data_1SMN
# 
_entry.id   1SMN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SMN         
WWPDB D_1000176431 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SMN 
_pdbx_database_status.recvd_initial_deposition_date   1995-01-25 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Miller, M.D.' 1 
'Krause, K.L.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Identification of the Serratia endonuclease dimer: structural basis and implications for catalysis.'      'Protein Sci.' 
5   24  33 1996 PRCIEI US 0961-8368 0795 ? 8771193 ? 
1       '2.1 Angstroms Structure of Serratia Endonuclease Suggests a Mechanism for Binding to Double-Stranded DNA' 
Nat.Struct.Biol. 1   461 ?  1994 NSBIEW US 1072-8368 2024 ? ?       ? 
2       'Crystallization and Preliminary Crystallographic Analysis of a Novel Nuclease from Serratia Marcescens'   J.Mol.Biol. 222 
27  ?  1991 JMOBAK UK 0022-2836 0070 ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Miller, M.D.'   1  
primary 'Krause, K.L.'   2  
1       'Miller, M.D.'   3  
1       'Tanner, J.'     4  
1       'Alpaugh, M.'    5  
1       'Benedik, M.J.'  6  
1       'Krause, K.L.'   7  
2       'Miller, M.D.'   8  
2       'Benedik, M.J.'  9  
2       'Sullivan, M.J.' 10 
2       'Shipley, M.C.'  11 
2       'Krause, K.L.'   12 
# 
_cell.entry_id           1SMN 
_cell.length_a           106.700 
_cell.length_b           74.500 
_cell.length_c           68.900 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SMN 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'EXTRACELLULAR ENDONUCLEASE' 26738.896 2   3.1.30.2 ? ? ? 
2 water   nat water                        18.015    224 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DTLESIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGAN
AALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGT
QKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPEL
MGCKN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DTLESIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGAN
AALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGT
QKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPEL
MGCKN
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   THR n 
1 3   LEU n 
1 4   GLU n 
1 5   SER n 
1 6   ILE n 
1 7   ASP n 
1 8   ASN n 
1 9   CYS n 
1 10  ALA n 
1 11  VAL n 
1 12  GLY n 
1 13  CYS n 
1 14  PRO n 
1 15  THR n 
1 16  GLY n 
1 17  GLY n 
1 18  SER n 
1 19  SER n 
1 20  ASN n 
1 21  VAL n 
1 22  SER n 
1 23  ILE n 
1 24  VAL n 
1 25  ARG n 
1 26  HIS n 
1 27  ALA n 
1 28  TYR n 
1 29  THR n 
1 30  LEU n 
1 31  ASN n 
1 32  ASN n 
1 33  ASN n 
1 34  SER n 
1 35  THR n 
1 36  THR n 
1 37  LYS n 
1 38  PHE n 
1 39  ALA n 
1 40  ASN n 
1 41  TRP n 
1 42  VAL n 
1 43  ALA n 
1 44  TYR n 
1 45  HIS n 
1 46  ILE n 
1 47  THR n 
1 48  LYS n 
1 49  ASP n 
1 50  THR n 
1 51  PRO n 
1 52  ALA n 
1 53  SER n 
1 54  GLY n 
1 55  LYS n 
1 56  THR n 
1 57  ARG n 
1 58  ASN n 
1 59  TRP n 
1 60  LYS n 
1 61  THR n 
1 62  ASP n 
1 63  PRO n 
1 64  ALA n 
1 65  LEU n 
1 66  ASN n 
1 67  PRO n 
1 68  ALA n 
1 69  ASP n 
1 70  THR n 
1 71  LEU n 
1 72  ALA n 
1 73  PRO n 
1 74  ALA n 
1 75  ASP n 
1 76  TYR n 
1 77  THR n 
1 78  GLY n 
1 79  ALA n 
1 80  ASN n 
1 81  ALA n 
1 82  ALA n 
1 83  LEU n 
1 84  LYS n 
1 85  VAL n 
1 86  ASP n 
1 87  ARG n 
1 88  GLY n 
1 89  HIS n 
1 90  GLN n 
1 91  ALA n 
1 92  PRO n 
1 93  LEU n 
1 94  ALA n 
1 95  SER n 
1 96  LEU n 
1 97  ALA n 
1 98  GLY n 
1 99  VAL n 
1 100 SER n 
1 101 ASP n 
1 102 TRP n 
1 103 GLU n 
1 104 SER n 
1 105 LEU n 
1 106 ASN n 
1 107 TYR n 
1 108 LEU n 
1 109 SER n 
1 110 ASN n 
1 111 ILE n 
1 112 THR n 
1 113 PRO n 
1 114 GLN n 
1 115 LYS n 
1 116 SER n 
1 117 ASP n 
1 118 LEU n 
1 119 ASN n 
1 120 GLN n 
1 121 GLY n 
1 122 ALA n 
1 123 TRP n 
1 124 ALA n 
1 125 ARG n 
1 126 LEU n 
1 127 GLU n 
1 128 ASP n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LYS n 
1 133 LEU n 
1 134 ILE n 
1 135 ASP n 
1 136 ARG n 
1 137 ALA n 
1 138 ASP n 
1 139 ILE n 
1 140 SER n 
1 141 SER n 
1 142 VAL n 
1 143 TYR n 
1 144 THR n 
1 145 VAL n 
1 146 THR n 
1 147 GLY n 
1 148 PRO n 
1 149 LEU n 
1 150 TYR n 
1 151 GLU n 
1 152 ARG n 
1 153 ASP n 
1 154 MET n 
1 155 GLY n 
1 156 LYS n 
1 157 LEU n 
1 158 PRO n 
1 159 GLY n 
1 160 THR n 
1 161 GLN n 
1 162 LYS n 
1 163 ALA n 
1 164 HIS n 
1 165 THR n 
1 166 ILE n 
1 167 PRO n 
1 168 SER n 
1 169 ALA n 
1 170 TYR n 
1 171 TRP n 
1 172 LYS n 
1 173 VAL n 
1 174 ILE n 
1 175 PHE n 
1 176 ILE n 
1 177 ASN n 
1 178 ASN n 
1 179 SER n 
1 180 PRO n 
1 181 ALA n 
1 182 VAL n 
1 183 ASN n 
1 184 HIS n 
1 185 TYR n 
1 186 ALA n 
1 187 ALA n 
1 188 PHE n 
1 189 LEU n 
1 190 PHE n 
1 191 ASP n 
1 192 GLN n 
1 193 ASN n 
1 194 THR n 
1 195 PRO n 
1 196 LYS n 
1 197 GLY n 
1 198 ALA n 
1 199 ASP n 
1 200 PHE n 
1 201 CYS n 
1 202 GLN n 
1 203 PHE n 
1 204 ARG n 
1 205 VAL n 
1 206 THR n 
1 207 VAL n 
1 208 ASP n 
1 209 GLU n 
1 210 ILE n 
1 211 GLU n 
1 212 LYS n 
1 213 ARG n 
1 214 THR n 
1 215 GLY n 
1 216 LEU n 
1 217 ILE n 
1 218 ILE n 
1 219 TRP n 
1 220 ALA n 
1 221 GLY n 
1 222 LEU n 
1 223 PRO n 
1 224 ASP n 
1 225 ASP n 
1 226 VAL n 
1 227 GLN n 
1 228 ALA n 
1 229 SER n 
1 230 LEU n 
1 231 LYS n 
1 232 SER n 
1 233 LYS n 
1 234 PRO n 
1 235 GLY n 
1 236 VAL n 
1 237 LEU n 
1 238 PRO n 
1 239 GLU n 
1 240 LEU n 
1 241 MET n 
1 242 GLY n 
1 243 CYS n 
1 244 LYS n 
1 245 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Serratia 
_entity_src_gen.pdbx_gene_src_gene                 NUCA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    SM6 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Serratia marcescens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     615 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Serratia marcescens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     615 
_entity_src_gen.host_org_genus                     Serratia 
_entity_src_gen.pdbx_host_org_gene                 NUCA 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PUC19NUC4OC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NUCA_SERMA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P13717 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MRFNNKMLALAALLFAAQASADTLESIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNW
KTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADI
SSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIW
AGLPDDVQASLKSKPGVLPELMGCKN
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1SMN A 1 ? 245 ? P13717 22 ? 266 ? 1 245 
2 1 1SMN B 1 ? 245 ? P13717 22 ? 266 ? 1 245 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1SMN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.56 
_exptl_crystal.density_percent_sol   51.93 
_exptl_crystal.description           
;THIS STRUCTURE WAS SOLVED USING MULTIPLE ISOMORPHOUS
 REPLACEMENT WITH 5 DERIVATIVES.  AFTER THE INITIAL MODEL
 WAS BUILT, THE DATA WAS REFINED AGAINST A NATIVE DATA SET
 COLLECTED FROM TWO CRYSTALS.
;
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 ? ? 1 
2 ? ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 DIFFRACTOMETER 'ENRAF-NONIUS FAST' 1993-03-08 ? 
2 DIFFRACTOMETER 'ENRAF-NONIUS FAST' 1993-04-09 ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 ? ? ? ? 1.54 ? 
2 ? ? ? ? 1.54 ? 
# 
_reflns.entry_id                     1SMN 
_reflns.observed_criterion_sigma_I   0. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            ? 
_reflns.number_obs                   ? 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         93.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1SMN 
_refine.ls_number_reflns_obs                     29445 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6.0 
_refine.ls_d_res_high                            2.04 
_refine.ls_percent_reflns_obs                    92.6 
_refine.ls_R_factor_obs                          0.168 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.168 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               11.0 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;CRYST1
  THERE IS STRONG PSEUDO-CENTERING ARISING FROM THE
  NON-CRYSTALLOGRAPHIC SYMMETRY.  SHIFTING ONE MONOMER BY
  ONLY 1.4 ANGSTROMS WITH A 1 DEGREE ROTATION WOULD CHANGE
  THE SPACE GROUP TO I 2 2 2.

 THIS STRUCTURE WAS SOLVED USING MULTIPLE ISOMORPHOUS
 REPLACEMENT WITH 5 DERIVATIVES.  AFTER THE INITIAL MODEL
 WAS BUILT, THE DATA WAS REFINED AGAINST A NATIVE DATA SET
 COLLECTED FROM TWO CRYSTALS.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1SMN 
_refine_analyze.Luzzati_coordinate_error_obs    0.15 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3694 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             224 
_refine_hist.number_atoms_total               3918 
_refine_hist.d_res_high                       2.04 
_refine_hist.d_res_low                        6.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.015 ?     ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.81  ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      25.5  ?     ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.60  ?     ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     1.000 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     1.500 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     1.500 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     2.000 ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.999890 
_struct_ncs_oper.matrix[1][2]   -0.014803 
_struct_ncs_oper.matrix[1][3]   -0.001089 
_struct_ncs_oper.matrix[2][1]   -0.014812 
_struct_ncs_oper.matrix[2][2]   0.999846 
_struct_ncs_oper.matrix[2][3]   0.009425 
_struct_ncs_oper.matrix[3][1]   -0.000949 
_struct_ncs_oper.matrix[3][2]   0.009440 
_struct_ncs_oper.matrix[3][3]   -0.999955 
_struct_ncs_oper.vector[1]      -1.18090 
_struct_ncs_oper.vector[2]      -0.49600 
_struct_ncs_oper.vector[3]      103.20240 
# 
_struct.entry_id                  1SMN 
_struct.title                     
'IDENTIFICATION OF THE SERRATIA ENDONUCLEASE DIMER: STRUCTURAL BASIS AND IMPLICATIONS FOR CATALYSIS' 
_struct.pdbx_descriptor           'EXTRACELLULAR ENDONUCLEASE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SMN 
_struct_keywords.pdbx_keywords   ENDONUCLEASE 
_struct_keywords.text            'NUCLEASE, DNASE, RNASE, SUGAR-NONSPECIFIC NUCLEASE, ENDONUCLEASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;MTRIX
 THE TRANSFORMATIONS PRESENTED ON MTRIX RECORDS BELOW
 DESCRIBE NON-CRYSTALLOGRAPHIC RELATIONSHIPS AMONG THE
 VARIOUS DOMAINS IN THIS ENTRY.  APPLYING THE APPROPRIATE
 MTRIX TRANSFORMATION TO THE RESIDUES LISTED FIRST WILL
 YIELD APPROXIMATE COORDINATES FOR THE RESIDUES LISTED
 SECOND.

           APPLIED TO           TRANSFORMED TO
 MTRIX      RESIDUES               RESIDUES         RMSD
   M1   A    5  ..  A  245     B    5  ..  B  245   0.131
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 101 ? TYR A 107 ? ASP A 101 TYR A 107 5 ? 7  
HELX_P HELX_P2  2  SER A 116 ? ARG A 136 ? SER A 116 ARG A 136 1 ? 21 
HELX_P HELX_P3  3  VAL A 207 ? GLY A 215 ? VAL A 207 GLY A 215 1 ? 9  
HELX_P HELX_P4  4  ASP A 224 ? LYS A 231 ? ASP A 224 LYS A 231 1 ? 8  
HELX_P HELX_P5  5  VAL A 236 ? MET A 241 ? VAL A 236 MET A 241 5 ? 6  
HELX_P HELX_P6  6  ASP B 101 ? TYR B 107 ? ASP B 101 TYR B 107 5 ? 7  
HELX_P HELX_P7  7  SER B 116 ? ARG B 136 ? SER B 116 ARG B 136 1 ? 21 
HELX_P HELX_P8  8  VAL B 207 ? GLY B 215 ? VAL B 207 GLY B 215 1 ? 9  
HELX_P HELX_P9  9  ASP B 224 ? LYS B 231 ? ASP B 224 LYS B 231 1 ? 8  
HELX_P HELX_P10 10 VAL B 236 ? MET B 241 ? VAL B 236 MET B 241 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 9   SG ? ? ? 1_555 A CYS 13  SG ? ? A CYS 9   A CYS 13  1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf2 disulf ? ? A CYS 201 SG ? ? ? 1_555 A CYS 243 SG ? ? A CYS 201 A CYS 243 1_555 ? ? ? ? ? ? ? 2.016 ? 
disulf3 disulf ? ? B CYS 9   SG ? ? ? 1_555 B CYS 13  SG ? ? B CYS 9   B CYS 13  1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf4 disulf ? ? B CYS 201 SG ? ? ? 1_555 B CYS 243 SG ? ? B CYS 201 B CYS 243 1_555 ? ? ? ? ? ? ? 2.029 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 6 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 22  ? ARG A 25  ? SER A 22  ARG A 25  
A 2 TYR A 28  ? ASN A 33  ? TYR A 28  ASN A 33  
A 3 PHE A 38  ? THR A 47  ? PHE A 38  THR A 47  
A 4 SER A 140 ? LEU A 149 ? SER A 140 LEU A 149 
A 5 SER A 168 ? ASN A 177 ? SER A 168 ASN A 177 
A 6 HIS A 184 ? GLN A 192 ? HIS A 184 GLN A 192 
B 1 PRO A 14  ? GLY A 16  ? PRO A 14  GLY A 16  
B 2 LEU A 216 ? ILE A 218 ? LEU A 216 ILE A 218 
C 1 SER B 22  ? ARG B 25  ? SER B 22  ARG B 25  
C 2 TYR B 28  ? ASN B 33  ? TYR B 28  ASN B 33  
C 3 PHE B 38  ? THR B 47  ? PHE B 38  THR B 47  
C 4 SER B 140 ? LEU B 149 ? SER B 140 LEU B 149 
C 5 SER B 168 ? ASN B 177 ? SER B 168 ASN B 177 
C 6 HIS B 184 ? GLN B 192 ? HIS B 184 GLN B 192 
D 1 PRO B 14  ? GLY B 16  ? PRO B 14  GLY B 16  
D 2 LEU B 216 ? ILE B 218 ? LEU B 216 ILE B 218 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 25  ? N ARG A 25  O TYR A 28  ? O TYR A 28  
A 2 3 N ASN A 31  ? N ASN A 31  O ASN A 40  ? O ASN A 40  
A 3 4 N ILE A 46  ? N ILE A 46  O VAL A 142 ? O VAL A 142 
A 4 5 N LEU A 149 ? N LEU A 149 O ALA A 169 ? O ALA A 169 
A 5 6 N ILE A 174 ? N ILE A 174 O ALA A 186 ? O ALA A 186 
B 1 2 N THR A 15  ? N THR A 15  O LEU A 216 ? O LEU A 216 
C 1 2 N ARG B 25  ? N ARG B 25  O TYR B 28  ? O TYR B 28  
C 2 3 N ASN B 31  ? N ASN B 31  O ASN B 40  ? O ASN B 40  
C 3 4 N ILE B 46  ? N ILE B 46  O VAL B 142 ? O VAL B 142 
C 4 5 N LEU B 149 ? N LEU B 149 O ALA B 169 ? O ALA B 169 
C 5 6 N ILE B 174 ? N ILE B 174 O ALA B 186 ? O ALA B 186 
D 1 2 N THR B 15  ? N THR B 15  O LEU B 216 ? O LEU B 216 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
ASA Author ? ? ? ? 2  'PUTATIVE ACTIVE SITE REGION IN MONOMER A'      
ASB Author ? ? ? ? 2  'PUTATIVE ACTIVE SITE REGION IN MONOMER B'      
INT Author ? ? ? ? 37 'RESIDUES IN THE PHYSIOLOGICAL DIMER INTERFACE' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  ASA 2  HIS A 89  ? HIS A 89  . ? 1_555 ? 
2  ASA 2  GLU A 127 ? GLU A 127 . ? 1_555 ? 
3  ASB 2  HIS B 89  ? HIS B 89  . ? 1_555 ? 
4  ASB 2  GLU B 127 ? GLU B 127 . ? 1_555 ? 
5  INT 37 ARG A 136 ? ARG A 136 . ? 1_555 ? 
6  INT 37 ASP A 138 ? ASP A 138 . ? 1_555 ? 
7  INT 37 ASN A 178 ? ASN A 178 . ? 1_555 ? 
8  INT 37 PRO A 180 ? PRO A 180 . ? 1_555 ? 
9  INT 37 ALA A 181 ? ALA A 181 . ? 1_555 ? 
10 INT 37 VAL A 182 ? VAL A 182 . ? 1_555 ? 
11 INT 37 ASN A 183 ? ASN A 183 . ? 1_555 ? 
12 INT 37 HIS A 184 ? HIS A 184 . ? 1_555 ? 
13 INT 37 ASP A 225 ? ASP A 225 . ? 1_555 ? 
14 INT 37 SER A 229 ? SER A 229 . ? 1_555 ? 
15 INT 37 LYS A 233 ? LYS A 233 . ? 1_555 ? 
16 INT 37 VAL A 236 ? VAL A 236 . ? 1_555 ? 
17 INT 37 GLU A 239 ? GLU A 239 . ? 1_555 ? 
18 INT 37 LEU A 240 ? LEU A 240 . ? 1_555 ? 
19 INT 37 ASN A 245 ? ASN A 245 . ? 1_555 ? 
20 INT 37 ARG B 136 ? ARG B 136 . ? 1_555 ? 
21 INT 37 ASP B 138 ? ASP B 138 . ? 1_555 ? 
22 INT 37 ASN B 178 ? ASN B 178 . ? 1_555 ? 
23 INT 37 PRO B 180 ? PRO B 180 . ? 1_555 ? 
24 INT 37 ALA B 181 ? ALA B 181 . ? 1_555 ? 
25 INT 37 VAL B 182 ? VAL B 182 . ? 1_555 ? 
26 INT 37 ASN B 183 ? ASN B 183 . ? 1_555 ? 
27 INT 37 HIS B 184 ? HIS B 184 . ? 1_555 ? 
28 INT 37 ASP B 225 ? ASP B 225 . ? 1_555 ? 
29 INT 37 SER B 229 ? SER B 229 . ? 1_555 ? 
30 INT 37 LYS B 233 ? LYS B 233 . ? 1_555 ? 
31 INT 37 VAL B 236 ? VAL B 236 . ? 1_555 ? 
32 INT 37 GLU B 239 ? GLU B 239 . ? 1_555 ? 
33 INT 37 LEU B 240 ? LEU B 240 . ? 1_555 ? 
34 INT 37 ASN B 245 ? ASN B 245 . ? 1_555 ? 
35 INT 37 HOH D .   ? HOH B 248 . ? 1_555 ? 
36 INT 37 HOH C .   ? HOH A 248 . ? 1_555 ? 
37 INT 37 HOH D .   ? HOH B 260 . ? 1_555 ? 
38 INT 37 HOH D .   ? HOH B 294 . ? 1_555 ? 
39 INT 37 HOH D .   ? HOH B 296 . ? 1_555 ? 
40 INT 37 HOH C .   ? HOH A 309 . ? 1_555 ? 
41 INT 37 HOH C .   ? HOH A 311 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1SMN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SMN 
_atom_sites.fract_transf_matrix[1][1]   0.009372 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013423 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014514 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 5   ? 21.945  4.227  52.625 1.00 35.07 ? 5   SER A N   1 
ATOM   2    C CA  . SER A 1 5   ? 20.544  3.939  52.177 1.00 33.62 ? 5   SER A CA  1 
ATOM   3    C C   . SER A 1 5   ? 19.513  4.353  53.235 1.00 31.20 ? 5   SER A C   1 
ATOM   4    O O   . SER A 1 5   ? 18.474  3.718  53.427 1.00 32.84 ? 5   SER A O   1 
ATOM   5    C CB  . SER A 1 5   ? 20.375  2.457  51.824 1.00 35.76 ? 5   SER A CB  1 
ATOM   6    O OG  . SER A 1 5   ? 19.067  2.228  51.300 1.00 38.15 ? 5   SER A OG  1 
ATOM   7    N N   . ILE A 1 6   ? 19.874  5.328  54.035 1.00 27.16 ? 6   ILE A N   1 
ATOM   8    C CA  . ILE A 1 6   ? 18.933  5.824  54.992 1.00 23.16 ? 6   ILE A CA  1 
ATOM   9    C C   . ILE A 1 6   ? 18.563  7.066  54.204 1.00 21.06 ? 6   ILE A C   1 
ATOM   10   O O   . ILE A 1 6   ? 19.457  7.765  53.712 1.00 20.82 ? 6   ILE A O   1 
ATOM   11   C CB  . ILE A 1 6   ? 19.640  6.229  56.253 1.00 22.19 ? 6   ILE A CB  1 
ATOM   12   C CG1 . ILE A 1 6   ? 19.988  4.980  57.056 1.00 21.92 ? 6   ILE A CG1 1 
ATOM   13   C CG2 . ILE A 1 6   ? 18.805  7.218  57.026 1.00 22.29 ? 6   ILE A CG2 1 
ATOM   14   C CD1 . ILE A 1 6   ? 21.115  5.216  58.033 1.00 21.33 ? 6   ILE A CD1 1 
ATOM   15   N N   . ASP A 1 7   ? 17.279  7.290  53.979 1.00 18.14 ? 7   ASP A N   1 
ATOM   16   C CA  . ASP A 1 7   ? 16.870  8.482  53.252 1.00 14.97 ? 7   ASP A CA  1 
ATOM   17   C C   . ASP A 1 7   ? 16.268  9.445  54.241 1.00 11.99 ? 7   ASP A C   1 
ATOM   18   O O   . ASP A 1 7   ? 15.175  9.228  54.708 1.00 11.98 ? 7   ASP A O   1 
ATOM   19   C CB  . ASP A 1 7   ? 15.847  8.147  52.173 1.00 15.98 ? 7   ASP A CB  1 
ATOM   20   C CG  . ASP A 1 7   ? 15.502  9.360  51.296 1.00 16.35 ? 7   ASP A CG  1 
ATOM   21   O OD1 . ASP A 1 7   ? 15.947  10.486 51.587 1.00 15.30 ? 7   ASP A OD1 1 
ATOM   22   O OD2 . ASP A 1 7   ? 14.798  9.180  50.288 1.00 19.09 ? 7   ASP A OD2 1 
ATOM   23   N N   . ASN A 1 8   ? 16.974  10.520 54.541 1.00 9.05  ? 8   ASN A N   1 
ATOM   24   C CA  . ASN A 1 8   ? 16.469  11.499 55.498 1.00 7.91  ? 8   ASN A CA  1 
ATOM   25   C C   . ASN A 1 8   ? 15.854  12.717 54.815 1.00 6.17  ? 8   ASN A C   1 
ATOM   26   O O   . ASN A 1 8   ? 15.532  13.721 55.450 1.00 5.40  ? 8   ASN A O   1 
ATOM   27   C CB  . ASN A 1 8   ? 17.625  11.941 56.423 1.00 7.95  ? 8   ASN A CB  1 
ATOM   28   C CG  . ASN A 1 8   ? 18.048  10.849 57.391 1.00 8.60  ? 8   ASN A CG  1 
ATOM   29   O OD1 . ASN A 1 8   ? 17.196  10.239 58.020 1.00 10.10 ? 8   ASN A OD1 1 
ATOM   30   N ND2 . ASN A 1 8   ? 19.357  10.621 57.540 1.00 6.32  ? 8   ASN A ND2 1 
ATOM   31   N N   . CYS A 1 9   ? 15.745  12.642 53.500 1.00 5.55  ? 9   CYS A N   1 
ATOM   32   C CA  . CYS A 1 9   ? 15.227  13.755 52.698 1.00 6.48  ? 9   CYS A CA  1 
ATOM   33   C C   . CYS A 1 9   ? 13.918  13.489 51.948 1.00 6.33  ? 9   CYS A C   1 
ATOM   34   O O   . CYS A 1 9   ? 13.155  14.435 51.692 1.00 7.33  ? 9   CYS A O   1 
ATOM   35   C CB  . CYS A 1 9   ? 16.300  14.212 51.705 1.00 5.49  ? 9   CYS A CB  1 
ATOM   36   S SG  . CYS A 1 9   ? 17.817  14.720 52.554 1.00 6.15  ? 9   CYS A SG  1 
ATOM   37   N N   . ALA A 1 10  ? 13.700  12.235 51.563 1.00 5.00  ? 10  ALA A N   1 
ATOM   38   C CA  . ALA A 1 10  ? 12.507  11.813 50.843 1.00 5.43  ? 10  ALA A CA  1 
ATOM   39   C C   . ALA A 1 10  ? 12.365  12.349 49.420 1.00 6.18  ? 10  ALA A C   1 
ATOM   40   O O   . ALA A 1 10  ? 12.014  11.590 48.539 1.00 7.66  ? 10  ALA A O   1 
ATOM   41   C CB  . ALA A 1 10  ? 11.231  12.141 51.638 1.00 5.59  ? 10  ALA A CB  1 
ATOM   42   N N   . VAL A 1 11  ? 12.582  13.641 49.183 1.00 5.11  ? 11  VAL A N   1 
ATOM   43   C CA  . VAL A 1 11  ? 12.415  14.205 47.844 1.00 4.98  ? 11  VAL A CA  1 
ATOM   44   C C   . VAL A 1 11  ? 13.738  14.791 47.289 1.00 5.43  ? 11  VAL A C   1 
ATOM   45   O O   . VAL A 1 11  ? 13.732  15.746 46.495 1.00 3.82  ? 11  VAL A O   1 
ATOM   46   C CB  . VAL A 1 11  ? 11.247  15.278 47.837 1.00 4.92  ? 11  VAL A CB  1 
ATOM   47   C CG1 . VAL A 1 11  ? 9.905   14.578 48.181 1.00 4.25  ? 11  VAL A CG1 1 
ATOM   48   C CG2 . VAL A 1 11  ? 11.524  16.408 48.830 1.00 5.72  ? 11  VAL A CG2 1 
ATOM   49   N N   . GLY A 1 12  ? 14.863  14.241 47.767 1.00 5.14  ? 12  GLY A N   1 
ATOM   50   C CA  . GLY A 1 12  ? 16.167  14.700 47.302 1.00 5.10  ? 12  GLY A CA  1 
ATOM   51   C C   . GLY A 1 12  ? 16.826  15.643 48.287 1.00 5.14  ? 12  GLY A C   1 
ATOM   52   O O   . GLY A 1 12  ? 16.289  16.688 48.628 1.00 5.89  ? 12  GLY A O   1 
ATOM   53   N N   . CYS A 1 13  ? 17.996  15.276 48.775 1.00 4.20  ? 13  CYS A N   1 
ATOM   54   C CA  . CYS A 1 13  ? 18.702  16.117 49.720 1.00 4.14  ? 13  CYS A CA  1 
ATOM   55   C C   . CYS A 1 13  ? 19.157  17.335 48.940 1.00 3.52  ? 13  CYS A C   1 
ATOM   56   O O   . CYS A 1 13  ? 19.230  17.293 47.717 1.00 4.24  ? 13  CYS A O   1 
ATOM   57   C CB  . CYS A 1 13  ? 19.867  15.354 50.355 1.00 4.31  ? 13  CYS A CB  1 
ATOM   58   S SG  . CYS A 1 13  ? 19.325  13.964 51.404 1.00 7.23  ? 13  CYS A SG  1 
ATOM   59   N N   . PRO A 1 14  ? 19.453  18.440 49.624 1.00 2.54  ? 14  PRO A N   1 
ATOM   60   C CA  . PRO A 1 14  ? 19.887  19.655 48.900 1.00 2.75  ? 14  PRO A CA  1 
ATOM   61   C C   . PRO A 1 14  ? 21.182  19.542 48.066 1.00 3.56  ? 14  PRO A C   1 
ATOM   62   O O   . PRO A 1 14  ? 22.087  18.763 48.408 1.00 3.18  ? 14  PRO A O   1 
ATOM   63   C CB  . PRO A 1 14  ? 20.045  20.716 50.015 1.00 2.13  ? 14  PRO A CB  1 
ATOM   64   C CG  . PRO A 1 14  ? 19.110  20.192 51.158 1.00 2.00  ? 14  PRO A CG  1 
ATOM   65   C CD  . PRO A 1 14  ? 19.317  18.659 51.075 1.00 2.24  ? 14  PRO A CD  1 
ATOM   66   N N   . THR A 1 15  ? 21.227  20.272 46.948 1.00 2.90  ? 15  THR A N   1 
ATOM   67   C CA  . THR A 1 15  ? 22.421  20.337 46.122 1.00 4.21  ? 15  THR A CA  1 
ATOM   68   C C   . THR A 1 15  ? 23.027  21.728 46.410 1.00 5.14  ? 15  THR A C   1 
ATOM   69   O O   . THR A 1 15  ? 22.344  22.639 46.939 1.00 4.56  ? 15  THR A O   1 
ATOM   70   C CB  . THR A 1 15  ? 22.112  20.178 44.582 1.00 3.11  ? 15  THR A CB  1 
ATOM   71   O OG1 . THR A 1 15  ? 21.183  21.178 44.171 1.00 2.56  ? 15  THR A OG1 1 
ATOM   72   C CG2 . THR A 1 15  ? 21.527  18.821 44.290 1.00 3.00  ? 15  THR A CG2 1 
ATOM   73   N N   . GLY A 1 16  ? 24.304  21.919 46.100 1.00 5.94  ? 16  GLY A N   1 
ATOM   74   C CA  . GLY A 1 16  ? 24.860  23.236 46.332 1.00 6.78  ? 16  GLY A CA  1 
ATOM   75   C C   . GLY A 1 16  ? 25.764  23.349 47.534 1.00 8.56  ? 16  GLY A C   1 
ATOM   76   O O   . GLY A 1 16  ? 26.422  24.363 47.691 1.00 9.09  ? 16  GLY A O   1 
ATOM   77   N N   . GLY A 1 17  ? 25.797  22.328 48.383 1.00 10.09 ? 17  GLY A N   1 
ATOM   78   C CA  . GLY A 1 17  ? 26.640  22.361 49.570 1.00 11.80 ? 17  GLY A CA  1 
ATOM   79   C C   . GLY A 1 17  ? 28.112  22.363 49.204 1.00 13.67 ? 17  GLY A C   1 
ATOM   80   O O   . GLY A 1 17  ? 28.506  21.846 48.140 1.00 13.76 ? 17  GLY A O   1 
ATOM   81   N N   . SER A 1 18  ? 28.942  22.911 50.081 1.00 13.96 ? 18  SER A N   1 
ATOM   82   C CA  . SER A 1 18  ? 30.367  22.990 49.802 1.00 14.17 ? 18  SER A CA  1 
ATOM   83   C C   . SER A 1 18  ? 31.054  21.645 49.720 1.00 15.68 ? 18  SER A C   1 
ATOM   84   O O   . SER A 1 18  ? 32.101  21.547 49.106 1.00 16.02 ? 18  SER A O   1 
ATOM   85   C CB  . SER A 1 18  ? 31.066  23.861 50.841 1.00 12.74 ? 18  SER A CB  1 
ATOM   86   O OG  . SER A 1 18  ? 31.018  23.260 52.128 1.00 10.23 ? 18  SER A OG  1 
ATOM   87   N N   . SER A 1 19  ? 30.535  20.619 50.382 1.00 16.93 ? 19  SER A N   1 
ATOM   88   C CA  . SER A 1 19  ? 31.177  19.316 50.291 1.00 18.84 ? 19  SER A CA  1 
ATOM   89   C C   . SER A 1 19  ? 30.471  18.473 49.290 1.00 19.76 ? 19  SER A C   1 
ATOM   90   O O   . SER A 1 19  ? 29.262  18.595 49.143 1.00 19.42 ? 19  SER A O   1 
ATOM   91   C CB  . SER A 1 19  ? 31.114  18.550 51.605 1.00 19.90 ? 19  SER A CB  1 
ATOM   92   O OG  . SER A 1 19  ? 31.922  19.168 52.576 1.00 24.23 ? 19  SER A OG  1 
ATOM   93   N N   . ASN A 1 20  ? 31.204  17.586 48.623 1.00 21.24 ? 20  ASN A N   1 
ATOM   94   C CA  . ASN A 1 20  ? 30.563  16.695 47.670 1.00 23.08 ? 20  ASN A CA  1 
ATOM   95   C C   . ASN A 1 20  ? 30.047  15.461 48.325 1.00 22.47 ? 20  ASN A C   1 
ATOM   96   O O   . ASN A 1 20  ? 29.192  14.801 47.759 1.00 23.22 ? 20  ASN A O   1 
ATOM   97   C CB  . ASN A 1 20  ? 31.460  16.314 46.529 1.00 27.13 ? 20  ASN A CB  1 
ATOM   98   C CG  . ASN A 1 20  ? 31.753  17.473 45.649 1.00 31.26 ? 20  ASN A CG  1 
ATOM   99   O OD1 . ASN A 1 20  ? 32.879  17.592 45.172 1.00 35.48 ? 20  ASN A OD1 1 
ATOM   100  N ND2 . ASN A 1 20  ? 30.778  18.401 45.483 1.00 32.64 ? 20  ASN A ND2 1 
ATOM   101  N N   . VAL A 1 21  ? 30.556  15.143 49.512 1.00 21.20 ? 21  VAL A N   1 
ATOM   102  C CA  . VAL A 1 21  ? 30.059  13.983 50.239 1.00 20.91 ? 21  VAL A CA  1 
ATOM   103  C C   . VAL A 1 21  ? 29.367  14.486 51.510 1.00 19.08 ? 21  VAL A C   1 
ATOM   104  O O   . VAL A 1 21  ? 29.810  15.454 52.116 1.00 19.87 ? 21  VAL A O   1 
ATOM   105  C CB  . VAL A 1 21  ? 31.201  12.997 50.621 1.00 22.46 ? 21  VAL A CB  1 
ATOM   106  C CG1 . VAL A 1 21  ? 30.610  11.726 51.229 1.00 23.73 ? 21  VAL A CG1 1 
ATOM   107  C CG2 . VAL A 1 21  ? 32.011  12.624 49.372 1.00 23.72 ? 21  VAL A CG2 1 
ATOM   108  N N   . SER A 1 22  ? 28.259  13.863 51.877 1.00 16.83 ? 22  SER A N   1 
ATOM   109  C CA  . SER A 1 22  ? 27.526  14.238 53.073 1.00 14.99 ? 22  SER A CA  1 
ATOM   110  C C   . SER A 1 22  ? 27.617  13.032 53.976 1.00 13.56 ? 22  SER A C   1 
ATOM   111  O O   . SER A 1 22  ? 27.870  11.926 53.492 1.00 13.33 ? 22  SER A O   1 
ATOM   112  C CB  . SER A 1 22  ? 26.058  14.494 52.726 1.00 14.59 ? 22  SER A CB  1 
ATOM   113  O OG  . SER A 1 22  ? 25.960  15.579 51.836 1.00 15.19 ? 22  SER A OG  1 
ATOM   114  N N   . ILE A 1 23  ? 27.455  13.250 55.279 1.00 11.75 ? 23  ILE A N   1 
ATOM   115  C CA  . ILE A 1 23  ? 27.484  12.182 56.283 1.00 10.54 ? 23  ILE A CA  1 
ATOM   116  C C   . ILE A 1 23  ? 26.045  11.709 56.406 1.00 8.89  ? 23  ILE A C   1 
ATOM   117  O O   . ILE A 1 23  ? 25.151  12.536 56.589 1.00 7.84  ? 23  ILE A O   1 
ATOM   118  C CB  . ILE A 1 23  ? 27.903  12.729 57.688 1.00 12.29 ? 23  ILE A CB  1 
ATOM   119  C CG1 . ILE A 1 23  ? 29.283  13.380 57.639 1.00 13.88 ? 23  ILE A CG1 1 
ATOM   120  C CG2 . ILE A 1 23  ? 27.860  11.626 58.729 1.00 12.05 ? 23  ILE A CG2 1 
ATOM   121  C CD1 . ILE A 1 23  ? 30.345  12.447 57.101 1.00 16.78 ? 23  ILE A CD1 1 
ATOM   122  N N   . VAL A 1 24  ? 25.804  10.414 56.341 1.00 7.24  ? 24  VAL A N   1 
ATOM   123  C CA  . VAL A 1 24  ? 24.437  9.927  56.431 1.00 8.34  ? 24  VAL A CA  1 
ATOM   124  C C   . VAL A 1 24  ? 24.376  9.074  57.684 1.00 9.01  ? 24  VAL A C   1 
ATOM   125  O O   . VAL A 1 24  ? 25.203  8.193  57.844 1.00 9.46  ? 24  VAL A O   1 
ATOM   126  C CB  . VAL A 1 24  ? 24.072  9.067  55.179 1.00 9.08  ? 24  VAL A CB  1 
ATOM   127  C CG1 . VAL A 1 24  ? 22.728  8.365  55.363 1.00 9.59  ? 24  VAL A CG1 1 
ATOM   128  C CG2 . VAL A 1 24  ? 24.094  9.935  53.905 1.00 7.83  ? 24  VAL A CG2 1 
ATOM   129  N N   . ARG A 1 25  ? 23.482  9.399  58.614 1.00 7.94  ? 25  ARG A N   1 
ATOM   130  C CA  . ARG A 1 25  ? 23.325  8.640  59.837 1.00 7.72  ? 25  ARG A CA  1 
ATOM   131  C C   . ARG A 1 25  ? 21.828  8.403  60.009 1.00 8.61  ? 25  ARG A C   1 
ATOM   132  O O   . ARG A 1 25  ? 21.019  8.915  59.222 1.00 8.69  ? 25  ARG A O   1 
ATOM   133  C CB  . ARG A 1 25  ? 23.820  9.469  61.050 1.00 7.80  ? 25  ARG A CB  1 
ATOM   134  C CG  . ARG A 1 25  ? 25.305  9.551  61.169 1.00 7.55  ? 25  ARG A CG  1 
ATOM   135  C CD  . ARG A 1 25  ? 25.755  10.538 62.184 1.00 7.82  ? 25  ARG A CD  1 
ATOM   136  N NE  . ARG A 1 25  ? 27.198  10.415 62.253 1.00 8.51  ? 25  ARG A NE  1 
ATOM   137  C CZ  . ARG A 1 25  ? 28.075  11.410 62.301 1.00 9.16  ? 25  ARG A CZ  1 
ATOM   138  N NH1 . ARG A 1 25  ? 27.678  12.673 62.315 1.00 9.09  ? 25  ARG A NH1 1 
ATOM   139  N NH2 . ARG A 1 25  ? 29.378  11.118 62.296 1.00 10.55 ? 25  ARG A NH2 1 
ATOM   140  N N   . HIS A 1 26  ? 21.441  7.674  61.057 1.00 8.53  ? 26  HIS A N   1 
ATOM   141  C CA  . HIS A 1 26  ? 20.022  7.482  61.304 1.00 8.77  ? 26  HIS A CA  1 
ATOM   142  C C   . HIS A 1 26  ? 19.490  8.796  61.856 1.00 7.79  ? 26  HIS A C   1 
ATOM   143  O O   . HIS A 1 26  ? 18.382  9.226  61.546 1.00 7.60  ? 26  HIS A O   1 
ATOM   144  C CB  . HIS A 1 26  ? 19.793  6.357  62.302 1.00 10.61 ? 26  HIS A CB  1 
ATOM   145  C CG  . HIS A 1 26  ? 20.182  5.024  61.773 1.00 12.88 ? 26  HIS A CG  1 
ATOM   146  N ND1 . HIS A 1 26  ? 21.373  4.408  62.100 1.00 15.03 ? 26  HIS A ND1 1 
ATOM   147  C CD2 . HIS A 1 26  ? 19.572  4.216  60.882 1.00 14.41 ? 26  HIS A CD2 1 
ATOM   148  C CE1 . HIS A 1 26  ? 21.483  3.274  61.433 1.00 14.67 ? 26  HIS A CE1 1 
ATOM   149  N NE2 . HIS A 1 26  ? 20.402  3.136  60.685 1.00 17.27 ? 26  HIS A NE2 1 
ATOM   150  N N   . ALA A 1 27  ? 20.324  9.477  62.620 1.00 6.59  ? 27  ALA A N   1 
ATOM   151  C CA  . ALA A 1 27  ? 19.910  10.725 63.223 1.00 6.23  ? 27  ALA A CA  1 
ATOM   152  C C   . ALA A 1 27  ? 19.673  11.836 62.209 1.00 6.69  ? 27  ALA A C   1 
ATOM   153  O O   . ALA A 1 27  ? 18.759  12.636 62.395 1.00 7.12  ? 27  ALA A O   1 
ATOM   154  C CB  . ALA A 1 27  ? 20.934  11.184 64.282 1.00 5.32  ? 27  ALA A CB  1 
ATOM   155  N N   . TYR A 1 28  ? 20.469  11.874 61.136 1.00 5.76  ? 28  TYR A N   1 
ATOM   156  C CA  . TYR A 1 28  ? 20.353  12.935 60.148 1.00 4.97  ? 28  TYR A CA  1 
ATOM   157  C C   . TYR A 1 28  ? 21.351  12.705 59.048 1.00 5.37  ? 28  TYR A C   1 
ATOM   158  O O   . TYR A 1 28  ? 22.156  11.756 59.101 1.00 4.25  ? 28  TYR A O   1 
ATOM   159  C CB  . TYR A 1 28  ? 20.677  14.300 60.810 1.00 4.30  ? 28  TYR A CB  1 
ATOM   160  C CG  . TYR A 1 28  ? 22.024  14.359 61.553 1.00 4.86  ? 28  TYR A CG  1 
ATOM   161  C CD1 . TYR A 1 28  ? 23.247  14.338 60.851 1.00 5.91  ? 28  TYR A CD1 1 
ATOM   162  C CD2 . TYR A 1 28  ? 22.075  14.355 62.945 1.00 4.02  ? 28  TYR A CD2 1 
ATOM   163  C CE1 . TYR A 1 28  ? 24.489  14.298 61.534 1.00 5.91  ? 28  TYR A CE1 1 
ATOM   164  C CE2 . TYR A 1 28  ? 23.302  14.326 63.640 1.00 5.21  ? 28  TYR A CE2 1 
ATOM   165  C CZ  . TYR A 1 28  ? 24.514  14.292 62.932 1.00 5.44  ? 28  TYR A CZ  1 
ATOM   166  O OH  . TYR A 1 28  ? 25.744  14.246 63.617 1.00 4.42  ? 28  TYR A OH  1 
ATOM   167  N N   . THR A 1 29  ? 21.272  13.580 58.047 1.00 5.56  ? 29  THR A N   1 
ATOM   168  C CA  . THR A 1 29  ? 22.201  13.632 56.905 1.00 5.61  ? 29  THR A CA  1 
ATOM   169  C C   . THR A 1 29  ? 22.756  15.049 56.969 1.00 5.86  ? 29  THR A C   1 
ATOM   170  O O   . THR A 1 29  ? 21.996  16.023 57.111 1.00 5.31  ? 29  THR A O   1 
ATOM   171  C CB  . THR A 1 29  ? 21.528  13.369 55.581 1.00 4.86  ? 29  THR A CB  1 
ATOM   172  O OG1 . THR A 1 29  ? 21.097  12.011 55.592 1.00 6.02  ? 29  THR A OG1 1 
ATOM   173  C CG2 . THR A 1 29  ? 22.513  13.554 54.457 1.00 3.55  ? 29  THR A CG2 1 
ATOM   174  N N   . LEU A 1 30  ? 24.065  15.175 56.858 1.00 4.97  ? 30  LEU A N   1 
ATOM   175  C CA  . LEU A 1 30  ? 24.678  16.481 57.033 1.00 6.39  ? 30  LEU A CA  1 
ATOM   176  C C   . LEU A 1 30  ? 25.758  16.762 56.010 1.00 6.15  ? 30  LEU A C   1 
ATOM   177  O O   . LEU A 1 30  ? 26.502  15.871 55.639 1.00 5.09  ? 30  LEU A O   1 
ATOM   178  C CB  . LEU A 1 30  ? 25.272  16.487 58.464 1.00 8.13  ? 30  LEU A CB  1 
ATOM   179  C CG  . LEU A 1 30  ? 26.201  17.497 59.126 1.00 10.88 ? 30  LEU A CG  1 
ATOM   180  C CD1 . LEU A 1 30  ? 26.067  17.342 60.630 1.00 9.27  ? 30  LEU A CD1 1 
ATOM   181  C CD2 . LEU A 1 30  ? 27.672  17.269 58.664 1.00 10.78 ? 30  LEU A CD2 1 
ATOM   182  N N   . ASN A 1 31  ? 25.810  17.995 55.532 1.00 5.76  ? 31  ASN A N   1 
ATOM   183  C CA  . ASN A 1 31  ? 26.831  18.400 54.577 1.00 5.43  ? 31  ASN A CA  1 
ATOM   184  C C   . ASN A 1 31  ? 27.712  19.436 55.308 1.00 5.49  ? 31  ASN A C   1 
ATOM   185  O O   . ASN A 1 31  ? 27.230  20.523 55.699 1.00 5.11  ? 31  ASN A O   1 
ATOM   186  C CB  . ASN A 1 31  ? 26.165  18.998 53.347 1.00 5.53  ? 31  ASN A CB  1 
ATOM   187  C CG  . ASN A 1 31  ? 27.129  19.250 52.240 1.00 5.66  ? 31  ASN A CG  1 
ATOM   188  O OD1 . ASN A 1 31  ? 27.634  20.357 52.078 1.00 8.38  ? 31  ASN A OD1 1 
ATOM   189  N ND2 . ASN A 1 31  ? 27.413  18.223 51.477 1.00 6.67  ? 31  ASN A ND2 1 
ATOM   190  N N   . ASN A 1 32  ? 28.986  19.094 55.534 1.00 6.01  ? 32  ASN A N   1 
ATOM   191  C CA  . ASN A 1 32  ? 29.883  19.964 56.280 1.00 5.97  ? 32  ASN A CA  1 
ATOM   192  C C   . ASN A 1 32  ? 30.567  21.003 55.438 1.00 7.46  ? 32  ASN A C   1 
ATOM   193  O O   . ASN A 1 32  ? 30.665  20.846 54.227 1.00 8.33  ? 32  ASN A O   1 
ATOM   194  C CB  . ASN A 1 32  ? 30.939  19.147 57.002 1.00 8.07  ? 32  ASN A CB  1 
ATOM   195  C CG  . ASN A 1 32  ? 31.727  19.979 58.022 1.00 10.28 ? 32  ASN A CG  1 
ATOM   196  O OD1 . ASN A 1 32  ? 31.142  20.546 58.951 1.00 10.50 ? 32  ASN A OD1 1 
ATOM   197  N ND2 . ASN A 1 32  ? 33.060  20.029 57.870 1.00 11.00 ? 32  ASN A ND2 1 
ATOM   198  N N   . ASN A 1 33  ? 30.923  22.129 56.054 1.00 7.17  ? 33  ASN A N   1 
ATOM   199  C CA  . ASN A 1 33  ? 31.643  23.177 55.357 1.00 7.85  ? 33  ASN A CA  1 
ATOM   200  C C   . ASN A 1 33  ? 32.973  23.283 56.113 1.00 8.71  ? 33  ASN A C   1 
ATOM   201  O O   . ASN A 1 33  ? 33.015  23.755 57.255 1.00 7.97  ? 33  ASN A O   1 
ATOM   202  C CB  . ASN A 1 33  ? 30.891  24.502 55.436 1.00 7.98  ? 33  ASN A CB  1 
ATOM   203  C CG  . ASN A 1 33  ? 31.559  25.598 54.605 1.00 9.62  ? 33  ASN A CG  1 
ATOM   204  O OD1 . ASN A 1 33  ? 32.760  25.843 54.739 1.00 7.65  ? 33  ASN A OD1 1 
ATOM   205  N ND2 . ASN A 1 33  ? 30.781  26.264 53.751 1.00 7.36  ? 33  ASN A ND2 1 
ATOM   206  N N   . SER A 1 34  ? 34.055  22.843 55.482 1.00 9.02  ? 34  SER A N   1 
ATOM   207  C CA  . SER A 1 34  ? 35.354  22.868 56.108 1.00 9.68  ? 34  SER A CA  1 
ATOM   208  C C   . SER A 1 34  ? 35.939  24.259 56.284 1.00 9.42  ? 34  SER A C   1 
ATOM   209  O O   . SER A 1 34  ? 36.883  24.435 57.033 1.00 9.76  ? 34  SER A O   1 
ATOM   210  C CB  . SER A 1 34  ? 36.289  21.930 55.369 1.00 10.83 ? 34  SER A CB  1 
ATOM   211  O OG  . SER A 1 34  ? 36.647  22.476 54.138 1.00 13.63 ? 34  SER A OG  1 
ATOM   212  N N   . THR A 1 35  ? 35.387  25.253 55.610 1.00 8.60  ? 35  THR A N   1 
ATOM   213  C CA  . THR A 1 35  ? 35.854  26.608 55.816 1.00 8.55  ? 35  THR A CA  1 
ATOM   214  C C   . THR A 1 35  ? 35.189  27.296 57.005 1.00 8.55  ? 35  THR A C   1 
ATOM   215  O O   . THR A 1 35  ? 35.841  27.949 57.822 1.00 8.43  ? 35  THR A O   1 
ATOM   216  C CB  . THR A 1 35  ? 35.614  27.467 54.583 1.00 10.32 ? 35  THR A CB  1 
ATOM   217  O OG1 . THR A 1 35  ? 36.286  26.872 53.466 1.00 11.02 ? 35  THR A OG1 1 
ATOM   218  C CG2 . THR A 1 35  ? 36.151  28.876 54.797 1.00 10.49 ? 35  THR A CG2 1 
ATOM   219  N N   . THR A 1 36  ? 33.871  27.181 57.108 1.00 8.35  ? 36  THR A N   1 
ATOM   220  C CA  . THR A 1 36  ? 33.162  27.848 58.200 1.00 7.54  ? 36  THR A CA  1 
ATOM   221  C C   . THR A 1 36  ? 33.256  27.049 59.493 1.00 7.06  ? 36  THR A C   1 
ATOM   222  O O   . THR A 1 36  ? 33.195  27.629 60.585 1.00 7.00  ? 36  THR A O   1 
ATOM   223  C CB  . THR A 1 36  ? 31.679  28.085 57.854 1.00 6.91  ? 36  THR A CB  1 
ATOM   224  O OG1 . THR A 1 36  ? 31.021  26.818 57.740 1.00 6.40  ? 36  THR A OG1 1 
ATOM   225  C CG2 . THR A 1 36  ? 31.567  28.865 56.486 1.00 6.36  ? 36  THR A CG2 1 
ATOM   226  N N   . LYS A 1 37  ? 33.451  25.739 59.326 1.00 5.97  ? 37  LYS A N   1 
ATOM   227  C CA  . LYS A 1 37  ? 33.558  24.725 60.379 1.00 5.77  ? 37  LYS A CA  1 
ATOM   228  C C   . LYS A 1 37  ? 32.170  24.266 60.872 1.00 5.97  ? 37  LYS A C   1 
ATOM   229  O O   . LYS A 1 37  ? 32.056  23.517 61.858 1.00 7.20  ? 37  LYS A O   1 
ATOM   230  C CB  . LYS A 1 37  ? 34.439  25.210 61.547 1.00 6.39  ? 37  LYS A CB  1 
ATOM   231  C CG  . LYS A 1 37  ? 35.901  25.606 61.180 1.00 6.07  ? 37  LYS A CG  1 
ATOM   232  C CD  . LYS A 1 37  ? 36.685  24.451 60.579 1.00 7.11  ? 37  LYS A CD  1 
ATOM   233  C CE  . LYS A 1 37  ? 38.111  24.858 60.164 1.00 8.92  ? 37  LYS A CE  1 
ATOM   234  N NZ  . LYS A 1 37  ? 38.142  26.018 59.226 1.00 9.27  ? 37  LYS A NZ  1 
ATOM   235  N N   . PHE A 1 38  ? 31.119  24.700 60.183 1.00 5.53  ? 38  PHE A N   1 
ATOM   236  C CA  . PHE A 1 38  ? 29.713  24.378 60.528 1.00 4.96  ? 38  PHE A CA  1 
ATOM   237  C C   . PHE A 1 38  ? 29.027  23.736 59.329 1.00 5.24  ? 38  PHE A C   1 
ATOM   238  O O   . PHE A 1 38  ? 29.417  23.951 58.173 1.00 5.43  ? 38  PHE A O   1 
ATOM   239  C CB  . PHE A 1 38  ? 28.946  25.648 60.969 1.00 3.66  ? 38  PHE A CB  1 
ATOM   240  C CG  . PHE A 1 38  ? 29.599  26.351 62.115 1.00 5.09  ? 38  PHE A CG  1 
ATOM   241  C CD1 . PHE A 1 38  ? 29.769  25.684 63.337 1.00 5.22  ? 38  PHE A CD1 1 
ATOM   242  C CD2 . PHE A 1 38  ? 30.197  27.603 61.936 1.00 3.89  ? 38  PHE A CD2 1 
ATOM   243  C CE1 . PHE A 1 38  ? 30.548  26.258 64.351 1.00 7.03  ? 38  PHE A CE1 1 
ATOM   244  C CE2 . PHE A 1 38  ? 30.966  28.183 62.925 1.00 5.14  ? 38  PHE A CE2 1 
ATOM   245  C CZ  . PHE A 1 38  ? 31.155  27.514 64.141 1.00 4.93  ? 38  PHE A CZ  1 
ATOM   246  N N   . ALA A 1 39  ? 28.019  22.924 59.590 1.00 4.67  ? 39  ALA A N   1 
ATOM   247  C CA  . ALA A 1 39  ? 27.341  22.246 58.490 1.00 5.35  ? 39  ALA A CA  1 
ATOM   248  C C   . ALA A 1 39  ? 26.546  23.219 57.612 1.00 5.27  ? 39  ALA A C   1 
ATOM   249  O O   . ALA A 1 39  ? 25.921  24.157 58.135 1.00 6.25  ? 39  ALA A O   1 
ATOM   250  C CB  . ALA A 1 39  ? 26.411  21.176 59.052 1.00 4.41  ? 39  ALA A CB  1 
ATOM   251  N N   . ASN A 1 40  ? 26.595  23.020 56.289 1.00 4.81  ? 40  ASN A N   1 
ATOM   252  C CA  . ASN A 1 40  ? 25.838  23.854 55.337 1.00 4.20  ? 40  ASN A CA  1 
ATOM   253  C C   . ASN A 1 40  ? 24.319  23.563 55.497 1.00 4.51  ? 40  ASN A C   1 
ATOM   254  O O   . ASN A 1 40  ? 23.457  24.447 55.366 1.00 4.18  ? 40  ASN A O   1 
ATOM   255  C CB  . ASN A 1 40  ? 26.230  23.517 53.896 1.00 3.80  ? 40  ASN A CB  1 
ATOM   256  C CG  . ASN A 1 40  ? 27.654  23.867 53.582 1.00 4.46  ? 40  ASN A CG  1 
ATOM   257  O OD1 . ASN A 1 40  ? 28.050  25.009 53.736 1.00 5.90  ? 40  ASN A OD1 1 
ATOM   258  N ND2 . ASN A 1 40  ? 28.426  22.898 53.118 1.00 3.59  ? 40  ASN A ND2 1 
ATOM   259  N N   . TRP A 1 41  ? 24.011  22.299 55.722 1.00 4.22  ? 41  TRP A N   1 
ATOM   260  C CA  . TRP A 1 41  ? 22.645  21.907 55.913 1.00 4.08  ? 41  TRP A CA  1 
ATOM   261  C C   . TRP A 1 41  ? 22.576  20.581 56.627 1.00 3.68  ? 41  TRP A C   1 
ATOM   262  O O   . TRP A 1 41  ? 23.527  19.802 56.595 1.00 3.63  ? 41  TRP A O   1 
ATOM   263  C CB  . TRP A 1 41  ? 21.883  21.877 54.561 1.00 3.12  ? 41  TRP A CB  1 
ATOM   264  C CG  . TRP A 1 41  ? 22.442  20.965 53.493 1.00 2.00  ? 41  TRP A CG  1 
ATOM   265  C CD1 . TRP A 1 41  ? 23.152  21.343 52.389 1.00 2.00  ? 41  TRP A CD1 1 
ATOM   266  C CD2 . TRP A 1 41  ? 22.270  19.545 53.395 1.00 2.46  ? 41  TRP A CD2 1 
ATOM   267  N NE1 . TRP A 1 41  ? 23.424  20.254 51.606 1.00 2.41  ? 41  TRP A NE1 1 
ATOM   268  C CE2 . TRP A 1 41  ? 22.900  19.133 52.201 1.00 2.00  ? 41  TRP A CE2 1 
ATOM   269  C CE3 . TRP A 1 41  ? 21.645  18.581 54.202 1.00 2.00  ? 41  TRP A CE3 1 
ATOM   270  C CZ2 . TRP A 1 41  ? 22.931  17.798 51.795 1.00 3.03  ? 41  TRP A CZ2 1 
ATOM   271  C CZ3 . TRP A 1 41  ? 21.668  17.271 53.807 1.00 2.00  ? 41  TRP A CZ3 1 
ATOM   272  C CH2 . TRP A 1 41  ? 22.308  16.877 52.612 1.00 2.87  ? 41  TRP A CH2 1 
ATOM   273  N N   . VAL A 1 42  ? 21.487  20.383 57.370 1.00 3.54  ? 42  VAL A N   1 
ATOM   274  C CA  . VAL A 1 42  ? 21.237  19.144 58.105 1.00 3.20  ? 42  VAL A CA  1 
ATOM   275  C C   . VAL A 1 42  ? 19.774  18.763 57.806 1.00 4.09  ? 42  VAL A C   1 
ATOM   276  O O   . VAL A 1 42  ? 18.863  19.582 57.961 1.00 4.10  ? 42  VAL A O   1 
ATOM   277  C CB  . VAL A 1 42  ? 21.461  19.307 59.643 1.00 2.70  ? 42  VAL A CB  1 
ATOM   278  C CG1 . VAL A 1 42  ? 21.369  17.918 60.308 1.00 2.00  ? 42  VAL A CG1 1 
ATOM   279  C CG2 . VAL A 1 42  ? 22.843  19.951 59.918 1.00 2.00  ? 42  VAL A CG2 1 
ATOM   280  N N   . ALA A 1 43  ? 19.573  17.555 57.279 1.00 3.79  ? 43  ALA A N   1 
ATOM   281  C CA  . ALA A 1 43  ? 18.254  17.044 56.915 1.00 3.48  ? 43  ALA A CA  1 
ATOM   282  C C   . ALA A 1 43  ? 17.928  15.915 57.882 1.00 3.77  ? 43  ALA A C   1 
ATOM   283  O O   . ALA A 1 43  ? 18.778  15.082 58.171 1.00 3.89  ? 43  ALA A O   1 
ATOM   284  C CB  . ALA A 1 43  ? 18.286  16.497 55.477 1.00 2.00  ? 43  ALA A CB  1 
ATOM   285  N N   . TYR A 1 44  ? 16.729  15.917 58.425 1.00 2.55  ? 44  TYR A N   1 
ATOM   286  C CA  . TYR A 1 44  ? 16.357  14.875 59.327 1.00 3.18  ? 44  TYR A CA  1 
ATOM   287  C C   . TYR A 1 44  ? 14.887  14.498 59.132 1.00 4.56  ? 44  TYR A C   1 
ATOM   288  O O   . TYR A 1 44  ? 14.080  15.252 58.538 1.00 4.05  ? 44  TYR A O   1 
ATOM   289  C CB  . TYR A 1 44  ? 16.706  15.235 60.786 1.00 2.56  ? 44  TYR A CB  1 
ATOM   290  C CG  . TYR A 1 44  ? 16.114  16.537 61.254 1.00 2.67  ? 44  TYR A CG  1 
ATOM   291  C CD1 . TYR A 1 44  ? 16.814  17.723 61.094 1.00 2.10  ? 44  TYR A CD1 1 
ATOM   292  C CD2 . TYR A 1 44  ? 14.848  16.572 61.885 1.00 2.00  ? 44  TYR A CD2 1 
ATOM   293  C CE1 . TYR A 1 44  ? 16.294  18.921 61.554 1.00 2.98  ? 44  TYR A CE1 1 
ATOM   294  C CE2 . TYR A 1 44  ? 14.318  17.763 62.346 1.00 2.45  ? 44  TYR A CE2 1 
ATOM   295  C CZ  . TYR A 1 44  ? 15.056  18.929 62.175 1.00 2.40  ? 44  TYR A CZ  1 
ATOM   296  O OH  . TYR A 1 44  ? 14.575  20.110 62.639 1.00 3.55  ? 44  TYR A OH  1 
ATOM   297  N N   . HIS A 1 45  ? 14.532  13.367 59.723 1.00 5.93  ? 45  HIS A N   1 
ATOM   298  C CA  . HIS A 1 45  ? 13.215  12.772 59.571 1.00 6.63  ? 45  HIS A CA  1 
ATOM   299  C C   . HIS A 1 45  ? 12.629  12.312 60.930 1.00 7.79  ? 45  HIS A C   1 
ATOM   300  O O   . HIS A 1 45  ? 13.085  11.311 61.527 1.00 7.19  ? 45  HIS A O   1 
ATOM   301  C CB  . HIS A 1 45  ? 13.422  11.587 58.606 1.00 6.68  ? 45  HIS A CB  1 
ATOM   302  C CG  . HIS A 1 45  ? 12.210  10.762 58.365 1.00 7.67  ? 45  HIS A CG  1 
ATOM   303  N ND1 . HIS A 1 45  ? 12.283  9.422  58.043 1.00 8.11  ? 45  HIS A ND1 1 
ATOM   304  C CD2 . HIS A 1 45  ? 10.895  11.080 58.388 1.00 6.70  ? 45  HIS A CD2 1 
ATOM   305  C CE1 . HIS A 1 45  ? 11.061  8.953  57.879 1.00 7.96  ? 45  HIS A CE1 1 
ATOM   306  N NE2 . HIS A 1 45  ? 10.204  9.939  58.082 1.00 7.73  ? 45  HIS A NE2 1 
ATOM   307  N N   . ILE A 1 46  ? 11.667  13.080 61.444 1.00 7.37  ? 46  ILE A N   1 
ATOM   308  C CA  . ILE A 1 46  ? 11.026  12.732 62.694 1.00 7.98  ? 46  ILE A CA  1 
ATOM   309  C C   . ILE A 1 46  ? 9.856   11.761 62.435 1.00 8.91  ? 46  ILE A C   1 
ATOM   310  O O   . ILE A 1 46  ? 9.113   11.937 61.455 1.00 9.14  ? 46  ILE A O   1 
ATOM   311  C CB  . ILE A 1 46  ? 10.444  13.975 63.385 1.00 7.18  ? 46  ILE A CB  1 
ATOM   312  C CG1 . ILE A 1 46  ? 11.541  15.019 63.620 1.00 6.79  ? 46  ILE A CG1 1 
ATOM   313  C CG2 . ILE A 1 46  ? 9.789   13.562 64.737 1.00 6.88  ? 46  ILE A CG2 1 
ATOM   314  C CD1 . ILE A 1 46  ? 11.020  16.421 64.041 1.00 5.66  ? 46  ILE A CD1 1 
ATOM   315  N N   . THR A 1 47  ? 9.762   10.695 63.227 1.00 9.39  ? 47  THR A N   1 
ATOM   316  C CA  . THR A 1 47  ? 8.630   9.764  63.143 1.00 10.82 ? 47  THR A CA  1 
ATOM   317  C C   . THR A 1 47  ? 8.159   9.562  64.583 1.00 12.03 ? 47  THR A C   1 
ATOM   318  O O   . THR A 1 47  ? 8.758   10.117 65.522 1.00 11.26 ? 47  THR A O   1 
ATOM   319  C CB  . THR A 1 47  ? 8.966   8.382  62.549 1.00 11.15 ? 47  THR A CB  1 
ATOM   320  O OG1 . THR A 1 47  ? 9.738   7.616  63.472 1.00 11.22 ? 47  THR A OG1 1 
ATOM   321  C CG2 . THR A 1 47  ? 9.703   8.518  61.254 1.00 12.41 ? 47  THR A CG2 1 
ATOM   322  N N   . LYS A 1 48  ? 7.088   8.791  64.772 1.00 12.85 ? 48  LYS A N   1 
ATOM   323  C CA  . LYS A 1 48  ? 6.594   8.562  66.124 1.00 14.49 ? 48  LYS A CA  1 
ATOM   324  C C   . LYS A 1 48  ? 7.640   7.870  67.017 1.00 13.93 ? 48  LYS A C   1 
ATOM   325  O O   . LYS A 1 48  ? 7.630   8.046  68.229 1.00 14.08 ? 48  LYS A O   1 
ATOM   326  C CB  . LYS A 1 48  ? 5.289   7.743  66.116 1.00 16.19 ? 48  LYS A CB  1 
ATOM   327  C CG  . LYS A 1 48  ? 4.020   8.568  65.832 1.00 19.20 ? 48  LYS A CG  1 
ATOM   328  C CD  . LYS A 1 48  ? 3.721   8.740  64.314 1.00 21.74 ? 48  LYS A CD  1 
ATOM   329  C CE  . LYS A 1 48  ? 2.220   8.937  63.952 1.00 20.99 ? 48  LYS A CE  1 
ATOM   330  N NZ  . LYS A 1 48  ? 1.625   10.186 64.522 1.00 20.75 ? 48  LYS A NZ  1 
ATOM   331  N N   . ASP A 1 49  ? 8.577   7.152  66.413 1.00 13.84 ? 49  ASP A N   1 
ATOM   332  C CA  . ASP A 1 49  ? 9.606   6.428  67.164 1.00 14.73 ? 49  ASP A CA  1 
ATOM   333  C C   . ASP A 1 49  ? 10.925  7.139  67.414 1.00 14.32 ? 49  ASP A C   1 
ATOM   334  O O   . ASP A 1 49  ? 11.825  6.543  68.018 1.00 14.68 ? 49  ASP A O   1 
ATOM   335  C CB  . ASP A 1 49  ? 9.954   5.153  66.422 1.00 17.63 ? 49  ASP A CB  1 
ATOM   336  C CG  . ASP A 1 49  ? 8.753   4.267  66.223 1.00 21.69 ? 49  ASP A CG  1 
ATOM   337  O OD1 . ASP A 1 49  ? 7.961   4.095  67.187 1.00 23.47 ? 49  ASP A OD1 1 
ATOM   338  O OD2 . ASP A 1 49  ? 8.575   3.782  65.094 1.00 24.76 ? 49  ASP A OD2 1 
ATOM   339  N N   . THR A 1 50  ? 11.094  8.353  66.897 1.00 12.64 ? 50  THR A N   1 
ATOM   340  C CA  . THR A 1 50  ? 12.378  9.030  67.066 1.00 11.76 ? 50  THR A CA  1 
ATOM   341  C C   . THR A 1 50  ? 12.554  9.907  68.315 1.00 11.96 ? 50  THR A C   1 
ATOM   342  O O   . THR A 1 50  ? 13.686  10.075 68.777 1.00 12.37 ? 50  THR A O   1 
ATOM   343  C CB  . THR A 1 50  ? 12.820  9.826  65.777 1.00 9.82  ? 50  THR A CB  1 
ATOM   344  O OG1 . THR A 1 50  ? 11.879  10.851 65.499 1.00 8.21  ? 50  THR A OG1 1 
ATOM   345  C CG2 . THR A 1 50  ? 12.904  8.929  64.550 1.00 8.91  ? 50  THR A CG2 1 
ATOM   346  N N   . PRO A 1 51  ? 11.467  10.512 68.849 1.00 12.02 ? 51  PRO A N   1 
ATOM   347  C CA  . PRO A 1 51  ? 11.662  11.351 70.038 1.00 12.60 ? 51  PRO A CA  1 
ATOM   348  C C   . PRO A 1 51  ? 12.052  10.561 71.280 1.00 13.58 ? 51  PRO A C   1 
ATOM   349  O O   . PRO A 1 51  ? 11.726  9.395  71.417 1.00 13.24 ? 51  PRO A O   1 
ATOM   350  C CB  . PRO A 1 51  ? 10.300  12.032 70.212 1.00 11.48 ? 51  PRO A CB  1 
ATOM   351  C CG  . PRO A 1 51  ? 9.774   12.072 68.828 1.00 12.30 ? 51  PRO A CG  1 
ATOM   352  C CD  . PRO A 1 51  ? 10.103  10.701 68.324 1.00 11.80 ? 51  PRO A CD  1 
ATOM   353  N N   . ALA A 1 52  ? 12.790  11.202 72.161 1.00 14.35 ? 52  ALA A N   1 
ATOM   354  C CA  . ALA A 1 52  ? 13.203  10.575 73.390 1.00 15.53 ? 52  ALA A CA  1 
ATOM   355  C C   . ALA A 1 52  ? 13.590  11.722 74.296 1.00 16.85 ? 52  ALA A C   1 
ATOM   356  O O   . ALA A 1 52  ? 14.253  12.667 73.870 1.00 15.82 ? 52  ALA A O   1 
ATOM   357  C CB  . ALA A 1 52  ? 14.365  9.700  73.148 1.00 15.54 ? 52  ALA A CB  1 
ATOM   358  N N   . SER A 1 53  ? 13.178  11.652 75.549 1.00 18.43 ? 53  SER A N   1 
ATOM   359  C CA  . SER A 1 53  ? 13.530  12.718 76.461 1.00 21.11 ? 53  SER A CA  1 
ATOM   360  C C   . SER A 1 53  ? 14.593  12.309 77.479 1.00 21.13 ? 53  SER A C   1 
ATOM   361  O O   . SER A 1 53  ? 14.941  11.131 77.625 1.00 21.53 ? 53  SER A O   1 
ATOM   362  C CB  . SER A 1 53  ? 12.285  13.190 77.182 1.00 22.83 ? 53  SER A CB  1 
ATOM   363  O OG  . SER A 1 53  ? 11.694  12.048 77.791 1.00 27.97 ? 53  SER A OG  1 
ATOM   364  N N   . GLY A 1 54  ? 15.158  13.315 78.125 1.00 21.62 ? 54  GLY A N   1 
ATOM   365  C CA  . GLY A 1 54  ? 16.151  13.060 79.142 1.00 22.19 ? 54  GLY A CA  1 
