 3 580 VAL 580 586 ?   ?   ?   A . n 
C 3 581 LYS 581 587 587 LYS LYS A . n 
C 3 582 TRP 582 588 588 TRP TRP A . n 
C 3 583 LYS 583 589 589 LYS LYS A . n 
C 3 584 ARG 584 590 590 ARG ARG A . n 
C 3 585 ARG 585 591 591 ARG ARG A . n 
C 3 586 TRP 586 592 592 TRP TRP A . n 
C 3 587 ILE 587 593 593 ILE ILE A . n 
C 3 588 LYS 588 594 594 LYS LYS A . n 
C 3 589 GLY 589 595 595 GLY GLY A . n 
C 3 590 LEU 590 596 596 LEU LEU A . n 
C 3 591 ASP 591 597 597 ASP ASP A . n 
C 3 592 GLY 592 598 598 GLY GLY A . n 
C 3 593 ARG 593 599 599 ARG ARG A . n 
C 3 594 LYS 594 600 600 LYS LYS A . n 
C 3 595 VAL 595 601 601 VAL VAL A . n 
C 3 596 HIS 596 602 602 HIS HIS A . n 
C 3 597 VAL 597 603 603 VAL VAL A . n 
C 3 598 ARG 598 604 604 ARG ARG A . n 
C 3 599 SER 599 605 605 SER SER A . n 
C 3 600 PRO 600 606 606 PRO PRO A . n 
C 3 601 HIS 601 607 607 HIS HIS A . n 
C 3 602 ALA 602 608 608 ALA ALA A . n 
C 3 603 ALA 603 609 609 ALA ALA A . n 
C 3 604 LEU 604 610 610 LEU LEU A . n 
C 3 605 ASN 605 611 611 ASN ASN A . n 
C 3 606 THR 606 612 612 THR THR A . n 
C 3 607 LEU 607 613 613 LEU LEU A . n 
C 3 608 LEU 608 614 614 LEU LEU A . n 
C 3 609 GLN 609 615 615 GLN GLN A . n 
C 3 610 SER 610 616 616 SER SER A . n 
C 3 611 ALA 611 617 617 ALA ALA A . n 
C 3 612 GLY 612 618 618 GLY GLY A . n 
C 3 613 ALA 613 619 619 ALA ALA A . n 
C 3 614 LEU 614 620 620 LEU LEU A . n 
C 3 615 ILE 615 621 621 ILE ILE A . n 
C 3 616 CYS 616 622 622 CYS CYS A . n 
C 3 617 LYS 617 623 623 LYS LYS A . n 
C 3 618 LEU 618 624 624 LEU LEU A . n 
C 3 619 TRP 619 625 625 TRP TRP A . n 
C 3 620 ILE 620 626 626 ILE ILE A . n 
C 3 621 ILE 621 627 627 ILE ILE A . n 
C 3 622 LYS 622 628 628 LYS LYS A . n 
C 3 623 THR 623 629 629 THR THR A . n 
C 3 624 GLU 624 630 630 GLU GLU A . n 
C 3 625 GLU 625 631 631 GLU GLU A . n 
C 3 626 MET 626 632 632 MET MET A . n 
C 3 627 LEU 627 633 633 LEU LEU A . n 
C 3 628 VAL 628 634 634 VAL VAL A . n 
C 3 629 GLU 629 635 635 GLU GLU A . n 
C 3 630 LYS 630 636 636 LYS LYS A . n 
C 3 631 GLY 631 637 637 GLY GLY A . n 
C 3 632 LEU 632 638 638 LEU LEU A . n 
C 3 633 LYS 633 639 639 LYS LYS A . n 
C 3 634 HIS 634 640 640 HIS HIS A . n 
C 3 635 GLY 635 641 641 GLY GLY A . n 
C 3 636 TRP 636 642 642 TRP TRP A . n 
C 3 637 ASP 637 643 643 ASP ASP A . n 
C 3 638 GLY 638 644 644 GLY GLY A . n 
C 3 639 ASP 639 645 645 ASP ASP A . n 
C 3 640 PHE 640 646 646 PHE PHE A . n 
C 3 641 ALA 641 647 647 ALA ALA A . n 
C 3 642 TYR 642 648 648 TYR TYR A . n 
C 3 643 MET 643 649 649 MET MET A . n 
C 3 644 ALA 644 650 650 ALA ALA A . n 
C 3 645 TRP 645 651 651 TRP TRP A . n 
C 3 646 VAL 646 652 652 VAL VAL A . n 
C 3 647 HIS 647 653 653 HIS HIS A . n 
C 3 648 ASP 648 654 654 ASP ASP A . n 
C 3 649 GLU 649 655 655 GLU GLU A . n 
C 3 650 ILE 650 656 656 ILE ILE A . n 
C 3 651 GLN 651 657 657 GLN GLN A . n 
C 3 652 VAL 652 658 658 VAL VAL A . n 
C 3 653 GLY 653 659 659 GLY GLY A . n 
C 3 654 CYS 654 660 660 CYS CYS A . n 
C 3 655 ARG 655 661 661 ARG ARG A . n 
C 3 656 THR 656 662 662 THR THR A . n 
C 3 657 GLU 657 663 663 GLU GLU A . n 
C 3 658 GLU 658 664 664 GLU GLU A . n 
C 3 659 ILE 659 665 665 ILE ILE A . n 
C 3 660 ALA 660 666 666 ALA ALA A . n 
C 3 661 GLN 661 667 667 GLN GLN A . n 
C 3 662 VAL 662 668 668 VAL VAL A . n 
C 3 663 VAL 663 669 669 VAL VAL A . n 
C 3 664 ILE 664 670 670 ILE ILE A . n 
C 3 665 GLU 665 671 671 GLU GLU A . n 
C 3 666 THR 666 672 672 THR THR A . n 
C 3 667 ALA 667 673 673 ALA ALA A . n 
C 3 668 GLN 668 674 674 GLN GLN A . n 
C 3 669 GLU 669 675 675 GLU GLU A . n 
C 3 670 ALA 670 676 676 ALA ALA A . n 
C 3 671 MET 671 677 677 MET MET A . n 
C 3 672 ARG 672 678 678 ARG ARG A . n 
C 3 673 TRP 673 679 679 TRP TRP A . n 
C 3 674 VAL 674 680 680 VAL VAL A . n 
C 3 675 GLY 675 681 681 GLY GLY A . n 
C 3 676 ASP 676 682 682 ASP ASP A . n 
C 3 677 HIS 677 683 683 HIS HIS A . n 
C 3 678 TRP 678 684 684 TRP TRP A . n 
C 3 679 ASN 679 685 685 ASN ASN A . n 
C 3 680 PHE 680 686 686 PHE PHE A . n 
C 3 681 ARG 681 687 687 ARG ARG A . n 
C 3 682 CYS 682 688 688 CYS CYS A . n 
C 3 683 LEU 683 689 689 LEU LEU A . n 
C 3 684 LEU 684 690 690 LEU LEU A . n 
C 3 685 ASP 685 691 691 ASP ASP A . n 
C 3 686 THR 686 692 692 THR THR A . n 
C 3 687 GLU 687 693 693 GLU GLU A . n 
C 3 688 GLY 688 694 694 GLY GLY A . n 
C 3 689 LYS 689 695 695 LYS LYS A . n 
C 3 690 MET 690 696 696 MET MET A . n 
C 3 691 GLY 691 697 697 GLY GLY A . n 
C 3 692 PRO 692 698 698 PRO PRO A . n 
C 3 693 ASN 693 699 699 ASN ASN A . n 
C 3 694 TRP 694 700 700 TRP TRP A . n 
C 3 695 ALA 695 701 701 ALA ALA A . n 
C 3 696 ILE 696 702 702 ILE ILE A . n 
C 3 697 CYS 697 703 703 CYS CYS A . n 
C 3 698 HIS 698 704 704 HIS HIS A . n 
D 4 1   SER 1   1   ?   ?   ?   B . n 
D 4 2   ASP 2   2   ?   ?   ?   B . n 
D 4 3   LYS 3   3   3   LYS LYS B . n 
D 4 4   ILE 4   4   4   ILE ILE B . n 
D 4 5   ILE 5   5   5   ILE ILE B . n 
