data_1SN8
# 
_entry.id   1SN8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SN8         
RCSB  RCSB021846   
WWPDB D_1000021846 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB  1SLJ 'solution structure'       unspecified 
BMRB 6122 'NMR assignment'           unspecified 
PDB  1SMX 'crystal structure native' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SN8 
_pdbx_database_status.recvd_initial_deposition_date   2004-03-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schubert, M.'      1 
'Edge, R.E.'        2 
'Lario, P.'         3 
'Cook, M.A.'        4 
'Strynadka, N.C.J.' 5 
'Mackie, G.A.'      6 
'McIntosh, L.P.'    7 
# 
_citation.id                        primary 
_citation.title                     
'Structural characterization of the RNase E S1 domain and identification of its oligonucleotide-binding and dimerization interfaces.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            341 
_citation.page_first                37 
_citation.page_last                 54 
_citation.year                      2004 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15312761 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2004.05.061 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Schubert, M.'    1 
primary 'Edge, R.E.'      2 
primary 'Lario, P.'       3 
primary 'Cook, M.A.'      4 
primary 'Strynadka, N.C.' 5 
primary 'Mackie, G.A.'    6 
primary 'McIntosh, L.P.'  7 
# 
_cell.entry_id           1SN8 
_cell.length_a           70.580 
_cell.length_b           70.580 
_cell.length_c           87.902 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SN8 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ribonuclease E' 10704.134 2   3.1.4.- ? 'S1 domain (residues 35-125)' ? 
2 non-polymer syn 'LEAD (II) ION'  207.200   2   ?       ? ?                             ? 
3 water       nat water            18.015    229 ?       ? ?                             ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RNase E' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMLEQKKANIYKGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPANYSAHGRPNIKDVLREGQEVIVQIDKEER
GNKGAALTTFISLAGS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMLEQKKANIYKGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPANYSAHGRPNIKDVLREGQEVIVQIDKEER
GNKGAALTTFISLAGS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  HIS n 
1 4  MET n 
1 5  LEU n 
1 6  GLU n 
1 7  GLN n 
1 8  LYS n 
1 9  LYS n 
1 10 ALA n 
1 11 ASN n 
1 12 ILE n 
1 13 TYR n 
1 14 LYS n 
1 15 GLY n 
1 16 LYS n 
1 17 ILE n 
1 18 THR n 
1 19 ARG n 
1 20 ILE n 
1 21 GLU n 
1 22 PRO n 
1 23 SER n 
1 24 LEU n 
1 25 GLU n 
1 26 ALA n 
1 27 ALA n 
1 28 PHE n 
1 29 VAL n 
1 30 ASP n 
1 31 TYR n 
1 32 GLY n 
1 33 ALA n 
1 34 GLU n 
1 35 ARG n 
1 36 HIS n 
1 37 GLY n 
1 38 PHE n 
1 39 LEU n 
1 40 PRO n 
1 41 LEU n 
1 42 LYS n 
1 43 GLU n 
1 44 ILE n 
1 45 ALA n 
1 46 ARG n 
1 47 GLU n 
1 48 TYR n 
1 49 PHE n 
1 50 PRO n 
1 51 ALA n 
1 52 ASN n 
1 53 TYR n 
1 54 SER n 
1 55 ALA n 
1 56 HIS n 
1 57 GLY n 
1 58 ARG n 
1 59 PRO n 
1 60 ASN n 
1 61 ILE n 
1 62 LYS n 
1 63 ASP n 
1 64 VAL n 
1 65 LEU n 
1 66 ARG n 
1 67 GLU n 
1 68 GLY n 
1 69 GLN n 
1 70 GLU n 
1 71 VAL n 
1 72 ILE n 
1 73 VAL n 
1 74 GLN n 
1 75 ILE n 
1 76 ASP n 
1 77 LYS n 
1 78 GLU n 
1 79 GLU n 
1 80 ARG n 
1 81 GLY n 
1 82 ASN n 
1 83 LYS n 
1 84 GLY n 
1 85 ALA n 
1 86 ALA n 
1 87 LEU n 
1 88 THR n 
1 89 THR n 
1 90 PHE n 
1 91 ILE n 
1 92 SER n 
1 93 LEU n 
1 94 ALA n 
1 95 GLY n 
1 96 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 'RNE, AMS, HMP1, B1084' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RNE_ECOLI 
_struct_ref.pdbx_db_accession          P21513 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EQKKANIYKGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPANYSAHGRPNIKDVLREGQEVIVQIDKEERGNKGA
ALTTFISLAGS
;
_struct_ref.pdbx_align_begin           35 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1SN8 A 6 ? 96 ? P21513 35 ? 125 ? 35 125 
2 1 1SN8 B 6 ? 96 ? P21513 35 ? 125 ? 35 125 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1SN8 GLY A 1 ? UNP P21513 ? ? 'CLONING ARTIFACT' 30 1  
1 1SN8 SER A 2 ? UNP P21513 ? ? 'CLONING ARTIFACT' 31 2  
1 1SN8 HIS A 3 ? UNP P21513 ? ? 'CLONING ARTIFACT' 32 3  
1 1SN8 MET A 4 ? UNP P21513 ? ? 'CLONING ARTIFACT' 33 4  
1 1SN8 LEU A 5 ? UNP P21513 ? ? 'CLONING ARTIFACT' 34 5  
2 1SN8 GLY B 1 ? UNP P21513 ? ? 'CLONING ARTIFACT' 30 6  
2 1SN8 SER B 2 ? UNP P21513 ? ? 'CLONING ARTIFACT' 31 7  
2 1SN8 HIS B 3 ? UNP P21513 ? ? 'CLONING ARTIFACT' 32 8  
2 1SN8 MET B 4 ? UNP P21513 ? ? 'CLONING ARTIFACT' 33 9  
2 1SN8 LEU B 5 ? UNP P21513 ? ? 'CLONING ARTIFACT' 34 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PB  non-polymer         . 'LEAD (II) ION' ? 'Pb 2'           207.200 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1SN8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   51.6 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      2.6 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'PEG 8000, sodium cacodylate, sodium acetate, glycerol, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2003-06-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si (111) double crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.947390 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X8C' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X8C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.947390 
# 
_reflns.entry_id                     1SN8 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            2.0 
_reflns.d_resolution_low             25.0 
_reflns.number_all                   15387 
_reflns.number_obs                   15387 
_reflns.percent_possible_obs         98.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.091 
_reflns.pdbx_netI_over_sigmaI        17.5 
_reflns.B_iso_Wilson_estimate        22.98 
_reflns.pdbx_redundancy              6.925 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.07 
_reflns_shell.percent_possible_all   86.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.338 
_reflns_shell.meanI_over_sigI_obs    2.6 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1SN8 
_refine.ls_number_reflns_obs                     14555 
_refine.ls_number_reflns_all                     14555 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             25.00 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    98.49 
_refine.ls_R_factor_obs                          0.18485 
_refine.ls_R_factor_all                          0.18485 
_refine.ls_R_factor_R_work                       0.18229 
_refine.ls_R_factor_R_free                       0.23223 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  783 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.952 
_refine.correlation_coeff_Fo_to_Fc_free          0.928 
_refine.B_iso_mean                               20.749 
_refine.aniso_B[1][1]                            0.90 
_refine.aniso_B[2][2]                            0.90 
_refine.aniso_B[3][3]                            -1.79 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.160 
_refine.pdbx_overall_ESU_R_Free                  0.155 
_refine.overall_SU_ML                            0.105 
_refine.overall_SU_B                             3.841 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1327 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             229 
_refine_hist.number_atoms_total               1558 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        25.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.014 0.021 ? 1336 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.002 0.020 ? 1227 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.417 1.965 ? 1801 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.746 3.000 ? 2852 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.945 5.000 ? 166  'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.083 0.200 ? 196  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.006 0.020 ? 1500 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.003 0.020 ? 273  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.206 0.200 ? 211  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.250 0.200 ? 1384 'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.086 0.200 ? 843  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.173 0.200 ? 150  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.141 0.200 ? 7    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.286 0.200 ? 67   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.157 0.200 ? 26   'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.946 1.500 ? 834  'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.752 2.000 ? 1331 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.519 3.000 ? 502  'X-RAY DIFFRACTION' ? 
r_scangle_it             4.315 4.500 ? 470  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.000 
_refine_ls_shell.d_res_low                        2.052 
_refine_ls_shell.number_reflns_R_work             906 
_refine_ls_shell.R_factor_R_work                  0.239 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.315 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             34 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1SN8 
_struct.title                     'Crystal structure of the S1 domain of RNase E from E. coli (Pb derivative)' 
_struct.pdbx_descriptor           'Ribonuclease E (E.C.3.1.4.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SN8 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'OB-fold, RNA-binding, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 22 ? LEU A 24 ? PRO A 51 LEU A 53 5 ? 3 
HELX_P HELX_P2 2 LYS A 42 ? ILE A 44 ? LYS A 71 ILE A 73 5 ? 3 
HELX_P HELX_P3 3 ALA A 45 ? PHE A 49 ? ALA A 74 PHE A 78 5 ? 5 
HELX_P HELX_P4 4 ASN A 60 ? VAL A 64 ? ASN A 89 VAL A 93 5 ? 5 
HELX_P HELX_P5 5 PRO B 22 ? LEU B 24 ? PRO B 51 LEU B 53 5 ? 3 
HELX_P HELX_P6 6 LYS B 42 ? ILE B 44 ? LYS B 71 ILE B 73 5 ? 3 
HELX_P HELX_P7 7 ALA B 45 ? PHE B 49 ? ALA B 74 PHE B 78 5 ? 5 
HELX_P HELX_P8 8 ASN B 60 ? LEU B 65 ? ASN B 89 LEU B 94 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? C PB . PB ? ? ? 1_555 A HIS 56 NE2 ? ? A PB 604 A HIS 85  1_555 ? ? ? ? ? ? ? 2.491 ? 
metalc2 metalc ? ? D PB . PB ? ? ? 1_555 A GLU 43 OE2 ? ? A PB 605 A GLU 72  1_555 ? ? ? ? ? ? ? 2.234 ? 
metalc3 metalc ? ? D PB . PB ? ? ? 1_555 E HOH .  O   ? ? A PB 605 A HOH 724 1_555 ? ? ? ? ? ? ? 2.922 ? 
metalc4 metalc ? ? D PB . PB ? ? ? 1_555 A GLU 43 OE1 ? ? A PB 605 A GLU 72  1_555 ? ? ? ? ? ? ? 2.860 ? 
metalc5 metalc ? ? C PB . PB ? ? ? 1_555 F HOH .  O   ? ? A PB 604 B HOH 216 3_655 ? ? ? ? ? ? ? 3.458 ? 
metalc6 metalc ? ? C PB . PB ? ? ? 1_555 F HOH .  O   ? ? A PB 604 B HOH 221 3_655 ? ? ? ? ? ? ? 2.704 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 13 ? GLU A 21 ? TYR A 42  GLU A 50  
A 2 ALA A 26 ? ASP A 30 ? ALA A 55  ASP A 59  
A 3 GLY A 37 ? PRO A 40 ? GLY A 66  PRO A 69  
A 4 ALA A 86 ? THR A 88 ? ALA A 115 THR A 117 
A 5 GLU A 70 ? LYS A 77 ? GLU A 99  LYS A 106 
A 6 TYR A 13 ? GLU A 21 ? TYR A 42  GLU A 50  
B 1 TYR B 13 ? GLU B 21 ? TYR B 42  GLU B 50  
B 2 ALA B 26 ? ASP B 30 ? ALA B 55  ASP B 59  
B 3 GLY B 37 ? PRO B 40 ? GLY B 66  PRO B 69  
B 4 ALA B 86 ? THR B 88 ? ALA B 115 THR B 117 
B 5 GLU B 70 ? LYS B 77 ? GLU B 99  LYS B 106 
B 6 TYR B 13 ? GLU B 21 ? TYR B 42  GLU B 50  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 19 ? N ARG A 48  O PHE A 28 ? O PHE A 57  
A 2 3 N ALA A 27 ? N ALA A 56  O LEU A 39 ? O LEU A 68  
A 3 4 N PHE A 38 ? N PHE A 67  O LEU A 87 ? O LEU A 116 
A 4 5 O ALA A 86 ? O ALA A 115 N ASP A 76 ? N ASP A 105 
A 5 6 O VAL A 71 ? O VAL A 100 N GLY A 15 ? N GLY A 44  
B 1 2 N GLU B 21 ? N GLU B 50  O ALA B 26 ? O ALA B 55  
B 2 3 N VAL B 29 ? N VAL B 58  O GLY B 37 ? O GLY B 66  
B 3 4 N PHE B 38 ? N PHE B 67  O LEU B 87 ? O LEU B 116 
B 4 5 O ALA B 86 ? O ALA B 115 N ASP B 76 ? N ASP B 105 
B 5 6 O VAL B 71 ? O VAL B 100 N GLY B 15 ? N GLY B 44  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PB A 604' 
AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PB A 605' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 HIS A 56 ? HIS A 85  . ? 1_555 ? 
2 AC1 2 HOH F .  ? HOH B 221 . ? 3_655 ? 
3 AC2 2 GLU A 43 ? GLU A 72  . ? 1_555 ? 
4 AC2 2 HOH E .  ? HOH A 724 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1SN8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SN8 
_atom_sites.fract_transf_matrix[1][1]   0.014168 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014168 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011376 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
PB 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 10 ? 57.687 53.477 61.929 1.00 34.69 ? 39  ALA A N   1 
ATOM   2    C  CA  . ALA A 1 10 ? 56.227 53.787 62.087 1.00 34.22 ? 39  ALA A CA  1 
ATOM   3    C  C   . ALA A 1 10 ? 55.865 53.678 63.567 1.00 32.79 ? 39  ALA A C   1 
ATOM   4    O  O   . ALA A 1 10 ? 56.093 52.621 64.159 1.00 34.35 ? 39  ALA A O   1 
ATOM   5    C  CB  . ALA A 1 10 ? 55.415 52.809 61.294 1.00 34.28 ? 39  ALA A CB  1 
ATOM   6    N  N   . ASN A 1 11 ? 55.350 54.755 64.161 1.00 29.19 ? 40  ASN A N   1 
ATOM   7    C  CA  . ASN A 1 11 ? 55.096 54.789 65.599 1.00 27.03 ? 40  ASN A CA  1 
ATOM   8    C  C   . ASN A 1 11 ? 53.720 55.405 65.893 1.00 25.10 ? 40  ASN A C   1 
ATOM   9    O  O   . ASN A 1 11 ? 53.640 56.453 66.483 1.00 24.00 ? 40  ASN A O   1 
ATOM   10   C  CB  . ASN A 1 11 ? 56.205 55.576 66.339 1.00 26.39 ? 40  ASN A CB  1 
ATOM   11   C  CG  . ASN A 1 11 ? 56.061 55.506 67.877 1.00 24.72 ? 40  ASN A CG  1 
ATOM   12   O  OD1 . ASN A 1 11 ? 55.336 54.672 68.387 1.00 20.42 ? 40  ASN A OD1 1 
ATOM   13   N  ND2 . ASN A 1 11 ? 56.745 56.395 68.599 1.00 20.42 ? 40  ASN A ND2 1 
ATOM   14   N  N   . ILE A 1 12 ? 52.667 54.716 65.471 1.00 24.09 ? 41  ILE A N   1 
ATOM   15   C  CA  . ILE A 1 12 ? 51.293 55.087 65.775 1.00 23.72 ? 41  ILE A CA  1 
ATOM   16   C  C   . ILE A 1 12 ? 50.387 53.876 65.797 1.00 23.59 ? 41  ILE A C   1 
ATOM   17   O  O   . ILE A 1 12 ? 50.510 52.947 64.979 1.00 24.36 ? 41  ILE A O   1 
ATOM   18   C  CB  . ILE A 1 12 ? 50.812 56.163 64.766 1.00 24.12 ? 41  ILE A CB  1 
ATOM   19   C  CG1 . ILE A 1 12 ? 49.475 56.773 65.195 1.00 22.72 ? 41  ILE A CG1 1 
ATOM   20   C  CG2 . ILE A 1 12 ? 50.776 55.610 63.333 1.00 23.99 ? 41  ILE A CG2 1 
ATOM   21   C  CD1 . ILE A 1 12 ? 49.188 58.082 64.425 1.00 22.14 ? 41  ILE A CD1 1 
ATOM   22   N  N   . TYR A 1 13 ? 49.482 53.859 66.757 1.00 22.88 ? 42  TYR A N   1 
ATOM   23   C  CA  . TYR A 1 13 ? 48.632 52.689 66.971 1.00 23.08 ? 42  TYR A CA  1 
ATOM   24   C  C   . TYR A 1 13 ? 47.275 53.125 67.427 1.00 22.95 ? 42  TYR A C   1 
ATOM   25   O  O   . TYR A 1 13 ? 47.120 54.211 67.965 1.00 21.42 ? 42  TYR A O   1 
ATOM   26   C  CB  . TYR A 1 13 ? 49.261 51.720 68.014 1.00 23.29 ? 42  TYR A CB  1 
ATOM   27   C  CG  . TYR A 1 13 ? 50.714 51.399 67.748 1.00 24.43 ? 42  TYR A CG  1 
ATOM   28   C  CD1 . TYR A 1 13 ? 51.719 52.245 68.193 1.00 24.80 ? 42  TYR A CD1 1 
ATOM   29   C  CD2 . TYR A 1 13 ? 51.087 50.244 67.042 1.00 25.12 ? 42  TYR A CD2 1 
ATOM   30   C  CE1 . TYR A 1 13 ? 53.056 51.965 67.940 1.00 24.93 ? 42  TYR A CE1 1 
ATOM   31   C  CE2 . TYR A 1 13 ? 52.441 49.963 66.784 1.00 26.44 ? 42  TYR A CE2 1 
ATOM   32   C  CZ  . TYR A 1 13 ? 53.406 50.825 67.235 1.00 25.51 ? 42  TYR A CZ  1 
ATOM   33   O  OH  . TYR A 1 13 ? 54.744 50.568 66.986 1.00 26.31 ? 42  TYR A OH  1 
ATOM   34   N  N   . LYS A 1 14 ? 46.277 52.288 67.172 1.00 23.92 ? 43  LYS A N   1 
ATOM   35   C  CA  . LYS A 1 14 ? 44.989 52.398 67.841 1.00 24.91 ? 43  LYS A CA  1 
ATOM   36   C  C   . LYS A 1 14 ? 45.062 51.514 69.068 1.00 25.17 ? 43  LYS A C   1 
ATOM   37   O  O   . LYS A 1 14 ? 45.135 50.294 68.920 1.00 25.87 ? 43  LYS A O   1 
ATOM   38   C  CB  . LYS A 1 14 ? 43.865 51.863 66.974 1.00 25.06 ? 43  LYS A CB  1 
ATOM   39   C  CG  . LYS A 1 14 ? 43.441 52.786 65.894 1.00 28.54 ? 43  LYS A CG  1 
ATOM   40   C  CD  . LYS A 1 14 ? 42.489 52.086 64.922 1.00 30.12 ? 43  LYS A CD  1 
ATOM   41   C  CE  . LYS A 1 14 ? 41.192 52.749 64.901 1.00 31.02 ? 43  LYS A CE  1 
ATOM   42   N  NZ  . LYS A 1 14 ? 40.272 52.063 63.937 1.00 31.35 ? 43  LYS A NZ  1 
ATOM   43   N  N   . GLY A 1 15 ? 45.022 52.104 70.256 1.00 24.89 ? 44  GLY A N   1 
ATOM   44   C  CA  . GLY A 1 15 ? 45.043 51.344 71.491 1.00 25.63 ? 44  GLY A CA  1 
ATOM   45   C  C   . GLY A 1 15 ? 43.674 51.174 72.094 1.00 25.72 ? 44  GLY A C   1 
ATOM   46   O  O   . GLY A 1 15 ? 42.904 52.138 72.181 1.00 26.76 ? 44  GLY A O   1 
ATOM   47   N  N   . LYS A 1 16 ? 43.355 49.963 72.510 1.00 25.21 ? 45  LYS A N   1 
ATOM   48   C  CA  . LYS A 1 16 ? 42.080 49.688 73.170 1.00 25.16 ? 45  LYS A CA  1 
ATOM   49   C  C   . LYS A 1 16 ? 42.340 49.677 74.668 1.00 24.12 ? 45  LYS A C   1 
ATOM   50   O  O   . LYS A 1 16 ? 43.228 48.985 75.127 1.00 22.68 ? 45  LYS A O   1 
ATOM   51   C  CB  . LYS A 1 16 ? 41.532 48.336 72.700 1.00 26.04 ? 45  LYS A CB  1 
ATOM   52   C  CG  . LYS A 1 16 ? 40.192 47.932 73.340 1.00 30.15 ? 45  LYS A CG  1 
ATOM   53   C  CD  . LYS A 1 16 ? 39.421 46.834 72.559 1.00 35.10 ? 45  LYS A CD  1 
ATOM   54   C  CE  . LYS A 1 16 ? 38.629 47.421 71.339 1.00 37.52 ? 45  LYS A CE  1 
ATOM   55   N  NZ  . LYS A 1 16 ? 37.145 47.638 71.583 1.00 38.90 ? 45  LYS A NZ  1 
ATOM   56   N  N   . ILE A 1 17 ? 41.569 50.434 75.429 1.00 23.71 ? 46  ILE A N   1 
ATOM   57   C  CA  . ILE A 1 17 ? 41.715 50.474 76.880 1.00 23.66 ? 46  ILE A CA  1 
ATOM   58   C  C   . ILE A 1 17 ? 41.264 49.111 77.473 1.00 24.45 ? 46  ILE A C   1 
ATOM   59   O  O   . ILE A 1 17 ? 40.136 48.704 77.270 1.00 23.08 ? 46  ILE A O   1 
ATOM   60   C  CB  . ILE A 1 17 ? 40.870 51.616 77.469 1.00 23.27 ? 46  ILE A CB  1 
ATOM   61   C  CG1 . ILE A 1 17 ? 41.265 52.983 76.883 1.00 20.77 ? 46  ILE A CG1 1 
ATOM   62   C  CG2 . ILE A 1 17 ? 40.991 51.658 79.021 1.00 23.73 ? 46  ILE A CG2 1 
ATOM   63   C  CD1 . ILE A 1 17 ? 42.712 53.305 76.958 1.00 21.12 ? 46  ILE A CD1 1 
ATOM   64   N  N   . THR A 1 18 ? 42.135 48.417 78.195 1.00 25.55 ? 47  THR A N   1 
ATOM   65   C  CA  . THR A 1 18 ? 41.783 47.095 78.735 1.00 26.93 ? 47  THR A CA  1 
ATOM   66   C  C   . THR A 1 18 ? 41.540 47.048 80.219 1.00 27.56 ? 47  THR A C   1 
ATOM   67   O  O   . THR A 1 18 ? 40.729 46.241 80.680 1.00 30.05 ? 47  THR A O   1 
ATOM   68   C  CB  . THR A 1 18 ? 42.872 46.066 78.438 1.00 27.80 ? 47  THR A CB  1 
ATOM   69   O  OG1 . THR A 1 18 ? 44.148 46.541 78.942 1.00 27.85 ? 47  THR A OG1 1 
ATOM   70   C  CG2 . THR A 1 18 ? 43.027 45.873 76.937 1.00 28.53 ? 47  THR A CG2 1 
ATOM   71   N  N   . ARG A 1 19 ? 42.293 47.810 80.989 1.00 27.40 ? 48  ARG A N   1 
ATOM   72   C  CA  . ARG A 1 19 ? 42.102 47.837 82.428 1.00 26.93 ? 48  ARG A CA  1 
ATOM   73   C  C   . ARG A 1 19 ? 42.460 49.213 82.937 1.00 25.92 ? 48  ARG A C   1 
ATOM   74   O  O   . ARG A 1 19 ? 43.554 49.740 82.666 1.00 24.25 ? 48  ARG A O   1 
ATOM   75   C  CB  . ARG A 1 19 ? 42.949 46.763 83.094 1.00 28.12 ? 48  ARG A CB  1 
ATOM   76   C  CG  . ARG A 1 19 ? 43.004 46.858 84.613 1.00 31.81 ? 48  ARG A CG  1 
ATOM   77   C  CD  . ARG A 1 19 ? 43.244 45.526 85.316 1.00 37.82 ? 48  ARG A CD  1 
ATOM   78   N  NE  . ARG A 1 19 ? 44.395 44.777 84.788 1.00 42.03 ? 48  ARG A NE  1 
ATOM   79   C  CZ  . ARG A 1 19 ? 45.656 44.877 85.235 1.00 44.97 ? 48  ARG A CZ  1 
ATOM   80   N  NH1 . ARG A 1 19 ? 45.968 45.731 86.213 1.00 45.02 ? 48  ARG A NH1 1 
ATOM   81   N  NH2 . ARG A 1 19 ? 46.617 44.132 84.682 1.00 47.31 ? 48  ARG A NH2 1 
ATOM   82   N  N   . ILE A 1 20 ? 41.522 49.816 83.641 1.00 24.60 ? 49  ILE A N   1 
ATOM   83   C  CA  . ILE A 1 20 ? 41.728 51.146 84.181 1.00 24.82 ? 49  ILE A CA  1 
ATOM   84   C  C   . ILE A 1 20 ? 42.105 51.001 85.644 1.00 24.41 ? 49  ILE A C   1 
ATOM   85   O  O   . ILE A 1 20 ? 41.475 50.228 86.363 1.00 24.20 ? 49  ILE A O   1 
ATOM   86   C  CB  . ILE A 1 20 ? 40.453 52.005 84.017 1.00 24.99 ? 49  ILE A CB  1 
ATOM   87   C  CG1 . ILE A 1 20 ? 40.132 52.182 82.538 1.00 25.84 ? 49  ILE A CG1 1 
ATOM   88   C  CG2 . ILE A 1 20 ? 40.654 53.357 84.657 1.00 25.57 ? 49  ILE A CG2 1 
ATOM   89   C  CD1 . ILE A 1 20 ? 38.755 52.702 82.287 1.00 29.57 ? 49  ILE A CD1 1 
ATOM   90   N  N   . GLU A 1 21 ? 43.133 51.736 86.060 1.00 23.76 ? 50  GLU A N   1 
ATOM   91   C  CA  . GLU A 1 21 ? 43.645 51.726 87.440 1.00 24.06 ? 50  GLU A CA  1 
