data_1SOA
# 
_entry.id   1SOA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SOA         
RCSB  RCSB021872   
WWPDB D_1000021872 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1p5f 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SOA 
_pdbx_database_status.recvd_initial_deposition_date   2004-03-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Canet-Aviles, R.'  1  
'Wilson, M.A.'      2  
'Miller, D.W.'      3  
'Ahmad, R.'         4  
'McLendon, C.'      5  
'Bandyopadhyay, S.' 6  
'Baptista, M.J.'    7  
'Ringe, D.'         8  
'Petsko, G.A.'      9  
'Cookson, M.R.'     10 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;The Parkinson's disease protein DJ-1 is neuroprotective due to cysteine-sulfinic acid-driven mitochondrial localization.
;
Proc.Natl.Acad.Sci.USA 101 9103 9108 2004 PNASA6 US 0027-8424 0040 ? 15181200 10.1073/pnas.0308089100 
1       
;The 1.1-A resolution crystal   
structure of DJ-1, the protein   
mutated in autosomal recessive,    
early onset Parkinson's disease
;
Proc.Natl.Acad.Sci.USA 100 9256 9261 2003 PNASA6 US 0027-8424 0040 ? ?        10.1073/pnas.1133288100 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wilson, M.A.'      1  
primary 'Miller, D.W.'      2  
primary 'Ahmad, R.'         3  
primary 'McLendon, C.'      4  
primary 'Bandyopadhyay, S.' 5  
primary 'Baptista, M.J.'    6  
primary 'Ringe, D.'         7  
primary 'Petsko, G.A.'      8  
primary 'Cookson, M.R.'     9  
1       'Wilson, M.A.'      10 
1       'Collins, J.L.'     11 
1       'Hod, Y.'           12 
1       'Ringe, D.'         13 
1       'Petsko, G.A.'      14 
# 
_cell.entry_id           1SOA 
_cell.length_a           75.130 
_cell.length_b           75.130 
_cell.length_c           75.094 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SOA 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'RNA-binding protein regulatory subunit; oncogene DJ1' 19949.051 1   ? ? ? ? 
2 water   nat water                                                  18.015    268 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQ
NLSESAAVKEILKEQENRKGLIAAI(CSD)AGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSR
GPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQ
NLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGT
SFEFALAIVEALNGKEVAAQVKAPLVLKD
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   SER n 
1 4   LYS n 
1 5   ARG n 
1 6   ALA n 
1 7   LEU n 
1 8   VAL n 
1 9   ILE n 
1 10  LEU n 
1 11  ALA n 
1 12  LYS n 
1 13  GLY n 
1 14  ALA n 
1 15  GLU n 
1 16  GLU n 
1 17  MET n 
1 18  GLU n 
1 19  THR n 
1 20  VAL n 
1 21  ILE n 
1 22  PRO n 
1 23  VAL n 
1 24  ASP n 
1 25  VAL n 
1 26  MET n 
1 27  ARG n 
1 28  ARG n 
1 29  ALA n 
1 30  GLY n 
1 31  ILE n 
1 32  LYS n 
1 33  VAL n 
1 34  THR n 
1 35  VAL n 
1 36  ALA n 
1 37  GLY n 
1 38  LEU n 
1 39  ALA n 
1 40  GLY n 
1 41  LYS n 
1 42  ASP n 
1 43  PRO n 
1 44  VAL n 
1 45  GLN n 
1 46  CYS n 
1 47  SER n 
1 48  ARG n 
1 49  ASP n 
1 50  VAL n 
1 51  VAL n 
1 52  ILE n 
1 53  CYS n 
1 54  PRO n 
1 55  ASP n 
1 56  ALA n 
1 57  SER n 
1 58  LEU n 
1 59  GLU n 
1 60  ASP n 
1 61  ALA n 
1 62  LYS n 
1 63  LYS n 
1 64  GLU n 
1 65  GLY n 
1 66  PRO n 
1 67  TYR n 
1 68  ASP n 
1 69  VAL n 
1 70  VAL n 
1 71  VAL n 
1 72  LEU n 
1 73  PRO n 
1 74  GLY n 
1 75  GLY n 
1 76  ASN n 
1 77  LEU n 
1 78  GLY n 
1 79  ALA n 
1 80  GLN n 
1 81  ASN n 
1 82  LEU n 
1 83  SER n 
1 84  GLU n 
1 85  SER n 
1 86  ALA n 
1 87  ALA n 
1 88  VAL n 
1 89  LYS n 
1 90  GLU n 
1 91  ILE n 
1 92  LEU n 
1 93  LYS n 
1 94  GLU n 
1 95  GLN n 
1 96  GLU n 
1 97  ASN n 
1 98  ARG n 
1 99  LYS n 
1 100 GLY n 
1 101 LEU n 
1 102 ILE n 
1 103 ALA n 
1 104 ALA n 
1 105 ILE n 
1 106 CSD n 
1 107 ALA n 
1 108 GLY n 
1 109 PRO n 
1 110 THR n 
1 111 ALA n 
1 112 LEU n 
1 113 LEU n 
1 114 ALA n 
1 115 HIS n 
1 116 GLU n 
1 117 ILE n 
1 118 GLY n 
1 119 PHE n 
1 120 GLY n 
1 121 SER n 
1 122 LYS n 
1 123 VAL n 
1 124 THR n 
1 125 THR n 
1 126 HIS n 
1 127 PRO n 
1 128 LEU n 
1 129 ALA n 
1 130 LYS n 
1 131 ASP n 
1 132 LYS n 
1 133 MET n 
1 134 MET n 
1 135 ASN n 
1 136 GLY n 
1 137 GLY n 
1 138 HIS n 
1 139 TYR n 
1 140 THR n 
1 141 TYR n 
1 142 SER n 
1 143 GLU n 
1 144 ASN n 
1 145 ARG n 
1 146 VAL n 
1 147 GLU n 
1 148 LYS n 
1 149 ASP n 
1 150 GLY n 
1 151 LEU n 
1 152 ILE n 
1 153 LEU n 
1 154 THR n 
1 155 SER n 
1 156 ARG n 
1 157 GLY n 
1 158 PRO n 
1 159 GLY n 
1 160 THR n 
1 161 SER n 
1 162 PHE n 
1 163 GLU n 
1 164 PHE n 
1 165 ALA n 
1 166 LEU n 
1 167 ALA n 
1 168 ILE n 
1 169 VAL n 
1 170 GLU n 
1 171 ALA n 
1 172 LEU n 
1 173 ASN n 
1 174 GLY n 
1 175 LYS n 
1 176 GLU n 
1 177 VAL n 
1 178 ALA n 
1 179 ALA n 
1 180 GLN n 
1 181 VAL n 
1 182 LYS n 
1 183 ALA n 
1 184 PRO n 
1 185 LEU n 
1 186 VAL n 
1 187 LEU n 
1 188 LYS n 
1 189 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PARK7_HUMAN 
_struct_ref.pdbx_db_accession          Q99497 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQ
NLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGT
SFEFALAIVEALNGKEVAAQVKAPLVLKD
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1SOA 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 189 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q99497 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  189 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       189 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1SOA 
_struct_ref_seq_dif.mon_id                       CSD 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      106 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q99497 
_struct_ref_seq_dif.db_mon_id                    CYS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          106 
_struct_ref_seq_dif.details                      'MODIFIED RESIDUE' 
_struct_ref_seq_dif.pdbx_auth_seq_num            106 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ?                                            'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ?                                            'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ?                                            'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ?                                            'C4 H7 N O4'     133.103 
CSD 'L-peptide linking' n 3-SULFINOALANINE 'S-CYSTEINESULFINIC ACID; S-SULFINOCYSTEINE' 'C3 H7 N O4 S'   153.157 
CYS 'L-peptide linking' y CYSTEINE         ?                                            'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ?                                            'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ?                                            'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ?                                            'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ?                                            'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ?                                            'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ?                                            'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ?                                            'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ?                                            'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ?                                            'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE    ?                                            'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ?                                            'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ?                                            'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ?                                            'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE         ?                                            'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ?                                            'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1SOA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   57.17 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      2.89 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'peg 400, sodium citrate, tris-HCl, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2003-10-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double crystal Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.83 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.2.1' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.2.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.83 
# 
_reflns.entry_id                     1SOA 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             65 
_reflns.d_resolution_high            1.2 
_reflns.number_obs                   76594 
_reflns.number_all                   76593 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.085 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        20.4 
_reflns.B_iso_Wilson_estimate        7.8 
_reflns.pdbx_redundancy              6.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.20 
_reflns_shell.d_res_low              1.24 
_reflns_shell.percent_possible_all   99.0 
_reflns_shell.Rmerge_I_obs           0.408 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.04 
_reflns_shell.pdbx_redundancy        5.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      7517 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1SOA 
_refine.ls_number_reflns_obs                     76593 
_refine.ls_number_reflns_all                     76593 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             65.00 
_refine.ls_d_res_high                            1.20 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_R_factor_obs                          0.113 
_refine.ls_R_factor_all                          0.115 
_refine.ls_R_factor_R_work                       0.113 
_refine.ls_R_factor_R_free                       0.1407 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 11.2 
_refine.ls_number_reflns_R_free                  7731 
_refine.ls_number_parameters                     16022 
_refine.ls_number_restraints                     20876 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    BABINET 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1p5f 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH AND HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1376 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             268 
_refine_hist.number_atoms_total               1644 
_refine_hist.d_res_high                       1.20 
_refine_hist.d_res_low                        65.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.014  ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.030  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.000  ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.0287 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.076  ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.086  ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.025  ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.005  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.049  ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      0.105  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1SOA 