D 4 6   HIS 6   6   6   HIS HIS B . n 
D 4 7   LEU 7   7   7   LEU LEU B . n 
D 4 8   THR 8   8   8   THR THR B . n 
D 4 9   ASP 9   9   9   ASP ASP B . n 
D 4 10  ASP 10  10  10  ASP ASP B . n 
D 4 11  SER 11  11  11  SER SER B . n 
D 4 12  PHE 12  12  12  PHE PHE B . n 
D 4 13  ASP 13  13  13  ASP ASP B . n 
D 4 14  THR 14  14  14  THR THR B . n 
D 4 15  ASP 15  15  15  ASP ASP B . n 
D 4 16  VAL 16  16  16  VAL VAL B . n 
D 4 17  LEU 17  17  17  LEU LEU B . n 
D 4 18  LYS 18  18  18  LYS LYS B . n 
D 4 19  ALA 19  19  19  ALA ALA B . n 
D 4 20  ASP 20  20  20  ASP ASP B . n 
D 4 21  GLY 21  21  21  GLY GLY B . n 
D 4 22  ALA 22  22  22  ALA ALA B . n 
D 4 23  ILE 23  23  23  ILE ILE B . n 
D 4 24  LEU 24  24  24  LEU LEU B . n 
D 4 25  VAL 25  25  25  VAL VAL B . n 
D 4 26  ASP 26  26  26  ASP ASP B . n 
D 4 27  PHE 27  27  27  PHE PHE B . n 
D 4 28  TRP 28  28  28  TRP TRP B . n 
D 4 29  ALA 29  29  29  ALA ALA B . n 
D 4 30  GLU 30  30  30  GLU GLU B . n 
D 4 31  TRP 31  31  31  TRP TRP B . n 
D 4 32  CYS 32  32  32  CYS CYS B . n 
D 4 33  GLY 33  33  33  GLY GLY B . n 
D 4 34  PRO 34  34  34  PRO PRO B . n 
D 4 35  CYS 35  35  35  CYS CYS B . n 
D 4 36  LYS 36  36  36  LYS LYS B . n 
D 4 37  MET 37  37  37  MET MET B . n 
D 4 38  ILE 38  38  38  ILE ILE B . n 
D 4 39  ALA 39  39  39  ALA ALA B . n 
D 4 40  PRO 40  40  40  PRO PRO B . n 
D 4 41  ILE 41  41  41  ILE ILE B . n 
D 4 42  LEU 42  42  42  LEU LEU B . n 
D 4 43  ASP 43  43  43  ASP ASP B . n 
D 4 44  GLU 44  44  44  GLU GLU B . n 
D 4 45  ILE 45  45  45  ILE ILE B . n 
D 4 46  ALA 46  46  46  ALA ALA B . n 
D 4 47  ASP 47  47  47  ASP ASP B . n 
D 4 48  GLU 48  48  48  GLU GLU B . n 
D 4 49  TYR 49  49  49  TYR TYR B . n 
D 4 50  GLN 50  50  50  GLN GLN B . n 
D 4 51  GLY 51  51  51  GLY GLY B . n 
D 4 52  LYS 52  52  52  LYS LYS B . n 
D 4 53  LEU 53  53  53  LEU LEU B . n 
D 4 54  THR 54  54  54  THR THR B . n 
D 4 55  VAL 55  55  55  VAL VAL B . n 
D 4 56  ALA 56  56  56  ALA ALA B . n 
D 4 57  LYS 57  57  57  LYS LYS B . n 
D 4 58  LEU 58  58  58  LEU LEU B . n 
D 4 59  ASN 59  59  59  ASN ASN B . n 
D 4 60  ILE 60  60  60  ILE ILE B . n 
D 4 61  ASP 61  61  61  ASP ASP B . n 
D 4 62  GLN 62  62  62  GLN GLN B . n 
D 4 63  ASN 63  63  63  ASN ASN B . n 
D 4 64  PRO 64  64  64  PRO PRO B . n 
D 4 65  GLY 65  65  65  GLY GLY B . n 
D 4 66  THR 66  66  66  THR THR B . n 
D 4 67  ALA 67  67  67  ALA ALA B . n 
D 4 68  PRO 68  68  68  PRO PRO B . n 
D 4 69  LYS 69  69  69  LYS LYS B . n 
D 4 70  TYR 70  70  70  TYR TYR B . n 
D 4 71  GLY 71  71  71  GLY GLY B . n 
D 4 72  ILE 72  72  72  ILE ILE B . n 
D 4 73  ARG 73  73  73  ARG ARG B . n 
D 4 74  GLY 74  74  74  GLY GLY B . n 
D 4 75  ILE 75  75  75  ILE ILE B . n 
D 4 76  PRO 76  76  76  PRO PRO B . n 
D 4 77  THR 77  77  77  THR THR B . n 
D 4 78  LEU 78  78  78  LEU LEU B . n 
D 4 79  LEU 79  79  79  LEU LEU B . n 
D 4 80  LEU 80  80  80  LEU LEU B . n 
D 4 81  PHE 81  81  81  PHE PHE B . n 
D 4 82  LYS 82  82  82  LYS LYS B . n 
D 4 83  ASN 83  83  83  ASN ASN B . n 
D 4 84  GLY 84  84  84  GLY GLY B . n 
D 4 85  GLU 85  85  85  GLU GLU B . n 
D 4 86  VAL 86  86  86  VAL VAL B . n 
D 4 87  ALA 87  87  87  ALA ALA B . n 
D 4 88  ALA 88  88  88  ALA ALA B . n 
D 4 89  THR 89  89  89  THR THR B . n 
D 4 90  LYS 90  90  90  LYS LYS B . n 
D 4 91  VAL 91  91  91  VAL VAL B . n 
D 4 92  GLY 92  92  92  GLY GLY B . n 
D 4 93  ALA 93  93  93  ALA ALA B . n 
D 4 94  LEU 94  94  94  LEU LEU B . n 
D 4 95  SER 95  95  95  SER SER B . n 
D 4 96  LYS 96  96  96  LYS LYS B . n 
D 4 97  GLY 97  97  97  GLY GLY B . n 
D 4 98  GLN 98  98  98  GLN GLN B . n 
D 4 99  LEU 99  99  99  LEU LEU B . n 
D 4 100 LYS 100 100 100 LYS LYS B . n 
D 4 101 GLU 101 101 101 GLU GLU B . n 
D 4 102 PHE 102 102 102 PHE PHE B . n 
D 4 103 LEU 103 103 103 LEU LEU B . n 
D 4 104 ASP 104 104 104 ASP ASP B . n 
D 4 105 ALA 105 105 105 ALA ALA B . n 
D 4 106 ASN 106 106 106 ASN ASN B . n 
D 4 107 LEU 107 107 107 LEU LEU B . n 
D 4 108 ALA 108 108 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 MG  1   4001 4001 MG  MG  A . 
F 5 MG  1   4002 4002 MG  MG  A . 
G 5 MG  1   4003 4003 MG  MG  A . 
H 6 DAD 1   4004 23   DAD DA3 A . 
I 7 HOH 1   5203 5203 HOH HOH P . 
J 7 HOH 1   5020 5020 HOH HOH T . 
J 7 HOH 2   5040 5040 HOH HOH T . 
J 7 HOH 3   5065 5065 HOH HOH T . 
J 7 HOH 4   5082 5082 HOH HOH T . 
J 7 HOH 5   5140 5140 HOH HOH T . 
J 7 HOH 6   5143 5143 HOH HOH T . 
J 7 HOH 7   5202 5202 HOH HOH T . 
J 7 HOH 8   5210 5210 HOH HOH T . 
J 7 HOH 9   5246 5246 HOH HOH T . 
J 7 HOH 10  5252 5252 HOH HOH T . 
J 7 HOH 11  5263 5263 HOH HOH T . 
J 7 HOH 12  5274 5274 HOH HOH T . 
K 7 HOH 1   5001 5001 HOH HOH A . 
K 7 HOH 2   5002 5002 HOH HOH A . 
K 7 HOH 3   5003 5003 HOH HOH A . 
K 7 HOH 4   5004 5004 HOH HOH A . 
K 7 HOH 5   5006 5006 HOH HOH A . 