ATOM   366  C C   . GLY A 1 54  ? 17.515  12.542 78.726 1.00 22.03 ? 54  GLY A C   1 
ATOM   367  O O   . GLY A 1 54  ? 18.220  11.968 79.560 1.00 24.03 ? 54  GLY A O   1 
ATOM   368  N N   . LYS A 1 55  ? 17.923  12.712 77.476 1.00 20.13 ? 55  LYS A N   1 
ATOM   369  C CA  . LYS A 1 55  ? 19.243  12.224 77.100 1.00 18.04 ? 55  LYS A CA  1 
ATOM   370  C C   . LYS A 1 55  ? 20.234  13.303 77.513 1.00 17.11 ? 55  LYS A C   1 
ATOM   371  O O   . LYS A 1 55  ? 19.876  14.490 77.613 1.00 16.83 ? 55  LYS A O   1 
ATOM   372  C CB  . LYS A 1 55  ? 19.317  11.962 75.604 1.00 18.44 ? 55  LYS A CB  1 
ATOM   373  C CG  . LYS A 1 55  ? 18.384  10.883 75.172 1.00 18.40 ? 55  LYS A CG  1 
ATOM   374  C CD  . LYS A 1 55  ? 19.006  9.532  75.213 1.00 19.32 ? 55  LYS A CD  1 
ATOM   375  C CE  . LYS A 1 55  ? 18.117  8.570  74.459 1.00 20.63 ? 55  LYS A CE  1 
ATOM   376  N NZ  . LYS A 1 55  ? 18.757  7.270  74.093 1.00 22.93 ? 55  LYS A NZ  1 
ATOM   377  N N   . THR A 1 56  ? 21.472  12.903 77.771 1.00 16.37 ? 56  THR A N   1 
ATOM   378  C CA  . THR A 1 56  ? 22.484  13.865 78.199 1.00 15.89 ? 56  THR A CA  1 
ATOM   379  C C   . THR A 1 56  ? 23.214  14.500 77.018 1.00 15.11 ? 56  THR A C   1 
ATOM   380  O O   . THR A 1 56  ? 23.047  14.096 75.849 1.00 13.87 ? 56  THR A O   1 
ATOM   381  C CB  . THR A 1 56  ? 23.443  13.197 79.178 1.00 16.35 ? 56  THR A CB  1 
ATOM   382  O OG1 . THR A 1 56  ? 24.030  12.043 78.558 1.00 16.79 ? 56  THR A OG1 1 
ATOM   383  C CG2 . THR A 1 56  ? 22.659  12.732 80.394 1.00 16.42 ? 56  THR A CG2 1 
ATOM   384  N N   . ARG A 1 57  ? 23.993  15.525 77.308 1.00 14.79 ? 57  ARG A N   1 
ATOM   385  C CA  . ARG A 1 57  ? 24.706  16.219 76.245 1.00 15.17 ? 57  ARG A CA  1 
ATOM   386  C C   . ARG A 1 57  ? 26.217  16.172 76.399 1.00 13.55 ? 57  ARG A C   1 
ATOM   387  O O   . ARG A 1 57  ? 26.824  17.050 77.022 1.00 13.30 ? 57  ARG A O   1 
ATOM   388  C CB  . ARG A 1 57  ? 24.234  17.671 76.149 1.00 17.85 ? 57  ARG A CB  1 
ATOM   389  C CG  . ARG A 1 57  ? 22.737  17.837 75.835 1.00 23.46 ? 57  ARG A CG  1 
ATOM   390  C CD  . ARG A 1 57  ? 22.172  19.040 76.573 1.00 28.75 ? 57  ARG A CD  1 
ATOM   391  N NE  . ARG A 1 57  ? 20.904  19.502 75.994 1.00 34.95 ? 57  ARG A NE  1 
ATOM   392  C CZ  . ARG A 1 57  ? 19.684  19.074 76.362 1.00 38.04 ? 57  ARG A CZ  1 
ATOM   393  N NH1 . ARG A 1 57  ? 19.543  18.157 77.333 1.00 38.81 ? 57  ARG A NH1 1 
ATOM   394  N NH2 . ARG A 1 57  ? 18.596  19.526 75.717 1.00 39.16 ? 57  ARG A NH2 1 
ATOM   395  N N   . ASN A 1 58  ? 26.814  15.116 75.872 1.00 11.21 ? 58  ASN A N   1 
ATOM   396  C CA  . ASN A 1 58  ? 28.275  14.983 75.895 1.00 9.95  ? 58  ASN A CA  1 
ATOM   397  C C   . ASN A 1 58  ? 28.826  15.455 74.554 1.00 8.82  ? 58  ASN A C   1 
ATOM   398  O O   . ASN A 1 58  ? 28.891  14.693 73.592 1.00 8.14  ? 58  ASN A O   1 
ATOM   399  C CB  . ASN A 1 58  ? 28.701  13.539 76.159 1.00 8.88  ? 58  ASN A CB  1 
ATOM   400  C CG  . ASN A 1 58  ? 28.746  13.205 77.667 1.00 9.17  ? 58  ASN A CG  1 
ATOM   401  O OD1 . ASN A 1 58  ? 28.424  12.090 78.087 1.00 10.87 ? 58  ASN A OD1 1 
ATOM   402  N ND2 . ASN A 1 58  ? 29.180  14.148 78.456 1.00 5.56  ? 58  ASN A ND2 1 
ATOM   403  N N   . TRP A 1 59  ? 29.187  16.726 74.488 1.00 8.17  ? 59  TRP A N   1 
ATOM   404  C CA  . TRP A 1 59  ? 29.726  17.288 73.254 1.00 8.58  ? 59  TRP A CA  1 
ATOM   405  C C   . TRP A 1 59  ? 30.964  16.501 72.835 1.00 8.90  ? 59  TRP A C   1 
ATOM   406  O O   . TRP A 1 59  ? 31.827  16.204 73.671 1.00 7.66  ? 59  TRP A O   1 
ATOM   407  C CB  . TRP A 1 59  ? 30.109  18.741 73.460 1.00 7.30  ? 59  TRP A CB  1 
ATOM   408  C CG  . TRP A 1 59  ? 29.079  19.505 74.169 1.00 8.02  ? 59  TRP A CG  1 
ATOM   409  C CD1 . TRP A 1 59  ? 29.215  20.139 75.366 1.00 7.10  ? 59  TRP A CD1 1 
ATOM   410  C CD2 . TRP A 1 59  ? 27.728  19.744 73.730 1.00 8.53  ? 59  TRP A CD2 1 
ATOM   411  N NE1 . TRP A 1 59  ? 28.036  20.759 75.700 1.00 8.27  ? 59  TRP A NE1 1 
ATOM   412  C CE2 . TRP A 1 59  ? 27.107  20.531 74.719 1.00 7.88  ? 59  TRP A CE2 1 
ATOM   413  C CE3 . TRP A 1 59  ? 26.989  19.368 72.592 1.00 8.95  ? 59  TRP A CE3 1 
ATOM   414  C CZ2 . TRP A 1 59  ? 25.774  20.953 74.616 1.00 9.58  ? 59  TRP A CZ2 1 
ATOM   415  C CZ3 . TRP A 1 59  ? 25.660  19.786 72.485 1.00 8.53  ? 59  TRP A CZ3 1 
ATOM   416  C CH2 . TRP A 1 59  ? 25.067  20.568 73.490 1.00 9.67  ? 59  TRP A CH2 1 
ATOM   417  N N   . LYS A 1 60  ? 31.123  16.326 71.525 1.00 9.56  ? 60  LYS A N   1 
ATOM   418  C CA  . LYS A 1 60  ? 32.229  15.555 70.991 1.00 10.86 ? 60  LYS A CA  1 
ATOM   419  C C   . LYS A 1 60  ? 32.575  15.952 69.557 1.00 10.25 ? 60  LYS A C   1 
ATOM   420  O O   . LYS A 1 60  ? 31.690  16.311 68.779 1.00 9.58  ? 60  LYS A O   1 
ATOM   421  C CB  . LYS A 1 60  ? 31.758  14.103 70.985 1.00 13.41 ? 60  LYS A CB  1 
ATOM   422  C CG  . LYS A 1 60  ? 32.764  13.045 70.854 1.00 17.84 ? 60  LYS A CG  1 
ATOM   423  C CD  . LYS A 1 60  ? 32.338  11.929 71.800 1.00 22.45 ? 60  LYS A CD  1 
ATOM   424  C CE  . LYS A 1 60  ? 31.959  12.531 73.179 1.00 25.05 ? 60  LYS A CE  1 
ATOM   425  N NZ  . LYS A 1 60  ? 31.615  11.499 74.207 1.00 27.73 ? 60  LYS A NZ  1 
ATOM   426  N N   . THR A 1 61  ? 33.851  15.868 69.207 1.00 9.34  ? 61  THR A N   1 
ATOM   427  C CA  . THR A 1 61  ? 34.279  16.147 67.846 1.00 9.74  ? 61  THR A CA  1 
ATOM   428  C C   . THR A 1 61  ? 33.731  15.014 66.974 1.00 9.42  ? 61  THR A C   1 
ATOM   429  O O   . THR A 1 61  ? 33.821  13.851 67.338 1.00 8.91  ? 61  THR A O   1 
ATOM   430  C CB  . THR A 1 61  ? 35.807  16.133 67.751 1.00 9.92  ? 61  THR A CB  1 
ATOM   431  O OG1 . THR A 1 61  ? 36.311  17.084 68.690 1.00 12.15 ? 61  THR A OG1 1 
ATOM   432  C CG2 . THR A 1 61  ? 36.285  16.526 66.369 1.00 9.37  ? 61  THR A CG2 1 
ATOM   433  N N   . ASP A 1 62  ? 33.144  15.354 65.828 1.00 10.03 ? 62  ASP A N   1 
ATOM   434  C CA  . ASP A 1 62  ? 32.601  14.342 64.914 1.00 9.16  ? 62  ASP A CA  1 
ATOM   435  C C   . ASP A 1 62  ? 33.753  13.467 64.431 1.00 9.57  ? 62  ASP A C   1 
ATOM   436  O O   . ASP A 1 62  ? 34.618  13.920 63.694 1.00 8.15  ? 62  ASP A O   1 
ATOM   437  C CB  . ASP A 1 62  ? 31.965  15.003 63.695 1.00 8.41  ? 62  ASP A CB  1 
ATOM   438  C CG  . ASP A 1 62  ? 31.083  14.046 62.918 1.00 8.97  ? 62  ASP A CG  1 
ATOM   439  O OD1 . ASP A 1 62  ? 31.472  12.886 62.700 1.00 4.66  ? 62  ASP A OD1 1 
ATOM   440  O OD2 . ASP A 1 62  ? 29.954  14.458 62.570 1.00 9.12  ? 62  ASP A OD2 1 
ATOM   441  N N   . PRO A 1 63  ? 33.720  12.177 64.775 1.00 10.28 ? 63  PRO A N   1 
ATOM   442  C CA  . PRO A 1 63  ? 34.776  11.243 64.371 1.00 11.25 ? 63  PRO A CA  1 
ATOM   443  C C   . PRO A 1 63  ? 34.791  10.935 62.879 1.00 12.22 ? 63  PRO A C   1 
ATOM   444  O O   . PRO A 1 63  ? 35.768  10.385 62.360 1.00 12.76 ? 63  PRO A O   1 
ATOM   445  C CB  . PRO A 1 63  ? 34.485  10.012 65.232 1.00 11.12 ? 63  PRO A CB  1 
ATOM   446  C CG  . PRO A 1 63  ? 32.987  10.075 65.375 1.00 11.71 ? 63  PRO A CG  1 
ATOM   447  C CD  . PRO A 1 63  ? 32.727  11.524 65.645 1.00 10.30 ? 63  PRO A CD  1 
ATOM   448  N N   . ALA A 1 64  ? 33.747  11.321 62.163 1.00 11.42 ? 64  ALA A N   1 
ATOM   449  C CA  . ALA A 1 64  ? 33.722  11.047 60.735 1.00 11.42 ? 64  ALA A CA  1 
ATOM   450  C C   . ALA A 1 64  ? 34.401  12.124 59.927 1.00 11.67 ? 64  ALA A C   1 
ATOM   451  O O   . ALA A 1 64  ? 34.607  11.959 58.748 1.00 12.68 ? 64  ALA A O   1 
ATOM   452  C CB  . ALA A 1 64  ? 32.305  10.872 60.262 1.00 11.41 ? 64  ALA A CB  1 
ATOM   453  N N   . LEU A 1 65  ? 34.722  13.250 60.542 1.00 12.12 ? 65  LEU A N   1 
ATOM   454  C CA  . LEU A 1 65  ? 35.358  14.341 59.825 1.00 12.12 ? 65  LEU A CA  1 
ATOM   455  C C   . LEU A 1 65  ? 36.832  14.494 60.200 1.00 13.26 ? 65  LEU A C   1 
ATOM   456  O O   . LEU A 1 65  ? 37.267  14.007 61.231 1.00 13.99 ? 65  LEU A O   1 
ATOM   457  C CB  . LEU A 1 65  ? 34.627  15.664 60.110 1.00 11.00 ? 65  LEU A CB  1 
ATOM   458  C CG  . LEU A 1 65  ? 33.150  15.750 59.688 1.00 10.09 ? 65  LEU A CG  1 
ATOM   459  C CD1 . LEU A 1 65  ? 32.480  16.954 60.296 1.00 9.26  ? 65  LEU A CD1 1 
ATOM   460  C CD2 . LEU A 1 65  ? 33.048  15.831 58.181 1.00 10.05 ? 65  LEU A CD2 1 
ATOM   461  N N   . ASN A 1 66  ? 37.582  15.200 59.363 1.00 13.57 ? 66  ASN A N   1 
ATOM   462  C CA  . ASN A 1 66  ? 38.986  15.485 59.613 1.00 14.46 ? 66  ASN A CA  1 
ATOM   463  C C   . ASN A 1 66  ? 38.891  16.524 60.718 1.00 13.24 ? 66  ASN A C   1 
ATOM   464  O O   . ASN A 1 66  ? 38.171  17.508 60.588 1.00 13.09 ? 66  ASN A O   1 
ATOM   465  C CB  . ASN A 1 66  ? 39.613  16.094 58.355 1.00 16.87 ? 66  ASN A CB  1 
ATOM   466  C CG  . ASN A 1 66  ? 41.013  16.601 58.590 1.00 20.54 ? 66  ASN A CG  1 
ATOM   467  O OD1 . ASN A 1 66  ? 41.449  16.787 59.723 1.00 23.10 ? 66  ASN A OD1 1 
ATOM   468  N ND2 . ASN A 1 66  ? 41.728  16.859 57.511 1.00 24.44 ? 66  ASN A ND2 1 
ATOM   469  N N   . PRO A 1 67  ? 39.646  16.352 61.800 1.00 12.59 ? 67  PRO A N   1 
ATOM   470  C CA  . PRO A 1 67  ? 39.564  17.324 62.892 1.00 11.88 ? 67  PRO A CA  1 
ATOM   471  C C   . PRO A 1 67  ? 39.876  18.774 62.569 1.00 11.77 ? 67  PRO A C   1 
ATOM   472  O O   . PRO A 1 67  ? 39.452  19.682 63.288 1.00 12.46 ? 67  PRO A O   1 
ATOM   473  C CB  . PRO A 1 67  ? 40.459  16.718 63.960 1.00 13.08 ? 67  PRO A CB  1 
ATOM   474  C CG  . PRO A 1 67  ? 41.359  15.759 63.191 1.00 13.40 ? 67  PRO A CG  1 
ATOM   475  C CD  . PRO A 1 67  ? 40.421  15.167 62.191 1.00 12.72 ? 67  PRO A CD  1 
ATOM   476  N N   . ALA A 1 68  ? 40.575  19.023 61.469 1.00 10.75 ? 68  ALA A N   1 
ATOM   477  C CA  . ALA A 1 68  ? 40.869  20.398 61.073 1.00 9.68  ? 68  ALA A CA  1 
ATOM   478  C C   . ALA A 1 68  ? 39.687  21.061 60.371 1.00 9.10  ? 68  ALA A C   1 
ATOM   479  O O   . ALA A 1 68  ? 39.689  22.271 60.210 1.00 8.94  ? 68  ALA A O   1 
ATOM   480  C CB  . ALA A 1 68  ? 42.069  20.424 60.128 1.00 10.79 ? 68  ALA A CB  1 
ATOM   481  N N   . ASP A 1 69  ? 38.689  20.284 59.937 1.00 9.07  ? 69  ASP A N   1 
ATOM   482  C CA  . ASP A 1 69  ? 37.538  20.849 59.207 1.00 9.03  ? 69  ASP A CA  1 
ATOM   483  C C   . ASP A 1 69  ? 36.263  21.052 60.042 1.00 9.45  ? 69  ASP A C   1 
ATOM   484  O O   . ASP A 1 69  ? 35.205  21.416 59.491 1.00 8.87  ? 69  ASP A O   1 
ATOM   485  C CB  . ASP A 1 69  ? 37.172  19.931 58.048 1.00 10.17 ? 69  ASP A CB  1 
ATOM   486  C CG  . ASP A 1 69  ? 38.355  19.644 57.104 1.00 11.42 ? 69  ASP A CG  1 
ATOM   487  O OD1 . ASP A 1 69  ? 39.241  20.506 56.971 1.00 12.48 ? 69  ASP A OD1 1 
ATOM   488  O OD2 . ASP A 1 69  ? 38.380  18.550 56.495 1.00 11.76 ? 69  ASP A OD2 1 
ATOM   489  N N   . THR A 1 70  ? 36.371  20.863 61.362 1.00 9.15  ? 70  THR A N   1 
ATOM   490  C CA  . THR A 1 70  ? 35.231  20.964 62.265 1.00 8.61  ? 70  THR A CA  1 
ATOM   491  C C   . THR A 1 70  ? 35.762  21.448 63.610 1.00 9.17  ? 70  THR A C   1 
ATOM   492  O O   . THR A 1 70  ? 36.987  21.654 63.753 1.00 9.51  ? 70  THR A O   1 
ATOM   493  C CB  . THR A 1 70  ? 34.544  19.554 62.390 1.00 8.52  ? 70  THR A CB  1 
ATOM   494  O OG1 . THR A 1 70  ? 33.307  19.649 63.118 1.00 8.04  ? 70  THR A OG1 1 
ATOM   495  C CG2 . THR A 1 70  ? 35.487  18.538 63.061 1.00 8.87  ? 70  THR A CG2 1 
ATOM   496  N N   . LEU A 1 71  ? 34.858  21.747 64.549 1.00 7.65  ? 71  LEU A N   1 
ATOM   497  C CA  . LEU A 1 71  ? 35.282  22.178 65.869 1.00 7.43  ? 71  LEU A CA  1 
ATOM   498  C C   . LEU A 1 71  ? 35.330  21.057 66.896 1.00 7.37  ? 71  LEU A C   1 
ATOM   499  O O   . LEU A 1 71  ? 34.705  19.997 66.731 1.00 7.60  ? 71  LEU A O   1 
ATOM   500  C CB  . LEU A 1 71  ? 34.414  23.310 66.414 1.00 7.45  ? 71  LEU A CB  1 
ATOM   501  C CG  . LEU A 1 71  ? 34.305  24.606 65.604 1.00 7.35  ? 71  LEU A CG  1 
ATOM   502  C CD1 . LEU A 1 71  ? 33.599  25.637 66.502 1.00 6.94  ? 71  LEU A CD1 1 
ATOM   503  C CD2 . LEU A 1 71  ? 35.710  25.081 65.160 1.00 6.37  ? 71  LEU A CD2 1 
ATOM   504  N N   . ALA A 1 72  ? 36.114  21.292 67.945 1.00 7.13  ? 72  ALA A N   1 
ATOM   505  C CA  . ALA A 1 72  ? 36.262  20.349 69.055 1.00 7.06  ? 72  ALA A CA  1 
ATOM   506  C C   . ALA A 1 72  ? 35.672  21.035 70.316 1.00 6.32  ? 72  ALA A C   1 
ATOM   507  O O   . ALA A 1 72  ? 35.543  22.276 70.352 1.00 6.94  ? 72  ALA A O   1 
ATOM   508  C CB  . ALA A 1 72  ? 37.755  20.010 69.239 1.00 7.43  ? 72  ALA A CB  1 
ATOM   509  N N   . PRO A 1 73  ? 35.308  20.258 71.363 1.00 6.43  ? 73  PRO A N   1 
ATOM   510  C CA  . PRO A 1 73  ? 34.735  20.872 72.579 1.00 6.46  ? 73  PRO A CA  1 
ATOM   511  C C   . PRO A 1 73  ? 35.547  22.011 73.178 1.00 7.28  ? 73  PRO A C   1 
ATOM   512  O O   . PRO A 1 73  ? 34.972  22.980 73.670 1.00 6.80  ? 73  PRO A O   1 
ATOM   513  C CB  . PRO A 1 73  ? 34.602  19.697 73.548 1.00 6.81  ? 73  PRO A CB  1 
ATOM   514  C CG  . PRO A 1 73  ? 34.351  18.553 72.642 1.00 5.92  ? 73  PRO A CG  1 
ATOM   515  C CD  . PRO A 1 73  ? 35.244  18.788 71.436 1.00 5.30  ? 73  PRO A CD  1 
ATOM   516  N N   . ALA A 1 74  ? 36.875  21.892 73.121 1.00 7.61  ? 74  ALA A N   1 
ATOM   517  C CA  . ALA A 1 74  ? 37.776  22.917 73.652 1.00 8.38  ? 74  ALA A CA  1 
ATOM   518  C C   . ALA A 1 74  ? 37.560  24.262 72.938 1.00 8.57  ? 74  ALA A C   1 
ATOM   519  O O   . ALA A 1 74  ? 37.720  25.337 73.544 1.00 9.52  ? 74  ALA A O   1 
ATOM   520  C CB  . ALA A 1 74  ? 39.262  22.458 73.474 1.00 8.07  ? 74  ALA A CB  1 
ATOM   521  N N   . ASP A 1 75  ? 37.167  24.206 71.664 1.00 8.76  ? 75  ASP A N   1 
ATOM   522  C CA  . ASP A 1 75  ? 36.943  25.421 70.870 1.00 8.63  ? 75  ASP A CA  1 
ATOM   523  C C   . ASP A 1 75  ? 35.876  26.370 71.404 1.00 8.98  ? 75  ASP A C   1 
ATOM   524  O O   . ASP A 1 75  ? 35.953  27.569 71.150 1.00 10.08 ? 75  ASP A O   1 
ATOM   525  C CB  . ASP A 1 75  ? 36.668  25.064 69.411 1.00 7.72  ? 75  ASP A CB  1 
ATOM   526  C CG  . ASP A 1 75  ? 37.880  24.422 68.726 1.00 9.22  ? 75  ASP A CG  1 
ATOM   527  O OD1 . ASP A 1 75  ? 39.026  24.821 69.036 1.00 9.17  ? 75  ASP A OD1 1 
ATOM   528  O OD2 . ASP A 1 75  ? 37.702  23.550 67.851 1.00 8.28  ? 75  ASP A OD2 1 
ATOM   529  N N   . TYR A 1 76  ? 34.896  25.859 72.148 1.00 8.95  ? 76  TYR A N   1 
ATOM   530  C CA  . TYR A 1 76  ? 33.844  26.700 72.712 1.00 9.59  ? 76  TYR A CA  1 
ATOM   531  C C   . TYR A 1 76  ? 34.178  27.320 74.066 1.00 10.40 ? 76  TYR A C   1 
ATOM   532  O O   . TYR A 1 76  ? 33.328  27.976 74.698 1.00 10.07 ? 76  TYR A O   1 
ATOM   533  C CB  . TYR A 1 76  ? 32.530  25.935 72.842 1.00 9.66  ? 76  TYR A CB  1 
ATOM   534  C CG  . TYR A 1 76  ? 31.768  25.832 71.545 1.00 9.44  ? 76  TYR A CG  1 
ATOM   535  C CD1 . TYR A 1 76  ? 32.037  24.802 70.642 1.00 9.40  ? 76  TYR A CD1 1 
ATOM   536  C CD2 . TYR A 1 76  ? 30.778  26.764 71.218 1.00 8.00  ? 76  TYR A CD2 1 
ATOM   537  C CE1 . TYR A 1 76  ? 31.319  24.702 69.429 1.00 9.61  ? 76  TYR A CE1 1 
ATOM   538  C CE2 . TYR A 1 76  ? 30.075  26.681 70.019 1.00 8.29  ? 76  TYR A CE2 1 
ATOM   539  C CZ  . TYR A 1 76  ? 30.348  25.650 69.132 1.00 8.88  ? 76  TYR A CZ  1 
ATOM   540  O OH  . TYR A 1 76  ? 29.680  25.564 67.943 1.00 9.84  ? 76  TYR A OH  1 
ATOM   541  N N   . THR A 1 77  ? 35.407  27.138 74.522 1.00 11.27 ? 77  THR A N   1 
ATOM   542  C CA  . THR A 1 77  ? 35.784  27.715 75.802 1.00 11.80 ? 77  THR A CA  1 
ATOM   543  C C   . THR A 1 77  ? 35.680  29.225 75.817 1.00 11.30 ? 77  THR A C   1 
ATOM   544  O O   . THR A 1 77  ? 36.249  29.903 74.982 1.00 11.06 ? 77  THR A O   1 
ATOM   545  C CB  . THR A 1 77  ? 37.194  27.325 76.196 1.00 12.51 ? 77  THR A CB  1 
ATOM   546  O OG1 . THR A 1 77  ? 37.237  25.904 76.323 1.00 14.31 ? 77  THR A OG1 1 
ATOM   547  C CG2 . THR A 1 77  ? 37.531  27.944 77.573 1.00 12.93 ? 77  THR A CG2 1 
ATOM   548  N N   . GLY A 1 78  ? 34.930  29.733 76.783 1.00 12.75 ? 78  GLY A N   1 
ATOM   549  C CA  . GLY A 1 78  ? 34.750  31.171 76.929 1.00 13.47 ? 78  GLY A CA  1 
ATOM   550  C C   . GLY A 1 78  ? 33.744  31.774 75.976 1.00 13.78 ? 78  GLY A C   1 
ATOM   551  O O   . GLY A 1 78  ? 33.427  32.951 76.089 1.00 14.39 ? 78  GLY A O   1 
ATOM   552  N N   . ALA A 1 79  ? 33.170  30.973 75.092 1.00 14.01 ? 79  ALA A N   1 
ATOM   553  C CA  . ALA A 1 79  ? 32.230  31.520 74.120 1.00 15.29 ? 79  ALA A CA  1 
ATOM   554  C C   . ALA A 1 79  ? 30.977  32.149 74.701 1.00 15.94 ? 79  ALA A C   1 
ATOM   555  O O   . ALA A 1 79  ? 30.553  33.197 74.227 1.00 16.02 ? 79  ALA A O   1 
ATOM   556  C CB  . ALA A 1 79  ? 31.868  30.479 73.054 1.00 13.70 ? 79  ALA A CB  1 
ATOM   557  N N   . ASN A 1 80  ? 30.360  31.512 75.688 1.00 17.85 ? 80  ASN A N   1 
ATOM   558  C CA  . ASN A 1 80  ? 29.141  32.074 76.275 1.00 20.09 ? 80  ASN A CA  1 
ATOM   559  C C   . ASN A 1 80  ? 29.327  33.442 76.922 1.00 21.42 ? 80  ASN A C   1 
ATOM   560  O O   . ASN A 1 80  ? 28.544  34.372 76.688 1.00 21.75 ? 80  ASN A O   1 
ATOM   561  C CB  . ASN A 1 80  ? 28.518  31.139 77.282 1.00 21.19 ? 80  ASN A CB  1 
ATOM   562  C CG  . ASN A 1 80  ? 27.151  31.651 77.765 1.00 24.45 ? 80  ASN A CG  1 
ATOM   563  O OD1 . ASN A 1 80  ? 27.053  32.241 78.857 1.00 26.59 ? 80  ASN A OD1 1 
ATOM   564  N ND2 . ASN A 1 80  ? 26.092  31.459 76.938 1.00 23.58 ? 80  ASN A ND2 1 
ATOM   565  N N   . ALA A 1 81  ? 30.371  33.574 77.734 1.00 22.08 ? 81  ALA A N   1 
ATOM   566  C CA  . ALA A 1 81  ? 30.671  34.852 78.384 1.00 21.51 ? 81  ALA A CA  1 
ATOM   567  C C   . ALA A 1 81  ? 31.121  35.912 77.384 1.00 21.00 ? 81  ALA A C   1 
ATOM   568  O O   . ALA A 1 81  ? 30.897  37.093 77.583 1.00 22.26 ? 81  ALA A O   1 
ATOM   569  C CB  . ALA A 1 81  ? 31.733  34.650 79.433 1.00 22.12 ? 81  ALA A CB  1 
ATOM   570  N N   . ALA A 1 82  ? 31.801  35.522 76.324 1.00 19.62 ? 82  ALA A N   1 
ATOM   571  C CA  . ALA A 1 82  ? 32.232  36.513 75.368 1.00 18.92 ? 82  ALA A CA  1 
ATOM   572  C C   . ALA A 1 82  ? 31.147  36.946 74.390 1.00 19.03 ? 82  ALA A C   1 
ATOM   573  O O   . ALA A 1 82  ? 30.997  38.150 74.094 1.00 19.23 ? 82  ALA A O   1 
ATOM   574  C CB  . ALA A 1 82  ? 33.420  35.997 74.561 1.00 19.22 ? 82  ALA A CB  1 
ATOM   575  N N   . LEU A 1 83  ? 30.426  35.970 73.845 1.00 17.24 ? 83  LEU A N   1 
ATOM   576  C CA  . LEU A 1 83  ? 29.449  36.272 72.821 1.00 16.21 ? 83  LEU A CA  1 
ATOM   577  C C   . LEU A 1 83  ? 27.963  36.025 73.156 1.00 15.29 ? 83  LEU A C   1 
ATOM   578  O O   . LEU A 1 83  ? 27.098  36.285 72.314 1.00 15.04 ? 83  LEU A O   1 
ATOM   579  C CB  . LEU A 1 83  ? 29.833  35.469 71.580 1.00 16.38 ? 83  LEU A CB  1 
ATOM   580  C CG  . LEU A 1 83  ? 31.145  35.784 70.870 1.00 18.11 ? 83  LEU A CG  1 
ATOM   581  C CD1 . LEU A 1 83  ? 31.752  34.529 70.290 1.00 18.23 ? 83  LEU A CD1 1 
ATOM   582  C CD2 . LEU A 1 83  ? 30.878  36.771 69.737 1.00 19.55 ? 83  LEU A CD2 1 
ATOM   583  N N   . LYS A 1 84  ? 27.676  35.515 74.350 1.00 14.13 ? 84  LYS A N   1 
ATOM   584  C CA  . LYS A 1 84  ? 26.309  35.174 74.773 1.00 14.46 ? 84  LYS A CA  1 
ATOM   585  C C   . LYS A 1 84  ? 25.690  34.177 73.783 1.00 13.08 ? 84  LYS A C   1 
ATOM   586  O O   . LYS A 1 84  ? 24.560  34.368 73.310 1.00 10.63 ? 84  LYS A O   1 
ATOM   587  C CB  . LYS A 1 84  ? 25.408  36.405 74.859 1.00 17.00 ? 84  LYS A CB  1 
ATOM   588  C CG  . LYS A 1 84  ? 25.771  37.384 75.949 1.00 21.04 ? 84  LYS A CG  1 
ATOM   589  C CD  . LYS A 1 84  ? 25.064  38.712 75.651 1.00 24.20 ? 84  LYS A CD  1 
ATOM   590  C CE  . LYS A 1 84  ? 25.230  39.707 76.764 1.00 26.02 ? 84  LYS A CE  1 
ATOM   591  N NZ  . LYS A 1 84  ? 24.482  40.932 76.367 1.00 28.94 ? 84  LYS A NZ  1 
ATOM   592  N N   . VAL A 1 85  ? 26.499  33.199 73.380 1.00 11.50 ? 85  VAL A N   1 
ATOM   593  C CA  . VAL A 1 85  ? 26.044  32.162 72.487 1.00 11.21 ? 85  VAL A CA  1 
ATOM   594  C C   . VAL A 1 85  ? 25.978  30.837 73.252 1.00 11.43 ? 85  VAL A C   1 
ATOM   595  O O   . VAL A 1 85  ? 26.708  30.651 74.243 1.00 11.94 ? 85  VAL A O   1 
ATOM   596  C CB  . VAL A 1 85  ? 26.976  31.989 71.233 1.00 10.60 ? 85  VAL A CB  1 
ATOM   597  C CG1 . VAL A 1 85  ? 26.869  33.183 70.324 1.00 10.26 ? 85  VAL A CG1 1 
ATOM   598  C CG2 . VAL A 1 85  ? 28.418  31.702 71.639 1.00 10.61 ? 85  VAL A CG2 1 
ATOM   599  N N   . ASP A 1 86  ? 25.078  29.955 72.824 1.00 10.23 ? 86  ASP A N   1 
ATOM   600  C CA  . ASP A 1 86  ? 24.930  28.618 73.380 1.00 11.02 ? 86  ASP A CA  1 
ATOM   601  C C   . ASP A 1 86  ? 25.377  27.615 72.309 1.00 10.06 ? 86  ASP A C   1 
ATOM   602  O O   . ASP A 1 86  ? 25.600  27.972 71.156 1.00 9.53  ? 86  ASP A O   1 
ATOM   603  C CB  . ASP A 1 86  ? 23.451  28.303 73.679 1.00 13.90 ? 86  ASP A CB  1 
ATOM   604  C CG  . ASP A 1 86  ? 22.930  28.967 74.964 1.00 16.47 ? 86  ASP A CG  1 
ATOM   605  O OD1 . ASP A 1 86  ? 23.762  29.414 75.773 1.00 17.66 ? 86  ASP A OD1 1 
ATOM   606  O OD2 . ASP A 1 86  ? 21.686  29.033 75.144 1.00 16.99 ? 86  ASP A OD2 1 
ATOM   607  N N   . ARG A 1 87  ? 25.575  26.368 72.701 1.00 9.43  ? 87  ARG A N   1 
ATOM   608  C CA  . ARG A 1 87  ? 25.893  25.349 71.721 1.00 9.45  ? 87  ARG A CA  1 
ATOM   609  C C   . ARG A 1 87  ? 24.505  24.917 71.186 1.00 9.14  ? 87  ARG A C   1 
ATOM   610  O O   . ARG A 1 87  ? 23.833  24.065 71.779 1.00 9.38  ? 87  ARG A O   1 
ATOM   611  C CB  . ARG A 1 87  ? 26.629  24.158 72.366 1.00 9.60  ? 87  ARG A CB  1 
ATOM   612  C CG  . ARG A 1 87  ? 28.048  24.507 72.884 1.00 11.53 ? 87  ARG A CG  1 
ATOM   613  C CD  . ARG A 1 87  ? 28.444  23.521 73.951 1.00 13.03 ? 87  ARG A CD  1 
ATOM   614  N NE  . ARG A 1 87  ? 29.773  23.749 74.486 1.00 14.02 ? 87  ARG A NE  1 
ATOM   615  C CZ  . ARG A 1 87  ? 30.018  24.512 75.541 1.00 15.55 ? 87  ARG A CZ  1 
ATOM   616  N NH1 . ARG A 1 87  ? 29.025  25.140 76.155 1.00 15.78 ? 87  ARG A NH1 1 
ATOM   617  N NH2 . ARG A 1 87  ? 31.231  24.550 76.063 1.00 15.07 ? 87  ARG A NH2 1 
ATOM   618  N N   . GLY A 1 88  ? 24.071  25.525 70.092 1.00 7.55  ? 88  GLY A N   1 
ATOM   619  C CA  . GLY A 1 88  ? 22.775  25.173 69.559 1.00 7.43  ? 88  GLY A CA  1 
ATOM   620  C C   . GLY A 1 88  ? 22.749  24.031 68.551 1.00 6.62  ? 88  GLY A C   1 
ATOM   621  O O   . GLY A 1 88  ? 23.566  23.989 67.636 1.00 7.69  ? 88  GLY A O   1 
ATOM   622  N N   . HIS A 1 89  ? 21.776  23.134 68.684 1.00 5.77  ? 89  HIS A N   1 
ATOM   623  C CA  . HIS A 1 89  ? 21.612  22.004 67.777 1.00 5.92  ? 89  HIS A CA  1 
ATOM   624  C C   . HIS A 1 89  ? 20.969  22.400 66.451 1.00 5.98  ? 89  HIS A C   1 
ATOM   625  O O   . HIS A 1 89  ? 20.077  23.274 66.420 1.00 6.37  ? 89  HIS A O   1 
ATOM   626  C CB  . HIS A 1 89  ? 20.697  20.938 68.392 1.00 5.91  ? 89  HIS A CB  1 
ATOM   627  C CG  . HIS A 1 89  ? 21.341  20.126 69.475 1.00 5.66  ? 89  HIS A CG  1 
ATOM   628  N ND1 . HIS A 1 89  ? 21.413  20.551 70.781 1.00 6.32  ? 89  HIS A ND1 1 
ATOM   629  C CD2 . HIS A 1 89  ? 21.902  18.892 69.449 1.00 5.95  ? 89  HIS A CD2 1 
ATOM   630  C CE1 . HIS A 1 89  ? 21.987  19.614 71.518 1.00 5.86  ? 89  HIS A CE1 1 
ATOM   631  N NE2 . HIS A 1 89  ? 22.293  18.599 70.730 1.00 5.74  ? 89  HIS A NE2 1 
ATOM   632  N N   . GLN A 1 90  ? 21.462  21.812 65.360 1.00 4.82  ? 90  GLN A N   1 
ATOM   633  C CA  . GLN A 1 90  ? 20.846  22.014 64.047 1.00 4.69  ? 90  GLN A CA  1 
ATOM   634  C C   . GLN A 1 90  ? 19.714  20.945 64.042 1.00 4.91  ? 90  GLN A C   1 
ATOM   635  O O   . GLN A 1 90  ? 18.552  21.295 64.174 1.00 5.32  ? 90  GLN A O   1 
ATOM   636  C CB  . GLN A 1 90  ? 21.880  21.858 62.933 1.00 4.59  ? 90  GLN A CB  1 
ATOM   637  C CG  . GLN A 1 90  ? 22.977  22.948 63.007 1.00 3.68  ? 90  GLN A CG  1 
ATOM   638  C CD  . GLN A 1 90  ? 23.258  23.559 61.645 1.00 6.57  ? 90  GLN A CD  1 
ATOM   639  O OE1 . GLN A 1 90  ? 22.324  23.933 60.934 1.00 8.21  ? 90  GLN A OE1 1 
ATOM   640  N NE2 . GLN A 1 90  ? 24.541  23.648 61.256 1.00 6.21  ? 90  GLN A NE2 1 
ATOM   641  N N   . ALA A 1 91  ? 20.048  19.655 63.944 1.00 4.62  ? 91  ALA A N   1 
ATOM   642  C CA  . ALA A 1 91  ? 19.026  18.578 64.073 1.00 4.31  ? 91  ALA A CA  1 
ATOM   643  C C   . ALA A 1 91  ? 18.766  18.567 65.591 1.00 5.37  ? 91  ALA A C   1 
ATOM   644  O O   . ALA A 1 91  ? 19.718  18.491 66.402 1.00 5.48  ? 91  ALA A O   1 
ATOM   645  C CB  . ALA A 1 91  ? 19.568  17.248 63.629 1.00 2.00  ? 91  ALA A CB  1 
ATOM   646  N N   . PRO A 1 92  ? 17.485  18.659 66.004 1.00 6.53  ? 92  PRO A N   1 
ATOM   647  C CA  . PRO A 1 92  ? 17.136  18.684 67.426 1.00 6.76  ? 92  PRO A CA  1 
ATOM   648  C C   . PRO A 1 92  ? 17.295  17.373 68.182 1.00 7.89  ? 92  PRO A C   1 
ATOM   649  O O   . PRO A 1 92  ? 16.905  16.287 67.696 1.00 8.33  ? 92  PRO A O   1 
ATOM   650  C CB  . PRO A 1 92  ? 15.697  19.210 67.419 1.00 5.74  ? 92  PRO A CB  1 
ATOM   651  C CG  . PRO A 1 92  ? 15.160  18.646 66.151 1.00 6.48  ? 92  PRO A CG  1 
ATOM   652  C CD  . PRO A 1 92  ? 16.283  18.806 65.162 1.00 6.16  ? 92  PRO A CD  1 
ATOM   653  N N   . LEU A 1 93  ? 17.843  17.506 69.398 1.00 7.27  ? 93  LEU A N   1 
ATOM   654  C CA  . LEU A 1 93  ? 18.103  16.373 70.265 1.00 7.18  ? 93  LEU A CA  1 
ATOM   655  C C   . LEU A 1 93  ? 16.858  15.623 70.695 1.00 7.26  ? 93  LEU A C   1 
ATOM   656  O O   . LEU A 1 93  ? 16.709  14.447 70.409 1.00 6.58  ? 93  LEU A O   1 
ATOM   657  C CB  . LEU A 1 93  ? 18.894  16.833 71.493 1.00 6.66  ? 93  LEU A CB  1 
ATOM   658  C CG  . LEU A 1 93  ? 19.290  15.751 72.518 1.00 6.78  ? 93  LEU A CG  1 
ATOM   659  C CD1 . LEU A 1 93  ? 20.147  14.705 71.865 1.00 6.79  ? 93  LEU A CD1 1 
ATOM   660  C CD2 . LEU A 1 93  ? 20.050  16.397 73.716 1.00 7.41  ? 93  LEU A CD2 1 
ATOM   661  N N   . ALA A 1 94  ? 15.923  16.316 71.337 1.00 8.10  ? 94  ALA A N   1 
ATOM   662  C CA  . ALA A 1 94  ? 14.728  15.632 71.840 1.00 8.81  ? 94  ALA A CA  1 
ATOM   663  C C   . ALA A 1 94  ? 13.830  14.996 70.792 1.00 9.15  ? 94  ALA A C   1 
ATOM   664  O O   . ALA A 1 94  ? 13.148  14.017 71.097 1.00 9.32  ? 94  ALA A O   1 
ATOM   665  C CB  . ALA A 1 94  ? 13.913  16.557 72.740 1.00 7.89  ? 94  ALA A CB  1 
ATOM   666  N N   . SER A 1 95  ? 13.813  15.537 69.572 1.00 8.84  ? 95  SER A N   1 
ATOM   667  C CA  . SER A 1 95  ? 12.945  14.988 68.518 1.00 8.88  ? 95  SER A CA  1 
ATOM   668  C C   . SER A 1 95  ? 13.514  13.753 67.861 1.00 8.32  ? 95  SER A C   1 
ATOM   669  O O   . SER A 1 95  ? 12.787  12.978 67.222 1.00 6.65  ? 95  SER A O   1 
ATOM   670  C CB  . SER A 1 95  ? 12.711  16.014 67.411 1.00 7.42  ? 95  SER A CB  1 
ATOM   671  O OG  . SER A 1 95  ? 12.075  17.145 67.939 1.00 11.60 ? 95  SER A OG  1 
ATOM   672  N N   . LEU A 1 96  ? 14.820  13.576 68.010 1.00 7.88  ? 96  LEU A N   1 
ATOM   673  C CA  . LEU A 1 96  ? 15.460  12.466 67.356 1.00 7.91  ? 96  LEU A CA  1 
ATOM   674  C C   . LEU A 1 96  ? 16.244  11.527 68.253 1.00 8.49  ? 96  LEU A C   1 
ATOM   675  O O   . LEU A 1 96  ? 16.760  10.532 67.751 1.00 6.75  ? 96  LEU A O   1 
ATOM   676  C CB  . LEU A 1 96  ? 16.413  13.052 66.309 1.00 8.94  ? 96  LEU A CB  1 
ATOM   677  C CG  . LEU A 1 96  ? 15.790  13.851 65.152 1.00 8.43  ? 96  LEU A CG  1 
ATOM   678  C CD1 . LEU A 1 96  ? 16.791  14.834 64.584 1.00 6.28  ? 96  LEU A CD1 1 
ATOM   679  C CD2 . LEU A 1 96  ? 15.249  12.847 64.091 1.00 7.27  ? 96  LEU A CD2 1 
ATOM   680  N N   . ALA A 1 97  ? 16.294  11.824 69.563 1.00 8.87  ? 97  ALA A N   1 
ATOM   681  C CA  . ALA A 1 97  ? 17.105  11.046 70.497 1.00 10.31 ? 97  ALA A CA  1 
ATOM   682  C C   . ALA A 1 97  ? 16.804  9.558  70.677 1.00 11.19 ? 97  ALA A C   1 
ATOM   683  O O   . ALA A 1 97  ? 17.523  8.873  71.407 1.00 11.23 ? 97  ALA A O   1 
ATOM   684  C CB  . ALA A 1 97  ? 17.188  11.729 71.832 1.00 11.30 ? 97  ALA A CB  1 
ATOM   685  N N   . GLY A 1 98  ? 15.777  9.057  69.997 1.00 10.33 ? 98  GLY A N   1 
ATOM   686  C CA  . GLY A 1 98  ? 15.466  7.659  70.116 1.00 10.47 ? 98  GLY A CA  1 
ATOM   687  C C   . GLY A 1 98  ? 16.149  6.829  69.047 1.00 10.49 ? 98  GLY A C   1 
ATOM   688  O O   . GLY A 1 98  ? 16.044  5.617  69.060 1.00 11.04 ? 98  GLY A O   1 
ATOM   689  N N   . VAL A 1 99  ? 16.801  7.457  68.077 1.00 10.36 ? 99  VAL A N   1 
ATOM   690  C CA  . VAL A 1 99  ? 17.476  6.689  67.022 1.00 9.56  ? 99  VAL A CA  1 
ATOM   691  C C   . VAL A 1 99  ? 18.716  5.978  67.581 1.00 10.37 ? 99  VAL A C   1 
ATOM   692  O O   . VAL A 1 99  ? 19.231  6.335  68.648 1.00 9.30  ? 99  VAL A O   1 
ATOM   693  C CB  . VAL A 1 99  ? 17.817  7.575  65.811 1.00 9.76  ? 99  VAL A CB  1 
ATOM   694  C CG1 . VAL A 1 99  ? 16.525  8.243  65.281 1.00 8.71  ? 99  VAL A CG1 1 
ATOM   695  C CG2 . VAL A 1 99  ? 18.865  8.662  66.191 1.00 8.48  ? 99  VAL A CG2 1 
ATOM   696  N N   . SER A 1 100 ? 19.204  4.989  66.840 1.00 11.21 ? 100 SER A N   1 
ATOM   697  C CA  . SER A 1 100 ? 20.335  4.174  67.293 1.00 12.75 ? 100 SER A CA  1 
ATOM   698  C C   . SER A 1 100 ? 21.685  4.889  67.423 1.00 12.89 ? 100 SER A C   1 
ATOM   699  O O   . SER A 1 100 ? 22.484  4.567  68.296 1.00 13.41 ? 100 SER A O   1 
ATOM   700  C CB  . SER A 1 100 ? 20.463  2.907  66.430 1.00 12.86 ? 100 SER A CB  1 
ATOM   701  O OG  . SER A 1 100 ? 20.587  3.231  65.049 1.00 16.12 ? 100 SER A OG  1 
ATOM   702  N N   . ASP A 1 101 ? 21.949  5.855  66.559 1.00 11.48 ? 101 ASP A N   1 
ATOM   703  C CA  . ASP A 1 101 ? 23.191  6.566  66.673 1.00 9.83  ? 101 ASP A CA  1 
ATOM   704  C C   . ASP A 1 101 ? 22.887  7.939  67.253 1.00 9.48  ? 101 ASP A C   1 
ATOM   705  O O   . ASP A 1 101 ? 23.480  8.913  66.823 1.00 9.45  ? 101 ASP A O   1 
ATOM   706  C CB  . ASP A 1 101 ? 23.860  6.672  65.296 1.00 10.17 ? 101 ASP A CB  1 
ATOM   707  C CG  . ASP A 1 101 ? 22.901  7.109  64.192 1.00 10.19 ? 101 ASP A CG  1 
ATOM   708  O OD1 . ASP A 1 101 ? 21.861  7.738  64.468 1.00 9.36  ? 101 ASP A OD1 1 
ATOM   709  O OD2 . ASP A 1 101 ? 23.200  6.821  63.020 1.00 10.36 ? 101 ASP A OD2 1 
ATOM   710  N N   . TRP A 1 102 ? 22.013  8.015  68.270 1.00 9.48  ? 102 TRP A N   1 
ATOM   711  C CA  . TRP A 1 102 ? 21.613  9.318  68.829 1.00 8.92  ? 102 TRP A CA  1 
ATOM   712  C C   . TRP A 1 102 ? 22.748  10.189 69.361 1.00 8.95  ? 102 TRP A C   1 
ATOM   713  O O   . TRP A 1 102 ? 22.626  11.420 69.374 1.00 8.48  ? 102 TRP A O   1 
ATOM   714  C CB  . TRP A 1 102 ? 20.525  9.180  69.904 1.00 9.13  ? 102 TRP A CB  1 
ATOM   715  C CG  . TRP A 1 102 ? 21.068  8.632  71.198 1.00 9.18  ? 102 TRP A CG  1 
ATOM   716  C CD1 . TRP A 1 102 ? 21.227  7.306  71.520 1.00 9.09  ? 102 TRP A CD1 1 
ATOM   717  C CD2 . TRP A 1 102 ? 21.620  9.382  72.287 1.00 8.91  ? 102 TRP A CD2 1 
ATOM   718  N NE1 . TRP A 1 102 ? 21.858  7.197  72.723 1.00 9.30  ? 102 TRP A NE1 1 
ATOM   719  C CE2 . TRP A 1 102 ? 22.111  8.450  73.222 1.00 9.63  ? 102 TRP A CE2 1 
ATOM   720  C CE3 . TRP A 1 102 ? 21.750  10.755 72.560 1.00 9.23  ? 102 TRP A CE3 1 
ATOM   721  C CZ2 . TRP A 1 102 ? 22.729  8.839  74.417 1.00 9.02  ? 102 TRP A CZ2 1 
ATOM   722  C CZ3 . TRP A 1 102 ? 22.355  11.138 73.729 1.00 9.42  ? 102 TRP A CZ3 1 
ATOM   723  C CH2 . TRP A 1 102 ? 22.840  10.181 74.650 1.00 9.54  ? 102 TRP A CH2 1 
ATOM   724  N N   . GLU A 1 103 ? 23.830  9.575  69.844 1.00 8.31  ? 103 GLU A N   1 
ATOM   725  C CA  . GLU A 1 103 ? 24.957  10.361 70.342 1.00 8.98  ? 103 GLU A CA  1 
ATOM   726  C C   . GLU A 1 103 ? 25.496  11.340 69.339 1.00 7.25  ? 103 GLU A C   1 
ATOM   727  O O   . GLU A 1 103 ? 25.938  12.425 69.718 1.00 6.60  ? 103 GLU A O   1 
ATOM   728  C CB  . GLU A 1 103 ? 26.064  9.467  70.860 1.00 12.64 ? 103 GLU A CB  1 
ATOM   729  C CG  . GLU A 1 103 ? 25.706  8.965  72.226 1.00 19.73 ? 103 GLU A CG  1 
ATOM   730  C CD  . GLU A 1 103 ? 26.619  7.836  72.694 1.00 25.65 ? 103 GLU A CD  1 
ATOM   731  O OE1 . GLU A 1 103 ? 27.756  8.153  73.159 1.00 28.82 ? 103 GLU A OE1 1 
ATOM   732  O OE2 . GLU A 1 103 ? 26.182  6.644  72.610 1.00 27.66 ? 103 GLU A OE2 1 
ATOM   733  N N   . SER A 1 104 ? 25.336  11.017 68.055 1.00 6.44  ? 104 SER A N   1 
ATOM   734  C CA  . SER A 1 104 ? 25.798  11.896 66.977 1.00 5.84  ? 104 SER A CA  1 
ATOM   735  C C   . SER A 1 104 ? 25.050  13.241 66.969 1.00 5.09  ? 104 SER A C   1 
ATOM   736  O O   . SER A 1 104 ? 25.502  14.202 66.340 1.00 4.81  ? 104 SER A O   1 
ATOM   737  C CB  . SER A 1 104 ? 25.673  11.218 65.618 1.00 5.64  ? 104 SER A CB  1 
ATOM   738  O OG  . SER A 1 104 ? 24.308  11.119 65.210 1.00 7.27  ? 104 SER A OG  1 
ATOM   739  N N   . LEU A 1 105 ? 23.929  13.333 67.683 1.00 4.55  ? 105 LEU A N   1 
ATOM   740  C CA  . LEU A 1 105 ? 23.192  14.596 67.742 1.00 4.13  ? 105 LEU A CA  1 
ATOM   741  C C   . LEU A 1 105 ? 23.994  15.592 68.542 1.00 4.73  ? 105 LEU A C   1 
ATOM   742  O O   . LEU A 1 105 ? 23.755  16.818 68.464 1.00 5.01  ? 105 LEU A O   1 
ATOM   743  C CB  . LEU A 1 105 ? 21.835  14.381 68.399 1.00 5.34  ? 105 LEU A CB  1 
ATOM   744  C CG  . LEU A 1 105 ? 20.833  13.604 67.519 1.00 5.64  ? 105 LEU A CG  1 
ATOM   745  C CD1 . LEU A 1 105 ? 19.703  13.028 68.374 1.00 5.09  ? 105 LEU A CD1 1 
ATOM   746  C CD2 . LEU A 1 105 ? 20.298  14.537 66.439 1.00 5.08  ? 105 LEU A CD2 1 
ATOM   747  N N   . ASN A 1 106 ? 24.938  15.080 69.341 1.00 5.11  ? 106 ASN A N   1 
ATOM   748  C CA  . ASN A 1 106 ? 25.789  15.962 70.144 1.00 5.40  ? 106 ASN A CA  1 
ATOM   749  C C   . ASN A 1 106 ? 27.207  16.115 69.609 1.00 5.67  ? 106 ASN A C   1 
ATOM   750  O O   . ASN A 1 106 ? 28.109  16.662 70.308 1.00 6.28  ? 106 ASN A O   1 
ATOM   751  C CB  . ASN A 1 106 ? 25.756  15.588 71.637 1.00 5.59  ? 106 ASN A CB  1 
ATOM   752  C CG  . ASN A 1 106 ? 24.354  15.744 72.233 1.00 5.43  ? 106 ASN A CG  1 
ATOM   753  O OD1 . ASN A 1 106 ? 23.679  16.708 71.956 1.00 6.24  ? 106 ASN A OD1 1 
ATOM   754  N ND2 . ASN A 1 106 ? 23.911  14.781 72.987 1.00 4.32  ? 106 ASN A ND2 1 
ATOM   755  N N   . TYR A 1 107 ? 27.427  15.605 68.394 1.00 4.90  ? 107 TYR A N   1 
ATOM   756  C CA  . TYR A 1 107 ? 28.713  15.796 67.723 1.00 4.24  ? 107 TYR A CA  1 
ATOM   757  C C   . TYR A 1 107 ? 28.705  17.272 67.301 1.00 4.94  ? 107 TYR A C   1 
ATOM   758  O O   . TYR A 1 107 ? 27.647  17.790 66.871 1.00 4.73  ? 107 TYR A O   1 
ATOM   759  C CB  . TYR A 1 107 ? 28.824  14.937 66.481 1.00 3.98  ? 107 TYR A CB  1 
ATOM   760  C CG  . TYR A 1 107 ? 29.043  13.507 66.764 1.00 3.77  ? 107 TYR A CG  1 
ATOM   761  C CD1 . TYR A 1 107 ? 29.234  13.052 68.070 1.00 4.59  ? 107 TYR A CD1 1 
ATOM   762  C CD2 . TYR A 1 107 ? 29.041  12.590 65.732 1.00 3.28  ? 107 TYR A CD2 1 
ATOM   763  C CE1 . TYR A 1 107 ? 29.408  11.681 68.328 1.00 5.63  ? 107 TYR A CE1 1 
ATOM   764  C CE2 . TYR A 1 107 ? 29.218  11.241 65.971 1.00 5.41  ? 107 TYR A CE2 1 
ATOM   765  C CZ  . TYR A 1 107 ? 29.396  10.789 67.270 1.00 6.15  ? 107 TYR A CZ  1 
ATOM   766  O OH  . TYR A 1 107 ? 29.511  9.420  67.492 1.00 8.46  ? 107 TYR A OH  1 
ATOM   767  N N   . LEU A 1 108 ? 29.857  17.955 67.385 1.00 4.40  ? 108 LEU A N   1 
ATOM   768  C CA  . LEU A 1 108 ? 29.884  19.375 67.059 1.00 4.51  ? 108 LEU A CA  1 
ATOM   769  C C   . LEU A 1 108 ? 29.607  19.753 65.615 1.00 4.30  ? 108 LEU A C   1 
ATOM   770  O O   . LEU A 1 108 ? 29.373  20.922 65.322 1.00 4.94  ? 108 LEU A O   1 
ATOM   771  C CB  . LEU A 1 108 ? 31.155  20.062 67.599 1.00 5.42  ? 108 LEU A CB  1 
ATOM   772  C CG  . LEU A 1 108 ? 31.200  19.963 69.125 1.00 7.16  ? 108 LEU A CG  1 
ATOM   773  C CD1 . LEU A 1 108 ? 32.431  20.651 69.612 1.00 9.76  ? 108 LEU A CD1 1 
ATOM   774  C CD2 . LEU A 1 108 ? 30.007  20.609 69.752 1.00 7.81  ? 108 LEU A CD2 1 
ATOM   775  N N   . SER A 1 109 ? 29.606  18.785 64.716 1.00 4.52  ? 109 SER A N   1 
ATOM   776  C CA  . SER A 1 109 ? 29.254  19.055 63.326 1.00 5.16  ? 109 SER A CA  1 
ATOM   777  C C   . SER A 1 109 ? 27.753  19.420 63.283 1.00 6.20  ? 109 SER A C   1 
ATOM   778  O O   . SER A 1 109 ? 27.280  20.066 62.340 1.00 6.35  ? 109 SER A O   1 
ATOM   779  C CB  . SER A 1 109 ? 29.442  17.786 62.535 1.00 3.95  ? 109 SER A CB  1 
ATOM   780  O OG  . SER A 1 109 ? 28.898  16.721 63.272 1.00 3.91  ? 109 SER A OG  1 
ATOM   781  N N   . ASN A 1 110 ? 26.999  19.008 64.310 1.00 6.29  ? 110 ASN A N   1 
ATOM   782  C CA  . ASN A 1 110 ? 25.556  19.293 64.376 1.00 6.26  ? 110 ASN A CA  1 
ATOM   783  C C   . ASN A 1 110 ? 25.276  20.491 65.303 1.00 6.64  ? 110 ASN A C   1 
ATOM   784  O O   . ASN A 1 110 ? 24.142  20.766 65.677 1.00 7.51  ? 110 ASN A O   1 
ATOM   785  C CB  . ASN A 1 110 ? 24.784  18.046 64.876 1.00 4.60  ? 110 ASN A CB  1 
ATOM   786  C CG  . ASN A 1 110 ? 23.245  18.256 64.869 1.00 6.40  ? 110 ASN A CG  1 
ATOM   787  O OD1 . ASN A 1 110 ? 22.696  18.759 63.892 1.00 4.20  ? 110 ASN A OD1 1 
ATOM   788  N ND2 . ASN A 1 110 ? 22.568  17.904 65.975 1.00 3.94  ? 110 ASN A ND2 1 
ATOM   789  N N   . ILE A 1 111 ? 26.318  21.219 65.655 1.00 7.03  ? 111 ILE A N   1 
ATOM   790  C CA  . ILE A 1 111 ? 26.177  22.347 66.553 1.00 7.19  ? 111 ILE A CA  1 
ATOM   791  C C   . ILE A 1 111 ? 26.809  23.613 65.953 1.00 6.87  ? 111 ILE A C   1 
ATOM   792  O O   . ILE A 1 111 ? 27.698  23.522 65.102 1.00 7.42  ? 111 ILE A O   1 
ATOM   793  C CB  . ILE A 1 111 ? 26.930  22.034 67.904 1.00 7.75  ? 111 ILE A CB  1 
ATOM   794  C CG1 . ILE A 1 111 ? 26.383  20.755 68.568 1.00 8.50  ? 111 ILE A CG1 1 
ATOM   795  C CG2 . ILE A 1 111 ? 26.872  23.236 68.877 1.00 7.76  ? 111 ILE A CG2 1 
ATOM   796  C CD1 . ILE A 1 111 ? 24.993  20.863 69.105 1.00 9.06  ? 111 ILE A CD1 1 
ATOM   797  N N   . THR A 1 112 ? 26.287  24.780 66.336 1.00 6.72  ? 112 THR A N   1 
ATOM   798  C CA  . THR A 1 112 ? 26.868  26.081 65.953 1.00 6.58  ? 112 THR A CA  1 
ATOM   799  C C   . THR A 1 112 ? 26.665  27.017 67.157 1.00 6.33  ? 112 THR A C   1 
ATOM   800  O O   . THR A 1 112 ? 25.864  26.718 68.072 1.00 6.85  ? 112 THR A O   1 
ATOM   801  C CB  . THR A 1 112 ? 26.182  26.785 64.763 1.00 6.78  ? 112 THR A CB  1 
ATOM   802  O OG1 . THR A 1 112 ? 24.939  27.333 65.213 1.00 8.13  ? 112 THR A OG1 1 
ATOM   803  C CG2 . THR A 1 112 ? 25.943  25.842 63.591 1.00 6.51  ? 112 THR A CG2 1 
ATOM   804  N N   . PRO A 1 113 ? 27.419  28.133 67.204 1.00 6.47  ? 113 PRO A N   1 
ATOM   805  C CA  . PRO A 1 113 ? 27.297  29.109 68.300 1.00 6.21  ? 113 PRO A CA  1 
ATOM   806  C C   . PRO A 1 113 ? 26.041  29.964 68.013 1.00 6.83  ? 113 PRO A C   1 
ATOM   807  O O   . PRO A 1 113 ? 26.076  30.906 67.210 1.00 7.00  ? 113 PRO A O   1 
ATOM   808  C CB  . PRO A 1 113 ? 28.570  29.964 68.159 1.00 6.36  ? 113 PRO A CB  1 
ATOM   809  C CG  . PRO A 1 113 ? 29.488  29.157 67.227 1.00 7.29  ? 113 PRO A CG  1 
ATOM   810  C CD  . PRO A 1 113 ? 28.522  28.499 66.291 1.00 6.17  ? 113 PRO A CD  1 
ATOM   811  N N   . GLN A 1 114 ? 24.944  29.640 68.675 1.00 6.46  ? 114 GLN A N   1 
ATOM   812  C CA  . GLN A 1 114 ? 23.703  30.325 68.467 1.00 6.65  ? 114 GLN A CA  1 
ATOM   813  C C   . GLN A 1 114 ? 23.414  31.261 69.636 1.00 7.09  ? 114 GLN A C   1 
ATOM   814  O O   . GLN A 1 114 ? 23.518  30.836 70.777 1.00 6.37  ? 114 GLN A O   1 
ATOM   815  C CB  . GLN A 1 114 ? 22.627  29.240 68.346 1.00 7.31  ? 114 GLN A CB  1 
ATOM   816  C CG  . GLN A 1 114 ? 21.308  29.736 67.784 1.00 9.73  ? 114 GLN A CG  1 
ATOM   817  C CD  . GLN A 1 114 ? 20.362  28.594 67.493 1.00 8.83  ? 114 GLN A CD  1 
ATOM   818  O OE1 . GLN A 1 114 ? 20.033  28.297 66.331 1.00 10.20 ? 114 GLN A OE1 1 
ATOM   819  N NE2 . GLN A 1 114 ? 19.983  27.908 68.524 1.00 7.13  ? 114 GLN A NE2 1 
ATOM   820  N N   . LYS A 1 115 ? 23.111  32.535 69.379 1.00 7.86  ? 115 LYS A N   1 
ATOM   821  C CA  . LYS A 1 115 ? 22.787  33.489 70.461 1.00 9.63  ? 115 LYS A CA  1 
ATOM   822  C C   . LYS A 1 115 ? 21.775  32.852 71.396 1.00 10.41 ? 115 LYS A C   1 
ATOM   823  O O   . LYS A 1 115 ? 20.773  32.318 70.932 1.00 10.30 ? 115 LYS A O   1 
ATOM   824  C CB  . LYS A 1 115 ? 22.182  34.746 69.895 1.00 10.15 ? 115 LYS A CB  1 
ATOM   825  C CG  . LYS A 1 115 ? 23.160  35.586 69.161 1.00 13.14 ? 115 LYS A CG  1 
ATOM   826  C CD  . LYS A 1 115 ? 24.208  36.113 70.097 1.00 15.69 ? 115 LYS A CD  1 
ATOM   827  C CE  . LYS A 1 115 ? 25.102  37.046 69.304 1.00 19.48 ? 115 LYS A CE  1 
ATOM   828  N NZ  . LYS A 1 115 ? 26.190  37.655 70.135 1.00 22.69 ? 115 LYS A NZ  1 
ATOM   829  N N   . SER A 1 116 ? 22.009  32.908 72.705 1.00 10.99 ? 116 SER A N   1 
ATOM   830  C CA  . SER A 1 116 ? 21.111  32.226 73.633 1.00 12.32 ? 116 SER A CA  1 
ATOM   831  C C   . SER A 1 116 ? 19.661  32.695 73.657 1.00 11.34 ? 116 SER A C   1 
ATOM   832  O O   . SER A 1 116 ? 18.760  31.893 73.894 1.00 10.85 ? 116 SER A O   1 
ATOM   833  C CB  . SER A 1 116 ? 21.719  32.124 75.034 1.00 13.58 ? 116 SER A CB  1 
ATOM   834  O OG  . SER A 1 116 ? 21.818  33.402 75.590 1.00 18.82 ? 116 SER A OG  1 
ATOM   835  N N   . ASP A 1 117 ? 19.429  33.958 73.345 1.00 11.55 ? 117 ASP A N   1 
ATOM   836  C CA  . ASP A 1 117 ? 18.060  34.457 73.294 1.00 12.27 ? 117 ASP A CA  1 
ATOM   837  C C   . ASP A 1 117 ? 17.304  33.844 72.139 1.00 12.11 ? 117 ASP A C   1 
ATOM   838  O O   . ASP A 1 117 ? 16.080  33.684 72.208 1.00 13.17 ? 117 ASP A O   1 
ATOM   839  C CB  . ASP A 1 117 ? 18.012  35.973 73.194 1.00 13.71 ? 117 ASP A CB  1 
ATOM   840  C CG  . ASP A 1 117 ? 18.305  36.633 74.524 1.00 16.59 ? 117 ASP A CG  1 
ATOM   841  O OD1 . ASP A 1 117 ? 18.433  35.909 75.539 1.00 17.29 ? 117 ASP A OD1 1 
ATOM   842  O OD2 . ASP A 1 117 ? 18.413  37.869 74.551 1.00 18.63 ? 117 ASP A OD2 1 
ATOM   843  N N   . LEU A 1 118 ? 18.002  33.563 71.051 1.00 10.26 ? 118 LEU A N   1 
ATOM   844  C CA  . LEU A 1 118 ? 17.336  32.917 69.939 1.00 9.63  ? 118 LEU A CA  1 
ATOM   845  C C   . LEU A 1 118 ? 17.174  31.428 70.311 1.00 9.84  ? 118 LEU A C   1 
ATOM   846  O O   . LEU A 1 118 ? 16.068  30.870 70.237 1.00 8.73  ? 118 LEU A O   1 
ATOM   847  C CB  . LEU A 1 118 ? 18.151  33.088 68.638 1.00 7.74  ? 118 LEU A CB  1 
ATOM   848  C CG  . LEU A 1 118 ? 17.797  32.088 67.531 1.00 7.33  ? 118 LEU A CG  1 
ATOM   849  C CD1 . LEU A 1 118 ? 16.341  32.237 67.118 1.00 7.38  ? 118 LEU A CD1 1 
ATOM   850  C CD2 . LEU A 1 118 ? 18.733  32.255 66.348 1.00 6.17  ? 118 LEU A CD2 1 
ATOM   851  N N   . ASN A 1 119 ? 18.282  30.807 70.727 1.00 9.90  ? 119 ASN A N   1 
ATOM   852  C CA  . ASN A 1 119 ? 18.309  29.390 71.088 1.00 12.12 ? 119 ASN A CA  1 
ATOM   853  C C   . ASN A 1 119 ? 17.236  28.975 72.109 1.00 13.16 ? 119 ASN A C   1 
ATOM   854  O O   . ASN A 1 119 ? 16.528  27.971 71.924 1.00 13.89 ? 119 ASN A O   1 
ATOM   855  C CB  . ASN A 1 119 ? 19.695  29.004 71.611 1.00 12.30 ? 119 ASN A CB  1 
ATOM   856  C CG  . ASN A 1 119 ? 19.776  27.559 71.988 1.00 14.77 ? 119 ASN A CG  1 
ATOM   857  O OD1 . ASN A 1 119 ? 19.779  26.689 71.121 1.00 16.53 ? 119 ASN A OD1 1 
ATOM   858  N ND2 . ASN A 1 119 ? 19.821  27.278 73.283 1.00 15.50 ? 119 ASN A ND2 1 
ATOM   859  N N   . GLN A 1 120 ? 17.096  29.775 73.158 1.00 13.44 ? 120 GLN A N   1 
ATOM   860  C CA  . GLN A 1 120 ? 16.142  29.508 74.221 1.00 14.30 ? 120 GLN A CA  1 
ATOM   861  C C   . GLN A 1 120 ? 14.767  30.124 73.993 1.00 12.72 ? 120 GLN A C   1 
ATOM   862  O O   . GLN A 1 120 ? 13.859  29.911 74.784 1.00 13.24 ? 120 GLN A O   1 
ATOM   863  C CB  . GLN A 1 120 ? 16.734  30.001 75.539 1.00 17.01 ? 120 GLN A CB  1 
ATOM   864  C CG  . GLN A 1 120 ? 17.905  29.110 76.003 1.00 22.86 ? 120 GLN A CG  1 
ATOM   865  C CD  . GLN A 1 120 ? 18.821  29.822 77.007 1.00 27.95 ? 120 GLN A CD  1 
ATOM   866  O OE1 . GLN A 1 120 ? 18.565  30.992 77.411 1.00 30.92 ? 120 GLN A OE1 1 
ATOM   867  N NE2 . GLN A 1 120 ? 19.923  29.147 77.389 1.00 29.03 ? 120 GLN A NE2 1 
ATOM   868  N N   . GLY A 1 121 ? 14.614  30.878 72.918 1.00 10.50 ? 121 GLY A N   1 
ATOM   869  C CA  . GLY A 1 121 ? 13.342  31.516 72.635 1.00 9.51  ? 121 GLY A CA  1 
ATOM   870  C C   . GLY A 1 121 ? 12.612  30.947 71.431 1.00 8.13  ? 121 GLY A C   1 
ATOM   871  O O   . GLY A 1 121 ? 12.181  29.812 71.443 1.00 8.96  ? 121 GLY A O   1 
ATOM   872  N N   . ALA A 1 122 ? 12.545  31.718 70.360 1.00 7.96  ? 122 ALA A N   1 
ATOM   873  C CA  . ALA A 1 122 ? 11.828  31.334 69.146 1.00 7.47  ? 122 ALA A CA  1 
ATOM   874  C C   . ALA A 1 122 ? 12.293  30.012 68.535 1.00 8.01  ? 122 ALA A C   1 
ATOM   875  O O   . ALA A 1 122 ? 11.466  29.189 68.121 1.00 8.56  ? 122 ALA A O   1 
ATOM   876  C CB  . ALA A 1 122 ? 11.908  32.460 68.141 1.00 6.64  ? 122 ALA A CB  1 
ATOM   877  N N   . TRP A 1 123 ? 13.609  29.761 68.548 1.00 8.08  ? 123 TRP A N   1 
ATOM   878  C CA  . TRP A 1 123 ? 14.145  28.516 68.009 1.00 7.37  ? 123 TRP A CA  1 
ATOM   879  C C   . TRP A 1 123 ? 13.645  27.295 68.810 1.00 7.42  ? 123 TRP A C   1 
ATOM   880  O O   . TRP A 1 123 ? 13.280  26.285 68.221 1.00 7.11  ? 123 TRP A O   1 
ATOM   881  C CB  . TRP A 1 123 ? 15.675  28.553 67.977 1.00 6.42  ? 123 TRP A CB  1 
ATOM   882  C CG  . TRP A 1 123 ? 16.265  27.432 67.178 1.00 6.85  ? 123 TRP A CG  1 
ATOM   883  C CD1 . TRP A 1 123 ? 16.796  26.263 67.657 1.00 5.59  ? 123 TRP A CD1 1 
ATOM   884  C CD2 . TRP A 1 123 ? 16.361  27.358 65.741 1.00 6.03  ? 123 TRP A CD2 1 
ATOM   885  N NE1 . TRP A 1 123 ? 17.211  25.479 66.610 1.00 6.81  ? 123 TRP A NE1 1 
ATOM   886  C CE2 . TRP A 1 123 ? 16.956  26.129 65.426 1.00 5.60  ? 123 TRP A CE2 1 
ATOM   887  C CE3 . TRP A 1 123 ? 15.997  28.218 64.696 1.00 5.86  ? 123 TRP A CE3 1 
ATOM   888  C CZ2 . TRP A 1 123 ? 17.201  25.728 64.105 1.00 6.01  ? 123 TRP A CZ2 1 
ATOM   889  C CZ3 . TRP A 1 123 ? 16.245  27.813 63.372 1.00 5.97  ? 123 TRP A CZ3 1 
ATOM   890  C CH2 . TRP A 1 123 ? 16.838  26.584 63.099 1.00 6.02  ? 123 TRP A CH2 1 
ATOM   891  N N   . ALA A 1 124 ? 13.685  27.369 70.143 1.00 6.98  ? 124 ALA A N   1 
ATOM   892  C CA  . ALA A 1 124 ? 13.216  26.275 70.974 1.00 7.17  ? 124 ALA A CA  1 
ATOM   893  C C   . ALA A 1 124 ? 11.695  26.070 70.801 1.00 7.42  ? 124 ALA A C   1 
ATOM   894  O O   . ALA A 1 124 ? 11.221  24.946 70.797 1.00 7.15  ? 124 ALA A O   1 
ATOM   895  C CB  . ALA A 1 124 ? 13.530  26.559 72.447 1.00 6.20  ? 124 ALA A CB  1 
ATOM   896  N N   . ARG A 1 125 ? 10.935  27.155 70.672 1.00 8.29  ? 125 ARG A N   1 
ATOM   897  C CA  . ARG A 1 125 ? 9.486   27.041 70.503 1.00 9.15  ? 125 ARG A CA  1 
ATOM   898  C C   . ARG A 1 125 ? 9.129   26.375 69.175 1.00 8.24  ? 125 ARG A C   1 
ATOM   899  O O   . ARG A 1 125 ? 8.268   25.498 69.126 1.00 7.84  ? 125 ARG A O   1 
ATOM   900  C CB  . ARG A 1 125 ? 8.798   28.403 70.731 1.00 11.23 ? 125 ARG A CB  1 
ATOM   901  C CG  . ARG A 1 125 ? 8.820   28.722 72.262 1.00 17.43 ? 125 ARG A CG  1 
ATOM   902  C CD  . ARG A 1 125 ? 8.181   30.040 72.733 1.00 21.24 ? 125 ARG A CD  1 
ATOM   903  N NE  . ARG A 1 125 ? 8.826   31.263 72.218 1.00 25.26 ? 125 ARG A NE  1 
ATOM   904  C CZ  . ARG A 1 125 ? 9.684   32.034 72.908 1.00 26.79 ? 125 ARG A CZ  1 
ATOM   905  N NH1 . ARG A 1 125 ? 10.045  31.703 74.158 1.00 26.97 ? 125 ARG A NH1 1 
ATOM   906  N NH2 . ARG A 1 125 ? 10.111  33.188 72.380 1.00 25.10 ? 125 ARG A NH2 1 
ATOM   907  N N   . LEU A 1 126 ? 9.870   26.701 68.119 1.00 7.79  ? 126 LEU A N   1 
ATOM   908  C CA  . LEU A 1 126 ? 9.638   26.060 66.823 1.00 6.94  ? 126 LEU A CA  1 
ATOM   909  C C   . LEU A 1 126 ? 10.008  24.585 66.966 1.00 6.95  ? 126 LEU A C   1 
ATOM   910  O O   . LEU A 1 126 ? 9.272   23.719 66.495 1.00 6.66  ? 126 LEU A O   1 
ATOM   911  C CB  . LEU A 1 126 ? 10.441  26.755 65.703 1.00 5.99  ? 126 LEU A CB  1 
ATOM   912  C CG  . LEU A 1 126 ? 10.452  26.050 64.345 1.00 7.51  ? 126 LEU A CG  1 
ATOM   913  C CD1 . LEU A 1 126 ? 9.026   25.779 63.820 1.00 5.82  ? 126 LEU A CD1 1 
ATOM   914  C CD2 . LEU A 1 126 ? 11.229  26.890 63.367 1.00 6.79  ? 126 LEU A CD2 1 
ATOM   915  N N   . GLU A 1 127 ? 11.126  24.264 67.625 1.00 6.85  ? 127 GLU A N   1 
ATOM   916  C CA  . GLU A 1 127 ? 11.438  22.848 67.801 1.00 7.45  ? 127 GLU A CA  1 
ATOM   917  C C   . GLU A 1 127 ? 10.299  22.106 68.527 1.00 7.82  ? 127 GLU A C   1 