_pdbx_refine.R_factor_all_no_cutoff                      0.1128 
_pdbx_refine.R_factor_obs_no_cutoff                      0.113 
_pdbx_refine.free_R_factor_no_cutoff                     0.1407 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     11.2 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            7731 
_pdbx_refine.R_factor_all_4sig_cutoff                    0.1011 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.1013 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.1285 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   11.3 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          6659 
_pdbx_refine.number_reflns_obs_4sig_cutoff               58985 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1SOA 
_struct.title                     'Human DJ-1 with sulfinic acid' 
_struct.pdbx_descriptor           'RNA-binding protein regulatory subunit; oncogene DJ1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SOA 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
;Parkinson's disease, DJ-1/ThiJ/pfpI familiy, PROTEIN BINDING
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;The second part of the biological assembly is generated 
by the symmetry operator:  Y,X,-Z+1
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 15  ? ALA A 29  ? GLU A 15  ALA A 29  1 ? 15 
HELX_P HELX_P2  2  LEU A 58  ? GLU A 64  ? LEU A 58  GLU A 64  1 ? 7  
HELX_P HELX_P3  3  GLY A 75  ? SER A 85  ? GLY A 75  SER A 85  1 ? 11 
HELX_P HELX_P4  4  SER A 85  ? ARG A 98  ? SER A 85  ARG A 98  1 ? 14 
HELX_P HELX_P5  5  GLY A 108 ? HIS A 115 ? GLY A 108 HIS A 115 1 ? 8  
HELX_P HELX_P6  6  HIS A 126 ? LEU A 128 ? HIS A 126 LEU A 128 5 ? 3  
HELX_P HELX_P7  7  ALA A 129 ? MET A 134 ? ALA A 129 MET A 134 1 ? 6  
HELX_P HELX_P8  8  GLY A 157 ? GLY A 159 ? GLY A 157 GLY A 159 5 ? 3  
HELX_P HELX_P9  9  THR A 160 ? GLY A 174 ? THR A 160 GLY A 174 1 ? 15 
HELX_P HELX_P10 10 GLY A 174 ? ALA A 183 ? GLY A 174 ALA A 183 1 ? 10 
HELX_P HELX_P11 11 PRO A 184 ? VAL A 186 ? PRO A 184 VAL A 186 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A ILE 105 C ? ? ? 1_555 A CSD 106 N ? ? A ILE 105 A CSD 106 1_555 ? ? ? ? ? ? ? 1.360 ? 
covale2 covale ? ? A CSD 106 C ? ? ? 1_555 A ALA 107 N ? ? A CSD 106 A ALA 107 1_555 ? ? ? ? ? ? ? 1.337 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           65 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            65 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    66 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     66 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -1.24 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 2 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 56  ? SER A 57  ? ALA A 56  SER A 57  
A 2 LYS A 32  ? GLY A 37  ? LYS A 32  GLY A 37  
A 3 ARG A 5   ? LEU A 10  ? ARG A 5   LEU A 10  
A 4 VAL A 69  ? LEU A 72  ? VAL A 69  LEU A 72  
A 5 LEU A 101 ? ILE A 105 ? LEU A 101 ILE A 105 
A 6 ILE A 152 ? SER A 155 ? ILE A 152 SER A 155 
A 7 VAL A 146 ? ASP A 149 ? VAL A 146 ASP A 149 
B 1 VAL A 44  ? GLN A 45  ? VAL A 44  GLN A 45  
B 2 VAL A 51  ? ILE A 52  ? VAL A 51  ILE A 52  
C 1 LYS A 122 ? VAL A 123 ? LYS A 122 VAL A 123 
C 2 THR A 140 ? TYR A 141 ? THR A 140 TYR A 141 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ALA A 56  ? O ALA A 56  N GLY A 37  ? N GLY A 37  
A 2 3 O ALA A 36  ? O ALA A 36  N LEU A 10  ? N LEU A 10  
A 3 4 N LEU A 7   ? N LEU A 7   O VAL A 71  ? O VAL A 71  
A 4 5 N VAL A 70  ? N VAL A 70  O ALA A 103 ? O ALA A 103 
A 5 6 N ILE A 102 ? N ILE A 102 O LEU A 153 ? O LEU A 153 
A 6 7 O THR A 154 ? O THR A 154 N GLU A 147 ? N GLU A 147 
B 1 2 N VAL A 44  ? N VAL A 44  O ILE A 52  ? O ILE A 52  
C 1 2 N VAL A 123 ? N VAL A 123 O THR A 140 ? O THR A 140 
# 
_database_PDB_matrix.entry_id          1SOA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    1SOA 
_atom_sites.fract_transf_matrix[1][1]   0.013310 
_atom_sites.fract_transf_matrix[1][2]   0.007685 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015369 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013317 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 2   ? 33.565 9.767   -76.494 1.00 60.46 ? 2   ALA A N   1 
ATOM   2    C CA  . ALA A 1 2   ? 32.547 9.347   -75.550 1.00 39.59 ? 2   ALA A CA  1 
ATOM   3    C C   . ALA A 1 2   ? 33.222 8.590   -74.417 1.00 29.43 ? 2   ALA A C   1 
ATOM   4    O O   . ALA A 1 2   ? 34.388 8.224   -74.423 1.00 41.46 ? 2   ALA A O   1 
ATOM   5    C CB  . ALA A 1 2   ? 31.481 8.428   -76.124 1.00 36.89 ? 2   ALA A CB  1 
ATOM   6    N N   . SER A 1 3   ? 32.417 8.377   -73.392 1.00 20.06 ? 3   SER A N   1 
ATOM   7    C CA  . SER A 1 3   ? 32.886 7.720   -72.187 1.00 15.41 ? 3   SER A CA  1 
ATOM   8    C C   . SER A 1 3   ? 32.801 6.199   -72.304 1.00 13.63 ? 3   SER A C   1 
ATOM   9    O O   . SER A 1 3   ? 31.910 5.597   -72.912 1.00 17.76 ? 3   SER A O   1 
ATOM   10   C CB  . SER A 1 3   ? 32.015 8.134   -71.005 1.00 20.72 ? 3   SER A CB  1 
ATOM   11   O OG  . SER A 1 3   ? 32.087 9.559   -70.833 1.00 43.70 ? 3   SER A OG  1 
ATOM   12   N N   . LYS A 1 4   ? 33.777 5.605   -71.640 1.00 10.65 ? 4   LYS A N   1 
ATOM   13   C CA  . LYS A 1 4   ? 33.741 4.120   -71.505 1.00 10.18 ? 4   LYS A CA  1 
ATOM   14   C C   . LYS A 1 4   ? 32.712 3.721   -70.468 1.00 9.49  ? 4   LYS A C   1 
ATOM   15   O O   . LYS A 1 4   ? 32.316 4.534   -69.622 1.00 10.47 ? 4   LYS A O   1 
ATOM   16   C CB  . LYS A 1 4   ? 35.157 3.635   -71.197 1.00 12.69 ? 4   LYS A CB  1 
ATOM   17   C CG  . LYS A 1 4   ? 36.250 3.996   -72.173 1.00 14.17 ? 4   LYS A CG  1 
ATOM   18   C CD  . LYS A 1 4   ? 36.279 3.086   -73.350 1.00 20.12 ? 4   LYS A CD  1 
ATOM   19   C CE  . LYS A 1 4   ? 37.240 3.539   -74.447 1.00 22.86 ? 4   LYS A CE  1 
ATOM   20   N NZ  . LYS A 1 4   ? 38.020 2.426   -74.938 1.00 44.24 ? 4   LYS A NZ  1 
ATOM   21   N N   A ARG A 1 5   ? 32.312 2.453   -70.519 0.44 9.03  ? 5   ARG A N   1 
ATOM   22   N N   B ARG A 1 5   ? 32.259 2.471   -70.507 0.56 9.55  ? 5   ARG A N   1 
ATOM   23   C CA  A ARG A 1 5   ? 31.261 1.923   -69.677 0.44 8.67  ? 5   ARG A CA  1 
ATOM   24   C CA  B ARG A 1 5   ? 31.171 1.950   -69.706 0.56 9.98  ? 5   ARG A CA  1 
ATOM   25   C C   A ARG A 1 5   ? 31.696 0.624   -69.016 0.44 7.66  ? 5   ARG A C   1 
ATOM   26   C C   B ARG A 1 5   ? 31.601 0.651   -69.036 0.56 9.67  ? 5   ARG A C   1 
ATOM   27   O O   A ARG A 1 5   ? 32.356 -0.234  -69.591 0.44 8.63  ? 5   ARG A O   1 
ATOM   28   O O   B ARG A 1 5   ? 32.205 -0.201  -69.676 0.56 9.76  ? 5   ARG A O   1 
ATOM   29   C CB  A ARG A 1 5   ? 30.002 1.626   -70.513 0.44 11.78 ? 5   ARG A CB  1 
ATOM   30   C CB  B ARG A 1 5   ? 29.933 1.639   -70.583 0.56 13.22 ? 5   ARG A CB  1 
ATOM   31   C CG  A ARG A 1 5   ? 29.679 2.773   -71.474 0.44 15.47 ? 5   ARG A CG  1 
ATOM   32   C CG  B ARG A 1 5   ? 29.338 2.882   -71.230 0.56 12.17 ? 5   ARG A CG  1 
ATOM   33   C CD  A ARG A 1 5   ? 28.607 2.388   -72.448 0.44 20.23 ? 5   ARG A CD  1 
ATOM   34   C CD  B ARG A 1 5   ? 28.199 2.646   -72.164 0.56 18.87 ? 5   ARG A CD  1 
ATOM   35   N NE  A ARG A 1 5   ? 27.290 2.335   -71.822 0.44 23.38 ? 5   ARG A NE  1 
ATOM   36   N NE  B ARG A 1 5   ? 27.723 3.850   -72.849 0.56 25.56 ? 5   ARG A NE  1 
ATOM   37   C CZ  A ARG A 1 5   ? 26.380 1.385   -71.829 0.44 25.96 ? 5   ARG A CZ  1 
ATOM   38   C CZ  B ARG A 1 5   ? 26.615 3.921   -73.561 0.56 29.37 ? 5   ARG A CZ  1 
ATOM   39   N NH1 A ARG A 1 5   ? 26.550 0.236   -72.458 0.44 26.62 ? 5   ARG A NH1 1 
ATOM   40   N NH1 B ARG A 1 5   ? 25.825 2.849   -73.720 0.56 47.89 ? 5   ARG A NH1 1 
ATOM   41   N NH2 A ARG A 1 5   ? 25.213 1.514   -71.195 0.44 36.50 ? 5   ARG A NH2 1 
ATOM   42   N NH2 B ARG A 1 5   ? 26.260 5.059   -74.146 0.56 45.58 ? 5   ARG A NH2 1 
ATOM   43   N N   . ALA A 1 6   ? 31.293 0.510   -67.748 1.00 7.96  ? 6   ALA A N   1 
ATOM   44   C CA  . ALA A 1 6   ? 31.602 -0.664  -66.939 1.00 7.89  ? 6   ALA A CA  1 
ATOM   45   C C   . ALA A 1 6   ? 30.340 -1.258  -66.347 1.00 7.40  ? 6   ALA A C   1 
ATOM   46   O O   . ALA A 1 6   ? 29.487 -0.517  -65.832 1.00 9.16  ? 6   ALA A O   1 
ATOM   47   C CB  . ALA A 1 6   ? 32.569 -0.294  -65.834 1.00 8.04  ? 6   ALA A CB  1 
ATOM   48   N N   . LEU A 1 7   ? 30.236 -2.588  -66.347 1.00 7.04  ? 7   LEU A N   1 
ATOM   49   C CA  . LEU A 1 7   ? 29.208 -3.355  -65.692 1.00 7.18  ? 7   LEU A CA  1 
ATOM   50   C C   . LEU A 1 7   ? 29.854 -4.054  -64.499 1.00 6.98  ? 7   LEU A C   1 
ATOM   51   O O   . LEU A 1 7   ? 30.784 -4.840  -64.672 1.00 8.76  ? 7   LEU A O   1 
ATOM   52   C CB  . LEU A 1 7   ? 28.655 -4.407  -66.651 1.00 7.75  ? 7   LEU A CB  1 
ATOM   53   C CG  . LEU A 1 7   ? 27.558 -5.307  -66.080 1.00 8.28  ? 7   LEU A CG  1 
ATOM   54   C CD1 . LEU A 1 7   ? 26.311 -4.523  -65.723 1.00 10.57 ? 7   LEU A CD1 1 
ATOM   55   C CD2 . LEU A 1 7   ? 27.259 -6.447  -67.070 1.00 9.94  ? 7   LEU A CD2 1 
ATOM   56   N N   . VAL A 1 8   ? 29.368 -3.796  -63.292 1.00 6.92  ? 8   VAL A N   1 
ATOM   57   C CA  . VAL A 1 8   ? 29.811 -4.475  -62.067 1.00 6.69  ? 8   VAL A CA  1 
ATOM   58   C C   . VAL A 1 8   ? 28.670 -5.377  -61.610 1.00 6.97  ? 8   VAL A C   1 
ATOM   59   O O   . VAL A 1 8   ? 27.547 -4.880  -61.320 1.00 8.19  ? 8   VAL A O   1 
ATOM   60   C CB  . VAL A 1 8   ? 30.206 -3.468  -60.986 1.00 7.48  ? 8   VAL A CB  1 
ATOM   61   C CG1 . VAL A 1 8   ? 30.611 -4.220  -59.707 1.00 8.98  ? 8   VAL A CG1 1 
ATOM   62   C CG2 . VAL A 1 8   ? 31.319 -2.540  -61.465 1.00 7.69  ? 8   VAL A CG2 1 
ATOM   63   N N   . ILE A 1 9   ? 28.882 -6.692  -61.554 1.00 6.33  ? 9   ILE A N   1 
ATOM   64   C CA  . ILE A 1 9   ? 27.820 -7.626  -61.228 1.00 6.72  ? 9   ILE A CA  1 
ATOM   65   C C   . ILE A 1 9   ? 27.884 -7.951  -59.723 1.00 6.47  ? 9   ILE A C   1 
ATOM   66   O O   . ILE A 1 9   ? 28.873 -8.494  -59.247 1.00 7.94  ? 9   ILE A O   1 
ATOM   67   C CB  . ILE A 1 9   ? 27.870 -8.910  -62.085 1.00 7.26  ? 9   ILE A CB  1 
ATOM   68   C CG1 . ILE A 1 9   ? 27.952 -8.565  -63.585 1.00 7.75  ? 9   ILE A CG1 1 
ATOM   69   C CG2 . ILE A 1 9   ? 26.632 -9.744  -61.748 1.00 9.08  ? 9   ILE A CG2 1 
ATOM   70   C CD1 . ILE A 1 9   ? 27.956 -9.775  -64.506 1.00 9.37  ? 9   ILE A CD1 1 
ATOM   71   N N   . LEU A 1 10  ? 26.814 -7.597  -59.024 1.00 7.14  ? 10  LEU A N   1 
ATOM   72   C CA  . LEU A 1 10  ? 26.735 -7.622  -57.575 1.00 6.83  ? 10  LEU A CA  1 
ATOM   73   C C   . LEU A 1 10  ? 25.751 -8.707  -57.112 1.00 7.12  ? 10  LEU A C   1 
ATOM   74   O O   . LEU A 1 10  ? 24.535 -8.591  -57.286 1.00 8.78  ? 10  LEU A O   1 
ATOM   75   C CB  . LEU A 1 10  ? 26.360 -6.268  -57.045 1.00 7.16  ? 10  LEU A CB  1 
ATOM   76   C CG  . LEU A 1 10  ? 26.140 -6.133  -55.564 1.00 7.30  ? 10  LEU A CG  1 
ATOM   77   C CD1 . LEU A 1 10  ? 27.336 -6.618  -54.788 1.00 9.20  ? 10  LEU A CD1 1 
ATOM   78   C CD2 . LEU A 1 10  ? 25.768 -4.703  -55.205 1.00 10.06 ? 10  LEU A CD2 1 
ATOM   79   N N   . ALA A 1 11  ? 26.297 -9.761  -56.493 1.00 7.41  ? 11  ALA A N   1 