K 7 HOH 6   5007 5007 HOH HOH A . 
K 7 HOH 7   5008 5008 HOH HOH A . 
K 7 HOH 8   5009 5009 HOH HOH A . 
K 7 HOH 9   5011 5011 HOH HOH A . 
K 7 HOH 10  5013 5013 HOH HOH A . 
K 7 HOH 11  5015 5015 HOH HOH A . 
K 7 HOH 12  5016 5016 HOH HOH A . 
K 7 HOH 13  5017 5017 HOH HOH A . 
K 7 HOH 14  5018 5018 HOH HOH A . 
K 7 HOH 15  5019 5019 HOH HOH A . 
K 7 HOH 16  5021 5021 HOH HOH A . 
K 7 HOH 17  5022 5022 HOH HOH A . 
K 7 HOH 18  5023 5023 HOH HOH A . 
K 7 HOH 19  5024 5024 HOH HOH A . 
K 7 HOH 20  5025 5025 HOH HOH A . 
K 7 HOH 21  5026 5026 HOH HOH A . 
K 7 HOH 22  5027 5027 HOH HOH A . 
K 7 HOH 23  5028 5028 HOH HOH A . 
K 7 HOH 24  5029 5029 HOH HOH A . 
K 7 HOH 25  5030 5030 HOH HOH A . 
K 7 HOH 26  5031 5031 HOH HOH A . 
K 7 HOH 27  5032 5032 HOH HOH A . 
K 7 HOH 28  5033 5033 HOH HOH A . 
K 7 HOH 29  5034 5034 HOH HOH A . 
K 7 HOH 30  5035 5035 HOH HOH A . 
K 7 HOH 31  5036 5036 HOH HOH A . 
K 7 HOH 32  5037 5037 HOH HOH A . 
K 7 HOH 33  5038 5038 HOH HOH A . 
K 7 HOH 34  5039 5039 HOH HOH A . 
K 7 HOH 35  5041 5041 HOH HOH A . 
K 7 HOH 36  5043 5043 HOH HOH A . 
K 7 HOH 37  5044 5044 HOH HOH A . 
K 7 HOH 38  5045 5045 HOH HOH A . 
K 7 HOH 39  5046 5046 HOH HOH A . 
K 7 HOH 40  5048 5048 HOH HOH A . 
K 7 HOH 41  5049 5049 HOH HOH A . 
K 7 HOH 42  5050 5050 HOH HOH A . 
K 7 HOH 43  5051 5051 HOH HOH A . 
K 7 HOH 44  5052 5052 HOH HOH A . 
K 7 HOH 45  5053 5053 HOH HOH A . 
K 7 HOH 46  5054 5054 HOH HOH A . 
K 7 HOH 47  5055 5055 HOH HOH A . 
K 7 HOH 48  5056 5056 HOH HOH A . 
K 7 HOH 49  5057 5057 HOH HOH A . 
K 7 HOH 50  5058 5058 HOH HOH A . 
K 7 HOH 51  5059 5059 HOH HOH A . 
K 7 HOH 52  5060 5060 HOH HOH A . 
K 7 HOH 53  5061 5061 HOH HOH A . 
K 7 HOH 54  5064 5064 HOH HOH A . 
K 7 HOH 55  5066 5066 HOH HOH A . 
K 7 HOH 56  5067 5067 HOH HOH A . 
K 7 HOH 57  5070 5070 HOH HOH A . 
K 7 HOH 58  5071 5071 HOH HOH A . 
K 7 HOH 59  5072 5072 HOH HOH A . 
K 7 HOH 60  5073 5073 HOH HOH A . 
K 7 HOH 61  5074 5074 HOH HOH A . 
K 7 HOH 62  5076 5076 HOH HOH A . 
K 7 HOH 63  5077 5077 HOH HOH A . 
K 7 HOH 64  5078 5078 HOH HOH A . 
K 7 HOH 65  5079 5079 HOH HOH A . 
K 7 HOH 66  5080 5080 HOH HOH A . 
K 7 HOH 67  5081 5081 HOH HOH A . 
K 7 HOH 68  5084 5084 HOH HOH A . 
K 7 HOH 69  5086 5086 HOH HOH A . 
K 7 HOH 70  5087 5087 HOH HOH A . 
K 7 HOH 71  5088 5088 HOH HOH A . 
K 7 HOH 72  5089 5089 HOH HOH A . 
K 7 HOH 73  5090 5090 HOH HOH A . 
K 7 HOH 74  5091 5091 HOH HOH A . 
K 7 HOH 75  5092 5092 HOH HOH A . 
K 7 HOH 76  5095 5095 HOH HOH A . 
K 7 HOH 77  5096 5096 HOH HOH A . 
K 7 HOH 78  5097 5097 HOH HOH A . 
K 7 HOH 79  5098 5098 HOH HOH A . 
K 7 HOH 80  5101 5101 HOH HOH A . 
K 7 HOH 81  5102 5102 HOH HOH A . 
K 7 HOH 82  5103 5103 HOH HOH A . 
K 7 HOH 83  5104 5104 HOH HOH A . 
K 7 HOH 84  5105 5105 HOH HOH A . 
K 7 HOH 85  5109 5109 HOH HOH A . 
K 7 HOH 86  5112 5112 HOH HOH A . 
K 7 HOH 87  5115 5115 HOH HOH A . 
K 7 HOH 88  5117 5117 HOH HOH A . 
K 7 HOH 89  5118 5118 HOH HOH A . 
K 7 HOH 90  5119 5119 HOH HOH A . 
K 7 HOH 91  5120 5120 HOH HOH A . 
K 7 HOH 92  5121 5121 HOH HOH A . 
K 7 HOH 93  5124 5124 HOH HOH A . 
K 7 HOH 94  5125 5125 HOH HOH A . 
K 7 HOH 95  5126 5126 HOH HOH A . 
K 7 HOH 96  5127 5127 HOH HOH A . 
K 7 HOH 97  5129 5129 HOH HOH A . 
K 7 HOH 98  5130 5130 HOH HOH A . 
K 7 HOH 99  5132 5132 HOH HOH A . 
K 7 HOH 100 5133 5133 HOH HOH A . 
K 7 HOH 101 5134 5134 HOH HOH A . 
K 7 HOH 102 5135 5135 HOH HOH A . 
K 7 HOH 103 5138 5138 HOH HOH A . 
K 7 HOH 104 5139 5139 HOH HOH A . 
K 7 HOH 105 5141 5141 HOH HOH A . 
K 7 HOH 106 5144 5144 HOH HOH A . 
K 7 HOH 107 5145 5145 HOH HOH A . 
K 7 HOH 108 5146 5146 HOH HOH A . 
K 7 HOH 109 5150 5150 HOH HOH A . 
K 7 HOH 110 5151 5151 HOH HOH A . 
K 7 HOH 111 5152 5152 HOH HOH A . 
K 7 HOH 112 5153 5153 HOH HOH A . 
K 7 HOH 113 5154 5154 HOH HOH A . 
K 7 HOH 114 5155 5155 HOH HOH A . 
K 7 HOH 115 5157 5157 HOH HOH A . 
K 7 HOH 116 5158 5158 HOH HOH A . 
K 7 HOH 117 5160 5160 HOH HOH A . 
K 7 HOH 118 5161 5161 HOH HOH A . 
K 7 HOH 119 5162 5162 HOH HOH A . 
K 7 HOH 120 5163 5163 HOH HOH A . 
K 7 HOH 121 5166 5166 HOH HOH A . 
K 7 HOH 122 5167 5167 HOH HOH A . 
K 7 HOH 123 5168 5168 HOH HOH A . 
K 7 HOH 124 5173 5173 HOH HOH A . 
K 7 HOH 125 5174 5174 HOH HOH A . 
K 7 HOH 126 5178 5178 HOH HOH A . 
K 7 HOH 127 5179 5179 HOH HOH A . 
K 7 HOH 128 5181 5181 HOH HOH A . 
K 7 HOH 129 5183 5183 HOH HOH A . 
K 7 HOH 130 5184 5184 HOH HOH A . 
K 7 HOH 131 5186 5186 HOH HOH A . 
K 7 HOH 132 5187 5187 HOH HOH A . 
K 7 HOH 133 5188 5188 HOH HOH A . 