ATOM   918  O O   . GLU A 1 127 ? 10.017  20.952 68.183 1.00 6.98  ? 127 GLU A O   1 
ATOM   919  C CB  . GLU A 1 127 ? 12.730  22.637 68.596 1.00 8.85  ? 127 GLU A CB  1 
ATOM   920  C CG  . GLU A 1 127 ? 14.023  22.879 67.791 1.00 10.12 ? 127 GLU A CG  1 
ATOM   921  C CD  . GLU A 1 127 ? 15.259  22.718 68.640 1.00 11.98 ? 127 GLU A CD  1 
ATOM   922  O OE1 . GLU A 1 127 ? 15.108  22.763 69.877 1.00 14.11 ? 127 GLU A OE1 1 
ATOM   923  O OE2 . GLU A 1 127 ? 16.378  22.558 68.089 1.00 12.62 ? 127 GLU A OE2 1 
ATOM   924  N N   . ASP A 1 128 ? 9.710   22.718 69.567 1.00 8.71  ? 128 ASP A N   1 
ATOM   925  C CA  . ASP A 1 128 ? 8.605   22.079 70.302 1.00 9.78  ? 128 ASP A CA  1 
ATOM   926  C C   . ASP A 1 128 ? 7.401   21.823 69.381 1.00 9.06  ? 128 ASP A C   1 
ATOM   927  O O   . ASP A 1 128 ? 6.851   20.730 69.353 1.00 8.33  ? 128 ASP A O   1 
ATOM   928  C CB  . ASP A 1 128 ? 8.115   22.956 71.463 1.00 14.03 ? 128 ASP A CB  1 
ATOM   929  C CG  . ASP A 1 128 ? 9.096   23.010 72.648 1.00 19.64 ? 128 ASP A CG  1 
ATOM   930  O OD1 . ASP A 1 128 ? 9.993   22.119 72.778 1.00 22.68 ? 128 ASP A OD1 1 
ATOM   931  O OD2 . ASP A 1 128 ? 8.966   23.966 73.473 1.00 22.78 ? 128 ASP A OD2 1 
ATOM   932  N N   . GLN A 1 129 ? 7.013   22.822 68.600 1.00 9.02  ? 129 GLN A N   1 
ATOM   933  C CA  . GLN A 1 129 ? 5.872   22.673 67.698 1.00 9.69  ? 129 GLN A CA  1 
ATOM   934  C C   . GLN A 1 129 ? 6.135   21.675 66.586 1.00 9.04  ? 129 GLN A C   1 
ATOM   935  O O   . GLN A 1 129 ? 5.243   20.926 66.176 1.00 7.70  ? 129 GLN A O   1 
ATOM   936  C CB  . GLN A 1 129 ? 5.453   24.024 67.110 1.00 10.91 ? 129 GLN A CB  1 
ATOM   937  C CG  . GLN A 1 129 ? 4.804   24.975 68.132 1.00 12.64 ? 129 GLN A CG  1 
ATOM   938  C CD  . GLN A 1 129 ? 3.649   24.322 68.856 1.00 13.93 ? 129 GLN A CD  1 
ATOM   939  O OE1 . GLN A 1 129 ? 2.854   23.577 68.270 1.00 14.90 ? 129 GLN A OE1 1 
ATOM   940  N NE2 . GLN A 1 129 ? 3.588   24.536 70.152 1.00 15.82 ? 129 GLN A NE2 1 
ATOM   941  N N   . GLU A 1 130 ? 7.364   21.670 66.100 1.00 8.43  ? 130 GLU A N   1 
ATOM   942  C CA  . GLU A 1 130 ? 7.756   20.749 65.042 1.00 9.00  ? 130 GLU A CA  1 
ATOM   943  C C   . GLU A 1 130 ? 7.610   19.292 65.547 1.00 9.84  ? 130 GLU A C   1 
ATOM   944  O O   . GLU A 1 130 ? 7.045   18.426 64.863 1.00 9.31  ? 130 GLU A O   1 
ATOM   945  C CB  . GLU A 1 130 ? 9.201   21.094 64.627 1.00 8.79  ? 130 GLU A CB  1 
ATOM   946  C CG  . GLU A 1 130 ? 9.925   20.094 63.759 1.00 8.02  ? 130 GLU A CG  1 
ATOM   947  C CD  . GLU A 1 130 ? 11.400  20.462 63.569 1.00 8.27  ? 130 GLU A CD  1 
ATOM   948  O OE1 . GLU A 1 130 ? 12.018  21.124 64.435 1.00 8.28  ? 130 GLU A OE1 1 
ATOM   949  O OE2 . GLU A 1 130 ? 11.964  20.074 62.555 1.00 6.99  ? 130 GLU A OE2 1 
ATOM   950  N N   . ARG A 1 131 ? 8.099   19.033 66.764 1.00 10.72 ? 131 ARG A N   1 
ATOM   951  C CA  . ARG A 1 131 ? 8.011   17.707 67.369 1.00 12.36 ? 131 ARG A CA  1 
ATOM   952  C C   . ARG A 1 131 ? 6.550   17.337 67.654 1.00 12.63 ? 131 ARG A C   1 
ATOM   953  O O   . ARG A 1 131 ? 6.165   16.168 67.523 1.00 12.65 ? 131 ARG A O   1 
ATOM   954  C CB  . ARG A 1 131 ? 8.843   17.682 68.663 1.00 15.13 ? 131 ARG A CB  1 
ATOM   955  C CG  . ARG A 1 131 ? 8.769   16.400 69.497 1.00 18.09 ? 131 ARG A CG  1 
ATOM   956  C CD  . ARG A 1 131 ? 9.807   16.433 70.615 1.00 21.68 ? 131 ARG A CD  1 
ATOM   957  N NE  . ARG A 1 131 ? 9.914   17.724 71.332 1.00 25.60 ? 131 ARG A NE  1 
ATOM   958  C CZ  . ARG A 1 131 ? 10.889  18.647 71.167 1.00 26.75 ? 131 ARG A CZ  1 
ATOM   959  N NH1 . ARG A 1 131 ? 11.882  18.478 70.282 1.00 26.49 ? 131 ARG A NH1 1 
ATOM   960  N NH2 . ARG A 1 131 ? 10.939  19.706 71.979 1.00 26.28 ? 131 ARG A NH2 1 
ATOM   961  N N   . LYS A 1 132 ? 5.743   18.318 68.058 1.00 12.27 ? 132 LYS A N   1 
ATOM   962  C CA  . LYS A 1 132 ? 4.317   18.077 68.317 1.00 13.02 ? 132 LYS A CA  1 
ATOM   963  C C   . LYS A 1 132 ? 3.501   17.645 67.101 1.00 12.00 ? 132 LYS A C   1 
ATOM   964  O O   . LYS A 1 132 ? 2.492   16.982 67.256 1.00 12.14 ? 132 LYS A O   1 
ATOM   965  C CB  . LYS A 1 132 ? 3.656   19.299 68.941 1.00 15.14 ? 132 LYS A CB  1 
ATOM   966  C CG  . LYS A 1 132 ? 3.884   19.357 70.426 1.00 20.24 ? 132 LYS A CG  1 
ATOM   967  C CD  . LYS A 1 132 ? 3.370   20.656 71.072 1.00 24.47 ? 132 LYS A CD  1 
ATOM   968  C CE  . LYS A 1 132 ? 3.800   20.697 72.556 1.00 27.92 ? 132 LYS A CE  1 
ATOM   969  N NZ  . LYS A 1 132 ? 3.474   22.007 73.250 1.00 31.24 ? 132 LYS A NZ  1 
ATOM   970  N N   . LEU A 1 133 ? 3.944   17.975 65.891 1.00 11.18 ? 133 LEU A N   1 
ATOM   971  C CA  . LEU A 1 133 ? 3.198   17.571 64.689 1.00 10.74 ? 133 LEU A CA  1 
ATOM   972  C C   . LEU A 1 133 ? 3.057   16.068 64.607 1.00 11.34 ? 133 LEU A C   1 
ATOM   973  O O   . LEU A 1 133 ? 2.012   15.566 64.179 1.00 10.93 ? 133 LEU A O   1 
ATOM   974  C CB  . LEU A 1 133 ? 3.885   18.047 63.412 1.00 8.91  ? 133 LEU A CB  1 
ATOM   975  C CG  . LEU A 1 133 ? 3.835   19.557 63.169 1.00 9.14  ? 133 LEU A CG  1 
ATOM   976  C CD1 . LEU A 1 133 ? 4.843   19.891 62.080 1.00 6.97  ? 133 LEU A CD1 1 
ATOM   977  C CD2 . LEU A 1 133 ? 2.417   20.031 62.810 1.00 7.63  ? 133 LEU A CD2 1 
ATOM   978  N N   . ILE A 1 134 ? 4.087   15.358 65.082 1.00 11.91 ? 134 ILE A N   1 
ATOM   979  C CA  . ILE A 1 134 ? 4.118   13.907 65.020 1.00 13.30 ? 134 ILE A CA  1 
ATOM   980  C C   . ILE A 1 134 ? 3.111   13.244 65.937 1.00 14.69 ? 134 ILE A C   1 
ATOM   981  O O   . ILE A 1 134 ? 2.904   12.047 65.856 1.00 14.34 ? 134 ILE A O   1 
ATOM   982  C CB  . ILE A 1 134 ? 5.557   13.351 65.261 1.00 13.49 ? 134 ILE A CB  1 
ATOM   983  C CG1 . ILE A 1 134 ? 5.760   12.084 64.427 1.00 13.40 ? 134 ILE A CG1 1 
ATOM   984  C CG2 . ILE A 1 134 ? 5.800   13.049 66.732 1.00 13.88 ? 134 ILE A CG2 1 
ATOM   985  C CD1 . ILE A 1 134 ? 5.603   12.332 62.959 1.00 12.24 ? 134 ILE A CD1 1 
ATOM   986  N N   . ASP A 1 135 ? 2.511   14.023 66.831 1.00 16.19 ? 135 ASP A N   1 
ATOM   987  C CA  . ASP A 1 135 ? 1.505   13.487 67.720 1.00 18.19 ? 135 ASP A CA  1 
ATOM   988  C C   . ASP A 1 135 ? 0.167   13.407 67.031 1.00 19.04 ? 135 ASP A C   1 
ATOM   989  O O   . ASP A 1 135 ? -0.713  12.662 67.486 1.00 19.48 ? 135 ASP A O   1 
ATOM   990  C CB  . ASP A 1 135 ? 1.387   14.321 68.983 1.00 20.03 ? 135 ASP A CB  1 
ATOM   991  C CG  . ASP A 1 135 ? 2.590   14.153 69.892 1.00 22.86 ? 135 ASP A CG  1 
ATOM   992  O OD1 . ASP A 1 135 ? 3.319   13.152 69.733 1.00 23.54 ? 135 ASP A OD1 1 
ATOM   993  O OD2 . ASP A 1 135 ? 2.809   15.028 70.764 1.00 26.15 ? 135 ASP A OD2 1 
ATOM   994  N N   . ARG A 1 136 ? -0.013  14.179 65.958 1.00 18.82 ? 136 ARG A N   1 
ATOM   995  C CA  . ARG A 1 136 ? -1.283  14.139 65.226 1.00 19.05 ? 136 ARG A CA  1 
ATOM   996  C C   . ARG A 1 136 ? -1.415  12.757 64.605 1.00 19.08 ? 136 ARG A C   1 
ATOM   997  O O   . ARG A 1 136 ? -0.466  12.209 64.026 1.00 17.79 ? 136 ARG A O   1 
ATOM   998  C CB  . ARG A 1 136 ? -1.392  15.231 64.149 1.00 19.44 ? 136 ARG A CB  1 
ATOM   999  C CG  . ARG A 1 136 ? -1.445  16.633 64.705 1.00 21.00 ? 136 ARG A CG  1 
ATOM   1000 C CD  . ARG A 1 136 ? -1.641  17.669 63.629 1.00 22.49 ? 136 ARG A CD  1 
ATOM   1001 N NE  . ARG A 1 136 ? -1.711  18.984 64.259 1.00 26.53 ? 136 ARG A NE  1 
ATOM   1002 C CZ  . ARG A 1 136 ? -2.850  19.593 64.634 1.00 28.47 ? 136 ARG A CZ  1 
ATOM   1003 N NH1 . ARG A 1 136 ? -4.038  19.011 64.422 1.00 28.78 ? 136 ARG A NH1 1 
ATOM   1004 N NH2 . ARG A 1 136 ? -2.804  20.758 65.293 1.00 28.48 ? 136 ARG A NH2 1 
ATOM   1005 N N   . ALA A 1 137 ? -2.624  12.223 64.699 1.00 19.13 ? 137 ALA A N   1 
ATOM   1006 C CA  . ALA A 1 137 ? -2.909  10.886 64.210 1.00 19.08 ? 137 ALA A CA  1 
ATOM   1007 C C   . ALA A 1 137 ? -2.577  10.678 62.750 1.00 18.37 ? 137 ALA A C   1 
ATOM   1008 O O   . ALA A 1 137 ? -1.983  9.651  62.380 1.00 18.91 ? 137 ALA A O   1 
ATOM   1009 C CB  . ALA A 1 137 ? -4.372  10.523 64.488 1.00 20.59 ? 137 ALA A CB  1 
ATOM   1010 N N   . ASP A 1 138 ? -2.880  11.677 61.932 1.00 16.77 ? 138 ASP A N   1 
ATOM   1011 C CA  . ASP A 1 138 ? -2.628  11.544 60.500 1.00 16.03 ? 138 ASP A CA  1 
ATOM   1012 C C   . ASP A 1 138 ? -1.279  12.019 59.978 1.00 13.80 ? 138 ASP A C   1 
ATOM   1013 O O   . ASP A 1 138 ? -1.053  12.056 58.774 1.00 12.34 ? 138 ASP A O   1 
ATOM   1014 C CB  . ASP A 1 138 ? -3.758  12.186 59.701 1.00 18.96 ? 138 ASP A CB  1 
ATOM   1015 C CG  . ASP A 1 138 ? -3.996  13.617 60.090 1.00 22.93 ? 138 ASP A CG  1 
ATOM   1016 O OD1 . ASP A 1 138 ? -3.346  14.111 61.062 1.00 24.37 ? 138 ASP A OD1 1 
ATOM   1017 O OD2 . ASP A 1 138 ? -4.846  14.245 59.410 1.00 25.61 ? 138 ASP A OD2 1 
ATOM   1018 N N   . ILE A 1 139 ? -0.390  12.401 60.878 1.00 12.25 ? 139 ILE A N   1 
ATOM   1019 C CA  . ILE A 1 139 ? 0.928   12.833 60.449 1.00 11.15 ? 139 ILE A CA  1 
ATOM   1020 C C   . ILE A 1 139 ? 1.886   11.728 60.850 1.00 10.66 ? 139 ILE A C   1 
ATOM   1021 O O   . ILE A 1 139 ? 2.072   11.432 62.044 1.00 11.33 ? 139 ILE A O   1 
ATOM   1022 C CB  . ILE A 1 139 ? 1.298   14.196 61.060 1.00 11.37 ? 139 ILE A CB  1 
ATOM   1023 C CG1 . ILE A 1 139 ? 0.330   15.273 60.509 1.00 9.99  ? 139 ILE A CG1 1 
ATOM   1024 C CG2 . ILE A 1 139 ? 2.820   14.529 60.765 1.00 9.58  ? 139 ILE A CG2 1 
ATOM   1025 C CD1 . ILE A 1 139 ? 0.613   16.725 60.992 1.00 9.27  ? 139 ILE A CD1 1 
ATOM   1026 N N   . SER A 1 140 ? 2.425   11.052 59.845 1.00 10.02 ? 140 SER A N   1 
ATOM   1027 C CA  . SER A 1 140 ? 3.343   9.946  60.070 1.00 9.66  ? 140 SER A CA  1 
ATOM   1028 C C   . SER A 1 140 ? 4.850   10.322 60.009 1.00 8.73  ? 140 SER A C   1 
ATOM   1029 O O   . SER A 1 140 ? 5.670   9.631  60.591 1.00 8.99  ? 140 SER A O   1 
ATOM   1030 C CB  . SER A 1 140 ? 3.034   8.823  59.080 1.00 9.87  ? 140 SER A CB  1 
ATOM   1031 O OG  . SER A 1 140 ? 3.203   9.300  57.754 1.00 13.56 ? 140 SER A OG  1 
ATOM   1032 N N   . SER A 1 141 ? 5.190   11.445 59.392 1.00 6.94  ? 141 SER A N   1 
ATOM   1033 C CA  . SER A 1 141 ? 6.582   11.859 59.278 1.00 6.21  ? 141 SER A CA  1 
ATOM   1034 C C   . SER A 1 141 ? 6.711   13.340 59.233 1.00 6.13  ? 141 SER A C   1 
ATOM   1035 O O   . SER A 1 141 ? 5.824   14.023 58.729 1.00 6.33  ? 141 SER A O   1 
ATOM   1036 C CB  . SER A 1 141 ? 7.169   11.423 57.929 1.00 6.02  ? 141 SER A CB  1 
ATOM   1037 O OG  . SER A 1 141 ? 7.476   10.043 57.890 1.00 8.22  ? 141 SER A OG  1 
ATOM   1038 N N   . VAL A 1 142 ? 7.841   13.848 59.717 1.00 5.60  ? 142 VAL A N   1 
ATOM   1039 C CA  . VAL A 1 142 ? 8.126   15.262 59.555 1.00 4.65  ? 142 VAL A CA  1 
ATOM   1040 C C   . VAL A 1 142 ? 9.526   15.236 58.914 1.00 4.89  ? 142 VAL A C   1 
ATOM   1041 O O   . VAL A 1 142 ? 10.420  14.548 59.434 1.00 6.17  ? 142 VAL A O   1 
ATOM   1042 C CB  . VAL A 1 142 ? 8.156   16.080 60.865 1.00 4.43  ? 142 VAL A CB  1 
ATOM   1043 C CG1 . VAL A 1 142 ? 8.544   17.498 60.522 1.00 2.51  ? 142 VAL A CG1 1 
ATOM   1044 C CG2 . VAL A 1 142 ? 6.756   16.047 61.627 1.00 3.16  ? 142 VAL A CG2 1 
ATOM   1045 N N   . TYR A 1 143 ? 9.675   15.839 57.730 1.00 4.11  ? 143 TYR A N   1 
ATOM   1046 C CA  . TYR A 1 143 ? 10.972  15.931 57.046 1.00 3.29  ? 143 TYR A CA  1 
ATOM   1047 C C   . TYR A 1 143 ? 11.387  17.372 57.102 1.00 3.38  ? 143 TYR A C   1 
ATOM   1048 O O   . TYR A 1 143 ? 10.709  18.238 56.529 1.00 2.54  ? 143 TYR A O   1 
ATOM   1049 C CB  . TYR A 1 143 ? 10.902  15.537 55.586 1.00 2.80  ? 143 TYR A CB  1 
ATOM   1050 C CG  . TYR A 1 143 ? 10.780  14.071 55.406 1.00 3.40  ? 143 TYR A CG  1 
ATOM   1051 C CD1 . TYR A 1 143 ? 11.918  13.268 55.388 1.00 3.58  ? 143 TYR A CD1 1 
ATOM   1052 C CD2 . TYR A 1 143 ? 9.538   13.473 55.250 1.00 3.31  ? 143 TYR A CD2 1 
ATOM   1053 C CE1 . TYR A 1 143 ? 11.834  11.903 55.210 1.00 4.04  ? 143 TYR A CE1 1 
ATOM   1054 C CE2 . TYR A 1 143 ? 9.433   12.082 55.058 1.00 4.17  ? 143 TYR A CE2 1 
ATOM   1055 C CZ  . TYR A 1 143 ? 10.592  11.324 55.039 1.00 5.02  ? 143 TYR A CZ  1 
ATOM   1056 O OH  . TYR A 1 143 ? 10.532  9.988  54.819 1.00 6.48  ? 143 TYR A OH  1 
ATOM   1057 N N   . THR A 1 144 ? 12.530  17.611 57.742 1.00 2.61  ? 144 THR A N   1 
ATOM   1058 C CA  . THR A 1 144 ? 13.067  18.939 57.894 1.00 2.61  ? 144 THR A CA  1 
ATOM   1059 C C   . THR A 1 144 ? 14.500  19.102 57.372 1.00 3.44  ? 144 THR A C   1 
ATOM   1060 O O   . THR A 1 144 ? 15.294  18.146 57.387 1.00 3.31  ? 144 THR A O   1 
ATOM   1061 C CB  . THR A 1 144 ? 13.037  19.317 59.381 1.00 3.27  ? 144 THR A CB  1 
ATOM   1062 O OG1 . THR A 1 144 ? 11.675  19.297 59.826 1.00 5.07  ? 144 THR A OG1 1 
ATOM   1063 C CG2 . THR A 1 144 ? 13.628  20.709 59.626 1.00 2.07  ? 144 THR A CG2 1 
ATOM   1064 N N   . VAL A 1 145 ? 14.791  20.286 56.825 1.00 3.58  ? 145 VAL A N   1 
ATOM   1065 C CA  . VAL A 1 145 ? 16.155  20.622 56.403 1.00 3.29  ? 145 VAL A CA  1 
ATOM   1066 C C   . VAL A 1 145 ? 16.407  21.921 57.138 1.00 2.67  ? 145 VAL A C   1 
ATOM   1067 O O   . VAL A 1 145 ? 15.571  22.829 57.106 1.00 2.20  ? 145 VAL A O   1 
ATOM   1068 C CB  . VAL A 1 145 ? 16.328  20.926 54.887 1.00 4.17  ? 145 VAL A CB  1 
ATOM   1069 C CG1 . VAL A 1 145 ? 17.820  21.117 54.591 1.00 4.78  ? 145 VAL A CG1 1 
ATOM   1070 C CG2 . VAL A 1 145 ? 15.798  19.799 54.019 1.00 3.10  ? 145 VAL A CG2 1 
ATOM   1071 N N   . THR A 1 146 ? 17.564  22.048 57.770 1.00 2.48  ? 146 THR A N   1 
ATOM   1072 C CA  . THR A 1 146 ? 17.860  23.269 58.517 1.00 2.73  ? 146 THR A CA  1 
ATOM   1073 C C   . THR A 1 146 ? 19.324  23.662 58.254 1.00 3.40  ? 146 THR A C   1 
ATOM   1074 O O   . THR A 1 146 ? 20.107  22.829 57.788 1.00 3.49  ? 146 THR A O   1 
ATOM   1075 C CB  . THR A 1 146 ? 17.594  23.064 60.032 1.00 2.00  ? 146 THR A CB  1 
ATOM   1076 O OG1 . THR A 1 146 ? 17.722  24.315 60.725 1.00 2.80  ? 146 THR A OG1 1 
ATOM   1077 C CG2 . THR A 1 146 ? 18.563  22.045 60.622 1.00 2.00  ? 146 THR A CG2 1 
ATOM   1078 N N   . GLY A 1 147 ? 19.679  24.928 58.484 1.00 2.83  ? 147 GLY A N   1 
ATOM   1079 C CA  . GLY A 1 147 ? 21.049  25.348 58.243 1.00 2.67  ? 147 GLY A CA  1 
ATOM   1080 C C   . GLY A 1 147 ? 21.254  26.806 58.566 1.00 3.34  ? 147 GLY A C   1 
ATOM   1081 O O   . GLY A 1 147 ? 20.316  27.511 58.953 1.00 2.00  ? 147 GLY A O   1 
ATOM   1082 N N   . PRO A 1 148 ? 22.496  27.297 58.397 1.00 5.00  ? 148 PRO A N   1 
ATOM   1083 C CA  . PRO A 1 148 ? 22.848  28.688 58.674 1.00 5.31  ? 148 PRO A CA  1 
ATOM   1084 C C   . PRO A 1 148 ? 22.984  29.573 57.459 1.00 5.62  ? 148 PRO A C   1 
ATOM   1085 O O   . PRO A 1 148 ? 22.954  29.076 56.332 1.00 5.56  ? 148 PRO A O   1 
ATOM   1086 C CB  . PRO A 1 148 ? 24.191  28.538 59.378 1.00 5.65  ? 148 PRO A CB  1 
ATOM   1087 C CG  . PRO A 1 148 ? 24.854  27.437 58.569 1.00 6.52  ? 148 PRO A CG  1 
ATOM   1088 C CD  . PRO A 1 148 ? 23.703  26.442 58.342 1.00 5.15  ? 148 PRO A CD  1 
ATOM   1089 N N   . LEU A 1 149 ? 23.010  30.885 57.715 1.00 5.76  ? 149 LEU A N   1 
ATOM   1090 C CA  . LEU A 1 149 ? 23.238  31.906 56.692 1.00 6.55  ? 149 LEU A CA  1 
ATOM   1091 C C   . LEU A 1 149 ? 24.476  32.585 57.224 1.00 7.35  ? 149 LEU A C   1 
ATOM   1092 O O   . LEU A 1 149 ? 24.679  32.644 58.442 1.00 7.14  ? 149 LEU A O   1 
ATOM   1093 C CB  . LEU A 1 149 ? 22.147  32.981 56.594 1.00 5.42  ? 149 LEU A CB  1 
ATOM   1094 C CG  . LEU A 1 149 ? 20.807  32.644 55.948 1.00 6.80  ? 149 LEU A CG  1 
ATOM   1095 C CD1 . LEU A 1 149 ? 19.923  33.891 55.733 1.00 6.88  ? 149 LEU A CD1 1 
ATOM   1096 C CD2 . LEU A 1 149 ? 21.032  31.927 54.678 1.00 5.55  ? 149 LEU A CD2 1 
ATOM   1097 N N   . TYR A 1 150 ? 25.278  33.120 56.311 1.00 8.01  ? 150 TYR A N   1 
ATOM   1098 C CA  . TYR A 1 150 ? 26.505  33.822 56.656 1.00 9.03  ? 150 TYR A CA  1 
ATOM   1099 C C   . TYR A 1 150 ? 26.453  35.162 55.930 1.00 9.60  ? 150 TYR A C   1 
ATOM   1100 O O   . TYR A 1 150 ? 27.058  35.303 54.869 1.00 10.38 ? 150 TYR A O   1 
ATOM   1101 C CB  . TYR A 1 150 ? 27.704  33.006 56.139 1.00 8.90  ? 150 TYR A CB  1 
ATOM   1102 C CG  . TYR A 1 150 ? 27.815  31.665 56.798 1.00 7.80  ? 150 TYR A CG  1 
ATOM   1103 C CD1 . TYR A 1 150 ? 28.290  31.551 58.096 1.00 8.88  ? 150 TYR A CD1 1 
ATOM   1104 C CD2 . TYR A 1 150 ? 27.418  30.519 56.133 1.00 8.17  ? 150 TYR A CD2 1 
ATOM   1105 C CE1 . TYR A 1 150 ? 28.365  30.311 58.723 1.00 8.84  ? 150 TYR A CE1 1 
ATOM   1106 C CE2 . TYR A 1 150 ? 27.472  29.289 56.739 1.00 8.74  ? 150 TYR A CE2 1 
ATOM   1107 C CZ  . TYR A 1 150 ? 27.952  29.194 58.040 1.00 9.47  ? 150 TYR A CZ  1 
ATOM   1108 O OH  . TYR A 1 150 ? 28.009  27.966 58.644 1.00 11.29 ? 150 TYR A OH  1 
ATOM   1109 N N   . GLU A 1 151 ? 25.796  36.154 56.512 1.00 9.44  ? 151 GLU A N   1 
ATOM   1110 C CA  . GLU A 1 151 ? 25.657  37.428 55.832 1.00 10.84 ? 151 GLU A CA  1 
ATOM   1111 C C   . GLU A 1 151 ? 26.331  38.631 56.441 1.00 12.70 ? 151 GLU A C   1 
ATOM   1112 O O   . GLU A 1 151 ? 26.326  39.705 55.828 1.00 14.76 ? 151 GLU A O   1 
ATOM   1113 C CB  . GLU A 1 151 ? 24.171  37.745 55.587 1.00 8.87  ? 151 GLU A CB  1 
ATOM   1114 C CG  . GLU A 1 151 ? 23.571  36.766 54.609 1.00 9.19  ? 151 GLU A CG  1 
ATOM   1115 C CD  . GLU A 1 151 ? 22.080  36.851 54.509 1.00 8.04  ? 151 GLU A CD  1 
ATOM   1116 O OE1 . GLU A 1 151 ? 21.429  37.314 55.469 1.00 7.59  ? 151 GLU A OE1 1 
ATOM   1117 O OE2 . GLU A 1 151 ? 21.569  36.410 53.467 1.00 7.27  ? 151 GLU A OE2 1 
ATOM   1118 N N   . ARG A 1 152 ? 26.758  38.525 57.688 1.00 14.10 ? 152 ARG A N   1 
ATOM   1119 C CA  . ARG A 1 152 ? 27.459  39.636 58.325 1.00 15.88 ? 152 ARG A CA  1 
ATOM   1120 C C   . ARG A 1 152 ? 28.423  39.032 59.336 1.00 16.64 ? 152 ARG A C   1 
ATOM   1121 O O   . ARG A 1 152 ? 28.168  37.948 59.876 1.00 17.28 ? 152 ARG A O   1 
ATOM   1122 C CB  . ARG A 1 152 ? 26.505  40.582 59.034 1.00 15.98 ? 152 ARG A CB  1 
ATOM   1123 C CG  . ARG A 1 152 ? 25.912  40.045 60.310 1.00 16.74 ? 152 ARG A CG  1 
ATOM   1124 C CD  . ARG A 1 152 ? 25.001  41.102 60.876 1.00 17.78 ? 152 ARG A CD  1 
ATOM   1125 N NE  . ARG A 1 152 ? 24.357  40.658 62.111 1.00 19.59 ? 152 ARG A NE  1 
ATOM   1126 C CZ  . ARG A 1 152 ? 23.136  40.124 62.173 1.00 18.82 ? 152 ARG A CZ  1 
ATOM   1127 N NH1 . ARG A 1 152 ? 22.421  39.969 61.067 1.00 16.36 ? 152 ARG A NH1 1 
ATOM   1128 N NH2 . ARG A 1 152 ? 22.641  39.756 63.351 1.00 19.12 ? 152 ARG A NH2 1 
ATOM   1129 N N   . ASP A 1 153 ? 29.513  39.734 59.586 1.00 16.49 ? 153 ASP A N   1 
ATOM   1130 C CA  . ASP A 1 153 ? 30.510  39.267 60.514 1.00 17.09 ? 153 ASP A CA  1 
ATOM   1131 C C   . ASP A 1 153 ? 29.928  39.226 61.907 1.00 16.18 ? 153 ASP A C   1 
ATOM   1132 O O   . ASP A 1 153 ? 29.402  40.220 62.402 1.00 16.37 ? 153 ASP A O   1 
ATOM   1133 C CB  . ASP A 1 153 ? 31.711  40.191 60.469 1.00 19.88 ? 153 ASP A CB  1 
ATOM   1134 C CG  . ASP A 1 153 ? 32.778  39.801 61.460 1.00 24.22 ? 153 ASP A CG  1 
ATOM   1135 O OD1 . ASP A 1 153 ? 32.966  38.589 61.724 1.00 26.83 ? 153 ASP A OD1 1 
ATOM   1136 O OD2 . ASP A 1 153 ? 33.443  40.724 61.981 1.00 27.85 ? 153 ASP A OD2 1 
ATOM   1137 N N   . MET A 1 154 ? 30.005  38.071 62.540 1.00 14.63 ? 154 MET A N   1 
ATOM   1138 C CA  . MET A 1 154 ? 29.474  37.931 63.878 1.00 14.74 ? 154 MET A CA  1 
ATOM   1139 C C   . MET A 1 154 ? 30.580  37.872 64.930 1.00 14.88 ? 154 MET A C   1 
ATOM   1140 O O   . MET A 1 154 ? 30.295  37.712 66.103 1.00 15.45 ? 154 MET A O   1 
ATOM   1141 C CB  . MET A 1 154 ? 28.593  36.683 63.976 1.00 14.74 ? 154 MET A CB  1 
ATOM   1142 C CG  . MET A 1 154 ? 27.251  36.780 63.217 1.00 15.87 ? 154 MET A CG  1 
ATOM   1143 S SD  . MET A 1 154 ? 26.098  37.982 63.927 1.00 18.48 ? 154 MET A SD  1 
ATOM   1144 C CE  . MET A 1 154 ? 25.731  37.163 65.430 1.00 18.27 ? 154 MET A CE  1 
ATOM   1145 N N   . GLY A 1 155 ? 31.836  38.003 64.526 1.00 14.14 ? 155 GLY A N   1 
ATOM   1146 C CA  . GLY A 1 155 ? 32.890  37.951 65.515 1.00 14.46 ? 155 GLY A CA  1 
ATOM   1147 C C   . GLY A 1 155 ? 33.532  36.583 65.487 1.00 14.70 ? 155 GLY A C   1 
ATOM   1148 O O   . GLY A 1 155 ? 33.323  35.850 64.524 1.00 15.23 ? 155 GLY A O   1 
ATOM   1149 N N   . LYS A 1 156 ? 34.287  36.221 66.519 1.00 13.85 ? 156 LYS A N   1 
ATOM   1150 C CA  . LYS A 1 156 ? 34.963  34.927 66.541 1.00 14.38 ? 156 LYS A CA  1 
ATOM   1151 C C   . LYS A 1 156 ? 34.945  34.275 67.906 1.00 13.09 ? 156 LYS A C   1 
ATOM   1152 O O   . LYS A 1 156 ? 34.928  34.948 68.927 1.00 12.82 ? 156 LYS A O   1 
ATOM   1153 C CB  . LYS A 1 156 ? 36.417  35.115 66.118 1.00 17.13 ? 156 LYS A CB  1 
ATOM   1154 C CG  . LYS A 1 156 ? 36.574  35.707 64.717 1.00 21.39 ? 156 LYS A CG  1 
ATOM   1155 C CD  . LYS A 1 156 ? 35.972  34.748 63.633 1.00 25.09 ? 156 LYS A CD  1 
ATOM   1156 C CE  . LYS A 1 156 ? 36.002  35.398 62.238 1.00 26.81 ? 156 LYS A CE  1 
ATOM   1157 N NZ  . LYS A 1 156 ? 35.282  34.629 61.172 1.00 29.02 ? 156 LYS A NZ  1 
ATOM   1158 N N   . LEU A 1 157 ? 34.971  32.958 67.929 1.00 11.88 ? 157 LEU A N   1 
ATOM   1159 C CA  . LEU A 1 157 ? 35.007  32.238 69.188 1.00 11.62 ? 157 LEU A CA  1 
ATOM   1160 C C   . LEU A 1 157 ? 36.356  32.585 69.853 1.00 12.16 ? 157 LEU A C   1 
ATOM   1161 O O   . LEU A 1 157 ? 37.419  32.491 69.232 1.00 12.02 ? 157 LEU A O   1 
ATOM   1162 C CB  . LEU A 1 157 ? 34.903  30.739 68.925 1.00 10.38 ? 157 LEU A CB  1 
ATOM   1163 C CG  . LEU A 1 157 ? 33.532  30.229 68.440 1.00 10.51 ? 157 LEU A CG  1 
ATOM   1164 C CD1 . LEU A 1 157 ? 33.601  28.711 68.175 1.00 8.68  ? 157 LEU A CD1 1 
ATOM   1165 C CD2 . LEU A 1 157 ? 32.475  30.511 69.480 1.00 9.29  ? 157 LEU A CD2 1 
ATOM   1166 N N   . PRO A 1 158 ? 36.328  32.986 71.122 1.00 12.97 ? 158 PRO A N   1 
ATOM   1167 C CA  . PRO A 1 158 ? 37.584  33.343 71.792 1.00 14.42 ? 158 PRO A CA  1 
ATOM   1168 C C   . PRO A 1 158 ? 38.502  32.185 72.109 1.00 15.15 ? 158 PRO A C   1 
ATOM   1169 O O   . PRO A 1 158 ? 39.704  32.361 72.184 1.00 16.11 ? 158 PRO A O   1 
ATOM   1170 C CB  . PRO A 1 158 ? 37.098  34.015 73.072 1.00 14.23 ? 158 PRO A CB  1 
ATOM   1171 C CG  . PRO A 1 158 ? 35.822  33.260 73.364 1.00 13.03 ? 158 PRO A CG  1 
ATOM   1172 C CD  . PRO A 1 158 ? 35.174  33.192 72.016 1.00 12.72 ? 158 PRO A CD  1 
ATOM   1173 N N   . GLY A 1 159 ? 37.943  30.999 72.273 1.00 15.19 ? 159 GLY A N   1 
ATOM   1174 C CA  . GLY A 1 159 ? 38.767  29.861 72.623 1.00 15.46 ? 159 GLY A CA  1 
ATOM   1175 C C   . GLY A 1 159 ? 39.361  29.043 71.500 1.00 15.26 ? 159 GLY A C   1 
ATOM   1176 O O   . GLY A 1 159 ? 39.728  27.889 71.715 1.00 15.20 ? 159 GLY A O   1 
ATOM   1177 N N   . THR A 1 160 ? 39.449  29.585 70.298 1.00 15.24 ? 160 THR A N   1 
ATOM   1178 C CA  . THR A 1 160 ? 40.025  28.775 69.247 1.00 15.35 ? 160 THR A CA  1 
ATOM   1179 C C   . THR A 1 160 ? 40.850  29.596 68.299 1.00 16.21 ? 160 THR A C   1 
ATOM   1180 O O   . THR A 1 160 ? 40.648  30.803 68.165 1.00 16.42 ? 160 THR A O   1 
ATOM   1181 C CB  . THR A 1 160 ? 38.975  27.979 68.444 1.00 14.91 ? 160 THR A CB  1 
ATOM   1182 O OG1 . THR A 1 160 ? 39.660  27.109 67.523 1.00 14.83 ? 160 THR A OG1 1 
ATOM   1183 C CG2 . THR A 1 160 ? 38.061  28.891 67.661 1.00 13.06 ? 160 THR A CG2 1 
ATOM   1184 N N   . GLN A 1 161 ? 41.803  28.936 67.659 1.00 16.62 ? 161 GLN A N   1 
ATOM   1185 C CA  . GLN A 1 161 ? 42.641  29.622 66.701 1.00 17.60 ? 161 GLN A CA  1 
ATOM   1186 C C   . GLN A 1 161 ? 42.263  29.163 65.278 1.00 16.74 ? 161 GLN A C   1 
ATOM   1187 O O   . GLN A 1 161 ? 42.781  29.680 64.291 1.00 17.65 ? 161 GLN A O   1 
ATOM   1188 C CB  . GLN A 1 161 ? 44.136  29.350 67.015 1.00 19.00 ? 161 GLN A CB  1 
ATOM   1189 N N   . LYS A 1 162 ? 41.339  28.212 65.173 1.00 15.43 ? 162 LYS A N   1 
ATOM   1190 C CA  . LYS A 1 162 ? 40.916  27.742 63.863 1.00 14.25 ? 162 LYS A CA  1 
ATOM   1191 C C   . LYS A 1 162 ? 40.141  28.844 63.185 1.00 13.16 ? 162 LYS A C   1 
ATOM   1192 O O   . LYS A 1 162 ? 39.378  29.549 63.838 1.00 13.35 ? 162 LYS A O   1 
ATOM   1193 C CB  . LYS A 1 162 ? 39.944  26.599 64.008 1.00 14.43 ? 162 LYS A CB  1 
ATOM   1194 C CG  . LYS A 1 162 ? 40.492  25.318 64.481 1.00 15.36 ? 162 LYS A CG  1 
ATOM   1195 C CD  . LYS A 1 162 ? 39.369  24.305 64.390 1.00 14.48 ? 162 LYS A CD  1 
ATOM   1196 C CE  . LYS A 1 162 ? 39.824  22.898 64.703 1.00 14.58 ? 162 LYS A CE  1 
ATOM   1197 N NZ  . LYS A 1 162 ? 39.352  22.418 66.049 1.00 14.57 ? 162 LYS A NZ  1 
ATOM   1198 N N   . ALA A 1 163 ? 40.267  28.941 61.871 1.00 12.42 ? 163 ALA A N   1 
ATOM   1199 C CA  . ALA A 1 163 ? 39.497  29.914 61.106 1.00 12.60 ? 163 ALA A CA  1 
ATOM   1200 C C   . ALA A 1 163 ? 38.073  29.339 61.107 1.00 12.31 ? 163 ALA A C   1 
ATOM   1201 O O   . ALA A 1 163 ? 37.912  28.141 60.868 1.00 12.55 ? 163 ALA A O   1 
ATOM   1202 C CB  . ALA A 1 163 ? 40.000  29.962 59.689 1.00 12.80 ? 163 ALA A CB  1 
ATOM   1203 N N   . HIS A 1 164 ? 37.061  30.168 61.350 1.00 11.34 ? 164 HIS A N   1 
ATOM   1204 C CA  . HIS A 1 164 ? 35.663  29.699 61.369 1.00 11.07 ? 164 HIS A CA  1 
ATOM   1205 C C   . HIS A 1 164 ? 34.788  30.920 61.142 1.00 10.81 ? 164 HIS A C   1 
ATOM   1206 O O   . HIS A 1 164 ? 35.259  32.053 61.301 1.00 10.24 ? 164 HIS A O   1 
ATOM   1207 C CB  . HIS A 1 164 ? 35.322  29.055 62.725 1.00 9.50  ? 164 HIS A CB  1 
ATOM   1208 C CG  . HIS A 1 164 ? 35.432  30.001 63.878 1.00 10.23 ? 164 HIS A CG  1 
ATOM   1209 N ND1 . HIS A 1 164 ? 36.641  30.340 64.454 1.00 10.69 ? 164 HIS A ND1 1 
ATOM   1210 C CD2 . HIS A 1 164 ? 34.493  30.759 64.500 1.00 10.01 ? 164 HIS A CD2 1 
ATOM   1211 C CE1 . HIS A 1 164 ? 36.440  31.275 65.370 1.00 10.27 ? 164 HIS A CE1 1 
ATOM   1212 N NE2 . HIS A 1 164 ? 35.145  31.548 65.416 1.00 9.65  ? 164 HIS A NE2 1 
ATOM   1213 N N   . THR A 1 165 ? 33.542  30.701 60.744 1.00 10.14 ? 165 THR A N   1 
ATOM   1214 C CA  . THR A 1 165 ? 32.620  31.816 60.519 1.00 10.02 ? 165 THR A CA  1 
ATOM   1215 C C   . THR A 1 165 ? 31.313  31.545 61.256 1.00 9.20  ? 165 THR A C   1 
ATOM   1216 O O   . THR A 1 165 ? 30.648  30.551 60.983 1.00 8.60  ? 165 THR A O   1 
ATOM   1217 C CB  . THR A 1 165 ? 32.315  32.015 59.012 1.00 10.96 ? 165 THR A CB  1 
ATOM   1218 O OG1 . THR A 1 165 ? 33.543  32.066 58.281 1.00 12.38 ? 165 THR A OG1 1 
ATOM   1219 C CG2 . THR A 1 165 ? 31.562  33.310 58.777 1.00 10.02 ? 165 THR A CG2 1 
ATOM   1220 N N   . ILE A 1 166 ? 30.987  32.397 62.226 1.00 7.75  ? 166 ILE A N   1 
ATOM   1221 C CA  . ILE A 1 166 ? 29.758  32.248 62.989 1.00 7.31  ? 166 ILE A CA  1 
ATOM   1222 C C   . ILE A 1 166 ? 28.554  32.676 62.139 1.00 7.60  ? 166 ILE A C   1 
ATOM   1223 O O   . ILE A 1 166 ? 28.608  33.692 61.442 1.00 8.39  ? 166 ILE A O   1 
ATOM   1224 C CB  . ILE A 1 166 ? 29.815  33.086 64.273 1.00 7.11  ? 166 ILE A CB  1 
ATOM   1225 C CG1 . ILE A 1 166 ? 31.018  32.620 65.120 1.00 7.00  ? 166 ILE A CG1 1 
ATOM   1226 C CG2 . ILE A 1 166 ? 28.459  33.003 65.044 1.00 5.33  ? 166 ILE A CG2 1 
ATOM   1227 C CD1 . ILE A 1 166 ? 31.168  33.361 66.457 1.00 6.71  ? 166 ILE A CD1 1 
ATOM   1228 N N   . PRO A 1 167 ? 27.469  31.873 62.136 1.00 7.20  ? 167 PRO A N   1 
ATOM   1229 C CA  . PRO A 1 167 ? 26.288  32.236 61.333 1.00 6.89  ? 167 PRO A CA  1 
ATOM   1230 C C   . PRO A 1 167 ? 25.661  33.552 61.788 1.00 5.97  ? 167 PRO A C   1 
ATOM   1231 O O   . PRO A 1 167 ? 25.823  33.946 62.938 1.00 6.10  ? 167 PRO A O   1 
ATOM   1232 C CB  . PRO A 1 167 ? 25.315  31.072 61.602 1.00 6.86  ? 167 PRO A CB  1 
ATOM   1233 C CG  . PRO A 1 167 ? 26.226  29.904 61.970 1.00 6.58  ? 167 PRO A CG  1 
ATOM   1234 C CD  . PRO A 1 167 ? 27.316  30.542 62.773 1.00 7.18  ? 167 PRO A CD  1 
ATOM   1235 N N   . SER A 1 168 ? 24.970  34.235 60.883 1.00 4.99  ? 168 SER A N   1 
ATOM   1236 C CA  . SER A 1 168 ? 24.256  35.463 61.228 1.00 4.24  ? 168 SER A CA  1 
ATOM   1237 C C   . SER A 1 168 ? 22.740  35.168 61.359 1.00 4.63  ? 168 SER A C   1 
ATOM   1238 O O   . SER A 1 168 ? 22.000  35.978 61.885 1.00 5.10  ? 168 SER A O   1 
ATOM   1239 C CB  . SER A 1 168 ? 24.451  36.502 60.145 1.00 3.80  ? 168 SER A CB  1 
ATOM   1240 O OG  . SER A 1 168 ? 24.071  35.981 58.875 1.00 4.05  ? 168 SER A OG  1 
ATOM   1241 N N   . ALA A 1 169 ? 22.293  33.997 60.898 1.00 5.48  ? 169 ALA A N   1 
ATOM   1242 C CA  . ALA A 1 169 ? 20.877  33.604 60.923 1.00 4.74  ? 169 ALA A CA  1 
ATOM   1243 C C   . ALA A 1 169 ? 20.775  32.087 60.693 1.00 4.60  ? 169 ALA A C   1 
ATOM   1244 O O   . ALA A 1 169 ? 21.758  31.429 60.324 1.00 4.21  ? 169 ALA A O   1 
ATOM   1245 C CB  . ALA A 1 169 ? 20.090  34.345 59.809 1.00 4.57  ? 169 ALA A CB  1 
ATOM   1246 N N   . TYR A 1 170 ? 19.574  31.552 60.898 1.00 4.15  ? 170 TYR A N   1 
ATOM   1247 C CA  . TYR A 1 170 ? 19.298  30.125 60.765 1.00 5.14  ? 170 TYR A CA  1 
ATOM   1248 C C   . TYR A 1 170 ? 17.921  29.959 60.110 1.00 5.55  ? 170 TYR A C   1 
ATOM   1249 O O   . TYR A 1 170 ? 17.018  30.759 60.379 1.00 5.03  ? 170 TYR A O   1 
ATOM   1250 C CB  . TYR A 1 170 ? 19.251  29.468 62.159 1.00 5.20  ? 170 TYR A CB  1 
ATOM   1251 C CG  . TYR A 1 170 ? 20.562  29.536 62.914 1.00 5.86  ? 170 TYR A CG  1 
ATOM   1252 C CD1 . TYR A 1 170 ? 21.547  28.570 62.726 1.00 5.56  ? 170 TYR A CD1 1 
ATOM   1253 C CD2 . TYR A 1 170 ? 20.835  30.607 63.773 1.00 5.82  ? 170 TYR A CD2 1 
ATOM   1254 C CE1 . TYR A 1 170 ? 22.785  28.666 63.375 1.00 6.32  ? 170 TYR A CE1 1 
ATOM   1255 C CE2 . TYR A 1 170 ? 22.069  30.714 64.414 1.00 6.33  ? 170 TYR A CE2 1 
ATOM   1256 C CZ  . TYR A 1 170 ? 23.033  29.740 64.211 1.00 5.93  ? 170 TYR A CZ  1 
ATOM   1257 O OH  . TYR A 1 170 ? 24.239  29.861 64.846 1.00 6.54  ? 170 TYR A OH  1 
ATOM   1258 N N   . TRP A 1 171 ? 17.741  28.871 59.354 1.00 4.64  ? 171 TRP A N   1 
ATOM   1259 C CA  . TRP A 1 171 ? 16.486  28.626 58.662 1.00 4.65  ? 171 TRP A CA  1 
ATOM   1260 C C   . TRP A 1 171 ? 16.065  27.202 58.843 1.00 4.61  ? 171 TRP A C   1 
ATOM   1261 O O   . TRP A 1 171 ? 16.889  26.333 59.159 1.00 5.18  ? 171 TRP A O   1 
ATOM   1262 C CB  . TRP A 1 171 ? 16.597  28.951 57.149 1.00 3.22  ? 171 TRP A CB  1 
ATOM   1263 C CG  . TRP A 1 171 ? 17.803  28.365 56.503 1.00 3.03  ? 171 TRP A CG  1 
ATOM   1264 C CD1 . TRP A 1 171 ? 19.021  28.962 56.366 1.00 2.64  ? 171 TRP A CD1 1 
ATOM   1265 C CD2 . TRP A 1 171 ? 17.931  27.059 55.929 1.00 4.22  ? 171 TRP A CD2 1 
ATOM   1266 N NE1 . TRP A 1 171 ? 19.889  28.121 55.750 1.00 3.24  ? 171 TRP A NE1 1 
ATOM   1267 C CE2 . TRP A 1 171 ? 19.252  26.939 55.472 1.00 3.36  ? 171 TRP A CE2 1 
ATOM   1268 C CE3 . TRP A 1 171 ? 17.054  25.978 55.761 1.00 4.41  ? 171 TRP A CE3 1 
ATOM   1269 C CZ2 . TRP A 1 171 ? 19.729  25.783 54.868 1.00 3.92  ? 171 TRP A CZ2 1 
ATOM   1270 C CZ3 . TRP A 1 171 ? 17.524  24.827 55.158 1.00 4.75  ? 171 TRP A CZ3 1 
ATOM   1271 C CH2 . TRP A 1 171 ? 18.855  24.737 54.721 1.00 5.34  ? 171 TRP A CH2 1 
ATOM   1272 N N   . LYS A 1 172 ? 14.781  26.957 58.628 1.00 3.81  ? 172 LYS A N   1 
ATOM   1273 C CA  . LYS A 1 172 ? 14.241  25.616 58.743 1.00 3.71  ? 172 LYS A CA  1 
ATOM   1274 C C   . LYS A 1 172 ? 13.110  25.513 57.713 1.00 3.91  ? 172 LYS A C   1 
ATOM   1275 O O   . LYS A 1 172 ? 12.283  26.384 57.656 1.00 4.33  ? 172 LYS A O   1 
ATOM   1276 C CB  . LYS A 1 172 ? 13.718  25.392 60.168 1.00 4.67  ? 172 LYS A CB  1 
ATOM   1277 C CG  . LYS A 1 172 ? 13.465  23.934 60.533 1.00 6.06  ? 172 LYS A CG  1 
ATOM   1278 C CD  . LYS A 1 172 ? 13.191  23.724 62.031 1.00 5.51  ? 172 LYS A CD  1 
ATOM   1279 C CE  . LYS A 1 172 ? 14.449  23.398 62.802 1.00 3.98  ? 172 LYS A CE  1 
ATOM   1280 N NZ  . LYS A 1 172 ? 14.067  23.109 64.231 1.00 4.45  ? 172 LYS A NZ  1 
ATOM   1281 N N   . VAL A 1 173 ? 13.111  24.447 56.919 1.00 3.88  ? 173 VAL A N   1 
ATOM   1282 C CA  . VAL A 1 173 ? 12.136  24.150 55.871 1.00 3.22  ? 173 VAL A CA  1 
ATOM   1283 C C   . VAL A 1 173 ? 11.578  22.815 56.304 1.00 3.49  ? 173 VAL A C   1 
ATOM   1284 O O   . VAL A 1 173 ? 12.324  21.859 56.527 1.00 3.58  ? 173 VAL A O   1 
ATOM   1285 C CB  . VAL A 1 173 ? 12.867  24.020 54.507 1.00 3.92  ? 173 VAL A CB  1 
ATOM   1286 C CG1 . VAL A 1 173 ? 11.954  23.501 53.417 1.00 2.61  ? 173 VAL A CG1 1 
ATOM   1287 C CG2 . VAL A 1 173 ? 13.438  25.398 54.129 1.00 3.11  ? 173 VAL A CG2 1 
ATOM   1288 N N   . ILE A 1 174 ? 10.260  22.730 56.404 1.00 3.39  ? 174 ILE A N   1 
ATOM   1289 C CA  . ILE A 1 174 ? 9.605   21.525 56.911 1.00 3.81  ? 174 ILE A CA  1 
ATOM   1290 C C   . ILE A 1 174 ? 8.436   21.104 56.034 1.00 3.82  ? 174 ILE A C   1 
ATOM   1291 O O   . ILE A 1 174 ? 7.806   21.946 55.389 1.00 3.53  ? 174 ILE A O   1 
ATOM   1292 C CB  . ILE A 1 174 ? 8.997   21.864 58.321 1.00 4.08  ? 174 ILE A CB  1 
ATOM   1293 C CG1 . ILE A 1 174 ? 10.079  22.474 59.243 1.00 6.17  ? 174 ILE A CG1 1 
ATOM   1294 C CG2 . ILE A 1 174 ? 8.302   20.640 58.973 1.00 4.70  ? 174 ILE A CG2 1 
ATOM   1295 C CD1 . ILE A 1 174 ? 9.509   23.200 60.439 1.00 6.60  ? 174 ILE A CD1 1 
ATOM   1296 N N   . PHE A 1 175 ? 8.220   19.803 55.929 1.00 4.16  ? 175 PHE A N   1 
ATOM   1297 C CA  . PHE A 1 175 ? 7.017   19.290 55.267 1.00 4.54  ? 175 PHE A CA  1 
ATOM   1298 C C   . PHE A 1 175 ? 6.640   17.993 55.970 1.00 4.66  ? 175 PHE A C   1 
ATOM   1299 O O   . PHE A 1 175 ? 7.467   17.324 56.609 1.00 4.87  ? 175 PHE A O   1 
ATOM   1300 C CB  . PHE A 1 175 ? 7.118   19.144 53.737 1.00 3.80  ? 175 PHE A CB  1 
ATOM   1301 C CG  . PHE A 1 175 ? 7.950   17.980 53.280 1.00 4.58  ? 175 PHE A CG  1 
ATOM   1302 C CD1 . PHE A 1 175 ? 7.396   16.697 53.190 1.00 4.86  ? 175 PHE A CD1 1 
ATOM   1303 C CD2 . PHE A 1 175 ? 9.293   18.167 52.943 1.00 3.96  ? 175 PHE A CD2 1 
ATOM   1304 C CE1 . PHE A 1 175 ? 8.183   15.591 52.767 1.00 4.82  ? 175 PHE A CE1 1 
ATOM   1305 C CE2 . PHE A 1 175 ? 10.096  17.081 52.517 1.00 4.95  ? 175 PHE A CE2 1 
ATOM   1306 C CZ  . PHE A 1 175 ? 9.542   15.795 52.431 1.00 4.13  ? 175 PHE A CZ  1 
ATOM   1307 N N   . ILE A 1 176 ? 5.382   17.620 55.864 1.00 5.16  ? 176 ILE A N   1 
ATOM   1308 C CA  . ILE A 1 176 ? 4.909   16.412 56.538 1.00 5.54  ? 176 ILE A CA  1 
ATOM   1309 C C   . ILE A 1 176 ? 4.551   15.320 55.568 1.00 5.79  ? 176 ILE A C   1 
ATOM   1310 O O   . ILE A 1 176 ? 4.331   15.551 54.394 1.00 4.92  ? 176 ILE A O   1 
ATOM   1311 C CB  . ILE A 1 176 ? 3.640   16.705 57.394 1.00 5.82  ? 176 ILE A CB  1 
ATOM   1312 C CG1 . ILE A 1 176 ? 2.550   17.379 56.517 1.00 5.27  ? 176 ILE A CG1 1 
ATOM   1313 C CG2 . ILE A 1 176 ? 3.993   17.577 58.609 1.00 4.12  ? 176 ILE A CG2 1 
ATOM   1314 C CD1 . ILE A 1 176 ? 1.122   17.454 57.177 1.00 6.60  ? 176 ILE A CD1 1 
ATOM   1315 N N   . ASN A 1 177 ? 4.535   14.108 56.096 1.00 7.42  ? 177 ASN A N   1 
ATOM   1316 C CA  . ASN A 1 177 ? 4.172   12.914 55.374 1.00 9.12  ? 177 ASN A CA  1 
ATOM   1317 C C   . ASN A 1 177 ? 4.983   12.488 54.180 1.00 10.58 ? 177 ASN A C   1 
ATOM   1318 O O   . ASN A 1 177 ? 6.041   11.922 54.363 1.00 12.83 ? 177 ASN A O   1 
ATOM   1319 C CB  . ASN A 1 177 ? 2.657   12.879 55.115 1.00 8.61  ? 177 ASN A CB  1 
ATOM   1320 C CG  . ASN A 1 177 ? 1.894   12.746 56.403 1.00 10.05 ? 177 ASN A CG  1 
ATOM   1321 O OD1 . ASN A 1 177 ? 2.499   12.668 57.478 1.00 9.88  ? 177 ASN A OD1 1 
ATOM   1322 N ND2 . ASN A 1 177 ? 0.584   12.756 56.330 1.00 10.81 ? 177 ASN A ND2 1 
ATOM   1323 N N   . ASN A 1 178 ? 4.526   12.776 52.977 1.00 11.00 ? 178 ASN A N   1 
ATOM   1324 C CA  . ASN A 1 178 ? 5.192   12.315 51.768 1.00 11.10 ? 178 ASN A CA  1 
ATOM   1325 C C   . ASN A 1 178 ? 6.058   13.274 50.975 1.00 9.23  ? 178 ASN A C   1 
ATOM   1326 O O   . ASN A 1 178 ? 7.181   12.943 50.640 1.00 7.78  ? 178 ASN A O   1 
ATOM   1327 C CB  . ASN A 1 178 ? 4.136   11.747 50.807 1.00 13.93 ? 178 ASN A CB  1 
ATOM   1328 C CG  . ASN A 1 178 ? 3.214   10.756 51.492 1.00 18.42 ? 178 ASN A CG  1 
ATOM   1329 O OD1 . ASN A 1 178 ? 2.009   11.011 51.687 1.00 20.91 ? 178 ASN A OD1 1 
ATOM   1330 N ND2 . ASN A 1 178 ? 3.795   9.660  51.953 1.00 20.30 ? 178 ASN A ND2 1 
ATOM   1331 N N   . SER A 1 179 ? 5.510   14.424 50.616 1.00 7.54  ? 179 SER A N   1 
ATOM   1332 C CA  . SER A 1 179 ? 6.242   15.343 49.767 1.00 6.55  ? 179 SER A CA  1 
ATOM   1333 C C   . SER A 1 179 ? 5.540   16.662 49.754 1.00 6.71  ? 179 SER A C   1 
ATOM   1334 O O   . SER A 1 179 ? 4.316   16.710 49.840 1.00 5.71  ? 179 SER A O   1 
ATOM   1335 C CB  . SER A 1 179 ? 6.201   14.799 48.327 1.00 6.44  ? 179 SER A CB  1 
ATOM   1336 O OG  . SER A 1 179 ? 6.508   15.802 47.362 1.00 6.85  ? 179 SER A OG  1 
ATOM   1337 N N   . PRO A 1 180 ? 6.297   17.760 49.601 1.00 6.95  ? 180 PRO A N   1 
ATOM   1338 C CA  . PRO A 1 180 ? 5.626   19.057 49.562 1.00 7.39  ? 180 PRO A CA  1 
ATOM   1339 C C   . PRO A 1 180 ? 4.743   19.197 48.283 1.00 7.22  ? 180 PRO A C   1 
ATOM   1340 O O   . PRO A 1 180 ? 3.902   20.099 48.194 1.00 6.53  ? 180 PRO A O   1 
ATOM   1341 C CB  . PRO A 1 180 ? 6.795   20.066 49.611 1.00 6.69  ? 180 PRO A CB  1 
ATOM   1342 C CG  . PRO A 1 180 ? 7.933   19.301 49.169 1.00 7.79  ? 180 PRO A CG  1 
ATOM   1343 C CD  . PRO A 1 180 ? 7.747   17.932 49.716 1.00 6.47  ? 180 PRO A CD  1 
ATOM   1344 N N   . ALA A 1 181 ? 4.930   18.304 47.305 1.00 6.80  ? 181 ALA A N   1 
ATOM   1345 C CA  . ALA A 1 181 ? 4.129   18.353 46.092 1.00 6.84  ? 181 ALA A CA  1 
ATOM   1346 C C   . ALA A 1 181 ? 2.651   18.136 46.442 1.00 7.23  ? 181 ALA A C   1 
ATOM   1347 O O   . ALA A 1 181 ? 1.773   18.575 45.702 1.00 8.56  ? 181 ALA A O   1 
ATOM   1348 C CB  . ALA A 1 181 ? 4.580   17.266 45.105 1.00 6.07  ? 181 ALA A CB  1 
ATOM   1349 N N   . VAL A 1 182 ? 2.373   17.433 47.538 1.00 6.14  ? 182 VAL A N   1 
ATOM   1350 C CA  . VAL A 1 182 ? 0.995   17.147 47.918 1.00 4.76  ? 182 VAL A CA  1 
ATOM   1351 C C   . VAL A 1 182 ? 0.647   17.442 49.397 1.00 4.47  ? 182 VAL A C   1 
ATOM   1352 O O   . VAL A 1 182 ? -0.529  17.556 49.731 1.00 4.05  ? 182 VAL A O   1 
ATOM   1353 C CB  . VAL A 1 182 ? 0.622   15.646 47.582 1.00 4.74  ? 182 VAL A CB  1 
ATOM   1354 C CG1 . VAL A 1 182 ? 0.758   15.386 46.081 1.00 3.49  ? 182 VAL A CG1 1 
ATOM   1355 C CG2 . VAL A 1 182 ? 1.516   14.620 48.387 1.00 4.23  ? 182 VAL A CG2 1 
ATOM   1356 N N   . ASN A 1 183 ? 1.661   17.649 50.243 1.00 3.37  ? 183 ASN A N   1 
ATOM   1357 C CA  . ASN A 1 183 ? 1.482   17.864 51.684 1.00 3.74  ? 183 ASN A CA  1 
ATOM   1358 C C   . ASN A 1 183 ? 1.878   19.232 52.156 1.00 4.29  ? 183 ASN A C   1 
ATOM   1359 O O   . ASN A 1 183 ? 2.714   19.895 51.527 1.00 5.52  ? 183 ASN A O   1 
ATOM   1360 C CB  . ASN A 1 183 ? 2.324   16.865 52.490 1.00 2.87  ? 183 ASN A CB  1 
ATOM   1361 C CG  . ASN A 1 183 ? 1.883   15.407 52.300 1.00 4.48  ? 183 ASN A CG  1 
ATOM   1362 O OD1 . ASN A 1 183 ? 2.645   14.567 51.794 1.00 4.20  ? 183 ASN A OD1 1 
ATOM   1363 N ND2 . ASN A 1 183 ? 0.676   15.079 52.781 1.00 4.17  ? 183 ASN A ND2 1 
ATOM   1364 N N   . HIS A 1 184 ? 1.316   19.643 53.285 1.00 3.03  ? 184 HIS A N   1 
ATOM   1365 C CA  . HIS A 1 184 ? 1.619   20.955 53.858 1.00 3.49  ? 184 HIS A CA  1 
ATOM   1366 C C   . HIS A 1 184 ? 3.129   21.142 54.144 1.00 3.13  ? 184 HIS A C   1 
ATOM   1367 O O   . HIS A 1 184 ? 3.811   20.200 54.591 1.00 2.00  ? 184 HIS A O   1 
ATOM   1368 C CB  . HIS A 1 184 ? 0.854   21.152 55.181 1.00 3.73  ? 184 HIS A CB  1 
ATOM   1369 C CG  . HIS A 1 184 ? -0.634  20.993 55.063 1.00 4.65  ? 184 HIS A CG  1 
ATOM   1370 N ND1 . HIS A 1 184 ? -1.355  21.430 53.966 1.00 5.57  ? 184 HIS A ND1 1 
ATOM   1371 C CD2 . HIS A 1 184 ? -1.545  20.504 55.942 1.00 4.67  ? 184 HIS A CD2 1 
ATOM   1372 C CE1 . HIS A 1 184 ? -2.646  21.221 54.183 1.00 5.38  ? 184 HIS A CE1 1 
ATOM   1373 N NE2 . HIS A 1 184 ? -2.784  20.662 55.373 1.00 4.17  ? 184 HIS A NE2 1 
ATOM   1374 N N   . TYR A 1 185 ? 3.594   22.388 54.051 1.00 2.60  ? 185 TYR A N   1 
ATOM   1375 C CA  . TYR A 1 185 ? 5.000   22.675 54.285 1.00 2.96  ? 185 TYR A CA  1 
ATOM   1376 C C   . TYR A 1 185 ? 5.150   24.051 54.925 1.00 3.81  ? 185 TYR A C   1 
ATOM   1377 O O   . TYR A 1 185 ? 4.214   24.864 54.938 1.00 4.17  ? 185 TYR A O   1 
ATOM   1378 C CB  . TYR A 1 185 ? 5.822   22.594 52.953 1.00 2.00  ? 185 TYR A CB  1 
ATOM   1379 C CG  . TYR A 1 185 ? 5.327   23.536 51.844 1.00 2.34  ? 185 TYR A CG  1 
ATOM   1380 C CD1 . TYR A 1 185 ? 5.730   24.869 51.810 1.00 2.82  ? 185 TYR A CD1 1 
ATOM   1381 C CD2 . TYR A 1 185 ? 4.422   23.094 50.853 1.00 2.54  ? 185 TYR A CD2 1 
ATOM   1382 C CE1 . TYR A 1 185 ? 5.269   25.745 50.838 1.00 3.20  ? 185 TYR A CE1 1 
ATOM   1383 C CE2 . TYR A 1 185 ? 3.933   23.980 49.878 1.00 3.24  ? 185 TYR A CE2 1 
ATOM   1384 C CZ  . TYR A 1 185 ? 4.362   25.292 49.881 1.00 3.86  ? 185 TYR A CZ  1 
ATOM   1385 O OH  . TYR A 1 185 ? 3.871   26.186 48.960 1.00 4.65  ? 185 TYR A OH  1 
ATOM   1386 N N   . ALA A 1 186 ? 6.360   24.355 55.361 1.00 4.30  ? 186 ALA A N   1 
ATOM   1387 C CA  . ALA A 1 186 ? 6.639   25.630 56.010 1.00 4.82  ? 186 ALA A CA  1 
ATOM   1388 C C   . ALA A 1 186 ? 8.126   25.965 55.881 1.00 5.08  ? 186 ALA A C   1 
ATOM   1389 O O   . ALA A 1 186 ? 8.963   25.069 55.653 1.00 4.70  ? 186 ALA A O   1 
ATOM   1390 C CB  . ALA A 1 186 ? 6.258   25.553 57.504 1.00 4.57  ? 186 ALA A CB  1 
ATOM   1391 N N   . ALA A 1 187 ? 8.435   27.259 55.998 1.00 4.38  ? 187 ALA A N   1 
ATOM   1392 C CA  . ALA A 1 187 ? 9.817   27.715 55.981 1.00 4.47  ? 187 ALA A CA  1 
ATOM   1393 C C   . ALA A 1 187 ? 9.864   28.910 56.916 1.00 5.05  ? 187 ALA A C   1 
ATOM   1394 O O   . ALA A 1 187 ? 8.952   29.753 56.914 1.00 5.25  ? 187 ALA A O   1 
ATOM   1395 C CB  . ALA A 1 187 ? 10.262  28.106 54.598 1.00 2.56  ? 187 ALA A CB  1 
ATOM   1396 N N   . PHE A 1 188 ? 10.921  28.951 57.738 1.00 5.96  ? 188 PHE A N   1 
ATOM   1397 C CA  . PHE A 1 188 ? 11.184  30.011 58.730 1.00 5.99  ? 188 PHE A CA  1 
ATOM   1398 C C   . PHE A 1 188 ? 12.644  30.462 58.650 1.00 6.15  ? 188 PHE A C   1 
ATOM   1399 O O   . PHE A 1 188 ? 13.518  29.668 58.309 1.00 6.05  ? 188 PHE A O   1 
ATOM   1400 C CB  . PHE A 1 188 ? 10.952  29.468 60.142 1.00 5.88  ? 188 PHE A CB  1 
ATOM   1401 C CG  . PHE A 1 188 ? 9.553   28.948 60.381 1.00 6.48  ? 188 PHE A CG  1 
ATOM   1402 C CD1 . PHE A 1 188 ? 9.239   27.605 60.134 1.00 6.80  ? 188 PHE A CD1 1 
ATOM   1403 C CD2 . PHE A 1 188 ? 8.564   29.785 60.910 1.00 6.87  ? 188 PHE A CD2 1 
ATOM   1404 C CE1 . PHE A 1 188 ? 7.947   27.092 60.419 1.00 6.83  ? 188 PHE A CE1 1 
ATOM   1405 C CE2 . PHE A 1 188 ? 7.279   29.287 61.199 1.00 6.04  ? 188 PHE A CE2 1 
ATOM   1406 C CZ  . PHE A 1 188 ? 6.979   27.942 60.955 1.00 6.25  ? 188 PHE A CZ  1 
ATOM   1407 N N   . LEU A 1 189 ? 12.916  31.715 58.974 1.00 6.50  ? 189 LEU A N   1 
ATOM   1408 C CA  . LEU A 1 189 ? 14.296  32.201 58.950 1.00 7.67  ? 189 LEU A CA  1 
ATOM   1409 C C   . LEU A 1 189 ? 14.393  33.168 60.082 1.00 7.96  ? 189 LEU A C   1 
ATOM   1410 O O   . LEU A 1 189 ? 13.573  34.086 60.174 1.00 7.98  ? 189 LEU A O   1 
ATOM   1411 C CB  . LEU A 1 189 ? 14.614  32.896 57.629 1.00 8.88  ? 189 LEU A CB  1 
ATOM   1412 C CG  . LEU A 1 189 ? 15.958  33.610 57.418 1.00 10.26 ? 189 LEU A CG  1 
ATOM   1413 C CD1 . LEU A 1 189 ? 17.063  32.630 57.736 1.00 10.88 ? 189 LEU A CD1 1 
ATOM   1414 C CD2 . LEU A 1 189 ? 16.047  34.014 55.948 1.00 11.45 ? 189 LEU A CD2 1 
ATOM   1415 N N   . PHE A 1 190 ? 15.372  32.949 60.953 1.00 7.30  ? 190 PHE A N   1 
ATOM   1416 C CA  . PHE A 1 190 ? 15.580  33.767 62.134 1.00 7.22  ? 190 PHE A CA  1 
ATOM   1417 C C   . PHE A 1 190 ? 16.984  34.370 62.141 1.00 7.96  ? 190 PHE A C   1 
ATOM   1418 O O   . PHE A 1 190 ? 17.973  33.649 61.936 1.00 8.10  ? 190 PHE A O   1 
ATOM   1419 C CB  . PHE A 1 190 ? 15.495  32.901 63.408 1.00 6.89  ? 190 PHE A CB  1 
ATOM   1420 C CG  . PHE A 1 190 ? 14.237  32.089 63.528 1.00 8.65  ? 190 PHE A CG  1 
ATOM   1421 C CD1 . PHE A 1 190 ? 14.156  30.809 62.971 1.00 9.00  ? 190 PHE A CD1 1 
ATOM   1422 C CD2 . PHE A 1 190 ? 13.121  32.604 64.206 1.00 9.89  ? 190 PHE A CD2 1 
ATOM   1423 C CE1 . PHE A 1 190 ? 12.979  30.042 63.080 1.00 8.81  ? 190 PHE A CE1 1 
ATOM   1424 C CE2 . PHE A 1 190 ? 11.938  31.839 64.320 1.00 9.93  ? 190 PHE A CE2 1 
ATOM   1425 C CZ  . PHE A 1 190 ? 11.876  30.562 63.755 1.00 9.50  ? 190 PHE A CZ  1 
ATOM   1426 N N   . ASP A 1 191 ? 17.072  35.668 62.424 1.00 7.45  ? 191 ASP A N   1 
ATOM   1427 C CA  . ASP A 1 191 ? 18.361  36.343 62.554 1.00 8.42  ? 191 ASP A CA  1 
ATOM   1428 C C   . ASP A 1 191 ? 18.939  35.952 63.935 1.00 7.66  ? 191 ASP A C   1 
ATOM   1429 O O   . ASP A 1 191 ? 18.185  35.651 64.866 1.00 7.47  ? 191 ASP A O   1 
ATOM   1430 C CB  . ASP A 1 191 ? 18.146  37.849 62.530 1.00 9.05  ? 191 ASP A CB  1 
ATOM   1431 C CG  . ASP A 1 191 ? 19.434  38.607 62.475 1.00 11.29 ? 191 ASP A CG  1 
ATOM   1432 O OD1 . ASP A 1 191 ? 20.019  38.748 61.377 1.00 12.38 ? 191 ASP A OD1 1 
ATOM   1433 O OD2 . ASP A 1 191 ? 19.886  39.028 63.540 1.00 11.63 ? 191 ASP A OD2 1 
ATOM   1434 N N   . GLN A 1 192 ? 20.260  35.949 64.065 1.00 7.86  ? 192 GLN A N   1 
ATOM   1435 C CA  . GLN A 1 192 ? 20.915  35.639 65.343 1.00 8.40  ? 192 GLN A CA  1 
ATOM   1436 C C   . GLN A 1 192 ? 20.395  36.536 66.494 1.00 9.31  ? 192 GLN A C   1 
ATOM   1437 O O   . GLN A 1 192 ? 20.253  36.107 67.656 1.00 8.80  ? 192 GLN A O   1 
ATOM   1438 C CB  . GLN A 1 192 ? 22.431  35.857 65.209 1.00 7.79  ? 192 GLN A CB  1 
ATOM   1439 C CG  . GLN A 1 192 ? 23.214  34.681 64.628 1.00 6.64  ? 192 GLN A CG  1 
ATOM   1440 C CD  . GLN A 1 192 ? 23.611  33.648 65.657 1.00 7.04  ? 192 GLN A CD  1 
ATOM   1441 O OE1 . GLN A 1 192 ? 22.887  33.403 66.603 1.00 8.22  ? 192 GLN A OE1 1 
ATOM   1442 N NE2 . GLN A 1 192 ? 24.767  33.026 65.472 1.00 7.81  ? 192 GLN A NE2 1 
ATOM   1443 N N   . ASN A 1 193 ? 20.066  37.774 66.177 1.00 10.14 ? 193 ASN A N   1 
ATOM   1444 C CA  . ASN A 1 193 ? 19.608  38.684 67.213 1.00 12.92 ? 193 ASN A CA  1 
ATOM   1445 C C   . ASN A 1 193 ? 18.109  38.708 67.511 1.00 13.21 ? 193 ASN A C   1 
ATOM   1446 O O   . ASN A 1 193 ? 17.609  39.685 68.071 1.00 13.13 ? 193 ASN A O   1 
ATOM   1447 C CB  . ASN A 1 193 ? 20.105  40.111 66.938 1.00 16.32 ? 193 ASN A CB  1 
ATOM   1448 C CG  . ASN A 1 193 ? 21.641  40.217 66.963 1.00 20.63 ? 193 ASN A CG  1 
ATOM   1449 O OD1 . ASN A 1 193 ? 22.232  40.932 66.143 1.00 23.52 ? 193 ASN A OD1 1 
ATOM   1450 N ND2 . ASN A 1 193 ? 22.293  39.476 67.883 1.00 21.26 ? 193 ASN A ND2 1 
ATOM   1451 N N   . THR A 1 194 ? 17.389  37.649 67.157 1.00 12.81 ? 194 THR A N   1 
ATOM   1452 C CA  . THR A 1 194 ? 15.950  37.585 67.427 1.00 12.46 ? 194 THR A CA  1 
ATOM   1453 C C   . THR A 1 194 ? 15.758  37.709 68.938 1.00 12.74 ? 194 THR A C   1 
ATOM   1454 O O   . THR A 1 194 ? 16.426  37.027 69.713 1.00 12.78 ? 194 THR A O   1 
ATOM   1455 C CB  . THR A 1 194 ? 15.387  36.251 66.916 1.00 12.89 ? 194 THR A CB  1 
ATOM   1456 O OG1 . THR A 1 194 ? 15.581  36.200 65.495 1.00 12.37 ? 194 THR A OG1 1 
ATOM   1457 C CG2 . THR A 1 194 ? 13.886  36.090 67.255 1.00 12.11 ? 194 THR A CG2 1 
ATOM   1458 N N   . PRO A 1 195 ? 14.856  38.589 69.381 1.00 13.11 ? 195 PRO A N   1 
ATOM   1459 C CA  . PRO A 1 195 ? 14.617  38.773 70.818 1.00 13.65 ? 195 PRO A CA  1 
ATOM   1460 C C   . PRO A 1 195 ? 14.074  37.525 71.502 1.00 14.47 ? 195 PRO A C   1 
ATOM   1461 O O   . PRO A 1 195 ? 13.392  36.715 70.895 1.00 14.16 ? 195 PRO A O   1 
ATOM   1462 C CB  . PRO A 1 195 ? 13.590  39.915 70.860 1.00 14.06 ? 195 PRO A CB  1 
ATOM   1463 C CG  . PRO A 1 195 ? 13.684  40.580 69.485 1.00 14.13 ? 195 PRO A CG  1 
ATOM   1464 C CD  . PRO A 1 195 ? 13.960  39.427 68.567 1.00 12.91 ? 195 PRO A CD  1 
ATOM   1465 N N   . LYS A 1 196 ? 14.365  37.383 72.781 1.00 15.90 ? 196 LYS A N   1 
ATOM   1466 C CA  . LYS A 1 196 ? 13.921  36.239 73.599 1.00 18.16 ? 196 LYS A CA  1 
ATOM   1467 C C   . LYS A 1 196 ? 12.426  35.854 73.496 1.00 17.89 ? 196 LYS A C   1 
ATOM   1468 O O   . LYS A 1 196 ? 12.057  34.676 73.513 1.00 18.36 ? 196 LYS A O   1 
ATOM   1469 C CB  . LYS A 1 196 ? 14.167  36.569 75.086 1.00 21.15 ? 196 LYS A CB  1 
ATOM   1470 C CG  . LYS A 1 196 ? 14.831  35.501 75.922 1.00 25.19 ? 196 LYS A CG  1 