ATOM   92   C  C   . GLU A 1 21 ? 43.585 53.147 88.028 1.00 22.66 ? 50  GLU A C   1 
ATOM   93   O  O   . GLU A 1 21 ? 44.533 53.935 87.888 1.00 21.61 ? 50  GLU A O   1 
ATOM   94   C  CB  . GLU A 1 21 ? 45.095 51.231 87.465 1.00 24.82 ? 50  GLU A CB  1 
ATOM   95   C  CG  . GLU A 1 21 ? 45.307 49.715 87.286 1.00 29.45 ? 50  GLU A CG  1 
ATOM   96   C  CD  . GLU A 1 21 ? 44.499 48.899 88.275 1.00 33.23 ? 50  GLU A CD  1 
ATOM   97   O  OE1 . GLU A 1 21 ? 44.306 49.364 89.429 1.00 34.75 ? 50  GLU A OE1 1 
ATOM   98   O  OE2 . GLU A 1 21 ? 44.018 47.812 87.888 1.00 36.68 ? 50  GLU A OE2 1 
ATOM   99   N  N   . PRO A 1 22 ? 42.476 53.468 88.678 1.00 22.14 ? 51  PRO A N   1 
ATOM   100  C  CA  . PRO A 1 22 ? 42.248 54.800 89.268 1.00 22.07 ? 51  PRO A CA  1 
ATOM   101  C  C   . PRO A 1 22 ? 43.306 55.219 90.273 1.00 20.84 ? 51  PRO A C   1 
ATOM   102  O  O   . PRO A 1 22 ? 43.683 56.394 90.277 1.00 20.48 ? 51  PRO A O   1 
ATOM   103  C  CB  . PRO A 1 22 ? 40.917 54.654 90.004 1.00 22.75 ? 51  PRO A CB  1 
ATOM   104  C  CG  . PRO A 1 22 ? 40.342 53.380 89.511 1.00 23.92 ? 51  PRO A CG  1 
ATOM   105  C  CD  . PRO A 1 22 ? 41.356 52.549 88.909 1.00 23.11 ? 51  PRO A CD  1 
ATOM   106  N  N   . SER A 1 23 ? 43.814 54.277 91.076 1.00 20.13 ? 52  SER A N   1 
ATOM   107  C  CA  . SER A 1 23 ? 44.777 54.632 92.126 1.00 20.03 ? 52  SER A CA  1 
ATOM   108  C  C   . SER A 1 23 ? 46.163 54.899 91.555 1.00 19.71 ? 52  SER A C   1 
ATOM   109  O  O   . SER A 1 23 ? 47.004 55.481 92.236 1.00 19.86 ? 52  SER A O   1 
ATOM   110  C  CB  . SER A 1 23 ? 44.854 53.537 93.228 1.00 20.27 ? 52  SER A CB  1 
ATOM   111  O  OG  . SER A 1 23 ? 45.454 52.370 92.704 1.00 20.62 ? 52  SER A OG  1 
ATOM   112  N  N   . LEU A 1 24 ? 46.403 54.451 90.325 1.00 19.16 ? 53  LEU A N   1 
ATOM   113  C  CA  . LEU A 1 24 ? 47.613 54.787 89.577 1.00 20.02 ? 53  LEU A CA  1 
ATOM   114  C  C   . LEU A 1 24 ? 47.446 55.932 88.572 1.00 19.03 ? 53  LEU A C   1 
ATOM   115  O  O   . LEU A 1 24 ? 48.387 56.310 87.889 1.00 18.82 ? 53  LEU A O   1 
ATOM   116  C  CB  . LEU A 1 24 ? 48.091 53.538 88.817 1.00 20.71 ? 53  LEU A CB  1 
ATOM   117  C  CG  . LEU A 1 24 ? 48.440 52.282 89.633 1.00 23.83 ? 53  LEU A CG  1 
ATOM   118  C  CD1 . LEU A 1 24 ? 49.055 51.228 88.718 1.00 26.36 ? 53  LEU A CD1 1 
ATOM   119  C  CD2 . LEU A 1 24 ? 49.399 52.665 90.772 1.00 22.08 ? 53  LEU A CD2 1 
ATOM   120  N  N   . GLU A 1 25 ? 46.222 56.449 88.461 1.00 19.51 ? 54  GLU A N   1 
ATOM   121  C  CA  . GLU A 1 25 ? 45.847 57.424 87.443 1.00 18.37 ? 54  GLU A CA  1 
ATOM   122  C  C   . GLU A 1 25 ? 46.369 57.007 86.083 1.00 17.70 ? 54  GLU A C   1 
ATOM   123  O  O   . GLU A 1 25 ? 47.117 57.732 85.462 1.00 17.46 ? 54  GLU A O   1 
ATOM   124  C  CB  . GLU A 1 25 ? 46.368 58.815 87.797 1.00 18.59 ? 54  GLU A CB  1 
ATOM   125  C  CG  . GLU A 1 25 ? 46.065 59.266 89.205 1.00 19.59 ? 54  GLU A CG  1 
ATOM   126  C  CD  . GLU A 1 25 ? 46.503 60.719 89.441 1.00 22.55 ? 54  GLU A CD  1 
ATOM   127  O  OE1 . GLU A 1 25 ? 47.692 61.049 89.267 1.00 20.95 ? 54  GLU A OE1 1 
ATOM   128  O  OE2 . GLU A 1 25 ? 45.624 61.540 89.769 1.00 22.24 ? 54  GLU A OE2 1 
ATOM   129  N  N   . ALA A 1 26 ? 46.015 55.808 85.656 1.00 17.12 ? 55  ALA A N   1 
ATOM   130  C  CA  . ALA A 1 26 ? 46.578 55.242 84.433 1.00 17.31 ? 55  ALA A CA  1 
ATOM   131  C  C   . ALA A 1 26 ? 45.720 54.097 83.952 1.00 16.66 ? 55  ALA A C   1 
ATOM   132  O  O   . ALA A 1 26 ? 44.899 53.603 84.705 1.00 17.53 ? 55  ALA A O   1 
ATOM   133  C  CB  . ALA A 1 26 ? 48.032 54.730 84.683 1.00 17.81 ? 55  ALA A CB  1 
ATOM   134  N  N   . ALA A 1 27 ? 45.920 53.695 82.705 1.00 16.46 ? 56  ALA A N   1 
ATOM   135  C  CA  . ALA A 1 27 ? 45.232 52.554 82.109 1.00 16.43 ? 56  ALA A CA  1 
ATOM   136  C  C   . ALA A 1 27 ? 46.196 51.685 81.338 1.00 16.74 ? 56  ALA A C   1 
ATOM   137  O  O   . ALA A 1 27 ? 47.187 52.179 80.757 1.00 17.27 ? 56  ALA A O   1 
ATOM   138  C  CB  . ALA A 1 27 ? 44.131 53.042 81.152 1.00 16.34 ? 56  ALA A CB  1 
ATOM   139  N  N   . PHE A 1 28 ? 45.889 50.396 81.297 1.00 17.04 ? 57  PHE A N   1 
ATOM   140  C  CA  . PHE A 1 28 ? 46.545 49.471 80.391 1.00 17.78 ? 57  PHE A CA  1 
ATOM   141  C  C   . PHE A 1 28 ? 45.849 49.541 79.031 1.00 17.45 ? 57  PHE A C   1 
ATOM   142  O  O   . PHE A 1 28 ? 44.621 49.722 78.940 1.00 18.33 ? 57  PHE A O   1 
ATOM   143  C  CB  . PHE A 1 28 ? 46.540 48.042 80.971 1.00 17.37 ? 57  PHE A CB  1 
ATOM   144  C  CG  . PHE A 1 28 ? 47.424 47.884 82.197 1.00 18.86 ? 57  PHE A CG  1 
ATOM   145  C  CD1 . PHE A 1 28 ? 48.773 47.616 82.061 1.00 20.61 ? 57  PHE A CD1 1 
ATOM   146  C  CD2 . PHE A 1 28 ? 46.897 48.013 83.478 1.00 21.04 ? 57  PHE A CD2 1 
ATOM   147  C  CE1 . PHE A 1 28 ? 49.572 47.434 83.167 1.00 18.93 ? 57  PHE A CE1 1 
ATOM   148  C  CE2 . PHE A 1 28 ? 47.718 47.863 84.596 1.00 21.78 ? 57  PHE A CE2 1 
ATOM   149  C  CZ  . PHE A 1 28 ? 49.070 47.575 84.413 1.00 19.90 ? 57  PHE A CZ  1 
ATOM   150  N  N   . VAL A 1 29 ? 46.651 49.379 77.989 1.00 17.98 ? 58  VAL A N   1 
ATOM   151  C  CA  . VAL A 1 29 ? 46.222 49.552 76.611 1.00 18.14 ? 58  VAL A CA  1 
ATOM   152  C  C   . VAL A 1 29 ? 46.716 48.388 75.741 1.00 19.21 ? 58  VAL A C   1 
ATOM   153  O  O   . VAL A 1 29 ? 47.893 48.094 75.707 1.00 18.95 ? 58  VAL A O   1 
ATOM   154  C  CB  . VAL A 1 29 ? 46.754 50.889 76.064 1.00 17.76 ? 58  VAL A CB  1 
ATOM   155  C  CG1 . VAL A 1 29 ? 46.294 51.108 74.621 1.00 18.96 ? 58  VAL A CG1 1 
ATOM   156  C  CG2 . VAL A 1 29 ? 46.310 52.046 76.958 1.00 16.53 ? 58  VAL A CG2 1 
ATOM   157  N  N   . ASP A 1 30 ? 45.814 47.723 75.039 1.00 20.17 ? 59  ASP A N   1 
ATOM   158  C  CA  . ASP A 1 30 ? 46.220 46.798 73.984 1.00 21.39 ? 59  ASP A CA  1 
ATOM   159  C  C   . ASP A 1 30 ? 46.446 47.580 72.711 1.00 21.90 ? 59  ASP A C   1 
ATOM   160  O  O   . ASP A 1 30 ? 45.486 48.012 72.091 1.00 22.23 ? 59  ASP A O   1 
ATOM   161  C  CB  . ASP A 1 30 ? 45.112 45.774 73.783 1.00 22.15 ? 59  ASP A CB  1 
ATOM   162  C  CG  . ASP A 1 30 ? 45.468 44.689 72.794 1.00 24.83 ? 59  ASP A CG  1 
ATOM   163  O  OD1 . ASP A 1 30 ? 46.532 44.761 72.131 1.00 24.91 ? 59  ASP A OD1 1 
ATOM   164  O  OD2 . ASP A 1 30 ? 44.685 43.722 72.625 1.00 29.69 ? 59  ASP A OD2 1 
ATOM   165  N  N   . TYR A 1 31 ? 47.705 47.770 72.331 1.00 22.83 ? 60  TYR A N   1 
ATOM   166  C  CA  . TYR A 1 31 ? 48.047 48.475 71.100 1.00 24.44 ? 60  TYR A CA  1 
ATOM   167  C  C   . TYR A 1 31 ? 48.511 47.525 69.978 1.00 26.03 ? 60  TYR A C   1 
ATOM   168  O  O   . TYR A 1 31 ? 49.092 47.971 69.003 1.00 26.03 ? 60  TYR A O   1 
ATOM   169  C  CB  . TYR A 1 31 ? 49.062 49.595 71.349 1.00 24.29 ? 60  TYR A CB  1 
ATOM   170  C  CG  . TYR A 1 31 ? 50.429 49.144 71.810 1.00 23.77 ? 60  TYR A CG  1 
ATOM   171  C  CD1 . TYR A 1 31 ? 50.669 48.849 73.151 1.00 23.56 ? 60  TYR A CD1 1 
ATOM   172  C  CD2 . TYR A 1 31 ? 51.477 48.999 70.904 1.00 24.04 ? 60  TYR A CD2 1 
ATOM   173  C  CE1 . TYR A 1 31 ? 51.924 48.426 73.583 1.00 24.82 ? 60  TYR A CE1 1 
ATOM   174  C  CE2 . TYR A 1 31 ? 52.742 48.557 71.332 1.00 25.44 ? 60  TYR A CE2 1 
ATOM   175  C  CZ  . TYR A 1 31 ? 52.941 48.278 72.684 1.00 23.33 ? 60  TYR A CZ  1 
ATOM   176  O  OH  . TYR A 1 31 ? 54.141 47.850 73.137 1.00 26.18 ? 60  TYR A OH  1 
ATOM   177  N  N   . GLY A 1 32 ? 48.205 46.230 70.108 1.00 27.87 ? 61  GLY A N   1 
ATOM   178  C  CA  . GLY A 1 32 ? 48.580 45.241 69.093 1.00 29.61 ? 61  GLY A CA  1 
ATOM   179  C  C   . GLY A 1 32 ? 49.832 44.404 69.392 1.00 30.73 ? 61  GLY A C   1 
ATOM   180  O  O   . GLY A 1 32 ? 50.144 43.471 68.666 1.00 31.86 ? 61  GLY A O   1 
ATOM   181  N  N   . ALA A 1 33 ? 50.572 44.752 70.439 1.00 31.13 ? 62  ALA A N   1 
ATOM   182  C  CA  . ALA A 1 33 ? 51.683 43.923 70.890 1.00 30.74 ? 62  ALA A CA  1 
ATOM   183  C  C   . ALA A 1 33 ? 51.169 42.889 71.902 1.00 30.81 ? 62  ALA A C   1 
ATOM   184  O  O   . ALA A 1 33 ? 50.074 43.027 72.467 1.00 30.63 ? 62  ALA A O   1 
ATOM   185  C  CB  . ALA A 1 33 ? 52.768 44.790 71.489 1.00 30.77 ? 62  ALA A CB  1 
ATOM   186  N  N   . GLU A 1 34 ? 51.945 41.825 72.114 1.00 31.02 ? 63  GLU A N   1 
ATOM   187  C  CA  . GLU A 1 34 ? 51.558 40.775 73.064 1.00 31.02 ? 63  GLU A CA  1 
ATOM   188  C  C   . GLU A 1 34 ? 51.344 41.357 74.477 1.00 30.23 ? 63  GLU A C   1 
ATOM   189  O  O   . GLU A 1 34 ? 50.367 41.035 75.162 1.00 30.94 ? 63  GLU A O   1 
ATOM   190  C  CB  . GLU A 1 34 ? 52.618 39.639 73.077 1.00 31.36 ? 63  GLU A CB  1 
ATOM   191  C  CG  . GLU A 1 34 ? 51.999 38.299 73.445 0.00 15.00 ? 63  GLU A CG  1 
ATOM   192  C  CD  . GLU A 1 34 ? 51.198 37.631 72.346 0.00 15.00 ? 63  GLU A CD  1 
ATOM   193  O  OE1 . GLU A 1 34 ? 51.255 36.386 72.238 0.00 15.00 ? 63  GLU A OE1 1 
ATOM   194  O  OE2 . GLU A 1 34 ? 50.511 38.347 71.588 0.00 15.00 ? 63  GLU A OE2 1 
ATOM   195  N  N   . ARG A 1 35 ? 52.253 42.236 74.884 1.00 29.35 ? 64  ARG A N   1 
ATOM   196  C  CA  . ARG A 1 35 ? 52.214 42.871 76.181 1.00 29.10 ? 64  ARG A CA  1 
ATOM   197  C  C   . ARG A 1 35 ? 51.556 44.255 76.091 1.00 28.70 ? 64  ARG A C   1 
ATOM   198  O  O   . ARG A 1 35 ? 51.940 45.086 75.269 1.00 28.41 ? 64  ARG A O   1 
ATOM   199  C  CB  . ARG A 1 35 ? 53.630 43.034 76.704 1.00 29.24 ? 64  ARG A CB  1 
ATOM   200  C  CG  . ARG A 1 35 ? 53.735 43.653 78.098 1.00 30.03 ? 64  ARG A CG  1 
ATOM   201  C  CD  . ARG A 1 35 ? 55.159 43.715 78.582 1.00 31.70 ? 64  ARG A CD  1 
ATOM   202  N  NE  . ARG A 1 35 ? 55.776 42.386 78.585 1.00 30.72 ? 64  ARG A NE  1 
ATOM   203  C  CZ  . ARG A 1 35 ? 57.090 42.138 78.608 1.00 31.11 ? 64  ARG A CZ  1 
ATOM   204  N  NH1 . ARG A 1 35 ? 58.006 43.129 78.599 1.00 30.03 ? 64  ARG A NH1 1 
ATOM   205  N  NH2 . ARG A 1 35 ? 57.489 40.871 78.632 1.00 30.77 ? 64  ARG A NH2 1 
ATOM   206  N  N   . HIS A 1 36 ? 50.592 44.496 76.965 1.00 27.81 ? 65  HIS A N   1 
ATOM   207  C  CA  . HIS A 1 36 ? 49.857 45.748 76.975 1.00 27.02 ? 65  HIS A CA  1 
ATOM   208  C  C   . HIS A 1 36 ? 50.743 46.922 77.377 1.00 25.53 ? 65  HIS A C   1 
ATOM   209  O  O   . HIS A 1 36 ? 51.652 46.775 78.177 1.00 25.83 ? 65  HIS A O   1 
ATOM   210  C  CB  . HIS A 1 36 ? 48.691 45.620 77.939 1.00 28.11 ? 65  HIS A CB  1 
ATOM   211  C  CG  . HIS A 1 36 ? 47.646 44.640 77.492 1.00 29.92 ? 65  HIS A CG  1 
ATOM   212  N  ND1 . HIS A 1 36 ? 46.545 44.327 78.260 1.00 32.38 ? 65  HIS A ND1 1 
ATOM   213  C  CD2 . HIS A 1 36 ? 47.524 43.923 76.351 1.00 33.56 ? 65  HIS A CD2 1 
ATOM   214  C  CE1 . HIS A 1 36 ? 45.796 43.448 77.620 1.00 31.70 ? 65  HIS A CE1 1 
ATOM   215  N  NE2 . HIS A 1 36 ? 46.367 43.186 76.458 1.00 33.84 ? 65  HIS A NE2 1 
ATOM   216  N  N   . GLY A 1 37 ? 50.503 48.090 76.796 1.00 23.73 ? 66  GLY A N   1 
ATOM   217  C  CA  . GLY A 1 37 ? 51.177 49.309 77.234 1.00 22.26 ? 66  GLY A CA  1 
ATOM   218  C  C   . GLY A 1 37 ? 50.472 49.974 78.400 1.00 21.33 ? 66  GLY A C   1 
ATOM   219  O  O   . GLY A 1 37 ? 49.408 49.558 78.837 1.00 19.44 ? 66  GLY A O   1 
ATOM   220  N  N   . PHE A 1 38 ? 51.064 51.063 78.860 1.00 20.14 ? 67  PHE A N   1 
ATOM   221  C  CA  . PHE A 1 38 ? 50.613 51.767 80.028 1.00 19.75 ? 67  PHE A CA  1 
ATOM   222  C  C   . PHE A 1 38 ? 50.473 53.225 79.640 1.00 18.92 ? 67  PHE A C   1 
ATOM   223  O  O   . PHE A 1 38 ? 51.403 53.827 79.121 1.00 17.62 ? 67  PHE A O   1 
ATOM   224  C  CB  . PHE A 1 38 ? 51.694 51.620 81.104 1.00 20.15 ? 67  PHE A CB  1 
ATOM   225  C  CG  . PHE A 1 38 ? 51.293 52.085 82.456 1.00 20.79 ? 67  PHE A CG  1 
ATOM   226  C  CD1 . PHE A 1 38 ? 50.344 51.405 83.180 1.00 21.90 ? 67  PHE A CD1 1 
ATOM   227  C  CD2 . PHE A 1 38 ? 51.878 53.205 83.017 1.00 23.20 ? 67  PHE A CD2 1 
ATOM   228  C  CE1 . PHE A 1 38 ? 50.018 51.805 84.450 1.00 21.29 ? 67  PHE A CE1 1 
ATOM   229  C  CE2 . PHE A 1 38 ? 51.526 53.614 84.283 1.00 22.09 ? 67  PHE A CE2 1 
ATOM   230  C  CZ  . PHE A 1 38 ? 50.608 52.893 84.990 1.00 19.88 ? 67  PHE A CZ  1 
ATOM   231  N  N   . LEU A 1 39 ? 49.297 53.774 79.920 1.00 18.77 ? 68  LEU A N   1 
ATOM   232  C  CA  . LEU A 1 39 ? 48.926 55.124 79.538 1.00 17.23 ? 68  LEU A CA  1 
ATOM   233  C  C   . LEU A 1 39 ? 48.541 55.939 80.776 1.00 16.84 ? 68  LEU A C   1 
ATOM   234  O  O   . LEU A 1 39 ? 47.456 55.776 81.313 1.00 16.01 ? 68  LEU A O   1 
ATOM   235  C  CB  . LEU A 1 39 ? 47.785 55.063 78.550 1.00 17.02 ? 68  LEU A CB  1 
ATOM   236  C  CG  . LEU A 1 39 ? 47.271 56.403 78.027 1.00 15.38 ? 68  LEU A CG  1 
ATOM   237  C  CD1 . LEU A 1 39 ? 48.341 57.143 77.302 1.00 15.23 ? 68  LEU A CD1 1 
ATOM   238  C  CD2 . LEU A 1 39 ? 46.057 56.152 77.111 1.00 13.96 ? 68  LEU A CD2 1 
ATOM   239  N  N   . PRO A 1 40 ? 49.442 56.817 81.232 1.00 16.88 ? 69  PRO A N   1 
ATOM   240  C  CA  . PRO A 1 40 ? 49.138 57.701 82.347 1.00 17.14 ? 69  PRO A CA  1 
ATOM   241  C  C   . PRO A 1 40 ? 48.149 58.808 81.967 1.00 16.86 ? 69  PRO A C   1 
ATOM   242  O  O   . PRO A 1 40 ? 48.140 59.311 80.862 1.00 16.28 ? 69  PRO A O   1 
ATOM   243  C  CB  . PRO A 1 40 ? 50.486 58.347 82.657 1.00 17.78 ? 69  PRO A CB  1 
ATOM   244  C  CG  . PRO A 1 40 ? 51.506 57.505 81.978 1.00 18.69 ? 69  PRO A CG  1 
ATOM   245  C  CD  . PRO A 1 40 ? 50.818 57.016 80.753 1.00 16.65 ? 69  PRO A CD  1 
ATOM   246  N  N   . LEU A 1 41 ? 47.368 59.214 82.942 1.00 17.46 ? 70  LEU A N   1 
ATOM   247  C  CA  . LEU A 1 41 ? 46.412 60.296 82.778 1.00 17.68 ? 70  LEU A CA  1 
ATOM   248  C  C   . LEU A 1 41 ? 47.047 61.557 82.203 1.00 18.26 ? 70  LEU A C   1 
ATOM   249  O  O   . LEU A 1 41 ? 46.444 62.234 81.374 1.00 16.87 ? 70  LEU A O   1 
ATOM   250  C  CB  . LEU A 1 41 ? 45.774 60.599 84.138 1.00 17.90 ? 70  LEU A CB  1 
ATOM   251  C  CG  . LEU A 1 41 ? 44.700 61.695 84.174 1.00 18.56 ? 70  LEU A CG  1 
ATOM   252  C  CD1 . LEU A 1 41 ? 43.602 61.422 83.167 1.00 20.39 ? 70  LEU A CD1 1 
ATOM   253  C  CD2 . LEU A 1 41 ? 44.154 61.788 85.586 1.00 20.05 ? 70  LEU A CD2 1 
ATOM   254  N  N   . LYS A 1 42 ? 48.283 61.877 82.611 1.00 18.66 ? 71  LYS A N   1 
ATOM   255  C  CA  . LYS A 1 42 ? 48.922 63.088 82.109 1.00 19.19 ? 71  LYS A CA  1 
ATOM   256  C  C   . LYS A 1 42 ? 49.256 63.010 80.612 1.00 17.63 ? 71  LYS A C   1 
ATOM   257  O  O   . LYS A 1 42 ? 49.528 64.031 79.990 1.00 17.51 ? 71  LYS A O   1 
ATOM   258  C  CB  . LYS A 1 42 ? 50.152 63.470 82.921 1.00 20.41 ? 71  LYS A CB  1 
ATOM   259  C  CG  . LYS A 1 42 ? 51.344 62.525 82.780 1.00 27.32 ? 71  LYS A CG  1 
ATOM   260  C  CD  . LYS A 1 42 ? 52.597 63.109 83.516 1.00 34.30 ? 71  LYS A CD  1 
ATOM   261  C  CE  . LYS A 1 42 ? 53.321 62.032 84.334 1.00 37.77 ? 71  LYS A CE  1 
ATOM   262  N  NZ  . LYS A 1 42 ? 52.409 61.025 84.982 1.00 36.69 ? 71  LYS A NZ  1 
ATOM   263  N  N   . GLU A 1 43 ? 49.227 61.807 80.059 1.00 15.82 ? 72  GLU A N   1 
ATOM   264  C  CA  . GLU A 1 43 ? 49.503 61.584 78.668 1.00 15.04 ? 72  GLU A CA  1 
ATOM   265  C  C   . GLU A 1 43 ? 48.222 61.413 77.829 1.00 14.81 ? 72  GLU A C   1 
ATOM   266  O  O   . GLU A 1 43 ? 48.279 60.967 76.689 1.00 14.59 ? 72  GLU A O   1 
ATOM   267  C  CB  . GLU A 1 43 ? 50.378 60.359 78.521 1.00 15.69 ? 72  GLU A CB  1 
ATOM   268  C  CG  . GLU A 1 43 ? 51.746 60.456 79.187 1.00 16.35 ? 72  GLU A CG  1 
ATOM   269  C  CD  . GLU A 1 43 ? 52.609 61.566 78.619 1.00 19.27 ? 72  GLU A CD  1 
ATOM   270  O  OE1 . GLU A 1 43 ? 52.411 61.964 77.454 1.00 19.21 ? 72  GLU A OE1 1 
ATOM   271  O  OE2 . GLU A 1 43 ? 53.512 62.021 79.338 1.00 23.01 ? 72  GLU A OE2 1 
ATOM   272  N  N   . ILE A 1 44 ? 47.084 61.804 78.389 1.00 13.93 ? 73  ILE A N   1 
ATOM   273  C  CA  . ILE A 1 44 ? 45.818 61.738 77.697 1.00 14.10 ? 73  ILE A CA  1 
ATOM   274  C  C   . ILE A 1 44 ? 45.402 63.170 77.335 1.00 13.28 ? 73  ILE A C   1 
ATOM   275  O  O   . ILE A 1 44 ? 45.154 64.007 78.206 1.00 12.83 ? 73  ILE A O   1 
ATOM   276  C  CB  . ILE A 1 44 ? 44.764 61.067 78.567 1.00 14.34 ? 73  ILE A CB  1 
ATOM   277  C  CG1 . ILE A 1 44 ? 45.185 59.649 78.977 1.00 15.82 ? 73  ILE A CG1 1 
ATOM   278  C  CG2 . ILE A 1 44 ? 43.437 60.952 77.809 1.00 13.45 ? 73  ILE A CG2 1 
ATOM   279  C  CD1 . ILE A 1 44 ? 44.211 59.053 79.988 1.00 16.53 ? 73  ILE A CD1 1 
ATOM   280  N  N   . ALA A 1 45 ? 45.281 63.394 76.040 1.00 14.05 ? 74  ALA A N   1 
ATOM   281  C  CA  . ALA A 1 45 ? 44.928 64.665 75.456 1.00 14.16 ? 74  ALA A CA  1 
ATOM   282  C  C   . ALA A 1 45 ? 43.476 64.991 75.774 1.00 14.65 ? 74  ALA A C   1 
ATOM   283  O  O   . ALA A 1 45 ? 42.642 64.103 75.845 1.00 14.15 ? 74  ALA A O   1 
ATOM   284  C  CB  . ALA A 1 45 ? 45.157 64.609 73.927 1.00 13.90 ? 74  ALA A CB  1 
ATOM   285  N  N   . ARG A 1 46 ? 43.179 66.281 75.903 1.00 15.29 ? 75  ARG A N   1 
ATOM   286  C  CA  . ARG A 1 46 ? 41.866 66.723 76.356 1.00 15.87 ? 75  ARG A CA  1 
ATOM   287  C  C   . ARG A 1 46 ? 40.734 66.355 75.419 1.00 16.39 ? 75  ARG A C   1 
ATOM   288  O  O   . ARG A 1 46 ? 39.585 66.264 75.851 1.00 16.46 ? 75  ARG A O   1 
ATOM   289  C  CB  . ARG A 1 46 ? 41.886 68.222 76.639 1.00 16.57 ? 75  ARG A CB  1 
ATOM   290  C  CG  . ARG A 1 46 ? 42.731 68.565 77.851 1.00 15.87 ? 75  ARG A CG  1 
ATOM   291  C  CD  . ARG A 1 46 ? 42.062 68.310 79.164 1.00 16.75 ? 75  ARG A CD  1 
ATOM   292  N  NE  . ARG A 1 46 ? 43.008 68.316 80.277 1.00 17.96 ? 75  ARG A NE  1 
ATOM   293  C  CZ  . ARG A 1 46 ? 42.666 68.385 81.556 1.00 16.84 ? 75  ARG A CZ  1 
ATOM   294  N  NH1 . ARG A 1 46 ? 41.394 68.476 81.929 1.00 14.43 ? 75  ARG A NH1 1 
ATOM   295  N  NH2 . ARG A 1 46 ? 43.610 68.365 82.471 1.00 17.75 ? 75  ARG A NH2 1 
ATOM   296  N  N   . GLU A 1 47 ? 41.040 66.059 74.161 1.00 17.24 ? 76  GLU A N   1 
ATOM   297  C  CA  . GLU A 1 47 ? 39.992 65.610 73.244 1.00 18.49 ? 76  GLU A CA  1 
ATOM   298  C  C   . GLU A 1 47 ? 39.351 64.299 73.658 1.00 18.13 ? 76  GLU A C   1 
ATOM   299  O  O   . GLU A 1 47 ? 38.203 64.039 73.258 1.00 17.66 ? 76  GLU A O   1 
ATOM   300  C  CB  . GLU A 1 47 ? 40.388 65.585 71.747 1.00 19.84 ? 76  GLU A CB  1 
ATOM   301  C  CG  . GLU A 1 47 ? 41.832 65.357 71.379 1.00 25.38 ? 76  GLU A CG  1 
ATOM   302  C  CD  . GLU A 1 47 ? 42.669 66.629 71.430 1.00 28.14 ? 76  GLU A CD  1 
ATOM   303  O  OE1 . GLU A 1 47 ? 42.708 67.477 70.450 1.00 31.38 ? 76  GLU A OE1 1 
ATOM   304  O  OE2 . GLU A 1 47 ? 43.305 66.754 72.474 1.00 26.95 ? 76  GLU A OE2 1 
ATOM   305  N  N   . TYR A 1 48 ? 40.036 63.500 74.480 1.00 17.19 ? 77  TYR A N   1 
ATOM   306  C  CA  . TYR A 1 48 ? 39.459 62.253 75.020 1.00 17.76 ? 77  TYR A CA  1 
ATOM   307  C  C   . TYR A 1 48 ? 38.558 62.426 76.261 1.00 18.61 ? 77  TYR A C   1 
ATOM   308  O  O   . TYR A 1 48 ? 37.810 61.514 76.612 1.00 19.59 ? 77  TYR A O   1 
ATOM   309  C  CB  . TYR A 1 48 ? 40.583 61.239 75.295 1.00 16.55 ? 77  TYR A CB  1 
ATOM   310  C  CG  . TYR A 1 48 ? 41.309 60.859 74.023 1.00 15.22 ? 77  TYR A CG  1 
ATOM   311  C  CD1 . TYR A 1 48 ? 40.726 60.024 73.079 1.00 13.16 ? 77  TYR A CD1 1 
ATOM   312  C  CD2 . TYR A 1 48 ? 42.561 61.359 73.742 1.00 13.76 ? 77  TYR A CD2 1 
ATOM   313  C  CE1 . TYR A 1 48 ? 41.380 59.726 71.908 1.00 14.15 ? 77  TYR A CE1 1 
ATOM   314  C  CE2 . TYR A 1 48 ? 43.243 61.031 72.590 1.00 13.34 ? 77  TYR A CE2 1 
ATOM   315  C  CZ  . TYR A 1 48 ? 42.654 60.213 71.669 1.00 14.96 ? 77  TYR A CZ  1 
ATOM   316  O  OH  . TYR A 1 48 ? 43.347 59.884 70.506 1.00 14.62 ? 77  TYR A OH  1 
ATOM   317  N  N   . PHE A 1 49 ? 38.616 63.598 76.902 1.00 17.92 ? 78  PHE A N   1 
ATOM   318  C  CA  . PHE A 1 49 ? 37.871 63.868 78.121 1.00 18.71 ? 78  PHE A CA  1 
ATOM   319  C  C   . PHE A 1 49 ? 36.405 64.132 77.769 1.00 20.21 ? 78  PHE A C   1 
ATOM   320  O  O   . PHE A 1 49 ? 36.144 64.974 76.930 1.00 21.51 ? 78  PHE A O   1 
ATOM   321  C  CB  . PHE A 1 49 ? 38.423 65.106 78.838 1.00 18.55 ? 78  PHE A CB  1 
ATOM   322  C  CG  . PHE A 1 49 ? 39.727 64.884 79.546 1.00 17.24 ? 78  PHE A CG  1 
ATOM   323  C  CD1 . PHE A 1 49 ? 40.817 64.287 78.898 1.00 18.57 ? 78  PHE A CD1 1 
ATOM   324  C  CD2 . PHE A 1 49 ? 39.884 65.294 80.865 1.00 17.24 ? 78  PHE A CD2 1 
ATOM   325  C  CE1 . PHE A 1 49 ? 42.044 64.121 79.565 1.00 16.66 ? 78  PHE A CE1 1 
ATOM   326  C  CE2 . PHE A 1 49 ? 41.093 65.101 81.520 1.00 16.68 ? 78  PHE A CE2 1 
ATOM   327  C  CZ  . PHE A 1 49 ? 42.151 64.533 80.872 1.00 17.14 ? 78  PHE A CZ  1 
ATOM   328  N  N   . PRO A 1 50 ? 35.462 63.431 78.387 1.00 20.54 ? 79  PRO A N   1 
ATOM   329  C  CA  . PRO A 1 50 ? 34.054 63.600 78.044 1.00 20.62 ? 79  PRO A CA  1 
ATOM   330  C  C   . PRO A 1 50 ? 33.458 64.930 78.512 1.00 19.95 ? 79  PRO A C   1 
ATOM   331  O  O   . PRO A 1 50 ? 32.399 65.306 78.031 1.00 19.23 ? 79  PRO A O   1 
ATOM   332  C  CB  . PRO A 1 50 ? 33.385 62.412 78.749 1.00 20.72 ? 79  PRO A CB  1 