ATOM   80   C CA  . ALA A 1 11  ? 25.553 -10.893 -55.973 1.00 7.62  ? 11  ALA A CA  1 
ATOM   81   C C   . ALA A 1 11  ? 25.644 -10.960 -54.443 1.00 7.37  ? 11  ALA A C   1 
ATOM   82   O O   . ALA A 1 11  ? 26.616 -10.487 -53.825 1.00 7.77  ? 11  ALA A O   1 
ATOM   83   C CB  . ALA A 1 11  ? 26.067 -12.200 -56.524 1.00 10.37 ? 11  ALA A CB  1 
ATOM   84   N N   A LYS A 1 12  ? 24.653 -11.584 -53.815 0.63 9.98  ? 12  LYS A N   1 
ATOM   85   N N   B LYS A 1 12  ? 24.642 -11.564 -53.821 0.37 6.41  ? 12  LYS A N   1 
ATOM   86   C CA  A LYS A 1 12  ? 24.660 -11.810 -52.391 0.63 7.42  ? 12  LYS A CA  1 
ATOM   87   C CA  B LYS A 1 12  ? 24.658 -11.833 -52.401 0.37 7.48  ? 12  LYS A CA  1 
ATOM   88   C C   A LYS A 1 12  ? 25.976 -12.491 -51.998 0.63 7.74  ? 12  LYS A C   1 
ATOM   89   C C   B LYS A 1 12  ? 25.979 -12.493 -51.998 0.37 6.93  ? 12  LYS A C   1 
ATOM   90   O O   A LYS A 1 12  ? 26.447 -13.432 -52.620 0.63 8.34  ? 12  LYS A O   1 
ATOM   91   O O   B LYS A 1 12  ? 26.451 -13.427 -52.635 0.37 7.22  ? 12  LYS A O   1 
ATOM   92   C CB  A LYS A 1 12  ? 23.446 -12.658 -51.961 0.63 8.96  ? 12  LYS A CB  1 
ATOM   93   C CB  B LYS A 1 12  ? 23.480 -12.741 -52.021 0.37 8.45  ? 12  LYS A CB  1 
ATOM   94   C CG  A LYS A 1 12  ? 23.327 -12.795 -50.438 0.63 9.01  ? 12  LYS A CG  1 
ATOM   95   C CG  B LYS A 1 12  ? 23.404 -13.008 -50.515 0.37 9.88  ? 12  LYS A CG  1 
ATOM   96   C CD  A LYS A 1 12  ? 22.040 -13.440 -49.973 0.63 13.09 ? 12  LYS A CD  1 
ATOM   97   C CD  B LYS A 1 12  ? 22.127 -13.755 -50.168 0.37 10.40 ? 12  LYS A CD  1 
ATOM   98   C CE  A LYS A 1 12  ? 21.756 -13.422 -48.482 0.63 16.44 ? 12  LYS A CE  1 
ATOM   99   C CE  B LYS A 1 12  ? 22.001 -14.052 -48.675 0.37 12.32 ? 12  LYS A CE  1 
ATOM   100  N NZ  A LYS A 1 12  ? 22.906 -13.633 -47.597 0.63 27.05 ? 12  LYS A NZ  1 
ATOM   101  N NZ  B LYS A 1 12  ? 20.584 -14.385 -48.342 0.37 18.38 ? 12  LYS A NZ  1 
ATOM   102  N N   . GLY A 1 13  ? 26.568 -11.993 -50.912 1.00 6.90  ? 13  GLY A N   1 
ATOM   103  C CA  . GLY A 1 13  ? 27.820 -12.524 -50.434 1.00 7.09  ? 13  GLY A CA  1 
ATOM   104  C C   . GLY A 1 13  ? 29.061 -11.961 -51.108 1.00 6.81  ? 13  GLY A C   1 
ATOM   105  O O   . GLY A 1 13  ? 30.190 -12.402 -50.807 1.00 7.15  ? 13  GLY A O   1 
ATOM   106  N N   . ALA A 1 14  ? 28.890 -10.985 -51.994 1.00 6.58  ? 14  ALA A N   1 
ATOM   107  C CA  . ALA A 1 14  ? 30.047 -10.321 -52.571 1.00 6.26  ? 14  ALA A CA  1 
ATOM   108  C C   . ALA A 1 14  ? 30.869 -9.602  -51.526 1.00 5.91  ? 14  ALA A C   1 
ATOM   109  O O   . ALA A 1 14  ? 30.337 -9.108  -50.508 1.00 6.44  ? 14  ALA A O   1 
ATOM   110  C CB  . ALA A 1 14  ? 29.587 -9.263  -53.560 1.00 7.83  ? 14  ALA A CB  1 
ATOM   111  N N   . GLU A 1 15  ? 32.182 -9.514  -51.754 1.00 5.64  ? 15  GLU A N   1 
ATOM   112  C CA  . GLU A 1 15  ? 33.060 -8.726  -50.897 1.00 5.61  ? 15  GLU A CA  1 
ATOM   113  C C   . GLU A 1 15  ? 32.785 -7.248  -51.182 1.00 5.80  ? 15  GLU A C   1 
ATOM   114  O O   . GLU A 1 15  ? 33.052 -6.731  -52.284 1.00 5.63  ? 15  GLU A O   1 
ATOM   115  C CB  . GLU A 1 15  ? 34.514 -9.116  -51.093 1.00 5.71  ? 15  GLU A CB  1 
ATOM   116  C CG  . GLU A 1 15  ? 35.315 -9.251  -49.787 1.00 6.04  ? 15  GLU A CG  1 
ATOM   117  C CD  . GLU A 1 15  ? 35.327 -7.969  -48.987 1.00 5.99  ? 15  GLU A CD  1 
ATOM   118  O OE1 . GLU A 1 15  ? 35.330 -6.874  -49.585 1.00 6.60  ? 15  GLU A OE1 1 
ATOM   119  O OE2 . GLU A 1 15  ? 35.303 -8.072  -47.711 1.00 7.54  ? 15  GLU A OE2 1 
ATOM   120  N N   . GLU A 1 16  ? 32.223 -6.543  -50.206 1.00 6.10  ? 16  GLU A N   1 
ATOM   121  C CA  . GLU A 1 16  ? 31.795 -5.174  -50.422 1.00 5.55  ? 16  GLU A CA  1 
ATOM   122  C C   . GLU A 1 16  ? 32.951 -4.204  -50.716 1.00 5.63  ? 16  GLU A C   1 
ATOM   123  O O   . GLU A 1 16  ? 32.746 -3.243  -51.444 1.00 6.00  ? 16  GLU A O   1 
ATOM   124  C CB  . GLU A 1 16  ? 30.944 -4.667  -49.236 1.00 5.81  ? 16  GLU A CB  1 
ATOM   125  C CG  . GLU A 1 16  ? 31.477 -5.003  -47.846 1.00 5.83  ? 16  GLU A CG  1 
ATOM   126  C CD  . GLU A 1 16  ? 30.909 -6.284  -47.298 1.00 5.99  ? 16  GLU A CD  1 
ATOM   127  O OE1 . GLU A 1 16  ? 31.360 -7.386  -47.762 1.00 6.51  ? 16  GLU A OE1 1 
ATOM   128  O OE2 . GLU A 1 16  ? 30.023 -6.250  -46.405 1.00 6.61  ? 16  GLU A OE2 1 
ATOM   129  N N   . MET A 1 17  ? 34.119 -4.442  -50.125 1.00 5.31  ? 17  MET A N   1 
ATOM   130  C CA  . MET A 1 17  ? 35.244 -3.570  -50.488 1.00 5.34  ? 17  MET A CA  1 
ATOM   131  C C   . MET A 1 17  ? 35.632 -3.739  -51.937 1.00 5.45  ? 17  MET A C   1 
ATOM   132  O O   . MET A 1 17  ? 36.006 -2.756  -52.605 1.00 6.04  ? 17  MET A O   1 
ATOM   133  C CB  . MET A 1 17  ? 36.435 -3.848  -49.573 1.00 5.58  ? 17  MET A CB  1 
ATOM   134  C CG  . MET A 1 17  ? 36.219 -3.580  -48.105 1.00 6.55  ? 17  MET A CG  1 
ATOM   135  S SD  . MET A 1 17  ? 37.649 -3.790  -47.055 1.00 7.59  ? 17  MET A SD  1 
ATOM   136  C CE  . MET A 1 17  ? 37.711 -5.577  -46.831 1.00 7.64  ? 17  MET A CE  1 
ATOM   137  N N   . GLU A 1 18  ? 35.583 -4.954  -52.437 1.00 6.13  ? 18  GLU A N   1 
ATOM   138  C CA  . GLU A 1 18  ? 35.927 -5.274  -53.814 1.00 6.44  ? 18  GLU A CA  1 
ATOM   139  C C   . GLU A 1 18  ? 34.871 -4.880  -54.808 1.00 6.49  ? 18  GLU A C   1 
ATOM   140  O O   . GLU A 1 18  ? 35.103 -4.904  -56.017 1.00 7.87  ? 18  GLU A O   1 
ATOM   141  C CB  . GLU A 1 18  ? 36.222 -6.788  -53.935 1.00 6.30  ? 18  GLU A CB  1 
ATOM   142  C CG  . GLU A 1 18  ? 37.377 -7.228  -53.113 1.00 6.82  ? 18  GLU A CG  1 
ATOM   143  C CD  . GLU A 1 18  ? 37.540 -8.695  -53.004 1.00 6.48  ? 18  GLU A CD  1 
ATOM   144  O OE1 . GLU A 1 18  ? 36.854 -9.489  -53.658 1.00 7.67  ? 18  GLU A OE1 1 
ATOM   145  O OE2 . GLU A 1 18  ? 38.436 -9.077  -52.141 1.00 8.07  ? 18  GLU A OE2 1 
ATOM   146  N N   . THR A 1 19  ? 33.698 -4.467  -54.302 1.00 6.66  ? 19  THR A N   1 
ATOM   147  C CA  . THR A 1 19  ? 32.625 -3.897  -55.116 1.00 6.56  ? 19  THR A CA  1 
ATOM   148  C C   . THR A 1 19  ? 32.787 -2.371  -55.117 1.00 6.11  ? 19  THR A C   1 
ATOM   149  O O   . THR A 1 19  ? 32.836 -1.740  -56.210 1.00 7.01  ? 19  THR A O   1 
ATOM   150  C CB  . THR A 1 19  ? 31.265 -4.318  -54.524 1.00 7.09  ? 19  THR A CB  1 
ATOM   151  O OG1 . THR A 1 19  ? 31.171 -5.747  -54.481 1.00 7.74  ? 19  THR A OG1 1 
ATOM   152  C CG2 . THR A 1 19  ? 30.115 -3.814  -55.379 1.00 8.80  ? 19  THR A CG2 1 
ATOM   153  N N   . VAL A 1 20  ? 32.844 -1.768  -53.941 1.00 6.14  ? 20  VAL A N   1 
ATOM   154  C CA  . VAL A 1 20  ? 32.851 -0.311  -53.845 1.00 5.92  ? 20  VAL A CA  1 
ATOM   155  C C   . VAL A 1 20  ? 34.119 0.348   -54.339 1.00 5.58  ? 20  VAL A C   1 
ATOM   156  O O   . VAL A 1 20  ? 34.062 1.412   -54.961 1.00 6.69  ? 20  VAL A O   1 
ATOM   157  C CB  . VAL A 1 20  ? 32.495 0.082   -52.381 1.00 7.30  ? 20  VAL A CB  1 
ATOM   158  C CG1 . VAL A 1 20  ? 32.650 1.545   -52.147 1.00 10.03 ? 20  VAL A CG1 1 
ATOM   159  C CG2 . VAL A 1 20  ? 31.062 -0.336  -52.070 1.00 7.90  ? 20  VAL A CG2 1 
ATOM   160  N N   . ILE A 1 21  ? 35.293 -0.234  -54.052 1.00 5.70  ? 21  ILE A N   1 
ATOM   161  C CA  . ILE A 1 21  ? 36.533 0.380   -54.485 1.00 5.19  ? 21  ILE A CA  1 
ATOM   162  C C   . ILE A 1 21  ? 36.548 0.486   -56.022 1.00 5.54  ? 21  ILE A C   1 
ATOM   163  O O   . ILE A 1 21  ? 36.770 1.591   -56.543 1.00 6.41  ? 21  ILE A O   1 
ATOM   164  C CB  . ILE A 1 21  ? 37.786 -0.267  -53.859 1.00 5.15  ? 21  ILE A CB  1 
ATOM   165  C CG1 . ILE A 1 21  ? 37.856 -0.048  -52.354 1.00 6.84  ? 21  ILE A CG1 1 
ATOM   166  C CG2 . ILE A 1 21  ? 39.053 0.259   -54.541 1.00 6.52  ? 21  ILE A CG2 1 
ATOM   167  C CD1 . ILE A 1 21  ? 38.826 -1.019  -51.687 1.00 7.05  ? 21  ILE A CD1 1 
ATOM   168  N N   . PRO A 1 22  ? 36.303 -0.577  -56.768 1.00 5.81  ? 22  PRO A N   1 
ATOM   169  C CA  . PRO A 1 22  ? 36.271 -0.432  -58.227 1.00 6.09  ? 22  PRO A CA  1 
ATOM   170  C C   . PRO A 1 22  ? 35.188 0.536   -58.721 1.00 5.67  ? 22  PRO A C   1 
ATOM   171  O O   . PRO A 1 22  ? 35.453 1.297   -59.640 1.00 6.22  ? 22  PRO A O   1 
ATOM   172  C CB  . PRO A 1 22  ? 36.099 -1.876  -58.756 1.00 6.88  ? 22  PRO A CB  1 
ATOM   173  C CG  . PRO A 1 22  ? 36.722 -2.695  -57.660 1.00 6.47  ? 22  PRO A CG  1 
ATOM   174  C CD  . PRO A 1 22  ? 36.268 -2.033  -56.395 1.00 5.83  ? 22  PRO A CD  1 
ATOM   175  N N   . VAL A 1 23  ? 33.973 0.489   -58.172 1.00 5.86  ? 23  VAL A N   1 
ATOM   176  C CA  . VAL A 1 23  ? 32.930 1.388   -58.649 1.00 5.72  ? 23  VAL A CA  1 
ATOM   177  C C   . VAL A 1 23  ? 33.357 2.837   -58.465 1.00 5.85  ? 23  VAL A C   1 
ATOM   178  O O   . VAL A 1 23  ? 33.210 3.653   -59.366 1.00 6.27  ? 23  VAL A O   1 
ATOM   179  C CB  . VAL A 1 23  ? 31.611 1.100   -57.928 1.00 5.76  ? 23  VAL A CB  1 
ATOM   180  C CG1 . VAL A 1 23  ? 30.555 2.193   -58.167 1.00 6.89  ? 23  VAL A CG1 1 
ATOM   181  C CG2 . VAL A 1 23  ? 31.066 -0.265  -58.319 1.00 6.71  ? 23  VAL A CG2 1 
ATOM   182  N N   . ASP A 1 24  ? 33.823 3.178   -57.260 1.00 5.57  ? 24  ASP A N   1 
ATOM   183  C CA  . ASP A 1 24  ? 34.185 4.548   -56.909 1.00 5.70  ? 24  ASP A CA  1 
ATOM   184  C C   . ASP A 1 24  ? 35.368 5.035   -57.749 1.00 5.65  ? 24  ASP A C   1 
ATOM   185  O O   . ASP A 1 24  ? 35.278 6.081   -58.404 1.00 6.39  ? 24  ASP A O   1 
ATOM   186  C CB  . ASP A 1 24  ? 34.416 4.596   -55.419 1.00 5.76  ? 24  ASP A CB  1 
ATOM   187  C CG  . ASP A 1 24  ? 34.771 5.908   -54.794 1.00 5.96  ? 24  ASP A CG  1 
ATOM   188  O OD1 . ASP A 1 24  ? 35.418 6.753   -55.465 1.00 6.79  ? 24  ASP A OD1 1 
ATOM   189  O OD2 . ASP A 1 24  ? 34.452 6.072   -53.576 1.00 6.71  ? 24  ASP A OD2 1 
ATOM   190  N N   . VAL A 1 25  ? 36.453 4.248   -57.809 1.00 5.33  ? 25  VAL A N   1 
ATOM   191  C CA  . VAL A 1 25  ? 37.606 4.628   -58.608 1.00 5.47  ? 25  VAL A CA  1 
ATOM   192  C C   . VAL A 1 25  ? 37.268 4.776   -60.076 1.00 5.82  ? 25  VAL A C   1 
ATOM   193  O O   . VAL A 1 25  ? 37.742 5.692   -60.733 1.00 5.83  ? 25  VAL A O   1 
ATOM   194  C CB  . VAL A 1 25  ? 38.774 3.644   -58.344 1.00 5.65  ? 25  VAL A CB  1 
ATOM   195  C CG1 . VAL A 1 25  ? 39.901 3.870   -59.318 1.00 7.01  ? 25  VAL A CG1 1 
ATOM   196  C CG2 . VAL A 1 25  ? 39.244 3.780   -56.893 1.00 6.87  ? 25  VAL A CG2 1 
ATOM   197  N N   . MET A 1 26  ? 36.471 3.851   -60.643 1.00 5.86  ? 26  MET A N   1 
ATOM   198  C CA  . MET A 1 26  ? 36.089 3.986   -62.042 1.00 5.91  ? 26  MET A CA  1 
ATOM   199  C C   . MET A 1 26  ? 35.245 5.251   -62.293 1.00 6.35  ? 26  MET A C   1 
ATOM   200  O O   . MET A 1 26  ? 35.436 5.914   -63.303 1.00 6.18  ? 26  MET A O   1 
ATOM   201  C CB  . MET A 1 26  ? 35.332 2.737   -62.541 1.00 6.16  ? 26  MET A CB  1 
ATOM   202  C CG  . MET A 1 26  ? 36.236 1.508   -62.719 1.00 7.08  ? 26  MET A CG  1 
ATOM   203  S SD  . MET A 1 26  ? 35.421 0.130   -63.536 1.00 7.40  ? 26  MET A SD  1 
ATOM   204  C CE  . MET A 1 26  ? 34.207 -0.355  -62.307 1.00 7.20  ? 26  MET A CE  1 
ATOM   205  N N   . ARG A 1 27  ? 34.327 5.563   -61.361 1.00 5.87  ? 27  ARG A N   1 
ATOM   206  C CA  . ARG A 1 27  ? 33.555 6.813   -61.522 1.00 5.79  ? 27  ARG A CA  1 
ATOM   207  C C   . ARG A 1 27  ? 34.477 8.035   -61.405 1.00 5.42  ? 27  ARG A C   1 