ATOM   1471 C CD  . LYS A 1 196 ? 14.294  34.114 75.649 1.00 28.51 ? 196 LYS A CD  1 
ATOM   1472 C CE  . LYS A 1 196 ? 14.746  33.187 76.774 1.00 31.41 ? 196 LYS A CE  1 
ATOM   1473 N NZ  . LYS A 1 196 ? 16.218  33.328 77.057 1.00 34.03 ? 196 LYS A NZ  1 
ATOM   1474 N N   . GLY A 1 197 ? 11.561  36.850 73.511 1.00 17.41 ? 197 GLY A N   1 
ATOM   1475 C CA  . GLY A 1 197 ? 10.153  36.543 73.491 1.00 17.11 ? 197 GLY A CA  1 
ATOM   1476 C C   . GLY A 1 197 ? 9.467   36.592 72.156 1.00 16.98 ? 197 GLY A C   1 
ATOM   1477 O O   . GLY A 1 197 ? 8.227   36.628 72.109 1.00 17.23 ? 197 GLY A O   1 
ATOM   1478 N N   . ALA A 1 198 ? 10.244  36.566 71.077 1.00 15.72 ? 198 ALA A N   1 
ATOM   1479 C CA  . ALA A 1 198 ? 9.659   36.627 69.749 1.00 14.45 ? 198 ALA A CA  1 
ATOM   1480 C C   . ALA A 1 198 ? 8.823   35.379 69.448 1.00 13.52 ? 198 ALA A C   1 
ATOM   1481 O O   . ALA A 1 198 ? 9.158   34.258 69.854 1.00 13.07 ? 198 ALA A O   1 
ATOM   1482 C CB  . ALA A 1 198 ? 10.747  36.817 68.671 1.00 14.27 ? 198 ALA A CB  1 
ATOM   1483 N N   . ASP A 1 199 ? 7.676   35.628 68.818 1.00 12.44 ? 199 ASP A N   1 
ATOM   1484 C CA  . ASP A 1 199 ? 6.761   34.600 68.376 1.00 12.02 ? 199 ASP A CA  1 
ATOM   1485 C C   . ASP A 1 199 ? 7.369   34.084 67.055 1.00 10.86 ? 199 ASP A C   1 
ATOM   1486 O O   . ASP A 1 199 ? 7.565   34.862 66.107 1.00 10.37 ? 199 ASP A O   1 
ATOM   1487 C CB  . ASP A 1 199 ? 5.425   35.261 68.106 1.00 13.18 ? 199 ASP A CB  1 
ATOM   1488 C CG  . ASP A 1 199 ? 4.395   34.317 67.518 1.00 15.13 ? 199 ASP A CG  1 
ATOM   1489 O OD1 . ASP A 1 199 ? 4.623   33.102 67.381 1.00 14.85 ? 199 ASP A OD1 1 
ATOM   1490 O OD2 . ASP A 1 199 ? 3.312   34.822 67.192 1.00 18.88 ? 199 ASP A OD2 1 
ATOM   1491 N N   . PHE A 1 200 ? 7.637   32.786 66.983 1.00 9.84  ? 200 PHE A N   1 
ATOM   1492 C CA  . PHE A 1 200 ? 8.256   32.208 65.796 1.00 9.79  ? 200 PHE A CA  1 
ATOM   1493 C C   . PHE A 1 200 ? 7.407   32.358 64.553 1.00 9.67  ? 200 PHE A C   1 
ATOM   1494 O O   . PHE A 1 200 ? 7.938   32.351 63.455 1.00 10.34 ? 200 PHE A O   1 
ATOM   1495 C CB  . PHE A 1 200 ? 8.699   30.732 66.005 1.00 9.96  ? 200 PHE A CB  1 
ATOM   1496 C CG  . PHE A 1 200 ? 7.570   29.719 65.977 1.00 10.48 ? 200 PHE A CG  1 
ATOM   1497 C CD1 . PHE A 1 200 ? 7.050   29.266 64.773 1.00 8.84  ? 200 PHE A CD1 1 
ATOM   1498 C CD2 . PHE A 1 200 ? 7.000   29.254 67.163 1.00 11.48 ? 200 PHE A CD2 1 
ATOM   1499 C CE1 . PHE A 1 200 ? 5.988   28.385 64.733 1.00 9.14  ? 200 PHE A CE1 1 
ATOM   1500 C CE2 . PHE A 1 200 ? 5.904   28.351 67.131 1.00 12.19 ? 200 PHE A CE2 1 
ATOM   1501 C CZ  . PHE A 1 200 ? 5.404   27.923 65.904 1.00 10.03 ? 200 PHE A CZ  1 
ATOM   1502 N N   . CYS A 1 201 ? 6.109   32.559 64.717 1.00 8.85  ? 201 CYS A N   1 
ATOM   1503 C CA  . CYS A 1 201 ? 5.214   32.711 63.578 1.00 8.77  ? 201 CYS A CA  1 
ATOM   1504 C C   . CYS A 1 201 ? 5.505   33.929 62.727 1.00 9.10  ? 201 CYS A C   1 
ATOM   1505 O O   . CYS A 1 201 ? 5.169   33.952 61.552 1.00 8.67  ? 201 CYS A O   1 
ATOM   1506 C CB  . CYS A 1 201 ? 3.771   32.761 64.061 1.00 8.49  ? 201 CYS A CB  1 
ATOM   1507 S SG  . CYS A 1 201 ? 3.253   31.253 64.909 1.00 9.02  ? 201 CYS A SG  1 
ATOM   1508 N N   . GLN A 1 202 ? 6.144   34.944 63.308 1.00 9.61  ? 202 GLN A N   1 
ATOM   1509 C CA  . GLN A 1 202 ? 6.453   36.151 62.554 1.00 10.32 ? 202 GLN A CA  1 
ATOM   1510 C C   . GLN A 1 202 ? 7.569   35.942 61.559 1.00 9.56  ? 202 GLN A C   1 
ATOM   1511 O O   . GLN A 1 202 ? 7.831   36.853 60.789 1.00 10.01 ? 202 GLN A O   1 
ATOM   1512 C CB  . GLN A 1 202 ? 7.004   37.247 63.459 1.00 12.80 ? 202 GLN A CB  1 
ATOM   1513 C CG  . GLN A 1 202 ? 6.142   37.844 64.496 1.00 19.98 ? 202 GLN A CG  1 
ATOM   1514 C CD  . GLN A 1 202 ? 6.992   38.758 65.413 1.00 24.28 ? 202 GLN A CD  1 
ATOM   1515 O OE1 . GLN A 1 202 ? 7.081   38.542 66.640 1.00 28.05 ? 202 GLN A OE1 1 
ATOM   1516 N NE2 . GLN A 1 202 ? 7.710   39.707 64.803 1.00 25.64 ? 202 GLN A NE2 1 
ATOM   1517 N N   . PHE A 1 203 ? 8.246   34.788 61.589 1.00 8.84  ? 203 PHE A N   1 
ATOM   1518 C CA  . PHE A 1 203 ? 9.437   34.548 60.748 1.00 8.98  ? 203 PHE A CA  1 
ATOM   1519 C C   . PHE A 1 203 ? 9.292   33.546 59.601 1.00 8.83  ? 203 PHE A C   1 
ATOM   1520 O O   . PHE A 1 203 ? 10.277  33.003 59.088 1.00 7.74  ? 203 PHE A O   1 
ATOM   1521 C CB  . PHE A 1 203 ? 10.642  34.207 61.655 1.00 8.55  ? 203 PHE A CB  1 
ATOM   1522 C CG  . PHE A 1 203 ? 10.851  35.212 62.750 1.00 10.71 ? 203 PHE A CG  1 
ATOM   1523 C CD1 . PHE A 1 203 ? 11.459  36.424 62.488 1.00 12.32 ? 203 PHE A CD1 1 
ATOM   1524 C CD2 . PHE A 1 203 ? 10.307  35.014 64.012 1.00 11.61 ? 203 PHE A CD2 1 
ATOM   1525 C CE1 . PHE A 1 203 ? 11.504  37.432 63.482 1.00 13.22 ? 203 PHE A CE1 1 
ATOM   1526 C CE2 . PHE A 1 203 ? 10.352  36.006 64.998 1.00 11.91 ? 203 PHE A CE2 1 
ATOM   1527 C CZ  . PHE A 1 203 ? 10.943  37.211 64.737 1.00 11.62 ? 203 PHE A CZ  1 
ATOM   1528 N N   . ARG A 1 204 ? 8.052   33.390 59.151 1.00 8.63  ? 204 ARG A N   1 
ATOM   1529 C CA  . ARG A 1 204 ? 7.717   32.525 58.039 1.00 8.65  ? 204 ARG A CA  1 
ATOM   1530 C C   . ARG A 1 204 ? 8.242   33.196 56.767 1.00 8.41  ? 204 ARG A C   1 
ATOM   1531 O O   . ARG A 1 204 ? 8.091   34.417 56.606 1.00 7.90  ? 204 ARG A O   1 
ATOM   1532 C CB  . ARG A 1 204 ? 6.203   32.410 57.950 1.00 9.60  ? 204 ARG A CB  1 
ATOM   1533 C CG  . ARG A 1 204 ? 5.613   31.464 58.981 1.00 11.74 ? 204 ARG A CG  1 
ATOM   1534 C CD  . ARG A 1 204 ? 4.071   31.531 59.006 1.00 14.75 ? 204 ARG A CD  1 
ATOM   1535 N NE  . ARG A 1 204 ? 3.540   32.703 59.726 1.00 16.84 ? 204 ARG A NE  1 
ATOM   1536 C CZ  . ARG A 1 204 ? 2.239   33.022 59.799 1.00 17.60 ? 204 ARG A CZ  1 
ATOM   1537 N NH1 . ARG A 1 204 ? 1.343   32.250 59.166 1.00 16.49 ? 204 ARG A NH1 1 
ATOM   1538 N NH2 . ARG A 1 204 ? 1.833   34.033 60.589 1.00 15.47 ? 204 ARG A NH2 1 
ATOM   1539 N N   . VAL A 1 205 ? 8.864   32.416 55.872 1.00 7.08  ? 205 VAL A N   1 
ATOM   1540 C CA  . VAL A 1 205 ? 9.388   32.934 54.595 1.00 5.65  ? 205 VAL A CA  1 
ATOM   1541 C C   . VAL A 1 205 ? 9.110   31.857 53.539 1.00 5.27  ? 205 VAL A C   1 
ATOM   1542 O O   . VAL A 1 205 ? 8.478   30.856 53.835 1.00 4.92  ? 205 VAL A O   1 
ATOM   1543 C CB  . VAL A 1 205 ? 10.947  33.212 54.668 1.00 4.14  ? 205 VAL A CB  1 
ATOM   1544 C CG1 . VAL A 1 205 ? 11.256  34.307 55.681 1.00 3.76  ? 205 VAL A CG1 1 
ATOM   1545 C CG2 . VAL A 1 205 ? 11.706  31.920 55.030 1.00 3.17  ? 205 VAL A CG2 1 
ATOM   1546 N N   . THR A 1 206 ? 9.548   32.080 52.304 1.00 5.86  ? 206 THR A N   1 
ATOM   1547 C CA  . THR A 1 206 ? 9.389   31.095 51.222 1.00 5.37  ? 206 THR A CA  1 
ATOM   1548 C C   . THR A 1 206 ? 10.677  30.271 51.143 1.00 5.43  ? 206 THR A C   1 
ATOM   1549 O O   . THR A 1 206 ? 11.733  30.694 51.624 1.00 5.29  ? 206 THR A O   1 
ATOM   1550 C CB  . THR A 1 206 ? 9.188   31.783 49.840 1.00 5.13  ? 206 THR A CB  1 
ATOM   1551 O OG1 . THR A 1 206 ? 10.302  32.651 49.572 1.00 5.75  ? 206 THR A OG1 1 
ATOM   1552 C CG2 . THR A 1 206 ? 7.922   32.625 49.831 1.00 5.90  ? 206 THR A CG2 1 
ATOM   1553 N N   . VAL A 1 207 ? 10.603  29.115 50.505 1.00 5.69  ? 207 VAL A N   1 
ATOM   1554 C CA  . VAL A 1 207 ? 11.786  28.277 50.336 1.00 6.05  ? 207 VAL A CA  1 
ATOM   1555 C C   . VAL A 1 207 ? 12.696  29.005 49.341 1.00 6.95  ? 207 VAL A C   1 
ATOM   1556 O O   . VAL A 1 207 ? 13.928  28.912 49.409 1.00 6.28  ? 207 VAL A O   1 
ATOM   1557 C CB  . VAL A 1 207 ? 11.398  26.843 49.805 1.00 6.12  ? 207 VAL A CB  1 
ATOM   1558 C CG1 . VAL A 1 207 ? 12.671  26.021 49.444 1.00 6.68  ? 207 VAL A CG1 1 
ATOM   1559 C CG2 . VAL A 1 207 ? 10.559  26.101 50.865 1.00 4.18  ? 207 VAL A CG2 1 
ATOM   1560 N N   . ASP A 1 208 ? 12.080  29.737 48.408 1.00 6.72  ? 208 ASP A N   1 
ATOM   1561 C CA  . ASP A 1 208 ? 12.849  30.458 47.426 1.00 7.55  ? 208 ASP A CA  1 
ATOM   1562 C C   . ASP A 1 208 ? 13.803  31.471 48.075 1.00 6.29  ? 208 ASP A C   1 
ATOM   1563 O O   . ASP A 1 208 ? 14.947  31.585 47.661 1.00 6.07  ? 208 ASP A O   1 
ATOM   1564 C CB  . ASP A 1 208 ? 11.932  31.116 46.378 1.00 10.61 ? 208 ASP A CB  1 
ATOM   1565 C CG  . ASP A 1 208 ? 12.711  31.886 45.340 1.00 13.80 ? 208 ASP A CG  1 
ATOM   1566 O OD1 . ASP A 1 208 ? 13.573  31.328 44.626 1.00 16.22 ? 208 ASP A OD1 1 
ATOM   1567 O OD2 . ASP A 1 208 ? 12.512  33.102 45.273 1.00 18.73 ? 208 ASP A OD2 1 
ATOM   1568 N N   . GLU A 1 209 ? 13.334  32.191 49.081 1.00 5.41  ? 209 GLU A N   1 
ATOM   1569 C CA  . GLU A 1 209 ? 14.164  33.154 49.786 1.00 5.39  ? 209 GLU A CA  1 
ATOM   1570 C C   . GLU A 1 209 ? 15.415  32.478 50.363 1.00 5.75  ? 209 GLU A C   1 
ATOM   1571 O O   . GLU A 1 209 ? 16.521  33.005 50.253 1.00 5.51  ? 209 GLU A O   1 
ATOM   1572 C CB  . GLU A 1 209 ? 13.406  33.808 50.938 1.00 6.19  ? 209 GLU A CB  1 
ATOM   1573 C CG  . GLU A 1 209 ? 14.253  34.887 51.621 1.00 8.41  ? 209 GLU A CG  1 
ATOM   1574 C CD  . GLU A 1 209 ? 13.495  35.753 52.582 1.00 9.57  ? 209 GLU A CD  1 
ATOM   1575 O OE1 . GLU A 1 209 ? 12.278  35.949 52.424 1.00 9.77  ? 209 GLU A OE1 1 
ATOM   1576 O OE2 . GLU A 1 209 ? 14.136  36.263 53.502 1.00 10.82 ? 209 GLU A OE2 1 
ATOM   1577 N N   . ILE A 1 210 ? 15.224  31.341 51.029 1.00 5.22  ? 210 ILE A N   1 
ATOM   1578 C CA  . ILE A 1 210 ? 16.328  30.596 51.604 1.00 5.64  ? 210 ILE A CA  1 
ATOM   1579 C C   . ILE A 1 210 ? 17.346  30.168 50.538 1.00 6.43  ? 210 ILE A C   1 
ATOM   1580 O O   . ILE A 1 210 ? 18.554  30.429 50.668 1.00 7.64  ? 210 ILE A O   1 
ATOM   1581 C CB  . ILE A 1 210 ? 15.776  29.405 52.419 1.00 5.61  ? 210 ILE A CB  1 
ATOM   1582 C CG1 . ILE A 1 210 ? 15.008  29.960 53.623 1.00 4.01  ? 210 ILE A CG1 1 
ATOM   1583 C CG2 . ILE A 1 210 ? 16.900  28.470 52.881 1.00 4.66  ? 210 ILE A CG2 1 
ATOM   1584 C CD1 . ILE A 1 210 ? 14.256  28.895 54.347 1.00 7.49  ? 210 ILE A CD1 1 
ATOM   1585 N N   . GLU A 1 211 ? 16.867  29.569 49.461 1.00 6.53  ? 211 GLU A N   1 
ATOM   1586 C CA  . GLU A 1 211 ? 17.740  29.133 48.371 1.00 7.09  ? 211 GLU A CA  1 
ATOM   1587 C C   . GLU A 1 211 ? 18.555  30.305 47.834 1.00 7.43  ? 211 GLU A C   1 
ATOM   1588 O O   . GLU A 1 211 ? 19.764  30.202 47.650 1.00 7.78  ? 211 GLU A O   1 
ATOM   1589 C CB  . GLU A 1 211 ? 16.904  28.528 47.254 1.00 6.42  ? 211 GLU A CB  1 
ATOM   1590 C CG  . GLU A 1 211 ? 16.246  27.193 47.651 1.00 6.96  ? 211 GLU A CG  1 
ATOM   1591 C CD  . GLU A 1 211 ? 15.594  26.481 46.466 1.00 7.27  ? 211 GLU A CD  1 
ATOM   1592 O OE1 . GLU A 1 211 ? 15.266  27.138 45.476 1.00 6.48  ? 211 GLU A OE1 1 
ATOM   1593 O OE2 . GLU A 1 211 ? 15.403  25.257 46.528 1.00 7.60  ? 211 GLU A OE2 1 
ATOM   1594 N N   . LYS A 1 212 ? 17.900  31.444 47.679 1.00 7.62  ? 212 LYS A N   1 
ATOM   1595 C CA  . LYS A 1 212 ? 18.574  32.624 47.180 1.00 8.85  ? 212 LYS A CA  1 
ATOM   1596 C C   . LYS A 1 212 ? 19.611  33.155 48.164 1.00 8.37  ? 212 LYS A C   1 
ATOM   1597 O O   . LYS A 1 212 ? 20.594  33.738 47.731 1.00 8.38  ? 212 LYS A O   1 
ATOM   1598 C CB  . LYS A 1 212 ? 17.567  33.732 46.805 1.00 10.71 ? 212 LYS A CB  1 
ATOM   1599 C CG  . LYS A 1 212 ? 16.883  33.436 45.480 1.00 14.49 ? 212 LYS A CG  1 
ATOM   1600 C CD  . LYS A 1 212 ? 15.721  34.358 45.222 1.00 19.56 ? 212 LYS A CD  1 
ATOM   1601 C CE  . LYS A 1 212 ? 15.061  34.082 43.832 1.00 21.55 ? 212 LYS A CE  1 
ATOM   1602 N NZ  . LYS A 1 212 ? 13.778  34.913 43.675 1.00 24.05 ? 212 LYS A NZ  1 
ATOM   1603 N N   . ARG A 1 213 ? 19.427  32.961 49.462 1.00 6.21  ? 213 ARG A N   1 
ATOM   1604 C CA  . ARG A 1 213 ? 20.414  33.475 50.393 1.00 6.28  ? 213 ARG A CA  1 
ATOM   1605 C C   . ARG A 1 213 ? 21.467  32.438 50.794 1.00 7.06  ? 213 ARG A C   1 
ATOM   1606 O O   . ARG A 1 213 ? 22.391  32.733 51.552 1.00 7.90  ? 213 ARG A O   1 
ATOM   1607 C CB  . ARG A 1 213 ? 19.711  34.068 51.604 1.00 5.56  ? 213 ARG A CB  1 
ATOM   1608 C CG  . ARG A 1 213 ? 18.785  35.251 51.222 1.00 5.34  ? 213 ARG A CG  1 
ATOM   1609 C CD  . ARG A 1 213 ? 17.846  35.678 52.365 1.00 4.84  ? 213 ARG A CD  1 
ATOM   1610 N NE  . ARG A 1 213 ? 18.556  36.361 53.450 1.00 6.32  ? 213 ARG A NE  1 
ATOM   1611 C CZ  . ARG A 1 213 ? 17.946  37.050 54.412 1.00 6.89  ? 213 ARG A CZ  1 
ATOM   1612 N NH1 . ARG A 1 213 ? 16.620  37.152 54.403 1.00 5.83  ? 213 ARG A NH1 1 
ATOM   1613 N NH2 . ARG A 1 213 ? 18.640  37.599 55.402 1.00 6.07  ? 213 ARG A NH2 1 
ATOM   1614 N N   . THR A 1 214 ? 21.310  31.203 50.341 1.00 6.14  ? 214 THR A N   1 
ATOM   1615 C CA  . THR A 1 214 ? 22.268  30.190 50.690 1.00 5.68  ? 214 THR A CA  1 
ATOM   1616 C C   . THR A 1 214 ? 23.001  29.628 49.469 1.00 6.39  ? 214 THR A C   1 
ATOM   1617 O O   . THR A 1 214 ? 24.094  29.105 49.616 1.00 7.18  ? 214 THR A O   1 
ATOM   1618 C CB  . THR A 1 214 ? 21.603  28.965 51.388 1.00 5.60  ? 214 THR A CB  1 
ATOM   1619 O OG1 . THR A 1 214 ? 20.620  28.417 50.515 1.00 4.45  ? 214 THR A OG1 1 
ATOM   1620 C CG2 . THR A 1 214 ? 20.934  29.346 52.691 1.00 5.61  ? 214 THR A CG2 1 
ATOM   1621 N N   . GLY A 1 215 ? 22.396  29.672 48.288 1.00 5.54  ? 215 GLY A N   1 
ATOM   1622 C CA  . GLY A 1 215 ? 23.041  29.063 47.139 1.00 4.87  ? 215 GLY A CA  1 
ATOM   1623 C C   . GLY A 1 215 ? 22.717  27.574 47.021 1.00 5.37  ? 215 GLY A C   1 
ATOM   1624 O O   . GLY A 1 215 ? 23.246  26.875 46.155 1.00 6.10  ? 215 GLY A O   1 
ATOM   1625 N N   . LEU A 1 216 ? 21.802  27.077 47.840 1.00 4.47  ? 216 LEU A N   1 
ATOM   1626 C CA  . LEU A 1 216 ? 21.442  25.665 47.802 1.00 5.12  ? 216 LEU A CA  1 
ATOM   1627 C C   . LEU A 1 216 ? 20.144  25.447 47.032 1.00 5.05  ? 216 LEU A C   1 
ATOM   1628 O O   . LEU A 1 216 ? 19.380  26.368 46.797 1.00 6.26  ? 216 LEU A O   1 
ATOM   1629 C CB  . LEU A 1 216 ? 21.185  25.155 49.256 1.00 5.30  ? 216 LEU A CB  1 
ATOM   1630 C CG  . LEU A 1 216 ? 22.246  25.271 50.364 1.00 5.14  ? 216 LEU A CG  1 
ATOM   1631 C CD1 . LEU A 1 216 ? 21.635  24.850 51.697 1.00 5.32  ? 216 LEU A CD1 1 
ATOM   1632 C CD2 . LEU A 1 216 ? 23.432  24.369 50.076 1.00 3.64  ? 216 LEU A CD2 1 
ATOM   1633 N N   . ILE A 1 217 ? 19.875  24.224 46.642 1.00 5.19  ? 217 ILE A N   1 
ATOM   1634 C CA  . ILE A 1 217 ? 18.567  23.937 46.044 1.00 5.37  ? 217 ILE A CA  1 
ATOM   1635 C C   . ILE A 1 217 ? 17.976  22.870 46.971 1.00 4.81  ? 217 ILE A C   1 
ATOM   1636 O O   . ILE A 1 217 ? 18.534  21.792 47.135 1.00 4.47  ? 217 ILE A O   1 
ATOM   1637 C CB  . ILE A 1 217 ? 18.644  23.428 44.582 1.00 5.71  ? 217 ILE A CB  1 
ATOM   1638 C CG1 . ILE A 1 217 ? 19.125  24.563 43.679 1.00 4.93  ? 217 ILE A CG1 1 
ATOM   1639 C CG2 . ILE A 1 217 ? 17.248  22.962 44.101 1.00 5.00  ? 217 ILE A CG2 1 
ATOM   1640 C CD1 . ILE A 1 217 ? 19.440  24.066 42.289 1.00 8.50  ? 217 ILE A CD1 1 
ATOM   1641 N N   . ILE A 1 218 ? 16.932  23.243 47.682 1.00 4.32  ? 218 ILE A N   1 
ATOM   1642 C CA  . ILE A 1 218 ? 16.256  22.343 48.603 1.00 5.56  ? 218 ILE A CA  1 
ATOM   1643 C C   . ILE A 1 218 ? 15.184  21.479 47.862 1.00 6.15  ? 218 ILE A C   1 
ATOM   1644 O O   . ILE A 1 218 ? 14.692  21.905 46.792 1.00 7.04  ? 218 ILE A O   1 
ATOM   1645 C CB  . ILE A 1 218 ? 15.707  23.221 49.813 1.00 7.29  ? 218 ILE A CB  1 
ATOM   1646 C CG1 . ILE A 1 218 ? 16.942  23.696 50.632 1.00 8.48  ? 218 ILE A CG1 1 
ATOM   1647 C CG2 . ILE A 1 218 ? 14.712  22.431 50.707 1.00 6.41  ? 218 ILE A CG2 1 
ATOM   1648 C CD1 . ILE A 1 218 ? 16.822  25.039 51.295 1.00 11.22 ? 218 ILE A CD1 1 
ATOM   1649 N N   . TRP A 1 219 ? 14.929  20.244 48.344 1.00 4.99  ? 219 TRP A N   1 
ATOM   1650 C CA  . TRP A 1 219 ? 13.941  19.319 47.739 1.00 5.38  ? 219 TRP A CA  1 
ATOM   1651 C C   . TRP A 1 219 ? 14.336  19.202 46.265 1.00 5.87  ? 219 TRP A C   1 
ATOM   1652 O O   . TRP A 1 219 ? 13.523  19.377 45.339 1.00 5.41  ? 219 TRP A O   1 
ATOM   1653 C CB  . TRP A 1 219 ? 12.532  19.918 47.830 1.00 4.96  ? 219 TRP A CB  1 
ATOM   1654 C CG  . TRP A 1 219 ? 12.039  20.310 49.232 1.00 4.73  ? 219 TRP A CG  1 
ATOM   1655 C CD1 . TRP A 1 219 ? 12.442  19.799 50.441 1.00 5.05  ? 219 TRP A CD1 1 
ATOM   1656 C CD2 . TRP A 1 219 ? 10.974  21.213 49.517 1.00 5.69  ? 219 TRP A CD2 1 
ATOM   1657 N NE1 . TRP A 1 219 ? 11.673  20.327 51.468 1.00 5.07  ? 219 TRP A NE1 1 
ATOM   1658 C CE2 . TRP A 1 219 ? 10.758  21.190 50.922 1.00 5.69  ? 219 TRP A CE2 1 
ATOM   1659 C CE3 . TRP A 1 219 ? 10.156  22.036 48.712 1.00 7.14  ? 219 TRP A CE3 1 
ATOM   1660 C CZ2 . TRP A 1 219 ? 9.761   21.947 51.539 1.00 5.74  ? 219 TRP A CZ2 1 
ATOM   1661 C CZ3 . TRP A 1 219 ? 9.152   22.798 49.332 1.00 6.47  ? 219 TRP A CZ3 1 
ATOM   1662 C CH2 . TRP A 1 219 ? 8.971   22.740 50.734 1.00 7.11  ? 219 TRP A CH2 1 
ATOM   1663 N N   . ALA A 1 220 ? 15.619  18.943 46.066 1.00 6.67  ? 220 ALA A N   1 
ATOM   1664 C CA  . ALA A 1 220 ? 16.214  18.909 44.738 1.00 6.31  ? 220 ALA A CA  1 
ATOM   1665 C C   . ALA A 1 220 ? 15.730  17.821 43.789 1.00 6.72  ? 220 ALA A C   1 
ATOM   1666 O O   . ALA A 1 220 ? 16.002  17.903 42.594 1.00 7.73  ? 220 ALA A O   1 
ATOM   1667 C CB  . ALA A 1 220 ? 17.734  18.893 44.881 1.00 5.43  ? 220 ALA A CB  1 
ATOM   1668 N N   . GLY A 1 221 ? 14.983  16.836 44.290 1.00 6.26  ? 221 GLY A N   1 
ATOM   1669 C CA  . GLY A 1 221 ? 14.482  15.769 43.431 1.00 6.50  ? 221 GLY A CA  1 
ATOM   1670 C C   . GLY A 1 221 ? 13.065  15.984 42.911 1.00 6.77  ? 221 GLY A C   1 
ATOM   1671 O O   . GLY A 1 221 ? 12.491  15.120 42.265 1.00 7.26  ? 221 GLY A O   1 
ATOM   1672 N N   . LEU A 1 222 ? 12.480  17.137 43.202 1.00 7.57  ? 222 LEU A N   1 
ATOM   1673 C CA  . LEU A 1 222 ? 11.130  17.443 42.740 1.00 7.45  ? 222 LEU A CA  1 
ATOM   1674 C C   . LEU A 1 222 ? 11.111  17.876 41.273 1.00 7.66  ? 222 LEU A C   1 
ATOM   1675 O O   . LEU A 1 222 ? 12.094  18.436 40.766 1.00 7.38  ? 222 LEU A O   1 
ATOM   1676 C CB  . LEU A 1 222 ? 10.529  18.582 43.575 1.00 6.40  ? 222 LEU A CB  1 
ATOM   1677 C CG  . LEU A 1 222 ? 10.168  18.333 45.039 1.00 7.89  ? 222 LEU A CG  1 
ATOM   1678 C CD1 . LEU A 1 222 ? 9.655   19.647 45.615 1.00 8.28  ? 222 LEU A CD1 1 
ATOM   1679 C CD2 . LEU A 1 222 ? 9.148   17.218 45.202 1.00 8.71  ? 222 LEU A CD2 1 
ATOM   1680 N N   . PRO A 1 223 ? 9.991   17.596 40.569 1.00 8.21  ? 223 PRO A N   1 
ATOM   1681 C CA  . PRO A 1 223 ? 9.842   17.986 39.166 1.00 8.41  ? 223 PRO A CA  1 
ATOM   1682 C C   . PRO A 1 223 ? 10.036  19.493 39.130 1.00 8.20  ? 223 PRO A C   1 
ATOM   1683 O O   . PRO A 1 223 ? 9.615   20.196 40.049 1.00 8.50  ? 223 PRO A O   1 
ATOM   1684 C CB  . PRO A 1 223 ? 8.379   17.643 38.867 1.00 7.78  ? 223 PRO A CB  1 
ATOM   1685 C CG  . PRO A 1 223 ? 8.184   16.358 39.665 1.00 8.61  ? 223 PRO A CG  1 
ATOM   1686 C CD  . PRO A 1 223 ? 8.862   16.740 41.001 1.00 8.53  ? 223 PRO A CD  1 
ATOM   1687 N N   . ASP A 1 224 ? 10.557  20.001 38.024 1.00 8.54  ? 224 ASP A N   1 
ATOM   1688 C CA  . ASP A 1 224 ? 10.820  21.418 37.902 1.00 9.14  ? 224 ASP A CA  1 
ATOM   1689 C C   . ASP A 1 224 ? 9.597   22.273 38.124 1.00 10.04 ? 224 ASP A C   1 
ATOM   1690 O O   . ASP A 1 224 ? 9.681   23.330 38.779 1.00 9.52  ? 224 ASP A O   1 
ATOM   1691 C CB  . ASP A 1 224 ? 11.371  21.757 36.520 1.00 9.36  ? 224 ASP A CB  1 
ATOM   1692 C CG  . ASP A 1 224 ? 12.783  21.239 36.285 1.00 10.18 ? 224 ASP A CG  1 
ATOM   1693 O OD1 . ASP A 1 224 ? 13.449  20.733 37.206 1.00 8.88  ? 224 ASP A OD1 1 
ATOM   1694 O OD2 . ASP A 1 224 ? 13.230  21.389 35.140 1.00 10.10 ? 224 ASP A OD2 1 
ATOM   1695 N N   . ASP A 1 225 ? 8.468   21.863 37.553 1.00 10.29 ? 225 ASP A N   1 
ATOM   1696 C CA  . ASP A 1 225 ? 7.285   22.697 37.694 1.00 11.41 ? 225 ASP A CA  1 
ATOM   1697 C C   . ASP A 1 225 ? 6.790   22.797 39.130 1.00 9.92  ? 225 ASP A C   1 
ATOM   1698 O O   . ASP A 1 225 ? 6.355   23.849 39.568 1.00 10.20 ? 225 ASP A O   1 
ATOM   1699 C CB  . ASP A 1 225 ? 6.192   22.230 36.746 1.00 14.21 ? 225 ASP A CB  1 
ATOM   1700 C CG  . ASP A 1 225 ? 5.520   20.974 37.211 1.00 18.24 ? 225 ASP A CG  1 
ATOM   1701 O OD1 . ASP A 1 225 ? 6.147   19.892 37.282 1.00 20.69 ? 225 ASP A OD1 1 
ATOM   1702 O OD2 . ASP A 1 225 ? 4.325   21.063 37.525 1.00 23.62 ? 225 ASP A OD2 1 
ATOM   1703 N N   . VAL A 1 226 ? 6.940   21.730 39.890 1.00 10.23 ? 226 VAL A N   1 
ATOM   1704 C CA  . VAL A 1 226 ? 6.516   21.720 41.280 1.00 10.36 ? 226 VAL A CA  1 
ATOM   1705 C C   . VAL A 1 226 ? 7.386   22.675 42.057 1.00 10.79 ? 226 VAL A C   1 
ATOM   1706 O O   . VAL A 1 226 ? 6.893   23.506 42.849 1.00 11.21 ? 226 VAL A O   1 
ATOM   1707 C CB  . VAL A 1 226 ? 6.623   20.312 41.860 1.00 10.79 ? 226 VAL A CB  1 
ATOM   1708 C CG1 . VAL A 1 226 ? 6.421   20.329 43.396 1.00 9.76  ? 226 VAL A CG1 1 
ATOM   1709 C CG2 . VAL A 1 226 ? 5.594   19.428 41.171 1.00 10.83 ? 226 VAL A CG2 1 
ATOM   1710 N N   . GLN A 1 227 ? 8.693   22.600 41.777 1.00 11.15 ? 227 GLN A N   1 
ATOM   1711 C CA  . GLN A 1 227 ? 9.682   23.471 42.430 1.00 10.59 ? 227 GLN A CA  1 
ATOM   1712 C C   . GLN A 1 227 ? 9.395   24.932 42.103 1.00 10.54 ? 227 GLN A C   1 
ATOM   1713 O O   . GLN A 1 227 ? 9.376   25.769 42.982 1.00 11.12 ? 227 GLN A O   1 
ATOM   1714 C CB  . GLN A 1 227 ? 11.109  23.128 41.967 1.00 10.22 ? 227 GLN A CB  1 
ATOM   1715 C CG  . GLN A 1 227 ? 11.642  21.823 42.501 1.00 8.91  ? 227 GLN A CG  1 
ATOM   1716 C CD  . GLN A 1 227 ? 13.109  21.652 42.173 1.00 9.34  ? 227 GLN A CD  1 
ATOM   1717 O OE1 . GLN A 1 227 ? 13.542  20.609 41.680 1.00 11.31 ? 227 GLN A OE1 1 
ATOM   1718 N NE2 . GLN A 1 227 ? 13.878  22.692 42.418 1.00 8.26  ? 227 GLN A NE2 1 
ATOM   1719 N N   . ALA A 1 228 ? 9.120   25.230 40.847 1.00 9.89  ? 228 ALA A N   1 
ATOM   1720 C CA  . ALA A 1 228 ? 8.856   26.601 40.485 1.00 11.38 ? 228 ALA A CA  1 
ATOM   1721 C C   . ALA A 1 228 ? 7.613   27.156 41.171 1.00 12.38 ? 228 ALA A C   1 
ATOM   1722 O O   . ALA A 1 228 ? 7.646   28.269 41.712 1.00 14.36 ? 228 ALA A O   1 
ATOM   1723 C CB  . ALA A 1 228 ? 8.690   26.734 38.968 1.00 10.90 ? 228 ALA A CB  1 
ATOM   1724 N N   . SER A 1 229 ? 6.543   26.375 41.229 1.00 12.46 ? 229 SER A N   1 
ATOM   1725 C CA  . SER A 1 229 ? 5.346   26.935 41.805 1.00 13.17 ? 229 SER A CA  1 
ATOM   1726 C C   . SER A 1 229 ? 5.264   26.964 43.307 1.00 12.69 ? 229 SER A C   1 
ATOM   1727 O O   . SER A 1 229 ? 4.881   27.988 43.881 1.00 13.87 ? 229 SER A O   1 
ATOM   1728 C CB  . SER A 1 229 ? 4.111   26.312 41.182 1.00 13.86 ? 229 SER A CB  1 
ATOM   1729 O OG  . SER A 1 229 ? 4.112   24.946 41.459 1.00 18.20 ? 229 SER A OG  1 
ATOM   1730 N N   . LEU A 1 230 ? 5.751   25.923 43.967 1.00 11.30 ? 230 LEU A N   1 
ATOM   1731 C CA  . LEU A 1 230 ? 5.626   25.910 45.401 1.00 10.01 ? 230 LEU A CA  1 
ATOM   1732 C C   . LEU A 1 230 ? 6.689   26.647 46.184 1.00 10.38 ? 230 LEU A C   1 
ATOM   1733 O O   . LEU A 1 230 ? 6.394   27.144 47.264 1.00 11.18 ? 230 LEU A O   1 
ATOM   1734 C CB  . LEU A 1 230 ? 5.497   24.482 45.910 1.00 9.80  ? 230 LEU A CB  1 
ATOM   1735 C CG  . LEU A 1 230 ? 4.295   23.650 45.402 1.00 10.53 ? 230 LEU A CG  1 
ATOM   1736 C CD1 . LEU A 1 230 ? 4.264   22.290 46.036 1.00 10.10 ? 230 LEU A CD1 1 
ATOM   1737 C CD2 . LEU A 1 230 ? 2.961   24.366 45.642 1.00 11.91 ? 230 LEU A CD2 1 
ATOM   1738 N N   . LYS A 1 231 ? 7.898   26.803 45.638 1.00 9.32  ? 231 LYS A N   1 
ATOM   1739 C CA  . LYS A 1 231 ? 8.980   27.436 46.403 1.00 7.89  ? 231 LYS A CA  1 
ATOM   1740 C C   . LYS A 1 231 ? 8.841   28.900 46.639 1.00 7.99  ? 231 LYS A C   1 
ATOM   1741 O O   . LYS A 1 231 ? 9.455   29.441 47.538 1.00 8.38  ? 231 LYS A O   1 
ATOM   1742 C CB  . LYS A 1 231 ? 10.361  27.091 45.829 1.00 6.52  ? 231 LYS A CB  1 
ATOM   1743 C CG  . LYS A 1 231 ? 10.801  25.633 46.091 1.00 5.13  ? 231 LYS A CG  1 
ATOM   1744 C CD  . LYS A 1 231 ? 12.082  25.327 45.346 1.00 5.99  ? 231 LYS A CD  1 
ATOM   1745 C CE  . LYS A 1 231 ? 12.557  23.927 45.660 1.00 6.15  ? 231 LYS A CE  1 
ATOM   1746 N NZ  . LYS A 1 231 ? 13.863  23.673 45.029 1.00 5.48  ? 231 LYS A NZ  1 
ATOM   1747 N N   . SER A 1 232 ? 8.013   29.560 45.852 1.00 8.81  ? 232 SER A N   1 
ATOM   1748 C CA  . SER A 1 232 ? 7.797   30.995 46.047 1.00 9.48  ? 232 SER A CA  1 
ATOM   1749 C C   . SER A 1 232 ? 6.454   31.272 46.752 1.00 8.60  ? 232 SER A C   1 
ATOM   1750 O O   . SER A 1 232 ? 6.025   32.397 46.828 1.00 8.80  ? 232 SER A O   1 
ATOM   1751 C CB  . SER A 1 232 ? 7.803   31.653 44.694 1.00 11.56 ? 232 SER A CB  1 
ATOM   1752 O OG  . SER A 1 232 ? 6.854   30.939 43.902 1.00 17.70 ? 232 SER A OG  1 
ATOM   1753 N N   . LYS A 1 233 ? 5.797   30.246 47.269 1.00 8.80  ? 233 LYS A N   1 
ATOM   1754 C CA  . LYS A 1 233 ? 4.511   30.399 47.977 1.00 8.54  ? 233 LYS A CA  1 
ATOM   1755 C C   . LYS A 1 233 ? 4.652   29.936 49.445 1.00 7.38  ? 233 LYS A C   1 
ATOM   1756 O O   . LYS A 1 233 ? 4.993   28.789 49.698 1.00 7.10  ? 233 LYS A O   1 
ATOM   1757 C CB  . LYS A 1 233 ? 3.449   29.542 47.270 1.00 9.58  ? 233 LYS A CB  1 
ATOM   1758 C CG  . LYS A 1 233 ? 2.081   29.619 47.862 1.00 10.09 ? 233 LYS A CG  1 
ATOM   1759 C CD  . LYS A 1 233 ? 1.522   30.999 47.666 1.00 12.88 ? 233 LYS A CD  1 
ATOM   1760 C CE  . LYS A 1 233 ? 0.208   31.122 48.424 1.00 15.31 ? 233 LYS A CE  1 
ATOM   1761 N NZ  . LYS A 1 233 ? -0.578  32.282 47.933 1.00 17.68 ? 233 LYS A NZ  1 
ATOM   1762 N N   . PRO A 1 234 ? 4.437   30.832 50.422 1.00 7.13  ? 234 PRO A N   1 
ATOM   1763 C CA  . PRO A 1 234 ? 4.567   30.416 51.831 1.00 7.31  ? 234 PRO A CA  1 
ATOM   1764 C C   . PRO A 1 234 ? 3.542   29.297 52.082 1.00 7.49  ? 234 PRO A C   1 
ATOM   1765 O O   . PRO A 1 234 ? 2.432   29.346 51.520 1.00 8.02  ? 234 PRO A O   1 
ATOM   1766 C CB  . PRO A 1 234 ? 4.210   31.681 52.613 1.00 7.16  ? 234 PRO A CB  1 
ATOM   1767 C CG  . PRO A 1 234 ? 4.554   32.805 51.647 1.00 7.86  ? 234 PRO A CG  1 
ATOM   1768 C CD  . PRO A 1 234 ? 4.104   32.263 50.300 1.00 6.52  ? 234 PRO A CD  1 
ATOM   1769 N N   . GLY A 1 235 ? 3.939   28.269 52.833 1.00 6.04  ? 235 GLY A N   1 
ATOM   1770 C CA  . GLY A 1 235 ? 3.055   27.150 53.073 1.00 5.78  ? 235 GLY A CA  1 
ATOM   1771 C C   . GLY A 1 235 ? 2.066   27.386 54.181 1.00 5.57  ? 235 GLY A C   1 
ATOM   1772 O O   . GLY A 1 235 ? 2.172   28.363 54.903 1.00 5.84  ? 235 GLY A O   1 
ATOM   1773 N N   . VAL A 1 236 ? 1.130   26.457 54.346 1.00 6.24  ? 236 VAL A N   1 
ATOM   1774 C CA  . VAL A 1 236 ? 0.103   26.570 55.398 1.00 6.42  ? 236 VAL A CA  1 
ATOM   1775 C C   . VAL A 1 236 ? 0.387   25.673 56.620 1.00 6.19  ? 236 VAL A C   1 
ATOM   1776 O O   . VAL A 1 236 ? -0.388  25.664 57.592 1.00 6.36  ? 236 VAL A O   1 
ATOM   1777 C CB  . VAL A 1 236 ? -1.338  26.254 54.839 1.00 6.13  ? 236 VAL A CB  1 
ATOM   1778 C CG1 . VAL A 1 236 ? -1.566  27.020 53.553 1.00 7.49  ? 236 VAL A CG1 1 
ATOM   1779 C CG2 . VAL A 1 236 ? -1.514  24.779 54.593 1.00 4.92  ? 236 VAL A CG2 1 
ATOM   1780 N N   . LEU A 1 237 ? 1.488   24.924 56.594 1.00 5.59  ? 237 LEU A N   1 
ATOM   1781 C CA  . LEU A 1 237 ? 1.789   24.071 57.737 1.00 5.45  ? 237 LEU A CA  1 
ATOM   1782 C C   . LEU A 1 237 ? 1.859   24.841 59.079 1.00 5.34  ? 237 LEU A C   1 
ATOM   1783 O O   . LEU A 1 237 ? 1.468   24.299 60.108 1.00 5.44  ? 237 LEU A O   1 
ATOM   1784 C CB  . LEU A 1 237 ? 3.074   23.274 57.513 1.00 5.53  ? 237 LEU A CB  1 
ATOM   1785 C CG  . LEU A 1 237 ? 3.450   22.266 58.621 1.00 6.36  ? 237 LEU A CG  1 
ATOM   1786 C CD1 . LEU A 1 237 ? 2.372   21.110 58.664 1.00 5.31  ? 237 LEU A CD1 1 
ATOM   1787 C CD2 . LEU A 1 237 ? 4.849   21.689 58.318 1.00 4.67  ? 237 LEU A CD2 1 
ATOM   1788 N N   . PRO A 1 238 ? 2.325   26.117 59.083 1.00 5.08  ? 238 PRO A N   1 
ATOM   1789 C CA  . PRO A 1 238 ? 2.390   26.848 60.364 1.00 4.75  ? 238 PRO A CA  1 
ATOM   1790 C C   . PRO A 1 238 ? 1.026   26.982 61.065 1.00 5.22  ? 238 PRO A C   1 
ATOM   1791 O O   . PRO A 1 238 ? 0.945   27.090 62.298 1.00 3.37  ? 238 PRO A O   1 
ATOM   1792 C CB  . PRO A 1 238 ? 2.964   28.195 59.962 1.00 4.57  ? 238 PRO A CB  1 
ATOM   1793 C CG  . PRO A 1 238 ? 3.887   27.812 58.754 1.00 5.15  ? 238 PRO A CG  1 
ATOM   1794 C CD  . PRO A 1 238 ? 2.939   26.906 57.995 1.00 4.21  ? 238 PRO A CD  1 
ATOM   1795 N N   . GLU A 1 239 ? -0.043  26.954 60.280 1.00 5.59  ? 239 GLU A N   1 
ATOM   1796 C CA  . GLU A 1 239 ? -1.371  27.044 60.853 1.00 7.11  ? 239 GLU A CA  1 
ATOM   1797 C C   . GLU A 1 239 ? -1.657  25.856 61.764 1.00 7.77  ? 239 GLU A C   1 
ATOM   1798 O O   . GLU A 1 239 ? -2.423  25.978 62.702 1.00 8.43  ? 239 GLU A O   1 
ATOM   1799 C CB  . GLU A 1 239 ? -2.394  27.142 59.745 1.00 8.39  ? 239 GLU A CB  1 
ATOM   1800 C CG  . GLU A 1 239 ? -3.021  28.516 59.647 1.00 10.82 ? 239 GLU A CG  1 
ATOM   1801 C CD  . GLU A 1 239 ? -2.064  29.588 59.172 1.00 14.06 ? 239 GLU A CD  1 
ATOM   1802 O OE1 . GLU A 1 239 ? -1.025  29.262 58.548 1.00 14.79 ? 239 GLU A OE1 1 
ATOM   1803 O OE2 . GLU A 1 239 ? -2.380  30.779 59.394 1.00 16.58 ? 239 GLU A OE2 1 
ATOM   1804 N N   . LEU A 1 240 ? -1.008  24.723 61.537 1.00 7.90  ? 240 LEU A N   1 
ATOM   1805 C CA  . LEU A 1 240 ? -1.218  23.562 62.402 1.00 9.40  ? 240 LEU A CA  1 
ATOM   1806 C C   . LEU A 1 240 ? -0.275  23.636 63.609 1.00 10.53 ? 240 LEU A C   1 
ATOM   1807 O O   . LEU A 1 240 ? -0.380  22.834 64.537 1.00 11.04 ? 240 LEU A O   1 
ATOM   1808 C CB  . LEU A 1 240 ? -0.975  22.255 61.657 1.00 9.61  ? 240 LEU A CB  1 
ATOM   1809 C CG  . LEU A 1 240 ? -1.915  21.910 60.500 1.00 11.19 ? 240 LEU A CG  1 
ATOM   1810 C CD1 . LEU A 1 240 ? -1.574  20.510 60.013 1.00 11.93 ? 240 LEU A CD1 1 
ATOM   1811 C CD2 . LEU A 1 240 ? -3.382  21.936 60.978 1.00 12.09 ? 240 LEU A CD2 1 
ATOM   1812 N N   . MET A 1 241 ? 0.607   24.628 63.599 1.00 10.76 ? 241 MET A N   1 
ATOM   1813 C CA  . MET A 1 241 ? 1.576   24.836 64.661 1.00 11.76 ? 241 MET A CA  1 
ATOM   1814 C C   . MET A 1 241 ? 1.192   26.019 65.542 1.00 12.63 ? 241 MET A C   1 
ATOM   1815 O O   . MET A 1 241 ? 2.017   26.539 66.272 1.00 13.33 ? 241 MET A O   1 
ATOM   1816 C CB  . MET A 1 241 ? 2.961   25.053 64.035 1.00 11.96 ? 241 MET A CB  1 
ATOM   1817 C CG  . MET A 1 241 ? 3.390   23.901 63.122 1.00 13.07 ? 241 MET A CG  1 
ATOM   1818 S SD  . MET A 1 241 ? 4.922   24.230 62.221 1.00 16.96 ? 241 MET A SD  1 
ATOM   1819 C CE  . MET A 1 241 ? 6.050   23.842 63.464 1.00 12.86 ? 241 MET A CE  1 
ATOM   1820 N N   . GLY A 1 242 ? -0.052  26.481 65.424 1.00 13.19 ? 242 GLY A N   1 
ATOM   1821 C CA  . GLY A 1 242 ? -0.495  27.594 66.232 1.00 13.60 ? 242 GLY A CA  1 
ATOM   1822 C C   . GLY A 1 242 ? -0.396  28.982 65.635 1.00 14.76 ? 242 GLY A C   1 
ATOM   1823 O O   . GLY A 1 242 ? -0.751  29.938 66.323 1.00 16.08 ? 242 GLY A O   1 
ATOM   1824 N N   . CYS A 1 243 ? 0.106   29.129 64.406 1.00 14.55 ? 243 CYS A N   1 
ATOM   1825 C CA  . CYS A 1 243 ? 0.202   30.453 63.778 1.00 14.92 ? 243 CYS A CA  1 
ATOM   1826 C C   . CYS A 1 243 ? -1.112  30.874 63.091 1.00 16.96 ? 243 CYS A C   1 
ATOM   1827 O O   . CYS A 1 243 ? -1.911  30.028 62.697 1.00 15.82 ? 243 CYS A O   1 
ATOM   1828 C CB  . CYS A 1 243 ? 1.328   30.476 62.740 1.00 12.73 ? 243 CYS A CB  1 
ATOM   1829 S SG  . CYS A 1 243 ? 2.952   29.965 63.388 1.00 10.44 ? 243 CYS A SG  1 
ATOM   1830 N N   . LYS A 1 244 ? -1.323  32.182 62.959 1.00 19.81 ? 244 LYS A N   1 
ATOM   1831 C CA  . LYS A 1 244 ? -2.514  32.738 62.297 1.00 23.46 ? 244 LYS A CA  1 
ATOM   1832 C C   . LYS A 1 244 ? -2.066  33.465 61.032 1.00 24.86 ? 244 LYS A C   1 
ATOM   1833 O O   . LYS A 1 244 ? -0.895  33.821 60.892 1.00 24.77 ? 244 LYS A O   1 
ATOM   1834 C CB  . LYS A 1 244 ? -3.244  33.760 63.182 1.00 25.52 ? 244 LYS A CB  1 
ATOM   1835 C CG  . LYS A 1 244 ? -3.439  33.358 64.656 1.00 28.94 ? 244 LYS A CG  1 
ATOM   1836 C CD  . LYS A 1 244 ? -4.272  32.090 64.778 1.00 32.62 ? 244 LYS A CD  1 
ATOM   1837 C CE  . LYS A 1 244 ? -4.911  31.936 66.173 1.00 34.78 ? 244 LYS A CE  1 
ATOM   1838 N NZ  . LYS A 1 244 ? -3.906  31.908 67.298 1.00 37.67 ? 244 LYS A NZ  1 
ATOM   1839 N N   . ASN A 1 245 ? -3.012  33.682 60.127 1.00 26.90 ? 245 ASN A N   1 
ATOM   1840 C CA  . ASN A 1 245 ? -2.774  34.376 58.864 1.00 28.87 ? 245 ASN A CA  1 
ATOM   1841 C C   . ASN A 1 245 ? -1.497  33.909 58.155 1.00 29.20 ? 245 ASN A C   1 
ATOM   1842 O O   . ASN A 1 245 ? -0.763  34.768 57.598 1.00 29.19 ? 245 ASN A O   1 
ATOM   1843 C CB  . ASN A 1 245 ? -2.733  35.890 59.094 1.00 31.46 ? 245 ASN A CB  1 
ATOM   1844 C CG  . ASN A 1 245 ? -3.841  36.375 60.038 1.00 34.48 ? 245 ASN A CG  1 
ATOM   1845 O OD1 . ASN A 1 245 ? -3.558  37.039 61.053 1.00 36.03 ? 245 ASN A OD1 1 
ATOM   1846 N ND2 . ASN A 1 245 ? -5.102  36.015 59.734 1.00 34.51 ? 245 ASN A ND2 1 
ATOM   1847 O OXT . ASN A 1 245 ? -1.250  32.678 58.160 1.00 28.73 ? 245 ASN A OXT 1 
ATOM   1848 N N   . SER B 1 5   ? -22.653 3.164  50.553 1.00 39.20 ? 5   SER B N   1 
ATOM   1849 C CA  . SER B 1 5   ? -21.232 2.676  50.524 1.00 37.99 ? 5   SER B CA  1 
ATOM   1850 C C   . SER B 1 5   ? -20.337 3.594  49.664 1.00 35.50 ? 5   SER B C   1 
ATOM   1851 O O   . SER B 1 5   ? -19.110 3.380  49.542 1.00 36.44 ? 5   SER B O   1 
ATOM   1852 C CB  . SER B 1 5   ? -21.185 1.217  50.015 1.00 39.91 ? 5   SER B CB  1 
ATOM   1853 O OG  . SER B 1 5   ? -21.933 0.349  50.885 1.00 42.98 ? 5   SER B OG  1 
ATOM   1854 N N   . ILE B 1 6   ? -20.935 4.657  49.131 1.00 31.04 ? 6   ILE B N   1 
ATOM   1855 C CA  . ILE B 1 6   ? -20.177 5.563  48.291 1.00 26.17 ? 6   ILE B CA  1 
ATOM   1856 C C   . ILE B 1 6   ? -19.881 6.821  49.081 1.00 23.31 ? 6   ILE B C   1 
ATOM   1857 O O   . ILE B 1 6   ? -20.798 7.520  49.489 1.00 23.27 ? 6   ILE B O   1 
ATOM   1858 C CB  . ILE B 1 6   ? -20.959 5.890  47.006 1.00 24.74 ? 6   ILE B CB  1 
ATOM   1859 C CG1 . ILE B 1 6   ? -21.164 4.610  46.190 1.00 24.18 ? 6   ILE B CG1 1 
ATOM   1860 C CG2 . ILE B 1 6   ? -20.208 6.870  46.180 1.00 23.93 ? 6   ILE B CG2 1 
ATOM   1861 C CD1 . ILE B 1 6   ? -22.156 4.752  45.075 1.00 25.09 ? 6   ILE B CD1 1 
ATOM   1862 N N   . ASP B 1 7   ? -18.606 7.078  49.333 1.00 20.15 ? 7   ASP B N   1 
ATOM   1863 C CA  . ASP B 1 7   ? -18.196 8.278  50.059 1.00 16.53 ? 7   ASP B CA  1 
ATOM   1864 C C   . ASP B 1 7   ? -17.593 9.242  49.058 1.00 13.45 ? 7   ASP B C   1 
ATOM   1865 O O   . ASP B 1 7   ? -16.497 9.023  48.554 1.00 12.95 ? 7   ASP B O   1 
ATOM   1866 C CB  . ASP B 1 7   ? -17.172 7.939  51.152 1.00 17.33 ? 7   ASP B CB  1 
ATOM   1867 C CG  . ASP B 1 7   ? -16.869 9.133  52.091 1.00 17.73 ? 7   ASP B CG  1 
ATOM   1868 O OD1 . ASP B 1 7   ? -17.332 10.273 51.836 1.00 16.06 ? 7   ASP B OD1 1 
ATOM   1869 O OD2 . ASP B 1 7   ? -16.187 8.899  53.123 1.00 19.40 ? 7   ASP B OD2 1 
ATOM   1870 N N   . ASN B 1 8   ? -18.318 10.305 48.761 1.00 10.80 ? 8   ASN B N   1 
ATOM   1871 C CA  . ASN B 1 8   ? -17.841 11.301 47.807 1.00 8.99  ? 8   ASN B CA  1 
ATOM   1872 C C   . ASN B 1 8   ? -17.282 12.517 48.545 1.00 7.70  ? 8   ASN B C   1 
ATOM   1873 O O   . ASN B 1 8   ? -16.994 13.542 47.943 1.00 7.51  ? 8   ASN B O   1 
ATOM   1874 C CB  . ASN B 1 8   ? -19.007 11.730 46.902 1.00 8.71  ? 8   ASN B CB  1 
ATOM   1875 C CG  . ASN B 1 8   ? -19.415 10.641 45.916 1.00 8.95  ? 8   ASN B CG  1 
ATOM   1876 O OD1 . ASN B 1 8   ? -18.559 10.057 45.280 1.00 9.81  ? 8   ASN B OD1 1 
ATOM   1877 N ND2 . ASN B 1 8   ? -20.715 10.376 45.784 1.00 5.90  ? 8   ASN B ND2 1 
ATOM   1878 N N   . CYS B 1 9   ? -17.153 12.408 49.861 1.00 6.18  ? 9   CYS B N   1 
ATOM   1879 C CA  . CYS B 1 9   ? -16.692 13.533 50.684 1.00 6.45  ? 9   CYS B CA  1 
ATOM   1880 C C   . CYS B 1 9   ? -15.378 13.328 51.421 1.00 5.63  ? 9   CYS B C   1 
ATOM   1881 O O   . CYS B 1 9   ? -14.679 14.299 51.706 1.00 6.34  ? 9   CYS B O   1 
ATOM   1882 C CB  . CYS B 1 9   ? -17.797 13.924 51.680 1.00 6.35  ? 9   CYS B CB  1 
ATOM   1883 S SG  . CYS B 1 9   ? -19.321 14.443 50.812 1.00 7.64  ? 9   CYS B SG  1 
ATOM   1884 N N   . ALA B 1 10  ? -15.104 12.075 51.769 1.00 4.83  ? 10  ALA B N   1 
ATOM   1885 C CA  . ALA B 1 10  ? -13.910 11.642 52.476 1.00 4.80  ? 10  ALA B CA  1 
ATOM   1886 C C   . ALA B 1 10  ? -13.760 12.152 53.901 1.00 5.23  ? 10  ALA B C   1 
ATOM   1887 O O   . ALA B 1 10  ? -13.363 11.388 54.757 1.00 6.24  ? 10  ALA B O   1 
ATOM   1888 C CB  . ALA B 1 10  ? -12.642 11.954 51.681 1.00 4.78  ? 10  ALA B CB  1 
ATOM   1889 N N   . VAL B 1 11  ? -14.024 13.428 54.162 1.00 3.97  ? 11  VAL B N   1 
ATOM   1890 C CA  . VAL B 1 11  ? -13.845 13.979 55.507 1.00 4.15  ? 11  VAL B CA  1 
ATOM   1891 C C   . VAL B 1 11  ? -15.158 14.576 56.037 1.00 4.95  ? 11  VAL B C   1 
ATOM   1892 O O   . VAL B 1 11  ? -15.159 15.556 56.773 1.00 3.04  ? 11  VAL B O   1 
ATOM   1893 C CB  . VAL B 1 11  ? -12.689 15.057 55.552 1.00 3.81  ? 11  VAL B CB  1 
ATOM   1894 C CG1 . VAL B 1 11  ? -11.337 14.406 55.188 1.00 3.90  ? 11  VAL B CG1 1 
ATOM   1895 C CG2 . VAL B 1 11  ? -12.961 16.190 54.617 1.00 2.94  ? 11  VAL B CG2 1 
ATOM   1896 N N   . GLY B 1 12  ? -16.279 14.007 55.578 1.00 6.24  ? 12  GLY B N   1 
ATOM   1897 C CA  . GLY B 1 12  ? -17.588 14.469 56.026 1.00 6.57  ? 12  GLY B CA  1 
ATOM   1898 C C   . GLY B 1 12  ? -18.252 15.420 55.062 1.00 6.38  ? 12  GLY B C   1 
ATOM   1899 O O   . GLY B 1 12  ? -17.752 16.504 54.798 1.00 6.71  ? 12  GLY B O   1 
ATOM   1900 N N   . CYS B 1 13  ? -19.401 15.008 54.541 1.00 6.14  ? 13  CYS B N   1 
ATOM   1901 C CA  . CYS B 1 13  ? -20.165 15.844 53.614 1.00 6.10  ? 13  CYS B CA  1 
ATOM   1902 C C   . CYS B 1 13  ? -20.633 17.086 54.390 1.00 5.47  ? 13  CYS B C   1 
ATOM   1903 O O   . CYS B 1 13  ? -20.699 17.067 55.620 1.00 5.45  ? 13  CYS B O   1 
ATOM   1904 C CB  . CYS B 1 13  ? -21.349 15.064 53.016 1.00 6.23  ? 13  CYS B CB  1 
ATOM   1905 S SG  . CYS B 1 13  ? -20.832 13.678 51.949 1.00 8.31  ? 13  CYS B SG  1 
ATOM   1906 N N   . PRO B 1 14  ? -20.980 18.169 53.679 1.00 4.82  ? 14  PRO B N   1 
ATOM   1907 C CA  . PRO B 1 14  ? -21.412 19.364 54.423 1.00 4.68  ? 14  PRO B CA  1 
ATOM   1908 C C   . PRO B 1 14  ? -22.692 19.217 55.272 1.00 5.01  ? 14  PRO B C   1 
ATOM   1909 O O   . PRO B 1 14  ? -23.559 18.407 54.950 1.00 4.92  ? 14  PRO B O   1 
ATOM   1910 C CB  . PRO B 1 14  ? -21.595 20.437 53.316 1.00 4.67  ? 14  PRO B CB  1 
ATOM   1911 C CG  . PRO B 1 14  ? -20.692 19.937 52.155 1.00 4.30  ? 14  PRO B CG  1 
ATOM   1912 C CD  . PRO B 1 14  ? -20.933 18.405 52.223 1.00 3.73  ? 14  PRO B CD  1 
ATOM   1913 N N   . THR B 1 15  ? -22.762 19.955 56.383 1.00 4.27  ? 15  THR B N   1 
ATOM   1914 C CA  . THR B 1 15  ? -23.956 19.965 57.208 1.00 4.95  ? 15  THR B CA  1 
ATOM   1915 C C   . THR B 1 15  ? -24.572 21.322 56.947 1.00 5.56  ? 15  THR B C   1 
ATOM   1916 O O   . THR B 1 15  ? -23.891 22.225 56.426 1.00 5.42  ? 15  THR B O   1 
ATOM   1917 C CB  . THR B 1 15  ? -23.661 19.811 58.728 1.00 4.28  ? 15  THR B CB  1 
ATOM   1918 O OG1 . THR B 1 15  ? -22.799 20.865 59.169 1.00 3.66  ? 15  THR B OG1 1 
ATOM   1919 C CG2 . THR B 1 15  ? -23.050 18.441 59.020 1.00 3.24  ? 15  THR B CG2 1 
ATOM   1920 N N   . GLY B 1 16  ? -25.857 21.484 57.250 1.00 6.35  ? 16  GLY B N   1 
ATOM   1921 C CA  . GLY B 1 16  ? -26.467 22.782 57.051 1.00 6.66  ? 16  GLY B CA  1 
ATOM   1922 C C   . GLY B 1 16  ? -27.328 22.875 55.813 1.00 8.46  ? 16  GLY B C   1 
ATOM   1923 O O   . GLY B 1 16  ? -27.950 23.901 55.599 1.00 7.81  ? 16  GLY B O   1 
ATOM   1924 N N   . GLY B 1 17  ? -27.366 21.826 54.993 1.00 9.80  ? 17  GLY B N   1 
ATOM   1925 C CA  . GLY B 1 17  ? -28.188 21.855 53.786 1.00 11.59 ? 17  GLY B CA  1 
ATOM   1926 C C   . GLY B 1 17  ? -29.668 21.820 54.158 1.00 13.27 ? 17  GLY B C   1 
ATOM   1927 O O   . GLY B 1 17  ? -30.030 21.248 55.187 1.00 13.12 ? 17  GLY B O   1 
ATOM   1928 N N   . SER B 1 18  ? -30.531 22.390 53.323 1.00 14.03 ? 18  SER B N   1 
ATOM   1929 C CA  . SER B 1 18  ? -31.965 22.417 53.613 1.00 14.82 ? 18  SER B CA  1 
ATOM   1930 C C   . SER B 1 18  ? -32.623 21.060 53.688 1.00 16.00 ? 18  SER B C   1 
ATOM   1931 O O   . SER B 1 18  ? -33.684 20.956 54.283 1.00 16.91 ? 18  SER B O   1 
ATOM   1932 C CB  . SER B 1 18  ? -32.723 23.264 52.586 1.00 14.54 ? 18  SER B CB  1 
ATOM   1933 O OG  . SER B 1 18  ? -32.623 22.678 51.299 1.00 13.96 ? 18  SER B OG  1 
ATOM   1934 N N   . SER B 1 19  ? -32.081 20.046 53.025 1.00 16.54 ? 19  SER B N   1 
ATOM   1935 C CA  . SER B 1 19  ? -32.701 18.732 53.089 1.00 18.52 ? 19  SER B CA  1 
ATOM   1936 C C   . SER B 1 19  ? -31.943 17.902 54.057 1.00 19.50 ? 19  SER B C   1 
ATOM   1937 O O   . SER B 1 19  ? -30.733 18.003 54.134 1.00 19.13 ? 19  SER B O   1 
ATOM   1938 C CB  . SER B 1 19  ? -32.615 17.979 51.771 1.00 19.03 ? 19  SER B CB  1 
ATOM   1939 O OG  . SER B 1 19  ? -33.133 18.754 50.734 1.00 23.49 ? 19  SER B OG  1 
ATOM   1940 N N   . ASN B 1 20  ? -32.647 17.003 54.727 1.00 21.27 ? 20  ASN B N   1 
ATOM   1941 C CA  . ASN B 1 20  ? -31.993 16.121 55.654 1.00 23.21 ? 20  ASN B CA  1 
ATOM   1942 C C   . ASN B 1 20  ? -31.501 14.864 54.962 1.00 22.71 ? 20  ASN B C   1 
ATOM   1943 O O   . ASN B 1 20  ? -30.608 14.188 55.465 1.00 23.85 ? 20  ASN B O   1 
ATOM   1944 C CB  . ASN B 1 20  ? -32.894 15.832 56.833 1.00 27.47 ? 20  ASN B CB  1 
ATOM   1945 C CG  . ASN B 1 20  ? -33.091 17.061 57.720 1.00 31.66 ? 20  ASN B CG  1 
ATOM   1946 O OD1 . ASN B 1 20  ? -34.130 17.176 58.374 1.00 35.01 ? 20  ASN B OD1 1 
ATOM   1947 N ND2 . ASN B 1 20  ? -32.100 17.999 57.738 1.00 34.05 ? 20  ASN B ND2 1 
ATOM   1948 N N   . VAL B 1 21  ? -32.013 14.607 53.764 1.00 21.36 ? 21  VAL B N   1 
ATOM   1949 C CA  . VAL B 1 21  ? -31.580 13.458 52.971 1.00 20.75 ? 21  VAL B CA  1 
ATOM   1950 C C   . VAL B 1 21  ? -30.812 13.957 51.726 1.00 18.87 ? 21  VAL B C   1 
ATOM   1951 O O   . VAL B 1 21  ? -31.211 14.928 51.087 1.00 19.50 ? 21  VAL B O   1 
ATOM   1952 C CB  . VAL B 1 21  ? -32.800 12.620 52.500 1.00 22.28 ? 21  VAL B CB  1 
ATOM   1953 C CG1 . VAL B 1 21  ? -32.341 11.324 51.819 1.00 23.73 ? 21  VAL B CG1 1 
ATOM   1954 C CG2 . VAL B 1 21  ? -33.655 12.269 53.695 1.00 24.86 ? 21  VAL B CG2 1 
ATOM   1955 N N   . SER B 1 22  ? -29.694 13.323 51.409 1.00 16.06 ? 22  SER B N   1 
ATOM   1956 C CA  . SER B 1 22  ? -28.926 13.707 50.247 1.00 14.28 ? 22  SER B CA  1 
ATOM   1957 C C   . SER B 1 22  ? -28.995 12.528 49.310 1.00 12.84 ? 22  SER B C   1 
ATOM   1958 O O   . SER B 1 22  ? -29.232 11.417 49.760 1.00 12.62 ? 22  SER B O   1 
ATOM   1959 C CB  . SER B 1 22  ? -27.474 13.968 50.629 1.00 13.78 ? 22  SER B CB  1 
ATOM   1960 O OG  . SER B 1 22  ? -27.411 15.072 51.493 1.00 14.79 ? 22  SER B OG  1 
ATOM   1961 N N   . ILE B 1 23  ? -28.878 12.784 48.017 1.00 10.96 ? 23  ILE B N   1 
ATOM   1962 C CA  . ILE B 1 23  ? -28.896 11.728 47.009 1.00 10.27 ? 23  ILE B CA  1 
ATOM   1963 C C   . ILE B 1 23  ? -27.438 11.283 46.862 1.00 8.69  ? 23  ILE B C   1 
ATOM   1964 O O   . ILE B 1 23  ? -26.557 12.132 46.685 1.00 8.17  ? 23  ILE B O   1 
ATOM   1965 C CB  . ILE B 1 23  ? -29.351 12.278 45.620 1.00 11.46 ? 23  ILE B CB  1 
ATOM   1966 C CG1 . ILE B 1 23  ? -30.746 12.907 45.696 1.00 13.23 ? 23  ILE B CG1 1 
ATOM   1967 C CG2 . ILE B 1 23  ? -29.287 11.176 44.566 1.00 12.73 ? 23  ILE B CG2 1 
ATOM   1968 C CD1 . ILE B 1 23  ? -31.694 12.140 46.598 1.00 15.64 ? 23  ILE B CD1 1 
ATOM   1969 N N   . VAL B 1 24  ? -27.178 9.986  46.914 1.00 7.42  ? 24  VAL B N   1 
ATOM   1970 C CA  . VAL B 1 24  ? -25.825 9.488  46.778 1.00 7.68  ? 24  VAL B CA  1 
ATOM   1971 C C   . VAL B 1 24  ? -25.719 8.671  45.504 1.00 8.64  ? 24  VAL B C   1 
ATOM   1972 O O   . VAL B 1 24  ? -26.468 7.737  45.294 1.00 9.50  ? 24  VAL B O   1 
ATOM   1973 C CB  . VAL B 1 24  ? -25.431 8.627  48.000 1.00 8.51  ? 24  VAL B CB  1 
ATOM   1974 C CG1 . VAL B 1 24  ? -24.062 7.972  47.795 1.00 9.34  ? 24  VAL B CG1 1 
ATOM   1975 C CG2 . VAL B 1 24  ? -25.439 9.493  49.280 1.00 8.09  ? 24  VAL B CG2 1 
ATOM   1976 N N   . ARG B 1 25  ? -24.788 9.024  44.639 1.00 8.25  ? 25  ARG B N   1 
ATOM   1977 C CA  . ARG B 1 25  ? -24.593 8.317  43.403 1.00 8.49  ? 25  ARG B CA  1 
ATOM   1978 C C   . ARG B 1 25  ? -23.082 8.146  43.212 1.00 9.16  ? 25  ARG B C   1 
ATOM   1979 O O   . ARG B 1 25  ? -22.274 8.681  43.980 1.00 8.40  ? 25  ARG B O   1 
ATOM   1980 C CB  . ARG B 1 25  ? -25.137 9.165  42.240 1.00 9.73  ? 25  ARG B CB  1 
ATOM   1981 C CG  . ARG B 1 25  ? -26.655 9.287  42.224 1.00 10.18 ? 25  ARG B CG  1 
ATOM   1982 C CD  . ARG B 1 25  ? -27.168 10.249 41.161 1.00 9.24  ? 25  ARG B CD  1 
ATOM   1983 N NE  . ARG B 1 25  ? -28.610 10.045 41.014 1.00 8.74  ? 25  ARG B NE  1 
ATOM   1984 C CZ  . ARG B 1 25  ? -29.534 10.998 40.978 1.00 7.99  ? 25  ARG B CZ  1 
ATOM   1985 N NH1 . ARG B 1 25  ? -29.212 12.280 41.051 1.00 5.07  ? 25  ARG B NH1 1 
ATOM   1986 N NH2 . ARG B 1 25  ? -30.811 10.639 40.921 1.00 8.67  ? 25  ARG B NH2 1 
ATOM   1987 N N   . HIS B 1 26  ? -22.689 7.415  42.178 1.00 9.18  ? 26  HIS B N   1 
ATOM   1988 C CA  . HIS B 1 26  ? -21.266 7.262  41.921 1.00 9.41  ? 26  HIS B CA  1 
ATOM   1989 C C   . HIS B 1 26  ? -20.807 8.600  41.358 1.00 9.26  ? 26  HIS B C   1 
ATOM   1990 O O   . HIS B 1 26  ? -19.664 9.040  41.581 1.00 9.94  ? 26  HIS B O   1 
ATOM   1991 C CB  . HIS B 1 26  ? -21.029 6.172  40.888 1.00 11.00 ? 26  HIS B CB  1 
ATOM   1992 C CG  . HIS B 1 26  ? -21.189 4.786  41.430 1.00 13.37 ? 26  HIS B CG  1 
ATOM   1993 N ND1 . HIS B 1 26  ? -22.362 4.072  41.325 1.00 15.23 ? 26  HIS B ND1 1 
ATOM   1994 C CD2 . HIS B 1 26  ? -20.317 3.976  42.075 1.00 14.22 ? 26  HIS B CD2 1 
ATOM   1995 C CE1 . HIS B 1 26  ? -22.211 2.883  41.880 1.00 16.26 ? 26  HIS B CE1 1 
ATOM   1996 N NE2 . HIS B 1 26  ? -20.977 2.800  42.343 1.00 16.33 ? 26  HIS B NE2 1 
ATOM   1997 N N   . ALA B 1 27  ? -21.696 9.277  40.635 1.00 7.10  ? 27  ALA B N   1 
ATOM   1998 C CA  . ALA B 1 27  ? -21.296 10.533 40.047 1.00 6.03  ? 27  ALA B CA  1 
ATOM   1999 C C   . ALA B 1 27  ? -21.083 11.619 41.085 1.00 5.53  ? 27  ALA B C   1 
ATOM   2000 O O   . ALA B 1 27  ? -20.189 12.443 40.918 1.00 6.33  ? 27  ALA B O   1 
ATOM   2001 C CB  . ALA B 1 27  ? -22.306 10.999 38.975 1.00 4.93  ? 27  ALA B CB  1 
ATOM   2002 N N   . TYR B 1 28  ? -21.893 11.631 42.144 1.00 4.10  ? 28  TYR B N   1 
ATOM   2003 C CA  . TYR B 1 28  ? -21.804 12.695 43.145 1.00 3.59  ? 28  TYR B CA  1 
ATOM   2004 C C   . TYR B 1 28  ? -22.797 12.427 44.232 1.00 4.03  ? 28  TYR B C   1 
ATOM   2005 O O   . TYR B 1 28  ? -23.574 11.468 44.150 1.00 3.12  ? 28  TYR B O   1 
ATOM   2006 C CB  . TYR B 1 28  ? -22.143 14.078 42.516 1.00 3.68  ? 28  TYR B CB  1 
ATOM   2007 C CG  . TYR B 1 28  ? -23.458 14.140 41.761 1.00 2.97  ? 28  TYR B CG  1 
ATOM   2008 C CD1 . TYR B 1 28  ? -24.677 14.090 42.448 1.00 4.20  ? 28  TYR B CD1 1 
ATOM   2009 C CD2 . TYR B 1 28  ? -23.485 14.127 40.369 1.00 2.31  ? 28  TYR B CD2 1 
ATOM   2010 C CE1 . TYR B 1 28  ? -25.899 14.005 41.763 1.00 4.64  ? 28  TYR B CE1 1 
ATOM   2011 C CE2 . TYR B 1 28  ? -24.713 14.049 39.653 1.00 3.90  ? 28  TYR B CE2 1 
ATOM   2012 C CZ  . TYR B 1 28  ? -25.924 13.986 40.365 1.00 5.15  ? 28  TYR B CZ  1 
ATOM   2013 O OH  . TYR B 1 28  ? -27.165 13.923 39.699 1.00 4.54  ? 28  TYR B OH  1 
ATOM   2014 N N   . THR B 1 29  ? -22.713 13.243 45.275 1.00 4.60  ? 29  THR B N   1 
ATOM   2015 C CA  . THR B 1 29  ? -23.645 13.220 46.401 1.00 4.38  ? 29  THR B CA  1 
ATOM   2016 C C   . THR B 1 29  ? -24.215 14.647 46.331 1.00 5.06  ? 29  THR B C   1 
ATOM   2017 O O   . THR B 1 29  ? -23.463 15.623 46.215 1.00 4.48  ? 29  THR B O   1 
ATOM   2018 C CB  . THR B 1 29  ? -22.935 12.969 47.705 1.00 4.23  ? 29  THR B CB  1 
ATOM   2019 O OG1 . THR B 1 29  ? -22.454 11.621 47.676 1.00 5.45  ? 29  THR B OG1 1 
ATOM   2020 C CG2 . THR B 1 29  ? -23.885 13.153 48.895 1.00 4.37  ? 29  THR B CG2 1 
ATOM   2021 N N   . LEU B 1 30  ? -25.528 14.773 46.437 1.00 4.69  ? 30  LEU B N   1 
ATOM   2022 C CA  . LEU B 1 30  ? -26.137 16.071 46.272 1.00 5.50  ? 30  LEU B CA  1 
ATOM   2023 C C   . LEU B 1 30  ? -27.221 16.317 47.323 1.00 5.57  ? 30  LEU B C   1 