ATOM   333  C  CG  . PRO A 1 50 ? 34.234 62.128 79.846 1.00 22.44 ? 79  PRO A CG  1 
ATOM   334  C  CD  . PRO A 1 50 ? 35.647 62.417 79.433 1.00 20.92 ? 79  PRO A CD  1 
ATOM   335  N  N   . ALA A 1 51 ? 34.127 65.612 79.436 1.00 19.26 ? 80  ALA A N   1 
ATOM   336  C  CA  . ALA A 1 51 ? 33.676 66.889 79.932 1.00 18.69 ? 80  ALA A CA  1 
ATOM   337  C  C   . ALA A 1 51 ? 34.885 67.773 80.229 1.00 18.16 ? 80  ALA A C   1 
ATOM   338  O  O   . ALA A 1 51 ? 36.001 67.269 80.474 1.00 18.05 ? 80  ALA A O   1 
ATOM   339  C  CB  . ALA A 1 51 ? 32.860 66.683 81.163 1.00 19.37 ? 80  ALA A CB  1 
ATOM   340  N  N   . ASN A 1 52 ? 34.661 69.084 80.224 1.00 16.56 ? 81  ASN A N   1 
ATOM   341  C  CA  . ASN A 1 52 ? 35.684 70.056 80.641 1.00 16.12 ? 81  ASN A CA  1 
ATOM   342  C  C   . ASN A 1 52 ? 35.729 70.128 82.178 1.00 15.98 ? 81  ASN A C   1 
ATOM   343  O  O   . ASN A 1 52 ? 34.772 70.499 82.817 1.00 16.03 ? 81  ASN A O   1 
ATOM   344  C  CB  . ASN A 1 52 ? 35.433 71.466 80.055 1.00 16.35 ? 81  ASN A CB  1 
ATOM   345  C  CG  . ASN A 1 52 ? 35.461 71.492 78.513 1.00 16.73 ? 81  ASN A CG  1 
ATOM   346  O  OD1 . ASN A 1 52 ? 34.721 70.757 77.868 1.00 18.08 ? 81  ASN A OD1 1 
ATOM   347  N  ND2 . ASN A 1 52 ? 36.280 72.345 77.940 1.00 13.23 ? 81  ASN A ND2 1 
ATOM   348  N  N   A TYR A 1 53 ? 36.883 69.770 82.735 0.60 16.40 ? 82  TYR A N   1 
ATOM   349  N  N   B TYR A 1 53 ? 36.854 69.794 82.765 0.40 16.19 ? 82  TYR A N   1 
ATOM   350  C  CA  A TYR A 1 53 ? 37.120 69.678 84.184 0.60 16.85 ? 82  TYR A CA  1 
ATOM   351  C  CA  B TYR A 1 53 ? 36.921 69.728 84.209 0.40 16.44 ? 82  TYR A CA  1 
ATOM   352  C  C   A TYR A 1 53 ? 37.494 71.052 84.734 0.60 15.94 ? 82  TYR A C   1 
ATOM   353  C  C   B TYR A 1 53 ? 37.524 71.030 84.734 0.40 15.82 ? 82  TYR A C   1 
ATOM   354  O  O   A TYR A 1 53 ? 37.511 72.049 83.996 0.60 14.21 ? 82  TYR A O   1 
ATOM   355  O  O   B TYR A 1 53 ? 37.705 71.985 83.972 0.40 14.86 ? 82  TYR A O   1 
ATOM   356  C  CB  A TYR A 1 53 ? 38.250 68.668 84.501 0.60 17.63 ? 82  TYR A CB  1 
ATOM   357  C  CB  B TYR A 1 53 ? 37.666 68.461 84.632 0.40 16.92 ? 82  TYR A CB  1 
ATOM   358  C  CG  A TYR A 1 53 ? 38.232 68.108 85.937 0.60 20.65 ? 82  TYR A CG  1 
ATOM   359  C  CG  B TYR A 1 53 ? 36.903 67.191 84.278 0.40 18.37 ? 82  TYR A CG  1 
ATOM   360  C  CD1 A TYR A 1 53 ? 37.235 67.236 86.352 0.60 25.11 ? 82  TYR A CD1 1 
ATOM   361  C  CD1 B TYR A 1 53 ? 35.630 66.942 84.798 0.40 21.95 ? 82  TYR A CD1 1 
ATOM   362  C  CD2 A TYR A 1 53 ? 39.212 68.463 86.873 0.60 23.69 ? 82  TYR A CD2 1 
ATOM   363  C  CD2 B TYR A 1 53 ? 37.440 66.255 83.412 0.40 19.69 ? 82  TYR A CD2 1 
ATOM   364  C  CE1 A TYR A 1 53 ? 37.212 66.728 87.661 0.60 25.47 ? 82  TYR A CE1 1 
ATOM   365  C  CE1 B TYR A 1 53 ? 34.929 65.782 84.466 0.40 21.94 ? 82  TYR A CE1 1 
ATOM   366  C  CE2 A TYR A 1 53 ? 39.175 67.981 88.173 0.60 23.87 ? 82  TYR A CE2 1 
ATOM   367  C  CE2 B TYR A 1 53 ? 36.756 65.103 83.081 0.40 20.15 ? 82  TYR A CE2 1 
ATOM   368  C  CZ  A TYR A 1 53 ? 38.179 67.112 88.549 0.60 24.31 ? 82  TYR A CZ  1 
ATOM   369  C  CZ  B TYR A 1 53 ? 35.509 64.867 83.614 0.40 21.40 ? 82  TYR A CZ  1 
ATOM   370  O  OH  A TYR A 1 53 ? 38.132 66.614 89.820 0.60 27.15 ? 82  TYR A OH  1 
ATOM   371  O  OH  B TYR A 1 53 ? 34.841 63.722 83.283 0.40 21.29 ? 82  TYR A OH  1 
ATOM   372  N  N   . SER A 1 54 ? 37.746 71.091 86.041 1.00 15.20 ? 83  SER A N   1 
ATOM   373  C  CA  . SER A 1 54 ? 38.281 72.277 86.697 1.00 15.06 ? 83  SER A CA  1 
ATOM   374  C  C   . SER A 1 54 ? 39.714 72.582 86.213 1.00 14.92 ? 83  SER A C   1 
ATOM   375  O  O   . SER A 1 54 ? 40.480 71.673 85.886 1.00 14.37 ? 83  SER A O   1 
ATOM   376  C  CB  . SER A 1 54 ? 38.291 72.040 88.220 1.00 15.10 ? 83  SER A CB  1 
ATOM   377  O  OG  . SER A 1 54 ? 38.981 73.072 88.893 1.00 14.95 ? 83  SER A OG  1 
ATOM   378  N  N   . ALA A 1 55 ? 40.067 73.856 86.222 1.00 15.43 ? 84  ALA A N   1 
ATOM   379  C  CA  . ALA A 1 55 ? 41.437 74.299 86.070 1.00 16.24 ? 84  ALA A CA  1 
ATOM   380  C  C   . ALA A 1 55 ? 42.368 73.709 87.105 1.00 17.28 ? 84  ALA A C   1 
ATOM   381  O  O   . ALA A 1 55 ? 43.570 73.718 86.869 1.00 18.31 ? 84  ALA A O   1 
ATOM   382  C  CB  . ALA A 1 55 ? 41.512 75.794 86.173 1.00 16.54 ? 84  ALA A CB  1 
ATOM   383  N  N   . HIS A 1 56 ? 41.832 73.285 88.261 1.00 17.98 ? 85  HIS A N   1 
ATOM   384  C  CA  . HIS A 1 56 ? 42.622 72.734 89.368 1.00 18.55 ? 85  HIS A CA  1 
ATOM   385  C  C   . HIS A 1 56 ? 42.363 71.251 89.533 1.00 20.08 ? 85  HIS A C   1 
ATOM   386  O  O   . HIS A 1 56 ? 41.247 70.781 89.392 1.00 19.15 ? 85  HIS A O   1 
ATOM   387  C  CB  . HIS A 1 56 ? 42.309 73.450 90.684 1.00 18.94 ? 85  HIS A CB  1 
ATOM   388  C  CG  . HIS A 1 56 ? 42.658 74.897 90.673 1.00 17.87 ? 85  HIS A CG  1 
ATOM   389  N  ND1 . HIS A 1 56 ? 43.856 75.368 91.158 1.00 20.73 ? 85  HIS A ND1 1 
ATOM   390  C  CD2 . HIS A 1 56 ? 41.994 75.974 90.177 1.00 19.82 ? 85  HIS A CD2 1 
ATOM   391  C  CE1 . HIS A 1 56 ? 43.902 76.682 90.994 1.00 21.16 ? 85  HIS A CE1 1 
ATOM   392  N  NE2 . HIS A 1 56 ? 42.794 77.073 90.384 1.00 17.81 ? 85  HIS A NE2 1 
ATOM   393  N  N   . GLY A 1 57 ? 43.424 70.508 89.818 1.00 21.76 ? 86  GLY A N   1 
ATOM   394  C  CA  . GLY A 1 57 ? 43.285 69.123 90.194 1.00 22.95 ? 86  GLY A CA  1 
ATOM   395  C  C   . GLY A 1 57 ? 43.186 68.283 88.948 1.00 23.83 ? 86  GLY A C   1 
ATOM   396  O  O   . GLY A 1 57 ? 43.433 68.741 87.835 1.00 24.18 ? 86  GLY A O   1 
ATOM   397  N  N   . ARG A 1 58 ? 42.823 67.030 89.144 1.00 25.28 ? 87  ARG A N   1 
ATOM   398  C  CA  . ARG A 1 58 ? 42.713 66.085 88.042 1.00 25.99 ? 87  ARG A CA  1 
ATOM   399  C  C   . ARG A 1 58 ? 41.499 65.233 88.311 1.00 24.36 ? 87  ARG A C   1 
ATOM   400  O  O   . ARG A 1 58 ? 41.248 64.872 89.460 1.00 22.81 ? 87  ARG A O   1 
ATOM   401  C  CB  . ARG A 1 58 ? 43.921 65.155 88.046 1.00 27.54 ? 87  ARG A CB  1 
ATOM   402  C  CG  . ARG A 1 58 ? 45.258 65.828 88.238 1.00 33.26 ? 87  ARG A CG  1 
ATOM   403  C  CD  . ARG A 1 58 ? 46.394 64.854 88.391 1.00 39.83 ? 87  ARG A CD  1 
ATOM   404  N  NE  . ARG A 1 58 ? 46.473 64.370 89.762 1.00 46.78 ? 87  ARG A NE  1 
ATOM   405  C  CZ  . ARG A 1 58 ? 46.983 65.062 90.783 1.00 52.88 ? 87  ARG A CZ  1 
ATOM   406  N  NH1 . ARG A 1 58 ? 47.456 66.300 90.613 1.00 55.50 ? 87  ARG A NH1 1 
ATOM   407  N  NH2 . ARG A 1 58 ? 46.996 64.512 91.999 1.00 55.78 ? 87  ARG A NH2 1 
ATOM   408  N  N   . PRO A 1 59 ? 40.787 64.849 87.274 1.00 22.71 ? 88  PRO A N   1 
ATOM   409  C  CA  . PRO A 1 59 ? 39.685 63.915 87.448 1.00 22.32 ? 88  PRO A CA  1 
ATOM   410  C  C   . PRO A 1 59 ? 40.205 62.507 87.754 1.00 21.30 ? 88  PRO A C   1 
ATOM   411  O  O   . PRO A 1 59 ? 41.385 62.203 87.565 1.00 20.14 ? 88  PRO A O   1 
ATOM   412  C  CB  . PRO A 1 59 ? 39.003 63.941 86.091 1.00 22.66 ? 88  PRO A CB  1 
ATOM   413  C  CG  . PRO A 1 59 ? 40.097 64.265 85.137 1.00 22.34 ? 88  PRO A CG  1 
ATOM   414  C  CD  . PRO A 1 59 ? 41.006 65.190 85.866 1.00 23.81 ? 88  PRO A CD  1 
ATOM   415  N  N   . ASN A 1 60 ? 39.299 61.665 88.234 1.00 20.96 ? 89  ASN A N   1 
ATOM   416  C  CA  . ASN A 1 60 ? 39.472 60.225 88.197 1.00 20.40 ? 89  ASN A CA  1 
ATOM   417  C  C   . ASN A 1 60 ? 39.561 59.740 86.745 1.00 20.11 ? 89  ASN A C   1 
ATOM   418  O  O   . ASN A 1 60 ? 38.715 60.076 85.935 1.00 21.25 ? 89  ASN A O   1 
ATOM   419  C  CB  . ASN A 1 60 ? 38.310 59.543 88.955 1.00 21.14 ? 89  ASN A CB  1 
ATOM   420  C  CG  . ASN A 1 60 ? 38.622 58.113 89.344 1.00 19.50 ? 89  ASN A CG  1 
ATOM   421  O  OD1 . ASN A 1 60 ? 39.149 57.355 88.555 1.00 19.09 ? 89  ASN A OD1 1 
ATOM   422  N  ND2 . ASN A 1 60 ? 38.327 57.757 90.585 1.00 19.59 ? 89  ASN A ND2 1 
ATOM   423  N  N   . ILE A 1 61 ? 40.603 58.975 86.403 1.00 19.34 ? 90  ILE A N   1 
ATOM   424  C  CA  . ILE A 1 61 ? 40.739 58.402 85.060 1.00 18.93 ? 90  ILE A CA  1 
ATOM   425  C  C   . ILE A 1 61 ? 39.517 57.569 84.644 1.00 19.69 ? 90  ILE A C   1 
ATOM   426  O  O   . ILE A 1 61 ? 39.244 57.454 83.452 1.00 16.99 ? 90  ILE A O   1 
ATOM   427  C  CB  . ILE A 1 61 ? 42.064 57.565 84.905 1.00 19.34 ? 90  ILE A CB  1 
ATOM   428  C  CG1 . ILE A 1 61 ? 42.338 57.254 83.429 1.00 18.00 ? 90  ILE A CG1 1 
ATOM   429  C  CG2 . ILE A 1 61 ? 42.026 56.279 85.739 1.00 17.92 ? 90  ILE A CG2 1 
ATOM   430  C  CD1 . ILE A 1 61 ? 43.798 56.849 83.121 1.00 17.68 ? 90  ILE A CD1 1 
ATOM   431  N  N   . LYS A 1 62 ? 38.777 57.025 85.618 1.00 20.67 ? 91  LYS A N   1 
ATOM   432  C  CA  . LYS A 1 62 ? 37.536 56.284 85.315 1.00 23.59 ? 91  LYS A CA  1 
ATOM   433  C  C   . LYS A 1 62 ? 36.433 57.188 84.757 1.00 23.77 ? 91  LYS A C   1 
ATOM   434  O  O   . LYS A 1 62 ? 35.533 56.691 84.137 1.00 25.63 ? 91  LYS A O   1 
ATOM   435  C  CB  . LYS A 1 62 ? 36.993 55.552 86.540 1.00 23.74 ? 91  LYS A CB  1 
ATOM   436  C  CG  . LYS A 1 62 ? 37.774 54.291 86.853 1.00 27.84 ? 91  LYS A CG  1 
ATOM   437  C  CD  . LYS A 1 62 ? 37.227 53.535 88.075 1.00 31.82 ? 91  LYS A CD  1 
ATOM   438  C  CE  . LYS A 1 62 ? 38.100 52.350 88.457 0.00 15.00 ? 91  LYS A CE  1 
ATOM   439  N  NZ  . LYS A 1 62 ? 37.440 51.511 89.498 0.00 15.00 ? 91  LYS A NZ  1 
ATOM   440  N  N   . ASP A 1 63 ? 36.517 58.481 85.007 1.00 24.71 ? 92  ASP A N   1 
ATOM   441  C  CA  . ASP A 1 63 ? 35.651 59.511 84.382 1.00 25.64 ? 92  ASP A CA  1 
ATOM   442  C  C   . ASP A 1 63 ? 36.202 60.116 83.082 1.00 26.25 ? 92  ASP A C   1 
ATOM   443  O  O   . ASP A 1 63 ? 35.614 61.071 82.525 1.00 27.60 ? 92  ASP A O   1 
ATOM   444  C  CB  . ASP A 1 63 ? 35.450 60.633 85.388 1.00 25.61 ? 92  ASP A CB  1 
ATOM   445  C  CG  . ASP A 1 63 ? 34.840 60.132 86.660 1.00 25.40 ? 92  ASP A CG  1 
ATOM   446  O  OD1 . ASP A 1 63 ? 34.017 59.232 86.559 1.00 29.23 ? 92  ASP A OD1 1 
ATOM   447  O  OD2 . ASP A 1 63 ? 35.133 60.539 87.790 1.00 27.35 ? 92  ASP A OD2 1 
ATOM   448  N  N   . VAL A 1 64 ? 37.338 59.589 82.614 1.00 25.24 ? 93  VAL A N   1 
ATOM   449  C  CA  . VAL A 1 64 ? 37.963 60.030 81.362 1.00 24.74 ? 93  VAL A CA  1 
ATOM   450  C  C   . VAL A 1 64 ? 37.849 58.954 80.306 1.00 24.84 ? 93  VAL A C   1 
ATOM   451  O  O   . VAL A 1 64 ? 37.355 59.211 79.212 1.00 24.54 ? 93  VAL A O   1 
ATOM   452  C  CB  . VAL A 1 64 ? 39.431 60.416 81.581 1.00 24.37 ? 93  VAL A CB  1 
ATOM   453  C  CG1 . VAL A 1 64 ? 40.105 60.819 80.265 1.00 24.42 ? 93  VAL A CG1 1 
ATOM   454  C  CG2 . VAL A 1 64 ? 39.522 61.527 82.611 1.00 24.28 ? 93  VAL A CG2 1 
ATOM   455  N  N   . LEU A 1 65 ? 38.241 57.727 80.670 1.00 24.40 ? 94  LEU A N   1 
ATOM   456  C  CA  . LEU A 1 65 ? 38.303 56.600 79.749 1.00 23.81 ? 94  LEU A CA  1 
ATOM   457  C  C   . LEU A 1 65 ? 37.339 55.535 80.151 1.00 23.82 ? 94  LEU A C   1 
ATOM   458  O  O   . LEU A 1 65 ? 36.935 55.476 81.297 1.00 23.61 ? 94  LEU A O   1 
ATOM   459  C  CB  . LEU A 1 65 ? 39.707 55.973 79.776 1.00 24.03 ? 94  LEU A CB  1 
ATOM   460  C  CG  . LEU A 1 65 ? 40.863 56.819 79.316 1.00 24.49 ? 94  LEU A CG  1 
ATOM   461  C  CD1 . LEU A 1 65 ? 42.141 55.980 79.430 1.00 25.80 ? 94  LEU A CD1 1 
ATOM   462  C  CD2 . LEU A 1 65 ? 40.621 57.302 77.896 1.00 24.56 ? 94  LEU A CD2 1 
ATOM   463  N  N   . ARG A 1 66 ? 36.994 54.676 79.194 1.00 24.50 ? 95  ARG A N   1 
ATOM   464  C  CA  . ARG A 1 66 ? 36.196 53.480 79.447 1.00 25.00 ? 95  ARG A CA  1 
ATOM   465  C  C   . ARG A 1 66 ? 36.902 52.288 78.868 1.00 24.73 ? 95  ARG A C   1 
ATOM   466  O  O   . ARG A 1 66 ? 37.542 52.376 77.838 1.00 23.60 ? 95  ARG A O   1 
ATOM   467  C  CB  . ARG A 1 66 ? 34.838 53.547 78.708 1.00 26.34 ? 95  ARG A CB  1 
ATOM   468  C  CG  . ARG A 1 66 ? 33.924 54.648 79.144 1.00 29.22 ? 95  ARG A CG  1 
ATOM   469  C  CD  . ARG A 1 66 ? 32.613 54.670 78.358 1.00 33.52 ? 95  ARG A CD  1 
ATOM   470  N  NE  . ARG A 1 66 ? 32.757 55.349 77.063 1.00 36.19 ? 95  ARG A NE  1 
ATOM   471  C  CZ  . ARG A 1 66 ? 32.952 56.526 77.223 0.00 15.00 ? 95  ARG A CZ  1 
ATOM   472  N  NH1 . ARG A 1 66 ? 33.067 57.145 78.389 0.00 15.00 ? 95  ARG A NH1 1 
ATOM   473  N  NH2 . ARG A 1 66 ? 33.045 57.220 76.098 0.00 15.00 ? 95  ARG A NH2 1 
ATOM   474  N  N   . GLU A 1 67 ? 36.692 51.137 79.486 1.00 24.61 ? 96  GLU A N   1 
ATOM   475  C  CA  . GLU A 1 67 ? 37.214 49.900 78.975 1.00 25.77 ? 96  GLU A CA  1 
ATOM   476  C  C   . GLU A 1 67 ? 36.605 49.661 77.599 1.00 24.65 ? 96  GLU A C   1 
ATOM   477  O  O   . GLU A 1 67 ? 35.419 49.921 77.376 1.00 25.05 ? 96  GLU A O   1 
ATOM   478  C  CB  . GLU A 1 67 ? 36.879 48.793 79.978 1.00 26.72 ? 96  GLU A CB  1 
ATOM   479  C  CG  . GLU A 1 67 ? 37.443 47.438 79.686 1.00 32.13 ? 96  GLU A CG  1 
ATOM   480  C  CD  . GLU A 1 67 ? 37.315 46.510 80.899 1.00 40.39 ? 96  GLU A CD  1 
ATOM   481  O  OE1 . GLU A 1 67 ? 37.881 46.840 81.987 1.00 43.81 ? 96  GLU A OE1 1 
ATOM   482  O  OE2 . GLU A 1 67 ? 36.644 45.459 80.765 1.00 43.56 ? 96  GLU A OE2 1 
ATOM   483  N  N   . GLY A 1 68 ? 37.422 49.201 76.663 1.00 23.32 ? 97  GLY A N   1 
ATOM   484  C  CA  . GLY A 1 68 ? 36.982 48.991 75.299 1.00 22.94 ? 97  GLY A CA  1 
ATOM   485  C  C   . GLY A 1 68 ? 37.119 50.208 74.374 1.00 22.46 ? 97  GLY A C   1 
ATOM   486  O  O   . GLY A 1 68 ? 37.125 50.063 73.152 1.00 22.04 ? 97  GLY A O   1 
ATOM   487  N  N   . GLN A 1 69 ? 37.202 51.410 74.940 1.00 22.61 ? 98  GLN A N   1 
ATOM   488  C  CA  . GLN A 1 69 ? 37.454 52.618 74.148 1.00 21.82 ? 98  GLN A CA  1 
ATOM   489  C  C   . GLN A 1 69 ? 38.785 52.521 73.380 1.00 21.22 ? 98  GLN A C   1 
ATOM   490  O  O   . GLN A 1 69 ? 39.729 51.927 73.876 1.00 21.13 ? 98  GLN A O   1 
ATOM   491  C  CB  . GLN A 1 69 ? 37.485 53.790 75.090 1.00 22.63 ? 98  GLN A CB  1 
ATOM   492  C  CG  . GLN A 1 69 ? 37.797 55.112 74.444 1.00 23.29 ? 98  GLN A CG  1 
ATOM   493  C  CD  . GLN A 1 69 ? 37.545 56.262 75.370 1.00 23.48 ? 98  GLN A CD  1 
ATOM   494  O  OE1 . GLN A 1 69 ? 37.255 56.069 76.570 1.00 23.01 ? 98  GLN A OE1 1 
ATOM   495  N  NE2 . GLN A 1 69 ? 37.668 57.473 74.833 1.00 22.28 ? 98  GLN A NE2 1 
ATOM   496  N  N   . GLU A 1 70 ? 38.851 53.077 72.169 1.00 19.45 ? 99  GLU A N   1 
ATOM   497  C  CA  . GLU A 1 70 ? 40.094 53.217 71.432 1.00 19.45 ? 99  GLU A CA  1 
ATOM   498  C  C   . GLU A 1 70 ? 40.617 54.640 71.486 1.00 18.83 ? 99  GLU A C   1 
ATOM   499  O  O   . GLU A 1 70 ? 39.867 55.584 71.332 1.00 18.70 ? 99  GLU A O   1 
ATOM   500  C  CB  . GLU A 1 70 ? 39.918 52.807 69.970 1.00 20.21 ? 99  GLU A CB  1 
ATOM   501  C  CG  . GLU A 1 70 ? 39.805 51.308 69.803 1.00 21.68 ? 99  GLU A CG  1 
ATOM   502  C  CD  . GLU A 1 70 ? 39.445 50.874 68.390 1.00 25.86 ? 99  GLU A CD  1 
ATOM   503  O  OE1 . GLU A 1 70 ? 38.672 51.575 67.738 1.00 26.03 ? 99  GLU A OE1 1 
ATOM   504  O  OE2 . GLU A 1 70 ? 39.910 49.797 67.955 1.00 28.31 ? 99  GLU A OE2 1 
ATOM   505  N  N   . VAL A 1 71 ? 41.918 54.767 71.701 1.00 18.90 ? 100 VAL A N   1 
ATOM   506  C  CA  . VAL A 1 71 ? 42.639 56.033 71.625 1.00 18.86 ? 100 VAL A CA  1 
ATOM   507  C  C   . VAL A 1 71 ? 43.814 55.883 70.693 1.00 18.68 ? 100 VAL A C   1 
ATOM   508  O  O   . VAL A 1 71 ? 44.298 54.774 70.468 1.00 19.04 ? 100 VAL A O   1 
ATOM   509  C  CB  . VAL A 1 71 ? 43.162 56.486 72.994 1.00 19.87 ? 100 VAL A CB  1 
ATOM   510  C  CG1 . VAL A 1 71 ? 42.015 56.785 73.924 1.00 19.71 ? 100 VAL A CG1 1 
ATOM   511  C  CG2 . VAL A 1 71 ? 44.063 55.436 73.592 1.00 19.89 ? 100 VAL A CG2 1 
ATOM   512  N  N   . ILE A 1 72 ? 44.276 56.987 70.133 1.00 16.97 ? 101 ILE A N   1 
ATOM   513  C  CA  . ILE A 1 72 ? 45.442 56.948 69.260 1.00 16.97 ? 101 ILE A CA  1 
ATOM   514  C  C   . ILE A 1 72 ? 46.663 57.167 70.132 1.00 17.37 ? 101 ILE A C   1 
ATOM   515  O  O   . ILE A 1 72 ? 46.716 58.126 70.915 1.00 16.19 ? 101 ILE A O   1 
ATOM   516  C  CB  . ILE A 1 72 ? 45.345 57.986 68.142 1.00 17.15 ? 101 ILE A CB  1 
ATOM   517  C  CG1 . ILE A 1 72 ? 44.111 57.712 67.288 1.00 18.32 ? 101 ILE A CG1 1 
ATOM   518  C  CG2 . ILE A 1 72 ? 46.591 57.943 67.255 1.00 17.85 ? 101 ILE A CG2 1 
ATOM   519  C  CD1 . ILE A 1 72 ? 43.588 58.962 66.561 1.00 20.81 ? 101 ILE A CD1 1 
ATOM   520  N  N   . VAL A 1 73 ? 47.631 56.262 70.031 1.00 17.03 ? 102 VAL A N   1 
ATOM   521  C  CA  . VAL A 1 73 ? 48.827 56.349 70.862 1.00 18.11 ? 102 VAL A CA  1 
ATOM   522  C  C   . VAL A 1 73 ? 50.108 56.206 70.050 1.00 17.82 ? 102 VAL A C   1 
ATOM   523  O  O   . VAL A 1 73 ? 50.136 55.643 68.947 1.00 17.32 ? 102 VAL A O   1 
ATOM   524  C  CB  . VAL A 1 73 ? 48.842 55.274 71.978 1.00 17.97 ? 102 VAL A CB  1 
ATOM   525  C  CG1 . VAL A 1 73 ? 47.687 55.443 72.917 1.00 19.19 ? 102 VAL A CG1 1 
ATOM   526  C  CG2 . VAL A 1 73 ? 48.824 53.837 71.396 1.00 18.45 ? 102 VAL A CG2 1 
ATOM   527  N  N   . GLN A 1 74 ? 51.166 56.759 70.595 1.00 18.73 ? 103 GLN A N   1 
ATOM   528  C  CA  . GLN A 1 74 ? 52.509 56.429 70.138 1.00 19.40 ? 103 GLN A CA  1 
ATOM   529  C  C   . GLN A 1 74 ? 53.310 55.925 71.328 1.00 20.03 ? 103 GLN A C   1 
ATOM   530  O  O   . GLN A 1 74 ? 53.001 56.241 72.484 1.00 18.83 ? 103 GLN A O   1 
ATOM   531  C  CB  . GLN A 1 74 ? 53.203 57.618 69.460 1.00 19.64 ? 103 GLN A CB  1 
ATOM   532  C  CG  . GLN A 1 74 ? 53.620 58.722 70.361 1.00 20.96 ? 103 GLN A CG  1 
ATOM   533  C  CD  . GLN A 1 74 ? 54.243 59.882 69.589 1.00 23.02 ? 103 GLN A CD  1 
ATOM   534  O  OE1 . GLN A 1 74 ? 53.808 60.209 68.480 1.00 23.27 ? 103 GLN A OE1 1 
ATOM   535  N  NE2 . GLN A 1 74 ? 55.248 60.500 70.177 1.00 25.08 ? 103 GLN A NE2 1 
ATOM   536  N  N   . ILE A 1 75 ? 54.350 55.147 71.029 1.00 20.94 ? 104 ILE A N   1 
ATOM   537  C  CA  . ILE A 1 75 ? 55.259 54.665 72.063 1.00 21.49 ? 104 ILE A CA  1 
ATOM   538  C  C   . ILE A 1 75 ? 56.216 55.769 72.467 1.00 23.18 ? 104 ILE A C   1 
ATOM   539  O  O   . ILE A 1 75 ? 56.953 56.305 71.652 1.00 23.77 ? 104 ILE A O   1 
ATOM   540  C  CB  . ILE A 1 75 ? 56.029 53.418 71.599 1.00 21.02 ? 104 ILE A CB  1 
ATOM   541  C  CG1 . ILE A 1 75 ? 55.039 52.274 71.444 1.00 21.94 ? 104 ILE A CG1 1 
ATOM   542  C  CG2 . ILE A 1 75 ? 57.141 53.083 72.622 1.00 20.70 ? 104 ILE A CG2 1 
ATOM   543  C  CD1 . ILE A 1 75 ? 55.503 51.100 70.698 1.00 24.17 ? 104 ILE A CD1 1 
ATOM   544  N  N   . ASP A 1 76 ? 56.158 56.093 73.748 1.00 24.83 ? 105 ASP A N   1 
ATOM   545  C  CA  . ASP A 1 76 ? 57.064 56.991 74.410 1.00 27.27 ? 105 ASP A CA  1 
ATOM   546  C  C   . ASP A 1 76 ? 58.365 56.311 74.897 1.00 27.72 ? 105 ASP A C   1 
ATOM   547  O  O   . ASP A 1 76 ? 59.456 56.864 74.720 1.00 27.37 ? 105 ASP A O   1 
ATOM   548  C  CB  . ASP A 1 76 ? 56.338 57.537 75.634 1.00 28.61 ? 105 ASP A CB  1 
ATOM   549  C  CG  . ASP A 1 76 ? 56.650 58.943 75.886 1.00 34.19 ? 105 ASP A CG  1 
ATOM   550  O  OD1 . ASP A 1 76 ? 56.490 59.727 74.925 1.00 41.87 ? 105 ASP A OD1 1 
ATOM   551  O  OD2 . ASP A 1 76 ? 57.055 59.351 77.009 1.00 42.50 ? 105 ASP A OD2 1 
ATOM   552  N  N   . LYS A 1 77 ? 58.220 55.171 75.587 1.00 27.33 ? 106 LYS A N   1 
ATOM   553  C  CA  . LYS A 1 77 ? 59.369 54.341 75.980 1.00 27.53 ? 106 LYS A CA  1 
ATOM   554  C  C   . LYS A 1 77 ? 59.095 52.957 75.509 1.00 26.68 ? 106 LYS A C   1 
ATOM   555  O  O   . LYS A 1 77 ? 58.062 52.397 75.812 1.00 24.99 ? 106 LYS A O   1 
ATOM   556  C  CB  . LYS A 1 77 ? 59.596 54.293 77.485 1.00 27.74 ? 106 LYS A CB  1 
ATOM   557  C  CG  . LYS A 1 77 ? 59.846 55.614 78.107 1.00 29.05 ? 106 LYS A CG  1 
ATOM   558  C  CD  . LYS A 1 77 ? 60.188 55.460 79.576 1.00 33.25 ? 106 LYS A CD  1 
ATOM   559  C  CE  . LYS A 1 77 ? 59.629 56.546 80.489 0.00 15.00 ? 106 LYS A CE  1 
ATOM   560  N  NZ  . LYS A 1 77 ? 59.719 56.341 81.962 0.00 15.00 ? 106 LYS A NZ  1 
ATOM   561  N  N   . GLU A 1 78 ? 60.033 52.405 74.756 1.00 27.50 ? 107 GLU A N   1 
ATOM   562  C  CA  . GLU A 1 78 ? 59.913 51.043 74.267 1.00 29.18 ? 107 GLU A CA  1 
ATOM   563  C  C   . GLU A 1 78 ? 59.774 50.046 75.449 1.00 28.84 ? 107 GLU A C   1 
ATOM   564  O  O   . GLU A 1 78 ? 60.288 50.282 76.539 1.00 26.62 ? 107 GLU A O   1 
ATOM   565  C  CB  . GLU A 1 78 ? 61.153 50.699 73.408 1.00 30.32 ? 107 GLU A CB  1 
ATOM   566  C  CG  . GLU A 1 78 ? 60.869 49.864 72.163 1.00 35.90 ? 107 GLU A CG  1 
ATOM   567  C  CD  . GLU A 1 78 ? 60.071 50.582 71.065 1.00 40.77 ? 107 GLU A CD  1 
ATOM   568  O  OE1 . GLU A 1 78 ? 60.426 51.743 70.708 1.00 46.36 ? 107 GLU A OE1 1 
ATOM   569  O  OE2 . GLU A 1 78 ? 59.105 49.972 70.526 1.00 41.12 ? 107 GLU A OE2 1 
ATOM   570  N  N   . GLU A 1 79 ? 59.023 48.979 75.201 1.00 29.63 ? 108 GLU A N   1 
ATOM   571  C  CA  . GLU A 1 79 ? 59.051 47.742 75.973 1.00 31.23 ? 108 GLU A CA  1 
ATOM   572  C  C   . GLU A 1 79 ? 60.495 47.353 76.318 1.00 31.81 ? 108 GLU A C   1 