K 7 HOH 134 5190 5190 HOH HOH A . 
K 7 HOH 135 5195 5195 HOH HOH A . 
K 7 HOH 136 5196 5196 HOH HOH A . 
K 7 HOH 137 5198 5198 HOH HOH A . 
K 7 HOH 138 5199 5199 HOH HOH A . 
K 7 HOH 139 5201 5201 HOH HOH A . 
K 7 HOH 140 5204 5204 HOH HOH A . 
K 7 HOH 141 5206 5206 HOH HOH A . 
K 7 HOH 142 5207 5207 HOH HOH A . 
K 7 HOH 143 5208 5208 HOH HOH A . 
K 7 HOH 144 5211 5211 HOH HOH A . 
K 7 HOH 145 5212 5212 HOH HOH A . 
K 7 HOH 146 5216 5216 HOH HOH A . 
K 7 HOH 147 5220 5220 HOH HOH A . 
K 7 HOH 148 5221 5221 HOH HOH A . 
K 7 HOH 149 5222 5222 HOH HOH A . 
K 7 HOH 150 5224 5224 HOH HOH A . 
K 7 HOH 151 5226 5226 HOH HOH A . 
K 7 HOH 152 5227 5227 HOH HOH A . 
K 7 HOH 153 5228 5228 HOH HOH A . 
K 7 HOH 154 5230 5230 HOH HOH A . 
K 7 HOH 155 5232 5232 HOH HOH A . 
K 7 HOH 156 5234 5234 HOH HOH A . 
K 7 HOH 157 5235 5235 HOH HOH A . 
K 7 HOH 158 5236 5236 HOH HOH A . 
K 7 HOH 159 5237 5237 HOH HOH A . 
K 7 HOH 160 5238 5238 HOH HOH A . 
K 7 HOH 161 5243 5243 HOH HOH A . 
K 7 HOH 162 5244 5244 HOH HOH A . 
K 7 HOH 163 5245 5245 HOH HOH A . 
K 7 HOH 164 5247 5247 HOH HOH A . 
K 7 HOH 165 5248 5248 HOH HOH A . 
K 7 HOH 166 5251 5251 HOH HOH A . 
K 7 HOH 167 5254 5254 HOH HOH A . 
K 7 HOH 168 5255 5255 HOH HOH A . 
K 7 HOH 169 5256 5256 HOH HOH A . 
K 7 HOH 170 5257 5257 HOH HOH A . 
K 7 HOH 171 5258 5258 HOH HOH A . 
K 7 HOH 172 5259 5259 HOH HOH A . 
K 7 HOH 173 5260 5260 HOH HOH A . 
K 7 HOH 174 5262 5262 HOH HOH A . 
K 7 HOH 175 5264 5264 HOH HOH A . 
K 7 HOH 176 5265 5265 HOH HOH A . 
K 7 HOH 177 5266 5266 HOH HOH A . 
K 7 HOH 178 5269 5269 HOH HOH A . 
K 7 HOH 179 5270 5270 HOH HOH A . 
K 7 HOH 180 5272 5272 HOH HOH A . 
K 7 HOH 181 5273 5273 HOH HOH A . 
K 7 HOH 182 5275 5275 HOH HOH A . 
K 7 HOH 183 5276 5276 HOH HOH A . 
K 7 HOH 184 5277 5277 HOH HOH A . 
K 7 HOH 185 5279 5279 HOH HOH A . 
K 7 HOH 186 5280 5280 HOH HOH A . 
K 7 HOH 187 5281 5281 HOH HOH A . 
K 7 HOH 188 5282 5282 HOH HOH A . 
K 7 HOH 189 5284 5284 HOH HOH A . 
K 7 HOH 190 5287 5287 HOH HOH A . 
K 7 HOH 191 5288 5288 HOH HOH A . 
K 7 HOH 192 5289 5289 HOH HOH A . 
K 7 HOH 193 5290 5290 HOH HOH A . 
K 7 HOH 194 5291 5291 HOH HOH A . 
L 7 HOH 1   5005 5005 HOH HOH B . 
L 7 HOH 2   5062 5062 HOH HOH B . 
L 7 HOH 3   5068 5068 HOH HOH B . 
L 7 HOH 4   5083 5083 HOH HOH B . 
L 7 HOH 5   5093 5093 HOH HOH B . 
L 7 HOH 6   5114 5114 HOH HOH B . 
L 7 HOH 7   5128 5128 HOH HOH B . 
L 7 HOH 8   5169 5169 HOH HOH B . 
L 7 HOH 9   5185 5185 HOH HOH B . 
L 7 HOH 10  5189 5189 HOH HOH B . 
L 7 HOH 11  5192 5192 HOH HOH B . 
L 7 HOH 12  5197 5197 HOH HOH B . 
L 7 HOH 13  5229 5229 HOH HOH B . 
L 7 HOH 14  5253 5253 HOH HOH B . 
L 7 HOH 15  5271 5271 HOH HOH B . 
L 7 HOH 16  5285 5285 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A 2DA 22 P 2DA 22 ? DA "2',3'-DIDEOXYADENOSINE-5'-MONOPHOSPHATE" 
2 B TTD 4  T TTD 5  ? DT 'CIS-SYN CYCLOBUTANE THYMINE DIMER'       
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 O1G ? H DAD .   ? A DAD 4004 ? 1_555 66.0  ? 
2  O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 O1A ? H DAD .   ? A DAD 4004 ? 1_555 113.9 ? 
3  O1G ? H DAD .   ? A DAD 4004 ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 O1A ? H DAD .   ? A DAD 4004 ? 1_555 70.9  ? 
4  O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 O2B ? H DAD .   ? A DAD 4004 ? 1_555 126.3 ? 
5  O1G ? H DAD .   ? A DAD 4004 ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 O2B ? H DAD .   ? A DAD 4004 ? 1_555 91.9  ? 
6  O1A ? H DAD .   ? A DAD 4004 ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 O2B ? H DAD .   ? A DAD 4004 ? 1_555 102.0 ? 
7  O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 O3A ? H DAD .   ? A DAD 4004 ? 1_555 161.8 ? 
8  O1G ? H DAD .   ? A DAD 4004 ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 O3A ? H DAD .   ? A DAD 4004 ? 1_555 96.5  ? 
9  O1A ? H DAD .   ? A DAD 4004 ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 O3A ? H DAD .   ? A DAD 4004 ? 1_555 52.4  ? 
10 O2B ? H DAD .   ? A DAD 4004 ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 O3A ? H DAD .   ? A DAD 4004 ? 1_555 55.6  ? 
11 O   ? C ALA 470 ? A ALA 476  ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 79.9  ? 
12 O1G ? H DAD .   ? A DAD 4004 ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 106.5 ? 
13 O1A ? H DAD .   ? A DAD 4004 ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 67.3  ? 
14 O2B ? H DAD .   ? A DAD 4004 ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 153.1 ? 
15 O3A ? H DAD .   ? A DAD 4004 ? 1_555 MG ? E MG . ? A MG 4001 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 101.9 ? 
16 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 O   ? K HOH .   ? A HOH 5046 ? 1_555 89.4  ? 
17 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 O1A ? H DAD .   ? A DAD 4004 ? 1_555 94.6  ? 
18 O   ? K HOH .   ? A HOH 5046 ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 O1A ? H DAD .   ? A DAD 4004 ? 1_555 150.9 ? 
19 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 O   ? K HOH .   ? A HOH 5288 ? 1_555 131.1 ? 
20 O   ? K HOH .   ? A HOH 5046 ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 O   ? K HOH .   ? A HOH 5288 ? 1_555 94.2  ? 
21 O1A ? H DAD .   ? A DAD 4004 ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 O   ? K HOH .   ? A HOH 5288 ? 1_555 61.8  ? 
22 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 93.5  ? 
23 O   ? K HOH .   ? A HOH 5046 ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 134.8 ? 
24 O1A ? H DAD .   ? A DAD 4004 ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 73.8  ? 
25 O   ? K HOH .   ? A HOH 5288 ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 116.3 ? 
26 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 125.7 ? 
27 O   ? K HOH .   ? A HOH 5046 ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 98.2  ? 
28 O1A ? H DAD .   ? A DAD 4004 ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 102.6 ? 
29 O   ? K HOH .   ? A HOH 5288 ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 102.0 ? 
30 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 45.7  ? 