ATOM   208  O O   . ARG A 1 27  ? 34.254 9.019   -62.144 1.00 6.43  ? 27  ARG A O   1 
ATOM   209  C CB  . ARG A 1 27  ? 32.380 6.825   -60.537 1.00 5.87  ? 27  ARG A CB  1 
ATOM   210  C CG  . ARG A 1 27  ? 31.267 5.875   -60.948 1.00 6.21  ? 27  ARG A CG  1 
ATOM   211  C CD  . ARG A 1 27  ? 30.080 5.888   -59.998 1.00 6.40  ? 27  ARG A CD  1 
ATOM   212  N NE  . ARG A 1 27  ? 28.992 5.106   -60.585 1.00 6.39  ? 27  ARG A NE  1 
ATOM   213  C CZ  . ARG A 1 27  ? 28.049 4.439   -59.908 1.00 6.69  ? 27  ARG A CZ  1 
ATOM   214  N NH1 . ARG A 1 27  ? 27.998 4.455   -58.572 1.00 6.48  ? 27  ARG A NH1 1 
ATOM   215  N NH2 . ARG A 1 27  ? 27.143 3.715   -60.557 1.00 7.96  ? 27  ARG A NH2 1 
ATOM   216  N N   . ARG A 1 28  ? 35.481 8.013   -60.566 1.00 5.75  ? 28  ARG A N   1 
ATOM   217  C CA  . ARG A 1 28  ? 36.460 9.108   -60.490 1.00 5.81  ? 28  ARG A CA  1 
ATOM   218  C C   . ARG A 1 28  ? 37.159 9.292   -61.824 1.00 5.90  ? 28  ARG A C   1 
ATOM   219  O O   . ARG A 1 28  ? 37.551 10.413  -62.168 1.00 6.82  ? 28  ARG A O   1 
ATOM   220  C CB  . ARG A 1 28  ? 37.476 8.818   -59.379 1.00 5.85  ? 28  ARG A CB  1 
ATOM   221  C CG  . ARG A 1 28  ? 36.925 9.019   -57.977 1.00 5.95  ? 28  ARG A CG  1 
ATOM   222  C CD  . ARG A 1 28  ? 37.892 8.500   -56.935 1.00 6.04  ? 28  ARG A CD  1 
ATOM   223  N NE  . ARG A 1 28  ? 37.453 8.773   -55.558 1.00 6.30  ? 28  ARG A NE  1 
ATOM   224  C CZ  . ARG A 1 28  ? 37.920 9.710   -54.729 1.00 6.10  ? 28  ARG A CZ  1 
ATOM   225  N NH1 . ARG A 1 28  ? 38.895 10.530  -55.054 1.00 6.62  ? 28  ARG A NH1 1 
ATOM   226  N NH2 . ARG A 1 28  ? 37.376 9.796   -53.517 1.00 6.36  ? 28  ARG A NH2 1 
ATOM   227  N N   . ALA A 1 29  ? 37.348 8.206   -62.566 1.00 6.15  ? 29  ALA A N   1 
ATOM   228  C CA  . ALA A 1 29  ? 37.957 8.205   -63.890 1.00 6.36  ? 29  ALA A CA  1 
ATOM   229  C C   . ALA A 1 29  ? 37.043 8.611   -65.013 1.00 7.38  ? 29  ALA A C   1 
ATOM   230  O O   . ALA A 1 29  ? 37.449 8.619   -66.181 1.00 8.82  ? 29  ALA A O   1 
ATOM   231  C CB  . ALA A 1 29  ? 38.547 6.821   -64.192 1.00 7.67  ? 29  ALA A CB  1 
ATOM   232  N N   . GLY A 1 30  ? 35.800 8.962   -64.731 1.00 7.16  ? 30  GLY A N   1 
ATOM   233  C CA  . GLY A 1 30  ? 34.827 9.358   -65.754 1.00 8.18  ? 30  GLY A CA  1 
ATOM   234  C C   . GLY A 1 30  ? 34.219 8.179   -66.470 1.00 7.28  ? 30  GLY A C   1 
ATOM   235  O O   . GLY A 1 30  ? 33.588 8.420   -67.508 1.00 9.84  ? 30  GLY A O   1 
ATOM   236  N N   . ILE A 1 31  ? 34.377 6.958   -65.994 1.00 7.52  ? 31  ILE A N   1 
ATOM   237  C CA  . ILE A 1 31  ? 33.720 5.801   -66.593 1.00 7.06  ? 31  ILE A CA  1 
ATOM   238  C C   . ILE A 1 31  ? 32.270 5.804   -66.135 1.00 7.40  ? 31  ILE A C   1 
ATOM   239  O O   . ILE A 1 31  ? 31.967 6.161   -64.974 1.00 8.46  ? 31  ILE A O   1 
ATOM   240  C CB  . ILE A 1 31  ? 34.477 4.517   -66.177 1.00 7.07  ? 31  ILE A CB  1 
ATOM   241  C CG1 . ILE A 1 31  ? 35.895 4.531   -66.725 1.00 7.95  ? 31  ILE A CG1 1 
ATOM   242  C CG2 . ILE A 1 31  ? 33.724 3.266   -66.578 1.00 7.80  ? 31  ILE A CG2 1 
ATOM   243  C CD1 . ILE A 1 31  ? 36.816 3.536   -66.096 1.00 8.66  ? 31  ILE A CD1 1 
ATOM   244  N N   . LYS A 1 32  ? 31.336 5.421   -67.009 1.00 7.97  ? 32  LYS A N   1 
ATOM   245  C CA  . LYS A 1 32  ? 29.952 5.271   -66.675 1.00 8.40  ? 32  LYS A CA  1 
ATOM   246  C C   . LYS A 1 32  ? 29.767 3.877   -66.155 1.00 8.12  ? 32  LYS A C   1 
ATOM   247  O O   . LYS A 1 32  ? 29.868 2.891   -66.917 1.00 8.97  ? 32  LYS A O   1 
ATOM   248  C CB  . LYS A 1 32  ? 29.088 5.479   -67.960 1.00 11.58 ? 32  LYS A CB  1 
ATOM   249  C CG  . LYS A 1 32  ? 29.260 6.867   -68.593 1.00 22.15 ? 32  LYS A CG  1 
ATOM   250  C CD  . LYS A 1 32  ? 28.583 6.915   -69.975 1.00 40.08 ? 32  LYS A CD  1 
ATOM   251  C CE  . LYS A 1 32  ? 27.127 6.512   -69.914 1.00 51.81 ? 32  LYS A CE  1 
ATOM   252  N NZ  . LYS A 1 32  ? 26.383 7.165   -71.047 1.00 66.11 ? 32  LYS A NZ  1 
ATOM   253  N N   . VAL A 1 33  ? 29.535 3.752   -64.862 1.00 8.26  ? 33  VAL A N   1 
ATOM   254  C CA  . VAL A 1 33  ? 29.454 2.441   -64.178 1.00 7.59  ? 33  VAL A CA  1 
ATOM   255  C C   . VAL A 1 33  ? 28.016 2.075   -63.862 1.00 7.25  ? 33  VAL A C   1 
ATOM   256  O O   . VAL A 1 33  ? 27.325 2.928   -63.301 1.00 8.55  ? 33  VAL A O   1 
ATOM   257  C CB  . VAL A 1 33  ? 30.281 2.462   -62.876 1.00 7.62  ? 33  VAL A CB  1 
ATOM   258  C CG1 . VAL A 1 33  ? 30.231 1.094   -62.182 1.00 8.35  ? 33  VAL A CG1 1 
ATOM   259  C CG2 . VAL A 1 33  ? 31.721 2.890   -63.141 1.00 8.03  ? 33  VAL A CG2 1 
ATOM   260  N N   . THR A 1 34  ? 27.621 0.859   -64.181 1.00 7.39  ? 34  THR A N   1 
ATOM   261  C CA  . THR A 1 34  ? 26.337 0.314   -63.752 1.00 8.34  ? 34  THR A CA  1 
ATOM   262  C C   . THR A 1 34  ? 26.581 -0.819  -62.764 1.00 7.78  ? 34  THR A C   1 
ATOM   263  O O   . THR A 1 34  ? 27.214 -1.821  -63.122 1.00 8.70  ? 34  THR A O   1 
ATOM   264  C CB  . THR A 1 34  ? 25.558 -0.208  -64.984 1.00 9.89  ? 34  THR A CB  1 
ATOM   265  O OG1 . THR A 1 34  ? 25.340 0.902   -65.862 1.00 10.71 ? 34  THR A OG1 1 
ATOM   266  C CG2 . THR A 1 34  ? 24.213 -0.814  -64.523 1.00 10.78 ? 34  THR A CG2 1 
ATOM   267  N N   . VAL A 1 35  ? 26.076 -0.646  -61.541 1.00 7.58  ? 35  VAL A N   1 
ATOM   268  C CA  . VAL A 1 35  ? 26.065 -1.688  -60.531 1.00 7.73  ? 35  VAL A CA  1 
ATOM   269  C C   . VAL A 1 35  ? 24.798 -2.478  -60.737 1.00 7.94  ? 35  VAL A C   1 
ATOM   270  O O   . VAL A 1 35  ? 23.708 -1.964  -60.519 1.00 8.49  ? 35  VAL A O   1 
ATOM   271  C CB  . VAL A 1 35  ? 26.154 -1.096  -59.100 1.00 8.13  ? 35  VAL A CB  1 
ATOM   272  C CG1 . VAL A 1 35  ? 26.140 -2.232  -58.071 1.00 10.15 ? 35  VAL A CG1 1 
ATOM   273  C CG2 . VAL A 1 35  ? 27.401 -0.227  -58.986 1.00 9.92  ? 35  VAL A CG2 1 
ATOM   274  N N   . ALA A 1 36  ? 24.925 -3.720  -61.179 1.00 7.68  ? 36  ALA A N   1 
ATOM   275  C CA  . ALA A 1 36  ? 23.793 -4.564  -61.559 1.00 8.03  ? 36  ALA A CA  1 
ATOM   276  C C   . ALA A 1 36  ? 23.606 -5.729  -60.566 1.00 7.67  ? 36  ALA A C   1 
ATOM   277  O O   . ALA A 1 36  ? 24.538 -6.478  -60.309 1.00 8.49  ? 36  ALA A O   1 
ATOM   278  C CB  . ALA A 1 36  ? 23.998 -5.127  -62.959 1.00 9.97  ? 36  ALA A CB  1 
ATOM   279  N N   . GLY A 1 37  ? 22.390 -5.856  -60.050 1.00 8.72  ? 37  GLY A N   1 
ATOM   280  C CA  . GLY A 1 37  ? 22.070 -6.899  -59.121 1.00 9.83  ? 37  GLY A CA  1 
ATOM   281  C C   . GLY A 1 37  ? 21.741 -8.178  -59.848 1.00 10.74 ? 37  GLY A C   1 
ATOM   282  O O   . GLY A 1 37  ? 20.872 -8.194  -60.741 1.00 12.62 ? 37  GLY A O   1 
ATOM   283  N N   . LEU A 1 38  ? 22.487 -9.208  -59.469 1.00 14.20 ? 38  LEU A N   1 
ATOM   284  C CA  . LEU A 1 38  ? 22.306 -10.499 -60.065 1.00 14.38 ? 38  LEU A CA  1 
ATOM   285  C C   . LEU A 1 38  ? 20.880 -10.938 -59.890 1.00 15.39 ? 38  LEU A C   1 
ATOM   286  O O   . LEU A 1 38  ? 20.294 -11.450 -60.828 1.00 21.54 ? 38  LEU A O   1 
ATOM   287  C CB  . LEU A 1 38  ? 23.254 -11.515 -59.393 1.00 14.28 ? 38  LEU A CB  1 
ATOM   288  C CG  . LEU A 1 38  ? 23.168 -12.903 -59.886 1.00 13.08 ? 38  LEU A CG  1 
ATOM   289  C CD1 . LEU A 1 38  ? 23.647 -12.869 -61.336 1.00 17.76 ? 38  LEU A CD1 1 
ATOM   290  C CD2 . LEU A 1 38  ? 24.023 -13.829 -59.088 1.00 14.18 ? 38  LEU A CD2 1 
ATOM   291  N N   . ALA A 1 39  ? 20.351 -10.752 -58.679 1.00 16.22 ? 39  ALA A N   1 
ATOM   292  C CA  . ALA A 1 39  ? 19.054 -11.282 -58.344 1.00 19.72 ? 39  ALA A CA  1 
ATOM   293  C C   . ALA A 1 39  ? 17.929 -10.333 -58.658 1.00 19.08 ? 39  ALA A C   1 
ATOM   294  O O   . ALA A 1 39  ? 16.801 -10.680 -58.383 1.00 34.27 ? 39  ALA A O   1 
ATOM   295  C CB  . ALA A 1 39  ? 18.965 -11.631 -56.844 1.00 21.15 ? 39  ALA A CB  1 
ATOM   296  N N   . GLY A 1 40  ? 18.209 -9.171  -59.195 1.00 20.43 ? 40  GLY A N   1 
ATOM   297  C CA  . GLY A 1 40  ? 17.037 -8.219  -59.366 1.00 24.30 ? 40  GLY A CA  1 
ATOM   298  C C   . GLY A 1 40  ? 17.508 -6.830  -58.913 1.00 24.84 ? 40  GLY A C   1 
ATOM   299  O O   . GLY A 1 40  ? 18.693 -6.595  -58.635 1.00 26.03 ? 40  GLY A O   1 
ATOM   300  N N   . LYS A 1 41  ? 16.615 -5.885  -58.793 1.00 22.94 ? 41  LYS A N   1 
ATOM   301  C CA  . LYS A 1 41  ? 16.784 -4.523  -58.302 1.00 20.08 ? 41  LYS A CA  1 
ATOM   302  C C   . LYS A 1 41  ? 16.904 -4.379  -56.781 1.00 16.23 ? 41  LYS A C   1 
ATOM   303  O O   . LYS A 1 41  ? 17.219 -3.342  -56.203 1.00 18.72 ? 41  LYS A O   1 
ATOM   304  C CB  . LYS A 1 41  ? 15.584 -3.686  -58.826 1.00 38.59 ? 41  LYS A CB  1 
ATOM   305  C CG  . LYS A 1 41  ? 15.365 -3.806  -60.339 1.00 48.74 ? 41  LYS A CG  1 
ATOM   306  C CD  . LYS A 1 41  ? 13.975 -3.538  -60.906 1.00 60.15 ? 41  LYS A CD  1 
ATOM   307  C CE  . LYS A 1 41  ? 14.003 -2.519  -62.037 1.00 58.02 ? 41  LYS A CE  1 
ATOM   308  N NZ  . LYS A 1 41  ? 12.621 -2.401  -62.631 1.00 82.27 ? 41  LYS A NZ  1 
ATOM   309  N N   . ASP A 1 42  ? 16.617 -5.464  -56.063 1.00 14.05 ? 42  ASP A N   1 
ATOM   310  C CA  . ASP A 1 42  ? 16.578 -5.436  -54.611 1.00 13.71 ? 42  ASP A CA  1 
ATOM   311  C C   . ASP A 1 42  ? 17.959 -5.217  -53.987 1.00 11.18 ? 42  ASP A C   1 
ATOM   312  O O   . ASP A 1 42  ? 19.003 -5.503  -54.575 1.00 11.32 ? 42  ASP A O   1 
ATOM   313  C CB  . ASP A 1 42  ? 16.025 -6.776  -54.124 1.00 23.10 ? 42  ASP A CB  1 
ATOM   314  C CG  . ASP A 1 42  ? 14.620 -7.084  -54.571 1.00 39.33 ? 42  ASP A CG  1 
ATOM   315  O OD1 . ASP A 1 42  ? 13.872 -6.103  -54.778 1.00 45.13 ? 42  ASP A OD1 1 
ATOM   316  O OD2 . ASP A 1 42  ? 14.281 -8.290  -54.702 1.00 53.57 ? 42  ASP A OD2 1 
ATOM   317  N N   A PRO A 1 43  ? 17.986 -4.658  -52.788 0.54 11.29 ? 43  PRO A N   1 
ATOM   318  N N   B PRO A 1 43  ? 17.945 -4.744  -52.752 0.46 11.77 ? 43  PRO A N   1 
ATOM   319  C CA  A PRO A 1 43  ? 19.287 -4.501  -52.133 0.54 11.06 ? 43  PRO A CA  1 
ATOM   320  C CA  B PRO A 1 43  ? 19.225 -4.553  -52.070 0.46 11.11 ? 43  PRO A CA  1 
ATOM   321  C C   A PRO A 1 43  ? 20.001 -5.819  -51.924 0.54 9.44  ? 43  PRO A C   1 
ATOM   322  C C   B PRO A 1 43  ? 20.000 -5.852  -51.950 0.46 9.19  ? 43  PRO A C   1 
ATOM   323  O O   A PRO A 1 43  ? 19.390 -6.891  -51.750 0.54 13.76 ? 43  PRO A O   1 
ATOM   324  O O   B PRO A 1 43  ? 19.419 -6.952  -51.857 0.46 12.40 ? 43  PRO A O   1 
ATOM   325  C CB  A PRO A 1 43  ? 18.905 -3.888  -50.777 0.54 13.19 ? 43  PRO A CB  1 
ATOM   326  C CB  B PRO A 1 43  ? 18.790 -4.051  -50.684 0.46 13.68 ? 43  PRO A CB  1 
ATOM   327  C CG  A PRO A 1 43  ? 17.638 -3.163  -51.078 0.54 14.06 ? 43  PRO A CG  1 
ATOM   328  C CG  B PRO A 1 43  ? 17.396 -4.543  -50.535 0.46 14.89 ? 43  PRO A CG  1 
ATOM   329  C CD  A PRO A 1 43  ? 16.889 -4.118  -51.978 0.54 14.79 ? 43  PRO A CD  1 
ATOM   330  C CD  B PRO A 1 43  ? 16.793 -4.386  -51.912 0.46 14.21 ? 43  PRO A CD  1 
ATOM   331  N N   . VAL A 1 44  ? 21.330 -5.747  -51.940 1.00 8.05  ? 44  VAL A N   1 
ATOM   332  C CA  . VAL A 1 44  ? 22.207 -6.896  -51.852 1.00 7.55  ? 44  VAL A CA  1 
ATOM   333  C C   . VAL A 1 44  ? 22.998 -6.870  -50.559 1.00 7.62  ? 44  VAL A C   1 
ATOM   334  O O   . VAL A 1 44  ? 23.684 -5.911  -50.207 1.00 7.99  ? 44  VAL A O   1 