ATOM   2024 O O   . LEU B 1 30  ? -27.874 15.385 47.756 1.00 5.46  ? 30  LEU B O   1 
ATOM   2025 C CB  . LEU B 1 30  ? -26.729 16.054 44.857 1.00 5.51  ? 30  LEU B CB  1 
ATOM   2026 C CG  . LEU B 1 30  ? -27.695 17.064 44.255 1.00 7.54  ? 30  LEU B CG  1 
ATOM   2027 C CD1 . LEU B 1 30  ? -27.465 17.014 42.733 1.00 5.70  ? 30  LEU B CD1 1 
ATOM   2028 C CD2 . LEU B 1 30  ? -29.200 16.763 44.689 1.00 6.67  ? 30  LEU B CD2 1 
ATOM   2029 N N   . ASN B 1 31  ? -27.344 17.554 47.786 1.00 5.35  ? 31  ASN B N   1 
ATOM   2030 C CA  . ASN B 1 31  ? -28.360 17.900 48.761 1.00 5.44  ? 31  ASN B CA  1 
ATOM   2031 C C   . ASN B 1 31  ? -29.213 18.942 48.034 1.00 5.60  ? 31  ASN B C   1 
ATOM   2032 O O   . ASN B 1 31  ? -28.724 20.036 47.679 1.00 5.06  ? 31  ASN B O   1 
ATOM   2033 C CB  . ASN B 1 31  ? -27.714 18.490 50.017 1.00 4.93  ? 31  ASN B CB  1 
ATOM   2034 C CG  . ASN B 1 31  ? -28.698 18.715 51.131 1.00 4.85  ? 31  ASN B CG  1 
ATOM   2035 O OD1 . ASN B 1 31  ? -29.200 19.818 51.338 1.00 6.32  ? 31  ASN B OD1 1 
ATOM   2036 N ND2 . ASN B 1 31  ? -28.948 17.678 51.893 1.00 7.45  ? 31  ASN B ND2 1 
ATOM   2037 N N   . ASN B 1 32  ? -30.474 18.594 47.784 1.00 5.23  ? 32  ASN B N   1 
ATOM   2038 C CA  . ASN B 1 32  ? -31.377 19.476 47.055 1.00 6.12  ? 32  ASN B CA  1 
ATOM   2039 C C   . ASN B 1 32  ? -32.079 20.514 47.900 1.00 6.37  ? 32  ASN B C   1 
ATOM   2040 O O   . ASN B 1 32  ? -32.244 20.330 49.095 1.00 7.09  ? 32  ASN B O   1 
ATOM   2041 C CB  . ASN B 1 32  ? -32.441 18.651 46.328 1.00 7.17  ? 32  ASN B CB  1 
ATOM   2042 C CG  . ASN B 1 32  ? -33.232 19.478 45.336 1.00 8.52  ? 32  ASN B CG  1 
ATOM   2043 O OD1 . ASN B 1 32  ? -32.640 20.153 44.489 1.00 8.99  ? 32  ASN B OD1 1 
ATOM   2044 N ND2 . ASN B 1 32  ? -34.574 19.439 45.432 1.00 7.59  ? 32  ASN B ND2 1 
ATOM   2045 N N   . ASN B 1 33  ? -32.401 21.649 47.298 1.00 6.31  ? 33  ASN B N   1 
ATOM   2046 C CA  . ASN B 1 33  ? -33.140 22.681 47.996 1.00 7.26  ? 33  ASN B CA  1 
ATOM   2047 C C   . ASN B 1 33  ? -34.498 22.773 47.275 1.00 8.22  ? 33  ASN B C   1 
ATOM   2048 O O   . ASN B 1 33  ? -34.574 23.215 46.114 1.00 7.71  ? 33  ASN B O   1 
ATOM   2049 C CB  . ASN B 1 33  ? -32.426 24.022 47.938 1.00 6.82  ? 33  ASN B CB  1 
ATOM   2050 C CG  . ASN B 1 33  ? -33.109 25.061 48.792 1.00 8.93  ? 33  ASN B CG  1 
ATOM   2051 O OD1 . ASN B 1 33  ? -34.336 25.235 48.730 1.00 8.44  ? 33  ASN B OD1 1 
ATOM   2052 N ND2 . ASN B 1 33  ? -32.327 25.760 49.605 1.00 6.97  ? 33  ASN B ND2 1 
ATOM   2053 N N   . SER B 1 34  ? -35.568 22.332 47.939 1.00 8.19  ? 34  SER B N   1 
ATOM   2054 C CA  . SER B 1 34  ? -36.878 22.358 47.301 1.00 9.15  ? 34  SER B CA  1 
ATOM   2055 C C   . SER B 1 34  ? -37.516 23.736 47.104 1.00 8.42  ? 34  SER B C   1 
ATOM   2056 O O   . SER B 1 34  ? -38.475 23.853 46.359 1.00 8.00  ? 34  SER B O   1 
ATOM   2057 C CB  . SER B 1 34  ? -37.832 21.410 48.016 1.00 10.01 ? 34  SER B CB  1 
ATOM   2058 O OG  . SER B 1 34  ? -38.071 21.890 49.307 1.00 13.27 ? 34  SER B OG  1 
ATOM   2059 N N   . THR B 1 35  ? -36.992 24.764 47.769 1.00 8.08  ? 35  THR B N   1 
ATOM   2060 C CA  . THR B 1 35  ? -37.501 26.118 47.604 1.00 7.83  ? 35  THR B CA  1 
ATOM   2061 C C   . THR B 1 35  ? -36.879 26.826 46.421 1.00 7.83  ? 35  THR B C   1 
ATOM   2062 O O   . THR B 1 35  ? -37.591 27.351 45.547 1.00 7.82  ? 35  THR B O   1 
ATOM   2063 C CB  . THR B 1 35  ? -37.259 26.944 48.846 1.00 8.71  ? 35  THR B CB  1 
ATOM   2064 O OG1 . THR B 1 35  ? -37.940 26.319 49.928 1.00 10.40 ? 35  THR B OG1 1 
ATOM   2065 C CG2 . THR B 1 35  ? -37.780 28.375 48.690 1.00 8.68  ? 35  THR B CG2 1 
ATOM   2066 N N   . THR B 1 36  ? -35.542 26.778 46.339 1.00 7.44  ? 36  THR B N   1 
ATOM   2067 C CA  . THR B 1 36  ? -34.831 27.465 45.242 1.00 5.75  ? 36  THR B CA  1 
ATOM   2068 C C   . THR B 1 36  ? -34.892 26.632 43.961 1.00 5.17  ? 36  THR B C   1 
ATOM   2069 O O   . THR B 1 36  ? -34.817 27.186 42.871 1.00 5.72  ? 36  THR B O   1 
ATOM   2070 C CB  . THR B 1 36  ? -33.355 27.726 45.590 1.00 4.12  ? 36  THR B CB  1 
ATOM   2071 O OG1 . THR B 1 36  ? -32.700 26.470 45.750 1.00 5.32  ? 36  THR B OG1 1 
ATOM   2072 C CG2 . THR B 1 36  ? -33.228 28.474 46.917 1.00 4.68  ? 36  THR B CG2 1 
ATOM   2073 N N   . LYS B 1 37  ? -35.021 25.319 44.115 1.00 4.56  ? 37  LYS B N   1 
ATOM   2074 C CA  . LYS B 1 37  ? -35.077 24.330 43.020 1.00 5.37  ? 37  LYS B CA  1 
ATOM   2075 C C   . LYS B 1 37  ? -33.688 23.884 42.503 1.00 5.50  ? 37  LYS B C   1 
ATOM   2076 O O   . LYS B 1 37  ? -33.590 23.103 41.504 1.00 6.27  ? 37  LYS B O   1 
ATOM   2077 C CB  . LYS B 1 37  ? -35.939 24.830 41.849 1.00 6.15  ? 37  LYS B CB  1 
ATOM   2078 C CG  . LYS B 1 37  ? -37.406 25.183 42.215 1.00 7.08  ? 37  LYS B CG  1 
ATOM   2079 C CD  . LYS B 1 37  ? -38.196 23.980 42.778 1.00 6.93  ? 37  LYS B CD  1 
ATOM   2080 C CE  . LYS B 1 37  ? -39.620 24.403 43.216 1.00 7.94  ? 37  LYS B CE  1 
ATOM   2081 N NZ  . LYS B 1 37  ? -39.611 25.522 44.221 1.00 7.83  ? 37  LYS B NZ  1 
ATOM   2082 N N   . PHE B 1 38  ? -32.634 24.363 43.176 1.00 3.93  ? 38  PHE B N   1 
ATOM   2083 C CA  . PHE B 1 38  ? -31.222 24.066 42.857 1.00 3.81  ? 38  PHE B CA  1 
ATOM   2084 C C   . PHE B 1 38  ? -30.547 23.418 44.054 1.00 4.35  ? 38  PHE B C   1 
ATOM   2085 O O   . PHE B 1 38  ? -30.935 23.654 45.207 1.00 5.39  ? 38  PHE B O   1 
ATOM   2086 C CB  . PHE B 1 38  ? -30.491 25.332 42.442 1.00 2.14  ? 38  PHE B CB  1 
ATOM   2087 C CG  . PHE B 1 38  ? -31.164 26.013 41.319 1.00 3.89  ? 38  PHE B CG  1 
ATOM   2088 C CD1 . PHE B 1 38  ? -31.301 25.351 40.090 1.00 3.27  ? 38  PHE B CD1 1 
ATOM   2089 C CD2 . PHE B 1 38  ? -31.791 27.249 41.505 1.00 3.73  ? 38  PHE B CD2 1 
ATOM   2090 C CE1 . PHE B 1 38  ? -32.049 25.893 39.061 1.00 4.33  ? 38  PHE B CE1 1 
ATOM   2091 C CE2 . PHE B 1 38  ? -32.555 27.815 40.478 1.00 5.66  ? 38  PHE B CE2 1 
ATOM   2092 C CZ  . PHE B 1 38  ? -32.688 27.134 39.246 1.00 5.06  ? 38  PHE B CZ  1 
ATOM   2093 N N   . ALA B 1 39  ? -29.576 22.560 43.802 1.00 3.61  ? 39  ALA B N   1 
ATOM   2094 C CA  . ALA B 1 39  ? -28.923 21.876 44.904 1.00 4.32  ? 39  ALA B CA  1 
ATOM   2095 C C   . ALA B 1 39  ? -28.155 22.842 45.815 1.00 4.49  ? 39  ALA B C   1 
ATOM   2096 O O   . ALA B 1 39  ? -27.545 23.783 45.317 1.00 4.63  ? 39  ALA B O   1 
ATOM   2097 C CB  . ALA B 1 39  ? -27.970 20.798 44.350 1.00 3.76  ? 39  ALA B CB  1 
ATOM   2098 N N   . ASN B 1 40  ? -28.183 22.596 47.131 1.00 4.21  ? 40  ASN B N   1 
ATOM   2099 C CA  . ASN B 1 40  ? -27.446 23.416 48.110 1.00 4.18  ? 40  ASN B CA  1 
ATOM   2100 C C   . ASN B 1 40  ? -25.946 23.147 47.915 1.00 4.55  ? 40  ASN B C   1 
ATOM   2101 O O   . ASN B 1 40  ? -25.105 24.056 48.019 1.00 4.77  ? 40  ASN B O   1 
ATOM   2102 C CB  . ASN B 1 40  ? -27.824 23.050 49.559 1.00 2.96  ? 40  ASN B CB  1 
ATOM   2103 C CG  . ASN B 1 40  ? -29.276 23.388 49.887 1.00 3.98  ? 40  ASN B CG  1 
ATOM   2104 O OD1 . ASN B 1 40  ? -29.702 24.518 49.700 1.00 3.72  ? 40  ASN B OD1 1 
ATOM   2105 N ND2 . ASN B 1 40  ? -30.037 22.410 50.355 1.00 3.49  ? 40  ASN B ND2 1 
ATOM   2106 N N   . TRP B 1 41  ? -25.616 21.895 47.639 1.00 4.29  ? 41  TRP B N   1 
ATOM   2107 C CA  . TRP B 1 41  ? -24.217 21.546 47.432 1.00 4.33  ? 41  TRP B CA  1 
ATOM   2108 C C   . TRP B 1 41  ? -24.159 20.232 46.718 1.00 3.85  ? 41  TRP B C   1 
ATOM   2109 O O   . TRP B 1 41  ? -25.111 19.464 46.770 1.00 2.72  ? 41  TRP B O   1 
ATOM   2110 C CB  . TRP B 1 41  ? -23.442 21.466 48.775 1.00 2.86  ? 41  TRP B CB  1 
ATOM   2111 C CG  . TRP B 1 41  ? -24.036 20.558 49.840 1.00 2.35  ? 41  TRP B CG  1 
ATOM   2112 C CD1 . TRP B 1 41  ? -24.767 20.951 50.934 1.00 2.00  ? 41  TRP B CD1 1 
ATOM   2113 C CD2 . TRP B 1 41  ? -23.862 19.130 49.970 1.00 3.12  ? 41  TRP B CD2 1 
ATOM   2114 N NE1 . TRP B 1 41  ? -25.040 19.863 51.733 1.00 2.36  ? 41  TRP B NE1 1 
ATOM   2115 C CE2 . TRP B 1 41  ? -24.501 18.738 51.165 1.00 2.39  ? 41  TRP B CE2 1 
ATOM   2116 C CE3 . TRP B 1 41  ? -23.209 18.146 49.199 1.00 2.36  ? 41  TRP B CE3 1 
ATOM   2117 C CZ2 . TRP B 1 41  ? -24.511 17.399 51.610 1.00 3.08  ? 41  TRP B CZ2 1 
ATOM   2118 C CZ3 . TRP B 1 41  ? -23.217 16.830 49.642 1.00 2.00  ? 41  TRP B CZ3 1 
ATOM   2119 C CH2 . TRP B 1 41  ? -23.862 16.467 50.832 1.00 2.50  ? 41  TRP B CH2 1 
ATOM   2120 N N   . VAL B 1 42  ? -23.046 20.014 46.019 1.00 3.87  ? 42  VAL B N   1 
ATOM   2121 C CA  . VAL B 1 42  ? -22.802 18.794 45.267 1.00 3.25  ? 42  VAL B CA  1 
ATOM   2122 C C   . VAL B 1 42  ? -21.349 18.446 45.577 1.00 3.94  ? 42  VAL B C   1 
ATOM   2123 O O   . VAL B 1 42  ? -20.458 19.294 45.462 1.00 2.94  ? 42  VAL B O   1 
ATOM   2124 C CB  . VAL B 1 42  ? -22.954 19.011 43.741 1.00 2.83  ? 42  VAL B CB  1 
ATOM   2125 C CG1 . VAL B 1 42  ? -22.783 17.685 43.048 1.00 2.20  ? 42  VAL B CG1 1 
ATOM   2126 C CG2 . VAL B 1 42  ? -24.311 19.597 43.417 1.00 2.00  ? 42  VAL B CG2 1 
ATOM   2127 N N   . ALA B 1 43  ? -21.132 17.227 46.059 1.00 4.01  ? 43  ALA B N   1 
ATOM   2128 C CA  . ALA B 1 43  ? -19.808 16.761 46.417 1.00 3.29  ? 43  ALA B CA  1 
ATOM   2129 C C   . ALA B 1 43  ? -19.430 15.656 45.442 1.00 3.47  ? 43  ALA B C   1 
ATOM   2130 O O   . ALA B 1 43  ? -20.233 14.761 45.156 1.00 3.97  ? 43  ALA B O   1 
ATOM   2131 C CB  . ALA B 1 43  ? -19.822 16.227 47.874 1.00 2.00  ? 43  ALA B CB  1 
ATOM   2132 N N   . TYR B 1 44  ? -18.232 15.730 44.892 1.00 3.27  ? 44  TYR B N   1 
ATOM   2133 C CA  . TYR B 1 44  ? -17.790 14.701 43.992 1.00 4.04  ? 44  TYR B CA  1 
ATOM   2134 C C   . TYR B 1 44  ? -16.317 14.325 44.189 1.00 5.34  ? 44  TYR B C   1 
ATOM   2135 O O   . TYR B 1 44  ? -15.519 15.061 44.801 1.00 5.41  ? 44  TYR B O   1 
ATOM   2136 C CB  . TYR B 1 44  ? -18.122 15.048 42.539 1.00 3.49  ? 44  TYR B CB  1 
ATOM   2137 C CG  . TYR B 1 44  ? -17.530 16.361 42.101 1.00 3.46  ? 44  TYR B CG  1 
ATOM   2138 C CD1 . TYR B 1 44  ? -18.263 17.549 42.245 1.00 2.32  ? 44  TYR B CD1 1 
ATOM   2139 C CD2 . TYR B 1 44  ? -16.267 16.411 41.495 1.00 2.16  ? 44  TYR B CD2 1 
ATOM   2140 C CE1 . TYR B 1 44  ? -17.779 18.742 41.796 1.00 2.31  ? 44  TYR B CE1 1 
ATOM   2141 C CE2 . TYR B 1 44  ? -15.759 17.615 41.035 1.00 3.44  ? 44  TYR B CE2 1 
ATOM   2142 C CZ  . TYR B 1 44  ? -16.533 18.780 41.188 1.00 3.32  ? 44  TYR B CZ  1 
ATOM   2143 O OH  . TYR B 1 44  ? -16.084 19.975 40.708 1.00 2.68  ? 44  TYR B OH  1 
ATOM   2144 N N   . HIS B 1 45  ? -15.957 13.173 43.628 1.00 6.66  ? 45  HIS B N   1 
ATOM   2145 C CA  . HIS B 1 45  ? -14.627 12.595 43.796 1.00 7.05  ? 45  HIS B CA  1 
ATOM   2146 C C   . HIS B 1 45  ? -14.068 12.175 42.434 1.00 8.00  ? 45  HIS B C   1 
ATOM   2147 O O   . HIS B 1 45  ? -14.530 11.193 41.817 1.00 7.49  ? 45  HIS B O   1 
ATOM   2148 C CB  . HIS B 1 45  ? -14.792 11.387 44.746 1.00 6.99  ? 45  HIS B CB  1 
ATOM   2149 C CG  . HIS B 1 45  ? -13.551 10.570 44.958 1.00 7.65  ? 45  HIS B CG  1 
ATOM   2150 N ND1 . HIS B 1 45  ? -13.598 9.238  45.321 1.00 8.28  ? 45  HIS B ND1 1 
ATOM   2151 C CD2 . HIS B 1 45  ? -12.240 10.888 44.861 1.00 7.23  ? 45  HIS B CD2 1 
ATOM   2152 C CE1 . HIS B 1 45  ? -12.369 8.772  45.434 1.00 8.43  ? 45  HIS B CE1 1 
ATOM   2153 N NE2 . HIS B 1 45  ? -11.526 9.754  45.163 1.00 8.44  ? 45  HIS B NE2 1 
ATOM   2154 N N   . ILE B 1 46  ? -13.107 12.946 41.939 1.00 7.50  ? 46  ILE B N   1 
ATOM   2155 C CA  . ILE B 1 46  ? -12.505 12.625 40.666 1.00 7.99  ? 46  ILE B CA  1 
ATOM   2156 C C   . ILE B 1 46  ? -11.334 11.688 40.893 1.00 8.88  ? 46  ILE B C   1 
ATOM   2157 O O   . ILE B 1 46  ? -10.571 11.881 41.865 1.00 8.62  ? 46  ILE B O   1 
ATOM   2158 C CB  . ILE B 1 46  ? -11.945 13.892 40.009 1.00 7.70  ? 46  ILE B CB  1 
ATOM   2159 C CG1 . ILE B 1 46  ? -13.067 14.914 39.779 1.00 5.89  ? 46  ILE B CG1 1 
ATOM   2160 C CG2 . ILE B 1 46  ? -11.226 13.529 38.701 1.00 7.46  ? 46  ILE B CG2 1 
ATOM   2161 C CD1 . ILE B 1 46  ? -12.524 16.303 39.329 1.00 5.82  ? 46  ILE B CD1 1 
ATOM   2162 N N   . THR B 1 47  ? -11.201 10.677 40.034 1.00 9.78  ? 47  THR B N   1 
ATOM   2163 C CA  . THR B 1 47  ? -10.048 9.754  40.083 1.00 11.38 ? 47  THR B CA  1 
ATOM   2164 C C   . THR B 1 47  ? -9.588  9.547  38.632 1.00 12.91 ? 47  THR B C   1 
ATOM   2165 O O   . THR B 1 47  ? -10.265 9.997  37.707 1.00 11.82 ? 47  THR B O   1 
ATOM   2166 C CB  . THR B 1 47  ? -10.374 8.364  40.669 1.00 11.14 ? 47  THR B CB  1 
ATOM   2167 O OG1 . THR B 1 47  ? -11.045 7.571  39.689 1.00 10.33 ? 47  THR B OG1 1 
ATOM   2168 C CG2 . THR B 1 47  ? -11.238 8.473  41.912 1.00 12.07 ? 47  THR B CG2 1 
ATOM   2169 N N   . LYS B 1 48  ? -8.486  8.807  38.435 1.00 14.35 ? 48  LYS B N   1 
ATOM   2170 C CA  . LYS B 1 48  ? -7.956  8.535  37.080 1.00 15.77 ? 48  LYS B CA  1 
ATOM   2171 C C   . LYS B 1 48  ? -9.012  7.863  36.213 1.00 14.62 ? 48  LYS B C   1 
ATOM   2172 O O   . LYS B 1 48  ? -8.975  8.000  35.018 1.00 14.96 ? 48  LYS B O   1 
ATOM   2173 C CB  . LYS B 1 48  ? -6.727  7.593  37.092 1.00 17.65 ? 48  LYS B CB  1 
ATOM   2174 C CG  . LYS B 1 48  ? -5.714  7.806  38.213 1.00 22.59 ? 48  LYS B CG  1 
ATOM   2175 C CD  . LYS B 1 48  ? -4.742  8.975  37.982 1.00 24.47 ? 48  LYS B CD  1 
ATOM   2176 C CE  . LYS B 1 48  ? -3.709  9.102  39.143 1.00 24.55 ? 48  LYS B CE  1 
ATOM   2177 N NZ  . LYS B 1 48  ? -2.693  10.177 38.819 1.00 23.07 ? 48  LYS B NZ  1 
ATOM   2178 N N   . ASP B 1 49  ? -9.927  7.123  36.821 1.00 15.05 ? 49  ASP B N   1 
ATOM   2179 C CA  . ASP B 1 49  ? -10.980 6.416  36.091 1.00 15.84 ? 49  ASP B CA  1 
ATOM   2180 C C   . ASP B 1 49  ? -12.288 7.154  35.848 1.00 16.01 ? 49  ASP B C   1 
ATOM   2181 O O   . ASP B 1 49  ? -13.157 6.606  35.192 1.00 15.96 ? 49  ASP B O   1 
ATOM   2182 C CB  . ASP B 1 49  ? -11.375 5.172  36.838 1.00 18.38 ? 49  ASP B CB  1 
ATOM   2183 C CG  . ASP B 1 49  ? -10.223 4.256  37.060 1.00 22.02 ? 49  ASP B CG  1 
ATOM   2184 O OD1 . ASP B 1 49  ? -9.392  4.088  36.139 1.00 22.91 ? 49  ASP B OD1 1 
ATOM   2185 O OD2 . ASP B 1 49  ? -10.143 3.727  38.180 1.00 25.50 ? 49  ASP B OD2 1 
ATOM   2186 N N   . THR B 1 50  ? -12.479 8.346  36.411 1.00 14.92 ? 50  THR B N   1 
ATOM   2187 C CA  . THR B 1 50  ? -13.757 9.007  36.197 1.00 13.44 ? 50  THR B CA  1 
ATOM   2188 C C   . THR B 1 50  ? -13.897 9.887  34.965 1.00 14.02 ? 50  THR B C   1 
ATOM   2189 O O   . THR B 1 50  ? -15.002 10.069 34.481 1.00 14.69 ? 50  THR B O   1 
ATOM   2190 C CB  . THR B 1 50  ? -14.232 9.778  37.444 1.00 12.13 ? 50  THR B CB  1 
ATOM   2191 O OG1 . THR B 1 50  ? -13.271 10.770 37.792 1.00 10.46 ? 50  THR B OG1 1 
ATOM   2192 C CG2 . THR B 1 50  ? -14.421 8.834  38.638 1.00 10.69 ? 50  THR B CG2 1 
ATOM   2193 N N   . PRO B 1 51  ? -12.803 10.475 34.457 1.00 13.88 ? 51  PRO B N   1 
ATOM   2194 C CA  . PRO B 1 51  ? -12.985 11.322 33.275 1.00 14.42 ? 51  PRO B CA  1 
ATOM   2195 C C   . PRO B 1 51  ? -13.396 10.563 32.025 1.00 15.01 ? 51  PRO B C   1 
ATOM   2196 O O   . PRO B 1 51  ? -13.101 9.395  31.870 1.00 14.86 ? 51  PRO B O   1 
ATOM   2197 C CB  . PRO B 1 51  ? -11.611 11.963 33.097 1.00 13.46 ? 51  PRO B CB  1 
ATOM   2198 C CG  . PRO B 1 51  ? -11.090 12.023 34.496 1.00 14.06 ? 51  PRO B CG  1 
ATOM   2199 C CD  . PRO B 1 51  ? -11.436 10.625 34.975 1.00 13.99 ? 51  PRO B CD  1 
ATOM   2200 N N   . ALA B 1 52  ? -14.139 11.233 31.168 1.00 15.60 ? 52  ALA B N   1 
ATOM   2201 C CA  . ALA B 1 52  ? -14.579 10.647 29.920 1.00 16.50 ? 52  ALA B CA  1 
ATOM   2202 C C   . ALA B 1 52  ? -15.024 11.802 29.030 1.00 17.47 ? 52  ALA B C   1 
ATOM   2203 O O   . ALA B 1 52  ? -15.788 12.679 29.458 1.00 16.55 ? 52  ALA B O   1 
ATOM   2204 C CB  . ALA B 1 52  ? -15.713 9.663  30.159 1.00 16.21 ? 52  ALA B CB  1 
ATOM   2205 N N   . SER B 1 53  ? -14.528 11.835 27.802 1.00 18.69 ? 53  SER B N   1 
ATOM   2206 C CA  . SER B 1 53  ? -14.930 12.914 26.924 1.00 21.03 ? 53  SER B CA  1 
ATOM   2207 C C   . SER B 1 53  ? -15.949 12.479 25.853 1.00 21.26 ? 53  SER B C   1 
ATOM   2208 O O   . SER B 1 53  ? -16.243 11.291 25.677 1.00 21.03 ? 53  SER B O   1 
ATOM   2209 C CB  . SER B 1 53  ? -13.709 13.545 26.279 1.00 22.24 ? 53  SER B CB  1 
ATOM   2210 O OG  . SER B 1 53  ? -13.150 12.614 25.376 1.00 26.83 ? 53  SER B OG  1 
ATOM   2211 N N   . GLY B 1 54  ? -16.568 13.467 25.219 1.00 21.99 ? 54  GLY B N   1 
ATOM   2212 C CA  . GLY B 1 54  ? -17.526 13.146 24.182 1.00 22.78 ? 54  GLY B CA  1 
ATOM   2213 C C   . GLY B 1 54  ? -18.865 12.542 24.572 1.00 22.45 ? 54  GLY B C   1 
ATOM   2214 O O   . GLY B 1 54  ? -19.535 11.954 23.710 1.00 24.25 ? 54  GLY B O   1 
ATOM   2215 N N   . LYS B 1 55  ? -19.295 12.662 25.822 1.00 20.44 ? 55  LYS B N   1 
ATOM   2216 C CA  . LYS B 1 55  ? -20.596 12.099 26.170 1.00 18.56 ? 55  LYS B CA  1 
ATOM   2217 C C   . LYS B 1 55  ? -21.682 13.122 25.822 1.00 17.44 ? 55  LYS B C   1 
ATOM   2218 O O   . LYS B 1 55  ? -21.441 14.329 25.812 1.00 16.51 ? 55  LYS B O   1 
ATOM   2219 C CB  . LYS B 1 55  ? -20.632 11.704 27.638 1.00 19.88 ? 55  LYS B CB  1 
ATOM   2220 C CG  . LYS B 1 55  ? -19.608 10.651 27.949 1.00 20.61 ? 55  LYS B CG  1 
ATOM   2221 C CD  . LYS B 1 55  ? -20.270 9.381  28.343 1.00 22.99 ? 55  LYS B CD  1 
ATOM   2222 C CE  . LYS B 1 55  ? -19.221 8.335  28.693 1.00 25.72 ? 55  LYS B CE  1 
ATOM   2223 N NZ  . LYS B 1 55  ? -19.635 7.334  29.746 1.00 28.51 ? 55  LYS B NZ  1 
ATOM   2224 N N   . THR B 1 56  ? -22.876 12.647 25.502 1.00 16.61 ? 56  THR B N   1 
ATOM   2225 C CA  . THR B 1 56  ? -23.945 13.563 25.117 1.00 16.35 ? 56  THR B CA  1 
ATOM   2226 C C   . THR B 1 56  ? -24.709 14.200 26.298 1.00 16.27 ? 56  THR B C   1 
ATOM   2227 O O   . THR B 1 56  ? -24.589 13.764 27.468 1.00 15.97 ? 56  THR B O   1 
ATOM   2228 C CB  . THR B 1 56  ? -24.873 12.860 24.152 1.00 16.54 ? 56  THR B CB  1 
ATOM   2229 O OG1 . THR B 1 56  ? -25.345 11.666 24.769 1.00 16.42 ? 56  THR B OG1 1 
ATOM   2230 C CG2 . THR B 1 56  ? -24.084 12.447 22.909 1.00 16.44 ? 56  THR B CG2 1 
ATOM   2231 N N   . ARG B 1 57  ? -25.458 15.259 26.010 1.00 15.42 ? 57  ARG B N   1 
ATOM   2232 C CA  . ARG B 1 57  ? -26.190 15.948 27.061 1.00 15.39 ? 57  ARG B CA  1 
ATOM   2233 C C   . ARG B 1 57  ? -27.693 15.883 26.936 1.00 14.03 ? 57  ARG B C   1 
ATOM   2234 O O   . ARG B 1 57  ? -28.298 16.760 26.336 1.00 14.67 ? 57  ARG B O   1 
ATOM   2235 C CB  . ARG B 1 57  ? -25.748 17.405 27.148 1.00 17.44 ? 57  ARG B CB  1 
ATOM   2236 C CG  . ARG B 1 57  ? -24.327 17.574 27.686 1.00 21.95 ? 57  ARG B CG  1 
ATOM   2237 C CD  . ARG B 1 57  ? -23.521 18.566 26.850 1.00 26.25 ? 57  ARG B CD  1 
ATOM   2238 N NE  . ARG B 1 57  ? -24.209 19.853 26.711 1.00 30.97 ? 57  ARG B NE  1 
ATOM   2239 C CZ  . ARG B 1 57  ? -24.756 20.295 25.573 1.00 33.24 ? 57  ARG B CZ  1 
ATOM   2240 N NH1 . ARG B 1 57  ? -24.702 19.550 24.460 1.00 34.36 ? 57  ARG B NH1 1 
ATOM   2241 N NH2 . ARG B 1 57  ? -25.350 21.489 25.536 1.00 34.02 ? 57  ARG B NH2 1 
ATOM   2242 N N   . ASN B 1 58  ? -28.301 14.837 27.476 1.00 12.00 ? 58  ASN B N   1 
ATOM   2243 C CA  . ASN B 1 58  ? -29.760 14.724 27.443 1.00 10.10 ? 58  ASN B CA  1 
ATOM   2244 C C   . ASN B 1 58  ? -30.302 15.220 28.774 1.00 9.45  ? 58  ASN B C   1 
ATOM   2245 O O   . ASN B 1 58  ? -30.309 14.490 29.761 1.00 9.07  ? 58  ASN B O   1 
ATOM   2246 C CB  . ASN B 1 58  ? -30.205 13.273 27.192 1.00 9.82  ? 58  ASN B CB  1 
ATOM   2247 C CG  . ASN B 1 58  ? -30.296 12.933 25.701 1.00 8.87  ? 58  ASN B CG  1 
ATOM   2248 O OD1 . ASN B 1 58  ? -29.952 11.855 25.285 1.00 10.56 ? 58  ASN B OD1 1 
ATOM   2249 N ND2 . ASN B 1 58  ? -30.794 13.831 24.930 1.00 5.73  ? 58  ASN B ND2 1 
ATOM   2250 N N   . TRP B 1 59  ? -30.680 16.486 28.828 1.00 8.57  ? 59  TRP B N   1 
ATOM   2251 C CA  . TRP B 1 59  ? -31.215 17.049 30.053 1.00 8.27  ? 59  TRP B CA  1 
ATOM   2252 C C   . TRP B 1 59  ? -32.434 16.237 30.470 1.00 8.45  ? 59  TRP B C   1 
ATOM   2253 O O   . TRP B 1 59  ? -33.272 15.890 29.625 1.00 7.20  ? 59  TRP B O   1 
ATOM   2254 C CB  . TRP B 1 59  ? -31.646 18.481 29.808 1.00 7.54  ? 59  TRP B CB  1 
ATOM   2255 C CG  . TRP B 1 59  ? -30.613 19.250 29.129 1.00 8.70  ? 59  TRP B CG  1 
ATOM   2256 C CD1 . TRP B 1 59  ? -30.734 19.880 27.933 1.00 9.74  ? 59  TRP B CD1 1 
ATOM   2257 C CD2 . TRP B 1 59  ? -29.253 19.469 29.574 1.00 8.86  ? 59  TRP B CD2 1 
ATOM   2258 N NE1 . TRP B 1 59  ? -29.534 20.476 27.595 1.00 10.72 ? 59  TRP B NE1 1 
ATOM   2259 C CE2 . TRP B 1 59  ? -28.610 20.234 28.578 1.00 9.19  ? 59  TRP B CE2 1 
ATOM   2260 C CE3 . TRP B 1 59  ? -28.525 19.095 30.718 1.00 8.36  ? 59  TRP B CE3 1 
ATOM   2261 C CZ2 . TRP B 1 59  ? -27.273 20.630 28.680 1.00 10.53 ? 59  TRP B CZ2 1 
ATOM   2262 C CZ3 . TRP B 1 59  ? -27.192 19.493 30.822 1.00 9.66  ? 59  TRP B CZ3 1 
ATOM   2263 C CH2 . TRP B 1 59  ? -26.578 20.249 29.812 1.00 9.91  ? 59  TRP B CH2 1 
ATOM   2264 N N   . LYS B 1 60  ? -32.618 16.090 31.780 1.00 8.79  ? 60  LYS B N   1 
ATOM   2265 C CA  . LYS B 1 60  ? -33.735 15.306 32.305 1.00 9.79  ? 60  LYS B CA  1 
ATOM   2266 C C   . LYS B 1 60  ? -34.053 15.649 33.751 1.00 8.88  ? 60  LYS B C   1 
ATOM   2267 O O   . LYS B 1 60  ? -33.171 16.057 34.515 1.00 8.35  ? 60  LYS B O   1 
ATOM   2268 C CB  . LYS B 1 60  ? -33.317 13.848 32.223 1.00 12.36 ? 60  LYS B CB  1 
ATOM   2269 C CG  . LYS B 1 60  ? -34.341 12.821 32.442 1.00 17.56 ? 60  LYS B CG  1 
ATOM   2270 C CD  . LYS B 1 60  ? -33.900 11.617 31.615 1.00 22.11 ? 60  LYS B CD  1 
ATOM   2271 C CE  . LYS B 1 60  ? -33.681 12.038 30.141 1.00 24.51 ? 60  LYS B CE  1 
ATOM   2272 N NZ  . LYS B 1 60  ? -32.954 10.988 29.362 1.00 27.37 ? 60  LYS B NZ  1 
ATOM   2273 N N   . THR B 1 61  ? -35.327 15.548 34.100 1.00 7.95  ? 61  THR B N   1 
ATOM   2274 C CA  . THR B 1 61  ? -35.778 15.767 35.474 1.00 7.89  ? 61  THR B CA  1 
ATOM   2275 C C   . THR B 1 61  ? -35.217 14.652 36.339 1.00 7.44  ? 61  THR B C   1 
ATOM   2276 O O   . THR B 1 61  ? -35.297 13.490 35.971 1.00 6.89  ? 61  THR B O   1 
ATOM   2277 C CB  . THR B 1 61  ? -37.300 15.683 35.538 1.00 7.79  ? 61  THR B CB  1 
ATOM   2278 O OG1 . THR B 1 61  ? -37.829 16.717 34.703 1.00 8.51  ? 61  THR B OG1 1 
ATOM   2279 C CG2 . THR B 1 61  ? -37.823 15.852 36.949 1.00 7.27  ? 61  THR B CG2 1 
ATOM   2280 N N   . ASP B 1 62  ? -34.617 14.992 37.472 1.00 7.56  ? 62  ASP B N   1 
ATOM   2281 C CA  . ASP B 1 62  ? -34.074 13.952 38.352 1.00 7.89  ? 62  ASP B CA  1 
ATOM   2282 C C   . ASP B 1 62  ? -35.232 13.049 38.817 1.00 8.56  ? 62  ASP B C   1 
ATOM   2283 O O   . ASP B 1 62  ? -36.127 13.487 39.533 1.00 7.91  ? 62  ASP B O   1 
ATOM   2284 C CB  . ASP B 1 62  ? -33.406 14.595 39.578 1.00 7.21  ? 62  ASP B CB  1 
ATOM   2285 C CG  . ASP B 1 62  ? -32.516 13.625 40.347 1.00 7.52  ? 62  ASP B CG  1 
ATOM   2286 O OD1 . ASP B 1 62  ? -32.896 12.461 40.545 1.00 5.76  ? 62  ASP B OD1 1 
ATOM   2287 O OD2 . ASP B 1 62  ? -31.417 14.044 40.771 1.00 8.28  ? 62  ASP B OD2 1 
ATOM   2288 N N   . PRO B 1 63  ? -35.163 11.754 38.500 1.00 9.88  ? 63  PRO B N   1 
ATOM   2289 C CA  . PRO B 1 63  ? -36.226 10.841 38.909 1.00 10.28 ? 63  PRO B CA  1 
ATOM   2290 C C   . PRO B 1 63  ? -36.201 10.515 40.390 1.00 11.47 ? 63  PRO B C   1 
ATOM   2291 O O   . PRO B 1 63  ? -37.152 9.923  40.901 1.00 12.08 ? 63  PRO B O   1 
ATOM   2292 C CB  . PRO B 1 63  ? -35.969 9.601  38.052 1.00 10.11 ? 63  PRO B CB  1 
ATOM   2293 C CG  . PRO B 1 63  ? -34.530 9.624  37.857 1.00 11.44 ? 63  PRO B CG  1 
ATOM   2294 C CD  . PRO B 1 63  ? -34.192 11.077 37.621 1.00 10.37 ? 63  PRO B CD  1 
ATOM   2295 N N   . ALA B 1 64  ? -35.133 10.881 41.092 1.00 10.40 ? 64  ALA B N   1 
ATOM   2296 C CA  . ALA B 1 64  ? -35.081 10.577 42.503 1.00 10.78 ? 64  ALA B CA  1 
ATOM   2297 C C   . ALA B 1 64  ? -35.783 11.639 43.323 1.00 11.32 ? 64  ALA B C   1 
ATOM   2298 O O   . ALA B 1 64  ? -36.017 11.453 44.502 1.00 12.23 ? 64  ALA B O   1 
ATOM   2299 C CB  . ALA B 1 64  ? -33.623 10.421 42.965 1.00 11.04 ? 64  ALA B CB  1 
ATOM   2300 N N   . LEU B 1 65  ? -36.129 12.764 42.715 1.00 11.86 ? 65  LEU B N   1 
ATOM   2301 C CA  . LEU B 1 65  ? -36.783 13.843 43.446 1.00 11.77 ? 65  LEU B CA  1 
ATOM   2302 C C   . LEU B 1 65  ? -38.251 13.989 43.062 1.00 13.17 ? 65  LEU B C   1 
ATOM   2303 O O   . LEU B 1 65  ? -38.680 13.548 42.013 1.00 12.49 ? 65  LEU B O   1 
ATOM   2304 C CB  . LEU B 1 65  ? -36.083 15.165 43.158 1.00 10.96 ? 65  LEU B CB  1 
ATOM   2305 C CG  . LEU B 1 65  ? -34.618 15.286 43.592 1.00 11.40 ? 65  LEU B CG  1 
ATOM   2306 C CD1 . LEU B 1 65  ? -33.954 16.524 42.999 1.00 10.35 ? 65  LEU B CD1 1 
ATOM   2307 C CD2 . LEU B 1 65  ? -34.566 15.345 45.098 1.00 10.44 ? 65  LEU B CD2 1 
ATOM   2308 N N   . ASN B 1 66  ? -39.024 14.623 43.927 1.00 14.36 ? 66  ASN B N   1 
ATOM   2309 C CA  . ASN B 1 66  ? -40.432 14.868 43.638 1.00 15.56 ? 66  ASN B CA  1 
ATOM   2310 C C   . ASN B 1 66  ? -40.373 15.959 42.560 1.00 14.74 ? 66  ASN B C   1 
ATOM   2311 O O   . ASN B 1 66  ? -39.649 16.939 42.686 1.00 14.40 ? 66  ASN B O   1 
ATOM   2312 C CB  . ASN B 1 66  ? -41.130 15.373 44.916 1.00 18.53 ? 66  ASN B CB  1 
ATOM   2313 C CG  . ASN B 1 66  ? -42.520 15.936 44.671 1.00 20.76 ? 66  ASN B CG  1 
ATOM   2314 O OD1 . ASN B 1 66  ? -42.874 16.393 43.582 1.00 22.51 ? 66  ASN B OD1 1 
ATOM   2315 N ND2 . ASN B 1 66  ? -43.306 15.947 45.725 1.00 23.62 ? 66  ASN B ND2 1 
ATOM   2316 N N   . PRO B 1 67  ? -41.124 15.786 41.478 1.00 14.27 ? 67  PRO B N   1 
ATOM   2317 C CA  . PRO B 1 67  ? -41.130 16.771 40.395 1.00 13.62 ? 67  PRO B CA  1 
ATOM   2318 C C   . PRO B 1 67  ? -41.444 18.214 40.782 1.00 13.04 ? 67  PRO B C   1 
ATOM   2319 O O   . PRO B 1 67  ? -41.010 19.134 40.100 1.00 12.61 ? 67  PRO B O   1 
ATOM   2320 C CB  . PRO B 1 67  ? -42.131 16.190 39.401 1.00 15.02 ? 67  PRO B CB  1 
ATOM   2321 C CG  . PRO B 1 67  ? -42.859 15.060 40.172 1.00 14.95 ? 67  PRO B CG  1 
ATOM   2322 C CD  . PRO B 1 67  ? -41.796 14.537 41.082 1.00 14.28 ? 67  PRO B CD  1 
ATOM   2323 N N   . ALA B 1 68  ? -42.146 18.439 41.890 1.00 11.87 ? 68  ALA B N   1 
ATOM   2324 C CA  . ALA B 1 68  ? -42.432 19.821 42.319 1.00 11.32 ? 68  ALA B CA  1 
ATOM   2325 C C   . ALA B 1 68  ? -41.249 20.538 42.997 1.00 11.25 ? 68  ALA B C   1 
ATOM   2326 O O   . ALA B 1 68  ? -41.281 21.753 43.145 1.00 10.59 ? 68  ALA B O   1 
ATOM   2327 C CB  . ALA B 1 68  ? -43.596 19.811 43.284 1.00 11.38 ? 68  ALA B CB  1 
ATOM   2328 N N   . ASP B 1 69  ? -40.227 19.771 43.422 1.00 11.02 ? 69  ASP B N   1 
ATOM   2329 C CA  . ASP B 1 69  ? -39.053 20.282 44.149 1.00 10.41 ? 69  ASP B CA  1 
ATOM   2330 C C   . ASP B 1 69  ? -37.782 20.477 43.308 1.00 10.60 ? 69  ASP B C   1 
ATOM   2331 O O   . ASP B 1 69  ? -36.696 20.784 43.858 1.00 10.04 ? 69  ASP B O   1 
ATOM   2332 C CB  . ASP B 1 69  ? -38.691 19.310 45.277 1.00 11.82 ? 69  ASP B CB  1 
ATOM   2333 C CG  . ASP B 1 69  ? -39.847 19.058 46.247 1.00 12.20 ? 69  ASP B CG  1 
ATOM   2334 O OD1 . ASP B 1 69  ? -40.697 19.946 46.433 1.00 12.81 ? 69  ASP B OD1 1 
ATOM   2335 O OD2 . ASP B 1 69  ? -39.900 17.958 46.801 1.00 12.53 ? 69  ASP B OD2 1 
ATOM   2336 N N   . THR B 1 70  ? -37.917 20.305 41.992 1.00 9.82  ? 70  THR B N   1 
ATOM   2337 C CA  . THR B 1 70  ? -36.789 20.428 41.089 1.00 9.43  ? 70  THR B CA  1 
ATOM   2338 C C   . THR B 1 70  ? -37.311 20.932 39.746 1.00 9.64  ? 70  THR B C   1 
ATOM   2339 O O   . THR B 1 70  ? -38.530 21.052 39.583 1.00 9.90  ? 70  THR B O   1 
ATOM   2340 C CB  . THR B 1 70  ? -36.070 19.034 40.956 1.00 9.27  ? 70  THR B CB  1 
ATOM   2341 O OG1 . THR B 1 70  ? -34.809 19.204 40.292 1.00 8.43  ? 70  THR B OG1 1 
ATOM   2342 C CG2 . THR B 1 70  ? -36.927 18.025 40.200 1.00 9.08  ? 70  THR B CG2 1 
ATOM   2343 N N   . LEU B 1 71  ? -36.419 21.379 38.860 1.00 8.37  ? 71  LEU B N   1 
ATOM   2344 C CA  . LEU B 1 71  ? -36.855 21.828 37.553 1.00 7.86  ? 71  LEU B CA  1 
ATOM   2345 C C   . LEU B 1 71  ? -36.883 20.691 36.512 1.00 7.46  ? 71  LEU B C   1 
ATOM   2346 O O   . LEU B 1 71  ? -36.244 19.633 36.673 1.00 7.23  ? 71  LEU B O   1 
ATOM   2347 C CB  . LEU B 1 71  ? -35.970 22.963 37.050 1.00 8.02  ? 71  LEU B CB  1 
ATOM   2348 C CG  . LEU B 1 71  ? -35.938 24.251 37.888 1.00 8.02  ? 71  LEU B CG  1 
ATOM   2349 C CD1 . LEU B 1 71  ? -35.166 25.328 37.141 1.00 6.64  ? 71  LEU B CD1 1 
ATOM   2350 C CD2 . LEU B 1 71  ? -37.380 24.695 38.207 1.00 7.22  ? 71  LEU B CD2 1 
ATOM   2351 N N   . ALA B 1 72  ? -37.626 20.935 35.437 1.00 7.22  ? 72  ALA B N   1 
ATOM   2352 C CA  . ALA B 1 72  ? -37.775 20.006 34.303 1.00 7.11  ? 72  ALA B CA  1 
ATOM   2353 C C   . ALA B 1 72  ? -37.165 20.714 33.074 1.00 6.08  ? 72  ALA B C   1 
ATOM   2354 O O   . ALA B 1 72  ? -37.036 21.961 33.051 1.00 6.34  ? 72  ALA B O   1 
ATOM   2355 C CB  . ALA B 1 72  ? -39.276 19.675 34.071 1.00 6.75  ? 72  ALA B CB  1 
ATOM   2356 N N   . PRO B 1 73  ? -36.784 19.946 32.037 1.00 6.25  ? 73  PRO B N   1 
ATOM   2357 C CA  . PRO B 1 73  ? -36.184 20.556 30.837 1.00 6.25  ? 73  PRO B CA  1 
ATOM   2358 C C   . PRO B 1 73  ? -37.018 21.708 30.232 1.00 6.81  ? 73  PRO B C   1 
ATOM   2359 O O   . PRO B 1 73  ? -36.472 22.721 29.774 1.00 5.98  ? 73  PRO B O   1 
ATOM   2360 C CB  . PRO B 1 73  ? -36.031 19.364 29.884 1.00 6.61  ? 73  PRO B CB  1 
ATOM   2361 C CG  . PRO B 1 73  ? -35.875 18.180 30.827 1.00 6.28  ? 73  PRO B CG  1 
ATOM   2362 C CD  . PRO B 1 73  ? -36.844 18.469 31.929 1.00 6.03  ? 73  PRO B CD  1 
ATOM   2363 N N   . ALA B 1 74  ? -38.343 21.554 30.267 1.00 6.65  ? 74  ALA B N   1 
ATOM   2364 C CA  . ALA B 1 74  ? -39.252 22.559 29.751 1.00 6.82  ? 74  ALA B CA  1 
ATOM   2365 C C   . ALA B 1 74  ? -39.088 23.898 30.477 1.00 7.37  ? 74  ALA B C   1 
ATOM   2366 O O   . ALA B 1 74  ? -39.293 24.960 29.868 1.00 7.29  ? 74  ALA B O   1 
ATOM   2367 C CB  . ALA B 1 74  ? -40.742 22.055 29.878 1.00 6.91  ? 74  ALA B CB  1 
ATOM   2368 N N   . ASP B 1 75  ? -38.685 23.865 31.749 1.00 7.45  ? 75  ASP B N   1 
ATOM   2369 C CA  . ASP B 1 75  ? -38.514 25.101 32.528 1.00 7.89  ? 75  ASP B CA  1 
ATOM   2370 C C   . ASP B 1 75  ? -37.436 26.061 32.021 1.00 8.01  ? 75  ASP B C   1 
ATOM   2371 O O   . ASP B 1 75  ? -37.471 27.239 32.345 1.00 9.11  ? 75  ASP B O   1 
ATOM   2372 C CB  . ASP B 1 75  ? -38.265 24.793 34.009 1.00 8.16  ? 75  ASP B CB  1 
ATOM   2373 C CG  . ASP B 1 75  ? -39.443 24.092 34.678 1.00 10.98 ? 75  ASP B CG  1 
ATOM   2374 O OD1 . ASP B 1 75  ? -40.607 24.502 34.453 1.00 12.22 ? 75  ASP B OD1 1 
ATOM   2375 O OD2 . ASP B 1 75  ? -39.215 23.148 35.461 1.00 9.89  ? 75  ASP B OD2 1 
ATOM   2376 N N   . TYR B 1 76  ? -36.465 25.572 31.261 1.00 8.21  ? 76  TYR B N   1 
ATOM   2377 C CA  . TYR B 1 76  ? -35.403 26.425 30.714 1.00 8.83  ? 76  TYR B CA  1 
ATOM   2378 C C   . TYR B 1 76  ? -35.743 27.099 29.386 1.00 9.89  ? 76  TYR B C   1 
ATOM   2379 O O   . TYR B 1 76  ? -34.936 27.863 28.846 1.00 9.75  ? 76  TYR B O   1 
ATOM   2380 C CB  . TYR B 1 76  ? -34.103 25.625 30.532 1.00 9.73  ? 76  TYR B CB  1 
ATOM   2381 C CG  . TYR B 1 76  ? -33.298 25.500 31.806 1.00 9.37  ? 76  TYR B CG  1 
ATOM   2382 C CD1 . TYR B 1 76  ? -33.592 24.502 32.742 1.00 9.89  ? 76  TYR B CD1 1 
ATOM   2383 C CD2 . TYR B 1 76  ? -32.302 26.428 32.115 1.00 9.08  ? 76  TYR B CD2 1 
ATOM   2384 C CE1 . TYR B 1 76  ? -32.914 24.435 33.966 1.00 10.03 ? 76  TYR B CE1 1 
ATOM   2385 C CE2 . TYR B 1 76  ? -31.616 26.370 33.342 1.00 8.95  ? 76  TYR B CE2 1 
ATOM   2386 C CZ  . TYR B 1 76  ? -31.927 25.380 34.257 1.00 10.13 ? 76  TYR B CZ  1 
ATOM   2387 O OH  . TYR B 1 76  ? -31.271 25.321 35.472 1.00 10.59 ? 76  TYR B OH  1 
ATOM   2388 N N   . THR B 1 77  ? -36.934 26.842 28.852 1.00 10.83 ? 77  THR B N   1 
ATOM   2389 C CA  . THR B 1 77  ? -37.308 27.446 27.583 1.00 10.54 ? 77  THR B CA  1 
ATOM   2390 C C   . THR B 1 77  ? -37.267 28.958 27.640 1.00 10.37 ? 77  THR B C   1 
ATOM   2391 O O   . THR B 1 77  ? -37.891 29.561 28.506 1.00 10.00 ? 77  THR B O   1 
ATOM   2392 C CB  . THR B 1 77  ? -38.703 27.018 27.169 1.00 11.43 ? 77  THR B CB  1 
ATOM   2393 O OG1 . THR B 1 77  ? -38.714 25.591 27.052 1.00 11.84 ? 77  THR B OG1 1 
ATOM   2394 C CG2 . THR B 1 77  ? -39.045 27.633 25.798 1.00 11.56 ? 77  THR B CG2 1 
ATOM   2395 N N   . GLY B 1 78  ? -36.548 29.545 26.678 1.00 10.80 ? 78  GLY B N   1 
ATOM   2396 C CA  . GLY B 1 78  ? -36.385 30.997 26.576 1.00 10.96 ? 78  GLY B CA  1 
ATOM   2397 C C   . GLY B 1 78  ? -35.367 31.619 27.531 1.00 11.30 ? 78  GLY B C   1 
ATOM   2398 O O   . GLY B 1 78  ? -35.081 32.827 27.453 1.00 11.59 ? 78  GLY B O   1 
ATOM   2399 N N   . ALA B 1 79  ? -34.754 30.801 28.386 1.00 10.85 ? 79  ALA B N   1 
ATOM   2400 C CA  . ALA B 1 79  ? -33.827 31.333 29.366 1.00 11.05 ? 79  ALA B CA  1 
ATOM   2401 C C   . ALA B 1 79  ? -32.578 31.978 28.793 1.00 11.35 ? 79  ALA B C   1 
ATOM   2402 O O   . ALA B 1 79  ? -32.198 33.053 29.262 1.00 10.85 ? 79  ALA B O   1 
ATOM   2403 C CB  . ALA B 1 79  ? -33.465 30.287 30.401 1.00 10.12 ? 79  ALA B CB  1 
ATOM   2404 N N   . ASN B 1 80  ? -31.924 31.352 27.815 1.00 11.82 ? 80  ASN B N   1 
ATOM   2405 C CA  . ASN B 1 80  ? -30.717 31.961 27.253 1.00 13.45 ? 80  ASN B CA  1 
ATOM   2406 C C   . ASN B 1 80  ? -30.989 33.339 26.637 1.00 14.29 ? 80  ASN B C   1 
ATOM   2407 O O   . ASN B 1 80  ? -30.294 34.320 26.890 1.00 14.08 ? 80  ASN B O   1 
ATOM   2408 C CB  . ASN B 1 80  ? -30.092 31.072 26.197 1.00 15.12 ? 80  ASN B CB  1 
ATOM   2409 C CG  . ASN B 1 80  ? -28.796 31.669 25.637 1.00 17.81 ? 80  ASN B CG  1 
ATOM   2410 O OD1 . ASN B 1 80  ? -28.787 32.257 24.546 1.00 20.28 ? 80  ASN B OD1 1 
ATOM   2411 N ND2 . ASN B 1 80  ? -27.714 31.567 26.405 1.00 17.05 ? 80  ASN B ND2 1 
ATOM   2412 N N   . ALA B 1 81  ? -32.045 33.407 25.850 1.00 14.79 ? 81  ALA B N   1 
ATOM   2413 C CA  . ALA B 1 81  ? -32.444 34.643 25.199 1.00 15.77 ? 81  ALA B CA  1 
ATOM   2414 C C   . ALA B 1 81  ? -32.818 35.747 26.208 1.00 15.95 ? 81  ALA B C   1 
ATOM   2415 O O   . ALA B 1 81  ? -32.448 36.914 26.039 1.00 17.30 ? 81  ALA B O   1 
ATOM   2416 C CB  . ALA B 1 81  ? -33.647 34.352 24.270 1.00 16.16 ? 81  ALA B CB  1 
ATOM   2417 N N   . ALA B 1 82  ? -33.581 35.403 27.231 1.00 14.12 ? 82  ALA B N   1 
ATOM   2418 C CA  . ALA B 1 82  ? -33.972 36.405 28.188 1.00 14.21 ? 82  ALA B CA  1 
ATOM   2419 C C   . ALA B 1 82  ? -32.884 36.838 29.184 1.00 13.90 ? 82  ALA B C   1 
ATOM   2420 O O   . ALA B 1 82  ? -32.714 38.045 29.441 1.00 14.29 ? 82  ALA B O   1 
ATOM   2421 C CB  . ALA B 1 82  ? -35.208 35.932 28.978 1.00 13.74 ? 82  ALA B CB  1 
ATOM   2422 N N   . LEU B 1 83  ? -32.143 35.865 29.713 1.00 12.98 ? 83  LEU B N   1 
ATOM   2423 C CA  . LEU B 1 83  ? -31.166 36.113 30.768 1.00 12.71 ? 83  LEU B CA  1 
ATOM   2424 C C   . LEU B 1 83  ? -29.695 35.887 30.432 1.00 12.43 ? 83  LEU B C   1 
ATOM   2425 O O   . LEU B 1 83  ? -28.827 36.140 31.263 1.00 11.77 ? 83  LEU B O   1 
ATOM   2426 C CB  . LEU B 1 83  ? -31.521 35.219 31.977 1.00 13.44 ? 83  LEU B CB  1 
ATOM   2427 C CG  . LEU B 1 83  ? -32.948 35.263 32.537 1.00 14.27 ? 83  LEU B CG  1 
ATOM   2428 C CD1 . LEU B 1 83  ? -33.166 34.134 33.502 1.00 15.11 ? 83  LEU B CD1 1 
ATOM   2429 C CD2 . LEU B 1 83  ? -33.180 36.570 33.237 1.00 14.93 ? 83  LEU B CD2 1 
ATOM   2430 N N   . LYS B 1 84  ? -29.438 35.336 29.264 1.00 12.13 ? 84  LYS B N   1 
ATOM   2431 C CA  . LYS B 1 84  ? -28.098 35.015 28.830 1.00 13.58 ? 84  LYS B CA  1 
ATOM   2432 C C   . LYS B 1 84  ? -27.450 34.017 29.779 1.00 12.77 ? 84  LYS B C   1 
ATOM   2433 O O   . LYS B 1 84  ? -26.294 34.163 30.211 1.00 12.63 ? 84  LYS B O   1 
ATOM   2434 C CB  . LYS B 1 84  ? -27.238 36.271 28.654 1.00 16.74 ? 84  LYS B CB  1 
ATOM   2435 C CG  . LYS B 1 84  ? -26.101 36.052 27.664 1.00 21.97 ? 84  LYS B CG  1 
ATOM   2436 C CD  . LYS B 1 84  ? -26.568 35.181 26.461 1.00 25.95 ? 84  LYS B CD  1 
ATOM   2437 C CE  . LYS B 1 84  ? -27.744 35.831 25.655 1.00 28.58 ? 84  LYS B CE  1 
ATOM   2438 N NZ  . LYS B 1 84  ? -28.321 34.931 24.560 1.00 30.03 ? 84  LYS B NZ  1 
ATOM   2439 N N   . VAL B 1 85  ? -28.229 33.008 30.119 1.00 11.53 ? 85  VAL B N   1 
ATOM   2440 C CA  . VAL B 1 85  ? -27.754 31.957 30.981 1.00 10.63 ? 85  VAL B CA  1 
ATOM   2441 C C   . VAL B 1 85  ? -27.682 30.657 30.204 1.00 10.27 ? 85  VAL B C   1 
ATOM   2442 O O   . VAL B 1 85  ? -28.353 30.498 29.181 1.00 9.53  ? 85  VAL B O   1 
ATOM   2443 C CB  . VAL B 1 85  ? -28.653 31.778 32.226 1.00 10.93 ? 85  VAL B CB  1 
ATOM   2444 C CG1 . VAL B 1 85  ? -28.585 33.026 33.100 1.00 8.84  ? 85  VAL B CG1 1 
ATOM   2445 C CG2 . VAL B 1 85  ? -30.095 31.430 31.821 1.00 10.56 ? 85  VAL B CG2 1 
ATOM   2446 N N   . ASP B 1 86  ? -26.793 29.773 30.651 1.00 10.79 ? 86  ASP B N   1 
ATOM   2447 C CA  . ASP B 1 86  ? -26.577 28.442 30.068 1.00 11.39 ? 86  ASP B CA  1 
ATOM   2448 C C   . ASP B 1 86  ? -26.995 27.424 31.119 1.00 10.47 ? 86  ASP B C   1 
ATOM   2449 O O   . ASP B 1 86  ? -27.144 27.756 32.297 1.00 9.86  ? 86  ASP B O   1 
ATOM   2450 C CB  . ASP B 1 86  ? -25.081 28.192 29.839 1.00 14.05 ? 86  ASP B CB  1 
ATOM   2451 C CG  . ASP B 1 86  ? -24.550 28.841 28.588 1.00 16.99 ? 86  ASP B CG  1 
ATOM   2452 O OD1 . ASP B 1 86  ? -25.364 29.348 27.803 1.00 18.88 ? 86  ASP B OD1 1 
ATOM   2453 O OD2 . ASP B 1 86  ? -23.317 28.826 28.376 1.00 18.44 ? 86  ASP B OD2 1 
ATOM   2454 N N   . ARG B 1 87  ? -27.188 26.186 30.700 1.00 9.92  ? 87  ARG B N   1 
ATOM   2455 C CA  . ARG B 1 87  ? -27.476 25.134 31.664 1.00 10.42 ? 87  ARG B CA  1 
ATOM   2456 C C   . ARG B 1 87  ? -26.061 24.738 32.224 1.00 10.24 ? 87  ARG B C   1 
ATOM   2457 O O   . ARG B 1 87  ? -25.338 23.980 31.598 1.00 9.49  ? 87  ARG B O   1 
ATOM   2458 C CB  . ARG B 1 87  ? -28.161 23.939 30.959 1.00 10.71 ? 87  ARG B CB  1 
ATOM   2459 C CG  . ARG B 1 87  ? -29.559 24.280 30.394 1.00 11.87 ? 87  ARG B CG  1 
ATOM   2460 C CD  . ARG B 1 87  ? -30.078 23.204 29.478 1.00 13.04 ? 87  ARG B CD  1 
ATOM   2461 N NE  . ARG B 1 87  ? -31.413 23.482 28.969 1.00 13.96 ? 87  ARG B NE  1 
ATOM   2462 C CZ  . ARG B 1 87  ? -31.669 24.244 27.907 1.00 16.17 ? 87  ARG B CZ  1 
ATOM   2463 N NH1 . ARG B 1 87  ? -30.681 24.827 27.232 1.00 15.67 ? 87  ARG B NH1 1 
ATOM   2464 N NH2 . ARG B 1 87  ? -32.911 24.372 27.469 1.00 15.56 ? 87  ARG B NH2 1 
ATOM   2465 N N   . GLY B 1 88  ? -25.645 25.314 33.348 1.00 9.19  ? 88  GLY B N   1 
ATOM   2466 C CA  . GLY B 1 88  ? -24.327 24.973 33.862 1.00 8.57  ? 88  GLY B CA  1 
ATOM   2467 C C   . GLY B 1 88  ? -24.292 23.790 34.836 1.00 8.05  ? 88  GLY B C   1 
ATOM   2468 O O   . GLY B 1 88  ? -25.141 23.667 35.742 1.00 8.43  ? 88  GLY B O   1 
ATOM   2469 N N   . HIS B 1 89  ? -23.287 22.930 34.705 1.00 6.92  ? 89  HIS B N   1 
ATOM   2470 C CA  . HIS B 1 89  ? -23.156 21.794 35.611 1.00 6.54  ? 89  HIS B CA  1 
ATOM   2471 C C   . HIS B 1 89  ? -22.562 22.192 36.952 1.00 6.57  ? 89  HIS B C   1 
ATOM   2472 O O   . HIS B 1 89  ? -21.694 23.084 37.007 1.00 7.09  ? 89  HIS B O   1 
ATOM   2473 C CB  . HIS B 1 89  ? -22.233 20.715 35.028 1.00 6.08  ? 89  HIS B CB  1 
ATOM   2474 C CG  . HIS B 1 89  ? -22.851 19.921 33.915 1.00 6.35  ? 89  HIS B CG  1 
ATOM   2475 N ND1 . HIS B 1 89  ? -22.903 20.374 32.615 1.00 6.34  ? 89  HIS B ND1 1 
ATOM   2476 C CD2 . HIS B 1 89  ? -23.409 18.687 33.906 1.00 5.64  ? 89  HIS B CD2 1 
ATOM   2477 C CE1 . HIS B 1 89  ? -23.471 19.456 31.855 1.00 5.29  ? 89  HIS B CE1 1 
ATOM   2478 N NE2 . HIS B 1 89  ? -23.785 18.424 32.617 1.00 6.05  ? 89  HIS B NE2 1 
ATOM   2479 N N   . GLN B 1 90  ? -23.052 21.566 38.026 1.00 5.28  ? 90  GLN B N   1 
ATOM   2480 C CA  . GLN B 1 90  ? -22.461 21.759 39.349 1.00 5.32  ? 90  GLN B CA  1 
ATOM   2481 C C   . GLN B 1 90  ? -21.296 20.723 39.340 1.00 5.87  ? 90  GLN B C   1 
ATOM   2482 O O   . GLN B 1 90  ? -20.140 21.108 39.217 1.00 6.46  ? 90  GLN B O   1 
ATOM   2483 C CB  . GLN B 1 90  ? -23.501 21.528 40.442 1.00 4.84  ? 90  GLN B CB  1 
ATOM   2484 C CG  . GLN B 1 90  ? -24.613 22.617 40.410 1.00 3.86  ? 90  GLN B CG  1 
ATOM   2485 C CD  . GLN B 1 90  ? -24.906 23.196 41.796 1.00 5.99  ? 90  GLN B CD  1 
ATOM   2486 O OE1 . GLN B 1 90  ? -23.989 23.651 42.498 1.00 6.29  ? 90  GLN B OE1 1 
ATOM   2487 N NE2 . GLN B 1 90  ? -26.183 23.172 42.207 1.00 5.18  ? 90  GLN B NE2 1 
ATOM   2488 N N   . ALA B 1 91  ? -21.596 19.425 39.417 1.00 5.29  ? 91  ALA B N   1 
ATOM   2489 C CA  . ALA B 1 91  ? -20.566 18.379 39.288 1.00 5.47  ? 91  ALA B CA  1 
ATOM   2490 C C   . ALA B 1 91  ? -20.276 18.384 37.784 1.00 6.02  ? 91  ALA B C   1 
ATOM   2491 O O   . ALA B 1 91  ? -21.200 18.268 36.948 1.00 6.50  ? 91  ALA B O   1 
ATOM   2492 C CB  . ALA B 1 91  ? -21.105 17.009 39.723 1.00 3.77  ? 91  ALA B CB  1 
ATOM   2493 N N   . PRO B 1 92  ? -18.993 18.489 37.407 1.00 6.53  ? 92  PRO B N   1 
ATOM   2494 C CA  . PRO B 1 92  ? -18.604 18.536 35.996 1.00 6.65  ? 92  PRO B CA  1 
ATOM   2495 C C   . PRO B 1 92  ? -18.778 17.255 35.186 1.00 7.32  ? 92  PRO B C   1 
ATOM   2496 O O   . PRO B 1 92  ? -18.422 16.157 35.642 1.00 6.34  ? 92  PRO B O   1 
ATOM   2497 C CB  . PRO B 1 92  ? -17.167 19.055 36.066 1.00 6.65  ? 92  PRO B CB  1 
ATOM   2498 C CG  . PRO B 1 92  ? -16.670 18.427 37.346 1.00 6.28  ? 92  PRO B CG  1 
ATOM   2499 C CD  . PRO B 1 92  ? -17.822 18.543 38.294 1.00 6.04  ? 92  PRO B CD  1 
ATOM   2500 N N   . LEU B 1 93  ? -19.270 17.427 33.951 1.00 7.04  ? 93  LEU B N   1 
ATOM   2501 C CA  . LEU B 1 93  ? -19.536 16.305 33.076 1.00 7.55  ? 93  LEU B CA  1 
ATOM   2502 C C   . LEU B 1 93  ? -18.312 15.540 32.649 1.00 7.56  ? 93  LEU B C   1 
ATOM   2503 O O   . LEU B 1 93  ? -18.196 14.348 32.924 1.00 7.24  ? 93  LEU B O   1 
ATOM   2504 C CB  . LEU B 1 93  ? -20.350 16.730 31.838 1.00 7.43  ? 93  LEU B CB  1 
ATOM   2505 C CG  . LEU B 1 93  ? -20.788 15.611 30.857 1.00 7.44  ? 93  LEU B CG  1 
ATOM   2506 C CD1 . LEU B 1 93  ? -21.612 14.578 31.523 1.00 7.30  ? 93  LEU B CD1 1 
ATOM   2507 C CD2 . LEU B 1 93  ? -21.606 16.226 29.719 1.00 9.01  ? 93  LEU B CD2 1 
ATOM   2508 N N   . ALA B 1 94  ? -17.378 16.239 32.022 1.00 8.27  ? 94  ALA B N   1 
ATOM   2509 C CA  . ALA B 1 94  ? -16.183 15.590 31.513 1.00 8.94  ? 94  ALA B CA  1 
ATOM   2510 C C   . ALA B 1 94  ? -15.260 14.952 32.540 1.00 8.96  ? 94  ALA B C   1 
ATOM   2511 O O   . ALA B 1 94  ? -14.554 14.013 32.206 1.00 9.68  ? 94  ALA B O   1 
ATOM   2512 C CB  . ALA B 1 94  ? -15.424 16.534 30.649 1.00 8.49  ? 94  ALA B CB  1 
ATOM   2513 N N   . SER B 1 95  ? -15.225 15.481 33.765 1.00 9.22  ? 95  SER B N   1 
ATOM   2514 C CA  . SER B 1 95  ? -14.369 14.920 34.839 1.00 8.78  ? 95  SER B CA  1 
ATOM   2515 C C   . SER B 1 95  ? -14.908 13.652 35.472 1.00 7.91  ? 95  SER B C   1 
ATOM   2516 O O   . SER B 1 95  ? -14.144 12.885 36.077 1.00 6.37  ? 95  SER B O   1 
ATOM   2517 C CB  . SER B 1 95  ? -14.215 15.914 35.979 1.00 8.18  ? 95  SER B CB  1 
ATOM   2518 O OG  . SER B 1 95  ? -13.831 17.177 35.492 1.00 11.31 ? 95  SER B OG  1 
ATOM   2519 N N   . LEU B 1 96  ? -16.226 13.451 35.355 1.00 7.51  ? 96  LEU B N   1 
ATOM   2520 C CA  . LEU B 1 96  ? -16.903 12.317 35.981 1.00 7.51  ? 96  LEU B CA  1 
ATOM   2521 C C   . LEU B 1 96  ? -17.699 11.379 35.062 1.00 7.73  ? 96  LEU B C   1 
ATOM   2522 O O   . LEU B 1 96  ? -18.217 10.366 35.553 1.00 7.02  ? 96  LEU B O   1 
ATOM   2523 C CB  . LEU B 1 96  ? -17.881 12.875 37.046 1.00 7.52  ? 96  LEU B CB  1 
ATOM   2524 C CG  . LEU B 1 96  ? -17.298 13.687 38.202 1.00 7.95  ? 96  LEU B CG  1 
ATOM   2525 C CD1 . LEU B 1 96  ? -18.346 14.529 38.905 1.00 5.18  ? 96  LEU B CD1 1 
ATOM   2526 C CD2 . LEU B 1 96  ? -16.677 12.659 39.157 1.00 8.18  ? 96  LEU B CD2 1 
ATOM   2527 N N   . ALA B 1 97  ? -17.774 11.679 33.759 1.00 8.44  ? 97  ALA B N   1 
ATOM   2528 C CA  . ALA B 1 97  ? -18.591 10.855 32.863 1.00 9.64  ? 97  ALA B CA  1 
ATOM   2529 C C   . ALA B 1 97  ? -18.215 9.385  32.693 1.00 10.96 ? 97  ALA B C   1 
ATOM   2530 O O   . ALA B 1 97  ? -18.911 8.650  31.997 1.00 11.10 ? 97  ALA B O   1 
ATOM   2531 C CB  . ALA B 1 97  ? -18.773 11.520 31.515 1.00 10.32 ? 97  ALA B CB  1 
ATOM   2532 N N   . GLY B 1 98  ? -17.137 8.944  33.329 1.00 10.77 ? 98  GLY B N   1 
ATOM   2533 C CA  . GLY B 1 98  ? -16.771 7.550  33.223 1.00 10.65 ? 98  GLY B CA  1 
ATOM   2534 C C   . GLY B 1 98  ? -17.482 6.684  34.249 1.00 10.93 ? 98  GLY B C   1 
ATOM   2535 O O   . GLY B 1 98  ? -17.443 5.461  34.157 1.00 11.64 ? 98  GLY B O   1 
ATOM   2536 N N   . VAL B 1 99  ? -18.120 7.282  35.242 1.00 10.51 ? 99  VAL B N   1 
ATOM   2537 C CA  . VAL B 1 99  ? -18.816 6.493  36.268 1.00 11.10 ? 99  VAL B CA  1 
ATOM   2538 C C   . VAL B 1 99  ? -20.042 5.767  35.708 1.00 11.71 ? 99  VAL B C   1 
ATOM   2539 O O   . VAL B 1 99  ? -20.584 6.183  34.690 1.00 11.37 ? 99  VAL B O   1 
ATOM   2540 C CB  . VAL B 1 99  ? -19.201 7.370  37.469 1.00 11.19 ? 99  VAL B CB  1 
ATOM   2541 C CG1 . VAL B 1 99  ? -17.925 8.043  37.999 1.00 12.16 ? 99  VAL B CG1 1 
ATOM   2542 C CG2 . VAL B 1 99  ? -20.248 8.449  37.065 1.00 10.89 ? 99  VAL B CG2 1 
ATOM   2543 N N   . SER B 1 100 ? -20.516 4.738  36.406 1.00 12.02 ? 100 SER B N   1 
ATOM   2544 C CA  . SER B 1 100 ? -21.645 3.950  35.913 1.00 13.02 ? 100 SER B CA  1 
ATOM   2545 C C   . SER B 1 100 ? -22.979 4.694  35.810 1.00 13.29 ? 100 SER B C   1 
ATOM   2546 O O   . SER B 1 100 ? -23.814 4.386  34.949 1.00 14.59 ? 100 SER B O   1 
ATOM   2547 C CB  . SER B 1 100 ? -21.825 2.652  36.722 1.00 12.86 ? 100 SER B CB  1 
ATOM   2548 O OG  . SER B 1 100 ? -22.039 2.928  38.098 1.00 15.00 ? 100 SER B OG  1 
ATOM   2549 N N   . ASP B 1 101 ? -23.217 5.668  36.669 1.00 11.85 ? 101 ASP B N   1 
ATOM   2550 C CA  . ASP B 1 101 ? -24.483 6.345  36.555 1.00 10.34 ? 101 ASP B CA  1 
ATOM   2551 C C   . ASP B 1 101 ? -24.239 7.709  35.974 1.00 10.00 ? 101 ASP B C   1 
ATOM   2552 O O   . ASP B 1 101 ? -24.863 8.669  36.399 1.00 8.88  ? 101 ASP B O   1 
ATOM   2553 C CB  . ASP B 1 101 ? -25.166 6.408  37.922 1.00 11.34 ? 101 ASP B CB  1 
ATOM   2554 C CG  . ASP B 1 101 ? -24.237 6.887  39.038 1.00 12.22 ? 101 ASP B CG  1 
ATOM   2555 O OD1 . ASP B 1 101 ? -23.166 7.485  38.769 1.00 10.56 ? 101 ASP B OD1 1 
ATOM   2556 O OD2 . ASP B 1 101 ? -24.593 6.635  40.210 1.00 14.24 ? 101 ASP B OD2 1 
ATOM   2557 N N   . TRP B 1 102 ? -23.399 7.782  34.930 1.00 10.22 ? 102 TRP B N   1 
ATOM   2558 C CA  . TRP B 1 102 ? -23.039 9.085  34.361 1.00 9.77  ? 102 TRP B CA  1 
ATOM   2559 C C   . TRP B 1 102 ? -24.171 9.980  33.825 1.00 9.50  ? 102 TRP B C   1 
ATOM   2560 O O   . TRP B 1 102 ? -24.056 11.221 33.856 1.00 8.96  ? 102 TRP B O   1 
ATOM   2561 C CB  . TRP B 1 102 ? -21.915 8.954  33.339 1.00 9.49  ? 102 TRP B CB  1 
ATOM   2562 C CG  . TRP B 1 102 ? -22.387 8.393  32.071 1.00 10.97 ? 102 TRP B CG  1 
ATOM   2563 C CD1 . TRP B 1 102 ? -22.473 7.078  31.755 1.00 11.30 ? 102 TRP B CD1 1 
ATOM   2564 C CD2 . TRP B 1 102 ? -22.965 9.114  30.981 1.00 11.62 ? 102 TRP B CD2 1 
ATOM   2565 N NE1 . TRP B 1 102 ? -23.086 6.929  30.550 1.00 13.03 ? 102 TRP B NE1 1 
ATOM   2566 C CE2 . TRP B 1 102 ? -23.399 8.167  30.047 1.00 13.06 ? 102 TRP B CE2 1 
ATOM   2567 C CE3 . TRP B 1 102 ? -23.170 10.475 30.710 1.00 12.25 ? 102 TRP B CE3 1 
ATOM   2568 C CZ2 . TRP B 1 102 ? -24.034 8.530  28.848 1.00 13.41 ? 102 TRP B CZ2 1 
ATOM   2569 C CZ3 . TRP B 1 102 ? -23.799 10.833 29.521 1.00 13.28 ? 102 TRP B CZ3 1 
ATOM   2570 C CH2 . TRP B 1 102 ? -24.224 9.862  28.606 1.00 11.63 ? 102 TRP B CH2 1 
ATOM   2571 N N   . GLU B 1 103 ? -25.268 9.383  33.360 1.00 9.16  ? 103 GLU B N   1 
ATOM   2572 C CA  . GLU B 1 103 ? -26.379 10.191 32.849 1.00 9.59  ? 103 GLU B CA  1 
ATOM   2573 C C   . GLU B 1 103 ? -26.934 11.129 33.900 1.00 7.99  ? 103 GLU B C   1 
ATOM   2574 O O   . GLU B 1 103 ? -27.477 12.190 33.558 1.00 6.84  ? 103 GLU B O   1 
ATOM   2575 C CB  . GLU B 1 103 ? -27.493 9.320  32.294 1.00 13.13 ? 103 GLU B CB  1 