31 OD1 ? C ASP 648 ? A ASP 654  ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 45.9  ? 
32 O   ? K HOH .   ? A HOH 5046 ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 131.2 ? 
33 O1A ? H DAD .   ? A DAD 4004 ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 66.7  ? 
34 O   ? K HOH .   ? A HOH 5288 ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 128.0 ? 
35 OD1 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 52.0  ? 
36 OD2 ? C ASP 469 ? A ASP 475  ? 1_555 MG ? F MG . ? A MG 4002 ? 1_555 OD2 ? C ASP 648 ? A ASP 654  ? 1_555 95.7  ? 
37 O   ? K HOH .   ? A HOH 5043 ? 1_555 MG ? G MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 5291 ? 1_555 76.0  ? 
38 O   ? K HOH .   ? A HOH 5043 ? 1_555 MG ? G MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 5280 ? 1_555 136.7 ? 
39 O   ? K HOH .   ? A HOH 5291 ? 1_555 MG ? G MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 5280 ? 1_555 145.0 ? 
40 O   ? K HOH .   ? A HOH 5043 ? 1_555 MG ? G MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 5290 ? 1_555 118.3 ? 
41 O   ? K HOH .   ? A HOH 5291 ? 1_555 MG ? G MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 5290 ? 1_555 71.2  ? 
42 O   ? K HOH .   ? A HOH 5280 ? 1_555 MG ? G MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 5290 ? 1_555 94.9  ? 
43 O   ? K HOH .   ? A HOH 5043 ? 1_555 MG ? G MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 5289 ? 1_555 77.1  ? 
44 O   ? K HOH .   ? A HOH 5291 ? 1_555 MG ? G MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 5289 ? 1_555 125.4 ? 
45 O   ? K HOH .   ? A HOH 5280 ? 1_555 MG ? G MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 5289 ? 1_555 81.8  ? 
46 O   ? K HOH .   ? A HOH 5290 ? 1_555 MG ? G MG . ? A MG 4003 ? 1_555 O   ? K HOH .   ? A HOH 5289 ? 1_555 81.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-07-06 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       . ? 1 
HKL-2000  'data reduction' . ? 2 
SCALEPACK 'data scaling'   . ? 3 
EPMR      phasing          . ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 64  ? ? -117.61 -77.69  
2  1 HIS A 99  ? ? -101.52 48.98   
3  1 PRO A 353 ? ? -49.32  151.53  
4  1 ASP A 358 ? ? -68.21  55.66   
5  1 LYS A 359 ? ? -170.20 23.75   
6  1 ALA A 361 ? ? -174.59 131.25  
7  1 ALA A 400 ? ? -135.20 -40.96  
8  1 HIS A 417 ? ? -101.76 74.86   
9  1 LEU A 501 ? ? -72.10  29.37   
10 1 ASN A 502 ? ? -116.94 63.69   
11 1 ALA A 513 ? ? -50.46  -8.76   
12 1 ALA A 543 ? ? -114.16 -167.98 
13 1 HIS A 653 ? ? 63.47   -81.29  
14 1 VAL B 16  ? ? -104.48 -64.85  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DC P 20 ? ? 0.070 'SIDE CHAIN' 
2 1 DG T 7  ? ? 0.080 'SIDE CHAIN' 
# 
loop_
_pdbx_validate_chiral.id 
_pdbx_validate_chiral.PDB_model_num 
_pdbx_validate_chiral.auth_atom_id 
_pdbx_validate_chiral.label_alt_id 
_pdbx_validate_chiral.auth_asym_id 
_pdbx_validate_chiral.auth_comp_id 
_pdbx_validate_chiral.auth_seq_id 
_pdbx_validate_chiral.PDB_ins_code 
_pdbx_validate_chiral.details 
_pdbx_validate_chiral.omega 
1 1 "C4'" ? A DAD 4004 ? 'WRONG HAND' . 
2 1 "C1'" ? A DAD 4004 ? 'WRONG HAND' . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A ILE 2   ? CD1 ? C ILE 2   CD1 
2   1 Y 1 A ILE 6   ? CD1 ? C ILE 6   CD1 
3   1 Y 1 A GLU 13  ? CD  ? C GLU 13  CD  
4   1 Y 1 A GLU 13  ? OE1 ? C GLU 13  OE1 
5   1 Y 1 A GLU 13  ? OE2 ? C GLU 13  OE2 
6   1 Y 1 A ILE 23  ? CD1 ? C ILE 23  CD1 
7   1 Y 1 A ILE 56  ? CD1 ? C ILE 56  CD1 
8   1 Y 1 A ILE 89  ? CD1 ? C ILE 89  CD1 
9   1 Y 1 A ILE 98  ? CD1 ? C ILE 98  CD1 
10  1 Y 1 A ARG 111 ? CG  ? C ARG 111 CG  
11  1 Y 1 A ARG 111 ? CD  ? C ARG 111 CD  
12  1 Y 1 A ARG 111 ? NE  ? C ARG 111 NE  
13  1 Y 1 A ARG 111 ? CZ  ? C ARG 111 CZ  
14  1 Y 1 A ARG 111 ? NH1 ? C ARG 111 NH1 
15  1 Y 1 A ARG 111 ? NH2 ? C ARG 111 NH2 
16  1 Y 1 A GLU 166 ? CG  ? C GLU 160 CG  
17  1 Y 1 A GLU 166 ? CD  ? C GLU 160 CD  
18  1 Y 1 A GLU 166 ? OE1 ? C GLU 160 OE1 
19  1 Y 1 A GLU 166 ? OE2 ? C GLU 160 OE2 
20  1 Y 1 A LYS 189 ? CG  ? C LYS 183 CG  
21  1 Y 1 A LYS 189 ? CD  ? C LYS 183 CD  
22  1 Y 1 A LYS 189 ? CE  ? C LYS 183 CE  
23  1 Y 1 A LYS 189 ? NZ  ? C LYS 183 NZ  
24  1 Y 1 A ILE 196 ? CD1 ? C ILE 190 CD1 
25  1 Y 1 A ILE 216 ? CD1 ? C ILE 210 CD1 
26  1 Y 1 A LYS 237 ? CD  ? C LYS 231 CD  
27  1 Y 1 A LYS 237 ? CE  ? C LYS 231 CE  
28  1 Y 1 A LYS 237 ? NZ  ? C LYS 231 NZ  
29  1 Y 1 A ILE 239 ? CD1 ? C ILE 233 CD1 
30  1 Y 1 A GLU 259 ? CG  ? C GLU 253 CG  
31  1 Y 1 A GLU 259 ? CD  ? C GLU 253 CD  
32  1 Y 1 A GLU 259 ? OE1 ? C GLU 253 OE1 