ATOM   335  C CB  . VAL A 1 44  ? 23.181 -6.942  -53.055 1.00 8.17  ? 44  VAL A CB  1 
ATOM   336  C CG1 . VAL A 1 44  ? 24.117 -8.131  -52.899 1.00 9.45  ? 44  VAL A CG1 1 
ATOM   337  C CG2 . VAL A 1 44  ? 22.372 -6.953  -54.354 1.00 9.58  ? 44  VAL A CG2 1 
ATOM   338  N N   . GLN A 1 45  ? 22.869 -7.969  -49.790 1.00 7.34  ? 45  GLN A N   1 
ATOM   339  C CA  . GLN A 1 45  ? 23.595 -8.177  -48.555 1.00 7.47  ? 45  GLN A CA  1 
ATOM   340  C C   . GLN A 1 45  ? 24.961 -8.769  -48.859 1.00 6.09  ? 45  GLN A C   1 
ATOM   341  O O   . GLN A 1 45  ? 25.074 -9.898  -49.292 1.00 7.30  ? 45  GLN A O   1 
ATOM   342  C CB  . GLN A 1 45  ? 22.787 -9.073  -47.633 1.00 8.98  ? 45  GLN A CB  1 
ATOM   343  C CG  . GLN A 1 45  ? 23.387 -9.275  -46.239 1.00 9.83  ? 45  GLN A CG  1 
ATOM   344  C CD  . GLN A 1 45  ? 22.620 -10.302 -45.456 1.00 13.66 ? 45  GLN A CD  1 
ATOM   345  O OE1 . GLN A 1 45  ? 21.651 -10.891 -45.938 1.00 19.42 ? 45  GLN A OE1 1 
ATOM   346  N NE2 . GLN A 1 45  ? 22.987 -10.510 -44.233 1.00 19.24 ? 45  GLN A NE2 1 
ATOM   347  N N   . CYS A 1 46  ? 25.997 -7.977  -48.646 1.00 6.37  ? 46  CYS A N   1 
ATOM   348  C CA  . CYS A 1 46  ? 27.353 -8.379  -48.936 1.00 6.50  ? 46  CYS A CA  1 
ATOM   349  C C   . CYS A 1 46  ? 27.941 -9.232  -47.803 1.00 6.33  ? 46  CYS A C   1 
ATOM   350  O O   . CYS A 1 46  ? 27.304 -9.506  -46.774 1.00 6.85  ? 46  CYS A O   1 
ATOM   351  C CB  . CYS A 1 46  ? 28.222 -7.135  -49.207 1.00 6.08  ? 46  CYS A CB  1 
ATOM   352  S SG  . CYS A 1 46  ? 27.678 -6.226  -50.701 1.00 7.95  ? 46  CYS A SG  1 
ATOM   353  N N   . SER A 1 47  ? 29.145 -9.739  -48.071 1.00 6.47  ? 47  SER A N   1 
ATOM   354  C CA  . SER A 1 47  ? 29.801 -10.713 -47.204 1.00 6.46  ? 47  SER A CA  1 
ATOM   355  C C   . SER A 1 47  ? 29.948 -10.295 -45.740 1.00 6.63  ? 47  SER A C   1 
ATOM   356  O O   . SER A 1 47  ? 29.869 -11.139 -44.851 1.00 9.08  ? 47  SER A O   1 
ATOM   357  C CB  . SER A 1 47  ? 31.173 -11.062 -47.780 1.00 6.65  ? 47  SER A CB  1 
ATOM   358  O OG  . SER A 1 47  ? 32.124 -10.050 -47.678 1.00 6.74  ? 47  SER A OG  1 
ATOM   359  N N   . ARG A 1 48  ? 30.208 -9.021  -45.473 1.00 5.98  ? 48  ARG A N   1 
ATOM   360  C CA  . ARG A 1 48  ? 30.378 -8.448  -44.128 1.00 6.22  ? 48  ARG A CA  1 
ATOM   361  C C   . ARG A 1 48  ? 29.153 -7.551  -43.819 1.00 6.29  ? 48  ARG A C   1 
ATOM   362  O O   . ARG A 1 48  ? 29.238 -6.626  -43.019 1.00 7.05  ? 48  ARG A O   1 
ATOM   363  C CB  . ARG A 1 48  ? 31.693 -7.735  -43.906 1.00 6.71  ? 48  ARG A CB  1 
ATOM   364  C CG  . ARG A 1 48  ? 32.853 -8.643  -43.520 1.00 7.41  ? 48  ARG A CG  1 
ATOM   365  C CD  . ARG A 1 48  ? 33.268 -9.549  -44.656 1.00 6.84  ? 48  ARG A CD  1 
ATOM   366  N NE  . ARG A 1 48  ? 34.319 -10.516 -44.286 1.00 7.30  ? 48  ARG A NE  1 
ATOM   367  C CZ  . ARG A 1 48  ? 34.778 -11.406 -45.144 1.00 5.86  ? 48  ARG A CZ  1 
ATOM   368  N NH1 . ARG A 1 48  ? 34.376 -11.419 -46.407 1.00 6.87  ? 48  ARG A NH1 1 
ATOM   369  N NH2 . ARG A 1 48  ? 35.691 -12.294 -44.771 1.00 7.41  ? 48  ARG A NH2 1 
ATOM   370  N N   . ASP A 1 49  ? 28.011 -7.906  -44.414 1.00 6.34  ? 49  ASP A N   1 
ATOM   371  C CA  . ASP A 1 49  ? 26.698 -7.362  -44.059 1.00 7.06  ? 49  ASP A CA  1 
ATOM   372  C C   . ASP A 1 49  ? 26.455 -5.901  -44.456 1.00 6.29  ? 49  ASP A C   1 
ATOM   373  O O   . ASP A 1 49  ? 25.399 -5.374  -44.142 1.00 7.37  ? 49  ASP A O   1 
ATOM   374  C CB  . ASP A 1 49  ? 26.351 -7.624  -42.605 1.00 7.53  ? 49  ASP A CB  1 
ATOM   375  C CG  . ASP A 1 49  ? 25.921 -9.067  -42.344 1.00 9.07  ? 49  ASP A CG  1 
ATOM   376  O OD1 . ASP A 1 49  ? 25.581 -9.782  -43.321 1.00 10.15 ? 49  ASP A OD1 1 
ATOM   377  O OD2 . ASP A 1 49  ? 25.908 -9.439  -41.167 1.00 13.47 ? 49  ASP A OD2 1 
ATOM   378  N N   . VAL A 1 50  ? 27.369 -5.278  -45.205 1.00 6.32  ? 50  VAL A N   1 
ATOM   379  C CA  . VAL A 1 50  ? 27.019 -4.028  -45.842 1.00 6.41  ? 50  VAL A CA  1 
ATOM   380  C C   . VAL A 1 50  ? 25.926 -4.317  -46.904 1.00 6.26  ? 50  VAL A C   1 
ATOM   381  O O   . VAL A 1 50  ? 26.064 -5.283  -47.653 1.00 7.38  ? 50  VAL A O   1 
ATOM   382  C CB  . VAL A 1 50  ? 28.271 -3.356  -46.463 1.00 6.48  ? 50  VAL A CB  1 
ATOM   383  C CG1 . VAL A 1 50  ? 27.888 -2.104  -47.291 1.00 8.06  ? 50  VAL A CG1 1 
ATOM   384  C CG2 . VAL A 1 50  ? 29.272 -3.003  -45.347 1.00 7.85  ? 50  VAL A CG2 1 
ATOM   385  N N   . VAL A 1 51  ? 24.901 -3.465  -46.930 1.00 6.65  ? 51  VAL A N   1 
ATOM   386  C CA  . VAL A 1 51  ? 23.787 -3.620  -47.872 1.00 6.89  ? 51  VAL A CA  1 
ATOM   387  C C   . VAL A 1 51  ? 23.847 -2.524  -48.907 1.00 6.70  ? 51  VAL A C   1 
ATOM   388  O O   . VAL A 1 51  ? 23.830 -1.338  -48.550 1.00 7.83  ? 51  VAL A O   1 
ATOM   389  C CB  . VAL A 1 51  ? 22.456 -3.620  -47.120 1.00 7.80  ? 51  VAL A CB  1 
ATOM   390  C CG1 . VAL A 1 51  ? 21.297 -3.660  -48.139 1.00 9.60  ? 51  VAL A CG1 1 
ATOM   391  C CG2 . VAL A 1 51  ? 22.352 -4.797  -46.145 1.00 9.26  ? 51  VAL A CG2 1 
ATOM   392  N N   . ILE A 1 52  ? 23.992 -2.915  -50.175 1.00 6.91  ? 52  ILE A N   1 
ATOM   393  C CA  . ILE A 1 52  ? 24.142 -1.997  -51.297 1.00 7.35  ? 52  ILE A CA  1 
ATOM   394  C C   . ILE A 1 52  ? 22.935 -2.103  -52.201 1.00 7.38  ? 52  ILE A C   1 
ATOM   395  O O   . ILE A 1 52  ? 22.491 -3.214  -52.524 1.00 9.02  ? 52  ILE A O   1 
ATOM   396  C CB  . ILE A 1 52  ? 25.451 -2.287  -52.062 1.00 8.07  ? 52  ILE A CB  1 
ATOM   397  C CG1 . ILE A 1 52  ? 26.658 -2.001  -51.184 1.00 9.40  ? 52  ILE A CG1 1 
ATOM   398  C CG2 . ILE A 1 52  ? 25.501 -1.537  -53.400 1.00 9.17  ? 52  ILE A CG2 1 
ATOM   399  C CD1 . ILE A 1 52  ? 27.976 -2.438  -51.743 1.00 11.17 ? 52  ILE A CD1 1 
ATOM   400  N N   A CYS A 1 53  ? 22.338 -0.963  -52.595 0.70 7.60  ? 53  CYS A N   1 
ATOM   401  N N   B CYS A 1 53  ? 22.447 -0.945  -52.621 0.29 8.42  ? 53  CYS A N   1 
ATOM   402  C CA  A CYS A 1 53  ? 21.254 -0.950  -53.549 0.70 8.33  ? 53  CYS A CA  1 
ATOM   403  C CA  B CYS A 1 53  ? 21.304 -0.900  -53.517 0.29 8.62  ? 53  CYS A CA  1 
ATOM   404  C C   A CYS A 1 53  ? 21.813 -0.828  -54.976 0.70 8.89  ? 53  CYS A C   1 
ATOM   405  C C   B CYS A 1 53  ? 21.747 -0.799  -54.968 0.29 6.88  ? 53  CYS A C   1 
ATOM   406  O O   A CYS A 1 53  ? 22.480 0.168   -55.268 0.70 9.80  ? 53  CYS A O   1 
ATOM   407  O O   B CYS A 1 53  ? 22.280 0.244   -55.370 0.29 8.81  ? 53  CYS A O   1 
ATOM   408  C CB  A CYS A 1 53  ? 20.300 0.232   -53.362 0.70 10.16 ? 53  CYS A CB  1 
ATOM   409  C CB  B CYS A 1 53  ? 20.455 0.295   -53.071 0.29 10.04 ? 53  CYS A CB  1 
ATOM   410  S SG  A CYS A 1 53  ? 19.647 0.214   -51.697 0.70 16.45 ? 53  CYS A SG  1 
ATOM   411  S SG  B CYS A 1 53  ? 18.779 0.208   -53.741 0.29 21.79 ? 53  CYS A SG  1 
ATOM   412  N N   . PRO A 1 54  ? 21.574 -1.823  -55.808 1.00 8.46  ? 54  PRO A N   1 
ATOM   413  C CA  . PRO A 1 54  ? 22.100 -1.709  -57.168 1.00 8.95  ? 54  PRO A CA  1 
ATOM   414  C C   . PRO A 1 54  ? 21.423 -0.655  -58.007 1.00 8.39  ? 54  PRO A C   1 
ATOM   415  O O   . PRO A 1 54  ? 20.303 -0.246  -57.741 1.00 9.91  ? 54  PRO A O   1 
ATOM   416  C CB  . PRO A 1 54  ? 21.807 -3.085  -57.753 1.00 12.14 ? 54  PRO A CB  1 
ATOM   417  C CG  . PRO A 1 54  ? 20.949 -3.805  -56.824 1.00 23.01 ? 54  PRO A CG  1 
ATOM   418  C CD  . PRO A 1 54  ? 20.876 -3.082  -55.537 1.00 10.60 ? 54  PRO A CD  1 
ATOM   419  N N   . ASP A 1 55  ? 22.096 -0.221  -59.065 1.00 8.35  ? 55  ASP A N   1 
ATOM   420  C CA  . ASP A 1 55  ? 21.546 0.757   -59.989 1.00 8.86  ? 55  ASP A CA  1 
ATOM   421  C C   . ASP A 1 55  ? 20.446 0.142   -60.831 1.00 9.44  ? 55  ASP A C   1 
ATOM   422  O O   . ASP A 1 55  ? 19.528 0.870   -61.267 1.00 11.24 ? 55  ASP A O   1 
ATOM   423  C CB  . ASP A 1 55  ? 22.623 1.287   -60.935 1.00 8.72  ? 55  ASP A CB  1 
ATOM   424  C CG  . ASP A 1 55  ? 23.779 1.958   -60.221 1.00 8.21  ? 55  ASP A CG  1 
ATOM   425  O OD1 . ASP A 1 55  ? 23.498 2.680   -59.240 1.00 11.22 ? 55  ASP A OD1 1 
ATOM   426  O OD2 . ASP A 1 55  ? 24.932 1.831   -60.651 1.00 9.04  ? 55  ASP A OD2 1 
ATOM   427  N N   . ALA A 1 56  ? 20.526 -1.140  -61.141 1.00 9.52  ? 56  ALA A N   1 
ATOM   428  C CA  . ALA A 1 56  ? 19.633 -1.796  -62.059 1.00 11.60 ? 56  ALA A CA  1 
ATOM   429  C C   . ALA A 1 56  ? 19.702 -3.303  -61.783 1.00 11.57 ? 56  ALA A C   1 
ATOM   430  O O   . ALA A 1 56  ? 20.675 -3.802  -61.207 1.00 10.83 ? 56  ALA A O   1 
ATOM   431  C CB  . ALA A 1 56  ? 20.068 -1.532  -63.479 1.00 13.30 ? 56  ALA A CB  1 
ATOM   432  N N   . SER A 1 57  ? 18.704 -4.039  -62.247 1.00 12.11 ? 57  SER A N   1 
ATOM   433  C CA  . SER A 1 57  ? 18.837 -5.483  -62.348 1.00 12.78 ? 57  SER A CA  1 
ATOM   434  C C   . SER A 1 57  ? 19.834 -5.855  -63.456 1.00 11.96 ? 57  SER A C   1 
ATOM   435  O O   . SER A 1 57  ? 20.029 -5.087  -64.411 1.00 12.49 ? 57  SER A O   1 
ATOM   436  C CB  . SER A 1 57  ? 17.464 -6.110  -62.691 1.00 14.42 ? 57  SER A CB  1 
ATOM   437  O OG  . SER A 1 57  ? 17.107 -5.762  -64.034 1.00 16.74 ? 57  SER A OG  1 
ATOM   438  N N   . LEU A 1 58  ? 20.440 -7.037  -63.345 1.00 12.32 ? 58  LEU A N   1 
ATOM   439  C CA  . LEU A 1 58  ? 21.279 -7.519  -64.418 1.00 12.15 ? 58  LEU A CA  1 
ATOM   440  C C   . LEU A 1 58  ? 20.523 -7.632  -65.737 1.00 15.14 ? 58  LEU A C   1 
ATOM   441  O O   . LEU A 1 58  ? 21.066 -7.301  -66.808 1.00 17.37 ? 58  LEU A O   1 
ATOM   442  C CB  . LEU A 1 58  ? 21.918 -8.856  -64.031 1.00 12.81 ? 58  LEU A CB  1 
ATOM   443  C CG  . LEU A 1 58  ? 22.989 -9.390  -65.018 1.00 12.03 ? 58  LEU A CG  1 
ATOM   444  C CD1 . LEU A 1 58  ? 24.120 -8.384  -65.214 1.00 13.57 ? 58  LEU A CD1 1 
ATOM   445  C CD2 . LEU A 1 58  ? 23.501 -10.714 -64.515 1.00 13.10 ? 58  LEU A CD2 1 
ATOM   446  N N   A GLU A 1 59  ? 19.268 -8.088  -65.668 0.66 18.55 ? 59  GLU A N   1 
ATOM   447  N N   B GLU A 1 59  ? 19.284 -8.101  -65.727 0.34 19.16 ? 59  GLU A N   1 
ATOM   448  C CA  A GLU A 1 59  ? 18.451 -8.210  -66.882 0.66 22.29 ? 59  GLU A CA  1 
ATOM   449  C CA  B GLU A 1 59  ? 18.592 -8.189  -67.025 0.34 22.69 ? 59  GLU A CA  1 
ATOM   450  C C   A GLU A 1 59  ? 18.328 -6.916  -67.675 0.66 22.50 ? 59  GLU A C   1 
ATOM   451  C C   B GLU A 1 59  ? 18.452 -6.819  -67.681 0.34 22.10 ? 59  GLU A C   1 
ATOM   452  O O   A GLU A 1 59  ? 18.408 -6.832  -68.900 0.66 26.70 ? 59  GLU A O   1 
ATOM   453  O O   B GLU A 1 59  ? 18.645 -6.658  -68.885 0.34 23.06 ? 59  GLU A O   1 
ATOM   454  C CB  A GLU A 1 59  ? 17.040 -8.712  -66.481 0.66 32.51 ? 59  GLU A CB  1 
ATOM   455  C CB  B GLU A 1 59  ? 17.226 -8.853  -66.862 0.34 29.40 ? 59  GLU A CB  1 
ATOM   456  C CG  A GLU A 1 59  ? 16.268 -9.327  -67.623 0.66 36.32 ? 59  GLU A CG  1 
ATOM   457  C CG  B GLU A 1 59  ? 16.708 -9.001  -65.447 0.34 36.39 ? 59  GLU A CG  1 
ATOM   458  C CD  A GLU A 1 59  ? 14.785 -9.521  -67.615 0.66 44.15 ? 59  GLU A CD  1 
ATOM   459  C CD  B GLU A 1 59  ? 15.262 -9.428  -65.356 0.34 39.34 ? 59  GLU A CD  1 
ATOM   460  O OE1 A GLU A 1 59  ? 14.244 -9.727  -68.740 0.66 57.00 ? 59  GLU A OE1 1 
ATOM   461  O OE1 B GLU A 1 59  ? 14.864 -10.356 -66.084 0.34 34.15 ? 59  GLU A OE1 1 
ATOM   462  O OE2 A GLU A 1 59  ? 14.120 -9.499  -66.558 0.66 46.93 ? 59  GLU A OE2 1 