ATOM   2576 C CG  . GLU B 1 103 ? -27.044 8.476  31.113 1.00 19.31 ? 103 GLU B CG  1 
ATOM   2577 C CD  . GLU B 1 103 ? -26.826 6.979  31.507 1.00 25.52 ? 103 GLU B CD  1 
ATOM   2578 O OE1 . GLU B 1 103 ? -26.365 6.692  32.684 1.00 26.05 ? 103 GLU B OE1 1 
ATOM   2579 O OE2 . GLU B 1 103 ? -27.139 6.096  30.633 1.00 27.28 ? 103 GLU B OE2 1 
ATOM   2580 N N   . SER B 1 104 ? -26.736 10.782 35.174 1.00 6.89  ? 104 SER B N   1 
ATOM   2581 C CA  . SER B 1 104 ? -27.210 11.636 36.289 1.00 6.95  ? 104 SER B CA  1 
ATOM   2582 C C   . SER B 1 104 ? -26.494 13.011 36.342 1.00 5.89  ? 104 SER B C   1 
ATOM   2583 O O   . SER B 1 104 ? -26.970 13.942 36.982 1.00 5.55  ? 104 SER B O   1 
ATOM   2584 C CB  . SER B 1 104 ? -27.117 10.904 37.638 1.00 7.25  ? 104 SER B CB  1 
ATOM   2585 O OG  . SER B 1 104 ? -25.772 10.794 38.095 1.00 9.13  ? 104 SER B OG  1 
ATOM   2586 N N   . LEU B 1 105 ? -25.362 13.143 35.649 1.00 5.12  ? 105 LEU B N   1 
ATOM   2587 C CA  . LEU B 1 105 ? -24.648 14.418 35.588 1.00 4.96  ? 105 LEU B CA  1 
ATOM   2588 C C   . LEU B 1 105 ? -25.488 15.400 34.784 1.00 4.93  ? 105 LEU B C   1 
ATOM   2589 O O   . LEU B 1 105 ? -25.318 16.621 34.883 1.00 4.87  ? 105 LEU B O   1 
ATOM   2590 C CB  . LEU B 1 105 ? -23.281 14.225 34.904 1.00 5.57  ? 105 LEU B CB  1 
ATOM   2591 C CG  . LEU B 1 105 ? -22.260 13.453 35.767 1.00 5.62  ? 105 LEU B CG  1 
ATOM   2592 C CD1 . LEU B 1 105 ? -21.122 12.931 34.924 1.00 3.93  ? 105 LEU B CD1 1 
ATOM   2593 C CD2 . LEU B 1 105 ? -21.734 14.382 36.859 1.00 5.75  ? 105 LEU B CD2 1 
ATOM   2594 N N   . ASN B 1 106 ? -26.383 14.873 33.956 1.00 5.30  ? 106 ASN B N   1 
ATOM   2595 C CA  . ASN B 1 106 ? -27.256 15.740 33.150 1.00 5.91  ? 106 ASN B CA  1 
ATOM   2596 C C   . ASN B 1 106 ? -28.684 15.876 33.684 1.00 6.04  ? 106 ASN B C   1 
ATOM   2597 O O   . ASN B 1 106 ? -29.582 16.384 32.979 1.00 6.72  ? 106 ASN B O   1 
ATOM   2598 C CB  . ASN B 1 106 ? -27.220 15.331 31.666 1.00 6.39  ? 106 ASN B CB  1 
ATOM   2599 C CG  . ASN B 1 106 ? -25.791 15.414 31.082 1.00 6.83  ? 106 ASN B CG  1 
ATOM   2600 O OD1 . ASN B 1 106 ? -25.094 16.372 31.328 1.00 6.94  ? 106 ASN B OD1 1 
ATOM   2601 N ND2 . ASN B 1 106 ? -25.362 14.397 30.367 1.00 5.97  ? 106 ASN B ND2 1 
ATOM   2602 N N   . TYR B 1 107 ? -28.905 15.376 34.905 1.00 5.55  ? 107 TYR B N   1 
ATOM   2603 C CA  . TYR B 1 107 ? -30.198 15.519 35.579 1.00 4.97  ? 107 TYR B CA  1 
ATOM   2604 C C   . TYR B 1 107 ? -30.243 16.976 36.016 1.00 5.26  ? 107 TYR B C   1 
ATOM   2605 O O   . TYR B 1 107 ? -29.226 17.509 36.477 1.00 5.14  ? 107 TYR B O   1 
ATOM   2606 C CB  . TYR B 1 107 ? -30.267 14.617 36.808 1.00 5.30  ? 107 TYR B CB  1 
ATOM   2607 C CG  . TYR B 1 107 ? -30.488 13.169 36.516 1.00 5.09  ? 107 TYR B CG  1 
ATOM   2608 C CD1 . TYR B 1 107 ? -30.655 12.711 35.206 1.00 7.06  ? 107 TYR B CD1 1 
ATOM   2609 C CD2 . TYR B 1 107 ? -30.501 12.250 37.543 1.00 5.33  ? 107 TYR B CD2 1 
ATOM   2610 C CE1 . TYR B 1 107 ? -30.821 11.350 34.937 1.00 7.80  ? 107 TYR B CE1 1 
ATOM   2611 C CE2 . TYR B 1 107 ? -30.667 10.896 37.301 1.00 7.17  ? 107 TYR B CE2 1 
ATOM   2612 C CZ  . TYR B 1 107 ? -30.826 10.448 35.998 1.00 8.20  ? 107 TYR B CZ  1 
ATOM   2613 O OH  . TYR B 1 107 ? -30.975 9.096  35.775 1.00 9.10  ? 107 TYR B OH  1 
ATOM   2614 N N   . LEU B 1 108 ? -31.407 17.618 35.953 1.00 4.70  ? 108 LEU B N   1 
ATOM   2615 C CA  . LEU B 1 108 ? -31.448 19.022 36.291 1.00 3.92  ? 108 LEU B CA  1 
ATOM   2616 C C   . LEU B 1 108 ? -31.192 19.368 37.748 1.00 3.11  ? 108 LEU B C   1 
ATOM   2617 O O   . LEU B 1 108 ? -30.936 20.512 38.066 1.00 3.08  ? 108 LEU B O   1 
ATOM   2618 C CB  . LEU B 1 108 ? -32.680 19.714 35.709 1.00 5.26  ? 108 LEU B CB  1 
ATOM   2619 C CG  . LEU B 1 108 ? -32.730 19.662 34.170 1.00 7.01  ? 108 LEU B CG  1 
ATOM   2620 C CD1 . LEU B 1 108 ? -33.946 20.398 33.709 1.00 8.38  ? 108 LEU B CD1 1 
ATOM   2621 C CD2 . LEU B 1 108 ? -31.564 20.303 33.521 1.00 7.55  ? 108 LEU B CD2 1 
ATOM   2622 N N   . SER B 1 109 ? -31.193 18.397 38.638 1.00 2.60  ? 109 SER B N   1 
ATOM   2623 C CA  . SER B 1 109 ? -30.806 18.721 40.002 1.00 3.52  ? 109 SER B CA  1 
ATOM   2624 C C   . SER B 1 109 ? -29.280 19.108 40.038 1.00 4.55  ? 109 SER B C   1 
ATOM   2625 O O   . SER B 1 109 ? -28.815 19.769 40.969 1.00 5.16  ? 109 SER B O   1 
ATOM   2626 C CB  . SER B 1 109 ? -30.981 17.496 40.836 1.00 2.00  ? 109 SER B CB  1 
ATOM   2627 O OG  . SER B 1 109 ? -30.441 16.424 40.119 1.00 2.18  ? 109 SER B OG  1 
ATOM   2628 N N   . ASN B 1 110 ? -28.511 18.707 39.018 1.00 4.69  ? 110 ASN B N   1 
ATOM   2629 C CA  . ASN B 1 110 ? -27.065 18.990 38.953 1.00 5.58  ? 110 ASN B CA  1 
ATOM   2630 C C   . ASN B 1 110 ? -26.739 20.188 38.046 1.00 5.94  ? 110 ASN B C   1 
ATOM   2631 O O   . ASN B 1 110 ? -25.582 20.438 37.729 1.00 6.93  ? 110 ASN B O   1 
ATOM   2632 C CB  . ASN B 1 110 ? -26.306 17.744 38.449 1.00 4.46  ? 110 ASN B CB  1 
ATOM   2633 C CG  . ASN B 1 110 ? -24.793 17.941 38.450 1.00 6.46  ? 110 ASN B CG  1 
ATOM   2634 O OD1 . ASN B 1 110 ? -24.224 18.395 39.444 1.00 5.28  ? 110 ASN B OD1 1 
ATOM   2635 N ND2 . ASN B 1 110 ? -24.140 17.657 37.315 1.00 5.02  ? 110 ASN B ND2 1 
ATOM   2636 N N   . ILE B 1 111 ? -27.767 20.943 37.675 1.00 5.64  ? 111 ILE B N   1 
ATOM   2637 C CA  . ILE B 1 111 ? -27.664 22.085 36.790 1.00 5.82  ? 111 ILE B CA  1 
ATOM   2638 C C   . ILE B 1 111 ? -28.311 23.334 37.422 1.00 6.24  ? 111 ILE B C   1 
ATOM   2639 O O   . ILE B 1 111 ? -29.205 23.223 38.266 1.00 6.64  ? 111 ILE B O   1 
ATOM   2640 C CB  . ILE B 1 111 ? -28.477 21.771 35.495 1.00 6.41  ? 111 ILE B CB  1 
ATOM   2641 C CG1 . ILE B 1 111 ? -27.993 20.461 34.859 1.00 7.42  ? 111 ILE B CG1 1 
ATOM   2642 C CG2 . ILE B 1 111 ? -28.428 22.944 34.502 1.00 7.13  ? 111 ILE B CG2 1 
ATOM   2643 C CD1 . ILE B 1 111 ? -26.598 20.549 34.280 1.00 8.59  ? 111 ILE B CD1 1 
ATOM   2644 N N   . THR B 1 112 ? -27.840 24.519 37.026 1.00 6.57  ? 112 THR B N   1 
ATOM   2645 C CA  . THR B 1 112 ? -28.414 25.798 37.451 1.00 6.64  ? 112 THR B CA  1 
ATOM   2646 C C   . THR B 1 112 ? -28.233 26.727 36.254 1.00 6.76  ? 112 THR B C   1 
ATOM   2647 O O   . THR B 1 112 ? -27.455 26.417 35.343 1.00 6.82  ? 112 THR B O   1 
ATOM   2648 C CB  . THR B 1 112 ? -27.674 26.463 38.641 1.00 7.20  ? 112 THR B CB  1 
ATOM   2649 O OG1 . THR B 1 112 ? -26.458 27.035 38.169 1.00 8.93  ? 112 THR B OG1 1 
ATOM   2650 C CG2 . THR B 1 112 ? -27.376 25.485 39.761 1.00 5.92  ? 112 THR B CG2 1 
ATOM   2651 N N   . PRO B 1 113 ? -28.991 27.846 36.202 1.00 7.67  ? 113 PRO B N   1 
ATOM   2652 C CA  . PRO B 1 113 ? -28.895 28.821 35.108 1.00 7.44  ? 113 PRO B CA  1 
ATOM   2653 C C   . PRO B 1 113 ? -27.689 29.696 35.429 1.00 8.08  ? 113 PRO B C   1 
ATOM   2654 O O   . PRO B 1 113 ? -27.769 30.572 36.278 1.00 9.41  ? 113 PRO B O   1 
ATOM   2655 C CB  . PRO B 1 113 ? -30.182 29.641 35.251 1.00 7.28  ? 113 PRO B CB  1 
ATOM   2656 C CG  . PRO B 1 113 ? -31.005 28.894 36.264 1.00 8.03  ? 113 PRO B CG  1 
ATOM   2657 C CD  . PRO B 1 113 ? -30.019 28.271 37.162 1.00 7.36  ? 113 PRO B CD  1 
ATOM   2658 N N   . GLN B 1 114 ? -26.566 29.414 34.788 1.00 8.19  ? 114 GLN B N   1 
ATOM   2659 C CA  . GLN B 1 114 ? -25.340 30.132 35.001 1.00 8.25  ? 114 GLN B CA  1 
ATOM   2660 C C   . GLN B 1 114 ? -25.072 31.096 33.837 1.00 9.17  ? 114 GLN B C   1 
ATOM   2661 O O   . GLN B 1 114 ? -25.216 30.713 32.678 1.00 8.87  ? 114 GLN B O   1 
ATOM   2662 C CB  . GLN B 1 114 ? -24.243 29.073 35.108 1.00 9.27  ? 114 GLN B CB  1 
ATOM   2663 C CG  . GLN B 1 114 ? -22.912 29.590 35.566 1.00 10.48 ? 114 GLN B CG  1 
ATOM   2664 C CD  . GLN B 1 114 ? -21.973 28.444 35.902 1.00 9.95  ? 114 GLN B CD  1 
ATOM   2665 O OE1 . GLN B 1 114 ? -21.692 28.167 37.076 1.00 13.23 ? 114 GLN B OE1 1 
ATOM   2666 N NE2 . GLN B 1 114 ? -21.572 27.724 34.905 1.00 8.00  ? 114 GLN B NE2 1 
ATOM   2667 N N   . LYS B 1 115 ? -24.746 32.362 34.114 1.00 10.04 ? 115 LYS B N   1 
ATOM   2668 C CA  . LYS B 1 115 ? -24.444 33.314 33.032 1.00 10.91 ? 115 LYS B CA  1 
ATOM   2669 C C   . LYS B 1 115 ? -23.423 32.670 32.077 1.00 11.93 ? 115 LYS B C   1 
ATOM   2670 O O   . LYS B 1 115 ? -22.481 31.991 32.532 1.00 12.62 ? 115 LYS B O   1 
ATOM   2671 C CB  . LYS B 1 115 ? -23.885 34.600 33.611 1.00 9.81  ? 115 LYS B CB  1 
ATOM   2672 C CG  . LYS B 1 115 ? -24.878 35.354 34.416 1.00 10.64 ? 115 LYS B CG  1 
ATOM   2673 C CD  . LYS B 1 115 ? -25.971 35.936 33.536 1.00 12.95 ? 115 LYS B CD  1 
ATOM   2674 C CE  . LYS B 1 115 ? -26.979 36.741 34.404 1.00 15.63 ? 115 LYS B CE  1 
ATOM   2675 N NZ  . LYS B 1 115 ? -28.134 37.398 33.653 1.00 17.29 ? 115 LYS B NZ  1 
ATOM   2676 N N   . SER B 1 116 ? -23.647 32.798 30.765 1.00 12.54 ? 116 SER B N   1 
ATOM   2677 C CA  . SER B 1 116 ? -22.749 32.198 29.748 1.00 13.33 ? 116 SER B CA  1 
ATOM   2678 C C   . SER B 1 116 ? -21.292 32.632 29.880 1.00 12.43 ? 116 SER B C   1 
ATOM   2679 O O   . SER B 1 116 ? -20.391 31.841 29.639 1.00 12.63 ? 116 SER B O   1 
ATOM   2680 C CB  . SER B 1 116 ? -23.215 32.561 28.325 1.00 14.16 ? 116 SER B CB  1 
ATOM   2681 O OG  . SER B 1 116 ? -24.596 32.335 28.203 1.00 18.90 ? 116 SER B OG  1 
ATOM   2682 N N   . ASP B 1 117 ? -21.071 33.904 30.193 1.00 12.36 ? 117 ASP B N   1 
ATOM   2683 C CA  . ASP B 1 117 ? -19.716 34.431 30.330 1.00 12.50 ? 117 ASP B CA  1 
ATOM   2684 C C   . ASP B 1 117 ? -18.965 33.757 31.440 1.00 12.17 ? 117 ASP B C   1 
ATOM   2685 O O   . ASP B 1 117 ? -17.777 33.478 31.306 1.00 12.74 ? 117 ASP B O   1 
ATOM   2686 C CB  . ASP B 1 117 ? -19.722 35.943 30.517 1.00 13.99 ? 117 ASP B CB  1 
ATOM   2687 C CG  . ASP B 1 117 ? -20.051 36.693 29.218 1.00 17.54 ? 117 ASP B CG  1 
ATOM   2688 O OD1 . ASP B 1 117 ? -19.989 36.104 28.110 1.00 18.06 ? 117 ASP B OD1 1 
ATOM   2689 O OD2 . ASP B 1 117 ? -20.384 37.881 29.309 1.00 19.74 ? 117 ASP B OD2 1 
ATOM   2690 N N   . LEU B 1 118 ? -19.648 33.499 32.542 1.00 11.02 ? 118 LEU B N   1 
ATOM   2691 C CA  . LEU B 1 118 ? -19.017 32.788 33.648 1.00 11.23 ? 118 LEU B CA  1 
ATOM   2692 C C   . LEU B 1 118 ? -18.824 31.314 33.215 1.00 11.60 ? 118 LEU B C   1 
ATOM   2693 O O   . LEU B 1 118 ? -17.707 30.750 33.265 1.00 11.13 ? 118 LEU B O   1 
ATOM   2694 C CB  . LEU B 1 118 ? -19.905 32.850 34.928 1.00 9.02  ? 118 LEU B CB  1 
ATOM   2695 C CG  . LEU B 1 118 ? -19.438 31.988 36.112 1.00 8.20  ? 118 LEU B CG  1 
ATOM   2696 C CD1 . LEU B 1 118 ? -18.022 32.394 36.532 1.00 8.22  ? 118 LEU B CD1 1 
ATOM   2697 C CD2 . LEU B 1 118 ? -20.431 32.074 37.293 1.00 6.90  ? 118 LEU B CD2 1 
ATOM   2698 N N   . ASN B 1 119 ? -19.921 30.708 32.771 1.00 11.65 ? 119 ASN B N   1 
ATOM   2699 C CA  . ASN B 1 119 ? -19.918 29.302 32.394 1.00 13.23 ? 119 ASN B CA  1 
ATOM   2700 C C   . ASN B 1 119 ? -18.862 28.942 31.384 1.00 13.68 ? 119 ASN B C   1 
ATOM   2701 O O   . ASN B 1 119 ? -18.178 27.919 31.513 1.00 13.46 ? 119 ASN B O   1 
ATOM   2702 C CB  . ASN B 1 119 ? -21.284 28.907 31.840 1.00 14.81 ? 119 ASN B CB  1 
ATOM   2703 C CG  . ASN B 1 119 ? -21.328 27.468 31.404 1.00 15.87 ? 119 ASN B CG  1 
ATOM   2704 O OD1 . ASN B 1 119 ? -21.300 26.560 32.227 1.00 18.80 ? 119 ASN B OD1 1 
ATOM   2705 N ND2 . ASN B 1 119 ? -21.394 27.249 30.118 1.00 16.50 ? 119 ASN B ND2 1 
ATOM   2706 N N   . GLN B 1 120 ? -18.774 29.780 30.362 1.00 13.86 ? 120 GLN B N   1 
ATOM   2707 C CA  . GLN B 1 120 ? -17.854 29.570 29.285 1.00 15.16 ? 120 GLN B CA  1 
ATOM   2708 C C   . GLN B 1 120 ? -16.486 30.193 29.489 1.00 13.83 ? 120 GLN B C   1 
ATOM   2709 O O   . GLN B 1 120 ? -15.585 29.933 28.712 1.00 13.92 ? 120 GLN B O   1 
ATOM   2710 C CB  . GLN B 1 120 ? -18.500 30.021 27.979 1.00 17.87 ? 120 GLN B CB  1 
ATOM   2711 C CG  . GLN B 1 120 ? -19.614 29.059 27.531 1.00 23.29 ? 120 GLN B CG  1 
ATOM   2712 C CD  . GLN B 1 120 ? -20.557 29.700 26.502 1.00 29.07 ? 120 GLN B CD  1 
ATOM   2713 O OE1 . GLN B 1 120 ? -20.302 30.831 26.008 1.00 32.51 ? 120 GLN B OE1 1 
ATOM   2714 N NE2 . GLN B 1 120 ? -21.672 29.008 26.194 1.00 30.36 ? 120 GLN B NE2 1 
ATOM   2715 N N   . GLY B 1 121 ? -16.313 30.922 30.588 1.00 12.37 ? 121 GLY B N   1 
ATOM   2716 C CA  . GLY B 1 121 ? -15.035 31.564 30.881 1.00 10.40 ? 121 GLY B CA  1 
ATOM   2717 C C   . GLY B 1 121 ? -14.292 30.983 32.079 1.00 8.43  ? 121 GLY B C   1 
ATOM   2718 O O   . GLY B 1 121 ? -13.819 29.866 32.044 1.00 7.88  ? 121 GLY B O   1 
ATOM   2719 N N   . ALA B 1 122 ? -14.203 31.740 33.152 1.00 8.23  ? 122 ALA B N   1 
ATOM   2720 C CA  . ALA B 1 122 ? -13.475 31.298 34.350 1.00 8.64  ? 122 ALA B CA  1 
ATOM   2721 C C   . ALA B 1 122 ? -13.911 29.950 34.924 1.00 8.95  ? 122 ALA B C   1 
ATOM   2722 O O   . ALA B 1 122 ? -13.078 29.150 35.350 1.00 9.33  ? 122 ALA B O   1 
ATOM   2723 C CB  . ALA B 1 122 ? -13.559 32.360 35.419 1.00 8.93  ? 122 ALA B CB  1 
ATOM   2724 N N   . TRP B 1 123 ? -15.217 29.693 34.919 1.00 9.12  ? 123 TRP B N   1 
ATOM   2725 C CA  . TRP B 1 123 ? -15.743 28.449 35.437 1.00 8.46  ? 123 TRP B CA  1 
ATOM   2726 C C   . TRP B 1 123 ? -15.240 27.226 34.643 1.00 8.91  ? 123 TRP B C   1 
ATOM   2727 O O   . TRP B 1 123 ? -14.898 26.200 35.255 1.00 8.43  ? 123 TRP B O   1 
ATOM   2728 C CB  . TRP B 1 123 ? -17.281 28.482 35.476 1.00 8.13  ? 123 TRP B CB  1 
ATOM   2729 C CG  . TRP B 1 123 ? -17.889 27.331 36.286 1.00 8.09  ? 123 TRP B CG  1 
ATOM   2730 C CD1 . TRP B 1 123 ? -18.438 26.174 35.794 1.00 6.72  ? 123 TRP B CD1 1 
ATOM   2731 C CD2 . TRP B 1 123 ? -17.975 27.239 37.720 1.00 6.70  ? 123 TRP B CD2 1 
ATOM   2732 N NE1 . TRP B 1 123 ? -18.861 25.385 36.834 1.00 7.44  ? 123 TRP B NE1 1 
ATOM   2733 C CE2 . TRP B 1 123 ? -18.589 26.014 38.023 1.00 6.48  ? 123 TRP B CE2 1 
ATOM   2734 C CE3 . TRP B 1 123 ? -17.595 28.084 38.775 1.00 6.48  ? 123 TRP B CE3 1 
ATOM   2735 C CZ2 . TRP B 1 123 ? -18.840 25.602 39.349 1.00 6.47  ? 123 TRP B CZ2 1 
ATOM   2736 C CZ3 . TRP B 1 123 ? -17.843 27.669 40.087 1.00 5.89  ? 123 TRP B CZ3 1 
ATOM   2737 C CH2 . TRP B 1 123 ? -18.459 26.443 40.357 1.00 5.82  ? 123 TRP B CH2 1 
ATOM   2738 N N   . ALA B 1 124 ? -15.291 27.295 33.303 1.00 8.54  ? 124 ALA B N   1 
ATOM   2739 C CA  . ALA B 1 124 ? -14.825 26.208 32.443 1.00 8.42  ? 124 ALA B CA  1 
ATOM   2740 C C   . ALA B 1 124 ? -13.306 26.028 32.628 1.00 9.09  ? 124 ALA B C   1 
ATOM   2741 O O   . ALA B 1 124 ? -12.795 24.904 32.674 1.00 9.10  ? 124 ALA B O   1 
ATOM   2742 C CB  . ALA B 1 124 ? -15.126 26.540 30.993 1.00 7.61  ? 124 ALA B CB  1 
ATOM   2743 N N   . ARG B 1 125 ? -12.594 27.148 32.703 1.00 9.97  ? 125 ARG B N   1 
ATOM   2744 C CA  . ARG B 1 125 ? -11.152 27.117 32.906 1.00 11.66 ? 125 ARG B CA  1 
ATOM   2745 C C   . ARG B 1 125 ? -10.798 26.423 34.237 1.00 10.85 ? 125 ARG B C   1 
ATOM   2746 O O   . ARG B 1 125 ? -9.862  25.617 34.293 1.00 10.56 ? 125 ARG B O   1 
ATOM   2747 C CB  . ARG B 1 125 ? -10.582 28.524 32.848 1.00 15.23 ? 125 ARG B CB  1 
ATOM   2748 C CG  . ARG B 1 125 ? -9.910  28.874 31.531 1.00 21.35 ? 125 ARG B CG  1 
ATOM   2749 C CD  . ARG B 1 125 ? -10.711 29.823 30.660 1.00 25.61 ? 125 ARG B CD  1 
ATOM   2750 N NE  . ARG B 1 125 ? -10.930 31.171 31.211 1.00 29.29 ? 125 ARG B NE  1 
ATOM   2751 C CZ  . ARG B 1 125 ? -11.561 32.156 30.543 1.00 29.81 ? 125 ARG B CZ  1 
ATOM   2752 N NH1 . ARG B 1 125 ? -12.017 31.931 29.304 1.00 30.31 ? 125 ARG B NH1 1 
ATOM   2753 N NH2 . ARG B 1 125 ? -11.807 33.332 31.134 1.00 28.59 ? 125 ARG B NH2 1 
ATOM   2754 N N   . LEU B 1 126 ? -11.546 26.713 35.301 1.00 9.24  ? 126 LEU B N   1 
ATOM   2755 C CA  . LEU B 1 126 ? -11.289 26.040 36.576 1.00 8.70  ? 126 LEU B CA  1 
ATOM   2756 C C   . LEU B 1 126 ? -11.633 24.551 36.437 1.00 8.63  ? 126 LEU B C   1 
ATOM   2757 O O   . LEU B 1 126 ? -10.875 23.676 36.899 1.00 8.33  ? 126 LEU B O   1 
ATOM   2758 C CB  . LEU B 1 126 ? -12.059 26.709 37.726 1.00 8.09  ? 126 LEU B CB  1 
ATOM   2759 C CG  . LEU B 1 126 ? -12.027 26.052 39.106 1.00 9.12  ? 126 LEU B CG  1 
ATOM   2760 C CD1 . LEU B 1 126 ? -10.623 25.830 39.637 1.00 7.05  ? 126 LEU B CD1 1 
ATOM   2761 C CD2 . LEU B 1 126 ? -12.779 26.963 40.047 1.00 8.99  ? 126 LEU B CD2 1 
ATOM   2762 N N   . GLU B 1 127 ? -12.743 24.225 35.777 1.00 8.04  ? 127 GLU B N   1 
ATOM   2763 C CA  . GLU B 1 127 ? -13.029 22.815 35.575 1.00 8.77  ? 127 GLU B CA  1 
ATOM   2764 C C   . GLU B 1 127 ? -11.851 22.108 34.859 1.00 9.19  ? 127 GLU B C   1 
ATOM   2765 O O   . GLU B 1 127 ? -11.467 20.995 35.242 1.00 8.78  ? 127 GLU B O   1 
ATOM   2766 C CB  . GLU B 1 127 ? -14.313 22.614 34.772 1.00 9.67  ? 127 GLU B CB  1 
ATOM   2767 C CG  . GLU B 1 127 ? -15.582 22.780 35.604 1.00 11.73 ? 127 GLU B CG  1 
ATOM   2768 C CD  . GLU B 1 127 ? -16.857 22.703 34.773 1.00 14.41 ? 127 GLU B CD  1 
ATOM   2769 O OE1 . GLU B 1 127 ? -16.765 22.833 33.528 1.00 17.46 ? 127 GLU B OE1 1 
ATOM   2770 O OE2 . GLU B 1 127 ? -17.958 22.530 35.351 1.00 14.55 ? 127 GLU B OE2 1 
ATOM   2771 N N   . ASP B 1 128 ? -11.307 22.723 33.809 1.00 10.05 ? 128 ASP B N   1 
ATOM   2772 C CA  . ASP B 1 128 ? -10.184 22.129 33.077 1.00 10.93 ? 128 ASP B CA  1 
ATOM   2773 C C   . ASP B 1 128 ? -8.973  21.882 34.008 1.00 10.32 ? 128 ASP B C   1 
ATOM   2774 O O   . ASP B 1 128 ? -8.433  20.797 34.060 1.00 9.38  ? 128 ASP B O   1 
ATOM   2775 C CB  . ASP B 1 128 ? -9.762  23.040 31.912 1.00 14.11 ? 128 ASP B CB  1 
ATOM   2776 C CG  . ASP B 1 128 ? -10.779 23.056 30.739 1.00 19.37 ? 128 ASP B CG  1 
ATOM   2777 O OD1 . ASP B 1 128 ? -11.673 22.170 30.655 1.00 22.57 ? 128 ASP B OD1 1 
ATOM   2778 O OD2 . ASP B 1 128 ? -10.677 23.956 29.856 1.00 21.95 ? 128 ASP B OD2 1 
ATOM   2779 N N   . GLN B 1 129 ? -8.608  22.870 34.811 1.00 10.85 ? 129 GLN B N   1 
ATOM   2780 C CA  . GLN B 1 129 ? -7.471  22.730 35.711 1.00 11.23 ? 129 GLN B CA  1 
ATOM   2781 C C   . GLN B 1 129 ? -7.697  21.736 36.820 1.00 10.81 ? 129 GLN B C   1 
ATOM   2782 O O   . GLN B 1 129 ? -6.772  21.040 37.225 1.00 9.77  ? 129 GLN B O   1 
ATOM   2783 C CB  . GLN B 1 129 ? -7.060  24.093 36.283 1.00 12.97 ? 129 GLN B CB  1 
ATOM   2784 C CG  . GLN B 1 129 ? -6.422  25.002 35.214 1.00 14.77 ? 129 GLN B CG  1 
ATOM   2785 C CD  . GLN B 1 129 ? -5.252  24.313 34.511 1.00 16.55 ? 129 GLN B CD  1 
ATOM   2786 O OE1 . GLN B 1 129 ? -4.406  23.666 35.146 1.00 17.25 ? 129 GLN B OE1 1 
ATOM   2787 N NE2 . GLN B 1 129 ? -5.222  24.413 33.197 1.00 18.28 ? 129 GLN B NE2 1 
ATOM   2788 N N   . GLU B 1 130 ? -8.927  21.669 37.309 1.00 10.31 ? 130 GLU B N   1 
ATOM   2789 C CA  . GLU B 1 130 ? -9.293  20.734 38.386 1.00 10.48 ? 130 GLU B CA  1 
ATOM   2790 C C   . GLU B 1 130 ? -9.148  19.279 37.891 1.00 10.76 ? 130 GLU B C   1 
ATOM   2791 O O   . GLU B 1 130 ? -8.640  18.388 38.593 1.00 9.80  ? 130 GLU B O   1 
ATOM   2792 C CB  . GLU B 1 130 ? -10.737 21.054 38.816 1.00 9.93  ? 130 GLU B CB  1 
ATOM   2793 C CG  . GLU B 1 130 ? -11.407 20.091 39.747 1.00 8.92  ? 130 GLU B CG  1 
ATOM   2794 C CD  . GLU B 1 130 ? -12.927 20.393 39.907 1.00 9.89  ? 130 GLU B CD  1 
ATOM   2795 O OE1 . GLU B 1 130 ? -13.584 20.976 38.992 1.00 7.86  ? 130 GLU B OE1 1 
ATOM   2796 O OE2 . GLU B 1 130 ? -13.471 20.016 40.963 1.00 8.99  ? 130 GLU B OE2 1 
ATOM   2797 N N   . ARG B 1 131 ? -9.564  19.066 36.646 1.00 11.66 ? 131 ARG B N   1 
ATOM   2798 C CA  . ARG B 1 131 ? -9.496  17.761 36.016 1.00 13.39 ? 131 ARG B CA  1 
ATOM   2799 C C   . ARG B 1 131 ? -8.016  17.373 35.739 1.00 13.82 ? 131 ARG B C   1 
ATOM   2800 O O   . ARG B 1 131 ? -7.614  16.220 35.942 1.00 14.38 ? 131 ARG B O   1 
ATOM   2801 C CB  . ARG B 1 131 ? -10.315 17.816 34.715 1.00 15.52 ? 131 ARG B CB  1 
ATOM   2802 C CG  . ARG B 1 131 ? -10.407 16.490 33.949 1.00 19.74 ? 131 ARG B CG  1 
ATOM   2803 C CD  . ARG B 1 131 ? -11.435 16.582 32.857 1.00 22.92 ? 131 ARG B CD  1 
ATOM   2804 N NE  . ARG B 1 131 ? -11.482 17.906 32.204 1.00 27.39 ? 131 ARG B NE  1 
ATOM   2805 C CZ  . ARG B 1 131 ? -12.517 18.766 32.265 1.00 28.81 ? 131 ARG B CZ  1 
ATOM   2806 N NH1 . ARG B 1 131 ? -13.623 18.489 32.970 1.00 28.20 ? 131 ARG B NH1 1 
ATOM   2807 N NH2 . ARG B 1 131 ? -12.504 19.865 31.510 1.00 29.38 ? 131 ARG B NH2 1 
ATOM   2808 N N   . LYS B 1 132 ? -7.200  18.343 35.321 1.00 13.22 ? 132 LYS B N   1 
ATOM   2809 C CA  . LYS B 1 132 ? -5.801  18.074 35.030 1.00 13.44 ? 132 LYS B CA  1 
ATOM   2810 C C   . LYS B 1 132 ? -5.000  17.648 36.237 1.00 12.97 ? 132 LYS B C   1 
ATOM   2811 O O   . LYS B 1 132 ? -4.004  16.959 36.089 1.00 13.67 ? 132 LYS B O   1 
ATOM   2812 C CB  . LYS B 1 132 ? -5.152  19.271 34.379 1.00 14.89 ? 132 LYS B CB  1 
ATOM   2813 C CG  . LYS B 1 132 ? -5.553  19.414 32.945 1.00 19.68 ? 132 LYS B CG  1 
ATOM   2814 C CD  . LYS B 1 132 ? -5.015  20.705 32.359 1.00 24.13 ? 132 LYS B CD  1 
ATOM   2815 C CE  . LYS B 1 132 ? -5.159  20.715 30.838 1.00 27.51 ? 132 LYS B CE  1 
ATOM   2816 N NZ  . LYS B 1 132 ? -4.794  22.068 30.266 1.00 30.89 ? 132 LYS B NZ  1 
ATOM   2817 N N   . LEU B 1 133 ? -5.472  17.971 37.438 1.00 12.46 ? 133 LEU B N   1 
ATOM   2818 C CA  . LEU B 1 133 ? -4.752  17.591 38.662 1.00 11.65 ? 133 LEU B CA  1 
ATOM   2819 C C   . LEU B 1 133 ? -4.576  16.093 38.726 1.00 12.15 ? 133 LEU B C   1 
ATOM   2820 O O   . LEU B 1 133 ? -3.521  15.602 39.128 1.00 11.01 ? 133 LEU B O   1 
ATOM   2821 C CB  . LEU B 1 133 ? -5.497  18.039 39.917 1.00 9.83  ? 133 LEU B CB  1 
ATOM   2822 C CG  . LEU B 1 133 ? -5.465  19.534 40.203 1.00 10.35 ? 133 LEU B CG  1 
ATOM   2823 C CD1 . LEU B 1 133 ? -6.454  19.804 41.336 1.00 9.01  ? 133 LEU B CD1 1 
ATOM   2824 C CD2 . LEU B 1 133 ? -4.022  20.014 40.558 1.00 8.82  ? 133 LEU B CD2 1 
ATOM   2825 N N   . ILE B 1 134 ? -5.604  15.371 38.284 1.00 12.98 ? 134 ILE B N   1 
ATOM   2826 C CA  . ILE B 1 134 ? -5.582  13.917 38.334 1.00 13.74 ? 134 ILE B CA  1 
ATOM   2827 C C   . ILE B 1 134 ? -4.541  13.289 37.394 1.00 15.35 ? 134 ILE B C   1 
ATOM   2828 O O   . ILE B 1 134 ? -4.273  12.091 37.472 1.00 15.58 ? 134 ILE B O   1 
ATOM   2829 C CB  . ILE B 1 134 ? -7.002  13.343 38.099 1.00 13.25 ? 134 ILE B CB  1 
ATOM   2830 C CG1 . ILE B 1 134 ? -7.173  12.043 38.882 1.00 12.63 ? 134 ILE B CG1 1 
ATOM   2831 C CG2 . ILE B 1 134 ? -7.270  13.156 36.622 1.00 12.75 ? 134 ILE B CG2 1 
ATOM   2832 C CD1 . ILE B 1 134 ? -6.980  12.239 40.333 1.00 11.96 ? 134 ILE B CD1 1 
ATOM   2833 N N   . ASP B 1 135 ? -3.956  14.096 36.511 1.00 16.77 ? 135 ASP B N   1 
ATOM   2834 C CA  . ASP B 1 135 ? -2.923  13.603 35.618 1.00 18.79 ? 135 ASP B CA  1 
ATOM   2835 C C   . ASP B 1 135 ? -1.585  13.596 36.327 1.00 19.18 ? 135 ASP B C   1 
ATOM   2836 O O   . ASP B 1 135 ? -0.631  13.032 35.821 1.00 19.94 ? 135 ASP B O   1 
ATOM   2837 C CB  . ASP B 1 135 ? -2.791  14.483 34.376 1.00 21.07 ? 135 ASP B CB  1 
ATOM   2838 C CG  . ASP B 1 135 ? -4.002  14.403 33.473 1.00 23.80 ? 135 ASP B CG  1 
ATOM   2839 O OD1 . ASP B 1 135 ? -4.750  13.393 33.537 1.00 23.88 ? 135 ASP B OD1 1 
ATOM   2840 O OD2 . ASP B 1 135 ? -4.202  15.368 32.699 1.00 26.39 ? 135 ASP B OD2 1 
ATOM   2841 N N   . ARG B 1 136 ? -1.463  14.312 37.433 1.00 18.68 ? 136 ARG B N   1 
ATOM   2842 C CA  . ARG B 1 136 ? -0.189  14.308 38.141 1.00 18.42 ? 136 ARG B CA  1 
ATOM   2843 C C   . ARG B 1 136 ? -0.025  12.922 38.739 1.00 18.50 ? 136 ARG B C   1 
ATOM   2844 O O   . ARG B 1 136 ? -0.972  12.331 39.272 1.00 17.60 ? 136 ARG B O   1 
ATOM   2845 C CB  . ARG B 1 136 ? -0.107  15.405 39.210 1.00 18.69 ? 136 ARG B CB  1 
ATOM   2846 C CG  . ARG B 1 136 ? -0.147  16.808 38.628 1.00 19.81 ? 136 ARG B CG  1 
ATOM   2847 C CD  . ARG B 1 136 ? 0.040   17.871 39.681 1.00 21.64 ? 136 ARG B CD  1 
ATOM   2848 N NE  . ARG B 1 136 ? 0.128   19.215 39.083 1.00 24.51 ? 136 ARG B NE  1 
ATOM   2849 C CZ  . ARG B 1 136 ? 1.270   19.807 38.687 1.00 25.65 ? 136 ARG B CZ  1 
ATOM   2850 N NH1 . ARG B 1 136 ? 2.461   19.188 38.803 1.00 24.71 ? 136 ARG B NH1 1 
ATOM   2851 N NH2 . ARG B 1 136 ? 1.233   21.055 38.224 1.00 25.10 ? 136 ARG B NH2 1 
ATOM   2852 N N   . ALA B 1 137 ? 1.201   12.425 38.665 1.00 18.28 ? 137 ALA B N   1 
ATOM   2853 C CA  . ALA B 1 137 ? 1.527   11.084 39.122 1.00 18.75 ? 137 ALA B CA  1 
ATOM   2854 C C   . ALA B 1 137 ? 1.221   10.813 40.578 1.00 18.40 ? 137 ALA B C   1 
ATOM   2855 O O   . ALA B 1 137 ? 0.711   9.743  40.927 1.00 19.09 ? 137 ALA B O   1 
ATOM   2856 C CB  . ALA B 1 137 ? 2.998   10.775 38.835 1.00 20.17 ? 137 ALA B CB  1 
ATOM   2857 N N   . ASP B 1 138 ? 1.514   11.790 41.420 1.00 16.81 ? 138 ASP B N   1 
ATOM   2858 C CA  . ASP B 1 138 ? 1.278   11.631 42.837 1.00 16.04 ? 138 ASP B CA  1 
ATOM   2859 C C   . ASP B 1 138 ? -0.104  12.069 43.319 1.00 14.07 ? 138 ASP B C   1 
ATOM   2860 O O   . ASP B 1 138 ? -0.391  12.042 44.498 1.00 13.22 ? 138 ASP B O   1 
ATOM   2861 C CB  . ASP B 1 138 ? 2.382   12.339 43.613 1.00 18.27 ? 138 ASP B CB  1 
ATOM   2862 C CG  . ASP B 1 138 ? 2.644   13.743 43.109 1.00 21.40 ? 138 ASP B CG  1 
ATOM   2863 O OD1 . ASP B 1 138 ? 1.959   14.206 42.168 1.00 22.03 ? 138 ASP B OD1 1 
ATOM   2864 O OD2 . ASP B 1 138 ? 3.560   14.388 43.670 1.00 24.42 ? 138 ASP B OD2 1 
ATOM   2865 N N   . ILE B 1 139 ? -0.952  12.516 42.416 1.00 12.73 ? 139 ILE B N   1 
ATOM   2866 C CA  . ILE B 1 139 ? -2.290  12.924 42.831 1.00 11.81 ? 139 ILE B CA  1 
ATOM   2867 C C   . ILE B 1 139 ? -3.270  11.819 42.444 1.00 11.39 ? 139 ILE B C   1 
ATOM   2868 O O   . ILE B 1 139 ? -3.467  11.554 41.261 1.00 11.32 ? 139 ILE B O   1 
ATOM   2869 C CB  . ILE B 1 139 ? -2.687  14.282 42.209 1.00 11.40 ? 139 ILE B CB  1 
ATOM   2870 C CG1 . ILE B 1 139 ? -1.825  15.404 42.832 1.00 9.12  ? 139 ILE B CG1 1 
ATOM   2871 C CG2 . ILE B 1 139 ? -4.228  14.516 42.393 1.00 10.35 ? 139 ILE B CG2 1 
ATOM   2872 C CD1 . ILE B 1 139 ? -2.136  16.823 42.294 1.00 8.98  ? 139 ILE B CD1 1 
ATOM   2873 N N   . SER B 1 140 ? -3.847  11.140 43.431 1.00 10.21 ? 140 SER B N   1 
ATOM   2874 C CA  . SER B 1 140 ? -4.756  10.065 43.121 1.00 10.05 ? 140 SER B CA  1 
ATOM   2875 C C   . SER B 1 140 ? -6.244  10.367 43.286 1.00 9.60  ? 140 SER B C   1 
ATOM   2876 O O   . SER B 1 140 ? -7.056  9.582  42.848 1.00 10.43 ? 140 SER B O   1 
ATOM   2877 C CB  . SER B 1 140 ? -4.377  8.830  43.898 1.00 10.59 ? 140 SER B CB  1 
ATOM   2878 O OG  . SER B 1 140 ? -4.389  9.113  45.274 1.00 15.19 ? 140 SER B OG  1 
ATOM   2879 N N   . SER B 1 141 ? -6.603  11.494 43.882 1.00 7.80  ? 141 SER B N   1 
ATOM   2880 C CA  . SER B 1 141 ? -8.016  11.857 44.049 1.00 6.81  ? 141 SER B CA  1 
ATOM   2881 C C   . SER B 1 141 ? -8.142  13.334 44.124 1.00 6.11  ? 141 SER B C   1 
ATOM   2882 O O   . SER B 1 141 ? -7.230  13.997 44.576 1.00 5.74  ? 141 SER B O   1 
ATOM   2883 C CB  . SER B 1 141 ? -8.577  11.384 45.395 1.00 6.04  ? 141 SER B CB  1 
ATOM   2884 O OG  . SER B 1 141 ? -8.805  10.002 45.409 1.00 7.62  ? 141 SER B OG  1 
ATOM   2885 N N   . VAL B 1 142 ? -9.279  13.847 43.661 1.00 5.76  ? 142 VAL B N   1 
ATOM   2886 C CA  . VAL B 1 142 ? -9.602  15.241 43.817 1.00 4.65  ? 142 VAL B CA  1 
ATOM   2887 C C   . VAL B 1 142 ? -11.012 15.194 44.428 1.00 5.17  ? 142 VAL B C   1 
ATOM   2888 O O   . VAL B 1 142 ? -11.911 14.512 43.885 1.00 5.32  ? 142 VAL B O   1 
ATOM   2889 C CB  . VAL B 1 142 ? -9.642  16.023 42.505 1.00 4.97  ? 142 VAL B CB  1 
ATOM   2890 C CG1 . VAL B 1 142 ? -10.013 17.458 42.815 1.00 3.04  ? 142 VAL B CG1 1 
ATOM   2891 C CG2 . VAL B 1 142 ? -8.233  15.964 41.763 1.00 4.79  ? 142 VAL B CG2 1 
ATOM   2892 N N   . TYR B 1 143 ? -11.164 15.772 45.618 1.00 4.93  ? 143 TYR B N   1 
ATOM   2893 C CA  . TYR B 1 143 ? -12.462 15.834 46.286 1.00 4.56  ? 143 TYR B CA  1 
ATOM   2894 C C   . TYR B 1 143 ? -12.915 17.251 46.236 1.00 4.48  ? 143 TYR B C   1 
ATOM   2895 O O   . TYR B 1 143 ? -12.250 18.139 46.781 1.00 4.85  ? 143 TYR B O   1 
ATOM   2896 C CB  . TYR B 1 143 ? -12.379 15.428 47.736 1.00 4.74  ? 143 TYR B CB  1 
ATOM   2897 C CG  . TYR B 1 143 ? -12.219 13.955 47.899 1.00 5.22  ? 143 TYR B CG  1 
ATOM   2898 C CD1 . TYR B 1 143 ? -13.340 13.128 47.981 1.00 5.35  ? 143 TYR B CD1 1 
ATOM   2899 C CD2 . TYR B 1 143 ? -10.944 13.381 47.983 1.00 4.78  ? 143 TYR B CD2 1 
ATOM   2900 C CE1 . TYR B 1 143 ? -13.204 11.745 48.148 1.00 6.93  ? 143 TYR B CE1 1 
ATOM   2901 C CE2 . TYR B 1 143 ? -10.792 12.025 48.155 1.00 5.72  ? 143 TYR B CE2 1 
ATOM   2902 C CZ  . TYR B 1 143 ? -11.919 11.207 48.240 1.00 6.96  ? 143 TYR B CZ  1 
ATOM   2903 O OH  . TYR B 1 143 ? -11.766 9.861  48.444 1.00 8.44  ? 143 TYR B OH  1 
ATOM   2904 N N   . THR B 1 144 ? -14.054 17.461 45.594 1.00 3.64  ? 144 THR B N   1 
ATOM   2905 C CA  . THR B 1 144 ? -14.611 18.780 45.469 1.00 3.36  ? 144 THR B CA  1 
ATOM   2906 C C   . THR B 1 144 ? -16.043 18.903 46.012 1.00 3.84  ? 144 THR B C   1 
ATOM   2907 O O   . THR B 1 144 ? -16.796 17.930 46.034 1.00 4.02  ? 144 THR B O   1 
ATOM   2908 C CB  . THR B 1 144 ? -14.568 19.203 43.983 1.00 3.11  ? 144 THR B CB  1 
ATOM   2909 O OG1 . THR B 1 144 ? -13.195 19.201 43.545 1.00 3.68  ? 144 THR B OG1 1 
ATOM   2910 C CG2 . THR B 1 144 ? -15.174 20.595 43.776 1.00 2.00  ? 144 THR B CG2 1 
ATOM   2911 N N   . VAL B 1 145 ? -16.359 20.079 46.560 1.00 4.62  ? 145 VAL B N   1 
ATOM   2912 C CA  . VAL B 1 145 ? -17.705 20.396 47.005 1.00 4.00  ? 145 VAL B CA  1 
ATOM   2913 C C   . VAL B 1 145 ? -17.965 21.720 46.305 1.00 3.70  ? 145 VAL B C   1 
ATOM   2914 O O   . VAL B 1 145 ? -17.119 22.627 46.337 1.00 2.88  ? 145 VAL B O   1 
ATOM   2915 C CB  . VAL B 1 145 ? -17.856 20.638 48.526 1.00 5.00  ? 145 VAL B CB  1 
ATOM   2916 C CG1 . VAL B 1 145 ? -19.330 20.804 48.840 1.00 4.40  ? 145 VAL B CG1 1 
ATOM   2917 C CG2 . VAL B 1 145 ? -17.344 19.457 49.323 1.00 3.68  ? 145 VAL B CG2 1 
ATOM   2918 N N   . THR B 1 146 ? -19.114 21.817 45.633 1.00 3.59  ? 146 THR B N   1 
ATOM   2919 C CA  . THR B 1 146 ? -19.476 23.021 44.913 1.00 3.25  ? 146 THR B CA  1 
ATOM   2920 C C   . THR B 1 146 ? -20.942 23.381 45.174 1.00 3.77  ? 146 THR B C   1 
ATOM   2921 O O   . THR B 1 146 ? -21.730 22.526 45.588 1.00 3.74  ? 146 THR B O   1 
ATOM   2922 C CB  . THR B 1 146 ? -19.192 22.837 43.411 1.00 2.44  ? 146 THR B CB  1 
ATOM   2923 O OG1 . THR B 1 146 ? -19.327 24.086 42.723 1.00 3.60  ? 146 THR B OG1 1 
ATOM   2924 C CG2 . THR B 1 146 ? -20.079 21.792 42.813 1.00 2.98  ? 146 THR B CG2 1 
ATOM   2925 N N   . GLY B 1 147 ? -21.286 24.659 45.017 1.00 4.19  ? 147 GLY B N   1 
ATOM   2926 C CA  . GLY B 1 147 ? -22.659 25.059 45.223 1.00 4.10  ? 147 GLY B CA  1 
ATOM   2927 C C   . GLY B 1 147 ? -22.891 26.510 44.858 1.00 5.10  ? 147 GLY B C   1 
ATOM   2928 O O   . GLY B 1 147 ? -21.969 27.227 44.476 1.00 5.29  ? 147 GLY B O   1 
ATOM   2929 N N   . PRO B 1 148 ? -24.136 26.983 44.984 1.00 6.12  ? 148 PRO B N   1 
ATOM   2930 C CA  . PRO B 1 148 ? -24.457 28.356 44.663 1.00 6.30  ? 148 PRO B CA  1 
ATOM   2931 C C   . PRO B 1 148 ? -24.604 29.157 45.918 1.00 7.51  ? 148 PRO B C   1 
ATOM   2932 O O   . PRO B 1 148 ? -24.558 28.633 47.024 1.00 7.82  ? 148 PRO B O   1 
ATOM   2933 C CB  . PRO B 1 148 ? -25.788 28.214 43.982 1.00 6.68  ? 148 PRO B CB  1 
ATOM   2934 C CG  . PRO B 1 148 ? -26.473 27.191 44.893 1.00 7.57  ? 148 PRO B CG  1 
ATOM   2935 C CD  . PRO B 1 148 ? -25.360 26.173 45.155 1.00 6.09  ? 148 PRO B CD  1 
ATOM   2936 N N   . LEU B 1 149 ? -24.801 30.443 45.710 1.00 9.07  ? 149 LEU B N   1 
ATOM   2937 C CA  . LEU B 1 149 ? -24.993 31.445 46.739 1.00 10.29 ? 149 LEU B CA  1 
ATOM   2938 C C   . LEU B 1 149 ? -26.168 32.241 46.260 1.00 9.46  ? 149 LEU B C   1 
ATOM   2939 O O   . LEU B 1 149 ? -26.324 32.454 45.077 1.00 8.79  ? 149 LEU B O   1 
ATOM   2940 C CB  . LEU B 1 149 ? -23.817 32.429 46.793 1.00 12.85 ? 149 LEU B CB  1 
ATOM   2941 C CG  . LEU B 1 149 ? -22.600 32.136 47.632 1.00 14.40 ? 149 LEU B CG  1 
ATOM   2942 C CD1 . LEU B 1 149 ? -21.715 33.372 47.659 1.00 15.83 ? 149 LEU B CD1 1 
ATOM   2943 C CD2 . LEU B 1 149 ? -23.069 31.834 49.013 1.00 17.24 ? 149 LEU B CD2 1 
ATOM   2944 N N   . TYR B 1 150 ? -26.884 32.829 47.195 1.00 10.58 ? 150 TYR B N   1 
ATOM   2945 C CA  . TYR B 1 150 ? -28.054 33.623 46.863 1.00 11.90 ? 150 TYR B CA  1 
ATOM   2946 C C   . TYR B 1 150 ? -27.946 34.967 47.548 1.00 13.34 ? 150 TYR B C   1 
ATOM   2947 O O   . TYR B 1 150 ? -28.386 35.118 48.674 1.00 14.60 ? 150 TYR B O   1 
ATOM   2948 C CB  . TYR B 1 150 ? -29.306 32.876 47.346 1.00 10.58 ? 150 TYR B CB  1 
ATOM   2949 C CG  . TYR B 1 150 ? -29.447 31.542 46.686 1.00 8.83  ? 150 TYR B CG  1 
ATOM   2950 C CD1 . TYR B 1 150 ? -29.997 31.431 45.412 1.00 8.31  ? 150 TYR B CD1 1 
ATOM   2951 C CD2 . TYR B 1 150 ? -29.021 30.387 47.327 1.00 8.21  ? 150 TYR B CD2 1 
ATOM   2952 C CE1 . TYR B 1 150 ? -30.124 30.193 44.798 1.00 7.38  ? 150 TYR B CE1 1 
ATOM   2953 C CE2 . TYR B 1 150 ? -29.144 29.150 46.719 1.00 7.17  ? 150 TYR B CE2 1 
ATOM   2954 C CZ  . TYR B 1 150 ? -29.698 29.067 45.455 1.00 7.23  ? 150 TYR B CZ  1 
ATOM   2955 O OH  . TYR B 1 150 ? -29.836 27.828 44.870 1.00 8.03  ? 150 TYR B OH  1 
ATOM   2956 N N   . GLU B 1 151 ? -27.372 35.947 46.875 1.00 14.22 ? 151 GLU B N   1 
ATOM   2957 C CA  . GLU B 1 151 ? -27.222 37.220 47.508 1.00 15.98 ? 151 GLU B CA  1 
ATOM   2958 C C   . GLU B 1 151 ? -28.044 38.359 46.952 1.00 16.30 ? 151 GLU B C   1 
ATOM   2959 O O   . GLU B 1 151 ? -28.426 39.248 47.691 1.00 16.92 ? 151 GLU B O   1 
ATOM   2960 C CB  . GLU B 1 151 ? -25.753 37.544 47.646 1.00 17.52 ? 151 GLU B CB  1 
ATOM   2961 C CG  . GLU B 1 151 ? -25.165 36.497 48.597 1.00 23.68 ? 151 GLU B CG  1 
ATOM   2962 C CD  . GLU B 1 151 ? -23.675 36.614 48.790 1.00 25.43 ? 151 GLU B CD  1 
ATOM   2963 O OE1 . GLU B 1 151 ? -22.969 36.679 47.754 1.00 28.57 ? 151 GLU B OE1 1 
ATOM   2964 O OE2 . GLU B 1 151 ? -23.233 36.615 49.959 1.00 24.07 ? 151 GLU B OE2 1 
ATOM   2965 N N   . ARG B 1 152 ? -28.360 38.320 45.673 1.00 17.25 ? 152 ARG B N   1 
ATOM   2966 C CA  . ARG B 1 152 ? -29.177 39.366 45.097 1.00 18.03 ? 152 ARG B CA  1 
ATOM   2967 C C   . ARG B 1 152 ? -30.123 38.760 44.078 1.00 18.17 ? 152 ARG B C   1 
ATOM   2968 O O   . ARG B 1 152 ? -29.861 37.672 43.541 1.00 17.82 ? 152 ARG B O   1 
ATOM   2969 C CB  . ARG B 1 152 ? -28.315 40.458 44.459 1.00 19.01 ? 152 ARG B CB  1 
ATOM   2970 C CG  . ARG B 1 152 ? -27.561 40.022 43.274 1.00 19.47 ? 152 ARG B CG  1 
ATOM   2971 C CD  . ARG B 1 152 ? -26.693 41.135 42.736 1.00 20.67 ? 152 ARG B CD  1 
ATOM   2972 N NE  . ARG B 1 152 ? -26.109 40.671 41.475 1.00 23.44 ? 152 ARG B NE  1 
ATOM   2973 C CZ  . ARG B 1 152 ? -24.973 39.977 41.389 1.00 23.09 ? 152 ARG B CZ  1 
ATOM   2974 N NH1 . ARG B 1 152 ? -24.295 39.709 42.486 1.00 21.94 ? 152 ARG B NH1 1 
ATOM   2975 N NH2 . ARG B 1 152 ? -24.614 39.420 40.237 1.00 23.60 ? 152 ARG B NH2 1 
ATOM   2976 N N   . ASP B 1 153 ? -31.228 39.463 43.842 1.00 17.86 ? 153 ASP B N   1 
ATOM   2977 C CA  . ASP B 1 153 ? -32.254 39.030 42.906 1.00 17.77 ? 153 ASP B CA  1 
ATOM   2978 C C   . ASP B 1 153 ? -31.653 38.944 41.530 1.00 16.88 ? 153 ASP B C   1 
ATOM   2979 O O   . ASP B 1 153 ? -31.109 39.912 41.034 1.00 16.02 ? 153 ASP B O   1 
ATOM   2980 C CB  . ASP B 1 153 ? -33.423 40.022 42.925 1.00 20.86 ? 153 ASP B CB  1 
ATOM   2981 C CG  . ASP B 1 153 ? -34.517 39.690 41.890 1.00 23.52 ? 153 ASP B CG  1 
ATOM   2982 O OD1 . ASP B 1 153 ? -34.814 38.491 41.610 1.00 25.01 ? 153 ASP B OD1 1 
ATOM   2983 O OD2 . ASP B 1 153 ? -35.073 40.671 41.347 1.00 26.73 ? 153 ASP B OD2 1 
ATOM   2984 N N   . MET B 1 154 ? -31.768 37.789 40.900 1.00 15.78 ? 154 MET B N   1 
ATOM   2985 C CA  . MET B 1 154 ? -31.214 37.635 39.576 1.00 15.58 ? 154 MET B CA  1 
ATOM   2986 C C   . MET B 1 154 ? -32.314 37.531 38.524 1.00 15.95 ? 154 MET B C   1 
ATOM   2987 O O   . MET B 1 154 ? -32.028 37.322 37.362 1.00 16.75 ? 154 MET B O   1 
ATOM   2988 C CB  . MET B 1 154 ? -30.326 36.400 39.530 1.00 15.52 ? 154 MET B CB  1 
ATOM   2989 C CG  . MET B 1 154 ? -29.065 36.509 40.392 1.00 16.01 ? 154 MET B CG  1 
ATOM   2990 S SD  . MET B 1 154 ? -27.886 37.678 39.720 1.00 17.21 ? 154 MET B SD  1 
ATOM   2991 C CE  . MET B 1 154 ? -27.567 36.945 38.155 1.00 17.24 ? 154 MET B CE  1 
ATOM   2992 N N   . GLY B 1 155 ? -33.569 37.726 38.912 1.00 15.50 ? 155 GLY B N   1 
ATOM   2993 C CA  . GLY B 1 155 ? -34.638 37.613 37.939 1.00 15.09 ? 155 GLY B CA  1 
ATOM   2994 C C   . GLY B 1 155 ? -35.245 36.221 38.004 1.00 14.79 ? 155 GLY B C   1 
ATOM   2995 O O   . GLY B 1 155 ? -34.966 35.475 38.929 1.00 14.68 ? 155 GLY B O   1 
ATOM   2996 N N   . LYS B 1 156 ? -36.041 35.848 37.014 1.00 14.23 ? 156 LYS B N   1 
ATOM   2997 C CA  . LYS B 1 156 ? -36.685 34.546 37.004 1.00 13.12 ? 156 LYS B CA  1 
ATOM   2998 C C   . LYS B 1 156 ? -36.582 33.923 35.617 1.00 12.09 ? 156 LYS B C   1 
ATOM   2999 O O   . LYS B 1 156 ? -36.462 34.618 34.608 1.00 10.23 ? 156 LYS B O   1 
ATOM   3000 C CB  . LYS B 1 156 ? -38.174 34.704 37.355 1.00 15.09 ? 156 LYS B CB  1 
ATOM   3001 C CG  . LYS B 1 156 ? -38.486 35.138 38.794 1.00 19.40 ? 156 LYS B CG  1 
ATOM   3002 C CD  . LYS B 1 156 ? -37.683 34.275 39.823 1.00 22.13 ? 156 LYS B CD  1 
ATOM   3003 C CE  . LYS B 1 156 ? -38.056 34.564 41.280 1.00 23.89 ? 156 LYS B CE  1 
ATOM   3004 N NZ  . LYS B 1 156 ? -36.954 34.299 42.322 1.00 25.71 ? 156 LYS B NZ  1 
ATOM   3005 N N   . LEU B 1 157 ? -36.621 32.598 35.566 1.00 11.47 ? 157 LEU B N   1 
ATOM   3006 C CA  . LEU B 1 157 ? -36.616 31.895 34.295 1.00 11.67 ? 157 LEU B CA  1 
ATOM   3007 C C   . LEU B 1 157 ? -37.985 32.230 33.652 1.00 12.80 ? 157 LEU B C   1 
ATOM   3008 O O   . LEU B 1 157 ? -39.034 32.087 34.294 1.00 12.57 ? 157 LEU B O   1 
ATOM   3009 C CB  . LEU B 1 157 ? -36.507 30.385 34.542 1.00 11.74 ? 157 LEU B CB  1 
ATOM   3010 C CG  . LEU B 1 157 ? -35.165 29.915 35.134 1.00 11.46 ? 157 LEU B CG  1 
ATOM   3011 C CD1 . LEU B 1 157 ? -35.203 28.434 35.435 1.00 9.72  ? 157 LEU B CD1 1 
ATOM   3012 C CD2 . LEU B 1 157 ? -34.079 30.241 34.124 1.00 11.13 ? 157 LEU B CD2 1 
ATOM   3013 N N   . PRO B 1 158 ? -37.994 32.658 32.380 1.00 13.75 ? 158 PRO B N   1 
ATOM   3014 C CA  . PRO B 1 158 ? -39.276 32.996 31.739 1.00 14.74 ? 158 PRO B CA  1 
ATOM   3015 C C   . PRO B 1 158 ? -40.145 31.815 31.347 1.00 15.46 ? 158 PRO B C   1 
ATOM   3016 O O   . PRO B 1 158 ? -41.332 31.970 31.131 1.00 16.63 ? 158 PRO B O   1 
ATOM   3017 C CB  . PRO B 1 158 ? -38.842 33.766 30.502 1.00 14.29 ? 158 PRO B CB  1 
ATOM   3018 C CG  . PRO B 1 158 ? -37.547 33.083 30.126 1.00 14.25 ? 158 PRO B CG  1 
ATOM   3019 C CD  . PRO B 1 158 ? -36.857 32.861 31.456 1.00 13.42 ? 158 PRO B CD  1 
ATOM   3020 N N   . GLY B 1 159 ? -39.577 30.627 31.263 1.00 15.86 ? 159 GLY B N   1 
ATOM   3021 C CA  . GLY B 1 159 ? -40.385 29.498 30.842 1.00 15.35 ? 159 GLY B CA  1 
ATOM   3022 C C   . GLY B 1 159 ? -41.002 28.640 31.922 1.00 14.68 ? 159 GLY B C   1 
ATOM   3023 O O   . GLY B 1 159 ? -41.402 27.530 31.624 1.00 14.70 ? 159 GLY B O   1 
ATOM   3024 N N   . THR B 1 160 ? -41.101 29.125 33.156 1.00 14.52 ? 160 THR B N   1 
ATOM   3025 C CA  . THR B 1 160 ? -41.673 28.310 34.223 1.00 13.32 ? 160 THR B CA  1 
ATOM   3026 C C   . THR B 1 160 ? -42.509 29.128 35.174 1.00 13.83 ? 160 THR B C   1 
ATOM   3027 O O   . THR B 1 160 ? -42.272 30.320 35.346 1.00 13.38 ? 160 THR B O   1 
ATOM   3028 C CB  . THR B 1 160 ? -40.594 27.577 35.059 1.00 13.42 ? 160 THR B CB  1 
ATOM   3029 O OG1 . THR B 1 160 ? -41.235 26.630 35.936 1.00 12.80 ? 160 THR B OG1 1 
ATOM   3030 C CG2 . THR B 1 160 ? -39.786 28.553 35.911 1.00 11.43 ? 160 THR B CG2 1 
ATOM   3031 N N   . GLN B 1 161 ? -43.481 28.470 35.796 1.00 14.63 ? 161 GLN B N   1 
ATOM   3032 C CA  . GLN B 1 161 ? -44.352 29.123 36.761 1.00 16.26 ? 161 GLN B CA  1 
ATOM   3033 C C   . GLN B 1 161 ? -43.953 28.661 38.155 1.00 16.21 ? 161 GLN B C   1 
ATOM   3034 O O   . GLN B 1 161 ? -44.530 29.111 39.157 1.00 17.58 ? 161 GLN B O   1 
ATOM   3035 C CB  . GLN B 1 161 ? -45.834 28.808 36.480 1.00 17.60 ? 161 GLN B CB  1 
ATOM   3036 N N   . LYS B 1 162 ? -42.981 27.747 38.220 1.00 15.22 ? 162 LYS B N   1 
ATOM   3037 C CA  . LYS B 1 162 ? -42.482 27.280 39.515 1.00 14.10 ? 162 LYS B CA  1 
ATOM   3038 C C   . LYS B 1 162 ? -41.723 28.397 40.198 1.00 13.04 ? 162 LYS B C   1 
ATOM   3039 O O   . LYS B 1 162 ? -40.980 29.147 39.552 1.00 12.84 ? 162 LYS B O   1 
ATOM   3040 C CB  . LYS B 1 162 ? -41.483 26.153 39.358 1.00 14.35 ? 162 LYS B CB  1 
ATOM   3041 C CG  . LYS B 1 162 ? -42.060 24.828 39.120 1.00 15.73 ? 162 LYS B CG  1 
ATOM   3042 C CD  . LYS B 1 162 ? -40.917 23.870 39.008 1.00 16.01 ? 162 LYS B CD  1 
ATOM   3043 C CE  . LYS B 1 162 ? -41.380 22.474 38.705 1.00 16.09 ? 162 LYS B CE  1 
ATOM   3044 N NZ  . LYS B 1 162 ? -40.954 22.120 37.310 1.00 17.45 ? 162 LYS B NZ  1 
ATOM   3045 N N   . ALA B 1 163 ? -41.847 28.426 41.514 1.00 12.51 ? 163 ALA B N   1 
ATOM   3046 C CA  . ALA B 1 163 ? -41.141 29.364 42.366 1.00 13.01 ? 163 ALA B CA  1 
ATOM   3047 C C   . ALA B 1 163 ? -39.713 28.788 42.389 1.00 12.78 ? 163 ALA B C   1 
ATOM   3048 O O   . ALA B 1 163 ? -39.527 27.585 42.606 1.00 13.24 ? 163 ALA B O   1 
ATOM   3049 C CB  . ALA B 1 163 ? -41.737 29.317 43.774 1.00 12.75 ? 163 ALA B CB  1 
ATOM   3050 N N   . HIS B 1 164 ? -38.725 29.627 42.109 1.00 12.23 ? 164 HIS B N   1 
ATOM   3051 C CA  . HIS B 1 164 ? -37.315 29.202 42.095 1.00 11.33 ? 164 HIS B CA  1 
ATOM   3052 C C   . HIS B 1 164 ? -36.502 30.458 42.367 1.00 10.97 ? 164 HIS B C   1 
ATOM   3053 O O   . HIS B 1 164 ? -37.024 31.568 42.249 1.00 10.61 ? 164 HIS B O   1 
ATOM   3054 C CB  . HIS B 1 164 ? -36.946 28.629 40.717 1.00 10.03 ? 164 HIS B CB  1 
ATOM   3055 C CG  . HIS B 1 164 ? -37.087 29.618 39.605 1.00 10.39 ? 164 HIS B CG  1 
ATOM   3056 N ND1 . HIS B 1 164 ? -38.304 29.923 39.027 1.00 10.41 ? 164 HIS B ND1 1 
ATOM   3057 C CD2 . HIS B 1 164 ? -36.175 30.432 39.018 1.00 10.19 ? 164 HIS B CD2 1 
ATOM   3058 C CE1 . HIS B 1 164 ? -38.136 30.887 38.137 1.00 9.53  ? 164 HIS B CE1 1 
ATOM   3059 N NE2 . HIS B 1 164 ? -36.852 31.215 38.115 1.00 10.93 ? 164 HIS B NE2 1 
ATOM   3060 N N   . THR B 1 165 ? -35.248 30.294 42.755 1.00 10.31 ? 165 THR B N   1 
ATOM   3061 C CA  . THR B 1 165 ? -34.387 31.437 43.016 1.00 9.52  ? 165 THR B CA  1 
ATOM   3062 C C   . THR B 1 165 ? -33.088 31.204 42.277 1.00 9.28  ? 165 THR B C   1 
ATOM   3063 O O   . THR B 1 165 ? -32.376 30.237 42.550 1.00 8.31  ? 165 THR B O   1 
ATOM   3064 C CB  . THR B 1 165 ? -34.076 31.598 44.519 1.00 9.54  ? 165 THR B CB  1 
ATOM   3065 O OG1 . THR B 1 165 ? -35.294 31.645 45.249 1.00 10.61 ? 165 THR B OG1 1 
ATOM   3066 C CG2 . THR B 1 165 ? -33.338 32.889 44.783 1.00 8.84  ? 165 THR B CG2 1 
ATOM   3067 N N   . ILE B 1 166 ? -32.821 32.043 41.279 1.00 8.71  ? 166 ILE B N   1 
ATOM   3068 C CA  . ILE B 1 166 ? -31.576 31.925 40.519 1.00 8.69  ? 166 ILE B CA  1 
ATOM   3069 C C   . ILE B 1 166 ? -30.368 32.377 41.384 1.00 8.46  ? 166 ILE B C   1 
ATOM   3070 O O   . ILE B 1 166 ? -30.404 33.434 42.010 1.00 8.42  ? 166 ILE B O   1 
ATOM   3071 C CB  . ILE B 1 166 ? -31.648 32.752 39.204 1.00 8.13  ? 166 ILE B CB  1 
ATOM   3072 C CG1 . ILE B 1 166 ? -32.785 32.176 38.295 1.00 7.52  ? 166 ILE B CG1 1 
ATOM   3073 C CG2 . ILE B 1 166 ? -30.280 32.734 38.493 1.00 7.35  ? 166 ILE B CG2 1 
ATOM   3074 C CD1 . ILE B 1 166 ? -33.013 32.957 37.052 1.00 6.03  ? 166 ILE B CD1 1 
ATOM   3075 N N   . PRO B 1 167 ? -29.313 31.548 41.465 1.00 8.52  ? 167 PRO B N   1 
ATOM   3076 C CA  . PRO B 1 167 ? -28.115 31.882 42.256 1.00 8.09  ? 167 PRO B CA  1 
ATOM   3077 C C   . PRO B 1 167 ? -27.437 33.174 41.742 1.00 7.26  ? 167 PRO B C   1 
ATOM   3078 O O   . PRO B 1 167 ? -27.520 33.503 40.548 1.00 5.96  ? 167 PRO B O   1 
ATOM   3079 C CB  . PRO B 1 167 ? -27.184 30.678 41.992 1.00 8.29  ? 167 PRO B CB  1 
ATOM   3080 C CG  . PRO B 1 167 ? -28.121 29.563 41.579 1.00 8.32  ? 167 PRO B CG  1 
ATOM   3081 C CD  . PRO B 1 167 ? -29.153 30.253 40.766 1.00 8.77  ? 167 PRO B CD  1 
ATOM   3082 N N   . SER B 1 168 ? -26.762 33.891 42.640 1.00 6.86  ? 168 SER B N   1 
ATOM   3083 C CA  . SER B 1 168 ? -26.039 35.103 42.256 1.00 6.00  ? 168 SER B CA  1 
ATOM   3084 C C   . SER B 1 168 ? -24.525 34.816 42.196 1.00 6.62  ? 168 SER B C   1 
ATOM   3085 O O   . SER B 1 168 ? -23.753 35.625 41.672 1.00 6.51  ? 168 SER B O   1 
ATOM   3086 C CB  . SER B 1 168 ? -26.312 36.234 43.248 1.00 5.65  ? 168 SER B CB  1 
ATOM   3087 O OG  . SER B 1 168 ? -25.910 35.873 44.564 1.00 6.78  ? 168 SER B OG  1 
ATOM   3088 N N   . ALA B 1 169 ? -24.110 33.642 42.671 1.00 6.46  ? 169 ALA B N   1 
ATOM   3089 C CA  . ALA B 1 169 ? -22.689 33.292 42.700 1.00 5.84  ? 169 ALA B CA  1 
ATOM   3090 C C   . ALA B 1 169 ? -22.502 31.783 42.853 1.00 6.09  ? 169 ALA B C   1 
ATOM   3091 O O   . ALA B 1 169 ? -23.446 31.057 43.186 1.00 4.81  ? 169 ALA B O   1 
ATOM   3092 C CB  . ALA B 1 169 ? -22.007 34.017 43.873 1.00 5.64  ? 169 ALA B CB  1 
ATOM   3093 N N   . TYR B 1 170 ? -21.275 31.320 42.616 1.00 5.56  ? 170 TYR B N   1 
ATOM   3094 C CA  . TYR B 1 170 ? -20.963 29.905 42.711 1.00 6.26  ? 170 TYR B CA  1 
ATOM   3095 C C   . TYR B 1 170 ? -19.606 29.740 43.377 1.00 5.84  ? 170 TYR B C   1 
ATOM   3096 O O   . TYR B 1 170 ? -18.723 30.570 43.174 1.00 5.75  ? 170 TYR B O   1 
ATOM   3097 C CB  . TYR B 1 170 ? -20.923 29.280 41.303 1.00 6.46  ? 170 TYR B CB  1 
ATOM   3098 C CG  . TYR B 1 170 ? -22.259 29.317 40.573 1.00 6.43  ? 170 TYR B CG  1 
ATOM   3099 C CD1 . TYR B 1 170 ? -23.183 28.304 40.734 1.00 6.64  ? 170 TYR B CD1 1 
ATOM   3100 C CD2 . TYR B 1 170 ? -22.596 30.401 39.747 1.00 7.05  ? 170 TYR B CD2 1 
ATOM   3101 C CE1 . TYR B 1 170 ? -24.416 28.357 40.102 1.00 6.96  ? 170 TYR B CE1 1 
ATOM   3102 C CE2 . TYR B 1 170 ? -23.798 30.463 39.123 1.00 5.62  ? 170 TYR B CE2 1 
ATOM   3103 C CZ  . TYR B 1 170 ? -24.709 29.443 39.302 1.00 6.72  ? 170 TYR B CZ  1 
ATOM   3104 O OH  . TYR B 1 170 ? -25.938 29.542 38.709 1.00 8.18  ? 170 TYR B OH  1 
ATOM   3105 N N   . TRP B 1 171 ? -19.432 28.643 44.106 1.00 5.10  ? 171 TRP B N   1 
ATOM   3106 C CA  . TRP B 1 171 ? -18.196 28.392 44.814 1.00 5.23  ? 171 TRP B CA  1 
ATOM   3107 C C   . TRP B 1 171 ? -17.757 26.980 44.630 1.00 5.25  ? 171 TRP B C   1 
ATOM   3108 O O   . TRP B 1 171 ? -18.557 26.091 44.324 1.00 5.58  ? 171 TRP B O   1 
ATOM   3109 C CB  . TRP B 1 171 ? -18.317 28.720 46.328 1.00 4.23  ? 171 TRP B CB  1 
ATOM   3110 C CG  . TRP B 1 171 ? -19.511 28.115 46.985 1.00 3.67  ? 171 TRP B CG  1 
ATOM   3111 C CD1 . TRP B 1 171 ? -20.745 28.690 47.112 1.00 3.10  ? 171 TRP B CD1 1 
ATOM   3112 C CD2 . TRP B 1 171 ? -19.621 26.788 47.555 1.00 4.68  ? 171 TRP B CD2 1 
ATOM   3113 N NE1 . TRP B 1 171 ? -21.610 27.820 47.703 1.00 4.56  ? 171 TRP B NE1 1 
ATOM   3114 C CE2 . TRP B 1 171 ? -20.960 26.638 47.985 1.00 4.30  ? 171 TRP B CE2 1 
ATOM   3115 C CE3 . TRP B 1 171 ? -18.722 25.715 47.728 1.00 3.51  ? 171 TRP B CE3 1 
ATOM   3116 C CZ2 . TRP B 1 171 ? -21.435 25.456 48.576 1.00 3.06  ? 171 TRP B CZ2 1 
ATOM   3117 C CZ3 . TRP B 1 171 ? -19.187 24.539 48.311 1.00 4.19  ? 171 TRP B CZ3 1 
ATOM   3118 C CH2 . TRP B 1 171 ? -20.541 24.418 48.728 1.00 4.59  ? 171 TRP B CH2 1 
ATOM   3119 N N   . LYS B 1 172 ? -16.462 26.771 44.789 1.00 5.19  ? 172 LYS B N   1 
ATOM   3120 C CA  . LYS B 1 172 ? -15.911 25.448 44.647 1.00 5.26  ? 172 LYS B CA  1 
ATOM   3121 C C   . LYS B 1 172 ? -14.753 25.331 45.645 1.00 5.33  ? 172 LYS B C   1 
ATOM   3122 O O   . LYS B 1 172 ? -13.905 26.198 45.672 1.00 5.55  ? 172 LYS B O   1 
ATOM   3123 C CB  . LYS B 1 172 ? -15.453 25.245 43.204 1.00 5.94  ? 172 LYS B CB  1 
ATOM   3124 C CG  . LYS B 1 172 ? -15.078 23.821 42.867 1.00 7.36  ? 172 LYS B CG  1 
ATOM   3125 C CD  . LYS B 1 172 ? -14.802 23.624 41.364 1.00 7.65  ? 172 LYS B CD  1 
ATOM   3126 C CE  . LYS B 1 172 ? -16.062 23.232 40.585 1.00 6.96  ? 172 LYS B CE  1 
ATOM   3127 N NZ  . LYS B 1 172 ? -15.716 22.887 39.158 1.00 7.12  ? 172 LYS B NZ  1 
ATOM   3128 N N   . VAL B 1 173 ? -14.779 24.287 46.476 1.00 4.69  ? 173 VAL B N   1 