ATOM   573  O  O   . GLU A 1 79 ? 61.363 47.340 75.436 1.00 31.66 ? 108 GLU A O   1 
ATOM   574  C  CB  . GLU A 1 79 ? 58.443 46.608 75.132 1.00 31.89 ? 108 GLU A CB  1 
ATOM   575  C  CG  . GLU A 1 79 ? 57.292 45.873 75.750 1.00 33.63 ? 108 GLU A CG  1 
ATOM   576  C  CD  . GLU A 1 79 ? 56.837 44.710 74.899 1.00 36.01 ? 108 GLU A CD  1 
ATOM   577  O  OE1 . GLU A 1 79 ? 57.671 43.815 74.635 1.00 40.87 ? 108 GLU A OE1 1 
ATOM   578  O  OE2 . GLU A 1 79 ? 55.656 44.683 74.499 1.00 35.03 ? 108 GLU A OE2 1 
ATOM   579  N  N   . ARG A 1 80 ? 60.716 47.028 77.592 1.00 31.14 ? 109 ARG A N   1 
ATOM   580  C  CA  . ARG A 1 80 ? 62.026 46.687 78.111 1.00 31.84 ? 109 ARG A CA  1 
ATOM   581  C  C   . ARG A 1 80 ? 61.937 45.754 79.339 1.00 30.76 ? 109 ARG A C   1 
ATOM   582  O  O   . ARG A 1 80 ? 61.301 46.079 80.342 1.00 30.12 ? 109 ARG A O   1 
ATOM   583  C  CB  . ARG A 1 80 ? 62.761 47.953 78.509 1.00 31.96 ? 109 ARG A CB  1 
ATOM   584  C  CG  . ARG A 1 80 ? 64.185 47.682 78.975 1.00 35.25 ? 109 ARG A CG  1 
ATOM   585  C  CD  . ARG A 1 80 ? 65.108 48.903 78.913 1.00 37.52 ? 109 ARG A CD  1 
ATOM   586  N  NE  . ARG A 1 80 ? 65.112 49.492 77.562 1.00 38.03 ? 109 ARG A NE  1 
ATOM   587  C  CZ  . ARG A 1 80 ? 65.568 50.918 77.596 0.00 15.00 ? 109 ARG A CZ  1 
ATOM   588  N  NH1 . ARG A 1 80 ? 65.285 51.617 76.506 0.00 15.00 ? 109 ARG A NH1 1 
ATOM   589  N  NH2 . ARG A 1 80 ? 66.500 51.351 78.431 0.00 15.00 ? 109 ARG A NH2 1 
ATOM   590  N  N   . GLY A 1 81 ? 62.619 44.618 79.255 1.00 29.77 ? 110 GLY A N   1 
ATOM   591  C  CA  . GLY A 1 81 ? 62.612 43.624 80.318 1.00 28.31 ? 110 GLY A CA  1 
ATOM   592  C  C   . GLY A 1 81 ? 61.207 43.102 80.464 1.00 26.27 ? 110 GLY A C   1 
ATOM   593  O  O   . GLY A 1 81 ? 60.643 42.674 79.483 1.00 26.25 ? 110 GLY A O   1 
ATOM   594  N  N   . ASN A 1 82 ? 60.632 43.197 81.657 1.00 24.80 ? 111 ASN A N   1 
ATOM   595  C  CA  . ASN A 1 82 ? 59.248 42.787 81.901 1.00 24.24 ? 111 ASN A CA  1 
ATOM   596  C  C   . ASN A 1 82 ? 58.201 43.900 81.720 1.00 23.47 ? 111 ASN A C   1 
ATOM   597  O  O   . ASN A 1 82 ? 57.024 43.638 81.791 1.00 22.13 ? 111 ASN A O   1 
ATOM   598  C  CB  . ASN A 1 82 ? 59.138 42.155 83.289 1.00 24.42 ? 111 ASN A CB  1 
ATOM   599  C  CG  . ASN A 1 82 ? 60.109 40.991 83.444 1.00 24.46 ? 111 ASN A CG  1 
ATOM   600  O  OD1 . ASN A 1 82 ? 60.090 40.071 82.631 1.00 24.63 ? 111 ASN A OD1 1 
ATOM   601  N  ND2 . ASN A 1 82 ? 61.015 41.081 84.413 1.00 23.50 ? 111 ASN A ND2 1 
ATOM   602  N  N   . LYS A 1 83 ? 58.666 45.116 81.463 1.00 23.62 ? 112 LYS A N   1 
ATOM   603  C  CA  . LYS A 1 83 ? 57.794 46.290 81.383 1.00 24.09 ? 112 LYS A CA  1 
ATOM   604  C  C   . LYS A 1 83 ? 57.132 46.462 80.042 1.00 23.01 ? 112 LYS A C   1 
ATOM   605  O  O   . LYS A 1 83 ? 57.763 46.290 79.010 1.00 22.51 ? 112 LYS A O   1 
ATOM   606  C  CB  . LYS A 1 83 ? 58.622 47.530 81.653 1.00 25.13 ? 112 LYS A CB  1 
ATOM   607  C  CG  . LYS A 1 83 ? 59.093 47.658 83.072 1.00 28.75 ? 112 LYS A CG  1 
ATOM   608  C  CD  . LYS A 1 83 ? 59.526 49.088 83.324 1.00 32.52 ? 112 LYS A CD  1 
ATOM   609  C  CE  . LYS A 1 83 ? 58.358 50.002 83.784 1.00 36.09 ? 112 LYS A CE  1 
ATOM   610  N  NZ  . LYS A 1 83 ? 57.039 49.321 84.058 1.00 38.68 ? 112 LYS A NZ  1 
ATOM   611  N  N   . GLY A 1 84 ? 55.849 46.824 80.038 1.00 22.91 ? 113 GLY A N   1 
ATOM   612  C  CA  . GLY A 1 84 ? 55.192 47.247 78.806 1.00 21.63 ? 113 GLY A CA  1 
ATOM   613  C  C   . GLY A 1 84 ? 55.724 48.598 78.347 1.00 20.87 ? 113 GLY A C   1 
ATOM   614  O  O   . GLY A 1 84 ? 56.394 49.309 79.097 1.00 20.43 ? 113 GLY A O   1 
ATOM   615  N  N   . ALA A 1 85 ? 55.423 48.936 77.102 1.00 21.04 ? 114 ALA A N   1 
ATOM   616  C  CA  . ALA A 1 85 ? 55.736 50.244 76.537 1.00 20.93 ? 114 ALA A CA  1 
ATOM   617  C  C   . ALA A 1 85 ? 54.975 51.343 77.279 1.00 20.69 ? 114 ALA A C   1 
ATOM   618  O  O   . ALA A 1 85 ? 53.819 51.157 77.712 1.00 20.78 ? 114 ALA A O   1 
ATOM   619  C  CB  . ALA A 1 85 ? 55.386 50.265 75.087 1.00 21.73 ? 114 ALA A CB  1 
ATOM   620  N  N   . ALA A 1 86 ? 55.656 52.456 77.498 1.00 20.06 ? 115 ALA A N   1 
ATOM   621  C  CA  . ALA A 1 86 ? 55.008 53.637 78.022 1.00 19.93 ? 115 ALA A CA  1 
ATOM   622  C  C   . ALA A 1 86 ? 54.422 54.355 76.815 1.00 19.48 ? 115 ALA A C   1 
ATOM   623  O  O   . ALA A 1 86 ? 55.121 54.627 75.831 1.00 19.91 ? 115 ALA A O   1 
ATOM   624  C  CB  . ALA A 1 86 ? 55.981 54.487 78.733 1.00 20.90 ? 115 ALA A CB  1 
ATOM   625  N  N   . LEU A 1 87 ? 53.127 54.617 76.880 1.00 18.26 ? 116 LEU A N   1 
ATOM   626  C  CA  . LEU A 1 87 ? 52.405 55.206 75.779 1.00 17.08 ? 116 LEU A CA  1 
ATOM   627  C  C   . LEU A 1 87 ? 51.976 56.640 76.050 1.00 15.92 ? 116 LEU A C   1 
ATOM   628  O  O   . LEU A 1 87 ? 51.815 57.068 77.198 1.00 15.42 ? 116 LEU A O   1 
ATOM   629  C  CB  . LEU A 1 87 ? 51.163 54.387 75.568 1.00 17.36 ? 116 LEU A CB  1 
ATOM   630  C  CG  . LEU A 1 87 ? 51.341 52.903 75.234 1.00 17.30 ? 116 LEU A CG  1 
ATOM   631  C  CD1 . LEU A 1 87 ? 49.970 52.312 75.155 1.00 16.89 ? 116 LEU A CD1 1 
ATOM   632  C  CD2 . LEU A 1 87 ? 52.054 52.771 73.945 1.00 18.54 ? 116 LEU A CD2 1 
ATOM   633  N  N   . THR A 1 88 ? 51.746 57.361 74.965 1.00 16.13 ? 117 THR A N   1 
ATOM   634  C  CA  . THR A 1 88 ? 51.138 58.665 75.034 1.00 15.72 ? 117 THR A CA  1 
ATOM   635  C  C   . THR A 1 88 ? 50.163 58.851 73.870 1.00 15.59 ? 117 THR A C   1 
ATOM   636  O  O   . THR A 1 88 ? 50.345 58.280 72.790 1.00 15.63 ? 117 THR A O   1 
ATOM   637  C  CB  . THR A 1 88 ? 52.186 59.778 75.063 1.00 15.48 ? 117 THR A CB  1 
ATOM   638  O  OG1 . THR A 1 88 ? 51.541 61.062 75.190 1.00 15.91 ? 117 THR A OG1 1 
ATOM   639  C  CG2 . THR A 1 88 ? 52.949 59.886 73.779 1.00 15.11 ? 117 THR A CG2 1 
ATOM   640  N  N   . THR A 1 89 ? 49.140 59.657 74.120 1.00 14.84 ? 118 THR A N   1 
ATOM   641  C  CA  . THR A 1 89 ? 48.257 60.155 73.048 1.00 15.20 ? 118 THR A CA  1 
ATOM   642  C  C   . THR A 1 89 ? 48.675 61.481 72.403 1.00 15.45 ? 118 THR A C   1 
ATOM   643  O  O   . THR A 1 89 ? 48.014 61.910 71.453 1.00 16.04 ? 118 THR A O   1 
ATOM   644  C  CB  . THR A 1 89 ? 46.828 60.319 73.535 1.00 14.22 ? 118 THR A CB  1 
ATOM   645  O  OG1 . THR A 1 89 ? 46.778 61.365 74.501 1.00 12.80 ? 118 THR A OG1 1 
ATOM   646  C  CG2 . THR A 1 89 ? 46.334 59.083 74.252 1.00 14.44 ? 118 THR A CG2 1 
ATOM   647  N  N   . PHE A 1 90 ? 49.740 62.103 72.895 1.00 16.13 ? 119 PHE A N   1 
ATOM   648  C  CA  . PHE A 1 90 ? 50.312 63.279 72.241 1.00 17.07 ? 119 PHE A CA  1 
ATOM   649  C  C   . PHE A 1 90 ? 51.213 62.865 71.100 1.00 19.01 ? 119 PHE A C   1 
ATOM   650  O  O   . PHE A 1 90 ? 52.363 62.418 71.311 1.00 19.31 ? 119 PHE A O   1 
ATOM   651  C  CB  . PHE A 1 90 ? 51.053 64.137 73.250 1.00 18.27 ? 119 PHE A CB  1 
ATOM   652  C  CG  . PHE A 1 90 ? 50.155 64.664 74.311 1.00 17.08 ? 119 PHE A CG  1 
ATOM   653  C  CD1 . PHE A 1 90 ? 49.198 65.590 74.005 1.00 19.53 ? 119 PHE A CD1 1 
ATOM   654  C  CD2 . PHE A 1 90 ? 50.238 64.211 75.592 1.00 20.72 ? 119 PHE A CD2 1 
ATOM   655  C  CE1 . PHE A 1 90 ? 48.352 66.063 74.984 1.00 21.60 ? 119 PHE A CE1 1 
ATOM   656  C  CE2 . PHE A 1 90 ? 49.368 64.687 76.561 1.00 21.65 ? 119 PHE A CE2 1 
ATOM   657  C  CZ  . PHE A 1 90 ? 48.441 65.602 76.246 1.00 20.30 ? 119 PHE A CZ  1 
ATOM   658  N  N   . ILE A 1 91 ? 50.666 62.978 69.887 1.00 19.75 ? 120 ILE A N   1 
ATOM   659  C  CA  . ILE A 1 91 ? 51.277 62.421 68.707 1.00 20.34 ? 120 ILE A CA  1 
ATOM   660  C  C   . ILE A 1 91 ? 52.128 63.507 68.062 1.00 21.67 ? 120 ILE A C   1 
ATOM   661  O  O   . ILE A 1 91 ? 51.653 64.607 67.814 1.00 20.31 ? 120 ILE A O   1 
ATOM   662  C  CB  . ILE A 1 91 ? 50.232 61.940 67.697 1.00 20.66 ? 120 ILE A CB  1 
ATOM   663  C  CG1 . ILE A 1 91 ? 49.249 60.950 68.316 1.00 19.73 ? 120 ILE A CG1 1 
ATOM   664  C  CG2 . ILE A 1 91 ? 50.928 61.320 66.468 1.00 21.45 ? 120 ILE A CG2 1 
ATOM   665  C  CD1 . ILE A 1 91 ? 49.888 59.726 68.939 1.00 19.86 ? 120 ILE A CD1 1 
ATOM   666  N  N   . SER A 1 92 ? 53.395 63.171 67.846 1.00 22.54 ? 121 SER A N   1 
ATOM   667  C  CA  . SER A 1 92 ? 54.351 63.961 67.089 1.00 24.66 ? 121 SER A CA  1 
ATOM   668  C  C   . SER A 1 92 ? 53.953 64.014 65.603 1.00 24.64 ? 121 SER A C   1 
ATOM   669  O  O   . SER A 1 92 ? 53.863 62.971 64.948 1.00 25.51 ? 121 SER A O   1 
ATOM   670  C  CB  . SER A 1 92 ? 55.740 63.284 67.177 1.00 24.57 ? 121 SER A CB  1 
ATOM   671  O  OG  . SER A 1 92 ? 56.047 63.034 68.526 1.00 28.88 ? 121 SER A OG  1 
ATOM   672  N  N   . LEU A 1 93 ? 53.714 65.212 65.099 1.00 24.75 ? 122 LEU A N   1 
ATOM   673  C  CA  . LEU A 1 93 ? 53.405 65.433 63.683 1.00 25.51 ? 122 LEU A CA  1 
ATOM   674  C  C   . LEU A 1 93 ? 54.167 66.646 63.168 1.00 25.80 ? 122 LEU A C   1 
ATOM   675  O  O   . LEU A 1 93 ? 53.971 67.757 63.664 1.00 24.87 ? 122 LEU A O   1 
ATOM   676  C  CB  . LEU A 1 93 ? 51.917 65.758 63.498 1.00 25.40 ? 122 LEU A CB  1 
ATOM   677  C  CG  . LEU A 1 93 ? 50.859 64.686 63.744 1.00 25.43 ? 122 LEU A CG  1 
ATOM   678  C  CD1 . LEU A 1 93 ? 49.509 65.325 63.520 1.00 25.69 ? 122 LEU A CD1 1 
ATOM   679  C  CD2 . LEU A 1 93 ? 51.055 63.469 62.857 1.00 25.27 ? 122 LEU A CD2 1 
ATOM   680  N  N   . ALA A 1 94 ? 54.986 66.436 62.141 1.00 27.05 ? 123 ALA A N   1 
ATOM   681  C  CA  . ALA A 1 94 ? 55.680 67.550 61.470 1.00 27.91 ? 123 ALA A CA  1 
ATOM   682  C  C   . ALA A 1 94 ? 54.675 68.615 61.046 1.00 28.83 ? 123 ALA A C   1 
ATOM   683  O  O   . ALA A 1 94 ? 53.653 68.317 60.409 1.00 27.86 ? 123 ALA A O   1 
ATOM   684  C  CB  . ALA A 1 94 ? 56.450 67.043 60.280 1.00 28.48 ? 123 ALA A CB  1 
ATOM   685  N  N   . GLY A 1 95 ? 54.931 69.856 61.453 1.00 30.07 ? 124 GLY A N   1 
ATOM   686  C  CA  . GLY A 1 95 ? 54.078 70.974 61.074 1.00 30.86 ? 124 GLY A CA  1 
ATOM   687  C  C   . GLY A 1 95 ? 52.793 71.166 61.885 1.00 31.87 ? 124 GLY A C   1 
ATOM   688  O  O   . GLY A 1 95 ? 51.959 71.991 61.510 1.00 32.93 ? 124 GLY A O   1 
ATOM   689  N  N   . SER A 1 96 ? 52.603 70.440 62.986 1.00 32.39 ? 125 SER A N   1 
ATOM   690  C  CA  . SER A 1 96 ? 51.438 70.710 63.853 1.00 32.83 ? 125 SER A CA  1 
ATOM   691  C  C   . SER A 1 96 ? 51.711 71.780 64.922 1.00 33.46 ? 125 SER A C   1 
ATOM   692  O  O   . SER A 1 96 ? 52.865 72.146 65.200 1.00 34.21 ? 125 SER A O   1 
ATOM   693  C  CB  . SER A 1 96 ? 50.948 69.443 64.542 1.00 32.64 ? 125 SER A CB  1 
ATOM   694  O  OG  . SER A 1 96 ? 51.965 68.871 65.359 1.00 32.87 ? 125 SER A OG  1 
ATOM   695  O  OXT . SER A 1 96 ? 50.756 72.282 65.542 1.00 33.05 ? 125 SER A OXT 1 
ATOM   696  N  N   . ALA B 1 10 ? 45.436 48.109 63.091 1.00 34.18 ? 39  ALA B N   1 
ATOM   697  C  CA  . ALA B 1 10 ? 45.938 47.736 61.741 1.00 33.66 ? 39  ALA B CA  1 
ATOM   698  C  C   . ALA B 1 10 ? 45.554 48.771 60.663 1.00 32.63 ? 39  ALA B C   1 
ATOM   699  O  O   . ALA B 1 10 ? 45.811 48.522 59.480 1.00 35.71 ? 39  ALA B O   1 
ATOM   700  C  CB  . ALA B 1 10 ? 45.378 46.353 61.343 1.00 34.20 ? 39  ALA B CB  1 
ATOM   701  N  N   . ASN B 1 11 ? 44.872 49.854 61.020 1.00 29.16 ? 40  ASN B N   1 
ATOM   702  C  CA  . ASN B 1 11 ? 44.428 50.856 60.018 1.00 27.14 ? 40  ASN B CA  1 
ATOM   703  C  C   . ASN B 1 11 ? 44.530 52.279 60.559 1.00 24.87 ? 40  ASN B C   1 
ATOM   704  O  O   . ASN B 1 11 ? 43.519 52.929 60.869 1.00 23.90 ? 40  ASN B O   1 
ATOM   705  C  CB  . ASN B 1 11 ? 42.990 50.601 59.547 1.00 26.27 ? 40  ASN B CB  1 
ATOM   706  C  CG  . ASN B 1 11 ? 42.585 51.501 58.342 1.00 24.76 ? 40  ASN B CG  1 
ATOM   707  O  OD1 . ASN B 1 11 ? 43.420 52.147 57.698 1.00 20.49 ? 40  ASN B OD1 1 
ATOM   708  N  ND2 . ASN B 1 11 ? 41.308 51.480 58.018 1.00 23.20 ? 40  ASN B ND2 1 
ATOM   709  N  N   . ILE B 1 12 ? 45.761 52.702 60.723 1.00 23.65 ? 41  ILE B N   1 
ATOM   710  C  CA  . ILE B 1 12 ? 46.074 54.059 61.164 1.00 23.46 ? 41  ILE B CA  1 
ATOM   711  C  C   . ILE B 1 12 ? 47.497 54.313 60.773 1.00 23.18 ? 41  ILE B C   1 
ATOM   712  O  O   . ILE B 1 12 ? 48.355 53.435 60.930 1.00 22.89 ? 41  ILE B O   1 
ATOM   713  C  CB  . ILE B 1 12 ? 45.870 54.246 62.693 1.00 23.52 ? 41  ILE B CB  1 
ATOM   714  C  CG1 . ILE B 1 12 ? 46.099 55.719 63.064 1.00 24.07 ? 41  ILE B CG1 1 
ATOM   715  C  CG2 . ILE B 1 12 ? 46.823 53.389 63.521 1.00 24.93 ? 41  ILE B CG2 1 
ATOM   716  C  CD1 . ILE B 1 12 ? 44.969 56.330 63.728 1.00 26.51 ? 41  ILE B CD1 1 
ATOM   717  N  N   . TYR B 1 13 ? 47.752 55.501 60.246 1.00 22.47 ? 42  TYR B N   1 
ATOM   718  C  CA  . TYR B 1 13 ? 49.038 55.821 59.697 1.00 22.77 ? 42  TYR B CA  1 
ATOM   719  C  C   . TYR B 1 13 ? 49.346 57.275 59.945 1.00 23.13 ? 42  TYR B C   1 
ATOM   720  O  O   . TYR B 1 13 ? 48.459 58.109 60.122 1.00 21.76 ? 42  TYR B O   1 
ATOM   721  C  CB  . TYR B 1 13 ? 49.091 55.543 58.188 1.00 22.66 ? 42  TYR B CB  1 
ATOM   722  C  CG  . TYR B 1 13 ? 48.626 54.162 57.807 1.00 22.88 ? 42  TYR B CG  1 
ATOM   723  C  CD1 . TYR B 1 13 ? 47.274 53.867 57.707 1.00 23.17 ? 42  TYR B CD1 1 
ATOM   724  C  CD2 . TYR B 1 13 ? 49.545 53.144 57.556 1.00 26.26 ? 42  TYR B CD2 1 
ATOM   725  C  CE1 . TYR B 1 13 ? 46.840 52.600 57.359 1.00 25.52 ? 42  TYR B CE1 1 
ATOM   726  C  CE2 . TYR B 1 13 ? 49.118 51.853 57.215 1.00 26.74 ? 42  TYR B CE2 1 
ATOM   727  C  CZ  . TYR B 1 13 ? 47.787 51.589 57.115 1.00 27.01 ? 42  TYR B CZ  1 
ATOM   728  O  OH  . TYR B 1 13 ? 47.384 50.321 56.770 1.00 27.12 ? 42  TYR B OH  1 
ATOM   729  N  N   . LYS B 1 14 ? 50.632 57.542 59.977 1.00 23.64 ? 43  LYS B N   1 
ATOM   730  C  CA  . LYS B 1 14 ? 51.141 58.881 59.918 1.00 25.42 ? 43  LYS B CA  1 
ATOM   731  C  C   . LYS B 1 14 ? 51.545 59.097 58.448 1.00 25.54 ? 43  LYS B C   1 
ATOM   732  O  O   . LYS B 1 14 ? 52.303 58.311 57.857 1.00 26.14 ? 43  LYS B O   1 
ATOM   733  C  CB  . LYS B 1 14 ? 52.278 59.012 60.915 1.00 26.02 ? 43  LYS B CB  1 
ATOM   734  C  CG  . LYS B 1 14 ? 52.727 60.396 61.215 1.00 29.30 ? 43  LYS B CG  1 
ATOM   735  C  CD  . LYS B 1 14 ? 54.015 60.375 62.094 1.00 32.08 ? 43  LYS B CD  1 
ATOM   736  C  CE  . LYS B 1 14 ? 53.740 59.975 63.519 1.00 32.42 ? 43  LYS B CE  1 
ATOM   737  N  NZ  . LYS B 1 14 ? 54.802 60.522 64.398 1.00 31.70 ? 43  LYS B NZ  1 
ATOM   738  N  N   . GLY B 1 15 ? 50.969 60.109 57.823 1.00 25.28 ? 44  GLY B N   1 
ATOM   739  C  CA  . GLY B 1 15 ? 51.203 60.358 56.414 1.00 25.48 ? 44  GLY B CA  1 
ATOM   740  C  C   . GLY B 1 15 ? 51.808 61.719 56.195 1.00 25.29 ? 44  GLY B C   1 
ATOM   741  O  O   . GLY B 1 15 ? 51.521 62.663 56.929 1.00 24.91 ? 44  GLY B O   1 
ATOM   742  N  N   . LYS B 1 16 ? 52.627 61.843 55.164 1.00 25.53 ? 45  LYS B N   1 
ATOM   743  C  CA  . LYS B 1 16 ? 53.219 63.132 54.816 1.00 25.89 ? 45  LYS B CA  1 
ATOM   744  C  C   . LYS B 1 16 ? 52.589 63.623 53.527 1.00 25.11 ? 45  LYS B C   1 
ATOM   745  O  O   . LYS B 1 16 ? 52.457 62.862 52.597 1.00 24.19 ? 45  LYS B O   1 
ATOM   746  C  CB  . LYS B 1 16 ? 54.720 62.944 54.643 1.00 27.67 ? 45  LYS B CB  1 
ATOM   747  C  CG  . LYS B 1 16 ? 55.515 64.220 54.573 1.00 32.13 ? 45  LYS B CG  1 
ATOM   748  C  CD  . LYS B 1 16 ? 57.004 63.917 54.596 1.00 38.35 ? 45  LYS B CD  1 
ATOM   749  C  CE  . LYS B 1 16 ? 57.524 63.684 56.034 1.00 42.92 ? 45  LYS B CE  1 
ATOM   750  N  NZ  . LYS B 1 16 ? 58.156 64.925 56.640 1.00 45.81 ? 45  LYS B NZ  1 
ATOM   751  N  N   . ILE B 1 17 ? 52.211 64.894 53.470 1.00 24.93 ? 46  ILE B N   1 
ATOM   752  C  CA  . ILE B 1 17 ? 51.605 65.460 52.287 1.00 25.54 ? 46  ILE B CA  1 
ATOM   753  C  C   . ILE B 1 17 ? 52.727 65.613 51.253 1.00 27.12 ? 46  ILE B C   1 
ATOM   754  O  O   . ILE B 1 17 ? 53.739 66.261 51.526 1.00 26.67 ? 46  ILE B O   1 
ATOM   755  C  CB  . ILE B 1 17 ? 50.955 66.840 52.591 1.00 24.91 ? 46  ILE B CB  1 
ATOM   756  C  CG1 . ILE B 1 17 ? 49.880 66.766 53.706 1.00 24.84 ? 46  ILE B CG1 1 
ATOM   757  C  CG2 . ILE B 1 17 ? 50.351 67.425 51.335 1.00 25.43 ? 46  ILE B CG2 1 
ATOM   758  C  CD1 . ILE B 1 17 ? 48.866 65.694 53.582 1.00 24.32 ? 46  ILE B CD1 1 
ATOM   759  N  N   . THR B 1 18 ? 52.568 64.966 50.102 1.00 28.06 ? 47  THR B N   1 
ATOM   760  C  CA  . THR B 1 18 ? 53.551 65.047 49.016 1.00 29.05 ? 47  THR B CA  1 
ATOM   761  C  C   . THR B 1 18 ? 53.158 66.091 47.972 1.00 29.81 ? 47  THR B C   1 
ATOM   762  O  O   . THR B 1 18 ? 54.009 66.797 47.415 1.00 31.56 ? 47  THR B O   1 
ATOM   763  C  CB  . THR B 1 18 ? 53.725 63.673 48.352 1.00 29.41 ? 47  THR B CB  1 
ATOM   764  O  OG1 . THR B 1 18 ? 52.445 63.101 47.975 1.00 30.61 ? 47  THR B OG1 1 
ATOM   765  C  CG2 . THR B 1 18 ? 54.313 62.678 49.337 1.00 30.24 ? 47  THR B CG2 1 
ATOM   766  N  N   . ARG B 1 19 ? 51.872 66.208 47.710 1.00 29.56 ? 48  ARG B N   1 
ATOM   767  C  CA  . ARG B 1 19 ? 51.406 67.044 46.627 1.00 29.74 ? 48  ARG B CA  1 
ATOM   768  C  C   . ARG B 1 19 ? 50.007 67.525 46.896 1.00 28.14 ? 48  ARG B C   1 
ATOM   769  O  O   . ARG B 1 19 ? 49.197 66.817 47.466 1.00 27.79 ? 48  ARG B O   1 
ATOM   770  C  CB  . ARG B 1 19 ? 51.441 66.261 45.313 1.00 30.60 ? 48  ARG B CB  1 
ATOM   771  C  CG  . ARG B 1 19 ? 50.825 66.996 44.106 1.00 34.97 ? 48  ARG B CG  1 
ATOM   772  C  CD  . ARG B 1 19 ? 51.099 66.314 42.737 1.00 39.92 ? 48  ARG B CD  1 
ATOM   773  N  NE  . ARG B 1 19 ? 50.678 64.902 42.737 1.00 45.09 ? 48  ARG B NE  1 
ATOM   774  C  CZ  . ARG B 1 19 ? 49.628 64.375 42.065 1.00 48.77 ? 48  ARG B CZ  1 
ATOM   775  N  NH1 . ARG B 1 19 ? 48.844 65.113 41.289 1.00 49.22 ? 48  ARG B NH1 1 
ATOM   776  N  NH2 . ARG B 1 19 ? 49.367 63.073 42.171 1.00 49.91 ? 48  ARG B NH2 1 
ATOM   777  N  N   . ILE B 1 20 ? 49.728 68.745 46.479 1.00 27.65 ? 49  ILE B N   1 
ATOM   778  C  CA  . ILE B 1 20 ? 48.423 69.361 46.681 1.00 27.24 ? 49  ILE B CA  1 
ATOM   779  C  C   . ILE B 1 20 ? 47.830 69.695 45.307 1.00 26.70 ? 49  ILE B C   1 
ATOM   780  O  O   . ILE B 1 20 ? 48.474 70.354 44.487 1.00 26.77 ? 49  ILE B O   1 
ATOM   781  C  CB  . ILE B 1 20 ? 48.579 70.579 47.575 1.00 27.37 ? 49  ILE B CB  1 
ATOM   782  C  CG1 . ILE B 1 20 ? 49.006 70.116 48.977 1.00 28.00 ? 49  ILE B CG1 1 
ATOM   783  C  CG2 . ILE B 1 20 ? 47.272 71.388 47.638 1.00 28.79 ? 49  ILE B CG2 1 
ATOM   784  C  CD1 . ILE B 1 20 ? 49.425 71.201 49.865 1.00 30.65 ? 49  ILE B CD1 1 
ATOM   785  N  N   . GLU B 1 21 ? 46.633 69.184 45.035 1.00 24.90 ? 50  GLU B N   1 
ATOM   786  C  CA  . GLU B 1 21 ? 46.004 69.383 43.734 1.00 24.13 ? 50  GLU B CA  1 
ATOM   787  C  C   . GLU B 1 21 ? 44.723 70.180 43.858 1.00 23.47 ? 50  GLU B C   1 
ATOM   788  O  O   . GLU B 1 21 ? 43.660 69.619 44.167 1.00 21.98 ? 50  GLU B O   1 
ATOM   789  C  CB  A GLU B 1 21 ? 45.740 68.054 43.030 0.60 23.51 ? 50  GLU B CB  1 
ATOM   790  C  CB  B GLU B 1 21 ? 45.721 68.050 43.031 0.40 23.90 ? 50  GLU B CB  1 
ATOM   791  C  CG  A GLU B 1 21 ? 45.293 68.231 41.591 0.60 23.67 ? 50  GLU B CG  1 
ATOM   792  C  CG  B GLU B 1 21 ? 46.944 67.330 42.480 0.40 24.79 ? 50  GLU B CG  1 
ATOM   793  C  CD  A GLU B 1 21 ? 46.102 69.308 40.873 0.60 24.75 ? 50  GLU B CD  1 
ATOM   794  C  CD  B GLU B 1 21 ? 47.723 68.131 41.446 0.40 25.66 ? 50  GLU B CD  1 
ATOM   795  O  OE1 A GLU B 1 21 ? 47.351 69.149 40.820 0.60 24.38 ? 50  GLU B OE1 1 
ATOM   796  O  OE1 B GLU B 1 21 ? 47.175 69.070 40.845 0.40 26.52 ? 50  GLU B OE1 1 
ATOM   797  O  OE2 A GLU B 1 21 ? 45.505 70.312 40.414 0.60 20.44 ? 50  GLU B OE2 1 
ATOM   798  O  OE2 B GLU B 1 21 ? 48.906 67.818 41.231 0.40 26.51 ? 50  GLU B OE2 1 
ATOM   799  N  N   . PRO B 1 22 ? 44.828 71.497 43.650 1.00 23.32 ? 51  PRO B N   1 
ATOM   800  C  CA  . PRO B 1 22 ? 43.645 72.364 43.701 1.00 23.55 ? 51  PRO B CA  1 
ATOM   801  C  C   . PRO B 1 22 ? 42.508 71.917 42.797 1.00 22.83 ? 51  PRO B C   1 
ATOM   802  O  O   . PRO B 1 22 ? 41.352 72.053 43.199 1.00 22.40 ? 51  PRO B O   1 
ATOM   803  C  CB  . PRO B 1 22 ? 44.185 73.737 43.263 1.00 24.14 ? 51  PRO B CB  1 
ATOM   804  C  CG  . PRO B 1 22 ? 45.608 73.724 43.705 1.00 25.36 ? 51  PRO B CG  1 
ATOM   805  C  CD  . PRO B 1 22 ? 46.063 72.277 43.416 1.00 24.25 ? 51  PRO B CD  1 
ATOM   806  N  N   . SER B 1 23 ? 42.803 71.396 41.615 1.00 21.36 ? 52  SER B N   1 
ATOM   807  C  CA  . SER B 1 23 ? 41.736 71.042 40.693 1.00 22.50 ? 52  SER B CA  1 
ATOM   808  C  C   . SER B 1 23 ? 40.889 69.853 41.206 1.00 21.90 ? 52  SER B C   1 
ATOM   809  O  O   . SER B 1 23 ? 39.790 69.659 40.742 1.00 22.08 ? 52  SER B O   1 
ATOM   810  C  CB  . SER B 1 23 ? 42.276 70.737 39.289 1.00 23.13 ? 52  SER B CB  1 
ATOM   811  O  OG  . SER B 1 23 ? 42.816 69.408 39.255 1.00 25.48 ? 52  SER B OG  1 
ATOM   812  N  N   . LEU B 1 24 ? 41.423 69.070 42.145 1.00 20.61 ? 53  LEU B N   1 
ATOM   813  C  CA  . LEU B 1 24 ? 40.697 67.951 42.740 1.00 20.37 ? 53  LEU B CA  1 