ATOM   463  O OE2 B GLU A 1 59  ? 14.532 -8.832  -64.538 0.34 46.21 ? 59  GLU A OE2 1 
ATOM   464  N N   A ASP A 1 60  ? 18.096 -5.824  -66.914 0.74 20.11 ? 60  ASP A N   1 
ATOM   465  N N   B ASP A 1 60  ? 18.111 -5.807  -66.880 0.26 19.20 ? 60  ASP A N   1 
ATOM   466  C CA  A ASP A 1 60  ? 17.968 -4.535  -67.577 0.74 19.77 ? 60  ASP A CA  1 
ATOM   467  C CA  B ASP A 1 60  ? 17.993 -4.449  -67.402 0.26 18.73 ? 60  ASP A CA  1 
ATOM   468  C C   A ASP A 1 60  ? 19.330 -4.009  -68.009 0.74 19.91 ? 60  ASP A C   1 
ATOM   469  C C   B ASP A 1 60  ? 19.323 -3.980  -67.988 0.26 20.40 ? 60  ASP A C   1 
ATOM   470  O O   . ASP A 1 60  ? 19.466 -3.449  -69.094 1.00 25.83 ? 60  ASP A O   1 
ATOM   471  C CB  A ASP A 1 60  ? 17.232 -3.527  -66.688 0.74 18.36 ? 60  ASP A CB  1 
ATOM   472  C CB  B ASP A 1 60  ? 17.550 -3.495  -66.300 0.26 18.28 ? 60  ASP A CB  1 
ATOM   473  C CG  A ASP A 1 60  ? 15.799 -3.893  -66.446 0.74 19.52 ? 60  ASP A CG  1 
ATOM   474  C CG  B ASP A 1 60  ? 16.086 -3.168  -66.229 0.26 19.69 ? 60  ASP A CG  1 
ATOM   475  O OD1 A ASP A 1 60  ? 15.171 -4.680  -67.193 0.74 24.48 ? 60  ASP A OD1 1 
ATOM   476  O OD1 B ASP A 1 60  ? 15.256 -3.803  -66.913 0.26 21.72 ? 60  ASP A OD1 1 
ATOM   477  O OD2 A ASP A 1 60  ? 15.196 -3.369  -65.492 0.74 22.11 ? 60  ASP A OD2 1 
ATOM   478  O OD2 B ASP A 1 60  ? 15.742 -2.235  -65.453 0.26 24.46 ? 60  ASP A OD2 1 
ATOM   479  N N   . ALA A 1 61  ? 20.354 -4.202  -67.159 1.00 15.64 ? 61  ALA A N   1 
ATOM   480  C CA  . ALA A 1 61  ? 21.682 -3.711  -67.507 1.00 15.65 ? 61  ALA A CA  1 
ATOM   481  C C   . ALA A 1 61  ? 22.162 -4.378  -68.812 1.00 16.71 ? 61  ALA A C   1 
ATOM   482  O O   . ALA A 1 61  ? 22.806 -3.738  -69.633 1.00 18.69 ? 61  ALA A O   1 
ATOM   483  C CB  . ALA A 1 61  ? 22.654 -3.955  -66.362 1.00 14.35 ? 61  ALA A CB  1 
ATOM   484  N N   . LYS A 1 62  ? 21.811 -5.666  -68.980 1.00 18.57 ? 62  LYS A N   1 
ATOM   485  C CA  . LYS A 1 62  ? 22.304 -6.274  -70.172 1.00 22.56 ? 62  LYS A CA  1 
ATOM   486  C C   . LYS A 1 62  ? 21.725 -5.603  -71.407 1.00 26.66 ? 62  LYS A C   1 
ATOM   487  O O   . LYS A 1 62  ? 22.393 -5.520  -72.440 1.00 30.10 ? 62  LYS A O   1 
ATOM   488  C CB  . LYS A 1 62  ? 21.877 -7.730  -70.202 1.00 27.44 ? 62  LYS A CB  1 
ATOM   489  C CG  . LYS A 1 62  ? 22.326 -8.410  -71.485 1.00 28.45 ? 62  LYS A CG  1 
ATOM   490  C CD  . LYS A 1 62  ? 22.152 -9.909  -71.305 1.00 33.76 ? 62  LYS A CD  1 
ATOM   491  C CE  . LYS A 1 62  ? 22.878 -10.834 -72.265 1.00 31.94 ? 62  LYS A CE  1 
ATOM   492  N NZ  . LYS A 1 62  ? 22.295 -10.786 -73.643 1.00 45.81 ? 62  LYS A NZ  1 
ATOM   493  N N   . LYS A 1 63  ? 20.513 -5.128  -71.305 1.00 23.82 ? 63  LYS A N   1 
ATOM   494  C CA  . LYS A 1 63  ? 19.794 -4.581  -72.442 1.00 27.22 ? 63  LYS A CA  1 
ATOM   495  C C   . LYS A 1 63  ? 20.498 -3.285  -72.837 1.00 30.42 ? 63  LYS A C   1 
ATOM   496  O O   . LYS A 1 63  ? 20.346 -2.904  -74.003 1.00 35.58 ? 63  LYS A O   1 
ATOM   497  C CB  . LYS A 1 63  ? 18.314 -4.386  -72.097 1.00 30.97 ? 63  LYS A CB  1 
ATOM   498  C CG  . LYS A 1 63  ? 17.575 -5.720  -72.235 1.00 44.23 ? 63  LYS A CG  1 
ATOM   499  C CD  . LYS A 1 63  ? 16.623 -6.014  -71.098 1.00 60.42 ? 63  LYS A CD  1 
ATOM   500  C CE  . LYS A 1 63  ? 15.633 -7.108  -71.496 1.00 65.63 ? 63  LYS A CE  1 
ATOM   501  N NZ  . LYS A 1 63  ? 14.715 -7.449  -70.371 1.00 82.00 ? 63  LYS A NZ  1 
ATOM   502  N N   . GLU A 1 64  ? 21.213 -2.660  -71.928 1.00 26.85 ? 64  GLU A N   1 
ATOM   503  C CA  . GLU A 1 64  ? 21.872 -1.381  -72.150 1.00 26.69 ? 64  GLU A CA  1 
ATOM   504  C C   . GLU A 1 64  ? 23.358 -1.497  -72.513 1.00 25.02 ? 64  GLU A C   1 
ATOM   505  O O   . GLU A 1 64  ? 24.055 -0.486  -72.501 1.00 30.39 ? 64  GLU A O   1 
ATOM   506  C CB  . GLU A 1 64  ? 21.849 -0.469  -70.905 1.00 31.48 ? 64  GLU A CB  1 
ATOM   507  C CG  . GLU A 1 64  ? 20.452 -0.330  -70.300 1.00 34.67 ? 64  GLU A CG  1 
ATOM   508  C CD  . GLU A 1 64  ? 19.471 0.238   -71.302 1.00 46.51 ? 64  GLU A CD  1 
ATOM   509  O OE1 . GLU A 1 64  ? 19.849 1.079   -72.158 1.00 50.30 ? 64  GLU A OE1 1 
ATOM   510  O OE2 . GLU A 1 64  ? 18.293 -0.177  -71.238 1.00 58.20 ? 64  GLU A OE2 1 
ATOM   511  N N   . GLY A 1 65  ? 23.805 -2.688  -72.779 1.00 21.89 ? 65  GLY A N   1 
ATOM   512  C CA  . GLY A 1 65  ? 25.207 -3.012  -73.121 1.00 23.22 ? 65  GLY A CA  1 
ATOM   513  C C   . GLY A 1 65  ? 25.465 -2.766  -74.601 1.00 27.36 ? 65  GLY A C   1 
ATOM   514  O O   . GLY A 1 65  ? 24.549 -2.237  -75.290 1.00 35.20 ? 65  GLY A O   1 
ATOM   515  N N   . PRO A 1 66  ? 26.628 -3.182  -75.111 1.00 29.48 ? 66  PRO A N   1 
ATOM   516  C CA  . PRO A 1 66  ? 27.669 -3.829  -74.339 1.00 25.67 ? 66  PRO A CA  1 
ATOM   517  C C   . PRO A 1 66  ? 28.530 -2.814  -73.593 1.00 18.99 ? 66  PRO A C   1 
ATOM   518  O O   . PRO A 1 66  ? 28.428 -1.611  -73.755 1.00 24.38 ? 66  PRO A O   1 
ATOM   519  C CB  . PRO A 1 66  ? 28.454 -4.567  -75.395 1.00 30.46 ? 66  PRO A CB  1 
ATOM   520  C CG  . PRO A 1 66  ? 28.340 -3.696  -76.599 1.00 34.36 ? 66  PRO A CG  1 
ATOM   521  C CD  . PRO A 1 66  ? 26.947 -3.101  -76.543 1.00 33.66 ? 66  PRO A CD  1 
ATOM   522  N N   . TYR A 1 67  ? 29.408 -3.346  -72.774 1.00 12.44 ? 67  TYR A N   1 
ATOM   523  C CA  . TYR A 1 67  ? 30.256 -2.640  -71.876 1.00 10.06 ? 67  TYR A CA  1 
ATOM   524  C C   . TYR A 1 67  ? 31.724 -2.812  -72.247 1.00 8.64  ? 67  TYR A C   1 
ATOM   525  O O   . TYR A 1 67  ? 32.126 -3.863  -72.727 1.00 10.13 ? 67  TYR A O   1 
ATOM   526  C CB  . TYR A 1 67  ? 30.000 -3.122  -70.409 1.00 9.75  ? 67  TYR A CB  1 
ATOM   527  C CG  . TYR A 1 67  ? 28.603 -2.865  -69.996 1.00 9.46  ? 67  TYR A CG  1 
ATOM   528  C CD1 . TYR A 1 67  ? 27.531 -3.751  -70.226 1.00 10.57 ? 67  TYR A CD1 1 
ATOM   529  C CD2 . TYR A 1 67  ? 28.281 -1.689  -69.331 1.00 11.20 ? 67  TYR A CD2 1 
ATOM   530  C CE1 . TYR A 1 67  ? 26.258 -3.480  -69.834 1.00 10.68 ? 67  TYR A CE1 1 
ATOM   531  C CE2 . TYR A 1 67  ? 26.967 -1.425  -68.949 1.00 12.46 ? 67  TYR A CE2 1 
ATOM   532  C CZ  . TYR A 1 67  ? 25.945 -2.322  -69.177 1.00 12.45 ? 67  TYR A CZ  1 
ATOM   533  O OH  . TYR A 1 67  ? 24.638 -2.024  -68.822 1.00 15.40 ? 67  TYR A OH  1 
ATOM   534  N N   . ASP A 1 68  ? 32.520 -1.779  -71.962 1.00 9.14  ? 68  ASP A N   1 
ATOM   535  C CA  . ASP A 1 68  ? 33.954 -1.873  -72.185 1.00 9.07  ? 68  ASP A CA  1 
ATOM   536  C C   . ASP A 1 68  ? 34.650 -2.781  -71.189 1.00 8.73  ? 68  ASP A C   1 
ATOM   537  O O   . ASP A 1 68  ? 35.748 -3.300  -71.457 1.00 10.17 ? 68  ASP A O   1 
ATOM   538  C CB  . ASP A 1 68  ? 34.559 -0.462  -72.192 1.00 9.66  ? 68  ASP A CB  1 
ATOM   539  C CG  . ASP A 1 68  ? 33.891 0.369   -73.266 1.00 11.17 ? 68  ASP A CG  1 
ATOM   540  O OD1 . ASP A 1 68  ? 34.184 0.095   -74.454 1.00 14.60 ? 68  ASP A OD1 1 
ATOM   541  O OD2 . ASP A 1 68  ? 33.104 1.249   -72.946 1.00 11.78 ? 68  ASP A OD2 1 
ATOM   542  N N   . VAL A 1 69  ? 34.090 -2.995  -70.003 1.00 8.13  ? 69  VAL A N   1 
ATOM   543  C CA  . VAL A 1 69  ? 34.584 -3.971  -69.047 1.00 8.00  ? 69  VAL A CA  1 
ATOM   544  C C   . VAL A 1 69  ? 33.394 -4.557  -68.259 1.00 7.16  ? 69  VAL A C   1 
ATOM   545  O O   . VAL A 1 69  ? 32.454 -3.821  -67.951 1.00 7.88  ? 69  VAL A O   1 
ATOM   546  C CB  . VAL A 1 69  ? 35.642 -3.378  -68.098 1.00 7.53  ? 69  VAL A CB  1 
ATOM   547  C CG1 . VAL A 1 69  ? 35.119 -2.232  -67.216 1.00 8.64  ? 69  VAL A CG1 1 
ATOM   548  C CG2 . VAL A 1 69  ? 36.274 -4.427  -67.209 1.00 8.11  ? 69  VAL A CG2 1 
ATOM   549  N N   . VAL A 1 70  ? 33.501 -5.871  -67.980 1.00 7.20  ? 70  VAL A N   1 
ATOM   550  C CA  . VAL A 1 70  ? 32.618 -6.542  -67.038 1.00 6.85  ? 70  VAL A CA  1 
ATOM   551  C C   . VAL A 1 70  ? 33.495 -6.884  -65.838 1.00 6.37  ? 70  VAL A C   1 
ATOM   552  O O   . VAL A 1 70  ? 34.540 -7.529  -66.004 1.00 6.76  ? 70  VAL A O   1 
ATOM   553  C CB  . VAL A 1 70  ? 31.979 -7.786  -67.658 1.00 7.33  ? 70  VAL A CB  1 
ATOM   554  C CG1 . VAL A 1 70  ? 31.117 -8.490  -66.609 1.00 9.49  ? 70  VAL A CG1 1 
ATOM   555  C CG2 . VAL A 1 70  ? 31.153 -7.382  -68.873 1.00 8.34  ? 70  VAL A CG2 1 
ATOM   556  N N   . VAL A 1 71  ? 33.022 -6.467  -64.646 1.00 6.45  ? 71  VAL A N   1 
ATOM   557  C CA  . VAL A 1 71  ? 33.783 -6.616  -63.391 1.00 6.53  ? 71  VAL A CA  1 
ATOM   558  C C   . VAL A 1 71  ? 33.079 -7.573  -62.443 1.00 6.16  ? 71  VAL A C   1 
ATOM   559  O O   . VAL A 1 71  ? 31.899 -7.377  -62.152 1.00 7.19  ? 71  VAL A O   1 
ATOM   560  C CB  . VAL A 1 71  ? 33.957 -5.241  -62.701 1.00 7.07  ? 71  VAL A CB  1 
ATOM   561  C CG1 . VAL A 1 71  ? 34.772 -5.389  -61.400 1.00 8.22  ? 71  VAL A CG1 1 
ATOM   562  C CG2 . VAL A 1 71  ? 34.591 -4.223  -63.656 1.00 8.40  ? 71  VAL A CG2 1 
ATOM   563  N N   . LEU A 1 72  ? 33.841 -8.552  -61.974 1.00 6.04  ? 72  LEU A N   1 
ATOM   564  C CA  . LEU A 1 72  ? 33.372 -9.536  -60.998 1.00 6.40  ? 72  LEU A CA  1 
ATOM   565  C C   . LEU A 1 72  ? 34.102 -9.375  -59.674 1.00 6.68  ? 72  LEU A C   1 
ATOM   566  O O   . LEU A 1 72  ? 35.288 -9.699  -59.557 1.00 7.43  ? 72  LEU A O   1 
ATOM   567  C CB  . LEU A 1 72  ? 33.611 -10.935 -61.537 1.00 6.68  ? 72  LEU A CB  1 
ATOM   568  C CG  . LEU A 1 72  ? 33.111 -11.281 -62.922 1.00 7.83  ? 72  LEU A CG  1 
ATOM   569  C CD1 . LEU A 1 72  ? 33.345 -12.776 -63.197 1.00 9.61  ? 72  LEU A CD1 1 
ATOM   570  C CD2 . LEU A 1 72  ? 31.619 -10.963 -63.075 1.00 8.50  ? 72  LEU A CD2 1 
ATOM   571  N N   . PRO A 1 73  ? 33.416 -8.839  -58.656 1.00 6.30  ? 73  PRO A N   1 
ATOM   572  C CA  . PRO A 1 73  ? 33.978 -8.814  -57.292 1.00 6.26  ? 73  PRO A CA  1 
ATOM   573  C C   . PRO A 1 73  ? 34.155 -10.247 -56.801 1.00 5.79  ? 73  PRO A C   1 
ATOM   574  O O   . PRO A 1 73  ? 33.643 -11.193 -57.357 1.00 6.73  ? 73  PRO A O   1 
ATOM   575  C CB  . PRO A 1 73  ? 32.905 -8.109  -56.489 1.00 6.66  ? 73  PRO A CB  1 
ATOM   576  C CG  . PRO A 1 73  ? 32.023 -7.393  -57.463 1.00 7.98  ? 73  PRO A CG  1 
ATOM   577  C CD  . PRO A 1 73  ? 32.064 -8.283  -58.668 1.00 7.28  ? 73  PRO A CD  1 
ATOM   578  N N   . GLY A 1 74  ? 34.900 -10.333 -55.676 1.00 5.84  ? 74  GLY A N   1 
ATOM   579  C CA  . GLY A 1 74  ? 35.097 -11.576 -54.974 1.00 6.33  ? 74  GLY A CA  1 
ATOM   580  C C   . GLY A 1 74  ? 34.171 -11.770 -53.813 1.00 5.40  ? 74  GLY A C   1 
ATOM   581  O O   . GLY A 1 74  ? 33.017 -11.321 -53.855 1.00 6.51  ? 74  GLY A O   1 
ATOM   582  N N   . GLY A 1 75  ? 34.678 -12.410 -52.756 1.00 6.28  ? 75  GLY A N   1 
ATOM   583  C CA  . GLY A 1 75  ? 33.833 -12.986 -51.689 1.00 6.86  ? 75  GLY A CA  1 
ATOM   584  C C   . GLY A 1 75  ? 33.432 -14.396 -52.118 1.00 6.59  ? 75  GLY A C   1 
ATOM   585  O O   . GLY A 1 75  ? 32.928 -14.561 -53.246 1.00 8.92  ? 75  GLY A O   1 
ATOM   586  N N   . ASN A 1 76  ? 33.696 -15.432 -51.340 1.00 7.04  ? 76  ASN A N   1 
ATOM   587  C CA  . ASN A 1 76  ? 33.408 -16.773 -51.850 1.00 7.57  ? 76  ASN A CA  1 
ATOM   588  C C   . ASN A 1 76  ? 31.953 -16.990 -52.219 1.00 7.57  ? 76  ASN A C   1 
ATOM   589  O O   . ASN A 1 76  ? 31.682 -17.630 -53.247 1.00 7.76  ? 76  ASN A O   1 
ATOM   590  C CB  . ASN A 1 76  ? 33.799 -17.805 -50.794 1.00 8.49  ? 76  ASN A CB  1 