ATOM   3129 C CA  . VAL B 1 173 ? -13.771 23.993 47.505 1.00 4.09  ? 173 VAL B CA  1 
ATOM   3130 C C   . VAL B 1 173 ? -13.170 22.662 47.078 1.00 4.37  ? 173 VAL B C   1 
ATOM   3131 O O   . VAL B 1 173 ? -13.912 21.666 46.876 1.00 4.95  ? 173 VAL B O   1 
ATOM   3132 C CB  . VAL B 1 173 ? -14.438 23.859 48.893 1.00 4.01  ? 173 VAL B CB  1 
ATOM   3133 C CG1 . VAL B 1 173 ? -13.458 23.380 49.920 1.00 2.67  ? 173 VAL B CG1 1 
ATOM   3134 C CG2 . VAL B 1 173 ? -14.986 25.226 49.340 1.00 3.08  ? 173 VAL B CG2 1 
ATOM   3135 N N   . ILE B 1 174 ? -11.838 22.609 47.002 1.00 3.46  ? 174 ILE B N   1 
ATOM   3136 C CA  . ILE B 1 174 ? -11.152 21.427 46.482 1.00 3.68  ? 174 ILE B CA  1 
ATOM   3137 C C   . ILE B 1 174 ? -9.967  20.994 47.318 1.00 3.49  ? 174 ILE B C   1 
ATOM   3138 O O   . ILE B 1 174 ? -9.305  21.838 47.907 1.00 3.89  ? 174 ILE B O   1 
ATOM   3139 C CB  . ILE B 1 174 ? -10.567 21.767 45.055 1.00 3.73  ? 174 ILE B CB  1 
ATOM   3140 C CG1 . ILE B 1 174 ? -11.648 22.380 44.140 1.00 6.14  ? 174 ILE B CG1 1 
ATOM   3141 C CG2 . ILE B 1 174 ? -9.945  20.541 44.371 1.00 4.45  ? 174 ILE B CG2 1 
ATOM   3142 C CD1 . ILE B 1 174 ? -11.062 23.146 42.940 1.00 5.80  ? 174 ILE B CD1 1 
ATOM   3143 N N   . PHE B 1 175 ? -9.763  19.694 47.465 1.00 3.53  ? 175 PHE B N   1 
ATOM   3144 C CA  . PHE B 1 175 ? -8.530  19.230 48.107 1.00 4.58  ? 175 PHE B CA  1 
ATOM   3145 C C   . PHE B 1 175 ? -8.139  17.980 47.377 1.00 5.41  ? 175 PHE B C   1 
ATOM   3146 O O   . PHE B 1 175 ? -8.981  17.341 46.720 1.00 5.78  ? 175 PHE B O   1 
ATOM   3147 C CB  . PHE B 1 175 ? -8.600  19.013 49.645 1.00 4.11  ? 175 PHE B CB  1 
ATOM   3148 C CG  . PHE B 1 175 ? -9.466  17.850 50.088 1.00 3.94  ? 175 PHE B CG  1 
ATOM   3149 C CD1 . PHE B 1 175 ? -8.931  16.566 50.217 1.00 3.11  ? 175 PHE B CD1 1 
ATOM   3150 C CD2 . PHE B 1 175 ? -10.817 18.054 50.390 1.00 2.47  ? 175 PHE B CD2 1 
ATOM   3151 C CE1 . PHE B 1 175 ? -9.737  15.493 50.643 1.00 4.52  ? 175 PHE B CE1 1 
ATOM   3152 C CE2 . PHE B 1 175 ? -11.629 16.994 50.813 1.00 3.30  ? 175 PHE B CE2 1 
ATOM   3153 C CZ  . PHE B 1 175 ? -11.093 15.712 50.940 1.00 3.23  ? 175 PHE B CZ  1 
ATOM   3154 N N   . ILE B 1 176 ? -6.875  17.597 47.500 1.00 5.30  ? 176 ILE B N   1 
ATOM   3155 C CA  . ILE B 1 176 ? -6.402  16.415 46.820 1.00 5.52  ? 176 ILE B CA  1 
ATOM   3156 C C   . ILE B 1 176 ? -6.030  15.304 47.791 1.00 6.30  ? 176 ILE B C   1 
ATOM   3157 O O   . ILE B 1 176 ? -5.780  15.546 48.981 1.00 6.27  ? 176 ILE B O   1 
ATOM   3158 C CB  . ILE B 1 176 ? -5.168  16.726 45.957 1.00 5.73  ? 176 ILE B CB  1 
ATOM   3159 C CG1 . ILE B 1 176 ? -4.072  17.379 46.839 1.00 7.11  ? 176 ILE B CG1 1 
ATOM   3160 C CG2 . ILE B 1 176 ? -5.561  17.592 44.783 1.00 3.86  ? 176 ILE B CG2 1 
ATOM   3161 C CD1 . ILE B 1 176 ? -2.641  17.480 46.174 1.00 8.02  ? 176 ILE B CD1 1 
ATOM   3162 N N   . ASN B 1 177 ? -6.006  14.090 47.260 1.00 6.41  ? 177 ASN B N   1 
ATOM   3163 C CA  . ASN B 1 177 ? -5.630  12.889 47.984 1.00 8.04  ? 177 ASN B CA  1 
ATOM   3164 C C   . ASN B 1 177 ? -6.408  12.429 49.207 1.00 9.14  ? 177 ASN B C   1 
ATOM   3165 O O   . ASN B 1 177 ? -7.416  11.768 49.057 1.00 11.67 ? 177 ASN B O   1 
ATOM   3166 C CB  . ASN B 1 177 ? -4.109  12.832 48.240 1.00 7.21  ? 177 ASN B CB  1 
ATOM   3167 C CG  . ASN B 1 177 ? -3.323  12.714 46.951 1.00 9.26  ? 177 ASN B CG  1 
ATOM   3168 O OD1 . ASN B 1 177 ? -3.903  12.660 45.856 1.00 8.68  ? 177 ASN B OD1 1 
ATOM   3169 N ND2 . ASN B 1 177 ? -2.012  12.719 47.056 1.00 9.48  ? 177 ASN B ND2 1 
ATOM   3170 N N   . ASN B 1 178 ? -5.974  12.766 50.402 1.00 8.86  ? 178 ASN B N   1 
ATOM   3171 C CA  . ASN B 1 178 ? -6.631  12.250 51.568 1.00 9.38  ? 178 ASN B CA  1 
ATOM   3172 C C   . ASN B 1 178 ? -7.464  13.182 52.385 1.00 8.09  ? 178 ASN B C   1 
ATOM   3173 O O   . ASN B 1 178 ? -8.600  12.845 52.722 1.00 6.94  ? 178 ASN B O   1 
ATOM   3174 C CB  . ASN B 1 178 ? -5.594  11.647 52.493 1.00 11.83 ? 178 ASN B CB  1 
ATOM   3175 C CG  . ASN B 1 178 ? -4.775  10.603 51.801 1.00 16.44 ? 178 ASN B CG  1 
ATOM   3176 O OD1 . ASN B 1 178 ? -3.571  10.783 51.544 1.00 19.80 ? 178 ASN B OD1 1 
ATOM   3177 N ND2 . ASN B 1 178 ? -5.432  9.528  51.419 1.00 17.74 ? 178 ASN B ND2 1 
ATOM   3178 N N   . SER B 1 179 ? -6.910  14.346 52.707 1.00 6.41  ? 179 SER B N   1 
ATOM   3179 C CA  . SER B 1 179 ? -7.618  15.252 53.590 1.00 5.31  ? 179 SER B CA  1 
ATOM   3180 C C   . SER B 1 179 ? -6.947  16.587 53.634 1.00 5.20  ? 179 SER B C   1 
ATOM   3181 O O   . SER B 1 179 ? -5.726  16.667 53.580 1.00 4.59  ? 179 SER B O   1 
ATOM   3182 C CB  . SER B 1 179 ? -7.587  14.650 55.009 1.00 4.93  ? 179 SER B CB  1 
ATOM   3183 O OG  . SER B 1 179 ? -8.046  15.577 55.977 1.00 5.97  ? 179 SER B OG  1 
ATOM   3184 N N   . PRO B 1 180 ? -7.740  17.669 53.760 1.00 5.73  ? 180 PRO B N   1 
ATOM   3185 C CA  . PRO B 1 180 ? -7.153  19.010 53.830 1.00 5.91  ? 180 PRO B CA  1 
ATOM   3186 C C   . PRO B 1 180 ? -6.257  19.100 55.086 1.00 5.76  ? 180 PRO B C   1 
ATOM   3187 O O   . PRO B 1 180 ? -5.486  20.045 55.197 1.00 5.86  ? 180 PRO B O   1 
ATOM   3188 C CB  . PRO B 1 180 ? -8.377  19.931 54.015 1.00 5.28  ? 180 PRO B CB  1 
ATOM   3189 C CG  . PRO B 1 180 ? -9.503  19.127 53.597 1.00 5.58  ? 180 PRO B CG  1 
ATOM   3190 C CD  . PRO B 1 180 ? -9.209  17.724 53.891 1.00 4.94  ? 180 PRO B CD  1 
ATOM   3191 N N   . ALA B 1 181 ? -6.455  18.217 56.075 1.00 4.83  ? 181 ALA B N   1 
ATOM   3192 C CA  . ALA B 1 181 ? -5.629  18.236 57.290 1.00 5.29  ? 181 ALA B CA  1 
ATOM   3193 C C   . ALA B 1 181 ? -4.129  18.040 56.954 1.00 6.43  ? 181 ALA B C   1 
ATOM   3194 O O   . ALA B 1 181 ? -3.259  18.530 57.683 1.00 7.15  ? 181 ALA B O   1 
ATOM   3195 C CB  . ALA B 1 181 ? -6.075  17.139 58.259 1.00 3.78  ? 181 ALA B CB  1 
ATOM   3196 N N   . VAL B 1 182 ? -3.827  17.356 55.839 1.00 5.90  ? 182 VAL B N   1 
ATOM   3197 C CA  . VAL B 1 182 ? -2.439  17.086 55.461 1.00 4.59  ? 182 VAL B CA  1 
ATOM   3198 C C   . VAL B 1 182 ? -2.111  17.388 53.983 1.00 4.61  ? 182 VAL B C   1 
ATOM   3199 O O   . VAL B 1 182 ? -0.917  17.512 53.618 1.00 4.17  ? 182 VAL B O   1 
ATOM   3200 C CB  . VAL B 1 182 ? -2.064  15.580 55.782 1.00 5.12  ? 182 VAL B CB  1 
ATOM   3201 C CG1 . VAL B 1 182 ? -2.206  15.291 57.273 1.00 5.25  ? 182 VAL B CG1 1 
ATOM   3202 C CG2 . VAL B 1 182 ? -2.965  14.582 55.002 1.00 5.10  ? 182 VAL B CG2 1 
ATOM   3203 N N   . ASN B 1 183 ? -3.156  17.595 53.159 1.00 3.72  ? 183 ASN B N   1 
ATOM   3204 C CA  . ASN B 1 183 ? -3.006  17.813 51.699 1.00 3.48  ? 183 ASN B CA  1 
ATOM   3205 C C   . ASN B 1 183 ? -3.383  19.196 51.216 1.00 3.63  ? 183 ASN B C   1 
ATOM   3206 O O   . ASN B 1 183 ? -4.205  19.861 51.850 1.00 3.87  ? 183 ASN B O   1 
ATOM   3207 C CB  . ASN B 1 183 ? -3.872  16.808 50.919 1.00 2.99  ? 183 ASN B CB  1 
ATOM   3208 C CG  . ASN B 1 183 ? -3.389  15.370 51.071 1.00 3.90  ? 183 ASN B CG  1 
ATOM   3209 O OD1 . ASN B 1 183 ? -4.111  14.492 51.564 1.00 3.88  ? 183 ASN B OD1 1 
ATOM   3210 N ND2 . ASN B 1 183 ? -2.180  15.112 50.596 1.00 4.17  ? 183 ASN B ND2 1 
ATOM   3211 N N   . HIS B 1 184 ? -2.802  19.619 50.096 1.00 2.24  ? 184 HIS B N   1 
ATOM   3212 C CA  . HIS B 1 184 ? -3.093  20.934 49.542 1.00 3.00  ? 184 HIS B CA  1 
ATOM   3213 C C   . HIS B 1 184 ? -4.592  21.119 49.262 1.00 3.10  ? 184 HIS B C   1 
ATOM   3214 O O   . HIS B 1 184 ? -5.272  20.182 48.823 1.00 2.00  ? 184 HIS B O   1 
ATOM   3215 C CB  . HIS B 1 184 ? -2.319  21.167 48.238 1.00 3.53  ? 184 HIS B CB  1 
ATOM   3216 C CG  . HIS B 1 184 ? -0.828  21.062 48.372 1.00 5.53  ? 184 HIS B CG  1 
ATOM   3217 N ND1 . HIS B 1 184 ? -0.128  21.549 49.462 1.00 6.41  ? 184 HIS B ND1 1 
ATOM   3218 C CD2 . HIS B 1 184 ? 0.109   20.562 47.522 1.00 6.58  ? 184 HIS B CD2 1 
ATOM   3219 C CE1 . HIS B 1 184 ? 1.175   21.364 49.272 1.00 6.32  ? 184 HIS B CE1 1 
ATOM   3220 N NE2 . HIS B 1 184 ? 1.343   20.766 48.104 1.00 6.13  ? 184 HIS B NE2 1 
ATOM   3221 N N   . TYR B 1 185 ? -5.081  22.352 49.414 1.00 3.16  ? 185 TYR B N   1 
ATOM   3222 C CA  . TYR B 1 185 ? -6.491  22.625 49.163 1.00 3.02  ? 185 TYR B CA  1 
ATOM   3223 C C   . TYR B 1 185 ? -6.673  24.023 48.535 1.00 3.44  ? 185 TYR B C   1 
ATOM   3224 O O   . TYR B 1 185 ? -5.737  24.849 48.494 1.00 3.72  ? 185 TYR B O   1 
ATOM   3225 C CB  . TYR B 1 185 ? -7.311  22.480 50.473 1.00 2.44  ? 185 TYR B CB  1 
ATOM   3226 C CG  . TYR B 1 185 ? -6.881  23.429 51.581 1.00 3.61  ? 185 TYR B CG  1 
ATOM   3227 C CD1 . TYR B 1 185 ? -7.352  24.756 51.620 1.00 3.94  ? 185 TYR B CD1 1 
ATOM   3228 C CD2 . TYR B 1 185 ? -5.959  23.022 52.567 1.00 3.66  ? 185 TYR B CD2 1 
ATOM   3229 C CE1 . TYR B 1 185 ? -6.932  25.637 52.570 1.00 3.26  ? 185 TYR B CE1 1 
ATOM   3230 C CE2 . TYR B 1 185 ? -5.525  23.910 53.525 1.00 3.99  ? 185 TYR B CE2 1 
ATOM   3231 C CZ  . TYR B 1 185 ? -6.011  25.213 53.520 1.00 4.43  ? 185 TYR B CZ  1 
ATOM   3232 O OH  . TYR B 1 185 ? -5.556  26.117 54.447 1.00 4.24  ? 185 TYR B OH  1 
ATOM   3233 N N   . ALA B 1 186 ? -7.890  24.308 48.111 1.00 3.14  ? 186 ALA B N   1 
ATOM   3234 C CA  . ALA B 1 186 ? -8.222  25.574 47.472 1.00 3.49  ? 186 ALA B CA  1 
ATOM   3235 C C   . ALA B 1 186 ? -9.720  25.871 47.614 1.00 3.71  ? 186 ALA B C   1 
ATOM   3236 O O   . ALA B 1 186 ? -10.537 24.953 47.750 1.00 3.05  ? 186 ALA B O   1 
ATOM   3237 C CB  . ALA B 1 186 ? -7.929  25.476 45.971 1.00 2.86  ? 186 ALA B CB  1 
ATOM   3238 N N   . ALA B 1 187 ? -10.073 27.149 47.492 1.00 3.99  ? 187 ALA B N   1 
ATOM   3239 C CA  . ALA B 1 187 ? -11.476 27.548 47.493 1.00 4.34  ? 187 ALA B CA  1 
ATOM   3240 C C   . ALA B 1 187 ? -11.552 28.731 46.553 1.00 4.98  ? 187 ALA B C   1 
ATOM   3241 O O   . ALA B 1 187 ? -10.663 29.608 46.552 1.00 5.62  ? 187 ALA B O   1 
ATOM   3242 C CB  . ALA B 1 187 ? -11.983 27.905 48.908 1.00 2.97  ? 187 ALA B CB  1 
ATOM   3243 N N   . PHE B 1 188 ? -12.588 28.726 45.718 1.00 5.74  ? 188 PHE B N   1 
ATOM   3244 C CA  . PHE B 1 188 ? -12.848 29.786 44.737 1.00 5.87  ? 188 PHE B CA  1 
ATOM   3245 C C   . PHE B 1 188 ? -14.313 30.189 44.857 1.00 6.73  ? 188 PHE B C   1 
ATOM   3246 O O   . PHE B 1 188 ? -15.169 29.362 45.243 1.00 6.76  ? 188 PHE B O   1 
ATOM   3247 C CB  . PHE B 1 188 ? -12.645 29.270 43.319 1.00 5.72  ? 188 PHE B CB  1 
ATOM   3248 C CG  . PHE B 1 188 ? -11.247 28.795 43.039 1.00 6.79  ? 188 PHE B CG  1 
ATOM   3249 C CD1 . PHE B 1 188 ? -10.896 27.450 43.244 1.00 6.68  ? 188 PHE B CD1 1 
ATOM   3250 C CD2 . PHE B 1 188 ? -10.292 29.686 42.515 1.00 6.97  ? 188 PHE B CD2 1 
ATOM   3251 C CE1 . PHE B 1 188 ? -9.606  26.985 42.925 1.00 5.57  ? 188 PHE B CE1 1 
ATOM   3252 C CE2 . PHE B 1 188 ? -9.015  29.242 42.192 1.00 6.83  ? 188 PHE B CE2 1 
ATOM   3253 C CZ  . PHE B 1 188 ? -8.672  27.896 42.394 1.00 7.35  ? 188 PHE B CZ  1 
ATOM   3254 N N   . LEU B 1 189 ? -14.599 31.440 44.508 1.00 6.80  ? 189 LEU B N   1 
ATOM   3255 C CA  . LEU B 1 189 ? -15.960 31.928 44.541 1.00 7.46  ? 189 LEU B CA  1 
ATOM   3256 C C   . LEU B 1 189 ? -16.129 32.937 43.424 1.00 7.28  ? 189 LEU B C   1 
ATOM   3257 O O   . LEU B 1 189 ? -15.373 33.901 43.347 1.00 8.42  ? 189 LEU B O   1 
ATOM   3258 C CB  . LEU B 1 189 ? -16.238 32.522 45.905 1.00 7.12  ? 189 LEU B CB  1 
ATOM   3259 C CG  . LEU B 1 189 ? -17.666 32.876 46.280 1.00 9.03  ? 189 LEU B CG  1 
ATOM   3260 C CD1 . LEU B 1 189 ? -17.700 33.126 47.806 1.00 9.84  ? 189 LEU B CD1 1 
ATOM   3261 C CD2 . LEU B 1 189 ? -18.100 34.125 45.495 1.00 8.56  ? 189 LEU B CD2 1 
ATOM   3262 N N   . PHE B 1 190 ? -17.064 32.685 42.520 1.00 7.39  ? 190 PHE B N   1 
ATOM   3263 C CA  . PHE B 1 190 ? -17.312 33.594 41.391 1.00 8.14  ? 190 PHE B CA  1 
ATOM   3264 C C   . PHE B 1 190 ? -18.731 34.191 41.392 1.00 8.62  ? 190 PHE B C   1 
ATOM   3265 O O   . PHE B 1 190 ? -19.701 33.469 41.532 1.00 8.78  ? 190 PHE B O   1 
ATOM   3266 C CB  . PHE B 1 190 ? -17.155 32.844 40.058 1.00 8.03  ? 190 PHE B CB  1 
ATOM   3267 C CG  . PHE B 1 190 ? -15.858 32.079 39.918 1.00 9.42  ? 190 PHE B CG  1 
ATOM   3268 C CD1 . PHE B 1 190 ? -15.732 30.782 40.413 1.00 9.20  ? 190 PHE B CD1 1 
ATOM   3269 C CD2 . PHE B 1 190 ? -14.768 32.647 39.261 1.00 10.54 ? 190 PHE B CD2 1 
ATOM   3270 C CE1 . PHE B 1 190 ? -14.546 30.069 40.254 1.00 9.62  ? 190 PHE B CE1 1 
ATOM   3271 C CE2 . PHE B 1 190 ? -13.572 31.925 39.099 1.00 10.72 ? 190 PHE B CE2 1 
ATOM   3272 C CZ  . PHE B 1 190 ? -13.474 30.648 39.594 1.00 9.22  ? 190 PHE B CZ  1 
ATOM   3273 N N   . ASP B 1 191 ? -18.866 35.492 41.195 1.00 8.77  ? 191 ASP B N   1 
ATOM   3274 C CA  . ASP B 1 191 ? -20.201 36.082 41.100 1.00 9.63  ? 191 ASP B CA  1 
ATOM   3275 C C   . ASP B 1 191 ? -20.712 35.774 39.665 1.00 9.69  ? 191 ASP B C   1 
ATOM   3276 O O   . ASP B 1 191 ? -19.906 35.553 38.744 1.00 8.74  ? 191 ASP B O   1 
ATOM   3277 C CB  . ASP B 1 191 ? -20.121 37.592 41.297 1.00 10.79 ? 191 ASP B CB  1 
ATOM   3278 C CG  . ASP B 1 191 ? -21.497 38.235 41.398 1.00 12.74 ? 191 ASP B CG  1 
ATOM   3279 O OD1 . ASP B 1 191 ? -22.079 38.546 40.343 1.00 12.21 ? 191 ASP B OD1 1 
ATOM   3280 O OD2 . ASP B 1 191 ? -22.012 38.356 42.539 1.00 15.58 ? 191 ASP B OD2 1 
ATOM   3281 N N   . GLN B 1 192 ? -22.033 35.681 39.494 1.00 10.17 ? 192 GLN B N   1 
ATOM   3282 C CA  . GLN B 1 192 ? -22.651 35.408 38.193 1.00 11.01 ? 192 GLN B CA  1 
ATOM   3283 C C   . GLN B 1 192 ? -22.132 36.402 37.150 1.00 12.72 ? 192 GLN B C   1 
ATOM   3284 O O   . GLN B 1 192 ? -21.974 36.070 35.970 1.00 13.40 ? 192 GLN B O   1 
ATOM   3285 C CB  . GLN B 1 192 ? -24.173 35.589 38.294 1.00 9.57  ? 192 GLN B CB  1 
ATOM   3286 C CG  . GLN B 1 192 ? -24.914 34.428 38.909 1.00 7.77  ? 192 GLN B CG  1 
ATOM   3287 C CD  . GLN B 1 192 ? -25.332 33.404 37.892 1.00 6.84  ? 192 GLN B CD  1 
ATOM   3288 O OE1 . GLN B 1 192 ? -24.587 33.112 36.962 1.00 6.41  ? 192 GLN B OE1 1 
ATOM   3289 N NE2 . GLN B 1 192 ? -26.518 32.833 38.065 1.00 6.15  ? 192 GLN B NE2 1 
ATOM   3290 N N   . ASN B 1 193 ? -21.866 37.623 37.591 1.00 14.08 ? 193 ASN B N   1 
ATOM   3291 C CA  . ASN B 1 193 ? -21.386 38.666 36.694 1.00 16.58 ? 193 ASN B CA  1 
ATOM   3292 C C   . ASN B 1 193 ? -19.875 38.683 36.346 1.00 16.29 ? 193 ASN B C   1 
ATOM   3293 O O   . ASN B 1 193 ? -19.374 39.691 35.880 1.00 16.90 ? 193 ASN B O   1 
ATOM   3294 C CB  . ASN B 1 193 ? -21.843 40.047 37.223 1.00 20.01 ? 193 ASN B CB  1 
ATOM   3295 C CG  . ASN B 1 193 ? -23.388 40.240 37.124 1.00 24.13 ? 193 ASN B CG  1 
ATOM   3296 O OD1 . ASN B 1 193 ? -23.983 41.036 37.873 1.00 26.86 ? 193 ASN B OD1 1 
ATOM   3297 N ND2 . ASN B 1 193 ? -24.038 39.489 36.207 1.00 25.40 ? 193 ASN B ND2 1 
ATOM   3298 N N   . THR B 1 194 ? -19.167 37.571 36.524 1.00 14.71 ? 194 THR B N   1 
ATOM   3299 C CA  . THR B 1 194 ? -17.738 37.518 36.231 1.00 13.56 ? 194 THR B CA  1 
ATOM   3300 C C   . THR B 1 194 ? -17.548 37.635 34.748 1.00 13.65 ? 194 THR B C   1 
ATOM   3301 O O   . THR B 1 194 ? -18.093 36.848 33.992 1.00 13.80 ? 194 THR B O   1 
ATOM   3302 C CB  . THR B 1 194 ? -17.160 36.204 36.722 1.00 13.12 ? 194 THR B CB  1 
ATOM   3303 O OG1 . THR B 1 194 ? -17.284 36.164 38.151 1.00 11.60 ? 194 THR B OG1 1 
ATOM   3304 C CG2 . THR B 1 194 ? -15.718 36.045 36.299 1.00 11.70 ? 194 THR B CG2 1 
ATOM   3305 N N   . PRO B 1 195 ? -16.732 38.596 34.306 1.00 13.85 ? 195 PRO B N   1 
ATOM   3306 C CA  . PRO B 1 195 ? -16.478 38.812 32.872 1.00 14.21 ? 195 PRO B CA  1 
ATOM   3307 C C   . PRO B 1 195 ? -15.936 37.573 32.170 1.00 14.84 ? 195 PRO B C   1 
ATOM   3308 O O   . PRO B 1 195 ? -15.211 36.789 32.762 1.00 13.41 ? 195 PRO B O   1 
ATOM   3309 C CB  . PRO B 1 195 ? -15.448 39.940 32.866 1.00 14.09 ? 195 PRO B CB  1 
ATOM   3310 C CG  . PRO B 1 195 ? -15.583 40.577 34.225 1.00 14.53 ? 195 PRO B CG  1 
ATOM   3311 C CD  . PRO B 1 195 ? -15.871 39.448 35.140 1.00 13.00 ? 195 PRO B CD  1 
ATOM   3312 N N   . LYS B 1 196 ? -16.236 37.437 30.886 1.00 16.44 ? 196 LYS B N   1 
ATOM   3313 C CA  . LYS B 1 196 ? -15.802 36.279 30.109 1.00 19.00 ? 196 LYS B CA  1 
ATOM   3314 C C   . LYS B 1 196 ? -14.290 35.960 30.127 1.00 19.26 ? 196 LYS B C   1 
ATOM   3315 O O   . LYS B 1 196 ? -13.891 34.780 30.173 1.00 19.61 ? 196 LYS B O   1 
ATOM   3316 C CB  . LYS B 1 196 ? -16.270 36.420 28.654 1.00 22.06 ? 196 LYS B CB  1 
ATOM   3317 C CG  . LYS B 1 196 ? -16.026 35.173 27.789 1.00 26.01 ? 196 LYS B CG  1 
ATOM   3318 C CD  . LYS B 1 196 ? -17.095 34.093 28.011 1.00 29.57 ? 196 LYS B CD  1 
ATOM   3319 C CE  . LYS B 1 196 ? -17.892 33.806 26.705 1.00 31.85 ? 196 LYS B CE  1 
ATOM   3320 N NZ  . LYS B 1 196 ? -19.427 33.818 26.852 1.00 33.60 ? 196 LYS B NZ  1 
ATOM   3321 N N   . GLY B 1 197 ? -13.443 36.986 30.101 1.00 18.90 ? 197 GLY B N   1 
ATOM   3322 C CA  . GLY B 1 197 ? -12.017 36.697 30.066 1.00 19.03 ? 197 GLY B CA  1 
ATOM   3323 C C   . GLY B 1 197 ? -11.287 36.675 31.392 1.00 18.79 ? 197 GLY B C   1 
ATOM   3324 O O   . GLY B 1 197 ? -10.060 36.683 31.410 1.00 18.61 ? 197 GLY B O   1 
ATOM   3325 N N   . ALA B 1 198 ? -12.038 36.698 32.489 1.00 17.98 ? 198 ALA B N   1 
ATOM   3326 C CA  . ALA B 1 198 ? -11.466 36.698 33.821 1.00 16.82 ? 198 ALA B CA  1 
ATOM   3327 C C   . ALA B 1 198 ? -10.624 35.454 34.090 1.00 15.67 ? 198 ALA B C   1 
ATOM   3328 O O   . ALA B 1 198 ? -10.917 34.352 33.623 1.00 14.79 ? 198 ALA B O   1 
ATOM   3329 C CB  . ALA B 1 198 ? -12.559 36.833 34.868 1.00 17.27 ? 198 ALA B CB  1 
ATOM   3330 N N   . ASP B 1 199 ? -9.563  35.683 34.855 1.00 15.02 ? 199 ASP B N   1 
ATOM   3331 C CA  . ASP B 1 199 ? -8.608  34.675 35.258 1.00 14.32 ? 199 ASP B CA  1 
ATOM   3332 C C   . ASP B 1 199 ? -9.146  34.115 36.572 1.00 13.31 ? 199 ASP B C   1 
ATOM   3333 O O   . ASP B 1 199 ? -9.270  34.863 37.554 1.00 13.08 ? 199 ASP B O   1 
ATOM   3334 C CB  . ASP B 1 199 ? -7.277  35.401 35.460 1.00 15.31 ? 199 ASP B CB  1 
ATOM   3335 C CG  . ASP B 1 199 ? -6.182  34.547 36.077 1.00 16.79 ? 199 ASP B CG  1 
ATOM   3336 O OD1 . ASP B 1 199 ? -6.273  33.313 36.241 1.00 17.58 ? 199 ASP B OD1 1 
ATOM   3337 O OD2 . ASP B 1 199 ? -5.172  35.171 36.419 1.00 20.11 ? 199 ASP B OD2 1 
ATOM   3338 N N   . PHE B 1 200 ? -9.469  32.819 36.582 1.00 12.53 ? 200 PHE B N   1 
ATOM   3339 C CA  . PHE B 1 200 ? -9.996  32.153 37.785 1.00 12.63 ? 200 PHE B CA  1 
ATOM   3340 C C   . PHE B 1 200 ? -9.065  32.292 39.006 1.00 12.75 ? 200 PHE B C   1 
ATOM   3341 O O   . PHE B 1 200 ? -9.544  32.270 40.155 1.00 13.85 ? 200 PHE B O   1 
ATOM   3342 C CB  . PHE B 1 200 ? -10.379 30.657 37.534 1.00 12.35 ? 200 PHE B CB  1 
ATOM   3343 C CG  . PHE B 1 200 ? -9.209  29.695 37.511 1.00 11.94 ? 200 PHE B CG  1 
ATOM   3344 C CD1 . PHE B 1 200 ? -8.593  29.288 38.693 1.00 11.26 ? 200 PHE B CD1 1 
ATOM   3345 C CD2 . PHE B 1 200 ? -8.714  29.212 36.305 1.00 12.35 ? 200 PHE B CD2 1 
ATOM   3346 C CE1 . PHE B 1 200 ? -7.507  28.430 38.687 1.00 11.11 ? 200 PHE B CE1 1 
ATOM   3347 C CE2 . PHE B 1 200 ? -7.600  28.332 36.287 1.00 13.79 ? 200 PHE B CE2 1 
ATOM   3348 C CZ  . PHE B 1 200 ? -6.998  27.945 37.496 1.00 11.47 ? 200 PHE B CZ  1 
ATOM   3349 N N   . CYS B 1 201 ? -7.761  32.478 38.771 1.00 10.98 ? 201 CYS B N   1 
ATOM   3350 C CA  . CYS B 1 201 ? -6.822  32.640 39.860 1.00 10.38 ? 201 CYS B CA  1 
ATOM   3351 C C   . CYS B 1 201 ? -7.144  33.883 40.672 1.00 10.67 ? 201 CYS B C   1 
ATOM   3352 O O   . CYS B 1 201 ? -6.723  33.976 41.814 1.00 10.42 ? 201 CYS B O   1 
ATOM   3353 C CB  . CYS B 1 201 ? -5.405  32.762 39.323 1.00 9.68  ? 201 CYS B CB  1 
ATOM   3354 S SG  . CYS B 1 201 ? -4.843  31.262 38.478 1.00 11.21 ? 201 CYS B SG  1 
ATOM   3355 N N   . GLN B 1 202 ? -7.842  34.859 40.087 1.00 10.86 ? 202 GLN B N   1 
ATOM   3356 C CA  . GLN B 1 202 ? -8.159  36.084 40.823 1.00 11.56 ? 202 GLN B CA  1 
ATOM   3357 C C   . GLN B 1 202 ? -9.315  35.855 41.807 1.00 10.24 ? 202 GLN B C   1 
ATOM   3358 O O   . GLN B 1 202 ? -9.705  36.778 42.515 1.00 9.27  ? 202 GLN B O   1 
ATOM   3359 C CB  . GLN B 1 202 ? -8.632  37.263 39.921 1.00 15.14 ? 202 GLN B CB  1 
ATOM   3360 C CG  . GLN B 1 202 ? -8.029  37.581 38.528 1.00 22.46 ? 202 GLN B CG  1 
ATOM   3361 C CD  . GLN B 1 202 ? -9.057  38.458 37.613 1.00 27.70 ? 202 GLN B CD  1 
ATOM   3362 O OE1 . GLN B 1 202 ? -9.252  38.200 36.374 1.00 28.08 ? 202 GLN B OE1 1 
ATOM   3363 N NE2 . GLN B 1 202 ? -9.739  39.448 38.257 1.00 28.86 ? 202 GLN B NE2 1 
ATOM   3364 N N   . PHE B 1 203 ? -9.870  34.652 41.882 1.00 9.57  ? 203 PHE B N   1 
ATOM   3365 C CA  . PHE B 1 203 ? -11.047 34.450 42.766 1.00 9.39  ? 203 PHE B CA  1 
ATOM   3366 C C   . PHE B 1 203 ? -10.870 33.460 43.896 1.00 8.45  ? 203 PHE B C   1 
ATOM   3367 O O   . PHE B 1 203 ? -11.830 32.800 44.336 1.00 7.03  ? 203 PHE B O   1 
ATOM   3368 C CB  . PHE B 1 203 ? -12.276 34.100 41.904 1.00 9.52  ? 203 PHE B CB  1 
ATOM   3369 C CG  . PHE B 1 203 ? -12.548 35.131 40.839 1.00 10.61 ? 203 PHE B CG  1 
ATOM   3370 C CD1 . PHE B 1 203 ? -11.874 35.088 39.615 1.00 11.64 ? 203 PHE B CD1 1 
ATOM   3371 C CD2 . PHE B 1 203 ? -13.408 36.181 41.086 1.00 10.96 ? 203 PHE B CD2 1 
ATOM   3372 C CE1 . PHE B 1 203 ? -12.049 36.064 38.674 1.00 12.13 ? 203 PHE B CE1 1 
ATOM   3373 C CE2 . PHE B 1 203 ? -13.596 37.175 40.141 1.00 12.66 ? 203 PHE B CE2 1 
ATOM   3374 C CZ  . PHE B 1 203 ? -12.911 37.113 38.928 1.00 12.37 ? 203 PHE B CZ  1 
ATOM   3375 N N   . ARG B 1 204 ? -9.627  33.347 44.344 1.00 8.12  ? 204 ARG B N   1 
ATOM   3376 C CA  . ARG B 1 204 ? -9.308  32.455 45.441 1.00 9.12  ? 204 ARG B CA  1 
ATOM   3377 C C   . ARG B 1 204 ? -9.885  33.088 46.713 1.00 8.80  ? 204 ARG B C   1 
ATOM   3378 O O   . ARG B 1 204 ? -9.792  34.315 46.902 1.00 9.20  ? 204 ARG B O   1 
ATOM   3379 C CB  . ARG B 1 204 ? -7.790  32.299 45.548 1.00 10.03 ? 204 ARG B CB  1 
ATOM   3380 C CG  . ARG B 1 204 ? -7.181  31.454 44.437 1.00 12.27 ? 204 ARG B CG  1 
ATOM   3381 C CD  . ARG B 1 204 ? -5.653  31.490 44.468 1.00 14.40 ? 204 ARG B CD  1 
ATOM   3382 N NE  . ARG B 1 204 ? -5.122  32.697 43.812 1.00 18.31 ? 204 ARG B NE  1 
ATOM   3383 C CZ  . ARG B 1 204 ? -3.822  32.924 43.549 1.00 19.47 ? 204 ARG B CZ  1 
ATOM   3384 N NH1 . ARG B 1 204 ? -2.910  32.004 43.906 1.00 18.88 ? 204 ARG B NH1 1 
ATOM   3385 N NH2 . ARG B 1 204 ? -3.451  34.022 42.858 1.00 16.74 ? 204 ARG B NH2 1 
ATOM   3386 N N   . VAL B 1 205 ? -10.505 32.277 47.566 1.00 7.63  ? 205 VAL B N   1 
ATOM   3387 C CA  . VAL B 1 205 ? -11.079 32.778 48.824 1.00 6.75  ? 205 VAL B CA  1 
ATOM   3388 C C   . VAL B 1 205 ? -10.812 31.736 49.931 1.00 6.25  ? 205 VAL B C   1 
ATOM   3389 O O   . VAL B 1 205 ? -10.153 30.707 49.680 1.00 6.09  ? 205 VAL B O   1 
ATOM   3390 C CB  . VAL B 1 205 ? -12.649 33.010 48.718 1.00 5.58  ? 205 VAL B CB  1 
ATOM   3391 C CG1 . VAL B 1 205 ? -13.001 34.138 47.793 1.00 4.27  ? 205 VAL B CG1 1 
ATOM   3392 C CG2 . VAL B 1 205 ? -13.336 31.731 48.299 1.00 5.84  ? 205 VAL B CG2 1 
ATOM   3393 N N   . THR B 1 206 ? -11.279 32.013 51.157 1.00 5.87  ? 206 THR B N   1 
ATOM   3394 C CA  . THR B 1 206 ? -11.124 31.052 52.265 1.00 5.42  ? 206 THR B CA  1 
ATOM   3395 C C   . THR B 1 206 ? -12.403 30.245 52.304 1.00 4.79  ? 206 THR B C   1 
ATOM   3396 O O   . THR B 1 206 ? -13.422 30.691 51.815 1.00 4.23  ? 206 THR B O   1 
ATOM   3397 C CB  . THR B 1 206 ? -10.975 31.737 53.685 1.00 5.87  ? 206 THR B CB  1 
ATOM   3398 O OG1 . THR B 1 206 ? -12.066 32.636 53.891 1.00 6.71  ? 206 THR B OG1 1 
ATOM   3399 C CG2 . THR B 1 206 ? -9.665  32.525 53.798 1.00 6.72  ? 206 THR B CG2 1 
ATOM   3400 N N   . VAL B 1 207 ? -12.356 29.080 52.943 1.00 5.38  ? 207 VAL B N   1 
ATOM   3401 C CA  . VAL B 1 207 ? -13.515 28.222 53.092 1.00 5.00  ? 207 VAL B CA  1 
ATOM   3402 C C   . VAL B 1 207 ? -14.450 28.903 54.103 1.00 6.41  ? 207 VAL B C   1 
ATOM   3403 O O   . VAL B 1 207 ? -15.666 28.806 54.013 1.00 5.86  ? 207 VAL B O   1 
ATOM   3404 C CB  . VAL B 1 207 ? -13.068 26.828 53.610 1.00 5.96  ? 207 VAL B CB  1 
ATOM   3405 C CG1 . VAL B 1 207 ? -14.288 25.964 53.968 1.00 4.36  ? 207 VAL B CG1 1 
ATOM   3406 C CG2 . VAL B 1 207 ? -12.211 26.141 52.538 1.00 3.88  ? 207 VAL B CG2 1 
ATOM   3407 N N   . ASP B 1 208 ? -13.866 29.614 55.064 1.00 6.43  ? 208 ASP B N   1 
ATOM   3408 C CA  . ASP B 1 208 ? -14.654 30.308 56.054 1.00 7.26  ? 208 ASP B CA  1 
ATOM   3409 C C   . ASP B 1 208 ? -15.649 31.295 55.404 1.00 7.05  ? 208 ASP B C   1 
ATOM   3410 O O   . ASP B 1 208 ? -16.804 31.380 55.813 1.00 7.25  ? 208 ASP B O   1 
ATOM   3411 C CB  . ASP B 1 208 ? -13.750 31.039 57.052 1.00 8.10  ? 208 ASP B CB  1 
ATOM   3412 C CG  . ASP B 1 208 ? -14.554 31.798 58.069 1.00 9.63  ? 208 ASP B CG  1 
ATOM   3413 O OD1 . ASP B 1 208 ? -15.263 31.172 58.854 1.00 12.35 ? 208 ASP B OD1 1 
ATOM   3414 O OD2 . ASP B 1 208 ? -14.594 33.026 58.017 1.00 12.14 ? 208 ASP B OD2 1 
ATOM   3415 N N   . GLU B 1 209 ? -15.163 32.085 54.457 1.00 6.14  ? 209 GLU B N   1 
ATOM   3416 C CA  . GLU B 1 209 ? -15.987 33.038 53.751 1.00 6.18  ? 209 GLU B CA  1 
ATOM   3417 C C   . GLU B 1 209 ? -17.178 32.333 53.077 1.00 6.10  ? 209 GLU B C   1 
ATOM   3418 O O   . GLU B 1 209 ? -18.287 32.833 53.131 1.00 6.23  ? 209 GLU B O   1 
ATOM   3419 C CB  . GLU B 1 209 ? -15.179 33.789 52.713 1.00 6.17  ? 209 GLU B CB  1 
ATOM   3420 C CG  . GLU B 1 209 ? -16.075 34.699 51.920 1.00 7.75  ? 209 GLU B CG  1 
ATOM   3421 C CD  . GLU B 1 209 ? -15.369 35.562 50.896 1.00 8.66  ? 209 GLU B CD  1 
ATOM   3422 O OE1 . GLU B 1 209 ? -14.110 35.605 50.832 1.00 8.94  ? 209 GLU B OE1 1 
ATOM   3423 O OE2 . GLU B 1 209 ? -16.106 36.217 50.145 1.00 9.24  ? 209 GLU B OE2 1 
ATOM   3424 N N   . ILE B 1 210 ? -16.941 31.181 52.441 1.00 5.66  ? 210 ILE B N   1 
ATOM   3425 C CA  . ILE B 1 210 ? -18.009 30.414 51.814 1.00 5.22  ? 210 ILE B CA  1 
ATOM   3426 C C   . ILE B 1 210 ? -19.038 29.982 52.868 1.00 5.89  ? 210 ILE B C   1 
ATOM   3427 O O   . ILE B 1 210 ? -20.235 30.226 52.699 1.00 6.46  ? 210 ILE B O   1 
ATOM   3428 C CB  . ILE B 1 210 ? -17.446 29.186 51.042 1.00 5.30  ? 210 ILE B CB  1 
ATOM   3429 C CG1 . ILE B 1 210 ? -16.741 29.695 49.765 1.00 3.95  ? 210 ILE B CG1 1 
ATOM   3430 C CG2 . ILE B 1 210 ? -18.582 28.178 50.687 1.00 4.17  ? 210 ILE B CG2 1 
ATOM   3431 C CD1 . ILE B 1 210 ? -15.866 28.675 49.114 1.00 5.26  ? 210 ILE B CD1 1 
ATOM   3432 N N   . GLU B 1 211 ? -18.569 29.407 53.976 1.00 5.94  ? 211 GLU B N   1 
ATOM   3433 C CA  . GLU B 1 211 ? -19.432 28.957 55.061 1.00 5.71  ? 211 GLU B CA  1 
ATOM   3434 C C   . GLU B 1 211 ? -20.307 30.093 55.586 1.00 6.67  ? 211 GLU B C   1 
ATOM   3435 O O   . GLU B 1 211 ? -21.530 29.948 55.712 1.00 7.43  ? 211 GLU B O   1 
ATOM   3436 C CB  . GLU B 1 211 ? -18.583 28.386 56.194 1.00 5.18  ? 211 GLU B CB  1 
ATOM   3437 C CG  . GLU B 1 211 ? -17.937 27.036 55.804 1.00 5.01  ? 211 GLU B CG  1 
ATOM   3438 C CD  . GLU B 1 211 ? -17.288 26.300 56.959 1.00 5.02  ? 211 GLU B CD  1 
ATOM   3439 O OE1 . GLU B 1 211 ? -16.996 26.909 57.979 1.00 4.65  ? 211 GLU B OE1 1 
ATOM   3440 O OE2 . GLU B 1 211 ? -17.096 25.088 56.859 1.00 5.80  ? 211 GLU B OE2 1 
ATOM   3441 N N   . LYS B 1 212 ? -19.698 31.243 55.846 1.00 7.10  ? 212 LYS B N   1 
ATOM   3442 C CA  . LYS B 1 212 ? -20.435 32.388 56.364 1.00 7.85  ? 212 LYS B CA  1 
ATOM   3443 C C   . LYS B 1 212 ? -21.535 32.873 55.392 1.00 8.40  ? 212 LYS B C   1 
ATOM   3444 O O   . LYS B 1 212 ? -22.584 33.358 55.835 1.00 8.72  ? 212 LYS B O   1 
ATOM   3445 C CB  . LYS B 1 212 ? -19.477 33.548 56.649 1.00 8.33  ? 212 LYS B CB  1 
ATOM   3446 C CG  . LYS B 1 212 ? -18.495 33.315 57.778 1.00 11.40 ? 212 LYS B CG  1 
ATOM   3447 C CD  . LYS B 1 212 ? -19.224 33.042 59.068 1.00 12.44 ? 212 LYS B CD  1 
ATOM   3448 C CE  . LYS B 1 212 ? -18.224 33.125 60.212 1.00 13.87 ? 212 LYS B CE  1 
ATOM   3449 N NZ  . LYS B 1 212 ? -17.590 31.826 60.427 1.00 15.62 ? 212 LYS B NZ  1 
ATOM   3450 N N   . ARG B 1 213 ? -21.278 32.793 54.091 1.00 7.71  ? 213 ARG B N   1 
ATOM   3451 C CA  . ARG B 1 213 ? -22.243 33.247 53.111 1.00 7.48  ? 213 ARG B CA  1 
ATOM   3452 C C   . ARG B 1 213 ? -23.253 32.171 52.699 1.00 8.22  ? 213 ARG B C   1 
ATOM   3453 O O   . ARG B 1 213 ? -24.237 32.471 52.024 1.00 9.24  ? 213 ARG B O   1 
ATOM   3454 C CB  . ARG B 1 213 ? -21.501 33.779 51.894 1.00 5.95  ? 213 ARG B CB  1 
ATOM   3455 C CG  . ARG B 1 213 ? -20.665 35.029 52.206 1.00 6.08  ? 213 ARG B CG  1 
ATOM   3456 C CD  . ARG B 1 213 ? -19.729 35.406 51.075 1.00 5.53  ? 213 ARG B CD  1 
ATOM   3457 N NE  . ARG B 1 213 ? -20.461 36.003 49.969 1.00 4.24  ? 213 ARG B NE  1 
ATOM   3458 C CZ  . ARG B 1 213 ? -19.880 36.475 48.883 1.00 5.08  ? 213 ARG B CZ  1 
ATOM   3459 N NH1 . ARG B 1 213 ? -18.561 36.422 48.773 1.00 6.05  ? 213 ARG B NH1 1 
ATOM   3460 N NH2 . ARG B 1 213 ? -20.596 37.025 47.934 1.00 4.40  ? 213 ARG B NH2 1 
ATOM   3461 N N   . THR B 1 214 ? -23.020 30.917 53.060 1.00 7.34  ? 214 THR B N   1 
ATOM   3462 C CA  . THR B 1 214 ? -23.959 29.878 52.661 1.00 7.00  ? 214 THR B CA  1 
ATOM   3463 C C   . THR B 1 214 ? -24.715 29.239 53.818 1.00 7.76  ? 214 THR B C   1 
ATOM   3464 O O   . THR B 1 214 ? -25.746 28.639 53.564 1.00 8.46  ? 214 THR B O   1 
ATOM   3465 C CB  . THR B 1 214 ? -23.277 28.670 51.929 1.00 5.87  ? 214 THR B CB  1 
ATOM   3466 O OG1 . THR B 1 214 ? -22.272 28.125 52.777 1.00 3.70  ? 214 THR B OG1 1 
ATOM   3467 C CG2 . THR B 1 214 ? -22.674 29.067 50.604 1.00 4.85  ? 214 THR B CG2 1 
ATOM   3468 N N   . GLY B 1 215 ? -24.189 29.314 55.052 1.00 7.09  ? 215 GLY B N   1 
ATOM   3469 C CA  . GLY B 1 215 ? -24.832 28.665 56.195 1.00 5.70  ? 215 GLY B CA  1 
ATOM   3470 C C   . GLY B 1 215 ? -24.457 27.184 56.301 1.00 5.80  ? 215 GLY B C   1 
ATOM   3471 O O   . GLY B 1 215 ? -24.969 26.437 57.140 1.00 6.46  ? 215 GLY B O   1 
ATOM   3472 N N   . LEU B 1 216 ? -23.475 26.758 55.526 1.00 4.79  ? 216 LEU B N   1 
ATOM   3473 C CA  . LEU B 1 216 ? -23.070 25.369 55.541 1.00 4.13  ? 216 LEU B CA  1 
ATOM   3474 C C   . LEU B 1 216 ? -21.782 25.197 56.328 1.00 4.51  ? 216 LEU B C   1 
ATOM   3475 O O   . LEU B 1 216 ? -21.067 26.152 56.558 1.00 4.72  ? 216 LEU B O   1 
ATOM   3476 C CB  . LEU B 1 216 ? -22.751 24.931 54.091 1.00 4.68  ? 216 LEU B CB  1 
ATOM   3477 C CG  . LEU B 1 216 ? -23.824 24.903 52.999 1.00 5.94  ? 216 LEU B CG  1 
ATOM   3478 C CD1 . LEU B 1 216 ? -23.229 24.559 51.614 1.00 4.96  ? 216 LEU B CD1 1 
ATOM   3479 C CD2 . LEU B 1 216 ? -24.874 23.873 53.371 1.00 5.68  ? 216 LEU B CD2 1 
ATOM   3480 N N   . ILE B 1 217 ? -21.478 23.969 56.722 1.00 4.66  ? 217 ILE B N   1 
ATOM   3481 C CA  . ILE B 1 217 ? -20.190 23.683 57.336 1.00 5.40  ? 217 ILE B CA  1 
ATOM   3482 C C   . ILE B 1 217 ? -19.604 22.622 56.421 1.00 5.54  ? 217 ILE B C   1 
ATOM   3483 O O   . ILE B 1 217 ? -20.166 21.528 56.300 1.00 6.00  ? 217 ILE B O   1 
ATOM   3484 C CB  . ILE B 1 217 ? -20.262 23.138 58.768 1.00 5.38  ? 217 ILE B CB  1 
ATOM   3485 C CG1 . ILE B 1 217 ? -20.685 24.263 59.715 1.00 4.62  ? 217 ILE B CG1 1 
ATOM   3486 C CG2 . ILE B 1 217 ? -18.872 22.602 59.185 1.00 3.22  ? 217 ILE B CG2 1 
ATOM   3487 C CD1 . ILE B 1 217 ? -20.985 23.715 61.064 1.00 8.36  ? 217 ILE B CD1 1 
ATOM   3488 N N   . ILE B 1 218 ? -18.554 22.992 55.692 1.00 5.30  ? 218 ILE B N   1 
ATOM   3489 C CA  . ILE B 1 218 ? -17.872 22.094 54.753 1.00 5.66  ? 218 ILE B CA  1 
ATOM   3490 C C   . ILE B 1 218 ? -16.821 21.251 55.510 1.00 5.95  ? 218 ILE B C   1 
ATOM   3491 O O   . ILE B 1 218 ? -16.367 21.664 56.604 1.00 6.48  ? 218 ILE B O   1 
ATOM   3492 C CB  . ILE B 1 218 ? -17.282 22.983 53.592 1.00 7.81  ? 218 ILE B CB  1 
ATOM   3493 C CG1 . ILE B 1 218 ? -18.474 23.586 52.826 1.00 8.92  ? 218 ILE B CG1 1 
ATOM   3494 C CG2 . ILE B 1 218 ? -16.371 22.187 52.606 1.00 5.99  ? 218 ILE B CG2 1 
ATOM   3495 C CD1 . ILE B 1 218 ? -18.150 24.886 52.220 1.00 12.72 ? 218 ILE B CD1 1 
ATOM   3496 N N   . TRP B 1 219 ? -16.494 20.058 54.985 1.00 5.00  ? 219 TRP B N   1 
ATOM   3497 C CA  . TRP B 1 219 ? -15.497 19.146 55.604 1.00 5.77  ? 219 TRP B CA  1 
ATOM   3498 C C   . TRP B 1 219 ? -15.877 19.015 57.084 1.00 5.82  ? 219 TRP B C   1 
ATOM   3499 O O   . TRP B 1 219 ? -15.044 19.113 57.969 1.00 5.60  ? 219 TRP B O   1 
ATOM   3500 C CB  . TRP B 1 219 ? -14.071 19.727 55.497 1.00 5.07  ? 219 TRP B CB  1 
ATOM   3501 C CG  . TRP B 1 219 ? -13.589 20.143 54.087 1.00 5.24  ? 219 TRP B CG  1 
ATOM   3502 C CD1 . TRP B 1 219 ? -13.958 19.609 52.867 1.00 4.67  ? 219 TRP B CD1 1 
ATOM   3503 C CD2 . TRP B 1 219 ? -12.554 21.090 53.809 1.00 6.06  ? 219 TRP B CD2 1 
ATOM   3504 N NE1 . TRP B 1 219 ? -13.193 20.160 51.850 1.00 4.70  ? 219 TRP B NE1 1 
ATOM   3505 C CE2 . TRP B 1 219 ? -12.313 21.059 52.405 1.00 5.38  ? 219 TRP B CE2 1 
ATOM   3506 C CE3 . TRP B 1 219 ? -11.784 21.950 54.619 1.00 7.37  ? 219 TRP B CE3 1 
ATOM   3507 C CZ2 . TRP B 1 219 ? -11.325 21.838 51.797 1.00 5.35  ? 219 TRP B CZ2 1 
ATOM   3508 C CZ3 . TRP B 1 219 ? -10.777 22.751 53.997 1.00 7.98  ? 219 TRP B CZ3 1 
ATOM   3509 C CH2 . TRP B 1 219 ? -10.568 22.673 52.596 1.00 5.86  ? 219 TRP B CH2 1 
ATOM   3510 N N   . ALA B 1 220 ? -17.147 18.732 57.326 1.00 7.00  ? 220 ALA B N   1 
ATOM   3511 C CA  . ALA B 1 220 ? -17.685 18.683 58.680 1.00 6.97  ? 220 ALA B CA  1 
ATOM   3512 C C   . ALA B 1 220 ? -17.240 17.554 59.580 1.00 6.94  ? 220 ALA B C   1 
ATOM   3513 O O   . ALA B 1 220 ? -17.606 17.538 60.753 1.00 7.50  ? 220 ALA B O   1 
ATOM   3514 C CB  . ALA B 1 220 ? -19.193 18.756 58.616 1.00 6.49  ? 220 ALA B CB  1 
ATOM   3515 N N   . GLY B 1 221 ? -16.477 16.604 59.054 1.00 6.01  ? 221 GLY B N   1 
ATOM   3516 C CA  . GLY B 1 221 ? -16.010 15.512 59.883 1.00 7.06  ? 221 GLY B CA  1 
ATOM   3517 C C   . GLY B 1 221 ? -14.590 15.749 60.402 1.00 8.04  ? 221 GLY B C   1 
ATOM   3518 O O   . GLY B 1 221 ? -14.028 14.895 61.056 1.00 8.42  ? 221 GLY B O   1 
ATOM   3519 N N   . LEU B 1 222 ? -13.986 16.890 60.084 1.00 7.74  ? 222 LEU B N   1 
ATOM   3520 C CA  . LEU B 1 222 ? -12.638 17.196 60.554 1.00 7.81  ? 222 LEU B CA  1 
ATOM   3521 C C   . LEU B 1 222 ? -12.595 17.621 62.042 1.00 7.92  ? 222 LEU B C   1 
ATOM   3522 O O   . LEU B 1 222 ? -13.566 18.196 62.555 1.00 7.79  ? 222 LEU B O   1 
ATOM   3523 C CB  . LEU B 1 222 ? -12.072 18.379 59.747 1.00 6.73  ? 222 LEU B CB  1 
ATOM   3524 C CG  . LEU B 1 222 ? -11.697 18.212 58.285 1.00 6.92  ? 222 LEU B CG  1 
ATOM   3525 C CD1 . LEU B 1 222 ? -11.154 19.567 57.778 1.00 6.55  ? 222 LEU B CD1 1 
ATOM   3526 C CD2 . LEU B 1 222 ? -10.707 17.063 58.112 1.00 6.00  ? 222 LEU B CD2 1 
ATOM   3527 N N   . PRO B 1 223 ? -11.467 17.336 62.746 1.00 8.28  ? 223 PRO B N   1 
ATOM   3528 C CA  . PRO B 1 223 ? -11.315 17.729 64.155 1.00 8.19  ? 223 PRO B CA  1 
ATOM   3529 C C   . PRO B 1 223 ? -11.488 19.243 64.183 1.00 7.96  ? 223 PRO B C   1 
ATOM   3530 O O   . PRO B 1 223 ? -11.048 19.941 63.250 1.00 7.52  ? 223 PRO B O   1 
ATOM   3531 C CB  . PRO B 1 223 ? -9.861  17.361 64.448 1.00 6.57  ? 223 PRO B CB  1 
ATOM   3532 C CG  . PRO B 1 223 ? -9.734  16.092 63.729 1.00 7.06  ? 223 PRO B CG  1 
ATOM   3533 C CD  . PRO B 1 223 ? -10.371 16.424 62.365 1.00 7.67  ? 223 PRO B CD  1 
ATOM   3534 N N   . ASP B 1 224 ? -12.058 19.750 65.273 1.00 8.40  ? 224 ASP B N   1 
ATOM   3535 C CA  . ASP B 1 224 ? -12.332 21.174 65.418 1.00 8.38  ? 224 ASP B CA  1 
ATOM   3536 C C   . ASP B 1 224 ? -11.095 22.023 65.251 1.00 9.64  ? 224 ASP B C   1 
ATOM   3537 O O   . ASP B 1 224 ? -11.158 23.086 64.639 1.00 9.27  ? 224 ASP B O   1 
ATOM   3538 C CB  . ASP B 1 224 ? -12.920 21.512 66.788 1.00 8.15  ? 224 ASP B CB  1 
ATOM   3539 C CG  . ASP B 1 224 ? -14.284 20.903 67.032 1.00 8.52  ? 224 ASP B CG  1 
ATOM   3540 O OD1 . ASP B 1 224 ? -14.979 20.459 66.114 1.00 7.72  ? 224 ASP B OD1 1 
ATOM   3541 O OD2 . ASP B 1 224 ? -14.670 20.892 68.197 1.00 8.91  ? 224 ASP B OD2 1 
ATOM   3542 N N   . ASP B 1 225 ? -9.962  21.590 65.800 1.00 10.18 ? 225 ASP B N   1 
ATOM   3543 C CA  . ASP B 1 225 ? -8.802  22.458 65.683 1.00 11.57 ? 225 ASP B CA  1 
ATOM   3544 C C   . ASP B 1 225 ? -8.321  22.614 64.246 1.00 10.45 ? 225 ASP B C   1 
ATOM   3545 O O   . ASP B 1 225 ? -7.895  23.706 63.848 1.00 10.44 ? 225 ASP B O   1 
ATOM   3546 C CB  . ASP B 1 225 ? -7.694  22.012 66.620 1.00 14.16 ? 225 ASP B CB  1 
ATOM   3547 C CG  . ASP B 1 225 ? -7.013  20.799 66.140 1.00 17.66 ? 225 ASP B CG  1 
ATOM   3548 O OD1 . ASP B 1 225 ? -7.592  19.707 66.186 1.00 20.87 ? 225 ASP B OD1 1 
ATOM   3549 O OD2 . ASP B 1 225 ? -5.876  20.937 65.680 1.00 23.60 ? 225 ASP B OD2 1 
ATOM   3550 N N   . VAL B 1 226 ? -8.459  21.549 63.453 1.00 9.77  ? 226 VAL B N   1 
ATOM   3551 C CA  . VAL B 1 226 ? -8.066  21.585 62.045 1.00 10.06 ? 226 VAL B CA  1 
ATOM   3552 C C   . VAL B 1 226 ? -8.989  22.529 61.273 1.00 9.96  ? 226 VAL B C   1 
ATOM   3553 O O   . VAL B 1 226 ? -8.545  23.351 60.452 1.00 9.82  ? 226 VAL B O   1 
ATOM   3554 C CB  . VAL B 1 226 ? -8.109  20.174 61.430 1.00 10.93 ? 226 VAL B CB  1 
ATOM   3555 C CG1 . VAL B 1 226 ? -7.904  20.219 59.886 1.00 9.65  ? 226 VAL B CG1 1 
ATOM   3556 C CG2 . VAL B 1 226 ? -7.057  19.338 62.103 1.00 10.82 ? 226 VAL B CG2 1 
ATOM   3557 N N   . GLN B 1 227 ? -10.278 22.439 61.584 1.00 10.05 ? 227 GLN B N   1 
ATOM   3558 C CA  . GLN B 1 227 ? -11.276 23.300 60.955 1.00 10.11 ? 227 GLN B CA  1 
ATOM   3559 C C   . GLN B 1 227 ? -10.967 24.739 61.313 1.00 10.06 ? 227 GLN B C   1 
ATOM   3560 O O   . GLN B 1 227 ? -10.895 25.588 60.451 1.00 11.23 ? 227 GLN B O   1 
ATOM   3561 C CB  . GLN B 1 227 ? -12.689 22.950 61.444 1.00 9.41  ? 227 GLN B CB  1 
ATOM   3562 C CG  . GLN B 1 227 ? -13.216 21.637 60.900 1.00 9.96  ? 227 GLN B CG  1 
ATOM   3563 C CD  . GLN B 1 227 ? -14.703 21.461 61.183 1.00 10.07 ? 227 GLN B CD  1 
ATOM   3564 O OE1 . GLN B 1 227 ? -15.155 20.414 61.681 1.00 10.88 ? 227 GLN B OE1 1 
ATOM   3565 N NE2 . GLN B 1 227 ? -15.466 22.488 60.877 1.00 8.18  ? 227 GLN B NE2 1 
ATOM   3566 N N   . ALA B 1 228 ? -10.708 25.006 62.579 1.00 10.04 ? 228 ALA B N   1 
ATOM   3567 C CA  . ALA B 1 228 ? -10.445 26.375 62.982 1.00 11.55 ? 228 ALA B CA  1 
ATOM   3568 C C   . ALA B 1 228 ? -9.240  26.956 62.283 1.00 12.30 ? 228 ALA B C   1 
ATOM   3569 O O   . ALA B 1 228 ? -9.329  28.042 61.700 1.00 14.51 ? 228 ALA B O   1 
ATOM   3570 C CB  . ALA B 1 228 ? -10.261 26.482 64.513 1.00 10.89 ? 228 ALA B CB  1 
ATOM   3571 N N   . SER B 1 229 ? -8.149  26.209 62.231 1.00 12.05 ? 229 SER B N   1 
ATOM   3572 C CA  . SER B 1 229 ? -6.969  26.794 61.643 1.00 12.52 ? 229 SER B CA  1 
ATOM   3573 C C   . SER B 1 229 ? -6.919  26.853 60.139 1.00 11.77 ? 229 SER B C   1 
ATOM   3574 O O   . SER B 1 229 ? -6.576  27.899 59.583 1.00 12.75 ? 229 SER B O   1 
ATOM   3575 C CB  . SER B 1 229 ? -5.722  26.167 62.226 1.00 14.00 ? 229 SER B CB  1 
ATOM   3576 O OG  . SER B 1 229 ? -5.695  24.812 61.866 1.00 18.48 ? 229 SER B OG  1 
ATOM   3577 N N   . LEU B 1 230 ? -7.405  25.829 59.457 1.00 9.63  ? 230 LEU B N   1 
ATOM   3578 C CA  . LEU B 1 230 ? -7.302  25.870 58.009 1.00 9.00  ? 230 LEU B CA  1 
ATOM   3579 C C   . LEU B 1 230 ? -8.400  26.611 57.248 1.00 9.09  ? 230 LEU B C   1 
ATOM   3580 O O   . LEU B 1 230 ? -8.140  27.139 56.169 1.00 9.01  ? 230 LEU B O   1 
ATOM   3581 C CB  . LEU B 1 230 ? -7.138  24.456 57.431 1.00 9.69  ? 230 LEU B CB  1 
ATOM   3582 C CG  . LEU B 1 230 ? -5.943  23.646 57.968 1.00 9.83  ? 230 LEU B CG  1 
ATOM   3583 C CD1 . LEU B 1 230 ? -5.919  22.297 57.341 1.00 9.49  ? 230 LEU B CD1 1 
ATOM   3584 C CD2 . LEU B 1 230 ? -4.640  24.405 57.723 1.00 9.98  ? 230 LEU B CD2 1 
ATOM   3585 N N   . LYS B 1 231 ? -9.604  26.707 57.816 1.00 7.89  ? 231 LYS B N   1 
ATOM   3586 C CA  . LYS B 1 231 ? -10.701 27.341 57.098 1.00 6.88  ? 231 LYS B CA  1 
ATOM   3587 C C   . LYS B 1 231 ? -10.537 28.821 56.877 1.00 6.77  ? 231 LYS B C   1 
ATOM   3588 O O   . LYS B 1 231 ? -11.167 29.402 56.002 1.00 6.39  ? 231 LYS B O   1 
ATOM   3589 C CB  . LYS B 1 231 ? -12.066 26.980 57.719 1.00 5.50  ? 231 LYS B CB  1 
ATOM   3590 C CG  . LYS B 1 231 ? -12.477 25.500 57.406 1.00 4.22  ? 231 LYS B CG  1 
ATOM   3591 C CD  . LYS B 1 231 ? -13.787 25.144 58.057 1.00 4.83  ? 231 LYS B CD  1 
ATOM   3592 C CE  . LYS B 1 231 ? -14.164 23.714 57.795 1.00 5.32  ? 231 LYS B CE  1 
ATOM   3593 N NZ  . LYS B 1 231 ? -15.523 23.460 58.343 1.00 4.94  ? 231 LYS B NZ  1 
ATOM   3594 N N   . SER B 1 232 ? -9.639  29.441 57.619 1.00 7.61  ? 232 SER B N   1 
ATOM   3595 C CA  . SER B 1 232 ? -9.426  30.863 57.424 1.00 7.97  ? 232 SER B CA  1 
ATOM   3596 C C   . SER B 1 232 ? -8.126  31.156 56.706 1.00 7.89  ? 232 SER B C   1 
ATOM   3597 O O   . SER B 1 232 ? -7.744  32.305 56.588 1.00 8.87  ? 232 SER B O   1 
ATOM   3598 C CB  . SER B 1 232 ? -9.477  31.575 58.757 1.00 10.26 ? 232 SER B CB  1 
ATOM   3599 O OG  . SER B 1 232 ? -10.834 31.722 59.201 1.00 15.29 ? 232 SER B OG  1 
ATOM   3600 N N   . LYS B 1 233 ? -7.467  30.130 56.186 1.00 7.75  ? 233 LYS B N   1 
ATOM   3601 C CA  . LYS B 1 233 ? -6.195  30.290 55.479 1.00 7.87  ? 233 LYS B CA  1 
ATOM   3602 C C   . LYS B 1 233 ? -6.335  29.838 54.023 1.00 7.15  ? 233 LYS B C   1 
ATOM   3603 O O   . LYS B 1 233 ? -6.622  28.663 53.767 1.00 6.21  ? 233 LYS B O   1 
ATOM   3604 C CB  . LYS B 1 233 ? -5.122  29.435 56.191 1.00 9.69  ? 233 LYS B CB  1 
ATOM   3605 C CG  . LYS B 1 233 ? -3.740  29.519 55.608 1.00 11.24 ? 233 LYS B CG  1 
ATOM   3606 C CD  . LYS B 1 233 ? -3.137  30.890 55.807 1.00 14.03 ? 233 LYS B CD  1 
ATOM   3607 C CE  . LYS B 1 233 ? -1.775  30.881 55.110 1.00 17.45 ? 233 LYS B CE  1 
ATOM   3608 N NZ  . LYS B 1 233 ? -1.042  32.143 55.374 1.00 19.62 ? 233 LYS B NZ  1 
ATOM   3609 N N   . PRO B 1 234 ? -6.161  30.768 53.052 1.00 7.22  ? 234 PRO B N   1 
ATOM   3610 C CA  . PRO B 1 234 ? -6.291  30.360 51.650 1.00 7.06  ? 234 PRO B CA  1 
ATOM   3611 C C   . PRO B 1 234 ? -5.240  29.258 51.384 1.00 7.24  ? 234 PRO B C   1 
ATOM   3612 O O   . PRO B 1 234 ? -4.132  29.293 51.953 1.00 7.65  ? 234 PRO B O   1 
ATOM   3613 C CB  . PRO B 1 234 ? -5.998  31.657 50.872 1.00 7.03  ? 234 PRO B CB  1 
ATOM   3614 C CG  . PRO B 1 234 ? -6.431  32.751 51.815 1.00 7.40  ? 234 PRO B CG  1 
ATOM   3615 C CD  . PRO B 1 234 ? -5.909  32.229 53.163 1.00 7.31  ? 234 PRO B CD  1 
ATOM   3616 N N   . GLY B 1 235 ? -5.608  28.252 50.603 1.00 5.45  ? 235 GLY B N   1 
ATOM   3617 C CA  . GLY B 1 235 ? -4.683  27.167 50.346 1.00 5.80  ? 235 GLY B CA  1 
ATOM   3618 C C   . GLY B 1 235 ? -3.691  27.431 49.230 1.00 5.96  ? 235 GLY B C   1 
ATOM   3619 O O   . GLY B 1 235 ? -3.774  28.420 48.501 1.00 6.19  ? 235 GLY B O   1 
ATOM   3620 N N   . VAL B 1 236 ? -2.783  26.482 49.036 1.00 6.46  ? 236 VAL B N   1 
ATOM   3621 C CA  . VAL B 1 236 ? -1.768  26.628 48.005 1.00 6.43  ? 236 VAL B CA  1 
ATOM   3622 C C   . VAL B 1 236 ? -2.016  25.724 46.797 1.00 5.91  ? 236 VAL B C   1 
ATOM   3623 O O   . VAL B 1 236 ? -1.253  25.791 45.810 1.00 6.33  ? 236 VAL B O   1 
ATOM   3624 C CB  . VAL B 1 236 ? -0.326  26.411 48.584 1.00 7.33  ? 236 VAL B CB  1 
ATOM   3625 C CG1 . VAL B 1 236 ? -0.133  27.264 49.827 1.00 8.40  ? 236 VAL B CG1 1 
ATOM   3626 C CG2 . VAL B 1 236 ? -0.097  24.986 48.910 1.00 6.77  ? 236 VAL B CG2 1 
ATOM   3627 N N   . LEU B 1 237 ? -3.071  24.898 46.846 1.00 4.84  ? 237 LEU B N   1 
ATOM   3628 C CA  . LEU B 1 237 ? -3.388  24.043 45.705 1.00 4.13  ? 237 LEU B CA  1 
ATOM   3629 C C   . LEU B 1 237 ? -3.450  24.827 44.368 1.00 4.48  ? 237 LEU B C   1 
ATOM   3630 O O   . LEU B 1 237 ? -3.020  24.310 43.341 1.00 4.47  ? 237 LEU B O   1 
ATOM   3631 C CB  . LEU B 1 237 ? -4.696  23.292 45.905 1.00 3.42  ? 237 LEU B CB  1 
ATOM   3632 C CG  . LEU B 1 237 ? -4.975  22.300 44.759 1.00 3.66  ? 237 LEU B CG  1 
ATOM   3633 C CD1 . LEU B 1 237 ? -3.871  21.130 44.724 1.00 3.68  ? 237 LEU B CD1 1 
ATOM   3634 C CD2 . LEU B 1 237 ? -6.367  21.735 44.934 1.00 2.65  ? 237 LEU B CD2 1 
ATOM   3635 N N   . PRO B 1 238 ? -3.975  26.080 44.365 1.00 4.48  ? 238 PRO B N   1 
ATOM   3636 C CA  . PRO B 1 238 ? -4.024  26.824 43.088 1.00 5.50  ? 238 PRO B CA  1 
ATOM   3637 C C   . PRO B 1 238 ? -2.644  26.980 42.396 1.00 6.53  ? 238 PRO B C   1 
ATOM   3638 O O   . PRO B 1 238 ? -2.583  27.156 41.186 1.00 5.75  ? 238 PRO B O   1 
ATOM   3639 C CB  . PRO B 1 238 ? -4.589  28.179 43.496 1.00 4.21  ? 238 PRO B CB  1 
ATOM   3640 C CG  . PRO B 1 238 ? -5.481  27.809 44.730 1.00 4.94  ? 238 PRO B CG  1 
ATOM   3641 C CD  . PRO B 1 238 ? -4.562  26.874 45.463 1.00 3.74  ? 238 PRO B CD  1 
ATOM   3642 N N   . GLU B 1 239 ? -1.554  26.989 43.169 1.00 7.19  ? 239 GLU B N   1 
ATOM   3643 C CA  . GLU B 1 239 ? -0.234  27.100 42.588 1.00 8.91  ? 239 GLU B CA  1 
ATOM   3644 C C   . GLU B 1 239 ? 0.042   25.929 41.659 1.00 9.75  ? 239 GLU B C   1 
ATOM   3645 O O   . GLU B 1 239 ? 0.813   26.062 40.713 1.00 9.62  ? 239 GLU B O   1 
ATOM   3646 C CB  . GLU B 1 239 ? 0.819   27.157 43.679 1.00 10.66 ? 239 GLU B CB  1 
ATOM   3647 C CG  . GLU B 1 239 ? 1.420   28.551 43.816 1.00 13.32 ? 239 GLU B CG  1 
ATOM   3648 C CD  . GLU B 1 239 ? 0.411   29.627 44.230 1.00 15.67 ? 239 GLU B CD  1 
ATOM   3649 O OE1 . GLU B 1 239 ? -0.588  29.303 44.914 1.00 16.14 ? 239 GLU B OE1 1 
ATOM   3650 O OE2 . GLU B 1 239 ? 0.647   30.807 43.906 1.00 16.89 ? 239 GLU B OE2 1 
ATOM   3651 N N   . LEU B 1 240 ? -0.591  24.784 41.906 1.00 9.46  ? 240 LEU B N   1 
ATOM   3652 C CA  . LEU B 1 240 ? -0.402  23.631 41.019 1.00 10.19 ? 240 LEU B CA  1 
ATOM   3653 C C   . LEU B 1 240 ? -1.367  23.676 39.831 1.00 11.18 ? 240 LEU B C   1 
ATOM   3654 O O   . LEU B 1 240 ? -1.289  22.840 38.924 1.00 11.47 ? 240 LEU B O   1 
ATOM   3655 C CB  . LEU B 1 240 ? -0.598  22.314 41.743 1.00 9.15  ? 240 LEU B CB  1 
ATOM   3656 C CG  . LEU B 1 240 ? 0.415   21.985 42.823 1.00 10.02 ? 240 LEU B CG  1 
ATOM   3657 C CD1 . LEU B 1 240 ? 0.094   20.587 43.332 1.00 10.36 ? 240 LEU B CD1 1 
ATOM   3658 C CD2 . LEU B 1 240 ? 1.859   22.046 42.227 1.00 10.04 ? 240 LEU B CD2 1 
ATOM   3659 N N   . MET B 1 241 ? -2.202  24.698 39.799 1.00 10.79 ? 241 MET B N   1 
ATOM   3660 C CA  . MET B 1 241 ? -3.168  24.848 38.747 1.00 12.10 ? 241 MET B CA  1 
ATOM   3661 C C   . MET B 1 241 ? -2.782  26.040 37.885 1.00 13.20 ? 241 MET B C   1 
ATOM   3662 O O   . MET B 1 241 ? -3.580  26.556 37.112 1.00 13.65 ? 241 MET B O   1 
ATOM   3663 C CB  . MET B 1 241 ? -4.556  25.021 39.365 1.00 12.78 ? 241 MET B CB  1 
ATOM   3664 C CG  . MET B 1 241 ? -4.955  23.883 40.279 1.00 13.25 ? 241 MET B CG  1 
ATOM   3665 S SD  . MET B 1 241 ? -6.468  24.288 41.207 1.00 16.85 ? 241 MET B SD  1 
ATOM   3666 C CE  . MET B 1 241 ? -7.634  23.723 40.138 1.00 14.47 ? 241 MET B CE  1 
ATOM   3667 N N   . GLY B 1 242 ? -1.549  26.504 38.056 1.00 14.19 ? 242 GLY B N   1 
ATOM   3668 C CA  . GLY B 1 242 ? -1.082  27.616 37.270 1.00 14.83 ? 242 GLY B CA  1 
ATOM   3669 C C   . GLY B 1 242 ? -1.214  29.003 37.846 1.00 15.88 ? 242 GLY B C   1 
ATOM   3670 O O   . GLY B 1 242 ? -0.939  29.961 37.137 1.00 16.95 ? 242 GLY B O   1 
ATOM   3671 N N   . CYS B 1 243 ? -1.674  29.150 39.081 1.00 15.94 ? 243 CYS B N   1 
ATOM   3672 C CA  . CYS B 1 243 ? -1.782  30.477 39.664 1.00 16.29 ? 243 CYS B CA  1 
ATOM   3673 C C   . CYS B 1 243 ? -0.477  30.869 40.362 1.00 19.05 ? 243 CYS B C   1 
ATOM   3674 O O   . CYS B 1 243 ? 0.292   30.014 40.797 1.00 18.10 ? 243 CYS B O   1 
ATOM   3675 C CB  . CYS B 1 243 ? -2.916  30.520 40.678 1.00 14.29 ? 243 CYS B CB  1 
ATOM   3676 S SG  . CYS B 1 243 ? -4.507  29.971 40.007 1.00 11.40 ? 243 CYS B SG  1 
ATOM   3677 N N   . LYS B 1 244 ? -0.268  32.175 40.494 1.00 22.59 ? 244 LYS B N   1 
ATOM   3678 C CA  . LYS B 1 244 ? 0.895   32.764 41.164 1.00 26.82 ? 244 LYS B CA  1 
ATOM   3679 C C   . LYS B 1 244 ? 0.457   33.621 42.368 1.00 28.75 ? 244 LYS B C   1 
ATOM   3680 O O   . LYS B 1 244 ? -0.649  34.160 42.406 1.00 28.82 ? 244 LYS B O   1 