33  1 Y 1 A GLU 259 ? OE2 ? C GLU 253 OE2 
34  1 Y 1 A LYS 268 ? CD  ? C LYS 262 CD  
35  1 Y 1 A LYS 268 ? CE  ? C LYS 262 CE  
36  1 Y 1 A LYS 268 ? NZ  ? C LYS 262 NZ  
37  1 Y 1 A LYS 285 ? CG  ? C LYS 279 CG  
38  1 Y 1 A LYS 285 ? CD  ? C LYS 279 CD  
39  1 Y 1 A LYS 285 ? CE  ? C LYS 279 CE  
40  1 Y 1 A LYS 285 ? NZ  ? C LYS 279 NZ  
41  1 Y 1 A ILE 289 ? CD1 ? C ILE 283 CD1 
42  1 Y 1 A LYS 290 ? CD  ? C LYS 284 CD  
43  1 Y 1 A LYS 290 ? CE  ? C LYS 284 CE  
44  1 Y 1 A LYS 290 ? NZ  ? C LYS 284 NZ  
45  1 Y 1 A LYS 293 ? CG  ? C LYS 287 CG  
46  1 Y 1 A LYS 293 ? CD  ? C LYS 287 CD  
47  1 Y 1 A LYS 293 ? CE  ? C LYS 287 CE  
48  1 Y 1 A LYS 293 ? NZ  ? C LYS 287 NZ  
49  1 Y 1 A ARG 318 ? CG  ? C ARG 312 CG  
50  1 Y 1 A ARG 318 ? CD  ? C ARG 312 CD  
51  1 Y 1 A ARG 318 ? NE  ? C ARG 312 NE  
52  1 Y 1 A ARG 318 ? CZ  ? C ARG 312 CZ  
53  1 Y 1 A ARG 318 ? NH1 ? C ARG 312 NH1 
54  1 Y 1 A ARG 318 ? NH2 ? C ARG 312 NH2 
55  1 Y 1 A ILE 342 ? CD1 ? C ILE 336 CD1 
56  1 Y 1 A ASP 358 ? CG  ? C ASP 352 CG  
57  1 Y 1 A ASP 358 ? OD1 ? C ASP 352 OD1 
58  1 Y 1 A ASP 358 ? OD2 ? C ASP 352 OD2 
59  1 Y 1 A LYS 359 ? CG  ? C LYS 353 CG  
60  1 Y 1 A LYS 359 ? CD  ? C LYS 353 CD  
61  1 Y 1 A LYS 359 ? CE  ? C LYS 353 CE  
62  1 Y 1 A LYS 359 ? NZ  ? C LYS 353 NZ  
63  1 Y 1 A ILE 383 ? CD1 ? C ILE 377 CD1 
64  1 Y 1 A ILE 386 ? CD1 ? C ILE 380 CD1 
65  1 Y 1 A ILE 392 ? CD1 ? C ILE 386 CD1 
66  1 Y 1 A ILE 396 ? CD1 ? C ILE 390 CD1 
67  1 Y 1 A GLU 412 ? CG  ? C GLU 406 CG  
68  1 Y 1 A GLU 412 ? CD  ? C GLU 406 CD  
69  1 Y 1 A GLU 412 ? OE1 ? C GLU 406 OE1 
70  1 Y 1 A GLU 412 ? OE2 ? C GLU 406 OE2 
71  1 Y 1 A ILE 416 ? CD1 ? C ILE 410 CD1 
72  1 Y 1 A ILE 440 ? CD1 ? C ILE 434 CD1 
73  1 Y 1 A ARG 444 ? CD  ? C ARG 438 CD  
74  1 Y 1 A ARG 444 ? NE  ? C ARG 438 NE  
75  1 Y 1 A ARG 444 ? CZ  ? C ARG 438 CZ  
76  1 Y 1 A ARG 444 ? NH1 ? C ARG 438 NH1 
77  1 Y 1 A ARG 444 ? NH2 ? C ARG 438 NH2 
78  1 Y 1 A ILE 464 ? CD1 ? C ILE 458 CD1 
79  1 Y 1 A ILE 474 ? CD1 ? C ILE 468 CD1 
80  1 Y 1 A GLU 495 ? CD  ? C GLU 489 CD  
81  1 Y 1 A GLU 495 ? OE1 ? C GLU 489 OE1 
82  1 Y 1 A GLU 495 ? OE2 ? C GLU 489 OE2 
83  1 Y 1 A ASN 502 ? CG  ? C ASN 496 CG  
84  1 Y 1 A ASN 502 ? OD1 ? C ASN 496 OD1 
85  1 Y 1 A ASN 502 ? ND2 ? C ASN 496 ND2 
86  1 Y 1 A ILE 505 ? CG1 ? C ILE 499 CG1 
87  1 Y 1 A ILE 505 ? CG2 ? C ILE 499 CG2 
88  1 Y 1 A ILE 505 ? CD1 ? C ILE 499 CD1 
89  1 Y 1 A THR 507 ? OG1 ? C THR 501 OG1 
90  1 Y 1 A THR 507 ? CG2 ? C THR 501 CG2 
91  1 Y 1 A ILE 511 ? CG1 ? C ILE 505 CG1 
92  1 Y 1 A ILE 511 ? CG2 ? C ILE 505 CG2 
93  1 Y 1 A ILE 511 ? CD1 ? C ILE 505 CD1 
94  1 Y 1 A GLU 514 ? CG  ? C GLU 508 CG  
95  1 Y 1 A GLU 514 ? CD  ? C GLU 508 CD  
96  1 Y 1 A GLU 514 ? OE1 ? C GLU 508 OE1 
97  1 Y 1 A GLU 514 ? OE2 ? C GLU 508 OE2 
98  1 Y 1 A LEU 515 ? CG  ? C LEU 509 CG  
99  1 Y 1 A LEU 515 ? CD1 ? C LEU 509 CD1 
100 1 Y 1 A LEU 515 ? CD2 ? C LEU 509 CD2 
101 1 Y 1 A THR 517 ? OG1 ? C THR 511 OG1 
102 1 Y 1 A THR 517 ? CG2 ? C THR 511 CG2 
103 1 Y 1 A ASN 520 ? CG  ? C ASN 514 CG  
104 1 Y 1 A ASN 520 ? OD1 ? C ASN 514 OD1 
105 1 Y 1 A ASN 520 ? ND2 ? C ASN 514 ND2 
106 1 Y 1 A THR 523 ? OG1 ? C THR 517 OG1 
107 1 Y 1 A THR 523 ? CG2 ? C THR 517 CG2 
108 1 Y 1 A PHE 528 ? CG  ? C PHE 522 CG  
109 1 Y 1 A PHE 528 ? CD1 ? C PHE 522 CD1 
110 1 Y 1 A PHE 528 ? CD2 ? C PHE 522 CD2 
111 1 Y 1 A PHE 528 ? CE1 ? C PHE 522 CE1 
112 1 Y 1 A PHE 528 ? CE2 ? C PHE 522 CE2 
113 1 Y 1 A PHE 528 ? CZ  ? C PHE 522 CZ  
114 1 Y 1 A GLU 535 ? CG  ? C GLU 529 CG  
115 1 Y 1 A GLU 535 ? CD  ? C GLU 529 CD  
116 1 Y 1 A GLU 535 ? OE1 ? C GLU 529 OE1 
117 1 Y 1 A GLU 535 ? OE2 ? C GLU 529 OE2 
118 1 Y 1 A LYS 536 ? CG  ? C LYS 530 CG  
119 1 Y 1 A LYS 536 ? CD  ? C LYS 530 CD  
120 1 Y 1 A LYS 536 ? CE  ? C LYS 530 CE  
121 1 Y 1 A LYS 536 ? NZ  ? C LYS 530 NZ  
122 1 Y 1 A ILE 537 ? CG1 ? C ILE 531 CG1 
123 1 Y 1 A ILE 537 ? CG2 ? C ILE 531 CG2 
124 1 Y 1 A ILE 537 ? CD1 ? C ILE 531 CD1 
125 1 Y 1 A GLN 539 ? CG  ? C GLN 533 CG  
126 1 Y 1 A GLN 539 ? CD  ? C GLN 533 CD  
127 1 Y 1 A GLN 539 ? OE1 ? C GLN 533 OE1 
128 1 Y 1 A GLN 539 ? NE2 ? C GLN 533 NE2 
129 1 Y 1 A ILE 540 ? CG1 ? C ILE 534 CG1 
130 1 Y 1 A ILE 540 ? CG2 ? C ILE 534 CG2 
131 1 Y 1 A ILE 540 ? CD1 ? C ILE 534 CD1 
132 1 Y 1 A VAL 541 ? CG1 ? C VAL 535 CG1 
133 1 Y 1 A VAL 541 ? CG2 ? C VAL 535 CG2 
134 1 Y 1 A LYS 545 ? CG  ? C LYS 539 CG  
135 1 Y 1 A LYS 545 ? CD  ? C LYS 539 CD  
136 1 Y 1 A LYS 545 ? CE  ? C LYS 539 CE  
137 1 Y 1 A LYS 545 ? NZ  ? C LYS 539 NZ  