ATOM   814  C  C   . LEU B 1 24 ? 40.264 68.275 44.164 1.00 20.21 ? 53  LEU B C   1 
ATOM   815  O  O   . LEU B 1 24 ? 39.625 67.441 44.794 1.00 19.54 ? 53  LEU B O   1 
ATOM   816  C  CB  . LEU B 1 24 ? 41.593 66.686 42.771 1.00 20.28 ? 53  LEU B CB  1 
ATOM   817  C  CG  . LEU B 1 24 ? 42.121 66.165 41.414 1.00 21.21 ? 53  LEU B CG  1 
ATOM   818  C  CD1 . LEU B 1 24 ? 43.131 65.008 41.589 1.00 22.61 ? 53  LEU B CD1 1 
ATOM   819  C  CD2 . LEU B 1 24 ? 40.995 65.714 40.503 1.00 22.28 ? 53  LEU B CD2 1 
ATOM   820  N  N   . GLU B 1 25 ? 40.641 69.455 44.669 1.00 20.29 ? 54  GLU B N   1 
ATOM   821  C  CA  . GLU B 1 25 ? 40.492 69.821 46.091 1.00 21.00 ? 54  GLU B CA  1 
ATOM   822  C  C   . GLU B 1 25 ? 40.951 68.667 47.008 1.00 19.89 ? 54  GLU B C   1 
ATOM   823  O  O   . GLU B 1 25 ? 40.216 68.190 47.863 1.00 17.71 ? 54  GLU B O   1 
ATOM   824  C  CB  . GLU B 1 25 ? 39.038 70.238 46.383 1.00 21.76 ? 54  GLU B CB  1 
ATOM   825  C  CG  . GLU B 1 25 ? 38.786 71.704 46.043 1.00 27.88 ? 54  GLU B CG  1 
ATOM   826  C  CD  . GLU B 1 25 ? 39.101 72.630 47.213 1.00 34.16 ? 54  GLU B CD  1 
ATOM   827  O  OE1 . GLU B 1 25 ? 40.284 72.979 47.402 1.00 35.76 ? 54  GLU B OE1 1 
ATOM   828  O  OE2 . GLU B 1 25 ? 38.137 72.982 47.965 1.00 43.02 ? 54  GLU B OE2 1 
ATOM   829  N  N   . ALA B 1 26 ? 42.170 68.214 46.781 1.00 19.17 ? 55  ALA B N   1 
ATOM   830  C  CA  . ALA B 1 26 ? 42.699 67.050 47.460 1.00 18.43 ? 55  ALA B CA  1 
ATOM   831  C  C   . ALA B 1 26 ? 44.216 67.091 47.521 1.00 19.26 ? 55  ALA B C   1 
ATOM   832  O  O   . ALA B 1 26 ? 44.900 67.825 46.757 1.00 18.89 ? 55  ALA B O   1 
ATOM   833  C  CB  . ALA B 1 26 ? 42.231 65.799 46.762 1.00 18.91 ? 55  ALA B CB  1 
ATOM   834  N  N   . ALA B 1 27 ? 44.751 66.312 48.451 1.00 19.26 ? 56  ALA B N   1 
ATOM   835  C  CA  . ALA B 1 27 ? 46.185 66.167 48.587 1.00 19.59 ? 56  ALA B CA  1 
ATOM   836  C  C   . ALA B 1 27 ? 46.538 64.715 48.457 1.00 19.47 ? 56  ALA B C   1 
ATOM   837  O  O   . ALA B 1 27 ? 45.729 63.824 48.742 1.00 19.00 ? 56  ALA B O   1 
ATOM   838  C  CB  . ALA B 1 27 ? 46.645 66.674 49.921 1.00 20.12 ? 56  ALA B CB  1 
ATOM   839  N  N   . PHE B 1 28 ? 47.766 64.493 48.033 1.00 19.72 ? 57  PHE B N   1 
ATOM   840  C  CA  . PHE B 1 28 ? 48.330 63.173 48.002 1.00 20.73 ? 57  PHE B CA  1 
ATOM   841  C  C   . PHE B 1 28 ? 49.219 62.991 49.217 1.00 20.52 ? 57  PHE B C   1 
ATOM   842  O  O   . PHE B 1 28 ? 49.834 63.942 49.697 1.00 20.57 ? 57  PHE B O   1 
ATOM   843  C  CB  . PHE B 1 28 ? 49.020 62.985 46.668 1.00 21.46 ? 57  PHE B CB  1 
ATOM   844  C  CG  . PHE B 1 28 ? 48.042 62.842 45.558 1.00 24.73 ? 57  PHE B CG  1 
ATOM   845  C  CD1 . PHE B 1 28 ? 47.482 61.603 45.283 1.00 28.29 ? 57  PHE B CD1 1 
ATOM   846  C  CD2 . PHE B 1 28 ? 47.575 63.960 44.878 1.00 27.83 ? 57  PHE B CD2 1 
ATOM   847  C  CE1 . PHE B 1 28 ? 46.515 61.462 44.289 1.00 29.79 ? 57  PHE B CE1 1 
ATOM   848  C  CE2 . PHE B 1 28 ? 46.604 63.831 43.892 1.00 29.00 ? 57  PHE B CE2 1 
ATOM   849  C  CZ  . PHE B 1 28 ? 46.082 62.584 43.588 1.00 30.48 ? 57  PHE B CZ  1 
ATOM   850  N  N   . VAL B 1 29 ? 49.221 61.775 49.740 1.00 20.45 ? 58  VAL B N   1 
ATOM   851  C  CA  . VAL B 1 29 ? 49.817 61.467 51.026 1.00 20.54 ? 58  VAL B CA  1 
ATOM   852  C  C   . VAL B 1 29 ? 50.657 60.200 50.921 1.00 20.69 ? 58  VAL B C   1 
ATOM   853  O  O   . VAL B 1 29 ? 50.176 59.163 50.508 1.00 20.38 ? 58  VAL B O   1 
ATOM   854  C  CB  . VAL B 1 29 ? 48.723 61.216 52.110 1.00 19.79 ? 58  VAL B CB  1 
ATOM   855  C  CG1 . VAL B 1 29 ? 49.385 61.114 53.496 1.00 21.94 ? 58  VAL B CG1 1 
ATOM   856  C  CG2 . VAL B 1 29 ? 47.671 62.303 52.089 1.00 19.88 ? 58  VAL B CG2 1 
ATOM   857  N  N   . ASP B 1 30 ? 51.926 60.294 51.276 1.00 21.95 ? 59  ASP B N   1 
ATOM   858  C  CA  . ASP B 1 30 ? 52.759 59.106 51.472 1.00 22.32 ? 59  ASP B CA  1 
ATOM   859  C  C   . ASP B 1 30 ? 52.587 58.606 52.898 1.00 22.63 ? 59  ASP B C   1 
ATOM   860  O  O   . ASP B 1 30 ? 53.088 59.222 53.845 1.00 22.32 ? 59  ASP B O   1 
ATOM   861  C  CB  . ASP B 1 30 ? 54.219 59.480 51.211 1.00 23.65 ? 59  ASP B CB  1 
ATOM   862  C  CG  . ASP B 1 30 ? 55.195 58.323 51.420 1.00 24.64 ? 59  ASP B CG  1 
ATOM   863  O  OD1 . ASP B 1 30 ? 54.783 57.213 51.809 1.00 22.10 ? 59  ASP B OD1 1 
ATOM   864  O  OD2 . ASP B 1 30 ? 56.416 58.475 51.206 1.00 30.34 ? 59  ASP B OD2 1 
ATOM   865  N  N   . TYR B 1 31 ? 51.894 57.483 53.042 1.00 22.90 ? 60  TYR B N   1 
ATOM   866  C  CA  . TYR B 1 31 ? 51.624 56.925 54.348 1.00 24.66 ? 60  TYR B CA  1 
ATOM   867  C  C   . TYR B 1 31 ? 52.367 55.583 54.519 1.00 26.04 ? 60  TYR B C   1 
ATOM   868  O  O   . TYR B 1 31 ? 52.077 54.826 55.420 1.00 26.07 ? 60  TYR B O   1 
ATOM   869  C  CB  . TYR B 1 31 ? 50.107 56.796 54.573 1.00 23.93 ? 60  TYR B CB  1 
ATOM   870  C  CG  . TYR B 1 31 ? 49.453 55.827 53.647 1.00 22.24 ? 60  TYR B CG  1 
ATOM   871  C  CD1 . TYR B 1 31 ? 49.083 56.189 52.359 1.00 21.14 ? 60  TYR B CD1 1 
ATOM   872  C  CD2 . TYR B 1 31 ? 49.238 54.525 54.042 1.00 22.68 ? 60  TYR B CD2 1 
ATOM   873  C  CE1 . TYR B 1 31 ? 48.504 55.255 51.499 1.00 22.56 ? 60  TYR B CE1 1 
ATOM   874  C  CE2 . TYR B 1 31 ? 48.652 53.614 53.203 1.00 23.63 ? 60  TYR B CE2 1 
ATOM   875  C  CZ  . TYR B 1 31 ? 48.280 53.976 51.941 1.00 22.47 ? 60  TYR B CZ  1 
ATOM   876  O  OH  . TYR B 1 31 ? 47.733 52.993 51.137 1.00 24.61 ? 60  TYR B OH  1 
ATOM   877  N  N   . GLY B 1 32 ? 53.333 55.331 53.636 1.00 27.65 ? 61  GLY B N   1 
ATOM   878  C  CA  . GLY B 1 32 ? 54.176 54.152 53.696 1.00 28.45 ? 61  GLY B CA  1 
ATOM   879  C  C   . GLY B 1 32 ? 54.005 53.199 52.534 1.00 29.14 ? 61  GLY B C   1 
ATOM   880  O  O   . GLY B 1 32 ? 54.832 52.314 52.381 1.00 29.87 ? 61  GLY B O   1 
ATOM   881  N  N   . ALA B 1 33 ? 52.931 53.348 51.746 1.00 28.86 ? 62  ALA B N   1 
ATOM   882  C  CA  . ALA B 1 33 ? 52.699 52.522 50.547 1.00 28.62 ? 62  ALA B CA  1 
ATOM   883  C  C   . ALA B 1 33 ? 53.346 53.203 49.359 1.00 28.43 ? 62  ALA B C   1 
ATOM   884  O  O   . ALA B 1 33 ? 53.621 54.403 49.404 1.00 29.08 ? 62  ALA B O   1 
ATOM   885  C  CB  . ALA B 1 33 ? 51.186 52.334 50.298 1.00 28.33 ? 62  ALA B CB  1 
ATOM   886  N  N   . GLU B 1 34 ? 53.627 52.446 48.297 1.00 28.42 ? 63  GLU B N   1 
ATOM   887  C  CA  . GLU B 1 34 ? 54.191 53.044 47.083 1.00 27.75 ? 63  GLU B CA  1 
ATOM   888  C  C   . GLU B 1 34 ? 53.200 53.969 46.387 1.00 26.59 ? 63  GLU B C   1 
ATOM   889  O  O   . GLU B 1 34 ? 53.556 55.044 45.952 1.00 25.89 ? 63  GLU B O   1 
ATOM   890  C  CB  . GLU B 1 34 ? 54.628 51.973 46.089 1.00 28.10 ? 63  GLU B CB  1 
ATOM   891  C  CG  . GLU B 1 34 ? 56.123 51.758 46.113 1.00 29.35 ? 63  GLU B CG  1 
ATOM   892  C  CD  . GLU B 1 34 ? 56.549 50.836 45.007 1.00 29.74 ? 63  GLU B CD  1 
ATOM   893  O  OE1 . GLU B 1 34 ? 56.252 49.614 45.095 1.00 30.63 ? 63  GLU B OE1 1 
ATOM   894  O  OE2 . GLU B 1 34 ? 57.157 51.356 44.067 1.00 29.45 ? 63  GLU B OE2 1 
ATOM   895  N  N   . ARG B 1 35 ? 51.965 53.513 46.256 1.00 26.55 ? 64  ARG B N   1 
ATOM   896  C  CA  . ARG B 1 35 ? 50.911 54.378 45.768 1.00 26.27 ? 64  ARG B CA  1 
ATOM   897  C  C   . ARG B 1 35 ? 50.548 55.390 46.888 1.00 25.06 ? 64  ARG B C   1 
ATOM   898  O  O   . ARG B 1 35 ? 50.141 55.006 47.976 1.00 23.94 ? 64  ARG B O   1 
ATOM   899  C  CB  . ARG B 1 35 ? 49.670 53.580 45.392 1.00 26.97 ? 64  ARG B CB  1 
ATOM   900  C  CG  . ARG B 1 35 ? 49.709 52.779 44.118 1.00 28.04 ? 64  ARG B CG  1 
ATOM   901  C  CD  . ARG B 1 35 ? 48.358 52.074 43.901 1.00 30.00 ? 64  ARG B CD  1 
ATOM   902  N  NE  . ARG B 1 35 ? 48.362 51.021 42.892 1.00 29.63 ? 64  ARG B NE  1 
ATOM   903  C  CZ  . ARG B 1 35 ? 47.265 50.440 42.410 1.00 33.19 ? 64  ARG B CZ  1 
ATOM   904  N  NH1 . ARG B 1 35 ? 46.063 50.772 42.860 1.00 32.27 ? 64  ARG B NH1 1 
ATOM   905  N  NH2 . ARG B 1 35 ? 47.368 49.500 41.476 1.00 35.10 ? 64  ARG B NH2 1 
ATOM   906  N  N   . HIS B 1 36 ? 50.716 56.667 46.616 1.00 24.45 ? 65  HIS B N   1 
ATOM   907  C  CA  . HIS B 1 36 ? 50.238 57.714 47.536 1.00 24.31 ? 65  HIS B CA  1 
ATOM   908  C  C   . HIS B 1 36 ? 48.735 57.623 47.735 1.00 22.75 ? 65  HIS B C   1 
ATOM   909  O  O   . HIS B 1 36 ? 47.989 57.178 46.860 1.00 22.46 ? 65  HIS B O   1 
ATOM   910  C  CB  . HIS B 1 36 ? 50.653 59.085 47.048 1.00 25.21 ? 65  HIS B CB  1 
ATOM   911  C  CG  . HIS B 1 36 ? 52.134 59.288 47.057 1.00 27.95 ? 65  HIS B CG  1 
ATOM   912  N  ND1 . HIS B 1 36 ? 52.735 60.448 46.618 1.00 31.53 ? 65  HIS B ND1 1 
ATOM   913  C  CD2 . HIS B 1 36 ? 53.142 58.465 47.450 1.00 32.50 ? 65  HIS B CD2 1 
ATOM   914  C  CE1 . HIS B 1 36 ? 54.049 60.327 46.722 1.00 33.84 ? 65  HIS B CE1 1 
ATOM   915  N  NE2 . HIS B 1 36 ? 54.322 59.142 47.241 1.00 33.80 ? 65  HIS B NE2 1 
ATOM   916  N  N   . GLY B 1 37 ? 48.301 57.937 48.941 1.00 21.14 ? 66  GLY B N   1 
ATOM   917  C  CA  . GLY B 1 37 ? 46.895 57.945 49.243 1.00 20.62 ? 66  GLY B CA  1 
ATOM   918  C  C   . GLY B 1 37 ? 46.257 59.265 48.823 1.00 19.48 ? 66  GLY B C   1 
ATOM   919  O  O   . GLY B 1 37 ? 46.922 60.264 48.652 1.00 17.98 ? 66  GLY B O   1 
ATOM   920  N  N   . PHE B 1 38 ? 44.939 59.244 48.725 1.00 18.50 ? 67  PHE B N   1 
ATOM   921  C  CA  . PHE B 1 38 ? 44.178 60.378 48.267 1.00 18.63 ? 67  PHE B CA  1 
ATOM   922  C  C   . PHE B 1 38 ? 43.397 60.948 49.451 1.00 17.48 ? 67  PHE B C   1 
ATOM   923  O  O   . PHE B 1 38 ? 42.583 60.257 50.054 1.00 17.95 ? 67  PHE B O   1 
ATOM   924  C  CB  . PHE B 1 38 ? 43.246 59.892 47.168 1.00 19.02 ? 67  PHE B CB  1 
ATOM   925  C  CG  . PHE B 1 38 ? 42.402 60.957 46.552 1.00 19.90 ? 67  PHE B CG  1 
ATOM   926  C  CD1 . PHE B 1 38 ? 42.954 61.898 45.714 1.00 23.06 ? 67  PHE B CD1 1 
ATOM   927  C  CD2 . PHE B 1 38 ? 41.029 60.996 46.806 1.00 24.18 ? 67  PHE B CD2 1 
ATOM   928  C  CE1 . PHE B 1 38 ? 42.150 62.879 45.115 1.00 23.66 ? 67  PHE B CE1 1 
ATOM   929  C  CE2 . PHE B 1 38 ? 40.232 62.006 46.240 1.00 25.44 ? 67  PHE B CE2 1 
ATOM   930  C  CZ  . PHE B 1 38 ? 40.791 62.906 45.373 1.00 22.64 ? 67  PHE B CZ  1 
ATOM   931  N  N   . LEU B 1 39 ? 43.659 62.211 49.780 1.00 16.25 ? 68  LEU B N   1 
ATOM   932  C  CA  . LEU B 1 39 ? 43.033 62.837 50.925 1.00 15.28 ? 68  LEU B CA  1 
ATOM   933  C  C   . LEU B 1 39 ? 42.266 64.086 50.447 1.00 14.97 ? 68  LEU B C   1 
ATOM   934  O  O   . LEU B 1 39 ? 42.864 65.156 50.260 1.00 14.07 ? 68  LEU B O   1 
ATOM   935  C  CB  . LEU B 1 39 ? 44.089 63.177 51.985 1.00 15.23 ? 68  LEU B CB  1 
ATOM   936  C  CG  . LEU B 1 39 ? 43.554 63.841 53.258 1.00 14.17 ? 68  LEU B CG  1 
ATOM   937  C  CD1 . LEU B 1 39 ? 42.599 62.973 54.036 1.00 14.17 ? 68  LEU B CD1 1 
ATOM   938  C  CD2 . LEU B 1 39 ? 44.721 64.268 54.101 1.00 14.92 ? 68  LEU B CD2 1 
ATOM   939  N  N   . PRO B 1 40 ? 40.955 63.963 50.224 1.00 14.33 ? 69  PRO B N   1 
ATOM   940  C  CA  . PRO B 1 40 ? 40.183 65.127 49.789 1.00 14.09 ? 69  PRO B CA  1 
ATOM   941  C  C   . PRO B 1 40 ? 39.943 66.075 50.969 1.00 14.33 ? 69  PRO B C   1 
ATOM   942  O  O   . PRO B 1 40 ? 39.946 65.670 52.131 1.00 13.37 ? 69  PRO B O   1 
ATOM   943  C  CB  . PRO B 1 40 ? 38.859 64.515 49.251 1.00 14.69 ? 69  PRO B CB  1 
ATOM   944  C  CG  . PRO B 1 40 ? 38.808 63.109 49.714 1.00 14.73 ? 69  PRO B CG  1 
ATOM   945  C  CD  . PRO B 1 40 ? 40.102 62.771 50.382 1.00 14.24 ? 69  PRO B CD  1 
ATOM   946  N  N   . LEU B 1 41 ? 39.712 67.340 50.659 1.00 14.43 ? 70  LEU B N   1 
ATOM   947  C  CA  . LEU B 1 41 ? 39.441 68.369 51.642 1.00 15.19 ? 70  LEU B CA  1 
ATOM   948  C  C   . LEU B 1 41 ? 38.306 68.043 52.627 1.00 14.52 ? 70  LEU B C   1 
ATOM   949  O  O   . LEU B 1 41 ? 38.413 68.330 53.818 1.00 13.80 ? 70  LEU B O   1 
ATOM   950  C  CB  . LEU B 1 41 ? 39.104 69.699 50.944 1.00 16.33 ? 70  LEU B CB  1 
ATOM   951  C  CG  . LEU B 1 41 ? 38.827 70.869 51.900 1.00 16.95 ? 70  LEU B CG  1 
ATOM   952  C  CD1 . LEU B 1 41 ? 39.992 71.074 52.830 1.00 19.11 ? 70  LEU B CD1 1 
ATOM   953  C  CD2 . LEU B 1 41 ? 38.604 72.108 51.081 1.00 21.60 ? 70  LEU B CD2 1 
ATOM   954  N  N   . LYS B 1 42 ? 37.249 67.406 52.141 1.00 14.77 ? 71  LYS B N   1 
ATOM   955  C  CA  . LYS B 1 42 ? 36.110 67.000 52.964 1.00 14.49 ? 71  LYS B CA  1 
ATOM   956  C  C   . LYS B 1 42 ? 36.479 65.972 54.051 1.00 14.03 ? 71  LYS B C   1 
ATOM   957  O  O   . LYS B 1 42 ? 35.713 65.763 55.003 1.00 13.95 ? 71  LYS B O   1 
ATOM   958  C  CB  . LYS B 1 42 ? 35.022 66.419 52.061 1.00 15.88 ? 71  LYS B CB  1 
ATOM   959  C  CG  . LYS B 1 42 ? 35.514 65.157 51.346 1.00 19.23 ? 71  LYS B CG  1 
ATOM   960  C  CD  . LYS B 1 42 ? 34.439 64.397 50.610 1.00 23.00 ? 71  LYS B CD  1 
ATOM   961  C  CE  . LYS B 1 42 ? 35.048 63.192 49.893 1.00 23.75 ? 71  LYS B CE  1 
ATOM   962  N  NZ  . LYS B 1 42 ? 34.876 61.937 50.659 1.00 24.34 ? 71  LYS B NZ  1 
ATOM   963  N  N   . GLU B 1 43 ? 37.624 65.304 53.881 1.00 13.40 ? 72  GLU B N   1 
ATOM   964  C  CA  . GLU B 1 43 ? 38.103 64.326 54.843 1.00 14.09 ? 72  GLU B CA  1 
ATOM   965  C  C   . GLU B 1 43 ? 39.186 64.873 55.779 1.00 13.16 ? 72  GLU B C   1 
ATOM   966  O  O   . GLU B 1 43 ? 39.837 64.112 56.505 1.00 13.31 ? 72  GLU B O   1 
ATOM   967  C  CB  . GLU B 1 43 ? 38.623 63.095 54.120 1.00 14.41 ? 72  GLU B CB  1 
ATOM   968  C  CG  . GLU B 1 43 ? 37.585 62.348 53.314 1.00 15.10 ? 72  GLU B CG  1 
ATOM   969  C  CD  . GLU B 1 43 ? 36.415 61.804 54.107 1.00 15.99 ? 72  GLU B CD  1 
ATOM   970  O  OE1 . GLU B 1 43 ? 36.488 61.636 55.358 1.00 14.80 ? 72  GLU B OE1 1 
ATOM   971  O  OE2 . GLU B 1 43 ? 35.383 61.536 53.436 1.00 19.04 ? 72  GLU B OE2 1 
ATOM   972  N  N   . ILE B 1 44 ? 39.359 66.193 55.799 1.00 12.74 ? 73  ILE B N   1 
ATOM   973  C  CA  . ILE B 1 44 ? 40.350 66.826 56.654 1.00 13.11 ? 73  ILE B CA  1 
ATOM   974  C  C   . ILE B 1 44 ? 39.680 67.483 57.872 1.00 13.61 ? 73  ILE B C   1 
ATOM   975  O  O   . ILE B 1 44 ? 38.835 68.388 57.755 1.00 13.69 ? 73  ILE B O   1 
ATOM   976  C  CB  . ILE B 1 44 ? 41.171 67.829 55.836 1.00 14.55 ? 73  ILE B CB  1 
ATOM   977  C  CG1 . ILE B 1 44 ? 41.897 67.083 54.703 1.00 15.81 ? 73  ILE B CG1 1 
ATOM   978  C  CG2 . ILE B 1 44 ? 42.149 68.547 56.719 1.00 14.82 ? 73  ILE B CG2 1 
ATOM   979  C  CD1 . ILE B 1 44 ? 42.746 67.979 53.869 1.00 18.24 ? 73  ILE B CD1 1 
ATOM   980  N  N   . ALA B 1 45 ? 40.091 67.055 59.043 1.00 13.22 ? 74  ALA B N   1 
ATOM   981  C  CA  . ALA B 1 45 ? 39.562 67.584 60.260 1.00 13.85 ? 74  ALA B CA  1 
ATOM   982  C  C   . ALA B 1 45 ? 40.045 69.008 60.527 1.00 14.73 ? 74  ALA B C   1 
ATOM   983  O  O   . ALA B 1 45 ? 41.102 69.440 60.070 1.00 13.42 ? 74  ALA B O   1 
ATOM   984  C  CB  . ALA B 1 45 ? 39.919 66.673 61.427 1.00 13.53 ? 74  ALA B CB  1 
ATOM   985  N  N   . ARG B 1 46 ? 39.231 69.738 61.278 1.00 15.39 ? 75  ARG B N   1 
ATOM   986  C  CA  . ARG B 1 46 ? 39.486 71.140 61.522 1.00 16.11 ? 75  ARG B CA  1 
ATOM   987  C  C   . ARG B 1 46 ? 40.753 71.407 62.343 1.00 16.36 ? 75  ARG B C   1 
ATOM   988  O  O   . ARG B 1 46 ? 41.294 72.516 62.300 1.00 15.69 ? 75  ARG B O   1 
ATOM   989  C  CB  . ARG B 1 46 ? 38.295 71.761 62.172 1.00 15.86 ? 75  ARG B CB  1 
ATOM   990  C  CG  . ARG B 1 46 ? 38.040 71.340 63.557 1.00 16.36 ? 75  ARG B CG  1 
ATOM   991  C  CD  . ARG B 1 46 ? 36.731 71.930 64.058 1.00 19.83 ? 75  ARG B CD  1 
ATOM   992  N  NE  . ARG B 1 46 ? 36.380 71.474 65.391 1.00 20.41 ? 75  ARG B NE  1 
ATOM   993  C  CZ  . ARG B 1 46 ? 35.140 71.339 65.808 1.00 23.43 ? 75  ARG B CZ  1 
ATOM   994  N  NH1 . ARG B 1 46 ? 34.111 71.635 65.015 1.00 26.62 ? 75  ARG B NH1 1 
ATOM   995  N  NH2 . ARG B 1 46 ? 34.921 70.924 67.036 1.00 27.04 ? 75  ARG B NH2 1 
ATOM   996  N  N   . GLU B 1 47 ? 41.260 70.385 63.030 1.00 16.05 ? 76  GLU B N   1 
ATOM   997  C  CA  . GLU B 1 47 ? 42.566 70.504 63.702 1.00 17.32 ? 76  GLU B CA  1 
ATOM   998  C  C   . GLU B 1 47 ? 43.730 70.792 62.747 1.00 17.54 ? 76  GLU B C   1 
ATOM   999  O  O   . GLU B 1 47 ? 44.771 71.306 63.197 1.00 18.40 ? 76  GLU B O   1 
ATOM   1000 C  CB  . GLU B 1 47 ? 42.917 69.238 64.504 1.00 17.26 ? 76  GLU B CB  1 
ATOM   1001 C  CG  . GLU B 1 47 ? 42.136 69.087 65.794 1.00 17.83 ? 76  GLU B CG  1 
ATOM   1002 C  CD  . GLU B 1 47 ? 40.764 68.447 65.619 1.00 19.30 ? 76  GLU B CD  1 
ATOM   1003 O  OE1 . GLU B 1 47 ? 40.386 68.101 64.468 1.00 17.94 ? 76  GLU B OE1 1 
ATOM   1004 O  OE2 . GLU B 1 47 ? 40.047 68.305 66.641 1.00 20.16 ? 76  GLU B OE2 1 
ATOM   1005 N  N   . TYR B 1 48 ? 43.561 70.477 61.461 1.00 16.71 ? 77  TYR B N   1 
ATOM   1006 C  CA  . TYR B 1 48 ? 44.539 70.799 60.428 1.00 18.24 ? 77  TYR B CA  1 
ATOM   1007 C  C   . TYR B 1 48 ? 44.331 72.134 59.726 1.00 19.16 ? 77  TYR B C   1 
ATOM   1008 O  O   . TYR B 1 48 ? 45.158 72.523 58.924 1.00 19.31 ? 77  TYR B O   1 
ATOM   1009 C  CB  . TYR B 1 48 ? 44.557 69.683 59.372 1.00 17.91 ? 77  TYR B CB  1 
ATOM   1010 C  CG  . TYR B 1 48 ? 44.854 68.338 59.981 1.00 17.66 ? 77  TYR B CG  1 
ATOM   1011 C  CD1 . TYR B 1 48 ? 46.161 67.997 60.296 1.00 20.68 ? 77  TYR B CD1 1 
ATOM   1012 C  CD2 . TYR B 1 48 ? 43.842 67.431 60.295 1.00 15.77 ? 77  TYR B CD2 1 
ATOM   1013 C  CE1 . TYR B 1 48 ? 46.460 66.784 60.865 1.00 18.20 ? 77  TYR B CE1 1 
ATOM   1014 C  CE2 . TYR B 1 48 ? 44.141 66.182 60.882 1.00 17.13 ? 77  TYR B CE2 1 
ATOM   1015 C  CZ  . TYR B 1 48 ? 45.468 65.892 61.165 1.00 17.98 ? 77  TYR B CZ  1 
ATOM   1016 O  OH  . TYR B 1 48 ? 45.857 64.713 61.732 1.00 20.96 ? 77  TYR B OH  1 
ATOM   1017 N  N   . PHE B 1 49 ? 43.210 72.798 59.981 1.00 21.39 ? 78  PHE B N   1 
ATOM   1018 C  CA  . PHE B 1 49 ? 42.832 74.037 59.288 1.00 22.41 ? 78  PHE B CA  1 
ATOM   1019 C  C   . PHE B 1 49 ? 43.619 75.237 59.843 1.00 24.95 ? 78  PHE B C   1 
ATOM   1020 O  O   . PHE B 1 49 ? 44.075 75.215 60.991 1.00 23.67 ? 78  PHE B O   1 
ATOM   1021 C  CB  . PHE B 1 49 ? 41.330 74.290 59.430 1.00 22.06 ? 78  PHE B CB  1 
ATOM   1022 C  CG  . PHE B 1 49 ? 40.492 73.695 58.319 1.00 20.70 ? 78  PHE B CG  1 
ATOM   1023 C  CD1 . PHE B 1 49 ? 40.477 72.337 58.083 1.00 18.79 ? 78  PHE B CD1 1 
ATOM   1024 C  CD2 . PHE B 1 49 ? 39.723 74.500 57.502 1.00 23.08 ? 78  PHE B CD2 1 
ATOM   1025 C  CE1 . PHE B 1 49 ? 39.704 71.792 57.075 1.00 16.55 ? 78  PHE B CE1 1 
ATOM   1026 C  CE2 . PHE B 1 49 ? 38.962 73.957 56.477 1.00 21.98 ? 78  PHE B CE2 1 
ATOM   1027 C  CZ  . PHE B 1 49 ? 38.954 72.588 56.280 1.00 20.72 ? 78  PHE B CZ  1 
ATOM   1028 N  N   . PRO B 1 50 ? 43.802 76.276 59.030 1.00 27.72 ? 79  PRO B N   1 
ATOM   1029 C  CA  . PRO B 1 50 ? 44.642 77.412 59.426 1.00 29.16 ? 79  PRO B CA  1 
ATOM   1030 C  C   . PRO B 1 50 ? 43.975 78.375 60.401 1.00 30.14 ? 79  PRO B C   1 
ATOM   1031 O  O   . PRO B 1 50 ? 42.746 78.564 60.358 1.00 29.72 ? 79  PRO B O   1 
ATOM   1032 C  CB  . PRO B 1 50 ? 44.923 78.103 58.082 1.00 28.81 ? 79  PRO B CB  1 
ATOM   1033 C  CG  . PRO B 1 50 ? 43.682 77.894 57.317 1.00 29.36 ? 79  PRO B CG  1 
ATOM   1034 C  CD  . PRO B 1 50 ? 43.258 76.473 57.674 1.00 28.82 ? 79  PRO B CD  1 
ATOM   1035 N  N   . ALA B 1 51 ? 44.795 78.990 61.257 1.00 32.16 ? 80  ALA B N   1 
ATOM   1036 C  CA  . ALA B 1 51 ? 44.351 80.034 62.204 1.00 33.53 ? 80  ALA B CA  1 
ATOM   1037 C  C   . ALA B 1 51 ? 43.842 81.313 61.554 1.00 34.67 ? 80  ALA B C   1 
ATOM   1038 O  O   . ALA B 1 51 ? 43.208 81.284 60.492 1.00 37.66 ? 80  ALA B O   1 
ATOM   1039 C  CB  . ALA B 1 51 ? 45.490 80.387 63.137 1.00 34.17 ? 80  ALA B CB  1 
ATOM   1040 N  N   . PRO B 1 59 ? 37.507 77.988 52.572 1.00 42.32 ? 88  PRO B N   1 
ATOM   1041 C  CA  . PRO B 1 59 ? 38.907 77.913 52.128 1.00 41.67 ? 88  PRO B CA  1 
ATOM   1042 C  C   . PRO B 1 59 ? 39.222 76.659 51.324 1.00 40.35 ? 88  PRO B C   1 
ATOM   1043 O  O   . PRO B 1 59 ? 38.531 75.656 51.400 1.00 40.66 ? 88  PRO B O   1 
ATOM   1044 C  CB  . PRO B 1 59 ? 39.729 77.923 53.429 1.00 41.75 ? 88  PRO B CB  1 
ATOM   1045 C  CG  . PRO B 1 59 ? 38.767 77.810 54.547 1.00 42.12 ? 88  PRO B CG  1 
ATOM   1046 C  CD  . PRO B 1 59 ? 37.406 78.233 54.019 1.00 43.01 ? 88  PRO B CD  1 
ATOM   1047 N  N   . ASN B 1 60 ? 40.292 76.756 50.549 1.00 38.79 ? 89  ASN B N   1 
ATOM   1048 C  CA  . ASN B 1 60 ? 40.659 75.740 49.574 1.00 37.40 ? 89  ASN B CA  1 
ATOM   1049 C  C   . ASN B 1 60 ? 41.766 74.914 50.157 1.00 34.64 ? 89  ASN B C   1 
ATOM   1050 O  O   . ASN B 1 60 ? 42.376 75.313 51.150 1.00 33.64 ? 89  ASN B O   1 
ATOM   1051 C  CB  . ASN B 1 60 ? 41.103 76.409 48.264 1.00 37.87 ? 89  ASN B CB  1 
ATOM   1052 C  CG  . ASN B 1 60 ? 39.993 77.254 47.641 1.00 40.45 ? 89  ASN B CG  1 
ATOM   1053 O  OD1 . ASN B 1 60 ? 38.936 76.728 47.266 1.00 46.35 ? 89  ASN B OD1 1 