ATOM   3681 C CB  . LYS B 1 244 ? 1.707   33.581 40.169 1.00 28.39 ? 244 LYS B CB  1 
ATOM   3682 C CG  . LYS B 1 244 ? 2.475   32.679 39.231 1.00 32.14 ? 244 LYS B CG  1 
ATOM   3683 C CD  . LYS B 1 244 ? 2.546   33.214 37.808 1.00 35.87 ? 244 LYS B CD  1 
ATOM   3684 C CE  . LYS B 1 244 ? 1.856   32.248 36.821 1.00 38.22 ? 244 LYS B CE  1 
ATOM   3685 N NZ  . LYS B 1 244 ? 1.917   32.684 35.375 1.00 39.88 ? 244 LYS B NZ  1 
ATOM   3686 N N   . ASN B 1 245 ? 1.308   33.685 43.380 1.00 31.36 ? 245 ASN B N   1 
ATOM   3687 C CA  . ASN B 1 245 ? 1.005   34.437 44.592 1.00 33.88 ? 245 ASN B CA  1 
ATOM   3688 C C   . ASN B 1 245 ? -0.318  33.978 45.209 1.00 34.04 ? 245 ASN B C   1 
ATOM   3689 O O   . ASN B 1 245 ? -1.142  34.828 45.629 1.00 34.68 ? 245 ASN B O   1 
ATOM   3690 C CB  . ASN B 1 245 ? 1.006   35.937 44.298 1.00 36.72 ? 245 ASN B CB  1 
ATOM   3691 C CG  . ASN B 1 245 ? 2.381   36.438 43.875 1.00 40.00 ? 245 ASN B CG  1 
ATOM   3692 O OD1 . ASN B 1 245 ? 2.837   36.184 42.743 1.00 42.11 ? 245 ASN B OD1 1 
ATOM   3693 N ND2 . ASN B 1 245 ? 3.074   37.120 44.792 1.00 41.44 ? 245 ASN B ND2 1 
ATOM   3694 O OXT . ASN B 1 245 ? -0.494  32.745 45.282 1.00 33.58 ? 245 ASN B OXT 1 
HETATM 3695 O O   . HOH C 2 .   ? 15.935  18.489 50.604 1.00 5.36  ? 246 HOH A O   1 
HETATM 3696 O O   . HOH C 2 .   ? 16.819  11.691 60.493 1.00 6.84  ? 247 HOH A O   1 
HETATM 3697 O O   . HOH C 2 .   ? 1.577   24.260 52.297 1.00 2.93  ? 248 HOH A O   1 
HETATM 3698 O O   . HOH C 2 .   ? 13.990  34.172 70.330 1.00 6.07  ? 249 HOH A O   1 
HETATM 3699 O O   . HOH C 2 .   ? 32.962  18.208 65.229 1.00 3.71  ? 250 HOH A O   1 
HETATM 3700 O O   . HOH C 2 .   ? 14.599  16.216 55.166 1.00 3.77  ? 251 HOH A O   1 
HETATM 3701 O O   . HOH C 2 .   ? 20.188  25.101 62.052 1.00 5.76  ? 252 HOH A O   1 
HETATM 3702 O O   . HOH C 2 .   ? 11.843  19.734 54.392 1.00 3.41  ? 253 HOH A O   1 
HETATM 3703 O O   . HOH C 2 .   ? 20.387  25.711 64.696 1.00 6.57  ? 254 HOH A O   1 
HETATM 3704 O O   . HOH C 2 .   ? 13.704  25.437 65.453 1.00 6.74  ? 255 HOH A O   1 
HETATM 3705 O O   . HOH C 2 .   ? 16.478  22.360 65.551 1.00 6.34  ? 256 HOH A O   1 
HETATM 3706 O O   . HOH C 2 .   ? 11.777  19.460 66.816 1.00 7.28  ? 257 HOH A O   1 
HETATM 3707 O O   . HOH C 2 .   ? 31.520  20.949 61.572 1.00 6.88  ? 258 HOH A O   1 
HETATM 3708 O O   . HOH C 2 .   ? 31.766  22.476 64.305 1.00 4.04  ? 259 HOH A O   1 
HETATM 3709 O O   . HOH C 2 .   ? 27.122  22.647 62.483 1.00 7.63  ? 260 HOH A O   1 
HETATM 3710 O O   . HOH C 2 .   ? 38.264  19.265 73.056 1.00 6.30  ? 261 HOH A O   1 
HETATM 3711 O O   . HOH C 2 .   ? 28.453  26.173 56.759 1.00 6.80  ? 262 HOH A O   1 
HETATM 3712 O O   . HOH C 2 .   ? 14.188  17.150 52.537 1.00 7.01  ? 263 HOH A O   1 
HETATM 3713 O O   . HOH C 2 .   ? 19.075  36.522 69.983 1.00 10.26 ? 264 HOH A O   1 
HETATM 3714 O O   . HOH C 2 .   ? 24.588  19.750 49.042 1.00 5.72  ? 265 HOH A O   1 
HETATM 3715 O O   . HOH C 2 .   ? 30.171  23.446 66.458 1.00 10.19 ? 266 HOH A O   1 
HETATM 3716 O O   . HOH C 2 .   ? 2.581   21.566 66.249 1.00 13.23 ? 267 HOH A O   1 
HETATM 3717 O O   . HOH C 2 .   ? 29.972  16.447 54.607 1.00 13.36 ? 268 HOH A O   1 
HETATM 3718 O O   . HOH C 2 .   ? 23.051  35.757 51.374 1.00 7.50  ? 269 HOH A O   1 
HETATM 3719 O O   . HOH C 2 .   ? 23.103  25.800 65.722 1.00 11.78 ? 270 HOH A O   1 
HETATM 3720 O O   . HOH C 2 .   ? 35.407  29.900 72.296 1.00 9.22  ? 271 HOH A O   1 
HETATM 3721 O O   . HOH C 2 .   ? 4.004   30.351 55.925 1.00 8.03  ? 272 HOH A O   1 
HETATM 3722 O O   . HOH C 2 .   ? 7.690   28.361 49.993 1.00 8.93  ? 273 HOH A O   1 
HETATM 3723 O O   . HOH C 2 .   ? 20.075  28.430 44.766 1.00 17.42 ? 274 HOH A O   1 
HETATM 3724 O O   . HOH C 2 .   ? 7.094   14.270 45.256 1.00 15.15 ? 275 HOH A O   1 
HETATM 3725 O O   . HOH C 2 .   ? 17.939  20.572 70.382 1.00 11.23 ? 276 HOH A O   1 
HETATM 3726 O O   . HOH C 2 .   ? 1.193   30.146 57.429 1.00 15.50 ? 277 HOH A O   1 
HETATM 3727 O O   . HOH C 2 .   ? 19.997  10.657 53.585 1.00 14.55 ? 278 HOH A O   1 
HETATM 3728 O O   . HOH C 2 .   ? 24.617  32.407 53.520 1.00 17.80 ? 279 HOH A O   1 
HETATM 3729 O O   . HOH C 2 .   ? 22.931  39.715 58.335 1.00 13.98 ? 280 HOH A O   1 
HETATM 3730 O O   . HOH C 2 .   ? 34.455  18.688 55.781 1.00 15.45 ? 281 HOH A O   1 
HETATM 3731 O O   . HOH C 2 .   ? 15.582  11.809 48.960 1.00 13.87 ? 282 HOH A O   1 
HETATM 3732 O O   . HOH C 2 .   ? 16.091  22.348 37.135 1.00 8.35  ? 283 HOH A O   1 
HETATM 3733 O O   . HOH C 2 .   ? 21.781  37.190 58.001 1.00 6.56  ? 284 HOH A O   1 
HETATM 3734 O O   . HOH C 2 .   ? 23.645  27.018 54.488 1.00 13.88 ? 285 HOH A O   1 
HETATM 3735 O O   . HOH C 2 .   ? 25.562  12.891 74.103 1.00 12.68 ? 286 HOH A O   1 
HETATM 3736 O O   . HOH C 2 .   ? 32.339  22.426 74.444 1.00 11.75 ? 287 HOH A O   1 
HETATM 3737 O O   . HOH C 2 .   ? 5.582   7.897  62.548 1.00 14.41 ? 288 HOH A O   1 
HETATM 3738 O O   . HOH C 2 .   ? 28.081  35.208 59.220 1.00 13.62 ? 289 HOH A O   1 
HETATM 3739 O O   . HOH C 2 .   ? 16.424  13.866 75.131 1.00 20.05 ? 290 HOH A O   1 
HETATM 3740 O O   . HOH C 2 .   ? 25.662  19.506 45.246 1.00 16.27 ? 291 HOH A O   1 
HETATM 3741 O O   . HOH C 2 .   ? 9.958   34.962 51.551 1.00 19.42 ? 292 HOH A O   1 
HETATM 3742 O O   . HOH C 2 .   ? 31.757  31.174 78.767 1.00 25.84 ? 293 HOH A O   1 
HETATM 3743 O O   . HOH C 2 .   ? 19.274  37.619 59.140 1.00 8.68  ? 294 HOH A O   1 
HETATM 3744 O O   . HOH C 2 .   ? 6.361   29.291 55.141 1.00 17.42 ? 295 HOH A O   1 
HETATM 3745 O O   . HOH C 2 .   ? 32.709  34.690 62.392 1.00 21.29 ? 296 HOH A O   1 
HETATM 3746 O O   . HOH C 2 .   ? 11.636  19.853 33.211 1.00 30.41 ? 297 HOH A O   1 
HETATM 3747 O O   . HOH C 2 .   ? 14.827  8.368  57.507 1.00 17.78 ? 298 HOH A O   1 
HETATM 3748 O O   . HOH C 2 .   ? 7.811   31.616 69.598 1.00 20.84 ? 299 HOH A O   1 
HETATM 3749 O O   . HOH C 2 .   ? 26.699  18.384 47.994 1.00 18.88 ? 300 HOH A O   1 
HETATM 3750 O O   . HOH C 2 .   ? 7.119   28.072 52.704 1.00 18.54 ? 301 HOH A O   1 
HETATM 3751 O O   . HOH C 2 .   ? 36.345  30.785 57.840 1.00 28.45 ? 302 HOH A O   1 
HETATM 3752 O O   . HOH C 2 .   ? 30.915  28.489 76.043 1.00 11.84 ? 303 HOH A O   1 
HETATM 3753 O O   . HOH C 2 .   ? 28.169  12.699 71.835 1.00 14.88 ? 304 HOH A O   1 
HETATM 3754 O O   . HOH C 2 .   ? 14.489  9.107  61.196 1.00 22.06 ? 305 HOH A O   1 
HETATM 3755 O O   . HOH C 2 .   ? 37.477  14.196 63.886 1.00 21.11 ? 306 HOH A O   1 
HETATM 3756 O O   . HOH C 2 .   ? 15.730  24.397 40.837 1.00 26.83 ? 307 HOH A O   1 
HETATM 3757 O O   . HOH C 2 .   ? 38.403  19.354 65.976 1.00 34.64 ? 308 HOH A O   1 
HETATM 3758 O O   . HOH C 2 .   ? -3.113  17.096 60.408 1.00 29.35 ? 309 HOH A O   1 
HETATM 3759 O O   . HOH C 2 .   ? 41.800  24.082 60.873 1.00 28.68 ? 310 HOH A O   1 
HETATM 3760 O O   . HOH C 2 .   ? -0.460  12.333 53.008 1.00 23.08 ? 311 HOH A O   1 
HETATM 3761 O O   . HOH C 2 .   ? 35.105  11.953 68.529 1.00 41.11 ? 312 HOH A O   1 
HETATM 3762 O O   . HOH C 2 .   ? 10.794  18.403 35.697 1.00 10.09 ? 313 HOH A O   1 
HETATM 3763 O O   . HOH C 2 .   ? 21.680  36.236 73.448 1.00 28.58 ? 314 HOH A O   1 
HETATM 3764 O O   . HOH C 2 .   ? 25.893  25.822 75.591 1.00 23.46 ? 315 HOH A O   1 
HETATM 3765 O O   . HOH C 2 .   ? 16.550  8.294  59.877 1.00 32.53 ? 316 HOH A O   1 
HETATM 3766 O O   . HOH C 2 .   ? 39.748  23.206 56.977 1.00 24.81 ? 317 HOH A O   1 
HETATM 3767 O O   . HOH C 2 .   ? 30.740  35.838 61.250 1.00 17.03 ? 318 HOH A O   1 
HETATM 3768 O O   . HOH C 2 .   ? 19.268  12.536 48.045 1.00 24.57 ? 319 HOH A O   1 
HETATM 3769 O O   . HOH C 2 .   ? 19.322  16.849 42.005 1.00 18.01 ? 320 HOH A O   1 
HETATM 3770 O O   . HOH C 2 .   ? 27.844  22.225 78.204 1.00 26.22 ? 321 HOH A O   1 
HETATM 3771 O O   . HOH C 2 .   ? 40.914  25.332 71.086 1.00 28.76 ? 322 HOH A O   1 
HETATM 3772 O O   . HOH C 2 .   ? 36.564  16.628 56.925 1.00 27.12 ? 323 HOH A O   1 
HETATM 3773 O O   . HOH C 2 .   ? 5.058   27.939 71.070 1.00 47.01 ? 324 HOH A O   1 
HETATM 3774 O O   . HOH C 2 .   ? 0.567   33.834 64.414 1.00 21.49 ? 325 HOH A O   1 
HETATM 3775 O O   . HOH C 2 .   ? 3.458   32.951 55.705 1.00 19.84 ? 326 HOH A O   1 
HETATM 3776 O O   . HOH C 2 .   ? 19.541  15.005 39.956 1.00 16.87 ? 327 HOH A O   1 
HETATM 3777 O O   . HOH C 2 .   ? 34.901  24.166 76.093 1.00 26.78 ? 328 HOH A O   1 
HETATM 3778 O O   . HOH C 2 .   ? 9.325   36.794 57.781 1.00 35.38 ? 329 HOH A O   1 
HETATM 3779 O O   . HOH C 2 .   ? 11.084  14.407 73.486 1.00 28.08 ? 330 HOH A O   1 
HETATM 3780 O O   . HOH C 2 .   ? 11.128  38.019 53.585 1.00 25.53 ? 331 HOH A O   1 
HETATM 3781 O O   . HOH C 2 .   ? 2.572   28.421 68.355 1.00 24.75 ? 332 HOH A O   1 
HETATM 3782 O O   . HOH C 2 .   ? 40.094  17.885 67.554 1.00 24.49 ? 333 HOH A O   1 
HETATM 3783 O O   . HOH C 2 .   ? 16.654  37.802 58.786 1.00 21.04 ? 334 HOH A O   1 
HETATM 3784 O O   . HOH C 2 .   ? 8.445   19.709 35.363 1.00 27.74 ? 335 HOH A O   1 
HETATM 3785 O O   . HOH C 2 .   ? -3.765  28.364 63.837 1.00 27.14 ? 336 HOH A O   1 
HETATM 3786 O O   . HOH C 2 .   ? 22.797  16.355 47.960 1.00 23.71 ? 337 HOH A O   1 
HETATM 3787 O O   . HOH C 2 .   ? 12.697  23.042 72.489 1.00 27.15 ? 338 HOH A O   1 
HETATM 3788 O O   . HOH C 2 .   ? 28.743  28.287 74.345 1.00 26.39 ? 339 HOH A O   1 
HETATM 3789 O O   . HOH C 2 .   ? 12.630  8.577  54.149 1.00 23.93 ? 340 HOH A O   1 
HETATM 3790 O O   . HOH C 2 .   ? 20.163  23.141 71.413 1.00 31.95 ? 341 HOH A O   1 
HETATM 3791 O O   . HOH C 2 .   ? 27.604  25.426 50.560 1.00 34.87 ? 342 HOH A O   1 
HETATM 3792 O O   . HOH C 2 .   ? 0.572   33.430 67.002 1.00 37.98 ? 343 HOH A O   1 
HETATM 3793 O O   . HOH C 2 .   ? 0.284   20.020 66.072 1.00 30.81 ? 344 HOH A O   1 
HETATM 3794 O O   . HOH C 2 .   ? 19.937  15.639 45.809 1.00 40.94 ? 345 HOH A O   1 
HETATM 3795 O O   . HOH C 2 .   ? 6.334   25.385 73.108 1.00 48.08 ? 346 HOH A O   1 
HETATM 3796 O O   . HOH C 2 .   ? 25.634  10.684 80.655 1.00 32.48 ? 347 HOH A O   1 
HETATM 3797 O O   . HOH C 2 .   ? 13.497  37.436 55.756 1.00 22.04 ? 348 HOH A O   1 
HETATM 3798 O O   . HOH C 2 .   ? 6.312   14.251 70.441 1.00 33.46 ? 349 HOH A O   1 
HETATM 3799 O O   . HOH C 2 .   ? 17.232  24.894 71.160 1.00 33.61 ? 350 HOH A O   1 
HETATM 3800 O O   . HOH C 2 .   ? 22.584  30.503 78.425 1.00 41.00 ? 351 HOH A O   1 
HETATM 3801 O O   . HOH C 2 .   ? 25.517  6.011  62.447 1.00 31.81 ? 352 HOH A O   1 
HETATM 3802 O O   . HOH C 2 .   ? 14.741  26.040 43.017 1.00 27.36 ? 353 HOH A O   1 
HETATM 3803 O O   . HOH C 2 .   ? 15.119  24.678 36.283 1.00 31.85 ? 354 HOH A O   1 
HETATM 3804 O O   . HOH C 2 .   ? 5.649   9.037  56.262 1.00 23.99 ? 355 HOH A O   1 
HETATM 3805 O O   . HOH C 2 .   ? 33.067  16.379 54.767 1.00 50.59 ? 356 HOH A O   1 
HETATM 3806 O O   . HOH D 2 .   ? -17.444 18.219 52.800 1.00 5.31  ? 246 HOH B O   1 
HETATM 3807 O O   . HOH D 2 .   ? -16.135 16.053 48.162 1.00 5.10  ? 247 HOH B O   1 
HETATM 3808 O O   . HOH D 2 .   ? -3.285  24.212 51.064 1.00 2.99  ? 248 HOH B O   1 
HETATM 3809 O O   . HOH D 2 .   ? -21.888 24.875 41.384 1.00 4.51  ? 249 HOH B O   1 
HETATM 3810 O O   . HOH D 2 .   ? -13.425 19.605 49.065 1.00 4.42  ? 250 HOH B O   1 
HETATM 3811 O O   . HOH D 2 .   ? -18.140 11.443 42.731 1.00 5.35  ? 251 HOH B O   1 
HETATM 3812 O O   . HOH D 2 .   ? -33.051 20.468 41.847 1.00 3.54  ? 252 HOH B O   1 
HETATM 3813 O O   . HOH D 2 .   ? -33.342 22.103 39.056 1.00 4.69  ? 253 HOH B O   1 
HETATM 3814 O O   . HOH D 2 .   ? -28.720 22.321 40.880 1.00 3.70  ? 254 HOH B O   1 
HETATM 3815 O O   . HOH D 2 .   ? -15.299 25.308 38.007 1.00 6.42  ? 255 HOH B O   1 
HETATM 3816 O O   . HOH D 2 .   ? -15.645 16.941 50.819 1.00 5.53  ? 256 HOH B O   1 
HETATM 3817 O O   . HOH D 2 .   ? -21.228 20.009 61.639 1.00 7.59  ? 257 HOH B O   1 
HETATM 3818 O O   . HOH D 2 .   ? -31.565 16.026 48.579 1.00 7.96  ? 258 HOH B O   1 
HETATM 3819 O O   . HOH D 2 .   ? -33.664 16.925 27.101 1.00 5.94  ? 259 HOH B O   1 
HETATM 3820 O O   . HOH D 2 .   ? -0.789  22.963 51.668 1.00 4.95  ? 260 HOH B O   1 
HETATM 3821 O O   . HOH D 2 .   ? -31.893 23.181 36.785 1.00 8.84  ? 261 HOH B O   1 
HETATM 3822 O O   . HOH D 2 .   ? -18.125 22.250 37.795 1.00 3.73  ? 262 HOH B O   1 
HETATM 3823 O O   . HOH D 2 .   ? -9.330  28.254 53.478 1.00 10.64 ? 263 HOH B O   1 
HETATM 3824 O O   . HOH D 2 .   ? -39.775 18.904 30.351 1.00 9.88  ? 264 HOH B O   1 
HETATM 3825 O O   . HOH D 2 .   ? -34.471 17.832 38.029 1.00 10.22 ? 265 HOH B O   1 
HETATM 3826 O O   . HOH D 2 .   ? -26.149 19.216 54.490 1.00 8.86  ? 266 HOH B O   1 
HETATM 3827 O O   . HOH D 2 .   ? -22.092 25.480 38.740 1.00 6.80  ? 267 HOH B O   1 
HETATM 3828 O O   . HOH D 2 .   ? -37.028 29.612 31.142 1.00 10.42 ? 268 HOH B O   1 
HETATM 3829 O O   . HOH D 2 .   ? -30.011 25.842 46.582 1.00 9.31  ? 269 HOH B O   1 
HETATM 3830 O O   . HOH D 2 .   ? -13.399 19.400 36.549 1.00 7.72  ? 270 HOH B O   1 
HETATM 3831 O O   . HOH D 2 .   ? -4.034  21.674 37.073 1.00 15.01 ? 271 HOH B O   1 
HETATM 3832 O O   . HOH D 2 .   ? -15.709 34.105 33.123 1.00 10.94 ? 272 HOH B O   1 
HETATM 3833 O O   . HOH D 2 .   ? -24.699 25.567 37.852 1.00 14.15 ? 273 HOH B O   1 
HETATM 3834 O O   . HOH D 2 .   ? -17.017 11.432 54.402 1.00 9.50  ? 274 HOH B O   1 
HETATM 3835 O O   . HOH D 2 .   ? -21.183 10.402 49.703 1.00 13.70 ? 275 HOH B O   1 
HETATM 3836 O O   . HOH D 2 .   ? -5.706  30.204 47.549 1.00 9.57  ? 276 HOH B O   1 
HETATM 3837 O O   . HOH D 2 .   ? -36.553 16.904 27.529 1.00 8.14  ? 277 HOH B O   1 
HETATM 3838 O O   . HOH D 2 .   ? -18.326 20.025 61.960 1.00 9.67  ? 278 HOH B O   1 
HETATM 3839 O O   . HOH D 2 .   ? -25.568 26.651 48.935 1.00 11.50 ? 279 HOH B O   1 
HETATM 3840 O O   . HOH D 2 .   ? -2.834  30.011 46.147 1.00 12.26 ? 280 HOH B O   1 
HETATM 3841 O O   . HOH D 2 .   ? -33.403 30.949 24.677 1.00 16.75 ? 281 HOH B O   1 
HETATM 3842 O O   . HOH D 2 .   ? -21.723 27.923 58.526 1.00 18.92 ? 282 HOH B O   1 
HETATM 3843 O O   . HOH D 2 .   ? -26.515 31.846 50.008 1.00 18.11 ? 283 HOH B O   1 
HETATM 3844 O O   . HOH D 2 .   ? -27.078 19.095 58.249 1.00 15.91 ? 284 HOH B O   1 
HETATM 3845 O O   . HOH D 2 .   ? -20.969 36.502 33.530 1.00 8.83  ? 285 HOH B O   1 
HETATM 3846 O O   . HOH D 2 .   ? -32.289 35.506 41.984 1.00 15.51 ? 286 HOH B O   1 
HETATM 3847 O O   . HOH D 2 .   ? -29.731 35.008 44.308 1.00 13.62 ? 287 HOH B O   1 
HETATM 3848 O O   . HOH D 2 .   ? -8.145  29.220 48.374 1.00 14.32 ? 288 HOH B O   1 
HETATM 3849 O O   . HOH D 2 .   ? -11.892 34.763 51.964 1.00 17.75 ? 289 HOH B O   1 
HETATM 3850 O O   . HOH D 2 .   ? -35.106 21.493 50.910 1.00 13.26 ? 290 HOH B O   1 
HETATM 3851 O O   . HOH D 2 .   ? -27.093 12.651 29.238 1.00 14.87 ? 291 HOH B O   1 
HETATM 3852 O O   . HOH D 2 .   ? -29.561 12.519 31.469 1.00 10.69 ? 292 HOH B O   1 
HETATM 3853 O O   . HOH D 2 .   ? -20.883 15.389 57.924 1.00 24.06 ? 293 HOH B O   1 
HETATM 3854 O O   . HOH D 2 .   ? -1.024  12.328 50.197 1.00 20.18 ? 294 HOH B O   1 
HETATM 3855 O O   . HOH D 2 .   ? -37.992 16.054 46.401 1.00 15.40 ? 295 HOH B O   1 
HETATM 3856 O O   . HOH D 2 .   ? 1.487   17.266 42.825 1.00 29.24 ? 296 HOH B O   1 
HETATM 3857 O O   . HOH D 2 .   ? -25.658 16.104 23.329 1.00 17.58 ? 297 HOH B O   1 
HETATM 3858 O O   . HOH D 2 .   ? -29.293 8.024  47.685 1.00 31.88 ? 298 HOH B O   1 
HETATM 3859 O O   . HOH D 2 .   ? -6.776  8.034  40.768 1.00 15.61 ? 299 HOH B O   1 
HETATM 3860 O O   . HOH D 2 .   ? -9.467  31.643 33.932 1.00 25.90 ? 300 HOH B O   1 
HETATM 3861 O O   . HOH D 2 .   ? -16.545 25.810 60.455 1.00 23.54 ? 301 HOH B O   1 
HETATM 3862 O O   . HOH D 2 .   ? -17.538 21.875 66.388 1.00 10.57 ? 302 HOH B O   1 
HETATM 3863 O O   . HOH D 2 .   ? -18.007 13.883 28.379 1.00 20.19 ? 303 HOH B O   1 
HETATM 3864 O O   . HOH D 2 .   ? -21.789 22.972 31.959 1.00 20.47 ? 304 HOH B O   1 
HETATM 3865 O O   . HOH D 2 .   ? -37.689 29.951 45.662 1.00 28.05 ? 305 HOH B O   1 
HETATM 3866 O O   . HOH D 2 .   ? -12.307 18.082 67.546 1.00 11.10 ? 306 HOH B O   1 
HETATM 3867 O O   . HOH D 2 .   ? -28.580 27.085 48.948 1.00 42.25 ? 307 HOH B O   1 
HETATM 3868 O O   . HOH D 2 .   ? -18.563 24.927 32.279 1.00 30.67 ? 308 HOH B O   1 
HETATM 3869 O O   . HOH D 2 .   ? -13.662 22.438 70.222 1.00 34.04 ? 309 HOH B O   1 
HETATM 3870 O O   . HOH D 2 .   ? 1.773   28.200 39.351 1.00 26.92 ? 310 HOH B O   1 
HETATM 3871 O O   . HOH D 2 .   ? -14.420 36.104 44.959 1.00 20.43 ? 311 HOH B O   1 
HETATM 3872 O O   . HOH D 2 .   ? -11.414 29.383 60.596 1.00 30.99 ? 312 HOH B O   1 
HETATM 3873 O O   . HOH D 2 .   ? -35.922 18.041 47.471 1.00 17.90 ? 313 HOH B O   1 
HETATM 3874 O O   . HOH D 2 .   ? -14.229 23.073 30.988 1.00 29.54 ? 314 HOH B O   1 
HETATM 3875 O O   . HOH D 2 .   ? -16.863 39.361 39.338 1.00 35.68 ? 315 HOH B O   1 
HETATM 3876 O O   . HOH D 2 .   ? -20.531 12.382 55.434 1.00 24.20 ? 316 HOH B O   1 
HETATM 3877 O O   . HOH D 2 .   ? -36.801 11.688 34.936 1.00 26.54 ? 317 HOH B O   1 
HETATM 3878 O O   . HOH D 2 .   ? -34.316 40.828 30.261 1.00 29.71 ? 318 HOH B O   1 
HETATM 3879 O O   . HOH D 2 .   ? -17.723 29.041 59.675 1.00 26.89 ? 319 HOH B O   1 
HETATM 3880 O O   . HOH D 2 .   ? -19.582 20.433 33.070 1.00 10.54 ? 320 HOH B O   1 
HETATM 3881 O O   . HOH D 2 .   ? -8.590  14.072 58.155 1.00 18.52 ? 321 HOH B O   1 
HETATM 3882 O O   . HOH D 2 .   ? -23.512 36.999 44.805 1.00 16.12 ? 322 HOH B O   1 
HETATM 3883 O O   . HOH D 2 .   ? -8.649  28.290 50.653 1.00 24.67 ? 323 HOH B O   1 
HETATM 3884 O O   . HOH D 2 .   ? -20.728 16.642 61.246 1.00 21.64 ? 324 HOH B O   1 
HETATM 3885 O O   . HOH D 2 .   ? -24.278 15.861 55.428 1.00 17.19 ? 325 HOH B O   1 
HETATM 3886 O O   . HOH D 2 .   ? -36.391 14.849 29.236 1.00 19.44 ? 326 HOH B O   1 
HETATM 3887 O O   . HOH D 2 .   ? -16.139 8.237  45.929 1.00 18.33 ? 327 HOH B O   1 
HETATM 3888 O O   . HOH D 2 .   ? -32.552 28.404 27.363 1.00 12.44 ? 328 HOH B O   1 
HETATM 3889 O O   . HOH D 2 .   ? -34.558 34.372 41.040 1.00 16.27 ? 329 HOH B O   1 
HETATM 3890 O O   . HOH D 2 .   ? -38.907 13.849 39.503 1.00 32.74 ? 330 HOH B O   1 
HETATM 3891 O O   . HOH D 2 .   ? -36.391 23.941 27.302 1.00 29.35 ? 331 HOH B O   1 
HETATM 3892 O O   . HOH D 2 .   ? -20.347 23.593 34.042 1.00 25.96 ? 332 HOH B O   1 
HETATM 3893 O O   . HOH D 2 .   ? -15.901 35.609 56.626 1.00 21.15 ? 333 HOH B O   1 
HETATM 3894 O O   . HOH D 2 .   ? -5.064  32.921 47.883 1.00 21.71 ? 334 HOH B O   1 
HETATM 3895 O O   . HOH D 2 .   ? -23.361 36.222 30.335 1.00 24.11 ? 335 HOH B O   1 
HETATM 3896 O O   . HOH D 2 .   ? -40.240 31.186 27.753 1.00 23.68 ? 336 HOH B O   1 
HETATM 3897 O O   . HOH D 2 .   ? -12.606 14.390 29.836 1.00 27.50 ? 337 HOH B O   1 
HETATM 3898 O O   . HOH D 2 .   ? -18.648 37.508 45.513 1.00 23.14 ? 338 HOH B O   1 
HETATM 3899 O O   . HOH D 2 .   ? -28.137 17.797 55.339 1.00 23.67 ? 339 HOH B O   1 
HETATM 3900 O O   . HOH D 2 .   ? -17.872 8.045  43.586 1.00 22.68 ? 340 HOH B O   1 
HETATM 3901 O O   . HOH D 2 .   ? -30.213 28.029 28.991 1.00 27.72 ? 341 HOH B O   1 
HETATM 3902 O O   . HOH D 2 .   ? -16.773 24.450 67.036 1.00 28.59 ? 342 HOH B O   1 
HETATM 3903 O O   . HOH D 2 .   ? -6.976  34.824 48.874 1.00 31.97 ? 343 HOH B O   1 
HETATM 3904 O O   . HOH D 2 .   ? -29.126 20.644 57.793 1.00 24.75 ? 344 HOH B O   1 
HETATM 3905 O O   . HOH D 2 .   ? -24.999 35.080 51.426 1.00 28.65 ? 345 HOH B O   1 
HETATM 3906 O O   . HOH D 2 .   ? -15.992 9.054  41.861 1.00 27.68 ? 346 HOH B O   1 
HETATM 3907 O O   . HOH D 2 .   ? -31.282 42.043 44.918 1.00 27.75 ? 347 HOH B O   1 
HETATM 3908 O O   . HOH D 2 .   ? -22.934 9.861  24.984 1.00 31.23 ? 348 HOH B O   1 
HETATM 3909 O O   . HOH D 2 .   ? -27.487 25.736 27.846 1.00 26.25 ? 349 HOH B O   1 
HETATM 3910 O O   . HOH D 2 .   ? -2.623  33.663 36.518 1.00 33.47 ? 350 HOH B O   1 
HETATM 3911 O O   . HOH D 2 .   ? -11.754 36.815 45.478 1.00 39.50 ? 351 HOH B O   1 
HETATM 3912 O O   . HOH D 2 .   ? -9.881  19.358 68.081 1.00 28.83 ? 352 HOH B O   1 
HETATM 3913 O O   . HOH D 2 .   ? -43.180 23.255 42.629 1.00 33.37 ? 353 HOH B O   1 
HETATM 3914 O O   . HOH D 2 .   ? -12.047 34.246 55.991 1.00 28.62 ? 354 HOH B O   1 
HETATM 3915 O O   . HOH D 2 .   ? -15.371 37.571 47.473 1.00 45.34 ? 355 HOH B O   1 
HETATM 3916 O O   . HOH D 2 .   ? -36.490 23.687 51.638 1.00 37.29 ? 356 HOH B O   1 
HETATM 3917 O O   . HOH D 2 .   ? -34.233 15.449 48.548 1.00 34.17 ? 357 HOH B O   1 
HETATM 3918 O O   . HOH D 2 .   ? -17.559 24.097 62.883 1.00 38.66 ? 358 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   THR 2   2   ?   ?   ?   A . n 
A 1 3   LEU 3   3   ?   ?   ?   A . n 
A 1 4   GLU 4   4   ?   ?   ?   A . n 
A 1 5   SER 5   5   5   SER SER A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   ASP 7   7   7   ASP ASP A . n 
A 1 8   ASN 8   8   8   ASN ASN A . n 
A 1 9   CYS 9   9   9   CYS CYS A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  VAL 11  11  11  VAL VAL A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  CYS 13  13  13  CYS CYS A . n 
A 1 14  PRO 14  14  14  PRO PRO A . n 
A 1 15  THR 15  15  15  THR THR A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  SER 18  18  18  SER SER A . n 
A 1 19  SER 19  19  19  SER SER A . n 
A 1 20  ASN 20  20  20  ASN ASN A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  ARG 25  25  25  ARG ARG A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  TYR 28  28  28  TYR TYR A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  LEU 30  30  30  LEU LEU A . n 
A 1 31  ASN 31  31  31  ASN ASN A . n 
A 1 32  ASN 32  32  32  ASN ASN A . n 
A 1 33  ASN 33  33  33  ASN ASN A . n 
A 1 34  SER 34  34  34  SER SER A . n 
A 1 35  THR 35  35  35  THR THR A . n 
A 1 36  THR 36  36  36  THR THR A . n 
A 1 37  LYS 37  37  37  LYS LYS A . n 
A 1 38  PHE 38  38  38  PHE PHE A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  ASN 40  40  40  ASN ASN A . n 
A 1 41  TRP 41  41  41  TRP TRP A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  ALA 43  43  43  ALA ALA A . n 
A 1 44  TYR 44  44  44  TYR TYR A . n 
A 1 45  HIS 45  45  45  HIS HIS A . n 
A 1 46  ILE 46  46  46  ILE ILE A . n 
A 1 47  THR 47  47  47  THR THR A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  ALA 52  52  52  ALA ALA A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  ARG 57  57  57  ARG ARG A . n 
A 1 58  ASN 58  58  58  ASN ASN A . n 
A 1 59  TRP 59  59  59  TRP TRP A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  THR 61  61  61  THR THR A . n 
A 1 62  ASP 62  62  62  ASP ASP A . n 
A 1 63  PRO 63  63  63  PRO PRO A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  PRO 67  67  67  PRO PRO A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  PRO 73  73  73  PRO PRO A . n 
A 1 74  ALA 74  74  74  ALA ALA A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  THR 77  77  77  THR THR A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  ASN 80  80  80  ASN ASN A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  ARG 87  87  87  ARG ARG A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  HIS 89  89  89  HIS HIS A . n 
A 1 90  GLN 90  90  90  GLN GLN A . n 
A 1 91  ALA 91  91  91  ALA ALA A . n 
A 1 92  PRO 92  92  92  PRO PRO A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  SER 95  95  95  SER SER A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 SER 100 100 100 SER SER A . n 
A 1 101 ASP 101 101 101 ASP ASP A . n 
A 1 102 TRP 102 102 102 TRP TRP A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 SER 104 104 104 SER SER A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 TYR 107 107 107 TYR TYR A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 ASN 110 110 110 ASN ASN A . n 
A 1 111 ILE 111 111 111 ILE ILE A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 GLN 114 114 114 GLN GLN A . n 
A 1 115 LYS 115 115 115 LYS LYS A . n 
A 1 116 SER 116 116 116 SER SER A . n 
A 1 117 ASP 117 117 117 ASP ASP A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 ASN 119 119 119 ASN ASN A . n 
A 1 120 GLN 120 120 120 GLN GLN A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 TRP 123 123 123 TRP TRP A . n 
A 1 124 ALA 124 124 124 ALA ALA A . n 
A 1 125 ARG 125 125 125 ARG ARG A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 GLN 129 129 129 GLN GLN A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 ARG 131 131 131 ARG ARG A . n 
A 1 132 LYS 132 132 132 LYS LYS A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 ILE 134 134 134 ILE ILE A . n 
A 1 135 ASP 135 135 135 ASP ASP A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 ASP 138 138 138 ASP ASP A . n 
A 1 139 ILE 139 139 139 ILE ILE A . n 
A 1 140 SER 140 140 140 SER SER A . n 
A 1 141 SER 141 141 141 SER SER A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 TYR 143 143 143 TYR TYR A . n 
A 1 144 THR 144 144 144 THR THR A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 THR 146 146 146 THR THR A . n 
A 1 147 GLY 147 147 147 GLY GLY A . n 
A 1 148 PRO 148 148 148 PRO PRO A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 TYR 150 150 150 TYR TYR A . n 
A 1 151 GLU 151 151 151 GLU GLU A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 ASP 153 153 153 ASP ASP A . n 
A 1 154 MET 154 154 154 MET MET A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 LYS 156 156 156 LYS LYS A . n 
A 1 157 LEU 157 157 157 LEU LEU A . n 
A 1 158 PRO 158 158 158 PRO PRO A . n 
A 1 159 GLY 159 159 159 GLY GLY A . n 
A 1 160 THR 160 160 160 THR THR A . n 
A 1 161 GLN 161 161 161 GLN GLN A . n 
A 1 162 LYS 162 162 162 LYS LYS A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 HIS 164 164 164 HIS HIS A . n 
A 1 165 THR 165 165 165 THR THR A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 PRO 167 167 167 PRO PRO A . n 
A 1 168 SER 168 168 168 SER SER A . n 
A 1 169 ALA 169 169 169 ALA ALA A . n 
A 1 170 TYR 170 170 170 TYR TYR A . n 
A 1 171 TRP 171 171 171 TRP TRP A . n 
A 1 172 LYS 172 172 172 LYS LYS A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 PHE 175 175 175 PHE PHE A . n 
A 1 176 ILE 176 176 176 ILE ILE A . n 
A 1 177 ASN 177 177 177 ASN ASN A . n 
A 1 178 ASN 178 178 178 ASN ASN A . n 
A 1 179 SER 179 179 179 SER SER A . n 
A 1 180 PRO 180 180 180 PRO PRO A . n 
A 1 181 ALA 181 181 181 ALA ALA A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 HIS 184 184 184 HIS HIS A . n 
A 1 185 TYR 185 185 185 TYR TYR A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 ALA 187 187 187 ALA ALA A . n 
A 1 188 PHE 188 188 188 PHE PHE A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 ASP 191 191 191 ASP ASP A . n 
A 1 192 GLN 192 192 192 GLN GLN A . n 
A 1 193 ASN 193 193 193 ASN ASN A . n 
A 1 194 THR 194 194 194 THR THR A . n 
A 1 195 PRO 195 195 195 PRO PRO A . n 
A 1 196 LYS 196 196 196 LYS LYS A . n 
A 1 197 GLY 197 197 197 GLY GLY A . n 
A 1 198 ALA 198 198 198 ALA ALA A . n 
A 1 199 ASP 199 199 199 ASP ASP A . n 
A 1 200 PHE 200 200 200 PHE PHE A . n 
A 1 201 CYS 201 201 201 CYS CYS A . n 
A 1 202 GLN 202 202 202 GLN GLN A . n 
A 1 203 PHE 203 203 203 PHE PHE A . n 
A 1 204 ARG 204 204 204 ARG ARG A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 THR 206 206 206 THR THR A . n 
A 1 207 VAL 207 207 207 VAL VAL A . n 
A 1 208 ASP 208 208 208 ASP ASP A . n 
A 1 209 GLU 209 209 209 GLU GLU A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 GLU 211 211 211 GLU GLU A . n 
A 1 212 LYS 212 212 212 LYS LYS A . n 
A 1 213 ARG 213 213 213 ARG ARG A . n 
A 1 214 THR 214 214 214 THR THR A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 ILE 217 217 217 ILE ILE A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 TRP 219 219 219 TRP TRP A . n 
A 1 220 ALA 220 220 220 ALA ALA A . n 
A 1 221 GLY 221 221 221 GLY GLY A . n 
A 1 222 LEU 222 222 222 LEU LEU A . n 
A 1 223 PRO 223 223 223 PRO PRO A . n 
A 1 224 ASP 224 224 224 ASP ASP A . n 
A 1 225 ASP 225 225 225 ASP ASP A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 GLN 227 227 227 GLN GLN A . n 
A 1 228 ALA 228 228 228 ALA ALA A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 LYS 231 231 231 LYS LYS A . n 
A 1 232 SER 232 232 232 SER SER A . n 
A 1 233 LYS 233 233 233 LYS LYS A . n 
A 1 234 PRO 234 234 234 PRO PRO A . n 
A 1 235 GLY 235 235 235 GLY GLY A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 LEU 237 237 237 LEU LEU A . n 
A 1 238 PRO 238 238 238 PRO PRO A . n 
A 1 239 GLU 239 239 239 GLU GLU A . n 
A 1 240 LEU 240 240 240 LEU LEU A . n 
A 1 241 MET 241 241 241 MET MET A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 CYS 243 243 243 CYS CYS A . n 
A 1 244 LYS 244 244 244 LYS LYS A . n 
A 1 245 ASN 245 245 245 ASN ASN A . n 
B 1 1   ASP 1   1   ?   ?   ?   B . n 
B 1 2   THR 2   2   ?   ?   ?   B . n 
B 1 3   LEU 3   3   ?   ?   ?   B . n 
B 1 4   GLU 4   4   ?   ?   ?   B . n 
B 1 5   SER 5   5   5   SER SER B . n 
B 1 6   ILE 6   6   6   ILE ILE B . n 
B 1 7   ASP 7   7   7   ASP ASP B . n 
B 1 8   ASN 8   8   8   ASN ASN B . n 
B 1 9   CYS 9   9   9   CYS CYS B . n 
B 1 10  ALA 10  10  10  ALA ALA B . n 
B 1 11  VAL 11  11  11  VAL VAL B . n 
B 1 12  GLY 12  12  12  GLY GLY B . n 
B 1 13  CYS 13  13  13  CYS CYS B . n 
B 1 14  PRO 14  14  14  PRO PRO B . n 
B 1 15  THR 15  15  15  THR THR B . n 
B 1 16  GLY 16  16  16  GLY GLY B . n 
B 1 17  GLY 17  17  17  GLY GLY B . n 
B 1 18  SER 18  18  18  SER SER B . n 
B 1 19  SER 19  19  19  SER SER B . n 
B 1 20  ASN 20  20  20  ASN ASN B . n 
B 1 21  VAL 21  21  21  VAL VAL B . n 
B 1 22  SER 22  22  22  SER SER B . n 
B 1 23  ILE 23  23  23  ILE ILE B . n 
B 1 24  VAL 24  24  24  VAL VAL B . n 
B 1 25  ARG 25  25  25  ARG ARG B . n 
B 1 26  HIS 26  26  26  HIS HIS B . n 
B 1 27  ALA 27  27  27  ALA ALA B . n 
B 1 28  TYR 28  28  28  TYR TYR B . n 
B 1 29  THR 29  29  29  THR THR B . n 
B 1 30  LEU 30  30  30  LEU LEU B . n 
B 1 31  ASN 31  31  31  ASN ASN B . n 
B 1 32  ASN 32  32  32  ASN ASN B . n 
B 1 33  ASN 33  33  33  ASN ASN B . n 
B 1 34  SER 34  34  34  SER SER B . n 
B 1 35  THR 35  35  35  THR THR B . n 
B 1 36  THR 36  36  36  THR THR B . n 
B 1 37  LYS 37  37  37  LYS LYS B . n 
B 1 38  PHE 38  38  38  PHE PHE B . n 
B 1 39  ALA 39  39  39  ALA ALA B . n 
B 1 40  ASN 40  40  40  ASN ASN B . n 
B 1 41  TRP 41  41  41  TRP TRP B . n 
B 1 42  VAL 42  42  42  VAL VAL B . n 
B 1 43  ALA 43  43  43  ALA ALA B . n 
B 1 44  TYR 44  44  44  TYR TYR B . n 
B 1 45  HIS 45  45  45  HIS HIS B . n 
B 1 46  ILE 46  46  46  ILE ILE B . n 
B 1 47  THR 47  47  47  THR THR B . n 
B 1 48  LYS 48  48  48  LYS LYS B . n 
B 1 49  ASP 49  49  49  ASP ASP B . n 
B 1 50  THR 50  50  50  THR THR B . n 
B 1 51  PRO 51  51  51  PRO PRO B . n 
B 1 52  ALA 52  52  52  ALA ALA B . n 
B 1 53  SER 53  53  53  SER SER B . n 
B 1 54  GLY 54  54  54  GLY GLY B . n 
B 1 55  LYS 55  55  55  LYS LYS B . n 
B 1 56  THR 56  56  56  THR THR B . n 
B 1 57  ARG 57  57  57  ARG ARG B . n 
B 1 58  ASN 58  58  58  ASN ASN B . n 
B 1 59  TRP 59  59  59  TRP TRP B . n 
B 1 60  LYS 60  60  60  LYS LYS B . n 
B 1 61  THR 61  61  61  THR THR B . n 
B 1 62  ASP 62  62  62  ASP ASP B . n 
B 1 63  PRO 63  63  63  PRO PRO B . n 
B 1 64  ALA 64  64  64  ALA ALA B . n 
B 1 65  LEU 65  65  65  LEU LEU B . n 
B 1 66  ASN 66  66  66  ASN ASN B . n 
B 1 67  PRO 67  67  67  PRO PRO B . n 
B 1 68  ALA 68  68  68  ALA ALA B . n 
B 1 69  ASP 69  69  69  ASP ASP B . n 
B 1 70  THR 70  70  70  THR THR B . n 
B 1 71  LEU 71  71  71  LEU LEU B . n 
B 1 72  ALA 72  72  72  ALA ALA B . n 
B 1 73  PRO 73  73  73  PRO PRO B . n 
B 1 74  ALA 74  74  74  ALA ALA B . n 
B 1 75  ASP 75  75  75  ASP ASP B . n 
B 1 76  TYR 76  76  76  TYR TYR B . n 
B 1 77  THR 77  77  77  THR THR B . n 
B 1 78  GLY 78  78  78  GLY GLY B . n 
B 1 79  ALA 79  79  79  ALA ALA B . n 
B 1 80  ASN 80  80  80  ASN ASN B . n 
B 1 81  ALA 81  81  81  ALA ALA B . n 
B 1 82  ALA 82  82  82  ALA ALA B . n 
B 1 83  LEU 83  83  83  LEU LEU B . n 
B 1 84  LYS 84  84  84  LYS LYS B . n 
B 1 85  VAL 85  85  85  VAL VAL B . n 
B 1 86  ASP 86  86  86  ASP ASP B . n 
B 1 87  ARG 87  87  87  ARG ARG B . n 
B 1 88  GLY 88  88  88  GLY GLY B . n 
B 1 89  HIS 89  89  89  HIS HIS B . n 
B 1 90  GLN 90  90  90  GLN GLN B . n 
B 1 91  ALA 91  91  91  ALA ALA B . n 
B 1 92  PRO 92  92  92  PRO PRO B . n 
B 1 93  LEU 93  93  93  LEU LEU B . n 
B 1 94  ALA 94  94  94  ALA ALA B . n 
B 1 95  SER 95  95  95  SER SER B . n 
B 1 96  LEU 96  96  96  LEU LEU B . n 
B 1 97  ALA 97  97  97  ALA ALA B . n 
B 1 98  GLY 98  98  98  GLY GLY B . n 
B 1 99  VAL 99  99  99  VAL VAL B . n 
B 1 100 SER 100 100 100 SER SER B . n 
B 1 101 ASP 101 101 101 ASP ASP B . n 
B 1 102 TRP 102 102 102 TRP TRP B . n 
B 1 103 GLU 103 103 103 GLU GLU B . n 
B 1 104 SER 104 104 104 SER SER B . n 
B 1 105 LEU 105 105 105 LEU LEU B . n 
B 1 106 ASN 106 106 106 ASN ASN B . n 
B 1 107 TYR 107 107 107 TYR TYR B . n 
B 1 108 LEU 108 108 108 LEU LEU B . n 
B 1 109 SER 109 109 109 SER SER B . n 
B 1 110 ASN 110 110 110 ASN ASN B . n 
B 1 111 ILE 111 111 111 ILE ILE B . n 
B 1 112 THR 112 112 112 THR THR B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 GLN 114 114 114 GLN GLN B . n 
B 1 115 LYS 115 115 115 LYS LYS B . n 
B 1 116 SER 116 116 116 SER SER B . n 
B 1 117 ASP 117 117 117 ASP ASP B . n 
B 1 118 LEU 118 118 118 LEU LEU B . n 
B 1 119 ASN 119 119 119 ASN ASN B . n 
B 1 120 GLN 120 120 120 GLN GLN B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 ALA 122 122 122 ALA ALA B . n 
B 1 123 TRP 123 123 123 TRP TRP B . n 
B 1 124 ALA 124 124 124 ALA ALA B . n 
B 1 125 ARG 125 125 125 ARG ARG B . n 
B 1 126 LEU 126 126 126 LEU LEU B . n 
B 1 127 GLU 127 127 127 GLU GLU B . n 
B 1 128 ASP 128 128 128 ASP ASP B . n 
B 1 129 GLN 129 129 129 GLN GLN B . n 
B 1 130 GLU 130 130 130 GLU GLU B . n 
B 1 131 ARG 131 131 131 ARG ARG B . n 
B 1 132 LYS 132 132 132 LYS LYS B . n 
B 1 133 LEU 133 133 133 LEU LEU B . n 
B 1 134 ILE 134 134 134 ILE ILE B . n 
B 1 135 ASP 135 135 135 ASP ASP B . n 
B 1 136 ARG 136 136 136 ARG ARG B . n 
B 1 137 ALA 137 137 137 ALA ALA B . n 
B 1 138 ASP 138 138 138 ASP ASP B . n 
B 1 139 ILE 139 139 139 ILE ILE B . n 
B 1 140 SER 140 140 140 SER SER B . n 
B 1 141 SER 141 141 141 SER SER B . n 
B 1 142 VAL 142 142 142 VAL VAL B . n 
B 1 143 TYR 143 143 143 TYR TYR B . n 
B 1 144 THR 144 144 144 THR THR B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 THR 146 146 146 THR THR B . n 
B 1 147 GLY 147 147 147 GLY GLY B . n 
B 1 148 PRO 148 148 148 PRO PRO B . n 
B 1 149 LEU 149 149 149 LEU LEU B . n 
B 1 150 TYR 150 150 150 TYR TYR B . n 
B 1 151 GLU 151 151 151 GLU GLU B . n 
B 1 152 ARG 152 152 152 ARG ARG B . n 
B 1 153 ASP 153 153 153 ASP ASP B . n 
B 1 154 MET 154 154 154 MET MET B . n 
B 1 155 GLY 155 155 155 GLY GLY B . n 
B 1 156 LYS 156 156 156 LYS LYS B . n 
B 1 157 LEU 157 157 157 LEU LEU B . n 
B 1 158 PRO 158 158 158 PRO PRO B . n 
B 1 159 GLY 159 159 159 GLY GLY B . n 
B 1 160 THR 160 160 160 THR THR B . n 
B 1 161 GLN 161 161 161 GLN GLN B . n 
B 1 162 LYS 162 162 162 LYS LYS B . n 
B 1 163 ALA 163 163 163 ALA ALA B . n 
B 1 164 HIS 164 164 164 HIS HIS B . n 
B 1 165 THR 165 165 165 THR THR B . n 
B 1 166 ILE 166 166 166 ILE ILE B . n 
B 1 167 PRO 167 167 167 PRO PRO B . n 
B 1 168 SER 168 168 168 SER SER B . n 
B 1 169 ALA 169 169 169 ALA ALA B . n 
B 1 170 TYR 170 170 170 TYR TYR B . n 
B 1 171 TRP 171 171 171 TRP TRP B . n 
B 1 172 LYS 172 172 172 LYS LYS B . n 
B 1 173 VAL 173 173 173 VAL VAL B . n 
B 1 174 ILE 174 174 174 ILE ILE B . n 
B 1 175 PHE 175 175 175 PHE PHE B . n 
B 1 176 ILE 176 176 176 ILE ILE B . n 
B 1 177 ASN 177 177 177 ASN ASN B . n 
B 1 178 ASN 178 178 178 ASN ASN B . n 
B 1 179 SER 179 179 179 SER SER B . n 
B 1 180 PRO 180 180 180 PRO PRO B . n 
B 1 181 ALA 181 181 181 ALA ALA B . n 
B 1 182 VAL 182 182 182 VAL VAL B . n 
B 1 183 ASN 183 183 183 ASN ASN B . n 
B 1 184 HIS 184 184 184 HIS HIS B . n 
B 1 185 TYR 185 185 185 TYR TYR B . n 
B 1 186 ALA 186 186 186 ALA ALA B . n 
B 1 187 ALA 187 187 187 ALA ALA B . n 
B 1 188 PHE 188 188 188 PHE PHE B . n 
B 1 189 LEU 189 189 189 LEU LEU B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 ASP 191 191 191 ASP ASP B . n 
B 1 192 GLN 192 192 192 GLN GLN B . n 
B 1 193 ASN 193 193 193 ASN ASN B . n 
B 1 194 THR 194 194 194 THR THR B . n 
B 1 195 PRO 195 195 195 PRO PRO B . n 
B 1 196 LYS 196 196 196 LYS LYS B . n 
B 1 197 GLY 197 197 197 GLY GLY B . n 
B 1 198 ALA 198 198 198 ALA ALA B . n 
B 1 199 ASP 199 199 199 ASP ASP B . n 
B 1 200 PHE 200 200 200 PHE PHE B . n 
B 1 201 CYS 201 201 201 CYS CYS B . n 
B 1 202 GLN 202 202 202 GLN GLN B . n 
B 1 203 PHE 203 203 203 PHE PHE B . n 
B 1 204 ARG 204 204 204 ARG ARG B . n 
B 1 205 VAL 205 205 205 VAL VAL B . n 
B 1 206 THR 206 206 206 THR THR B . n 
B 1 207 VAL 207 207 207 VAL VAL B . n 
B 1 208 ASP 208 208 208 ASP ASP B . n 
B 1 209 GLU 209 209 209 GLU GLU B . n 
B 1 210 ILE 210 210 210 ILE ILE B . n 
B 1 211 GLU 211 211 211 GLU GLU B . n 
B 1 212 LYS 212 212 212 LYS LYS B . n 
B 1 213 ARG 213 213 213 ARG ARG B . n 
B 1 214 THR 214 214 214 THR THR B . n 
B 1 215 GLY 215 215 215 GLY GLY B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 ILE 217 217 217 ILE ILE B . n 
B 1 218 ILE 218 218 218 ILE ILE B . n 
B 1 219 TRP 219 219 219 TRP TRP B . n 
B 1 220 ALA 220 220 220 ALA ALA B . n 
B 1 221 GLY 221 221 221 GLY GLY B . n 
B 1 222 LEU 222 222 222 LEU LEU B . n 
B 1 223 PRO 223 223 223 PRO PRO B . n 
B 1 224 ASP 224 224 224 ASP ASP B . n 
B 1 225 ASP 225 225 225 ASP ASP B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 GLN 227 227 227 GLN GLN B . n 
B 1 228 ALA 228 228 228 ALA ALA B . n 
B 1 229 SER 229 229 229 SER SER B . n 
B 1 230 LEU 230 230 230 LEU LEU B . n 
B 1 231 LYS 231 231 231 LYS LYS B . n 
B 1 232 SER 232 232 232 SER SER B . n 
B 1 233 LYS 233 233 233 LYS LYS B . n 
B 1 234 PRO 234 234 234 PRO PRO B . n 
B 1 235 GLY 235 235 235 GLY GLY B . n 
B 1 236 VAL 236 236 236 VAL VAL B . n 
B 1 237 LEU 237 237 237 LEU LEU B . n 
B 1 238 PRO 238 238 238 PRO PRO B . n 
B 1 239 GLU 239 239 239 GLU GLU B . n 
B 1 240 LEU 240 240 240 LEU LEU B . n 
B 1 241 MET 241 241 241 MET MET B . n 
B 1 242 GLY 242 242 242 GLY GLY B . n 
B 1 243 CYS 243 243 243 CYS CYS B . n 
B 1 244 LYS 244 244 244 LYS LYS B . n 
B 1 245 ASN 245 245 245 ASN ASN B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1   246 1   HOH HOH A . 
C 2 HOH 2   247 2   HOH HOH A . 
C 2 HOH 3   248 8   HOH HOH A . 
C 2 HOH 4   249 10  HOH HOH A . 
C 2 HOH 5   250 13  HOH HOH A . 
C 2 HOH 6   251 14  HOH HOH A . 
C 2 HOH 7   252 16  HOH HOH A . 
C 2 HOH 8   253 19  HOH HOH A . 
C 2 HOH 9   254 20  HOH HOH A . 
C 2 HOH 10  255 21  HOH HOH A . 
C 2 HOH 11  256 22  HOH HOH A . 
C 2 HOH 12  257 23  HOH HOH A . 
C 2 HOH 13  258 24  HOH HOH A . 
C 2 HOH 14  259 27  HOH HOH A . 
C 2 HOH 15  260 31  HOH HOH A . 
C 2 HOH 16  261 32  HOH HOH A . 
C 2 HOH 17  262 33  HOH HOH A . 
C 2 HOH 18  263 35  HOH HOH A . 
C 2 HOH 19  264 39  HOH HOH A . 
C 2 HOH 20  265 41  HOH HOH A . 
C 2 HOH 21  266 42  HOH HOH A . 
C 2 HOH 22  267 43  HOH HOH A . 
C 2 HOH 23  268 46  HOH HOH A . 
C 2 HOH 24  269 48  HOH HOH A . 
C 2 HOH 25  270 49  HOH HOH A . 
C 2 HOH 26  271 50  HOH HOH A . 
C 2 HOH 27  272 52  HOH HOH A . 
C 2 HOH 28  273 53  HOH HOH A . 
C 2 HOH 29  274 54  HOH HOH A . 
C 2 HOH 30  275 60  HOH HOH A . 
C 2 HOH 31  276 62  HOH HOH A . 
C 2 HOH 32  277 66  HOH HOH A . 
C 2 HOH 33  278 69  HOH HOH A . 
C 2 HOH 34  279 70  HOH HOH A . 
C 2 HOH 35  280 71  HOH HOH A . 
C 2 HOH 36  281 72  HOH HOH A . 
C 2 HOH 37  282 73  HOH HOH A . 
C 2 HOH 38  283 76  HOH HOH A . 
C 2 HOH 39  284 77  HOH HOH A . 
C 2 HOH 40  285 81  HOH HOH A . 
C 2 HOH 41  286 83  HOH HOH A . 
C 2 HOH 42  287 84  HOH HOH A . 
C 2 HOH 43  288 85  HOH HOH A . 
C 2 HOH 44  289 86  HOH HOH A . 
C 2 HOH 45  290 89  HOH HOH A . 
C 2 HOH 46  291 94  HOH HOH A . 
C 2 HOH 47  292 97  HOH HOH A . 
C 2 HOH 48  293 98  HOH HOH A . 
C 2 HOH 49  294 99  HOH HOH A . 
C 2 HOH 50  295 101 HOH HOH A . 
C 2 HOH 51  296 102 HOH HOH A . 
C 2 HOH 52  297 103 HOH HOH A . 
C 2 HOH 53  298 105 HOH HOH A . 
C 2 HOH 54  299 108 HOH HOH A . 
C 2 HOH 55  300 109 HOH HOH A . 
C 2 HOH 56  301 111 HOH HOH A . 
C 2 HOH 57  302 112 HOH HOH A . 
C 2 HOH 58  303 113 HOH HOH A . 
C 2 HOH 59  304 116 HOH HOH A . 
C 2 HOH 60  305 118 HOH HOH A . 
C 2 HOH 61  306 121 HOH HOH A . 
C 2 HOH 62  307 123 HOH HOH A . 
C 2 HOH 63  308 124 HOH HOH A . 
C 2 HOH 64  309 125 HOH HOH A . 
C 2 HOH 65  310 126 HOH HOH A . 
C 2 HOH 66  311 130 HOH HOH A . 
C 2 HOH 67  312 131 HOH HOH A . 
C 2 HOH 68  313 132 HOH HOH A . 
C 2 HOH 69  314 133 HOH HOH A . 
C 2 HOH 70  315 134 HOH HOH A . 
C 2 HOH 71  316 135 HOH HOH A . 
C 2 HOH 72  317 139 HOH HOH A . 
C 2 HOH 73  318 140 HOH HOH A . 
C 2 HOH 74  319 141 HOH HOH A . 
C 2 HOH 75  320 142 HOH HOH A . 
C 2 HOH 76  321 149 HOH HOH A . 
C 2 HOH 77  322 150 HOH HOH A . 
C 2 HOH 78  323 151 HOH HOH A . 
C 2 HOH 79  324 154 HOH HOH A . 
C 2 HOH 80  325 163 HOH HOH A . 
C 2 HOH 81  326 164 HOH HOH A . 
C 2 HOH 82  327 165 HOH HOH A . 
C 2 HOH 83  328 168 HOH HOH A . 
C 2 HOH 84  329 169 HOH HOH A . 
C 2 HOH 85  330 174 HOH HOH A . 
C 2 HOH 86  331 176 HOH HOH A . 
C 2 HOH 87  332 177 HOH HOH A . 
C 2 HOH 88  333 179 HOH HOH A . 
C 2 HOH 89  334 183 HOH HOH A . 
C 2 HOH 90  335 184 HOH HOH A . 
C 2 HOH 91  336 185 HOH HOH A . 
C 2 HOH 92  337 186 HOH HOH A . 
C 2 HOH 93  338 187 HOH HOH A . 
C 2 HOH 94  339 188 HOH HOH A . 
C 2 HOH 95  340 190 HOH HOH A . 
C 2 HOH 96  341 192 HOH HOH A . 
C 2 HOH 97  342 194 HOH HOH A . 
C 2 HOH 98  343 195 HOH HOH A . 
C 2 HOH 99  344 197 HOH HOH A . 
C 2 HOH 100 345 198 HOH HOH A . 
C 2 HOH 101 346 201 HOH HOH A . 
C 2 HOH 102 347 203 HOH HOH A . 
C 2 HOH 103 348 204 HOH HOH A . 
C 2 HOH 104 349 207 HOH HOH A . 
C 2 HOH 105 350 208 HOH HOH A . 
C 2 HOH 106 351 210 HOH HOH A . 
C 2 HOH 107 352 211 HOH HOH A . 
C 2 HOH 108 353 212 HOH HOH A . 
C 2 HOH 109 354 214 HOH HOH A . 
C 2 HOH 110 355 219 HOH HOH A . 
C 2 HOH 111 356 223 HOH HOH A . 
D 2 HOH 1   246 3   HOH HOH B . 
D 2 HOH 2   247 4   HOH HOH B . 
D 2 HOH 3   248 5   HOH HOH B . 
D 2 HOH 4   249 6   HOH HOH B . 
D 2 HOH 5   250 7   HOH HOH B . 
D 2 HOH 6   251 9   HOH HOH B . 
D 2 HOH 7   252 11  HOH HOH B . 
D 2 HOH 8   253 12  HOH HOH B . 
D 2 HOH 9   254 15  HOH HOH B . 
D 2 HOH 10  255 17  HOH HOH B . 
D 2 HOH 11  256 18  HOH HOH B . 
D 2 HOH 12  257 25  HOH HOH B . 
D 2 HOH 13  258 26  HOH HOH B . 
D 2 HOH 14  259 28  HOH HOH B . 
D 2 HOH 15  260 29  HOH HOH B . 
D 2 HOH 16  261 30  HOH HOH B . 
D 2 HOH 17  262 34  HOH HOH B . 
D 2 HOH 18  263 36  HOH HOH B . 
D 2 HOH 19  264 37  HOH HOH B . 
D 2 HOH 20  265 38  HOH HOH B . 
D 2 HOH 21  266 40  HOH HOH B . 
D 2 HOH 22  267 44  HOH HOH B . 
D 2 HOH 23  268 45  HOH HOH B . 
D 2 HOH 24  269 47  HOH HOH B . 
D 2 HOH 25  270 51  HOH HOH B . 
D 2 HOH 26  271 55  HOH HOH B . 
D 2 HOH 27  272 56  HOH HOH B . 
D 2 HOH 28  273 57  HOH HOH B . 
D 2 HOH 29  274 58  HOH HOH B . 
D 2 HOH 30  275 59  HOH HOH B . 
D 2 HOH 31  276 61  HOH HOH B . 
D 2 HOH 32  277 63  HOH HOH B . 
D 2 HOH 33  278 64  HOH HOH B . 
D 2 HOH 34  279 65  HOH HOH B . 
D 2 HOH 35  280 67  HOH HOH B . 
D 2 HOH 36  281 68  HOH HOH B . 
D 2 HOH 37  282 74  HOH HOH B . 
D 2 HOH 38  283 75  HOH HOH B . 
D 2 HOH 39  284 78  HOH HOH B . 
D 2 HOH 40  285 79  HOH HOH B . 
D 2 HOH 41  286 80  HOH HOH B . 
D 2 HOH 42  287 82  HOH HOH B . 
D 2 HOH 43  288 87  HOH HOH B . 
D 2 HOH 44  289 88  HOH HOH B . 
D 2 HOH 45  290 90  HOH HOH B . 
D 2 HOH 46  291 91  HOH HOH B . 
D 2 HOH 47  292 92  HOH HOH B . 
D 2 HOH 48  293 93  HOH HOH B . 
D 2 HOH 49  294 95  HOH HOH B . 
D 2 HOH 50  295 96  HOH HOH B . 
D 2 HOH 51  296 100 HOH HOH B . 
D 2 HOH 52  297 104 HOH HOH B . 
D 2 HOH 53  298 106 HOH HOH B . 
D 2 HOH 54  299 107 HOH HOH B . 
D 2 HOH 55  300 110 HOH HOH B . 
D 2 HOH 56  301 114 HOH HOH B . 
D 2 HOH 57  302 115 HOH HOH B . 
D 2 HOH 58  303 117 HOH HOH B . 
D 2 HOH 59  304 119 HOH HOH B . 
D 2 HOH 60  305 120 HOH HOH B . 
D 2 HOH 61  306 122 HOH HOH B . 
D 2 HOH 62  307 127 HOH HOH B . 
D 2 HOH 63  308 128 HOH HOH B . 
D 2 HOH 64  309 129 HOH HOH B . 
D 2 HOH 65  310 136 HOH HOH B . 
D 2 HOH 66  311 137 HOH HOH B . 
D 2 HOH 67  312 138 HOH HOH B . 
D 2 HOH 68  313 143 HOH HOH B . 
D 2 HOH 69  314 144 HOH HOH B . 
D 2 HOH 70  315 145 HOH HOH B . 
D 2 HOH 71  316 146 HOH HOH B . 
D 2 HOH 72  317 147 HOH HOH B . 
D 2 HOH 73  318 148 HOH HOH B . 
D 2 HOH 74  319 152 HOH HOH B . 
D 2 HOH 75  320 153 HOH HOH B . 
D 2 HOH 76  321 155 HOH HOH B . 
D 2 HOH 77  322 156 HOH HOH B . 
D 2 HOH 78  323 157 HOH HOH B . 
D 2 HOH 79  324 158 HOH HOH B . 
D 2 HOH 80  325 159 HOH HOH B . 
D 2 HOH 81  326 160 HOH HOH B . 
D 2 HOH 82  327 161 HOH HOH B . 
D 2 HOH 83  328 162 HOH HOH B . 
D 2 HOH 84  329 166 HOH HOH B . 
D 2 HOH 85  330 167 HOH HOH B . 
D 2 HOH 86  331 170 HOH HOH B . 
D 2 HOH 87  332 171 HOH HOH B . 
D 2 HOH 88  333 172 HOH HOH B . 
D 2 HOH 89  334 173 HOH HOH B . 
D 2 HOH 90  335 175 HOH HOH B . 
D 2 HOH 91  336 178 HOH HOH B . 
D 2 HOH 92  337 180 HOH HOH B . 
D 2 HOH 93  338 181 HOH HOH B . 
D 2 HOH 94  339 182 HOH HOH B . 
D 2 HOH 95  340 189 HOH HOH B . 
D 2 HOH 96  341 191 HOH HOH B . 
D 2 HOH 97  342 193 HOH HOH B . 
D 2 HOH 98  343 196 HOH HOH B . 
D 2 HOH 99  344 199 HOH HOH B . 
D 2 HOH 100 345 200 HOH HOH B . 
D 2 HOH 101 346 202 HOH HOH B . 
D 2 HOH 102 347 205 HOH HOH B . 
D 2 HOH 103 348 206 HOH HOH B . 
D 2 HOH 104 349 209 HOH HOH B . 
D 2 HOH 105 350 213 HOH HOH B . 
D 2 HOH 106 351 215 HOH HOH B . 
D 2 HOH 107 352 216 HOH HOH B . 
D 2 HOH 108 353 217 HOH HOH B . 
D 2 HOH 109 354 218 HOH HOH B . 
D 2 HOH 110 355 220 HOH HOH B . 
D 2 HOH 111 356 221 HOH HOH B . 
D 2 HOH 112 357 222 HOH HOH B . 
D 2 HOH 113 358 224 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1740  ? 
1 MORE         -7    ? 
1 'SSA (A^2)'  18620 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1996-01-29 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-04-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            diffrn_detector 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_diffrn_detector.detector' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MADNES 'data collection' .   ? 1 
PROCOR 'data collection' .   ? 2 
XSCALE 'data scaling'    .   ? 3 
X-PLOR 'model building'  3.1 ? 4 
X-PLOR refinement        3.1 ? 5 
MADNES 'data reduction'  .   ? 6 
PROCOR 'data reduction'  .   ? 7 
X-PLOR phasing           3.1 ? 8 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA A LEU 30  ? ? CB A LEU 30  ? ? CG  A LEU 30  ? ? 129.61 115.30 14.31 2.30 N 
2 1 CB B ASP 199 ? ? CG B ASP 199 ? ? OD1 B ASP 199 ? ? 123.81 118.30 5.51  0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 10  ? ? 67.65   -46.41 
2  1 LYS A 37  ? ? 82.18   8.38   
3  1 GLN A 90  ? ? -84.92  -71.22 
4  1 ASP A 101 ? ? -105.53 42.71  
5  1 ASN A 177 ? ? 61.49   -99.61 
6  1 ALA B 10  ? ? 65.65   -43.92 
7  1 LYS B 37  ? ? 84.08   5.09   
8  1 GLN B 90  ? ? -84.82  -71.88 
9  1 ASP B 101 ? ? -106.91 44.38  
10 1 ASN B 177 ? ? 60.66   -95.78 
11 1 SER B 179 ? ? -170.04 145.30 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A GLN 161 ? CG  ? A GLN 161 CG  
2 1 Y 1 A GLN 161 ? CD  ? A GLN 161 CD  
3 1 Y 1 A GLN 161 ? OE1 ? A GLN 161 OE1 
4 1 Y 1 A GLN 161 ? NE2 ? A GLN 161 NE2 
5 1 Y 1 B GLN 161 ? CG  ? B GLN 161 CG  
6 1 Y 1 B GLN 161 ? CD  ? B GLN 161 CD  
7 1 Y 1 B GLN 161 ? OE1 ? B GLN 161 OE1 
8 1 Y 1 B GLN 161 ? NE2 ? B GLN 161 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 1 ? A ASP 1 
2 1 Y 1 A THR 2 ? A THR 2 
3 1 Y 1 A LEU 3 ? A LEU 3 
4 1 Y 1 A GLU 4 ? A GLU 4 
5 1 Y 1 B ASP 1 ? B ASP 1 
6 1 Y 1 B THR 2 ? B THR 2 
7 1 Y 1 B LEU 3 ? B LEU 3 
8 1 Y 1 B GLU 4 ? B GLU 4 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#