138 1 Y 1 A GLU 546 ? CG  ? C GLU 540 CG  
139 1 Y 1 A GLU 546 ? CD  ? C GLU 540 CD  
140 1 Y 1 A GLU 546 ? OE1 ? C GLU 540 OE1 
141 1 Y 1 A GLU 546 ? OE2 ? C GLU 540 OE2 
142 1 Y 1 A ARG 547 ? CG  ? C ARG 541 CG  
143 1 Y 1 A ARG 547 ? CD  ? C ARG 541 CD  
144 1 Y 1 A ARG 547 ? NE  ? C ARG 541 NE  
145 1 Y 1 A ARG 547 ? CZ  ? C ARG 541 CZ  
146 1 Y 1 A ARG 547 ? NH1 ? C ARG 541 NH1 
147 1 Y 1 A ARG 547 ? NH2 ? C ARG 541 NH2 
148 1 Y 1 A LYS 549 ? CG  ? C LYS 543 CG  
149 1 Y 1 A LYS 549 ? CD  ? C LYS 543 CD  
150 1 Y 1 A LYS 549 ? CE  ? C LYS 543 CE  
151 1 Y 1 A LYS 549 ? NZ  ? C LYS 543 NZ  
152 1 Y 1 A GLU 550 ? CG  ? C GLU 544 CG  
153 1 Y 1 A GLU 550 ? CD  ? C GLU 544 CD  
154 1 Y 1 A GLU 550 ? OE1 ? C GLU 544 OE1 
155 1 Y 1 A GLU 550 ? OE2 ? C GLU 544 OE2 
156 1 Y 1 A LEU 551 ? CG  ? C LEU 545 CG  
157 1 Y 1 A LEU 551 ? CD1 ? C LEU 545 CD1 
158 1 Y 1 A LEU 551 ? CD2 ? C LEU 545 CD2 
159 1 Y 1 A LYS 552 ? CG  ? C LYS 546 CG  
160 1 Y 1 A LYS 552 ? CD  ? C LYS 546 CD  
161 1 Y 1 A LYS 552 ? CE  ? C LYS 546 CE  
162 1 Y 1 A LYS 552 ? NZ  ? C LYS 546 NZ  
163 1 Y 1 A LYS 553 ? CG  ? C LYS 547 CG  
164 1 Y 1 A LYS 553 ? CD  ? C LYS 547 CD  
165 1 Y 1 A LYS 553 ? CE  ? C LYS 547 CE  
166 1 Y 1 A LYS 553 ? NZ  ? C LYS 547 NZ  
167 1 Y 1 A LYS 554 ? CG  ? C LYS 548 CG  
168 1 Y 1 A LYS 554 ? CD  ? C LYS 548 CD  
169 1 Y 1 A LYS 554 ? CE  ? C LYS 548 CE  
170 1 Y 1 A LYS 554 ? NZ  ? C LYS 548 NZ  
171 1 Y 1 A PHE 555 ? CG  ? C PHE 549 CG  
172 1 Y 1 A PHE 555 ? CD1 ? C PHE 549 CD1 
173 1 Y 1 A PHE 555 ? CD2 ? C PHE 549 CD2 
174 1 Y 1 A PHE 555 ? CE1 ? C PHE 549 CE1 
175 1 Y 1 A PHE 555 ? CE2 ? C PHE 549 CE2 
176 1 Y 1 A PHE 555 ? CZ  ? C PHE 549 CZ  
177 1 Y 1 A LEU 556 ? CG  ? C LEU 550 CG  
178 1 Y 1 A LEU 556 ? CD1 ? C LEU 550 CD1 
179 1 Y 1 A LEU 556 ? CD2 ? C LEU 550 CD2 
180 1 Y 1 A GLU 557 ? CG  ? C GLU 551 CG  
181 1 Y 1 A GLU 557 ? CD  ? C GLU 551 CD  
182 1 Y 1 A GLU 557 ? OE1 ? C GLU 551 OE1 
183 1 Y 1 A GLU 557 ? OE2 ? C GLU 551 OE2 
184 1 Y 1 A ASN 558 ? CG  ? C ASN 552 CG  
185 1 Y 1 A ASN 558 ? OD1 ? C ASN 552 OD1 
186 1 Y 1 A ASN 558 ? ND2 ? C ASN 552 ND2 
187 1 Y 1 A THR 559 ? OG1 ? C THR 553 OG1 
188 1 Y 1 A THR 559 ? CG2 ? C THR 553 CG2 
189 1 Y 1 A ILE 562 ? CD1 ? C ILE 556 CD1 
190 1 Y 1 A ILE 569 ? CD1 ? C ILE 563 CD1 
191 1 Y 1 A GLN 571 ? CG  ? C GLN 565 CG  
192 1 Y 1 A GLN 571 ? CD  ? C GLN 565 CD  
193 1 Y 1 A GLN 571 ? OE1 ? C GLN 565 OE1 
194 1 Y 1 A GLN 571 ? NE2 ? C GLN 565 NE2 
195 1 Y 1 A GLU 575 ? CG  ? C GLU 569 CG  
196 1 Y 1 A GLU 575 ? CD  ? C GLU 569 CD  
197 1 Y 1 A GLU 575 ? OE1 ? C GLU 569 OE1 
198 1 Y 1 A GLU 575 ? OE2 ? C GLU 569 OE2 
199 1 Y 1 A LYS 587 ? CG  ? C LYS 581 CG  
200 1 Y 1 A LYS 587 ? CD  ? C LYS 581 CD  
201 1 Y 1 A LYS 587 ? CE  ? C LYS 581 CE  
202 1 Y 1 A LYS 587 ? NZ  ? C LYS 581 NZ  
203 1 Y 1 A ILE 593 ? CD1 ? C ILE 587 CD1 
204 1 Y 1 A ILE 621 ? CD1 ? C ILE 615 CD1 
205 1 Y 1 A ILE 626 ? CD1 ? C ILE 620 CD1 
206 1 Y 1 A ILE 627 ? CD1 ? C ILE 621 CD1 
207 1 Y 1 A ILE 656 ? CD1 ? C ILE 650 CD1 
208 1 Y 1 A GLU 664 ? CG  ? C GLU 658 CG  
209 1 Y 1 A GLU 664 ? CD  ? C GLU 658 CD  
210 1 Y 1 A GLU 664 ? OE1 ? C GLU 658 OE1 
211 1 Y 1 A GLU 664 ? OE2 ? C GLU 658 OE2 
212 1 Y 1 A ILE 665 ? CD1 ? C ILE 659 CD1 
213 1 Y 1 A GLN 667 ? CD  ? C GLN 661 CD  
214 1 Y 1 A GLN 667 ? OE1 ? C GLN 661 OE1 
215 1 Y 1 A GLN 667 ? NE2 ? C GLN 661 NE2 
216 1 Y 1 A ILE 670 ? CD1 ? C ILE 664 CD1 
217 1 Y 1 A ILE 702 ? CD1 ? C ILE 696 CD1 
218 1 Y 1 B ILE 4   ? CD1 ? D ILE 4   CD1 
219 1 Y 1 B ILE 5   ? CD1 ? D ILE 5   CD1 
220 1 Y 1 B ASP 20  ? CG  ? D ASP 20  CG  
221 1 Y 1 B ASP 20  ? OD1 ? D ASP 20  OD1 
222 1 Y 1 B ASP 20  ? OD2 ? D ASP 20  OD2 
223 1 Y 1 B ILE 23  ? CD1 ? D ILE 23  CD1 
224 1 Y 1 B ILE 38  ? CD1 ? D ILE 38  CD1 
225 1 Y 1 B ILE 41  ? CD1 ? D ILE 41  CD1 
226 1 Y 1 B ILE 45  ? CD1 ? D ILE 45  CD1 
227 1 Y 1 B ILE 60  ? CD1 ? D ILE 60  CD1 
228 1 Y 1 B ILE 72  ? CD1 ? D ILE 72  CD1 
229 1 Y 1 B ARG 73  ? CG  ? D ARG 73  CG  
230 1 Y 1 B ARG 73  ? CD  ? D ARG 73  CD  
231 1 Y 1 B ARG 73  ? NE  ? D ARG 73  NE  
232 1 Y 1 B ARG 73  ? CZ  ? D ARG 73  CZ  
233 1 Y 1 B ARG 73  ? NH1 ? D ARG 73  NH1 
234 1 Y 1 B ARG 73  ? NH2 ? D ARG 73  NH2 
235 1 Y 1 B ILE 75  ? CD1 ? D ILE 75  CD1 
236 1 Y 1 B LYS 82  ? CG  ? D LYS 82  CG  
237 1 Y 1 B LYS 82  ? CD  ? D LYS 82  CD  
238 1 Y 1 B LYS 82  ? CE  ? D LYS 82  CE  
239 1 Y 1 B LYS 82  ? NZ  ? D LYS 82  NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 P DC  1   ? A DC  1   
2  1 Y 1 P DG  2   ? A DG  2   
3  1 Y 1 P DA  3   ? A DA  3   