ATOM   1054 N  ND2 . ASN B 1 60 ? 40.223 78.563 47.528 1.00 45.31 ? 89  ASN B ND2 1 
ATOM   1055 N  N   . ILE B 1 61 ? 42.015 73.760 49.544 1.00 32.10 ? 90  ILE B N   1 
ATOM   1056 C  CA  . ILE B 1 61 ? 43.034 72.821 50.020 1.00 30.27 ? 90  ILE B CA  1 
ATOM   1057 C  C   . ILE B 1 61 ? 44.429 73.461 50.138 1.00 29.94 ? 90  ILE B C   1 
ATOM   1058 O  O   . ILE B 1 61 ? 45.207 73.117 51.028 1.00 28.74 ? 90  ILE B O   1 
ATOM   1059 C  CB  . ILE B 1 61 ? 43.064 71.539 49.116 1.00 29.83 ? 90  ILE B CB  1 
ATOM   1060 C  CG1 . ILE B 1 61 ? 43.890 70.436 49.766 1.00 29.77 ? 90  ILE B CG1 1 
ATOM   1061 C  CG2 . ILE B 1 61 ? 43.621 71.810 47.725 1.00 27.66 ? 90  ILE B CG2 1 
ATOM   1062 C  CD1 . ILE B 1 61 ? 43.137 69.611 50.663 1.00 29.88 ? 90  ILE B CD1 1 
ATOM   1063 N  N   . LYS B 1 62 ? 44.715 74.415 49.259 1.00 29.76 ? 91  LYS B N   1 
ATOM   1064 C  CA  . LYS B 1 62 ? 46.023 75.072 49.192 1.00 30.84 ? 91  LYS B CA  1 
ATOM   1065 C  C   . LYS B 1 62 ? 46.273 75.947 50.432 1.00 31.13 ? 91  LYS B C   1 
ATOM   1066 O  O   . LYS B 1 62 ? 47.404 76.107 50.872 1.00 31.20 ? 91  LYS B O   1 
ATOM   1067 C  CB  . LYS B 1 62 ? 46.122 75.885 47.881 1.00 30.84 ? 91  LYS B CB  1 
ATOM   1068 C  CG  . LYS B 1 62 ? 47.094 77.080 47.881 1.00 32.47 ? 91  LYS B CG  1 
ATOM   1069 C  CD  . LYS B 1 62 ? 47.077 77.817 46.502 1.00 32.99 ? 91  LYS B CD  1 
ATOM   1070 C  CE  . LYS B 1 62 ? 47.412 79.094 46.697 0.00 15.00 ? 91  LYS B CE  1 
ATOM   1071 N  NZ  . LYS B 1 62 ? 46.585 79.718 47.767 0.00 15.00 ? 91  LYS B NZ  1 
ATOM   1072 N  N   . ASP B 1 63 ? 45.200 76.483 50.989 1.00 31.65 ? 92  ASP B N   1 
ATOM   1073 C  CA  . ASP B 1 63 ? 45.237 77.212 52.250 1.00 32.46 ? 92  ASP B CA  1 
ATOM   1074 C  C   . ASP B 1 63 ? 45.327 76.306 53.499 1.00 32.37 ? 92  ASP B C   1 
ATOM   1075 O  O   . ASP B 1 63 ? 45.801 76.742 54.561 1.00 32.99 ? 92  ASP B O   1 
ATOM   1076 C  CB  . ASP B 1 63 ? 43.982 78.080 52.337 1.00 33.02 ? 92  ASP B CB  1 
ATOM   1077 C  CG  . ASP B 1 63 ? 43.853 79.033 51.160 1.00 35.58 ? 92  ASP B CG  1 
ATOM   1078 O  OD1 . ASP B 1 63 ? 44.900 79.542 50.655 1.00 40.74 ? 92  ASP B OD1 1 
ATOM   1079 O  OD2 . ASP B 1 63 ? 42.750 79.316 50.652 1.00 40.94 ? 92  ASP B OD2 1 
ATOM   1080 N  N   . VAL B 1 64 ? 44.912 75.042 53.371 1.00 31.26 ? 93  VAL B N   1 
ATOM   1081 C  CA  . VAL B 1 64 ? 44.799 74.150 54.526 1.00 30.34 ? 93  VAL B CA  1 
ATOM   1082 C  C   . VAL B 1 64 ? 46.039 73.305 54.781 1.00 30.49 ? 93  VAL B C   1 
ATOM   1083 O  O   . VAL B 1 64 ? 46.509 73.219 55.914 1.00 30.65 ? 93  VAL B O   1 
ATOM   1084 C  CB  . VAL B 1 64 ? 43.574 73.230 54.402 1.00 29.65 ? 93  VAL B CB  1 
ATOM   1085 C  CG1 . VAL B 1 64 ? 43.579 72.161 55.509 1.00 29.79 ? 93  VAL B CG1 1 
ATOM   1086 C  CG2 . VAL B 1 64 ? 42.315 74.045 54.438 1.00 29.03 ? 93  VAL B CG2 1 
ATOM   1087 N  N   . LEU B 1 65 ? 46.522 72.639 53.738 1.00 30.17 ? 94  LEU B N   1 
ATOM   1088 C  CA  . LEU B 1 65 ? 47.661 71.741 53.829 1.00 30.60 ? 94  LEU B CA  1 
ATOM   1089 C  C   . LEU B 1 65 ? 48.887 72.315 53.120 1.00 31.78 ? 94  LEU B C   1 
ATOM   1090 O  O   . LEU B 1 65 ? 48.757 73.202 52.259 1.00 32.40 ? 94  LEU B O   1 
ATOM   1091 C  CB  . LEU B 1 65 ? 47.313 70.399 53.171 1.00 30.13 ? 94  LEU B CB  1 
ATOM   1092 C  CG  . LEU B 1 65 ? 46.235 69.533 53.838 1.00 30.62 ? 94  LEU B CG  1 
ATOM   1093 C  CD1 . LEU B 1 65 ? 46.141 68.162 53.151 1.00 29.68 ? 94  LEU B CD1 1 
ATOM   1094 C  CD2 . LEU B 1 65 ? 46.514 69.372 55.323 1.00 30.17 ? 94  LEU B CD2 1 
ATOM   1095 N  N   . ARG B 1 66 ? 50.059 71.776 53.467 1.00 32.28 ? 95  ARG B N   1 
ATOM   1096 C  CA  . ARG B 1 66 ? 51.301 72.063 52.757 1.00 33.18 ? 95  ARG B CA  1 
ATOM   1097 C  C   . ARG B 1 66 ? 52.187 70.830 52.687 1.00 32.77 ? 95  ARG B C   1 
ATOM   1098 O  O   . ARG B 1 66 ? 52.111 69.937 53.533 1.00 31.21 ? 95  ARG B O   1 
ATOM   1099 C  CB  . ARG B 1 66 ? 52.039 73.261 53.376 1.00 34.70 ? 95  ARG B CB  1 
ATOM   1100 C  CG  . ARG B 1 66 ? 52.563 73.056 54.775 1.00 37.77 ? 95  ARG B CG  1 
ATOM   1101 C  CD  . ARG B 1 66 ? 52.685 74.351 55.595 1.00 43.87 ? 95  ARG B CD  1 
ATOM   1102 N  NE  . ARG B 1 66 ? 52.219 74.156 56.972 1.00 48.66 ? 95  ARG B NE  1 
ATOM   1103 C  CZ  . ARG B 1 66 ? 52.818 73.378 57.875 1.00 51.87 ? 95  ARG B CZ  1 
ATOM   1104 N  NH1 . ARG B 1 66 ? 53.953 72.719 57.596 1.00 52.76 ? 95  ARG B NH1 1 
ATOM   1105 N  NH2 . ARG B 1 66 ? 52.279 73.265 59.081 1.00 53.15 ? 95  ARG B NH2 1 
ATOM   1106 N  N   . GLU B 1 67 ? 52.999 70.775 51.637 1.00 32.00 ? 96  GLU B N   1 
ATOM   1107 C  CA  . GLU B 1 67 ? 53.915 69.676 51.417 1.00 32.44 ? 96  GLU B CA  1 
ATOM   1108 C  C   . GLU B 1 67 ? 54.780 69.521 52.659 1.00 31.07 ? 96  GLU B C   1 
ATOM   1109 O  O   . GLU B 1 67 ? 55.147 70.519 53.261 1.00 30.76 ? 96  GLU B O   1 
ATOM   1110 C  CB  . GLU B 1 67 ? 54.843 69.969 50.216 1.00 33.47 ? 96  GLU B CB  1 
ATOM   1111 C  CG  . GLU B 1 67 ? 54.220 69.763 48.852 1.00 37.46 ? 96  GLU B CG  1 
ATOM   1112 C  CD  . GLU B 1 67 ? 55.251 69.634 47.714 1.00 42.11 ? 96  GLU B CD  1 
ATOM   1113 O  OE1 . GLU B 1 67 ? 56.269 68.912 47.851 1.00 44.89 ? 96  GLU B OE1 1 
ATOM   1114 O  OE2 . GLU B 1 67 ? 55.015 70.242 46.658 1.00 46.44 ? 96  GLU B OE2 1 
ATOM   1115 N  N   . GLY B 1 68 ? 55.082 68.277 53.039 1.00 29.50 ? 97  GLY B N   1 
ATOM   1116 C  CA  . GLY B 1 68 ? 55.937 67.989 54.187 1.00 28.64 ? 97  GLY B CA  1 
ATOM   1117 C  C   . GLY B 1 68 ? 55.226 67.837 55.534 1.00 27.54 ? 97  GLY B C   1 
ATOM   1118 O  O   . GLY B 1 68 ? 55.758 67.214 56.457 1.00 26.12 ? 97  GLY B O   1 
ATOM   1119 N  N   . GLN B 1 69 ? 54.026 68.402 55.652 1.00 26.68 ? 98  GLN B N   1 
ATOM   1120 C  CA  . GLN B 1 69 ? 53.250 68.278 56.893 1.00 26.36 ? 98  GLN B CA  1 
ATOM   1121 C  C   . GLN B 1 69 ? 52.702 66.856 57.062 1.00 25.49 ? 98  GLN B C   1 
ATOM   1122 O  O   . GLN B 1 69 ? 52.473 66.147 56.073 1.00 24.77 ? 98  GLN B O   1 
ATOM   1123 C  CB  . GLN B 1 69 ? 52.179 69.364 56.922 1.00 26.82 ? 98  GLN B CB  1 
ATOM   1124 C  CG  . GLN B 1 69 ? 50.803 68.950 57.262 1.00 28.03 ? 98  GLN B CG  1 
ATOM   1125 C  CD  . GLN B 1 69 ? 49.889 70.126 57.369 1.00 27.57 ? 98  GLN B CD  1 
ATOM   1126 O  OE1 . GLN B 1 69 ? 49.739 70.888 56.411 1.00 28.78 ? 98  GLN B OE1 1 
ATOM   1127 N  NE2 . GLN B 1 69 ? 49.267 70.280 58.513 1.00 25.06 ? 98  GLN B NE2 1 
ATOM   1128 N  N   . GLU B 1 70 ? 52.525 66.431 58.316 1.00 24.09 ? 99  GLU B N   1 
ATOM   1129 C  CA  . GLU B 1 70 ? 52.081 65.086 58.620 1.00 23.46 ? 99  GLU B CA  1 
ATOM   1130 C  C   . GLU B 1 70 ? 50.639 65.113 59.145 1.00 22.14 ? 99  GLU B C   1 
ATOM   1131 O  O   . GLU B 1 70 ? 50.246 66.030 59.850 1.00 22.10 ? 99  GLU B O   1 
ATOM   1132 C  CB  . GLU B 1 70 ? 53.000 64.378 59.629 1.00 23.32 ? 99  GLU B CB  1 
ATOM   1133 C  CG  . GLU B 1 70 ? 54.264 63.764 59.032 1.00 26.09 ? 99  GLU B CG  1 
ATOM   1134 C  CD  . GLU B 1 70 ? 55.239 63.254 60.090 1.00 28.27 ? 99  GLU B CD  1 
ATOM   1135 O  OE1 . GLU B 1 70 ? 55.416 63.897 61.146 1.00 26.05 ? 99  GLU B OE1 1 
ATOM   1136 O  OE2 . GLU B 1 70 ? 55.831 62.186 59.870 1.00 34.83 ? 99  GLU B OE2 1 
ATOM   1137 N  N   . VAL B 1 71 ? 49.876 64.096 58.757 1.00 19.21 ? 100 VAL B N   1 
ATOM   1138 C  CA  . VAL B 1 71 ? 48.494 63.927 59.138 1.00 18.76 ? 100 VAL B CA  1 
ATOM   1139 C  C   . VAL B 1 71 ? 48.300 62.507 59.625 1.00 17.57 ? 100 VAL B C   1 
ATOM   1140 O  O   . VAL B 1 71 ? 49.036 61.589 59.233 1.00 18.83 ? 100 VAL B O   1 
ATOM   1141 C  CB  . VAL B 1 71 ? 47.521 64.198 57.943 1.00 18.75 ? 100 VAL B CB  1 
ATOM   1142 C  CG1 . VAL B 1 71 ? 47.626 65.626 57.531 1.00 19.76 ? 100 VAL B CG1 1 
ATOM   1143 C  CG2 . VAL B 1 71 ? 47.805 63.277 56.754 1.00 18.75 ? 100 VAL B CG2 1 
ATOM   1144 N  N   . ILE B 1 72 ? 47.343 62.328 60.511 1.00 16.10 ? 101 ILE B N   1 
ATOM   1145 C  CA  . ILE B 1 72 ? 46.947 61.024 60.963 1.00 15.95 ? 101 ILE B CA  1 
ATOM   1146 C  C   . ILE B 1 72 ? 45.752 60.643 60.111 1.00 15.95 ? 101 ILE B C   1 
ATOM   1147 O  O   . ILE B 1 72 ? 44.746 61.350 60.077 1.00 16.03 ? 101 ILE B O   1 
ATOM   1148 C  CB  . ILE B 1 72 ? 46.607 61.049 62.463 1.00 16.34 ? 101 ILE B CB  1 
ATOM   1149 C  CG1 . ILE B 1 72 ? 47.847 61.502 63.252 1.00 18.25 ? 101 ILE B CG1 1 
ATOM   1150 C  CG2 . ILE B 1 72 ? 46.138 59.684 62.919 1.00 16.96 ? 101 ILE B CG2 1 
ATOM   1151 C  CD1 . ILE B 1 72 ? 47.545 61.884 64.697 1.00 19.67 ? 101 ILE B CD1 1 
ATOM   1152 N  N   . VAL B 1 73 ? 45.901 59.523 59.412 1.00 16.20 ? 102 VAL B N   1 
ATOM   1153 C  CA  . VAL B 1 73 ? 44.933 59.019 58.474 1.00 15.68 ? 102 VAL B CA  1 
ATOM   1154 C  C   . VAL B 1 73 ? 44.647 57.553 58.699 1.00 16.90 ? 102 VAL B C   1 
ATOM   1155 O  O   . VAL B 1 73 ? 45.459 56.807 59.307 1.00 16.56 ? 102 VAL B O   1 
ATOM   1156 C  CB  . VAL B 1 73 ? 45.383 59.222 57.008 1.00 15.14 ? 102 VAL B CB  1 
ATOM   1157 C  CG1 . VAL B 1 73 ? 45.404 60.687 56.695 1.00 14.52 ? 102 VAL B CG1 1 
ATOM   1158 C  CG2 . VAL B 1 73 ? 46.788 58.606 56.730 1.00 15.36 ? 102 VAL B CG2 1 
ATOM   1159 N  N   . GLN B 1 74 ? 43.467 57.158 58.223 1.00 17.06 ? 103 GLN B N   1 
ATOM   1160 C  CA  . GLN B 1 74 ? 43.099 55.782 58.070 1.00 17.67 ? 103 GLN B CA  1 
ATOM   1161 C  C   . GLN B 1 74 ? 42.644 55.595 56.629 1.00 18.78 ? 103 GLN B C   1 
ATOM   1162 O  O   . GLN B 1 74 ? 42.318 56.547 55.932 1.00 17.58 ? 103 GLN B O   1 
ATOM   1163 C  CB  . GLN B 1 74 ? 41.987 55.399 59.047 1.00 17.59 ? 103 GLN B CB  1 
ATOM   1164 C  CG  . GLN B 1 74 ? 40.615 55.936 58.719 1.00 18.43 ? 103 GLN B CG  1 
ATOM   1165 C  CD  . GLN B 1 74 ? 39.525 55.446 59.674 1.00 20.97 ? 103 GLN B CD  1 
ATOM   1166 O  OE1 . GLN B 1 74 ? 39.780 55.212 60.861 1.00 20.90 ? 103 GLN B OE1 1 
ATOM   1167 N  NE2 . GLN B 1 74 ? 38.311 55.300 59.159 1.00 20.87 ? 103 GLN B NE2 1 
ATOM   1168 N  N   . ILE B 1 75 ? 42.631 54.349 56.193 1.00 19.99 ? 104 ILE B N   1 
ATOM   1169 C  CA  . ILE B 1 75 ? 42.170 53.998 54.850 1.00 21.12 ? 104 ILE B CA  1 
ATOM   1170 C  C   . ILE B 1 75 ? 40.655 53.773 54.885 1.00 22.08 ? 104 ILE B C   1 
ATOM   1171 O  O   . ILE B 1 75 ? 40.186 52.927 55.659 1.00 21.83 ? 104 ILE B O   1 
ATOM   1172 C  CB  . ILE B 1 75 ? 42.871 52.706 54.356 1.00 21.09 ? 104 ILE B CB  1 
ATOM   1173 C  CG1 . ILE B 1 75 ? 44.352 52.968 54.063 1.00 22.75 ? 104 ILE B CG1 1 
ATOM   1174 C  CG2 . ILE B 1 75 ? 42.153 52.178 53.126 1.00 22.78 ? 104 ILE B CG2 1 
ATOM   1175 C  CD1 . ILE B 1 75 ? 45.242 51.701 53.875 1.00 25.45 ? 104 ILE B CD1 1 
ATOM   1176 N  N   . ASP B 1 76 ? 39.902 54.523 54.055 1.00 22.68 ? 105 ASP B N   1 
ATOM   1177 C  CA  . ASP B 1 76 ? 38.448 54.347 53.905 1.00 23.51 ? 105 ASP B CA  1 
ATOM   1178 C  C   . ASP B 1 76 ? 38.089 53.441 52.717 1.00 24.33 ? 105 ASP B C   1 
ATOM   1179 O  O   . ASP B 1 76 ? 37.083 52.745 52.764 1.00 24.00 ? 105 ASP B O   1 
ATOM   1180 C  CB  . ASP B 1 76 ? 37.737 55.693 53.665 1.00 23.98 ? 105 ASP B CB  1 
ATOM   1181 C  CG  . ASP B 1 76 ? 37.251 56.350 54.934 1.00 26.91 ? 105 ASP B CG  1 
ATOM   1182 O  OD1 . ASP B 1 76 ? 37.347 55.746 56.046 1.00 27.73 ? 105 ASP B OD1 1 
ATOM   1183 O  OD2 . ASP B 1 76 ? 36.748 57.515 54.889 1.00 30.69 ? 105 ASP B OD2 1 
ATOM   1184 N  N   . LYS B 1 77 ? 38.859 53.522 51.636 1.00 24.87 ? 106 LYS B N   1 
ATOM   1185 C  CA  . LYS B 1 77 ? 38.828 52.514 50.559 1.00 25.84 ? 106 LYS B CA  1 
ATOM   1186 C  C   . LYS B 1 77 ? 40.234 52.069 50.228 1.00 25.70 ? 106 LYS B C   1 
ATOM   1187 O  O   . LYS B 1 77 ? 41.117 52.896 49.996 1.00 24.24 ? 106 LYS B O   1 
ATOM   1188 C  CB  . LYS B 1 77 ? 38.242 53.046 49.251 1.00 26.01 ? 106 LYS B CB  1 
ATOM   1189 C  CG  . LYS B 1 77 ? 36.926 53.785 49.364 1.00 30.05 ? 106 LYS B CG  1 
ATOM   1190 C  CD  . LYS B 1 77 ? 36.051 53.544 48.118 1.00 35.75 ? 106 LYS B CD  1 
ATOM   1191 C  CE  . LYS B 1 77 ? 35.170 54.748 47.787 1.00 37.62 ? 106 LYS B CE  1 
ATOM   1192 N  NZ  . LYS B 1 77 ? 34.346 54.528 46.534 1.00 39.63 ? 106 LYS B NZ  1 
ATOM   1193 N  N   . GLU B 1 78 ? 40.417 50.756 50.156 1.00 26.60 ? 107 GLU B N   1 
ATOM   1194 C  CA  . GLU B 1 78 ? 41.707 50.181 49.813 1.00 28.51 ? 107 GLU B CA  1 
ATOM   1195 C  C   . GLU B 1 78 ? 42.089 50.573 48.402 1.00 29.10 ? 107 GLU B C   1 
ATOM   1196 O  O   . GLU B 1 78 ? 41.277 51.022 47.621 1.00 29.17 ? 107 GLU B O   1 
ATOM   1197 C  CB  . GLU B 1 78 ? 41.674 48.640 49.902 1.00 29.01 ? 107 GLU B CB  1 
ATOM   1198 C  CG  . GLU B 1 78 ? 41.196 48.072 51.239 1.00 31.65 ? 107 GLU B CG  1 
ATOM   1199 C  CD  . GLU B 1 78 ? 42.163 48.286 52.407 1.00 34.93 ? 107 GLU B CD  1 
ATOM   1200 O  OE1 . GLU B 1 78 ? 43.383 48.422 52.196 1.00 37.18 ? 107 GLU B OE1 1 
ATOM   1201 O  OE2 . GLU B 1 78 ? 41.692 48.281 53.561 1.00 40.82 ? 107 GLU B OE2 1 
ATOM   1202 N  N   . GLU B 1 79 ? 43.345 50.390 48.077 1.00 30.11 ? 108 GLU B N   1 
ATOM   1203 C  CA  . GLU B 1 79 ? 43.793 50.518 46.712 1.00 31.79 ? 108 GLU B CA  1 
ATOM   1204 C  C   . GLU B 1 79 ? 42.942 49.662 45.776 1.00 32.90 ? 108 GLU B C   1 
ATOM   1205 O  O   . GLU B 1 79 ? 42.591 48.529 46.104 1.00 33.16 ? 108 GLU B O   1 
ATOM   1206 C  CB  . GLU B 1 79 ? 45.221 50.050 46.619 1.00 32.02 ? 108 GLU B CB  1 
ATOM   1207 C  CG  . GLU B 1 79 ? 46.193 50.983 47.302 1.00 32.47 ? 108 GLU B CG  1 
ATOM   1208 C  CD  . GLU B 1 79 ? 47.604 50.457 47.240 1.00 33.76 ? 108 GLU B CD  1 
ATOM   1209 O  OE1 . GLU B 1 79 ? 47.832 49.467 46.505 1.00 38.13 ? 108 GLU B OE1 1 
ATOM   1210 O  OE2 . GLU B 1 79 ? 48.472 51.037 47.898 1.00 33.70 ? 108 GLU B OE2 1 
ATOM   1211 N  N   . ARG B 1 80 ? 42.600 50.222 44.627 1.00 33.73 ? 109 ARG B N   1 
ATOM   1212 C  CA  . ARG B 1 80 ? 41.778 49.528 43.644 1.00 34.33 ? 109 ARG B CA  1 
ATOM   1213 C  C   . ARG B 1 80 ? 42.024 50.111 42.264 1.00 34.18 ? 109 ARG B C   1 
ATOM   1214 O  O   . ARG B 1 80 ? 42.351 51.299 42.128 1.00 34.20 ? 109 ARG B O   1 
ATOM   1215 C  CB  . ARG B 1 80 ? 40.302 49.658 44.026 1.00 34.87 ? 109 ARG B CB  1 
ATOM   1216 C  CG  . ARG B 1 80 ? 39.798 51.106 44.049 1.00 35.27 ? 109 ARG B CG  1 
ATOM   1217 C  CD  . ARG B 1 80 ? 38.924 51.448 45.267 1.00 36.53 ? 109 ARG B CD  1 
ATOM   1218 N  NE  . ARG B 1 80 ? 38.635 52.882 45.284 1.00 37.13 ? 109 ARG B NE  1 
ATOM   1219 C  CZ  . ARG B 1 80 ? 39.496 53.834 45.635 1.00 34.09 ? 109 ARG B CZ  1 
ATOM   1220 N  NH1 . ARG B 1 80 ? 40.719 53.540 46.082 1.00 31.69 ? 109 ARG B NH1 1 
ATOM   1221 N  NH2 . ARG B 1 80 ? 39.108 55.103 45.563 1.00 33.95 ? 109 ARG B NH2 1 
ATOM   1222 N  N   . GLY B 1 81 ? 41.881 49.283 41.225 1.00 34.64 ? 110 GLY B N   1 
ATOM   1223 C  CA  . GLY B 1 81 ? 42.280 49.701 39.885 1.00 34.17 ? 110 GLY B CA  1 
ATOM   1224 C  C   . GLY B 1 81 ? 43.686 50.289 39.934 1.00 33.87 ? 110 GLY B C   1 
ATOM   1225 O  O   . GLY B 1 81 ? 44.571 49.695 40.545 1.00 34.23 ? 110 GLY B O   1 
ATOM   1226 N  N   . ASN B 1 82 ? 43.873 51.452 39.309 1.00 33.36 ? 111 ASN B N   1 
ATOM   1227 C  CA  . ASN B 1 82 ? 45.116 52.224 39.381 1.00 33.29 ? 111 ASN B CA  1 
ATOM   1228 C  C   . ASN B 1 82 ? 45.095 53.371 40.442 1.00 31.37 ? 111 ASN B C   1 
ATOM   1229 O  O   . ASN B 1 82 ? 45.884 54.329 40.363 1.00 31.17 ? 111 ASN B O   1 
ATOM   1230 C  CB  . ASN B 1 82 ? 45.429 52.813 37.996 1.00 34.13 ? 111 ASN B CB  1 
ATOM   1231 C  CG  . ASN B 1 82 ? 44.504 53.974 37.631 1.00 38.81 ? 111 ASN B CG  1 
ATOM   1232 O  OD1 . ASN B 1 82 ? 43.422 54.146 38.242 1.00 44.39 ? 111 ASN B OD1 1 
ATOM   1233 N  ND2 . ASN B 1 82 ? 44.911 54.780 36.643 1.00 42.42 ? 111 ASN B ND2 1 
ATOM   1234 N  N   . LYS B 1 83 ? 44.213 53.261 41.431 1.00 29.37 ? 112 LYS B N   1 
ATOM   1235 C  CA  . LYS B 1 83 ? 44.043 54.311 42.444 1.00 28.21 ? 112 LYS B CA  1 
ATOM   1236 C  C   . LYS B 1 83 ? 44.737 53.970 43.761 1.00 25.86 ? 112 LYS B C   1 
ATOM   1237 O  O   . LYS B 1 83 ? 44.641 52.852 44.232 1.00 25.37 ? 112 LYS B O   1 
ATOM   1238 C  CB  . LYS B 1 83 ? 42.560 54.488 42.769 1.00 28.81 ? 112 LYS B CB  1 
ATOM   1239 C  CG  . LYS B 1 83 ? 41.641 54.785 41.579 1.00 30.62 ? 112 LYS B CG  1 
ATOM   1240 C  CD  . LYS B 1 83 ? 40.434 55.572 42.069 1.00 34.28 ? 112 LYS B CD  1 
ATOM   1241 C  CE  . LYS B 1 83 ? 39.523 56.039 40.938 1.00 36.06 ? 112 LYS B CE  1 
ATOM   1242 N  NZ  . LYS B 1 83 ? 38.265 56.590 41.540 1.00 38.67 ? 112 LYS B NZ  1 
ATOM   1243 N  N   . GLY B 1 84 ? 45.354 54.958 44.394 1.00 24.05 ? 113 GLY B N   1 
ATOM   1244 C  CA  . GLY B 1 84 ? 45.724 54.851 45.798 1.00 23.09 ? 113 GLY B CA  1 
ATOM   1245 C  C   . GLY B 1 84 ? 44.548 54.666 46.734 1.00 21.70 ? 113 GLY B C   1 
ATOM   1246 O  O   . GLY B 1 84 ? 43.381 54.747 46.313 1.00 21.31 ? 113 GLY B O   1 
ATOM   1247 N  N   . ALA B 1 85 ? 44.847 54.374 48.000 1.00 19.91 ? 114 ALA B N   1 
ATOM   1248 C  CA  . ALA B 1 85 ? 43.818 54.256 49.001 1.00 19.54 ? 114 ALA B CA  1 
ATOM   1249 C  C   . ALA B 1 85 ? 43.158 55.625 49.165 1.00 17.81 ? 114 ALA B C   1 
ATOM   1250 O  O   . ALA B 1 85 ? 43.823 56.625 49.069 1.00 16.78 ? 114 ALA B O   1 
ATOM   1251 C  CB  . ALA B 1 85 ? 44.400 53.782 50.330 1.00 19.48 ? 114 ALA B CB  1 
ATOM   1252 N  N   . ALA B 1 86 ? 41.850 55.631 49.370 1.00 17.65 ? 115 ALA B N   1 
ATOM   1253 C  CA  . ALA B 1 86 ? 41.113 56.816 49.755 1.00 17.75 ? 115 ALA B CA  1 
ATOM   1254 C  C   . ALA B 1 86 ? 41.293 56.939 51.255 1.00 16.87 ? 115 ALA B C   1 
ATOM   1255 O  O   . ALA B 1 86 ? 40.969 56.006 51.995 1.00 16.59 ? 115 ALA B O   1 
ATOM   1256 C  CB  . ALA B 1 86 ? 39.609 56.669 49.406 1.00 17.75 ? 115 ALA B CB  1 
ATOM   1257 N  N   . LEU B 1 87 ? 41.839 58.069 51.685 1.00 16.46 ? 116 LEU B N   1 
ATOM   1258 C  CA  . LEU B 1 87 ? 42.160 58.317 53.083 1.00 15.57 ? 116 LEU B CA  1 
ATOM   1259 C  C   . LEU B 1 87 ? 41.224 59.293 53.746 1.00 15.04 ? 116 LEU B C   1 
ATOM   1260 O  O   . LEU B 1 87 ? 40.580 60.088 53.091 1.00 14.70 ? 116 LEU B O   1 
ATOM   1261 C  CB  . LEU B 1 87 ? 43.548 58.923 53.189 1.00 16.41 ? 116 LEU B CB  1 
ATOM   1262 C  CG  . LEU B 1 87 ? 44.734 58.094 52.685 1.00 16.14 ? 116 LEU B CG  1 
ATOM   1263 C  CD1 . LEU B 1 87 ? 45.970 58.893 52.807 1.00 17.35 ? 116 LEU B CD1 1 
ATOM   1264 C  CD2 . LEU B 1 87 ? 44.856 56.796 53.433 1.00 17.82 ? 116 LEU B CD2 1 
ATOM   1265 N  N   . THR B 1 88 ? 41.178 59.228 55.070 1.00 15.59 ? 117 THR B N   1 
ATOM   1266 C  CA  . THR B 1 88 ? 40.514 60.246 55.904 1.00 15.68 ? 117 THR B CA  1 
ATOM   1267 C  C   . THR B 1 88 ? 41.293 60.553 57.194 1.00 15.39 ? 117 THR B C   1 
ATOM   1268 O  O   . THR B 1 88 ? 42.056 59.718 57.662 1.00 16.62 ? 117 THR B O   1 
ATOM   1269 C  CB  . THR B 1 88 ? 39.064 59.810 56.215 1.00 15.04 ? 117 THR B CB  1 
ATOM   1270 O  OG1 . THR B 1 88 ? 38.393 60.842 56.957 1.00 15.53 ? 117 THR B OG1 1 
ATOM   1271 C  CG2 . THR B 1 88 ? 39.010 58.586 57.135 1.00 17.20 ? 117 THR B CG2 1 
ATOM   1272 N  N   . THR B 1 89 ? 41.134 61.758 57.741 1.00 14.98 ? 118 THR B N   1 
ATOM   1273 C  CA  . THR B 1 89 ? 41.632 62.083 59.063 1.00 15.06 ? 118 THR B CA  1 
ATOM   1274 C  C   . THR B 1 89 ? 40.577 61.850 60.138 1.00 15.25 ? 118 THR B C   1 
ATOM   1275 O  O   . THR B 1 89 ? 40.871 61.987 61.320 1.00 15.63 ? 118 THR B O   1 
ATOM   1276 C  CB  . THR B 1 89 ? 42.127 63.552 59.149 1.00 15.95 ? 118 THR B CB  1 
ATOM   1277 O  OG1 . THR B 1 89 ? 41.036 64.473 58.888 1.00 14.91 ? 118 THR B OG1 1 
ATOM   1278 C  CG2 . THR B 1 89 ? 43.190 63.840 58.098 1.00 14.48 ? 118 THR B CG2 1 
ATOM   1279 N  N   . PHE B 1 90 ? 39.342 61.519 59.742 1.00 14.66 ? 119 PHE B N   1 
ATOM   1280 C  CA  . PHE B 1 90 ? 38.283 61.279 60.701 1.00 15.22 ? 119 PHE B CA  1 
ATOM   1281 C  C   . PHE B 1 90 ? 38.373 59.850 61.178 1.00 16.76 ? 119 PHE B C   1 
ATOM   1282 O  O   . PHE B 1 90 ? 37.731 58.956 60.619 1.00 16.81 ? 119 PHE B O   1 
ATOM   1283 C  CB  . PHE B 1 90 ? 36.908 61.599 60.076 1.00 14.90 ? 119 PHE B CB  1 
ATOM   1284 C  CG  . PHE B 1 90 ? 36.749 63.036 59.752 1.00 13.76 ? 119 PHE B CG  1 
ATOM   1285 C  CD1 . PHE B 1 90 ? 36.715 63.970 60.767 1.00 13.35 ? 119 PHE B CD1 1 
ATOM   1286 C  CD2 . PHE B 1 90 ? 36.677 63.470 58.451 1.00 14.35 ? 119 PHE B CD2 1 
ATOM   1287 C  CE1 . PHE B 1 90 ? 36.605 65.318 60.492 1.00 12.06 ? 119 PHE B CE1 1 
ATOM   1288 C  CE2 . PHE B 1 90 ? 36.545 64.841 58.165 1.00 15.82 ? 119 PHE B CE2 1 
ATOM   1289 C  CZ  . PHE B 1 90 ? 36.547 65.756 59.200 1.00 12.84 ? 119 PHE B CZ  1 
ATOM   1290 N  N   . ILE B 1 91 ? 39.208 59.625 62.195 1.00 18.00 ? 120 ILE B N   1 
ATOM   1291 C  CA  . ILE B 1 91 ? 39.607 58.262 62.555 1.00 18.64 ? 120 ILE B CA  1 
ATOM   1292 C  C   . ILE B 1 91 ? 38.475 57.562 63.303 1.00 18.86 ? 120 ILE B C   1 
ATOM   1293 O  O   . ILE B 1 91 ? 37.857 58.151 64.183 1.00 18.81 ? 120 ILE B O   1 
ATOM   1294 C  CB  . ILE B 1 91 ? 40.873 58.276 63.440 1.00 18.76 ? 120 ILE B CB  1 