ATOM   591  C CG  . ASN A 1 76  ? 35.284 -18.088 -50.805 1.00 10.36 ? 76  ASN A CG  1 
ATOM   592  O OD1 . ASN A 1 76  ? 36.030 -17.765 -51.724 1.00 14.85 ? 76  ASN A OD1 1 
ATOM   593  N ND2 . ASN A 1 76  ? 35.722 -18.688 -49.717 1.00 14.40 ? 76  ASN A ND2 1 
ATOM   594  N N   A LEU A 1 77  ? 31.026 -16.510 -51.390 0.73 7.57  ? 77  LEU A N   1 
ATOM   595  N N   B LEU A 1 77  ? 31.023 -16.512 -51.394 0.27 7.19  ? 77  LEU A N   1 
ATOM   596  C CA  A LEU A 1 77  ? 29.612 -16.815 -51.695 0.73 7.40  ? 77  LEU A CA  1 
ATOM   597  C CA  B LEU A 1 77  ? 29.593 -16.741 -51.615 0.27 7.48  ? 77  LEU A CA  1 
ATOM   598  C C   A LEU A 1 77  ? 29.130 -15.976 -52.868 0.73 6.90  ? 77  LEU A C   1 
ATOM   599  C C   B LEU A 1 77  ? 29.105 -15.953 -52.829 0.27 8.69  ? 77  LEU A C   1 
ATOM   600  O O   A LEU A 1 77  ? 28.320 -16.454 -53.676 0.73 8.56  ? 77  LEU A O   1 
ATOM   601  O O   B LEU A 1 77  ? 28.278 -16.451 -53.594 0.27 8.58  ? 77  LEU A O   1 
ATOM   602  C CB  A LEU A 1 77  ? 28.739 -16.637 -50.446 0.73 8.13  ? 77  LEU A CB  1 
ATOM   603  C CB  B LEU A 1 77  ? 28.744 -16.370 -50.401 0.27 8.50  ? 77  LEU A CB  1 
ATOM   604  C CG  A LEU A 1 77  ? 28.720 -17.774 -49.418 0.73 10.33 ? 77  LEU A CG  1 
ATOM   605  C CG  B LEU A 1 77  ? 28.378 -17.441 -49.376 0.27 8.67  ? 77  LEU A CG  1 
ATOM   606  C CD1 A LEU A 1 77  ? 30.095 -18.129 -48.911 0.73 12.43 ? 77  LEU A CD1 1 
ATOM   607  C CD1 B LEU A 1 77  ? 27.668 -18.641 -49.992 0.27 18.24 ? 77  LEU A CD1 1 
ATOM   608  C CD2 A LEU A 1 77  ? 27.837 -17.437 -48.218 0.73 10.60 ? 77  LEU A CD2 1 
ATOM   609  C CD2 B LEU A 1 77  ? 29.635 -17.895 -48.634 0.27 14.52 ? 77  LEU A CD2 1 
ATOM   610  N N   . GLY A 1 78  ? 29.617 -14.738 -52.985 1.00 6.87  ? 78  GLY A N   1 
ATOM   611  C CA  . GLY A 1 78  ? 29.277 -13.928 -54.168 1.00 7.34  ? 78  GLY A CA  1 
ATOM   612  C C   . GLY A 1 78  ? 29.799 -14.607 -55.440 1.00 6.60  ? 78  GLY A C   1 
ATOM   613  O O   . GLY A 1 78  ? 29.095 -14.734 -56.446 1.00 7.42  ? 78  GLY A O   1 
ATOM   614  N N   . ALA A 1 79  ? 31.033 -15.061 -55.405 1.00 6.91  ? 79  ALA A N   1 
ATOM   615  C CA  . ALA A 1 79  ? 31.617 -15.747 -56.580 1.00 6.57  ? 79  ALA A CA  1 
ATOM   616  C C   . ALA A 1 79  ? 30.871 -17.010 -56.927 1.00 7.42  ? 79  ALA A C   1 
ATOM   617  O O   . ALA A 1 79  ? 30.678 -17.318 -58.113 1.00 7.52  ? 79  ALA A O   1 
ATOM   618  C CB  . ALA A 1 79  ? 33.095 -16.020 -56.355 1.00 8.09  ? 79  ALA A CB  1 
ATOM   619  N N   A GLN A 1 80  ? 30.409 -17.746 -55.912 0.63 9.50  ? 80  GLN A N   1 
ATOM   620  N N   B GLN A 1 80  ? 30.438 -17.762 -55.920 0.37 5.88  ? 80  GLN A N   1 
ATOM   621  C CA  A GLN A 1 80  ? 29.630 -18.946 -56.179 0.63 8.16  ? 80  GLN A CA  1 
ATOM   622  C CA  B GLN A 1 80  ? 29.647 -18.952 -56.198 0.37 8.07  ? 80  GLN A CA  1 
ATOM   623  C C   A GLN A 1 80  ? 28.298 -18.616 -56.846 0.63 8.27  ? 80  GLN A C   1 
ATOM   624  C C   B GLN A 1 80  ? 28.329 -18.591 -56.869 0.37 7.84  ? 80  GLN A C   1 
ATOM   625  O O   A GLN A 1 80  ? 27.830 -19.293 -57.785 0.63 9.76  ? 80  GLN A O   1 
ATOM   626  O O   B GLN A 1 80  ? 27.924 -19.252 -57.840 0.37 7.96  ? 80  GLN A O   1 
ATOM   627  C CB  A GLN A 1 80  ? 29.396 -19.773 -54.916 0.63 13.38 ? 80  GLN A CB  1 
ATOM   628  C CB  B GLN A 1 80  ? 29.395 -19.741 -54.916 0.37 7.47  ? 80  GLN A CB  1 
ATOM   629  C CG  A GLN A 1 80  ? 28.547 -21.003 -55.163 0.63 18.32 ? 80  GLN A CG  1 
ATOM   630  C CG  B GLN A 1 80  ? 28.788 -21.103 -55.208 0.37 9.94  ? 80  GLN A CG  1 
ATOM   631  C CD  A GLN A 1 80  ? 29.134 -22.166 -55.920 0.63 19.55 ? 80  GLN A CD  1 
ATOM   632  C CD  B GLN A 1 80  ? 29.772 -22.096 -55.798 0.37 13.56 ? 80  GLN A CD  1 
ATOM   633  O OE1 A GLN A 1 80  ? 29.308 -23.257 -55.349 0.63 36.66 ? 80  GLN A OE1 1 
ATOM   634  O OE1 B GLN A 1 80  ? 30.979 -21.997 -55.560 0.37 20.68 ? 80  GLN A OE1 1 
ATOM   635  N NE2 A GLN A 1 80  ? 29.443 -22.021 -57.220 0.63 15.74 ? 80  GLN A NE2 1 
ATOM   636  N NE2 B GLN A 1 80  ? 29.248 -23.062 -56.558 0.37 16.92 ? 80  GLN A NE2 1 
ATOM   637  N N   . ASN A 1 81  ? 27.663 -17.556 -56.368 1.00 7.63  ? 81  ASN A N   1 
ATOM   638  C CA  . ASN A 1 81  ? 26.424 -17.136 -57.017 1.00 8.08  ? 81  ASN A CA  1 
ATOM   639  C C   . ASN A 1 81  ? 26.662 -16.683 -58.448 1.00 7.83  ? 81  ASN A C   1 
ATOM   640  O O   . ASN A 1 81  ? 25.870 -16.994 -59.349 1.00 9.32  ? 81  ASN A O   1 
ATOM   641  C CB  . ASN A 1 81  ? 25.760 -16.039 -56.181 1.00 8.25  ? 81  ASN A CB  1 
ATOM   642  C CG  . ASN A 1 81  ? 25.092 -16.531 -54.928 1.00 9.66  ? 81  ASN A CG  1 
ATOM   643  O OD1 . ASN A 1 81  ? 24.479 -17.599 -54.940 1.00 13.54 ? 81  ASN A OD1 1 
ATOM   644  N ND2 . ASN A 1 81  ? 25.173 -15.789 -53.849 1.00 10.69 ? 81  ASN A ND2 1 
ATOM   645  N N   . LEU A 1 82  ? 27.761 -15.978 -58.712 1.00 7.48  ? 82  LEU A N   1 
ATOM   646  C CA  . LEU A 1 82  ? 28.117 -15.615 -60.119 1.00 7.30  ? 82  LEU A CA  1 
ATOM   647  C C   . LEU A 1 82  ? 28.345 -16.874 -60.956 1.00 7.39  ? 82  LEU A C   1 
ATOM   648  O O   . LEU A 1 82  ? 27.926 -16.936 -62.113 1.00 8.81  ? 82  LEU A O   1 
ATOM   649  C CB  . LEU A 1 82  ? 29.378 -14.722 -60.137 1.00 7.34  ? 82  LEU A CB  1 
ATOM   650  C CG  . LEU A 1 82  ? 29.240 -13.353 -59.474 1.00 7.39  ? 82  LEU A CG  1 
ATOM   651  C CD1 . LEU A 1 82  ? 30.580 -12.658 -59.449 1.00 8.43  ? 82  LEU A CD1 1 
ATOM   652  C CD2 . LEU A 1 82  ? 28.235 -12.453 -60.198 1.00 8.06  ? 82  LEU A CD2 1 
ATOM   653  N N   A SER A 1 83  ? 29.027 -17.873 -60.376 0.93 8.13  ? 83  SER A N   1 
ATOM   654  N N   B SER A 1 83  ? 29.006 -17.855 -60.355 0.07 8.08  ? 83  SER A N   1 
ATOM   655  C CA  A SER A 1 83  ? 29.367 -19.116 -61.039 0.93 8.67  ? 83  SER A CA  1 
ATOM   656  C CA  B SER A 1 83  ? 29.372 -19.101 -61.010 0.07 8.08  ? 83  SER A CA  1 
ATOM   657  C C   A SER A 1 83  ? 28.145 -19.945 -61.399 0.93 9.53  ? 83  SER A C   1 
ATOM   658  C C   B SER A 1 83  ? 28.162 -19.945 -61.387 0.07 9.13  ? 83  SER A C   1 
ATOM   659  O O   A SER A 1 83  ? 28.223 -20.734 -62.356 0.93 12.28 ? 83  SER A O   1 
ATOM   660  O O   B SER A 1 83  ? 28.216 -20.709 -62.354 0.07 9.87  ? 83  SER A O   1 
ATOM   661  C CB  A SER A 1 83  ? 30.300 -19.953 -60.174 0.93 8.76  ? 83  SER A CB  1 
ATOM   662  C CB  B SER A 1 83  ? 30.308 -19.910 -60.105 0.07 8.91  ? 83  SER A CB  1 
ATOM   663  O OG  A SER A 1 83  ? 31.556 -19.322 -59.990 0.93 8.82  ? 83  SER A OG  1 
ATOM   664  O OG  B SER A 1 83  ? 29.589 -20.565 -59.075 0.07 7.56  ? 83  SER A OG  1 
ATOM   665  N N   . GLU A 1 84  ? 27.076 -19.824 -60.632 1.00 9.45  ? 84  GLU A N   1 
ATOM   666  C CA  . GLU A 1 84  ? 25.894 -20.611 -60.830 1.00 10.80 ? 84  GLU A CA  1 
ATOM   667  C C   . GLU A 1 84  ? 24.864 -19.979 -61.720 1.00 11.52 ? 84  GLU A C   1 
ATOM   668  O O   . GLU A 1 84  ? 23.868 -20.618 -62.060 1.00 14.54 ? 84  GLU A O   1 
ATOM   669  C CB  . GLU A 1 84  ? 25.278 -20.930 -59.441 1.00 11.59 ? 84  GLU A CB  1 
ATOM   670  C CG  . GLU A 1 84  ? 26.092 -21.894 -58.636 1.00 12.69 ? 84  GLU A CG  1 
ATOM   671  C CD  . GLU A 1 84  ? 25.618 -22.203 -57.255 1.00 17.21 ? 84  GLU A CD  1 
ATOM   672  O OE1 . GLU A 1 84  ? 24.740 -21.484 -56.707 1.00 18.85 ? 84  GLU A OE1 1 
ATOM   673  O OE2 . GLU A 1 84  ? 26.105 -23.188 -56.667 1.00 19.65 ? 84  GLU A OE2 1 
ATOM   674  N N   . SER A 1 85  ? 25.124 -18.732 -62.139 1.00 11.94 ? 85  SER A N   1 
ATOM   675  C CA  . SER A 1 85  ? 24.147 -17.969 -62.924 1.00 11.14 ? 85  SER A CA  1 
ATOM   676  C C   . SER A 1 85  ? 24.290 -18.120 -64.430 1.00 12.44 ? 85  SER A C   1 
ATOM   677  O O   . SER A 1 85  ? 25.323 -17.796 -65.045 1.00 10.99 ? 85  SER A O   1 
ATOM   678  C CB  . SER A 1 85  ? 24.317 -16.478 -62.582 1.00 10.56 ? 85  SER A CB  1 
ATOM   679  O OG  . SER A 1 85  ? 23.561 -15.677 -63.474 1.00 11.88 ? 85  SER A OG  1 
ATOM   680  N N   . ALA A 1 86  ? 23.221 -18.593 -65.054 1.00 12.94 ? 86  ALA A N   1 
ATOM   681  C CA  . ALA A 1 86  ? 23.150 -18.681 -66.507 1.00 13.21 ? 86  ALA A CA  1 
ATOM   682  C C   . ALA A 1 86  ? 23.242 -17.308 -67.158 1.00 11.96 ? 86  ALA A C   1 
ATOM   683  O O   . ALA A 1 86  ? 23.837 -17.166 -68.252 1.00 13.06 ? 86  ALA A O   1 
ATOM   684  C CB  . ALA A 1 86  ? 21.865 -19.400 -67.003 1.00 18.26 ? 86  ALA A CB  1 
ATOM   685  N N   . ALA A 1 87  ? 22.669 -16.291 -66.503 1.00 12.28 ? 87  ALA A N   1 
ATOM   686  C CA  . ALA A 1 87  ? 22.737 -14.930 -67.027 1.00 12.69 ? 87  ALA A CA  1 
ATOM   687  C C   . ALA A 1 87  ? 24.167 -14.430 -67.087 1.00 11.43 ? 87  ALA A C   1 
ATOM   688  O O   . ALA A 1 87  ? 24.608 -13.808 -68.067 1.00 12.40 ? 87  ALA A O   1 
ATOM   689  C CB  . ALA A 1 87  ? 21.835 -14.013 -66.190 1.00 14.50 ? 87  ALA A CB  1 
ATOM   690  N N   . VAL A 1 88  ? 24.937 -14.691 -66.002 1.00 11.15 ? 88  VAL A N   1 
ATOM   691  C CA  . VAL A 1 88  ? 26.357 -14.309 -65.994 1.00 10.36 ? 88  VAL A CA  1 
ATOM   692  C C   . VAL A 1 88  ? 27.125 -15.065 -67.078 1.00 10.98 ? 88  VAL A C   1 
ATOM   693  O O   . VAL A 1 88  ? 27.967 -14.467 -67.767 1.00 11.43 ? 88  VAL A O   1 
ATOM   694  C CB  . VAL A 1 88  ? 26.953 -14.526 -64.594 1.00 9.57  ? 88  VAL A CB  1 
ATOM   695  C CG1 . VAL A 1 88  ? 28.475 -14.318 -64.587 1.00 10.13 ? 88  VAL A CG1 1 
ATOM   696  C CG2 . VAL A 1 88  ? 26.293 -13.605 -63.583 1.00 10.22 ? 88  VAL A CG2 1 
ATOM   697  N N   A LYS A 1 89  ? 26.832 -16.355 -67.246 0.59 10.88 ? 89  LYS A N   1 
ATOM   698  N N   B LYS A 1 89  ? 26.901 -16.366 -67.288 0.41 10.33 ? 89  LYS A N   1 
ATOM   699  C CA  A LYS A 1 89  ? 27.459 -17.161 -68.300 0.59 11.39 ? 89  LYS A CA  1 
ATOM   700  C CA  B LYS A 1 89  ? 27.652 -17.051 -68.352 0.41 11.12 ? 89  LYS A CA  1 
ATOM   701  C C   A LYS A 1 89  ? 27.355 -16.446 -69.632 0.59 11.84 ? 89  LYS A C   1 
ATOM   702  C C   B LYS A 1 89  ? 27.379 -16.396 -69.694 0.41 12.01 ? 89  LYS A C   1 
ATOM   703  O O   A LYS A 1 89  ? 28.351 -16.275 -70.315 0.59 12.74 ? 89  LYS A O   1 
ATOM   704  O O   B LYS A 1 89  ? 28.265 -16.192 -70.511 0.41 12.60 ? 89  LYS A O   1 
ATOM   705  C CB  A LYS A 1 89  ? 26.806 -18.553 -68.385 0.59 12.27 ? 89  LYS A CB  1 
ATOM   706  C CB  B LYS A 1 89  ? 27.289 -18.540 -68.448 0.41 12.61 ? 89  LYS A CB  1 
ATOM   707  C CG  A LYS A 1 89  ? 27.633 -19.557 -69.137 0.59 12.14 ? 89  LYS A CG  1 
ATOM   708  C CG  B LYS A 1 89  ? 27.913 -19.210 -69.652 0.41 13.84 ? 89  LYS A CG  1 
ATOM   709  C CD  A LYS A 1 89  ? 27.034 -20.951 -69.221 0.59 16.57 ? 89  LYS A CD  1 
ATOM   710  C CD  B LYS A 1 89  ? 27.712 -20.702 -69.719 0.41 20.57 ? 89  LYS A CD  1 
ATOM   711  C CE  A LYS A 1 89  ? 26.972 -21.721 -67.953 0.59 15.79 ? 89  LYS A CE  1 
ATOM   712  C CE  B LYS A 1 89  ? 28.620 -21.399 -70.708 0.41 20.18 ? 89  LYS A CE  1 
ATOM   713  N NZ  A LYS A 1 89  ? 28.171 -22.092 -67.158 0.59 16.33 ? 89  LYS A NZ  1 
ATOM   714  N NZ  B LYS A 1 89  ? 29.968 -21.744 -70.174 0.41 31.39 ? 89  LYS A NZ  1 
ATOM   715  N N   A GLU A 1 90  ? 26.135 -16.011 -69.988 0.73 11.90 ? 90  GLU A N   1 
ATOM   716  N N   B GLU A 1 90  ? 26.102 -16.056 -69.914 0.27 12.54 ? 90  GLU A N   1 
ATOM   717  C CA  A GLU A 1 90  ? 25.864 -15.398 -71.271 0.73 12.65 ? 90  GLU A CA  1 
ATOM   718  C CA  B GLU A 1 90  ? 25.709 -15.412 -71.161 0.27 13.12 ? 90  GLU A CA  1 