4  1 Y 1 P DA  4   ? A DA  4   
5  1 Y 1 P DA  5   ? A DA  5   
6  1 Y 1 P DA  6   ? A DA  6   
7  1 Y 1 P DC  7   ? A DC  7   
8  1 Y 1 P DG  8   ? A DG  8   
9  1 Y 1 P DA  9   ? A DA  9   
10 1 Y 1 P DC  10  ? A DC  10  
11 1 Y 1 P DG  11  ? A DG  11  
12 1 Y 1 P DG  12  ? A DG  12  
13 1 Y 1 P DC  13  ? A DC  13  
14 1 Y 1 T DC  2   ? B DC  1   
15 1 Y 1 T DC  3   ? B DC  2   
16 1 Y 1 T DC  4   ? B DC  3   
17 1 Y 1 T DC  15  ? B DC  14  
18 1 Y 1 T DC  16  ? B DC  15  
19 1 Y 1 T DG  17  ? B DG  16  
20 1 Y 1 T DT  18  ? B DT  17  
21 1 Y 1 T DC  19  ? B DC  18  
22 1 Y 1 T DG  20  ? B DG  19  
23 1 Y 1 T DT  21  ? B DT  20  
24 1 Y 1 T DT  22  ? B DT  21  
25 1 Y 1 T DT  23  ? B DT  22  
26 1 Y 1 T DT  24  ? B DT  23  
27 1 Y 1 T DC  25  ? B DC  24  
28 1 Y 1 T DG  26  ? B DG  25  
29 1 Y 1 A PHE 298 ? C PHE 292 
30 1 Y 1 A LYS 299 ? C LYS 293 
31 1 Y 1 A LYS 300 ? C LYS 294 
32 1 Y 1 A PRO 301 ? C PRO 295 
33 1 Y 1 A LYS 302 ? C LYS 296 
34 1 Y 1 A ASN 303 ? C ASN 297 
35 1 Y 1 A LYS 304 ? C LYS 298 
36 1 Y 1 A ALA 305 ? C ALA 299 
37 1 Y 1 A GLN 306 ? C GLN 300 
38 1 Y 1 A ARG 307 ? C ARG 301 
39 1 Y 1 A GLU 308 ? C GLU 302 
40 1 Y 1 A GLY 309 ? C GLY 303 
41 1 Y 1 A ARG 310 ? C ARG 304 
42 1 Y 1 A GLU 311 ? C GLU 305 
43 1 Y 1 A PRO 312 ? C PRO 306 
44 1 Y 1 A CYS 313 ? C CYS 307 
45 1 Y 1 A GLU 314 ? C GLU 308 
46 1 Y 1 A GLY 531 ? C GLY 525 
47 1 Y 1 A ALA 532 ? C ALA 526 
48 1 Y 1 A GLY 533 ? C GLY 527 
49 1 Y 1 A SER 576 ? C SER 570 
50 1 Y 1 A SER 577 ? C SER 571 
51 1 Y 1 A GLN 578 ? C GLN 572 
52 1 Y 1 A TRP 579 ? C TRP 573 
53 1 Y 1 A VAL 580 ? C VAL 574 
54 1 Y 1 A ALA 581 ? C ALA 575 
55 1 Y 1 A GLY 582 ? C GLY 576 
56 1 Y 1 A GLU 583 ? C GLU 577 
57 1 Y 1 A GLN 584 ? C GLN 578 
58 1 Y 1 A GLN 585 ? C GLN 579 
59 1 Y 1 A VAL 586 ? C VAL 580 
60 1 Y 1 B SER 1   ? D SER 1   
61 1 Y 1 B ASP 2   ? D ASP 2   
62 1 Y 1 B ALA 108 ? D ALA 108 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1SL2 'double helix'        
1SL2 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC 14 1_555 B DG 12 1_555 -0.556 0.099  -0.251 -12.080 -5.817  -0.975 1 P_DC14:DG13_T P 14 ? T 13 ? 19 1 
1 A DA 15 1_555 B DT 11 1_555 0.303  0.038  0.340  -11.710 -7.681  -1.624 2 P_DA15:DT12_T P 15 ? T 12 ? 20 1 
1 A DG 16 1_555 B DC 10 1_555 -0.217 0.314  -0.037 -10.834 -14.494 0.862  3 P_DG16:DC11_T P 16 ? T 11 ? 19 1 
1 A DT 17 1_555 B DA 9  1_555 -0.433 -0.240 -0.084 1.716   -7.006  0.742  4 P_DT17:DA10_T P 17 ? T 10 ? 20 1 
1 A DG 18 1_555 B DC 8  1_555 -0.095 0.019  -0.640 -2.392  0.075   2.359  5 P_DG18:DC9_T  P 18 ? T 9  ? 19 1 
1 A DC 19 1_555 B DG 7  1_555 -0.331 -0.237 -0.690 7.822   1.338   -0.777 6 P_DC19:DG8_T  P 19 ? T 8  ? 19 1 
1 A DC 20 1_555 B DG 6  1_555 0.207  -0.373 -0.364 -2.464  -0.030  1.950  7 P_DC20:DG7_T  P 20 ? T 7  ? 19 1 
1 A DT 21 1_555 B DA 5  1_555 0.114  -0.144 0.466  -0.044  -11.883 3.216  8 P_DT21:DA6_T  P 21 ? T 6  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 14 1_555 B DG 12 1_555 A DA 15 1_555 B DT 11 1_555 -0.533 0.337  3.274 -6.900  5.418  36.276 -0.208 -0.102 3.331 8.549  
10.887 37.287 1 PP_DC14DA15:DT12DG13_TT P 14 ? T 13 ? P 15 ? T 12 ? 
1 A DA 15 1_555 B DT 11 1_555 A DG 16 1_555 B DC 10 1_555 -0.143 -0.169 3.333 1.106   1.734  34.138 -0.566 0.420  3.315 2.950  
-1.882 34.198 2 PP_DA15DG16:DC11DT12_TT P 15 ? T 12 ? P 16 ? T 11 ? 
1 A DG 16 1_555 B DC 10 1_555 A DT 17 1_555 B DA 9  1_555 0.396  -0.393 3.049 2.024   2.931  28.707 -1.392 -0.376 3.015 5.883  
-4.062 28.922 3 PP_DG16DT17:DA10DC11_TT P 16 ? T 11 ? P 17 ? T 10 ? 
1 A DT 17 1_555 B DA 9  1_555 A DG 18 1_555 B DC 8  1_555 1.094  0.161  3.513 3.805   7.771  34.544 -0.979 -1.181 3.561 12.838 
-6.287 35.579 4 PP_DT17DG18:DC9DA10_TT  P 17 ? T 10 ? P 18 ? T 9  ? 
1 A DG 18 1_555 B DC 8  1_555 A DC 19 1_555 B DG 7  1_555 -0.673 -0.593 3.118 0.592   2.506  27.041 -1.857 1.573  3.036 5.344  
-1.262 27.161 5 PP_DG18DC19:DG8DC9_TT   P 18 ? T 9  ? P 19 ? T 8  ? 
1 A DC 19 1_555 B DG 7  1_555 A DC 20 1_555 B DG 6  1_555 -0.113 -0.665 3.859 -11.920 13.781 41.724 -2.282 -1.082 3.399 18.335 
15.858 45.366 6 PP_DC19DC20:DG7DG8_TT   P 19 ? T 8  ? P 20 ? T 7  ? 
1 A DC 20 1_555 B DG 6  1_555 A DT 21 1_555 B DA 5  1_555 -0.829 -1.537 3.409 -5.767  8.214  20.576 -6.770 0.059  2.732 21.428 
15.044 22.870 7 PP_DC20DT21:DA6DG7_TT   P 20 ? T 7  ? P 21 ? T 6  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'MAGNESIUM ION'                          MG  
6 "2',3'-DIDEOXYADENOSINE-5'-TRIPHOSPHATE" DAD 
7 water                                    HOH 
#