ATOM   1295 C  CG1 . ILE B 1 91 ? 42.062 58.968 62.729 1.00 18.90 ? 120 ILE B CG1 1 
ATOM   1296 C  CG2 . ILE B 1 91 ? 41.253 56.855 63.864 1.00 21.19 ? 120 ILE B CG2 1 
ATOM   1297 C  CD1 . ILE B 1 91 ? 42.383 58.425 61.334 1.00 18.49 ? 120 ILE B CD1 1 
ATOM   1298 N  N   . SER B 1 92 ? 38.222 56.308 62.940 1.00 19.37 ? 121 SER B N   1 
ATOM   1299 C  CA  . SER B 1 92 ? 37.219 55.477 63.572 1.00 20.89 ? 121 SER B CA  1 
ATOM   1300 C  C   . SER B 1 92 ? 37.776 54.951 64.895 1.00 20.79 ? 121 SER B C   1 
ATOM   1301 O  O   . SER B 1 92 ? 38.764 54.192 64.890 1.00 21.23 ? 121 SER B O   1 
ATOM   1302 C  CB  . SER B 1 92 ? 36.862 54.282 62.662 1.00 21.20 ? 121 SER B CB  1 
ATOM   1303 O  OG  . SER B 1 92 ? 36.689 54.696 61.305 1.00 24.74 ? 121 SER B OG  1 
ATOM   1304 N  N   . LEU B 1 93 ? 37.171 55.346 66.009 1.00 21.01 ? 122 LEU B N   1 
ATOM   1305 C  CA  . LEU B 1 93 ? 37.617 54.886 67.329 1.00 21.96 ? 122 LEU B CA  1 
ATOM   1306 C  C   . LEU B 1 93 ? 36.455 54.335 68.113 1.00 23.42 ? 122 LEU B C   1 
ATOM   1307 O  O   . LEU B 1 93 ? 35.482 55.052 68.375 1.00 22.27 ? 122 LEU B O   1 
ATOM   1308 C  CB  . LEU B 1 93 ? 38.304 56.024 68.118 1.00 21.71 ? 122 LEU B CB  1 
ATOM   1309 C  CG  . LEU B 1 93 ? 39.606 56.582 67.520 1.00 18.90 ? 122 LEU B CG  1 
ATOM   1310 C  CD1 . LEU B 1 93 ? 40.023 57.855 68.267 1.00 20.62 ? 122 LEU B CD1 1 
ATOM   1311 C  CD2 . LEU B 1 93 ? 40.719 55.580 67.529 1.00 19.91 ? 122 LEU B CD2 1 
ATOM   1312 N  N   . ALA B 1 94 ? 36.562 53.065 68.506 1.00 25.26 ? 123 ALA B N   1 
ATOM   1313 C  CA  . ALA B 1 94 ? 35.523 52.433 69.308 1.00 26.90 ? 123 ALA B CA  1 
ATOM   1314 C  C   . ALA B 1 94 ? 35.291 53.213 70.593 1.00 28.63 ? 123 ALA B C   1 
ATOM   1315 O  O   . ALA B 1 94 ? 36.239 53.736 71.212 1.00 26.24 ? 123 ALA B O   1 
ATOM   1316 C  CB  . ALA B 1 94 ? 35.888 50.955 69.628 1.00 27.71 ? 123 ALA B CB  1 
ATOM   1317 N  N   . GLY B 1 95 ? 34.013 53.338 70.947 1.00 31.01 ? 124 GLY B N   1 
ATOM   1318 C  CA  . GLY B 1 95 ? 33.579 53.834 72.243 1.00 34.05 ? 124 GLY B CA  1 
ATOM   1319 C  C   . GLY B 1 95 ? 33.567 55.333 72.323 1.00 37.01 ? 124 GLY B C   1 
ATOM   1320 O  O   . GLY B 1 95 ? 33.447 55.910 73.422 1.00 38.76 ? 124 GLY B O   1 
ATOM   1321 N  N   . SER B 1 96 ? 33.677 55.983 71.158 1.00 40.18 ? 125 SER B N   1 
ATOM   1322 C  CA  . SER B 1 96 ? 34.163 57.379 71.085 1.00 41.52 ? 125 SER B CA  1 
ATOM   1323 C  C   . SER B 1 96 ? 34.483 57.885 69.671 1.00 42.25 ? 125 SER B C   1 
ATOM   1324 O  O   . SER B 1 96 ? 34.097 57.522 68.561 1.00 42.59 ? 125 SER B O   1 
ATOM   1325 C  CB  . SER B 1 96 ? 35.481 57.464 71.850 1.00 41.45 ? 125 SER B CB  1 
ATOM   1326 O  OG  . SER B 1 96 ? 36.423 56.622 71.206 1.00 40.96 ? 125 SER B OG  1 
ATOM   1327 O  OXT . SER B 1 96 ? 35.293 58.781 69.512 1.00 45.28 ? 125 SER B OXT 1 
HETATM 1328 PB PB  . PB  C 2 .  ? 41.941 79.369 89.932 0.60 27.36 ? 604 PB  A PB  1 
HETATM 1329 PB PB  . PB  D 2 .  ? 54.715 63.499 78.172 0.16 35.68 ? 605 PB  A PB  1 
HETATM 1330 O  O   . HOH E 3 .  ? 38.650 68.476 80.851 1.00 16.14 ? 606 HOH A O   1 
HETATM 1331 O  O   . HOH E 3 .  ? 45.777 60.698 70.153 1.00 18.21 ? 607 HOH A O   1 
HETATM 1332 O  O   . HOH E 3 .  ? 49.500 60.704 85.055 1.00 16.73 ? 608 HOH A O   1 
HETATM 1333 O  O   . HOH E 3 .  ? 49.784 45.819 73.297 1.00 22.44 ? 609 HOH A O   1 
HETATM 1334 O  O   . HOH E 3 .  ? 45.749 64.888 81.722 1.00 17.54 ? 610 HOH A O   1 
HETATM 1335 O  O   . HOH E 3 .  ? 53.993 46.568 75.215 1.00 25.41 ? 611 HOH A O   1 
HETATM 1336 O  O   . HOH E 3 .  ? 42.645 58.414 88.577 1.00 20.71 ? 612 HOH A O   1 
HETATM 1337 O  O   . HOH E 3 .  ? 31.664 70.172 80.181 1.00 22.60 ? 613 HOH A O   1 
HETATM 1338 O  O   . HOH E 3 .  ? 41.052 52.996 61.675 1.00 27.45 ? 614 HOH A O   1 
HETATM 1339 O  O   . HOH E 3 .  ? 36.642 62.648 88.174 1.00 24.91 ? 615 HOH A O   1 
HETATM 1340 O  O   . HOH E 3 .  ? 44.556 62.397 92.146 1.00 32.41 ? 616 HOH A O   1 
HETATM 1341 O  O   . HOH E 3 .  ? 49.958 59.649 88.820 1.00 23.71 ? 617 HOH A O   1 
HETATM 1342 O  O   . HOH E 3 .  ? 45.660 73.617 92.328 1.00 19.89 ? 618 HOH A O   1 
HETATM 1343 O  O   . HOH E 3 .  ? 43.066 60.998 89.285 1.00 18.38 ? 619 HOH A O   1 
HETATM 1344 O  O   . HOH E 3 .  ? 43.935 51.210 90.751 1.00 23.28 ? 620 HOH A O   1 
HETATM 1345 O  O   . HOH E 3 .  ? 54.548 63.185 72.571 1.00 29.39 ? 621 HOH A O   1 
HETATM 1346 O  O   . HOH E 3 .  ? 53.709 57.157 79.155 1.00 20.09 ? 622 HOH A O   1 
HETATM 1347 O  O   . HOH E 3 .  ? 49.904 58.402 86.253 1.00 19.98 ? 623 HOH A O   1 
HETATM 1348 O  O   . HOH E 3 .  ? 55.526 41.485 82.216 1.00 28.90 ? 624 HOH A O   1 
HETATM 1349 O  O   . HOH E 3 .  ? 63.423 39.244 84.419 1.00 34.84 ? 625 HOH A O   1 
HETATM 1350 O  O   . HOH E 3 .  ? 47.150 50.098 65.383 1.00 28.22 ? 626 HOH A O   1 
HETATM 1351 O  O   . HOH E 3 .  ? 37.280 67.653 76.366 1.00 24.72 ? 627 HOH A O   1 
HETATM 1352 O  O   . HOH E 3 .  ? 45.295 66.398 79.378 1.00 16.37 ? 628 HOH A O   1 
HETATM 1353 O  O   . HOH E 3 .  ? 45.125 71.452 85.261 1.00 31.05 ? 629 HOH A O   1 
HETATM 1354 O  O   . HOH E 3 .  ? 55.495 58.536 78.947 1.00 48.28 ? 630 HOH A O   1 
HETATM 1355 O  O   . HOH E 3 .  ? 35.587 54.019 83.267 1.00 28.45 ? 631 HOH A O   1 
HETATM 1356 O  O   . HOH E 3 .  ? 47.972 53.042 94.446 1.00 32.03 ? 632 HOH A O   1 
HETATM 1357 O  O   . HOH E 3 .  ? 39.025 48.166 83.636 1.00 27.99 ? 633 HOH A O   1 
HETATM 1358 O  O   . HOH E 3 .  ? 38.148 55.259 91.886 1.00 36.91 ? 634 HOH A O   1 
HETATM 1359 O  O   . HOH E 3 .  ? 49.933 42.456 78.992 1.00 33.44 ? 635 HOH A O   1 
HETATM 1360 O  O   . HOH E 3 .  ? 56.709 52.052 67.247 1.00 27.72 ? 636 HOH A O   1 
HETATM 1361 O  O   . HOH E 3 .  ? 54.504 67.349 66.774 1.00 29.76 ? 637 HOH A O   1 
HETATM 1362 O  O   . HOH E 3 .  ? 52.155 56.891 86.117 1.00 29.34 ? 638 HOH A O   1 
HETATM 1363 O  O   . HOH E 3 .  ? 44.707 65.252 84.255 1.00 22.40 ? 639 HOH A O   1 
HETATM 1364 O  O   . HOH E 3 .  ? 46.899 68.185 78.026 1.00 23.89 ? 640 HOH A O   1 
HETATM 1365 O  O   . HOH E 3 .  ? 48.096 64.350 69.754 1.00 24.39 ? 641 HOH A O   1 
HETATM 1366 O  O   . HOH E 3 .  ? 35.358 50.993 81.862 1.00 32.22 ? 642 HOH A O   1 
HETATM 1367 O  O   . HOH E 3 .  ? 54.055 55.444 81.455 1.00 30.59 ? 643 HOH A O   1 
HETATM 1368 O  O   . HOH E 3 .  ? 45.911 73.534 88.116 1.00 22.51 ? 644 HOH A O   1 
HETATM 1369 O  O   . HOH E 3 .  ? 54.255 56.643 84.168 1.00 37.96 ? 645 HOH A O   1 
HETATM 1370 O  O   . HOH E 3 .  ? 55.187 50.314 81.316 1.00 36.91 ? 646 HOH A O   1 
HETATM 1371 O  O   . HOH E 3 .  ? 56.074 47.144 71.446 1.00 32.25 ? 647 HOH A O   1 
HETATM 1372 O  O   . HOH E 3 .  ? 45.985 72.056 90.079 1.00 25.99 ? 648 HOH A O   1 
HETATM 1373 O  O   . HOH E 3 .  ? 49.564 68.380 78.269 1.00 22.39 ? 649 HOH A O   1 
HETATM 1374 O  O   . HOH E 3 .  ? 55.832 51.246 87.200 0.50 28.16 ? 650 HOH A O   1 
HETATM 1375 O  O   . HOH E 3 .  ? 45.355 44.567 80.892 1.00 38.82 ? 651 HOH A O   1 
HETATM 1376 O  O   . HOH E 3 .  ? 58.463 53.341 81.408 1.00 40.38 ? 652 HOH A O   1 
HETATM 1377 O  O   . HOH E 3 .  ? 59.303 50.011 79.116 1.00 38.31 ? 653 HOH A O   1 
HETATM 1378 O  O   . HOH E 3 .  ? 54.623 42.695 73.309 1.00 32.55 ? 654 HOH A O   1 
HETATM 1379 O  O   . HOH E 3 .  ? 57.060 40.600 74.841 1.00 44.68 ? 655 HOH A O   1 
HETATM 1380 O  O   . HOH E 3 .  ? 49.330 50.724 64.009 1.00 31.57 ? 656 HOH A O   1 
HETATM 1381 O  O   . HOH E 3 .  ? 47.515 43.951 82.076 1.00 55.31 ? 657 HOH A O   1 
HETATM 1382 O  O   . HOH E 3 .  ? 37.313 51.293 65.475 1.00 36.77 ? 658 HOH A O   1 
HETATM 1383 O  O   . HOH E 3 .  ? 58.050 48.329 72.263 1.00 28.74 ? 659 HOH A O   1 
HETATM 1384 O  O   . HOH E 3 .  ? 48.295 62.407 86.836 1.00 35.04 ? 660 HOH A O   1 
HETATM 1385 O  O   . HOH E 3 .  ? 50.352 63.865 87.495 1.00 41.46 ? 661 HOH A O   1 
HETATM 1386 O  O   . HOH E 3 .  ? 44.537 46.994 69.152 1.00 41.67 ? 662 HOH A O   1 
HETATM 1387 O  O   . HOH E 3 .  ? 51.482 46.876 67.580 0.50 25.97 ? 663 HOH A O   1 
HETATM 1388 O  O   . HOH E 3 .  ? 55.529 53.064 82.067 1.00 39.69 ? 664 HOH A O   1 
HETATM 1389 O  O   . HOH E 3 .  ? 55.500 52.775 84.929 1.00 43.20 ? 665 HOH A O   1 
HETATM 1390 O  O   . HOH E 3 .  ? 47.173 64.737 85.624 1.00 40.63 ? 666 HOH A O   1 
HETATM 1391 O  O   . HOH E 3 .  ? 49.602 66.603 80.466 1.00 29.83 ? 667 HOH A O   1 
HETATM 1392 O  O   . HOH E 3 .  ? 46.520 68.619 81.912 1.00 26.03 ? 668 HOH A O   1 
HETATM 1393 O  O   . HOH E 3 .  ? 37.510 44.440 83.270 0.50 42.71 ? 669 HOH A O   1 
HETATM 1394 O  O   . HOH E 3 .  ? 36.585 49.799 83.975 1.00 42.93 ? 670 HOH A O   1 
HETATM 1395 O  O   . HOH E 3 .  ? 64.334 48.324 75.129 1.00 44.35 ? 671 HOH A O   1 
HETATM 1396 O  O   . HOH E 3 .  ? 29.783 65.980 79.367 1.00 46.79 ? 672 HOH A O   1 
HETATM 1397 O  O   . HOH E 3 .  ? 31.398 68.439 76.168 1.00 49.01 ? 673 HOH A O   1 
HETATM 1398 O  O   . HOH E 3 .  ? 37.001 61.608 72.316 1.00 31.40 ? 674 HOH A O   1 
HETATM 1399 O  O   . HOH E 3 .  ? 34.659 70.094 73.296 1.00 39.45 ? 675 HOH A O   1 
HETATM 1400 O  O   . HOH E 3 .  ? 41.639 69.255 84.922 1.00 31.78 ? 676 HOH A O   1 
HETATM 1401 O  O   . HOH E 3 .  ? 39.288 70.195 91.066 1.00 51.57 ? 677 HOH A O   1 
HETATM 1402 O  O   . HOH E 3 .  ? 64.323 43.756 76.701 1.00 39.44 ? 678 HOH A O   1 
HETATM 1403 O  O   . HOH E 3 .  ? 50.862 66.864 67.291 1.00 36.23 ? 679 HOH A O   1 
HETATM 1404 O  O   . HOH E 3 .  ? 54.143 69.833 67.478 1.00 34.52 ? 680 HOH A O   1 
HETATM 1405 O  O   . HOH E 3 .  ? 56.508 60.328 72.764 1.00 32.79 ? 681 HOH A O   1 
HETATM 1406 O  O   . HOH E 3 .  ? 55.382 47.680 68.393 1.00 41.89 ? 682 HOH A O   1 
HETATM 1407 O  O   . HOH E 3 .  ? 42.116 45.759 87.943 1.00 47.42 ? 683 HOH A O   1 
HETATM 1408 O  O   . HOH E 3 .  ? 44.309 50.455 94.842 1.00 48.55 ? 684 HOH A O   1 
HETATM 1409 O  O   . HOH E 3 .  ? 52.951 41.077 81.220 1.00 37.84 ? 685 HOH A O   1 
HETATM 1410 O  O   . HOH E 3 .  ? 29.656 68.377 80.562 1.00 40.75 ? 686 HOH A O   1 
HETATM 1411 O  O   . HOH E 3 .  ? 34.860 67.450 90.284 1.00 39.87 ? 687 HOH A O   1 
HETATM 1412 O  O   . HOH E 3 .  ? 33.778 51.065 75.037 1.00 43.78 ? 688 HOH A O   1 
HETATM 1413 O  O   . HOH E 3 .  ? 57.692 56.281 81.416 1.00 45.24 ? 689 HOH A O   1 
HETATM 1414 O  O   . HOH E 3 .  ? 53.367 46.019 68.073 0.50 26.61 ? 690 HOH A O   1 
HETATM 1415 O  O   . HOH E 3 .  ? 46.819 69.896 84.518 1.00 38.34 ? 691 HOH A O   1 
HETATM 1416 O  O   . HOH E 3 .  ? 38.717 51.226 60.387 1.00 40.90 ? 692 HOH A O   1 
HETATM 1417 O  O   . HOH E 3 .  ? 34.494 52.511 65.552 1.00 37.99 ? 693 HOH A O   1 
HETATM 1418 O  O   . HOH E 3 .  ? 42.231 47.937 68.618 1.00 46.15 ? 694 HOH A O   1 
HETATM 1419 O  O   . HOH E 3 .  ? 33.164 49.971 78.740 1.00 35.18 ? 695 HOH A O   1 
HETATM 1420 O  O   . HOH E 3 .  ? 38.487 72.655 91.842 1.00 36.84 ? 696 HOH A O   1 
HETATM 1421 O  O   . HOH E 3 .  ? 38.977 46.148 76.080 1.00 40.41 ? 697 HOH A O   1 
HETATM 1422 O  O   . HOH E 3 .  ? 57.419 70.456 62.427 1.00 40.33 ? 698 HOH A O   1 
HETATM 1423 O  O   . HOH E 3 .  ? 35.888 59.238 77.159 1.00 48.90 ? 699 HOH A O   1 
HETATM 1424 O  O   . HOH E 3 .  ? 32.451 60.509 82.869 1.00 40.75 ? 700 HOH A O   1 
HETATM 1425 O  O   . HOH E 3 .  ? 42.253 64.209 92.128 1.00 35.53 ? 701 HOH A O   1 
HETATM 1426 O  O   . HOH E 3 .  ? 32.911 56.777 81.914 1.00 47.38 ? 702 HOH A O   1 
HETATM 1427 O  O   . HOH E 3 .  ? 45.519 68.372 69.284 1.00 40.31 ? 703 HOH A O   1 
HETATM 1428 O  O   . HOH E 3 .  ? 49.138 70.331 67.613 1.00 40.59 ? 704 HOH A O   1 
HETATM 1429 O  O   . HOH E 3 .  ? 47.746 47.582 66.313 1.00 33.91 ? 705 HOH A O   1 
HETATM 1430 O  O   . HOH E 3 .  ? 40.374 49.024 89.980 1.00 49.04 ? 706 HOH A O   1 
HETATM 1431 O  O   . HOH E 3 .  ? 57.044 44.856 70.753 1.00 46.08 ? 707 HOH A O   1 
HETATM 1432 O  O   . HOH E 3 .  ? 59.467 45.739 68.551 1.00 41.72 ? 708 HOH A O   1 
HETATM 1433 O  O   . HOH E 3 .  ? 60.457 45.270 72.413 1.00 42.38 ? 709 HOH A O   1 
HETATM 1434 O  O   . HOH E 3 .  ? 60.177 42.538 75.502 1.00 40.91 ? 710 HOH A O   1 
HETATM 1435 O  O   . HOH E 3 .  ? 42.825 43.068 74.323 1.00 39.25 ? 711 HOH A O   1 
HETATM 1436 O  O   . HOH E 3 .  ? 54.940 60.523 80.915 1.00 37.45 ? 712 HOH A O   1 
HETATM 1437 O  O   . HOH E 3 .  ? 47.318 42.419 71.339 1.00 44.35 ? 713 HOH A O   1 
HETATM 1438 O  O   . HOH E 3 .  ? 36.540 65.532 71.593 1.00 40.75 ? 714 HOH A O   1 
HETATM 1439 O  O   . HOH E 3 .  ? 30.997 63.927 76.364 1.00 39.36 ? 715 HOH A O   1 
HETATM 1440 O  O   . HOH E 3 .  ? 52.705 52.058 63.408 1.00 40.92 ? 716 HOH A O   1 
HETATM 1441 O  O   . HOH E 3 .  ? 37.507 44.047 82.771 0.50 38.77 ? 717 HOH A O   1 
HETATM 1442 O  O   . HOH E 3 .  ? 35.803 69.681 75.590 1.00 40.81 ? 718 HOH A O   1 
HETATM 1443 O  O   . HOH E 3 .  ? 39.871 67.503 91.382 1.00 41.64 ? 719 HOH A O   1 
HETATM 1444 O  O   . HOH E 3 .  ? 34.176 66.322 74.248 1.00 39.87 ? 720 HOH A O   1 
HETATM 1445 O  O   . HOH E 3 .  ? 53.508 49.458 63.169 1.00 37.97 ? 721 HOH A O   1 
HETATM 1446 O  O   . HOH E 3 .  ? 32.146 64.009 83.904 1.00 39.05 ? 722 HOH A O   1 
HETATM 1447 O  O   . HOH E 3 .  ? 31.288 60.668 85.970 1.00 44.78 ? 723 HOH A O   1 
HETATM 1448 O  O   . HOH E 3 .  ? 57.114 63.078 76.557 1.00 37.00 ? 724 HOH A O   1 
HETATM 1449 O  O   . HOH F 3 .  ? 32.953 60.514 53.706 1.00 13.14 ? 126 HOH B O   1 
HETATM 1450 O  O   . HOH F 3 .  ? 51.723 55.876 50.591 1.00 16.63 ? 127 HOH B O   1 
HETATM 1451 O  O   . HOH F 3 .  ? 34.079 67.477 56.397 1.00 16.55 ? 128 HOH B O   1 
HETATM 1452 O  O   . HOH F 3 .  ? 38.763 59.600 51.201 1.00 21.50 ? 129 HOH B O   1 
HETATM 1453 O  O   . HOH F 3 .  ? 43.348 62.404 62.176 1.00 16.78 ? 130 HOH B O   1 
HETATM 1454 O  O   . HOH F 3 .  ? 35.760 58.373 58.940 1.00 20.64 ? 131 HOH B O   1 
HETATM 1455 O  O   . HOH F 3 .  ? 36.705 67.728 49.152 1.00 17.81 ? 132 HOH B O   1 
HETATM 1456 O  O   . HOH F 3 .  ? 50.640 68.382 60.758 1.00 25.55 ? 133 HOH B O   1 
HETATM 1457 O  O   . HOH F 3 .  ? 37.636 66.854 46.829 1.00 21.19 ? 134 HOH B O   1 
HETATM 1458 O  O   . HOH F 3 .  ? 42.461 74.114 64.351 1.00 20.78 ? 135 HOH B O   1 
HETATM 1459 O  O   . HOH F 3 .  ? 38.013 71.801 40.414 1.00 28.39 ? 136 HOH B O   1 
HETATM 1460 O  O   . HOH F 3 .  ? 38.229 57.814 71.813 1.00 21.19 ? 137 HOH B O   1 
HETATM 1461 O  O   . HOH F 3 .  ? 56.642 63.289 63.379 1.00 37.74 ? 138 HOH B O   1 
HETATM 1462 O  O   . HOH F 3 .  ? 54.538 58.872 66.366 1.00 38.95 ? 139 HOH B O   1 
HETATM 1463 O  O   . HOH F 3 .  ? 40.892 69.077 68.998 1.00 21.10 ? 140 HOH B O   1 
HETATM 1464 O  O   . HOH F 3 .  ? 32.965 59.584 51.044 1.00 33.95 ? 141 HOH B O   1 
HETATM 1465 O  O   . HOH F 3 .  ? 36.679 58.648 52.656 1.00 27.42 ? 142 HOH B O   1 
HETATM 1466 O  O   . HOH F 3 .  ? 34.867 57.328 65.985 1.00 34.51 ? 143 HOH B O   1 
HETATM 1467 O  O   . HOH F 3 .  ? 44.897 49.419 56.739 1.00 33.31 ? 144 HOH B O   1 
HETATM 1468 O  O   . HOH F 3 .  ? 52.545 55.075 60.135 1.00 29.60 ? 145 HOH B O   1 
HETATM 1469 O  O   . HOH F 3 .  ? 37.949 59.876 48.326 1.00 35.73 ? 146 HOH B O   1 
HETATM 1470 O  O   . HOH F 3 .  ? 36.097 70.244 48.774 1.00 34.27 ? 147 HOH B O   1 
HETATM 1471 O  O   . HOH F 3 .  ? 47.464 71.846 58.586 1.00 31.77 ? 148 HOH B O   1 
HETATM 1472 O  O   . HOH F 3 .  ? 38.152 70.916 67.239 1.00 23.27 ? 149 HOH B O   1 
HETATM 1473 O  O   . HOH F 3 .  ? 51.925 70.455 45.615 1.00 39.38 ? 150 HOH B O   1 
HETATM 1474 O  O   . HOH F 3 .  ? 47.955 57.973 44.023 1.00 24.63 ? 151 HOH B O   1 
HETATM 1475 O  O   . HOH F 3 .  ? 47.831 53.728 48.520 1.00 22.35 ? 152 HOH B O   1 
HETATM 1476 O  O   . HOH F 3 .  ? 35.450 59.469 56.462 1.00 18.72 ? 153 HOH B O   1 
HETATM 1477 O  O   . HOH F 3 .  ? 46.737 68.012 64.856 1.00 42.13 ? 154 HOH B O   1 
HETATM 1478 O  O   . HOH F 3 .  ? 37.840 65.376 43.888 1.00 27.28 ? 155 HOH B O   1 
HETATM 1479 O  O   . HOH F 3 .  ? 47.983 77.797 61.602 1.00 45.74 ? 156 HOH B O   1 
HETATM 1480 O  O   . HOH F 3 .  ? 47.714 78.222 66.056 1.00 32.64 ? 157 HOH B O   1 
HETATM 1481 O  O   . HOH F 3 .  ? 44.636 72.849 65.483 1.00 29.54 ? 158 HOH B O   1 
HETATM 1482 O  O   . HOH F 3 .  ? 41.033 74.111 38.790 1.00 38.66 ? 159 HOH B O   1 
HETATM 1483 O  O   . HOH F 3 .  ? 52.895 49.593 48.418 1.00 33.22 ? 160 HOH B O   1 
HETATM 1484 O  O   . HOH F 3 .  ? 49.641 74.742 50.238 1.00 35.42 ? 161 HOH B O   1 
HETATM 1485 O  O   . HOH F 3 .  ? 52.894 73.073 49.525 1.00 44.09 ? 162 HOH B O   1 
HETATM 1486 O  O   . HOH F 3 .  ? 35.077 52.859 54.672 1.00 36.21 ? 163 HOH B O   1 
HETATM 1487 O  O   . HOH F 3 .  ? 36.510 64.176 46.546 1.00 27.12 ? 164 HOH B O   1 
HETATM 1488 O  O   . HOH F 3 .  ? 57.733 58.577 63.414 1.00 39.40 ? 165 HOH B O   1 
HETATM 1489 O  O   . HOH F 3 .  ? 50.877 50.379 46.867 1.00 25.67 ? 166 HOH B O   1 
HETATM 1490 O  O   . HOH F 3 .  ? 46.047 73.842 62.370 1.00 35.53 ? 167 HOH B O   1 
HETATM 1491 O  O   . HOH F 3 .  ? 35.459 56.045 57.849 1.00 25.21 ? 168 HOH B O   1 
HETATM 1492 O  O   . HOH F 3 .  ? 35.837 56.993 50.583 1.00 36.60 ? 169 HOH B O   1 
HETATM 1493 O  O   . HOH F 3 .  ? 49.007 76.923 67.979 1.00 25.02 ? 170 HOH B O   1 
HETATM 1494 O  O   . HOH F 3 .  ? 35.868 69.417 69.038 1.00 38.58 ? 171 HOH B O   1 
HETATM 1495 O  O   . HOH F 3 .  ? 38.785 69.335 70.232 1.00 33.27 ? 172 HOH B O   1 
HETATM 1496 O  O   . HOH F 3 .  ? 53.988 57.541 43.582 1.00 37.21 ? 173 HOH B O   1 
HETATM 1497 O  O   . HOH F 3 .  ? 43.267 74.806 46.512 1.00 33.53 ? 174 HOH B O   1 
HETATM 1498 O  O   . HOH F 3 .  ? 37.887 49.098 50.357 1.00 36.09 ? 175 HOH B O   1 
HETATM 1499 O  O   . HOH F 3 .  ? 44.882 49.456 50.429 1.00 23.53 ? 176 HOH B O   1 
HETATM 1500 O  O   . HOH F 3 .  ? 47.263 50.190 51.352 1.00 30.81 ? 177 HOH B O   1 
HETATM 1501 O  O   . HOH F 3 .  ? 32.994 54.614 54.238 1.00 41.08 ? 178 HOH B O   1 
HETATM 1502 O  O   . HOH F 3 .  ? 41.202 74.049 45.333 1.00 40.31 ? 179 HOH B O   1 
HETATM 1503 O  O   . HOH F 3 .  ? 42.282 76.896 44.643 1.00 47.41 ? 180 HOH B O   1 
HETATM 1504 O  O   . HOH F 3 .  ? 48.175 54.627 41.152 1.00 31.27 ? 181 HOH B O   1 
HETATM 1505 O  O   . HOH F 3 .  ? 45.426 57.427 43.229 1.00 24.22 ? 182 HOH B O   1 
HETATM 1506 O  O   . HOH F 3 .  ? 46.536 76.527 64.443 1.00 33.73 ? 183 HOH B O   1 
HETATM 1507 O  O   . HOH F 3 .  ? 47.718 74.788 68.096 1.00 26.93 ? 184 HOH B O   1 
HETATM 1508 O  O   . HOH F 3 .  ? 31.307 58.841 48.988 1.00 37.28 ? 185 HOH B O   1 
HETATM 1509 O  O   . HOH F 3 .  ? 40.463 78.190 58.897 1.00 33.13 ? 186 HOH B O   1 
HETATM 1510 O  O   . HOH F 3 .  ? 33.984 54.955 52.044 1.00 48.53 ? 187 HOH B O   1 
HETATM 1511 O  O   . HOH F 3 .  ? 46.880 74.240 65.633 1.00 29.38 ? 188 HOH B O   1 
HETATM 1512 O  O   . HOH F 3 .  ? 47.822 69.980 63.262 1.00 37.79 ? 189 HOH B O   1 
HETATM 1513 O  O   . HOH F 3 .  ? 41.818 67.873 37.412 1.00 34.31 ? 190 HOH B O   1 
HETATM 1514 O  O   . HOH F 3 .  ? 45.691 69.750 37.035 1.00 46.15 ? 191 HOH B O   1 
HETATM 1515 O  O   . HOH F 3 .  ? 51.948 62.067 44.174 1.00 48.10 ? 192 HOH B O   1 
HETATM 1516 O  O   . HOH F 3 .  ? 31.366 72.423 65.635 1.00 37.20 ? 193 HOH B O   1 
HETATM 1517 O  O   . HOH F 3 .  ? 39.613 74.602 43.541 1.00 38.87 ? 194 HOH B O   1 
HETATM 1518 O  O   . HOH F 3 .  ? 39.198 74.097 40.510 1.00 39.20 ? 195 HOH B O   1 
HETATM 1519 O  O   . HOH F 3 .  ? 45.598 80.228 54.885 1.00 45.35 ? 196 HOH B O   1 
HETATM 1520 O  O   . HOH F 3 .  ? 50.326 74.123 47.651 1.00 41.71 ? 197 HOH B O   1 
HETATM 1521 O  O   . HOH F 3 .  ? 39.667 80.835 59.684 1.00 51.74 ? 198 HOH B O   1 
HETATM 1522 O  O   . HOH F 3 .  ? 44.825 50.163 63.976 1.00 38.05 ? 199 HOH B O   1 
HETATM 1523 O  O   . HOH F 3 .  ? 55.468 67.898 44.873 1.00 43.29 ? 200 HOH B O   1 
HETATM 1524 O  O   . HOH F 3 .  ? 36.662 61.722 46.501 1.00 36.02 ? 201 HOH B O   1 
HETATM 1525 O  O   . HOH F 3 .  ? 52.435 51.239 59.101 1.00 39.39 ? 202 HOH B O   1 
HETATM 1526 O  O   . HOH F 3 .  ? 41.980 48.677 62.386 1.00 47.72 ? 203 HOH B O   1 
HETATM 1527 O  O   . HOH F 3 .  ? 58.266 47.851 48.555 1.00 44.58 ? 204 HOH B O   1 
HETATM 1528 O  O   . HOH F 3 .  ? 31.519 55.874 48.595 1.00 47.77 ? 205 HOH B O   1 
HETATM 1529 O  O   . HOH F 3 .  ? 31.703 52.140 69.538 1.00 43.51 ? 206 HOH B O   1 
HETATM 1530 O  O   . HOH F 3 .  ? 39.088 68.964 37.911 1.00 35.52 ? 207 HOH B O   1 
HETATM 1531 O  O   . HOH F 3 .  ? 36.954 74.761 53.420 1.00 37.15 ? 208 HOH B O   1 
HETATM 1532 O  O   . HOH F 3 .  ? 53.389 54.317 57.578 1.00 42.27 ? 209 HOH B O   1 
HETATM 1533 O  O   . HOH F 3 .  ? 55.385 50.131 50.508 1.00 47.70 ? 210 HOH B O   1 
HETATM 1534 O  O   . HOH F 3 .  ? 48.781 73.316 60.528 1.00 45.26 ? 211 HOH B O   1 
HETATM 1535 O  O   . HOH F 3 .  ? 41.429 55.282 37.870 1.00 45.06 ? 212 HOH B O   1 
HETATM 1536 O  O   . HOH F 3 .  ? 49.173 49.029 49.758 1.00 41.96 ? 213 HOH B O   1 
HETATM 1537 O  O   . HOH F 3 .  ? 34.082 56.138 62.189 1.00 37.86 ? 214 HOH B O   1 
HETATM 1538 O  O   . HOH F 3 .  ? 51.194 50.119 54.530 1.00 54.14 ? 215 HOH B O   1 
HETATM 1539 O  O   . HOH F 3 .  ? 46.011 65.501 65.558 1.00 45.00 ? 216 HOH B O   1 
HETATM 1540 O  O   . HOH F 3 .  ? 54.909 49.589 60.182 1.00 49.13 ? 217 HOH B O   1 
HETATM 1541 O  O   . HOH F 3 .  ? 58.718 45.980 50.765 1.00 44.51 ? 218 HOH B O   1 
HETATM 1542 O  O   . HOH F 3 .  ? 45.213 57.038 40.128 1.00 38.54 ? 219 HOH B O   1 
HETATM 1543 O  O   . HOH F 3 .  ? 44.600 64.387 63.808 1.00 35.07 ? 220 HOH B O   1 
HETATM 1544 O  O   . HOH F 3 .  ? 46.638 64.765 67.699 1.00 33.03 ? 221 HOH B O   1 
HETATM 1545 O  O   . HOH F 3 .  ? 57.558 66.342 64.743 1.00 41.41 ? 222 HOH B O   1 
HETATM 1546 O  O   . HOH F 3 .  ? 56.210 70.416 58.183 1.00 39.26 ? 223 HOH B O   1 
HETATM 1547 O  O   . HOH F 3 .  ? 57.316 52.474 49.859 1.00 47.22 ? 224 HOH B O   1 
HETATM 1548 O  O   . HOH F 3 .  ? 51.110 52.821 60.742 1.00 44.65 ? 225 HOH B O   1 
HETATM 1549 O  O   . HOH F 3 .  ? 48.609 50.583 61.177 1.00 46.38 ? 226 HOH B O   1 
HETATM 1550 O  O   . HOH F 3 .  ? 55.866 73.011 52.803 1.00 42.40 ? 227 HOH B O   1 
HETATM 1551 O  O   . HOH F 3 .  ? 49.727 73.509 57.035 1.00 44.64 ? 228 HOH B O   1 
HETATM 1552 O  O   . HOH F 3 .  ? 32.600 54.817 68.278 1.00 39.61 ? 229 HOH B O   1 
HETATM 1553 O  O   . HOH F 3 .  ? 43.993 76.365 63.621 1.00 36.16 ? 230 HOH B O   1 
HETATM 1554 O  O   . HOH F 3 .  ? 44.434 47.891 54.542 1.00 46.40 ? 231 HOH B O   1 
HETATM 1555 O  O   . HOH F 3 .  ? 57.439 60.813 61.408 1.00 38.46 ? 232 HOH B O   1 
HETATM 1556 O  O   . HOH F 3 .  ? 57.633 56.036 51.655 1.00 41.23 ? 233 HOH B O   1 
HETATM 1557 O  O   . HOH F 3 .  ? 58.073 67.163 44.523 1.00 44.34 ? 234 HOH B O   1 
HETATM 1558 O  O   . HOH F 3 .  ? 44.138 46.330 47.799 1.00 38.60 ? 235 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  30  ?   ?   ?   A . n 
A 1 2  SER 2  31  ?   ?   ?   A . n 
A 1 3  HIS 3  32  ?   ?   ?   A . n 
A 1 4  MET 4  33  ?   ?   ?   A . n 
A 1 5  LEU 5  34  ?   ?   ?   A . n 
A 1 6  GLU 6  35  ?   ?   ?   A . n 
A 1 7  GLN 7  36  ?   ?   ?   A . n 
A 1 8  LYS 8  37  ?   ?   ?   A . n 
A 1 9  LYS 9  38  ?   ?   ?   A . n 
A 1 10 ALA 10 39  39  ALA ALA A . n 
A 1 11 ASN 11 40  40  ASN ASN A . n 
A 1 12 ILE 12 41  41  ILE ILE A . n 
A 1 13 TYR 13 42  42  TYR TYR A . n 
A 1 14 LYS 14 43  43  LYS LYS A . n 
A 1 15 GLY 15 44  44  GLY GLY A . n 
A 1 16 LYS 16 45  45  LYS LYS A . n 
A 1 17 ILE 17 46  46  ILE ILE A . n 
A 1 18 THR 18 47  47  THR THR A . n 
A 1 19 ARG 19 48  48  ARG ARG A . n 
A 1 20 ILE 20 49  49  ILE ILE A . n 
A 1 21 GLU 21 50  50  GLU GLU A . n 
A 1 22 PRO 22 51  51  PRO PRO A . n 
A 1 23 SER 23 52  52  SER SER A . n 
A 1 24 LEU 24 53  53  LEU LEU A . n 
A 1 25 GLU 25 54  54  GLU GLU A . n 
A 1 26 ALA 26 55  55  ALA ALA A . n 
A 1 27 ALA 27 56  56  ALA ALA A . n 
A 1 28 PHE 28 57  57  PHE PHE A . n 
A 1 29 VAL 29 58  58  VAL VAL A . n 
A 1 30 ASP 30 59  59  ASP ASP A . n 
A 1 31 TYR 31 60  60  TYR TYR A . n 
A 1 32 GLY 32 61  61  GLY GLY A . n 
A 1 33 ALA 33 62  62  ALA ALA A . n 
A 1 34 GLU 34 63  63  GLU GLU A . n 
A 1 35 ARG 35 64  64  ARG ARG A . n 
A 1 36 HIS 36 65  65  HIS HIS A . n 
A 1 37 GLY 37 66  66  GLY GLY A . n 
A 1 38 PHE 38 67  67  PHE PHE A . n 
A 1 39 LEU 39 68  68  LEU LEU A . n 
A 1 40 PRO 40 69  69  PRO PRO A . n 
A 1 41 LEU 41 70  70  LEU LEU A . n 
A 1 42 LYS 42 71  71  LYS LYS A . n 
A 1 43 GLU 43 72  72  GLU GLU A . n 
A 1 44 ILE 44 73  73  ILE ILE A . n 
A 1 45 ALA 45 74  74  ALA ALA A . n 
A 1 46 ARG 46 75  75  ARG ARG A . n 
A 1 47 GLU 47 76  76  GLU GLU A . n 
A 1 48 TYR 48 77  77  TYR TYR A . n 
A 1 49 PHE 49 78  78  PHE PHE A . n 
A 1 50 PRO 50 79  79  PRO PRO A . n 
A 1 51 ALA 51 80  80  ALA ALA A . n 
A 1 52 ASN 52 81  81  ASN ASN A . n 
A 1 53 TYR 53 82  82  TYR TYR A . n 
A 1 54 SER 54 83  83  SER SER A . n 
A 1 55 ALA 55 84  84  ALA ALA A . n 
A 1 56 HIS 56 85  85  HIS HIS A . n 
A 1 57 GLY 57 86  86  GLY GLY A . n 
A 1 58 ARG 58 87  87  ARG ARG A . n 
A 1 59 PRO 59 88  88  PRO PRO A . n 
A 1 60 ASN 60 89  89  ASN ASN A . n 
A 1 61 ILE 61 90  90  ILE ILE A . n 
A 1 62 LYS 62 91  91  LYS LYS A . n 
A 1 63 ASP 63 92  92  ASP ASP A . n 
A 1 64 VAL 64 93  93  VAL VAL A . n 
A 1 65 LEU 65 94  94  LEU LEU A . n 
A 1 66 ARG 66 95  95  ARG ARG A . n 
A 1 67 GLU 67 96  96  GLU GLU A . n 
A 1 68 GLY 68 97  97  GLY GLY A . n 
A 1 69 GLN 69 98  98  GLN GLN A . n 
A 1 70 GLU 70 99  99  GLU GLU A . n 
A 1 71 VAL 71 100 100 VAL VAL A . n 
A 1 72 ILE 72 101 101 ILE ILE A . n 
A 1 73 VAL 73 102 102 VAL VAL A . n 
A 1 74 GLN 74 103 103 GLN GLN A . n 
A 1 75 ILE 75 104 104 ILE ILE A . n 
A 1 76 ASP 76 105 105 ASP ASP A . n 
A 1 77 LYS 77 106 106 LYS LYS A . n 
A 1 78 GLU 78 107 107 GLU GLU A . n 
A 1 79 GLU 79 108 108 GLU GLU A . n 
A 1 80 ARG 80 109 109 ARG ARG A . n 
A 1 81 GLY 81 110 110 GLY GLY A . n 
A 1 82 ASN 82 111 111 ASN ASN A . n 
A 1 83 LYS 83 112 112 LYS LYS A . n 
A 1 84 GLY 84 113 113 GLY GLY A . n 
A 1 85 ALA 85 114 114 ALA ALA A . n 
A 1 86 ALA 86 115 115 ALA ALA A . n 
A 1 87 LEU 87 116 116 LEU LEU A . n 
A 1 88 THR 88 117 117 THR THR A . n 
A 1 89 THR 89 118 118 THR THR A . n 
A 1 90 PHE 90 119 119 PHE PHE A . n 
A 1 91 ILE 91 120 120 ILE ILE A . n 
A 1 92 SER 92 121 121 SER SER A . n 
A 1 93 LEU 93 122 122 LEU LEU A . n 
A 1 94 ALA 94 123 123 ALA ALA A . n 
A 1 95 GLY 95 124 124 GLY GLY A . n 
A 1 96 SER 96 125 125 SER SER A . n 
B 1 1  GLY 1  30  ?   ?   ?   B . n 
B 1 2  SER 2  31  ?   ?   ?   B . n 
B 1 3  HIS 3  32  ?   ?   ?   B . n 
B 1 4  MET 4  33  ?   ?   ?   B . n 
B 1 5  LEU 5  34  ?   ?   ?   B . n 
B 1 6  GLU 6  35  ?   ?   ?   B . n 
B 1 7  GLN 7  36  ?   ?   ?   B . n 
B 1 8  LYS 8  37  ?   ?   ?   B . n 
B 1 9  LYS 9  38  ?   ?   ?   B . n 
B 1 10 ALA 10 39  39  ALA ALA B . n 
B 1 11 ASN 11 40  40  ASN ASN B . n 
B 1 12 ILE 12 41  41  ILE ILE B . n 
B 1 13 TYR 13 42  42  TYR TYR B . n 
B 1 14 LYS 14 43  43  LYS LYS B . n 
B 1 15 GLY 15 44  44  GLY GLY B . n 
B 1 16 LYS 16 45  45  LYS LYS B . n 
B 1 17 ILE 17 46  46  ILE ILE B . n 
B 1 18 THR 18 47  47  THR THR B . n 
B 1 19 ARG 19 48  48  ARG ARG B . n 
B 1 20 ILE 20 49  49  ILE ILE B . n 
B 1 21 GLU 21 50  50  GLU GLU B . n 
B 1 22 PRO 22 51  51  PRO PRO B . n 
B 1 23 SER 23 52  52  SER SER B . n 
B 1 24 LEU 24 53  53  LEU LEU B . n 
B 1 25 GLU 25 54  54  GLU GLU B . n 
B 1 26 ALA 26 55  55  ALA ALA B . n 
B 1 27 ALA 27 56  56  ALA ALA B . n 
B 1 28 PHE 28 57  57  PHE PHE B . n 
B 1 29 VAL 29 58  58  VAL VAL B . n 
B 1 30 ASP 30 59  59  ASP ASP B . n 
B 1 31 TYR 31 60  60  TYR TYR B . n 
B 1 32 GLY 32 61  61  GLY GLY B . n 
B 1 33 ALA 33 62  62  ALA ALA B . n 
B 1 34 GLU 34 63  63  GLU GLU B . n 
B 1 35 ARG 35 64  64  ARG ARG B . n 
B 1 36 HIS 36 65  65  HIS HIS B . n 
B 1 37 GLY 37 66  66  GLY GLY B . n 
B 1 38 PHE 38 67  67  PHE PHE B . n 
B 1 39 LEU 39 68  68  LEU LEU B . n 
B 1 40 PRO 40 69  69  PRO PRO B . n 
B 1 41 LEU 41 70  70  LEU LEU B . n 
B 1 42 LYS 42 71  71  LYS LYS B . n 
B 1 43 GLU 43 72  72  GLU GLU B . n 
B 1 44 ILE 44 73  73  ILE ILE B . n 
B 1 45 ALA 45 74  74  ALA ALA B . n 
B 1 46 ARG 46 75  75  ARG ARG B . n 
B 1 47 GLU 47 76  76  GLU GLU B . n 
B 1 48 TYR 48 77  77  TYR TYR B . n 
B 1 49 PHE 49 78  78  PHE PHE B . n 
B 1 50 PRO 50 79  79  PRO PRO B . n 
B 1 51 ALA 51 80  80  ALA ALA B . n 
B 1 52 ASN 52 81  ?   ?   ?   B . n 
B 1 53 TYR 53 82  ?   ?   ?   B . n 
B 1 54 SER 54 83  ?   ?   ?   B . n 
B 1 55 ALA 55 84  ?   ?   ?   B . n 
B 1 56 HIS 56 85  ?   ?   ?   B . n 
B 1 57 GLY 57 86  ?   ?   ?   B . n 
B 1 58 ARG 58 87  ?   ?   ?   B . n 
B 1 59 PRO 59 88  88  PRO PRO B . n 
B 1 60 ASN 60 89  89  ASN ASN B . n 
B 1 61 ILE 61 90  90  ILE ILE B . n 
B 1 62 LYS 62 91  91  LYS LYS B . n 
B 1 63 ASP 63 92  92  ASP ASP B . n 
B 1 64 VAL 64 93  93  VAL VAL B . n 
B 1 65 LEU 65 94  94  LEU LEU B . n 
B 1 66 ARG 66 95  95  ARG ARG B . n 
B 1 67 GLU 67 96  96  GLU GLU B . n 
B 1 68 GLY 68 97  97  GLY GLY B . n 
B 1 69 GLN 69 98  98  GLN GLN B . n 
B 1 70 GLU 70 99  99  GLU GLU B . n 
B 1 71 VAL 71 100 100 VAL VAL B . n 
B 1 72 ILE 72 101 101 ILE ILE B . n 
B 1 73 VAL 73 102 102 VAL VAL B . n 
B 1 74 GLN 74 103 103 GLN GLN B . n 
B 1 75 ILE 75 104 104 ILE ILE B . n 
B 1 76 ASP 76 105 105 ASP ASP B . n 
B 1 77 LYS 77 106 106 LYS LYS B . n 
B 1 78 GLU 78 107 107 GLU GLU B . n 
B 1 79 GLU 79 108 108 GLU GLU B . n 
B 1 80 ARG 80 109 109 ARG ARG B . n 
B 1 81 GLY 81 110 110 GLY GLY B . n 
B 1 82 ASN 82 111 111 ASN ASN B . n 
B 1 83 LYS 83 112 112 LYS LYS B . n 
B 1 84 GLY 84 113 113 GLY GLY B . n 
B 1 85 ALA 85 114 114 ALA ALA B . n 
B 1 86 ALA 86 115 115 ALA ALA B . n 
B 1 87 LEU 87 116 116 LEU LEU B . n 
B 1 88 THR 88 117 117 THR THR B . n 
B 1 89 THR 89 118 118 THR THR B . n 
B 1 90 PHE 90 119 119 PHE PHE B . n 
B 1 91 ILE 91 120 120 ILE ILE B . n 
B 1 92 SER 92 121 121 SER SER B . n 
B 1 93 LEU 93 122 122 LEU LEU B . n 
B 1 94 ALA 94 123 123 ALA ALA B . n 
B 1 95 GLY 95 124 124 GLY GLY B . n 
B 1 96 SER 96 125 125 SER SER B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 PB  1   604 604 PB  PB  A . 
D 2 PB  1   605 605 PB  PB  A . 
E 3 HOH 1   606 4   HOH HOH A . 
E 3 HOH 2   607 5   HOH HOH A . 
E 3 HOH 3   608 7   HOH HOH A . 
E 3 HOH 4   609 8   HOH HOH A . 
E 3 HOH 5   610 10  HOH HOH A . 
E 3 HOH 6   611 11  HOH HOH A . 
E 3 HOH 7   612 12  HOH HOH A . 
E 3 HOH 8   613 13  HOH HOH A . 
E 3 HOH 9   614 14  HOH HOH A . 
E 3 HOH 10  615 15  HOH HOH A . 
E 3 HOH 11  616 17  HOH HOH A . 
E 3 HOH 12  617 20  HOH HOH A . 
E 3 HOH 13  618 21  HOH HOH A . 
E 3 HOH 14  619 22  HOH HOH A . 
E 3 HOH 15  620 23  HOH HOH A . 
E 3 HOH 16  621 24  HOH HOH A . 
E 3 HOH 17  622 27  HOH HOH A . 
E 3 HOH 18  623 28  HOH HOH A . 
E 3 HOH 19  624 29  HOH HOH A . 
E 3 HOH 20  625 35  HOH HOH A . 
E 3 HOH 21  626 36  HOH HOH A . 
E 3 HOH 22  627 37  HOH HOH A . 
E 3 HOH 23  628 38  HOH HOH A . 
E 3 HOH 24  629 39  HOH HOH A . 
E 3 HOH 25  630 40  HOH HOH A . 
E 3 HOH 26  631 41  HOH HOH A . 
E 3 HOH 27  632 44  HOH HOH A . 
E 3 HOH 28  633 45  HOH HOH A . 
E 3 HOH 29  634 46  HOH HOH A . 
E 3 HOH 30  635 50  HOH HOH A . 
E 3 HOH 31  636 51  HOH HOH A . 
E 3 HOH 32  637 52  HOH HOH A . 
E 3 HOH 33  638 53  HOH HOH A . 
E 3 HOH 34  639 54  HOH HOH A . 
E 3 HOH 35  640 55  HOH HOH A . 
E 3 HOH 36  641 56  HOH HOH A . 
E 3 HOH 37  642 60  HOH HOH A . 
E 3 HOH 38  643 62  HOH HOH A . 
E 3 HOH 39  644 64  HOH HOH A . 
E 3 HOH 40  645 65  HOH HOH A . 
E 3 HOH 41  646 68  HOH HOH A . 
E 3 HOH 42  647 69  HOH HOH A . 
E 3 HOH 43  648 70  HOH HOH A . 
E 3 HOH 44  649 72  HOH HOH A . 
E 3 HOH 45  650 78  HOH HOH A . 
E 3 HOH 46  651 79  HOH HOH A . 
E 3 HOH 47  652 80  HOH HOH A . 
E 3 HOH 48  653 81  HOH HOH A . 
E 3 HOH 49  654 83  HOH HOH A . 
E 3 HOH 50  655 84  HOH HOH A . 
E 3 HOH 51  656 85  HOH HOH A . 
E 3 HOH 52  657 86  HOH HOH A . 
E 3 HOH 53  658 87  HOH HOH A . 
E 3 HOH 54  659 92  HOH HOH A . 
E 3 HOH 55  660 94  HOH HOH A . 
E 3 HOH 56  661 95  HOH HOH A . 
E 3 HOH 57  662 96  HOH HOH A . 
E 3 HOH 58  663 97  HOH HOH A . 
E 3 HOH 59  664 98  HOH HOH A . 
E 3 HOH 60  665 99  HOH HOH A . 
E 3 HOH 61  666 100 HOH HOH A . 
E 3 HOH 62  667 101 HOH HOH A . 
E 3 HOH 63  668 102 HOH HOH A . 
E 3 HOH 64  669 103 HOH HOH A . 
E 3 HOH 65  670 104 HOH HOH A . 
E 3 HOH 66  671 105 HOH HOH A . 
E 3 HOH 67  672 110 HOH HOH A . 
E 3 HOH 68  673 111 HOH HOH A . 
E 3 HOH 69  674 112 HOH HOH A . 
E 3 HOH 70  675 114 HOH HOH A . 
E 3 HOH 71  676 116 HOH HOH A . 
E 3 HOH 72  677 117 HOH HOH A . 
E 3 HOH 73  678 120 HOH HOH A . 
E 3 HOH 74  679 121 HOH HOH A . 
E 3 HOH 75  680 122 HOH HOH A . 
E 3 HOH 76  681 136 HOH HOH A . 
E 3 HOH 77  682 138 HOH HOH A . 
E 3 HOH 78  683 139 HOH HOH A . 
E 3 HOH 79  684 140 HOH HOH A . 
E 3 HOH 80  685 141 HOH HOH A . 
E 3 HOH 81  686 142 HOH HOH A . 
E 3 HOH 82  687 143 HOH HOH A . 
E 3 HOH 83  688 144 HOH HOH A . 
E 3 HOH 84  689 145 HOH HOH A . 
E 3 HOH 85  690 156 HOH HOH A . 
E 3 HOH 86  691 158 HOH HOH A . 
E 3 HOH 87  692 162 HOH HOH A . 
E 3 HOH 88  693 163 HOH HOH A . 
E 3 HOH 89  694 164 HOH HOH A . 
E 3 HOH 90  695 165 HOH HOH A . 
E 3 HOH 91  696 167 HOH HOH A . 
E 3 HOH 92  697 169 HOH HOH A . 
E 3 HOH 93  698 171 HOH HOH A . 
E 3 HOH 94  699 174 HOH HOH A . 
E 3 HOH 95  700 175 HOH HOH A . 
E 3 HOH 96  701 178 HOH HOH A . 
E 3 HOH 97  702 180 HOH HOH A . 
E 3 HOH 98  703 188 HOH HOH A . 
E 3 HOH 99  704 190 HOH HOH A . 
E 3 HOH 100 705 192 HOH HOH A . 
E 3 HOH 101 706 193 HOH HOH A . 
E 3 HOH 102 707 197 HOH HOH A . 
E 3 HOH 103 708 198 HOH HOH A . 
E 3 HOH 104 709 199 HOH HOH A . 
E 3 HOH 105 710 200 HOH HOH A . 
E 3 HOH 106 711 202 HOH HOH A . 
E 3 HOH 107 712 204 HOH HOH A . 
E 3 HOH 108 713 206 HOH HOH A . 
E 3 HOH 109 714 208 HOH HOH A . 
E 3 HOH 110 715 209 HOH HOH A . 
E 3 HOH 111 716 212 HOH HOH A . 
E 3 HOH 112 717 217 HOH HOH A . 
E 3 HOH 113 718 219 HOH HOH A . 
E 3 HOH 114 719 220 HOH HOH A . 
E 3 HOH 115 720 224 HOH HOH A . 
E 3 HOH 116 721 225 HOH HOH A . 
E 3 HOH 117 722 226 HOH HOH A . 
E 3 HOH 118 723 227 HOH HOH A . 
E 3 HOH 119 724 229 HOH HOH A . 
F 3 HOH 1   126 1   HOH HOH B . 
F 3 HOH 2   127 2   HOH HOH B . 
F 3 HOH 3   128 3   HOH HOH B . 
F 3 HOH 4   129 6   HOH HOH B . 
F 3 HOH 5   130 9   HOH HOH B . 
F 3 HOH 6   131 16  HOH HOH B . 
F 3 HOH 7   132 18  HOH HOH B . 
F 3 HOH 8   133 19  HOH HOH B . 
F 3 HOH 9   134 25  HOH HOH B . 
F 3 HOH 10  135 26  HOH HOH B . 
F 3 HOH 11  136 30  HOH HOH B . 
F 3 HOH 12  137 31  HOH HOH B . 
F 3 HOH 13  138 32  HOH HOH B . 
F 3 HOH 14  139 33  HOH HOH B . 
F 3 HOH 15  140 34  HOH HOH B . 
F 3 HOH 16  141 42  HOH HOH B . 
F 3 HOH 17  142 43  HOH HOH B . 
F 3 HOH 18  143 47  HOH HOH B . 
F 3 HOH 19  144 48  HOH HOH B . 
F 3 HOH 20  145 49  HOH HOH B . 
F 3 HOH 21  146 57  HOH HOH B . 
F 3 HOH 22  147 58  HOH HOH B . 
F 3 HOH 23  148 59  HOH HOH B . 
F 3 HOH 24  149 61  HOH HOH B . 
F 3 HOH 25  150 63  HOH HOH B . 
F 3 HOH 26  151 66  HOH HOH B . 
F 3 HOH 27  152 67  HOH HOH B . 
F 3 HOH 28  153 71  HOH HOH B . 
F 3 HOH 29  154 73  HOH HOH B . 
F 3 HOH 30  155 74  HOH HOH B . 
F 3 HOH 31  156 75  HOH HOH B . 
F 3 HOH 32  157 76  HOH HOH B . 
F 3 HOH 33  158 77  HOH HOH B . 
F 3 HOH 34  159 82  HOH HOH B . 
F 3 HOH 35  160 88  HOH HOH B . 
F 3 HOH 36  161 89  HOH HOH B . 
F 3 HOH 37  162 90  HOH HOH B . 
F 3 HOH 38  163 91  HOH HOH B . 
F 3 HOH 39  164 93  HOH HOH B . 
F 3 HOH 40  165 106 HOH HOH B . 
F 3 HOH 41  166 107 HOH HOH B . 
F 3 HOH 42  167 108 HOH HOH B . 
F 3 HOH 43  168 109 HOH HOH B . 
F 3 HOH 44  169 113 HOH HOH B . 
F 3 HOH 45  170 115 HOH HOH B . 
F 3 HOH 46  171 118 HOH HOH B . 
F 3 HOH 47  172 119 HOH HOH B . 
F 3 HOH 48  173 123 HOH HOH B . 
F 3 HOH 49  174 124 HOH HOH B . 
F 3 HOH 50  175 125 HOH HOH B . 
F 3 HOH 51  176 126 HOH HOH B . 
F 3 HOH 52  177 127 HOH HOH B . 
F 3 HOH 53  178 128 HOH HOH B . 
F 3 HOH 54  179 129 HOH HOH B . 
F 3 HOH 55  180 130 HOH HOH B . 
F 3 HOH 56  181 131 HOH HOH B . 
F 3 HOH 57  182 132 HOH HOH B . 
F 3 HOH 58  183 133 HOH HOH B . 
F 3 HOH 59  184 134 HOH HOH B . 
F 3 HOH 60  185 135 HOH HOH B . 
F 3 HOH 61  186 137 HOH HOH B . 
F 3 HOH 62  187 146 HOH HOH B . 
F 3 HOH 63  188 147 HOH HOH B . 
F 3 HOH 64  189 148 HOH HOH B . 
F 3 HOH 65  190 149 HOH HOH B . 
F 3 HOH 66  191 150 HOH HOH B . 
F 3 HOH 67  192 151 HOH HOH B . 
F 3 HOH 68  193 152 HOH HOH B . 
F 3 HOH 69  194 153 HOH HOH B . 
F 3 HOH 70  195 154 HOH HOH B . 
F 3 HOH 71  196 155 HOH HOH B . 
F 3 HOH 72  197 157 HOH HOH B . 
F 3 HOH 73  198 159 HOH HOH B . 
F 3 HOH 74  199 160 HOH HOH B . 
F 3 HOH 75  200 161 HOH HOH B . 
F 3 HOH 76  201 166 HOH HOH B . 
F 3 HOH 77  202 168 HOH HOH B . 
F 3 HOH 78  203 170 HOH HOH B . 
F 3 HOH 79  204 172 HOH HOH B . 
F 3 HOH 80  205 173 HOH HOH B . 
F 3 HOH 81  206 176 HOH HOH B . 
F 3 HOH 82  207 177 HOH HOH B . 
F 3 HOH 83  208 179 HOH HOH B . 
F 3 HOH 84  209 181 HOH HOH B . 
F 3 HOH 85  210 182 HOH HOH B . 
F 3 HOH 86  211 183 HOH HOH B . 
F 3 HOH 87  212 184 HOH HOH B . 
F 3 HOH 88  213 185 HOH HOH B . 
F 3 HOH 89  214 186 HOH HOH B . 
F 3 HOH 90  215 187 HOH HOH B . 
F 3 HOH 91  216 189 HOH HOH B . 
F 3 HOH 92  217 191 HOH HOH B . 
F 3 HOH 93  218 194 HOH HOH B . 
F 3 HOH 94  219 195 HOH HOH B . 
F 3 HOH 95  220 196 HOH HOH B . 
F 3 HOH 96  221 201 HOH HOH B . 
F 3 HOH 97  222 203 HOH HOH B . 
F 3 HOH 98  223 205 HOH HOH B . 
F 3 HOH 99  224 207 HOH HOH B . 
F 3 HOH 100 225 210 HOH HOH B . 
F 3 HOH 101 226 211 HOH HOH B . 
F 3 HOH 102 227 213 HOH HOH B . 
F 3 HOH 103 228 214 HOH HOH B . 
F 3 HOH 104 229 215 HOH HOH B . 
F 3 HOH 105 230 216 HOH HOH B . 
F 3 HOH 106 231 218 HOH HOH B . 
F 3 HOH 107 232 221 HOH HOH B . 
F 3 HOH 108 233 222 HOH HOH B . 
F 3 HOH 109 234 223 HOH HOH B . 
F 3 HOH 110 235 228 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 NE2 ? A HIS 56 ? A HIS 85  ? 1_555 PB ? C PB . ? A PB 604 ? 1_555 O   ? F HOH .  ? B HOH 216 ? 3_655 142.8 ? 
2 NE2 ? A HIS 56 ? A HIS 85  ? 1_555 PB ? C PB . ? A PB 604 ? 1_555 O   ? F HOH .  ? B HOH 221 ? 3_655 174.5 ? 
3 O   ? F HOH .  ? B HOH 216 ? 3_655 PB ? C PB . ? A PB 604 ? 1_555 O   ? F HOH .  ? B HOH 221 ? 3_655 42.7  ? 
4 OE2 ? A GLU 43 ? A GLU 72  ? 1_555 PB ? D PB . ? A PB 605 ? 1_555 O   ? E HOH .  ? A HOH 724 ? 1_555 129.4 ? 
5 OE2 ? A GLU 43 ? A GLU 72  ? 1_555 PB ? D PB . ? A PB 605 ? 1_555 OE1 ? A GLU 43 ? A GLU 72  ? 1_555 48.9  ? 
6 O   ? E HOH .  ? A HOH 724 ? 1_555 PB ? D PB . ? A PB 605 ? 1_555 OE1 ? A GLU 43 ? A GLU 72  ? 1_555 116.4 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-08-17 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.1.24 ? 1 
DENZO     'data reduction' .      ? 2 
SCALEPACK 'data scaling'   .      ? 3 
SOLVE     phasing          .      ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NZ A LYS 106 ? ? O A HOH 689 ? ? 2.10 
2 1 CE A LYS 106 ? ? O A HOH 689 ? ? 2.16 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 NE A ARG 95  ? ? CZ A ARG 95  ? ? 1.204 1.326 -0.122 0.013 N 
2 1 NE A ARG 109 ? ? CZ A ARG 109 ? ? 1.498 1.326 0.172  0.013 N 
3 1 CD B LYS 91  ? ? CE B LYS 91  ? ? 1.335 1.508 -0.173 0.025 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 92  ? ? CG A ASP 92  ? ? OD2 A ASP 92  ? ? 124.74 118.30 6.44   0.90 N 
2 1 CD A ARG 95  ? ? NE A ARG 95  ? ? CZ  A ARG 95  ? ? 110.52 123.60 -13.08 1.40 N 
3 1 NE A ARG 95  ? ? CZ A ARG 95  ? ? NH1 A ARG 95  ? ? 126.00 120.30 5.70   0.50 N 
4 1 NE A ARG 95  ? ? CZ A ARG 95  ? ? NH2 A ARG 95  ? ? 114.24 120.30 -6.06  0.50 N 
5 1 CD A ARG 109 ? ? NE A ARG 109 ? ? CZ  A ARG 109 ? ? 111.14 123.60 -12.46 1.40 N 
6 1 NE A ARG 109 ? ? CZ A ARG 109 ? ? NH1 A ARG 109 ? ? 114.74 120.30 -5.56  0.50 N 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ARG 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     109 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.133 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 A GLU 63  ? CG  ? A GLU 34 CG  
2  1 Y 0 A GLU 63  ? CD  ? A GLU 34 CD  
3  1 Y 0 A GLU 63  ? OE1 ? A GLU 34 OE1 
4  1 Y 0 A GLU 63  ? OE2 ? A GLU 34 OE2 
5  1 Y 0 A LYS 91  ? CE  ? A LYS 62 CE  
6  1 Y 0 A LYS 91  ? NZ  ? A LYS 62 NZ  
7  1 Y 0 A ARG 95  ? CZ  ? A ARG 66 CZ  
8  1 Y 0 A ARG 95  ? NH1 ? A ARG 66 NH1 
9  1 Y 0 A ARG 95  ? NH2 ? A ARG 66 NH2 
10 1 Y 0 A LYS 106 ? CE  ? A LYS 77 CE  
11 1 Y 0 A LYS 106 ? NZ  ? A LYS 77 NZ  
12 1 Y 0 A ARG 109 ? CZ  ? A ARG 80 CZ  
13 1 Y 0 A ARG 109 ? NH1 ? A ARG 80 NH1 
14 1 Y 0 A ARG 109 ? NH2 ? A ARG 80 NH2 
15 1 Y 0 B LYS 91  ? CE  ? B LYS 62 CE  
16 1 Y 0 B LYS 91  ? NZ  ? B LYS 62 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 30 ? A GLY 1  
2  1 Y 1 A SER 31 ? A SER 2  
3  1 Y 1 A HIS 32 ? A HIS 3  
4  1 Y 1 A MET 33 ? A MET 4  
5  1 Y 1 A LEU 34 ? A LEU 5  
6  1 Y 1 A GLU 35 ? A GLU 6  
7  1 Y 1 A GLN 36 ? A GLN 7  
8  1 Y 1 A LYS 37 ? A LYS 8  
9  1 Y 1 A LYS 38 ? A LYS 9  
10 1 Y 1 B GLY 30 ? B GLY 1  
11 1 Y 1 B SER 31 ? B SER 2  
12 1 Y 1 B HIS 32 ? B HIS 3  
13 1 Y 1 B MET 33 ? B MET 4  
14 1 Y 1 B LEU 34 ? B LEU 5  
15 1 Y 1 B GLU 35 ? B GLU 6  
16 1 Y 1 B GLN 36 ? B GLN 7  
17 1 Y 1 B LYS 37 ? B LYS 8  
18 1 Y 1 B LYS 38 ? B LYS 9  
19 1 Y 1 B ASN 81 ? B ASN 52 
20 1 Y 1 B TYR 82 ? B TYR 53 
21 1 Y 1 B SER 83 ? B SER 54 
22 1 Y 1 B ALA 84 ? B ALA 55 
23 1 Y 1 B HIS 85 ? B HIS 56 
24 1 Y 1 B GLY 86 ? B GLY 57 
25 1 Y 1 B ARG 87 ? B ARG 58 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'LEAD (II) ION' PB  
3 water           HOH 
#