ATOM   719  C C   A GLU A 1 90  ? 26.566 -14.053 -71.421 0.73 11.55 ? 90  GLU A C   1 
ATOM   720  C C   B GLU A 1 90  ? 26.502 -14.124 -71.363 0.27 13.43 ? 90  GLU A C   1 
ATOM   721  O O   A GLU A 1 90  ? 27.118 -13.700 -72.463 0.73 14.46 ? 90  GLU A O   1 
ATOM   722  O O   B GLU A 1 90  ? 27.098 -13.916 -72.420 0.27 9.00  ? 90  GLU A O   1 
ATOM   723  C CB  A GLU A 1 90  ? 24.354 -15.212 -71.408 0.73 15.44 ? 90  GLU A CB  1 
ATOM   724  C CB  B GLU A 1 90  ? 24.202 -15.139 -71.183 0.27 16.56 ? 90  GLU A CB  1 
ATOM   725  C CG  A GLU A 1 90  ? 23.864 -14.301 -72.503 0.73 23.17 ? 90  GLU A CG  1 
ATOM   726  C CG  B GLU A 1 90  ? 23.358 -16.345 -71.572 0.27 18.60 ? 90  GLU A CG  1 
ATOM   727  C CD  A GLU A 1 90  ? 22.347 -14.190 -72.507 0.73 27.24 ? 90  GLU A CD  1 
ATOM   728  C CD  B GLU A 1 90  ? 21.880 -16.208 -71.251 0.27 26.52 ? 90  GLU A CD  1 
ATOM   729  O OE1 A GLU A 1 90  ? 21.662 -13.588 -71.650 0.73 32.14 ? 90  GLU A OE1 1 
ATOM   730  O OE1 B GLU A 1 90  ? 21.445 -15.064 -70.974 0.27 32.65 ? 90  GLU A OE1 1 
ATOM   731  O OE2 A GLU A 1 90  ? 21.823 -14.765 -73.495 0.73 39.02 ? 90  GLU A OE2 1 
ATOM   732  O OE2 B GLU A 1 90  ? 21.135 -17.224 -71.272 0.27 32.64 ? 90  GLU A OE2 1 
ATOM   733  N N   . ILE A 1 91  ? 26.526 -13.260 -70.355 1.00 10.89 ? 91  ILE A N   1 
ATOM   734  C CA  . ILE A 1 91  ? 27.200 -11.987 -70.449 1.00 11.14 ? 91  ILE A CA  1 
ATOM   735  C C   . ILE A 1 91  ? 28.692 -12.162 -70.656 1.00 9.91  ? 91  ILE A C   1 
ATOM   736  O O   . ILE A 1 91  ? 29.317 -11.442 -71.441 1.00 10.12 ? 91  ILE A O   1 
ATOM   737  C CB  . ILE A 1 91  ? 26.928 -11.144 -69.182 1.00 12.93 ? 91  ILE A CB  1 
ATOM   738  C CG1 . ILE A 1 91  ? 25.512 -10.596 -69.292 1.00 16.49 ? 91  ILE A CG1 1 
ATOM   739  C CG2 . ILE A 1 91  ? 27.894 -10.029 -68.930 1.00 13.69 ? 91  ILE A CG2 1 
ATOM   740  C CD1 . ILE A 1 91  ? 24.895 -10.179 -68.062 1.00 21.04 ? 91  ILE A CD1 1 
ATOM   741  N N   . LEU A 1 92  ? 29.323 -13.083 -69.938 1.00 9.68  ? 92  LEU A N   1 
ATOM   742  C CA  . LEU A 1 92  ? 30.744 -13.270 -70.045 1.00 9.05  ? 92  LEU A CA  1 
ATOM   743  C C   . LEU A 1 92  ? 31.119 -13.879 -71.397 1.00 9.90  ? 92  LEU A C   1 
ATOM   744  O O   . LEU A 1 92  ? 32.109 -13.473 -71.992 1.00 10.05 ? 92  LEU A O   1 
ATOM   745  C CB  . LEU A 1 92  ? 31.308 -14.145 -68.929 1.00 9.02  ? 92  LEU A CB  1 
ATOM   746  C CG  . LEU A 1 92  ? 31.169 -13.566 -67.524 1.00 8.90  ? 92  LEU A CG  1 
ATOM   747  C CD1 . LEU A 1 92  ? 31.664 -14.604 -66.514 1.00 9.74  ? 92  LEU A CD1 1 
ATOM   748  C CD2 . LEU A 1 92  ? 31.956 -12.276 -67.391 1.00 10.18 ? 92  LEU A CD2 1 
ATOM   749  N N   A LYS A 1 93  ? 30.332 -14.823 -71.889 0.80 10.46 ? 93  LYS A N   1 
ATOM   750  N N   B LYS A 1 93  ? 30.331 -14.821 -71.910 0.20 11.04 ? 93  LYS A N   1 
ATOM   751  C CA  A LYS A 1 93  ? 30.583 -15.384 -73.224 0.80 11.29 ? 93  LYS A CA  1 
ATOM   752  C CA  B LYS A 1 93  ? 30.659 -15.372 -73.229 0.20 11.76 ? 93  LYS A CA  1 
ATOM   753  C C   A LYS A 1 93  ? 30.518 -14.313 -74.298 0.80 12.05 ? 93  LYS A C   1 
ATOM   754  C C   B LYS A 1 93  ? 30.488 -14.325 -74.321 0.20 12.07 ? 93  LYS A C   1 
ATOM   755  O O   A LYS A 1 93  ? 31.384 -14.275 -75.174 0.80 12.01 ? 93  LYS A O   1 
ATOM   756  O O   B LYS A 1 93  ? 31.264 -14.285 -75.279 0.20 12.97 ? 93  LYS A O   1 
ATOM   757  C CB  A LYS A 1 93  ? 29.616 -16.513 -73.529 0.80 14.84 ? 93  LYS A CB  1 
ATOM   758  C CB  B LYS A 1 93  ? 29.821 -16.610 -73.546 0.20 12.49 ? 93  LYS A CB  1 
ATOM   759  C CG  A LYS A 1 93  ? 29.763 -17.719 -72.629 0.80 21.74 ? 93  LYS A CG  1 
ATOM   760  C CG  B LYS A 1 93  ? 30.346 -17.399 -74.736 0.20 16.59 ? 93  LYS A CG  1 
ATOM   761  C CD  A LYS A 1 93  ? 30.747 -18.735 -73.145 0.80 29.18 ? 93  LYS A CD  1 
ATOM   762  C CD  B LYS A 1 93  ? 30.012 -18.872 -74.695 0.20 21.20 ? 93  LYS A CD  1 
ATOM   763  C CE  A LYS A 1 93  ? 30.858 -19.916 -72.180 0.80 34.04 ? 93  LYS A CE  1 
ATOM   764  C CE  B LYS A 1 93  ? 30.623 -19.622 -73.527 0.20 28.67 ? 93  LYS A CE  1 
ATOM   765  N NZ  A LYS A 1 93  ? 32.091 -20.717 -72.386 0.80 45.84 ? 93  LYS A NZ  1 
ATOM   766  N NZ  B LYS A 1 93  ? 31.898 -20.312 -73.877 0.20 37.05 ? 93  LYS A NZ  1 
ATOM   767  N N   . GLU A 1 94  ? 29.473 -13.467 -74.182 1.00 11.50 ? 94  GLU A N   1 
ATOM   768  C CA  . GLU A 1 94  ? 29.301 -12.399 -75.174 1.00 12.81 ? 94  GLU A CA  1 
ATOM   769  C C   . GLU A 1 94  ? 30.489 -11.431 -75.097 1.00 11.50 ? 94  GLU A C   1 
ATOM   770  O O   . GLU A 1 94  ? 30.995 -10.994 -76.126 1.00 11.52 ? 94  GLU A O   1 
ATOM   771  C CB  . GLU A 1 94  ? 27.955 -11.724 -74.984 1.00 13.79 ? 94  GLU A CB  1 
ATOM   772  C CG  . GLU A 1 94  ? 26.753 -12.587 -75.420 1.00 32.18 ? 94  GLU A CG  1 
ATOM   773  C CD  . GLU A 1 94  ? 25.354 -12.037 -75.413 1.00 49.60 ? 94  GLU A CD  1 
ATOM   774  O OE1 . GLU A 1 94  ? 25.098 -11.302 -74.432 1.00 69.88 ? 94  GLU A OE1 1 
ATOM   775  O OE2 . GLU A 1 94  ? 24.528 -12.335 -76.309 1.00 70.37 ? 94  GLU A OE2 1 
ATOM   776  N N   . GLN A 1 95  ? 30.926 -11.116 -73.878 1.00 10.85 ? 95  GLN A N   1 
ATOM   777  C CA  . GLN A 1 95  ? 32.039 -10.152 -73.741 1.00 9.86  ? 95  GLN A CA  1 
ATOM   778  C C   . GLN A 1 95  ? 33.309 -10.742 -74.282 1.00 9.23  ? 95  GLN A C   1 
ATOM   779  O O   . GLN A 1 95  ? 34.070 -10.099 -75.020 1.00 10.08 ? 95  GLN A O   1 
ATOM   780  C CB  . GLN A 1 95  ? 32.195 -9.765  -72.262 1.00 10.20 ? 95  GLN A CB  1 
ATOM   781  C CG  . GLN A 1 95  ? 33.259 -8.700  -72.008 1.00 8.91  ? 95  GLN A CG  1 
ATOM   782  C CD  . GLN A 1 95  ? 32.848 -7.313  -72.417 1.00 10.27 ? 95  GLN A CD  1 
ATOM   783  O OE1 . GLN A 1 95  ? 31.894 -7.146  -73.185 1.00 13.91 ? 95  GLN A OE1 1 
ATOM   784  N NE2 . GLN A 1 95  ? 33.574 -6.333  -71.913 1.00 9.50  ? 95  GLN A NE2 1 
ATOM   785  N N   . GLU A 1 96  ? 33.593 -12.003 -73.990 1.00 9.79  ? 96  GLU A N   1 
ATOM   786  C CA  . GLU A 1 96  ? 34.707 -12.668 -74.578 1.00 11.02 ? 96  GLU A CA  1 
ATOM   787  C C   . GLU A 1 96  ? 34.615 -12.711 -76.111 1.00 11.08 ? 96  GLU A C   1 
ATOM   788  O O   . GLU A 1 96  ? 35.599 -12.433 -76.827 1.00 12.34 ? 96  GLU A O   1 
ATOM   789  C CB  . GLU A 1 96  ? 34.810 -14.082 -73.964 1.00 12.95 ? 96  GLU A CB  1 
ATOM   790  C CG  . GLU A 1 96  ? 35.952 -14.881 -74.382 1.00 16.43 ? 96  GLU A CG  1 
ATOM   791  C CD  . GLU A 1 96  ? 35.895 -16.305 -73.837 1.00 18.85 ? 96  GLU A CD  1 
ATOM   792  O OE1 . GLU A 1 96  ? 34.823 -16.992 -73.884 1.00 22.11 ? 96  GLU A OE1 1 
ATOM   793  O OE2 . GLU A 1 96  ? 36.938 -16.712 -73.354 1.00 17.85 ? 96  GLU A OE2 1 
ATOM   794  N N   A ASN A 1 97  ? 33.434 -13.045 -76.666 0.80 11.60 ? 97  ASN A N   1 
ATOM   795  N N   B ASN A 1 97  ? 33.436 -13.033 -76.625 0.20 12.11 ? 97  ASN A N   1 
ATOM   796  C CA  A ASN A 1 97  ? 33.260 -13.143 -78.102 0.80 13.59 ? 97  ASN A CA  1 
ATOM   797  C CA  B ASN A 1 97  ? 33.356 -13.121 -78.075 0.20 14.30 ? 97  ASN A CA  1 
ATOM   798  C C   A ASN A 1 97  ? 33.546 -11.820 -78.824 0.80 14.96 ? 97  ASN A C   1 
ATOM   799  C C   B ASN A 1 97  ? 33.644 -11.803 -78.782 0.20 14.87 ? 97  ASN A C   1 
ATOM   800  O O   A ASN A 1 97  ? 34.022 -11.829 -79.969 0.80 16.37 ? 97  ASN A O   1 
ATOM   801  O O   B ASN A 1 97  ? 34.215 -11.803 -79.880 0.20 18.13 ? 97  ASN A O   1 
ATOM   802  C CB  A ASN A 1 97  ? 31.837 -13.681 -78.404 0.80 19.20 ? 97  ASN A CB  1 
ATOM   803  C CB  B ASN A 1 97  ? 31.960 -13.663 -78.434 0.20 16.14 ? 97  ASN A CB  1 
ATOM   804  C CG  A ASN A 1 97  ? 31.669 -15.146 -78.084 0.80 21.76 ? 97  ASN A CG  1 
ATOM   805  C CG  B ASN A 1 97  ? 31.928 -13.849 -79.946 0.20 16.37 ? 97  ASN A CG  1 
ATOM   806  O OD1 A ASN A 1 97  ? 32.665 -15.848 -77.896 0.80 27.31 ? 97  ASN A OD1 1 
ATOM   807  O OD1 B ASN A 1 97  ? 32.669 -14.683 -80.454 0.20 15.15 ? 97  ASN A OD1 1 
ATOM   808  N ND2 A ASN A 1 97  ? 30.450 -15.662 -77.998 0.80 27.33 ? 97  ASN A ND2 1 
ATOM   809  N ND2 B ASN A 1 97  ? 31.085 -13.046 -80.568 0.20 16.72 ? 97  ASN A ND2 1 
ATOM   810  N N   . ARG A 1 98  ? 33.271 -10.671 -78.193 1.00 12.33 ? 98  ARG A N   1 
ATOM   811  C CA  . ARG A 1 98  ? 33.419 -9.367  -78.783 1.00 12.64 ? 98  ARG A CA  1 
ATOM   812  C C   . ARG A 1 98  ? 34.760 -8.773  -78.450 1.00 12.05 ? 98  ARG A C   1 
ATOM   813  O O   . ARG A 1 98  ? 35.008 -7.617  -78.794 1.00 13.81 ? 98  ARG A O   1 
ATOM   814  C CB  . ARG A 1 98  ? 32.311 -8.394  -78.437 1.00 13.30 ? 98  ARG A CB  1 
ATOM   815  C CG  . ARG A 1 98  ? 32.279 -7.973  -77.000 1.00 14.61 ? 98  ARG A CG  1 
ATOM   816  C CD  . ARG A 1 98  ? 31.032 -7.073  -76.719 1.00 19.37 ? 98  ARG A CD  1 
ATOM   817  N NE  . ARG A 1 98  ? 31.258 -5.780  -77.311 1.00 24.02 ? 98  ARG A NE  1 
ATOM   818  C CZ  . ARG A 1 98  ? 31.922 -4.766  -76.742 1.00 33.97 ? 98  ARG A CZ  1 
ATOM   819  N NH1 . ARG A 1 98  ? 32.482 -4.817  -75.496 1.00 29.26 ? 98  ARG A NH1 1 
ATOM   820  N NH2 . ARG A 1 98  ? 31.982 -3.684  -77.510 1.00 34.54 ? 98  ARG A NH2 1 
ATOM   821  N N   . LYS A 1 99  ? 35.599 -9.534  -77.781 1.00 11.36 ? 99  LYS A N   1 
ATOM   822  C CA  . LYS A 1 99  ? 36.963 -9.090  -77.479 1.00 10.96 ? 99  LYS A CA  1 
ATOM   823  C C   . LYS A 1 99  ? 36.965 -7.881  -76.517 1.00 11.16 ? 99  LYS A C   1 
ATOM   824  O O   . LYS A 1 99  ? 37.710 -6.911  -76.621 1.00 13.41 ? 99  LYS A O   1 
ATOM   825  C CB  . LYS A 1 99  ? 37.790 -8.795  -78.741 1.00 13.34 ? 99  LYS A CB  1 
ATOM   826  C CG  . LYS A 1 99  ? 37.872 -10.000 -79.669 1.00 15.49 ? 99  LYS A CG  1 
ATOM   827  C CD  . LYS A 1 99  ? 38.707 -9.689  -80.902 1.00 19.67 ? 99  LYS A CD  1 
ATOM   828  C CE  . LYS A 1 99  ? 38.652 -10.776 -81.958 1.00 23.39 ? 99  LYS A CE  1 
ATOM   829  N NZ  . LYS A 1 99  ? 39.633 -10.496 -83.073 1.00 27.92 ? 99  LYS A NZ  1 
ATOM   830  N N   . GLY A 1 100 ? 36.085 -7.948  -75.525 1.00 10.64 ? 100 GLY A N   1 
ATOM   831  C CA  . GLY A 1 100 ? 36.000 -6.941  -74.503 1.00 11.04 ? 100 GLY A CA  1 
ATOM   832  C C   . GLY A 1 100 ? 36.648 -7.437  -73.188 1.00 9.42  ? 100 GLY A C   1 
ATOM   833  O O   . GLY A 1 100 ? 36.686 -8.614  -72.874 1.00 10.88 ? 100 GLY A O   1 
ATOM   834  N N   . LEU A 1 101 ? 37.107 -6.488  -72.387 1.00 9.30  ? 101 LEU A N   1 
ATOM   835  C CA  . LEU A 1 101 ? 37.823 -6.764  -71.142 1.00 8.87  ? 101 LEU A CA  1 
ATOM   836  C C   . LEU A 1 101 ? 36.877 -7.381  -70.113 1.00 7.55  ? 101 LEU A C   1 
ATOM   837  O O   . LEU A 1 101 ? 35.716 -6.941  -69.930 1.00 8.30  ? 101 LEU A O   1 
ATOM   838  C CB  . LEU A 1 101 ? 38.397 -5.463  -70.600 1.00 9.23  ? 101 LEU A CB  1 
ATOM   839  C CG  . LEU A 1 101 ? 39.273 -5.523  -69.352 1.00 8.54  ? 101 LEU A CG  1 
ATOM   840  C CD1 . LEU A 1 101 ? 40.537 -6.302  -69.625 1.00 10.23 ? 101 LEU A CD1 1 
ATOM   841  C CD2 . LEU A 1 101 ? 39.637 -4.096  -68.926 1.00 11.01 ? 101 LEU A CD2 1 
ATOM   842  N N   . ILE A 1 102 ? 37.414 -8.350  -69.394 1.00 7.28  ? 102 ILE A N   1 
ATOM   843  C CA  . ILE A 1 102 ? 36.786 -8.961  -68.236 1.00 6.82  ? 102 ILE A CA  1 
ATOM   844  C C   . ILE A 1 102 ? 37.787 -8.845  -67.065 1.00 6.65  ? 102 ILE A C   1 
ATOM   845  O O   . ILE A 1 102 ? 38.947 -9.212  -67.216 1.00 7.80  ? 102 ILE A O   1 
ATOM   846  C CB  . ILE A 1 102 ? 36.379 -10.430 -68.467 1.00 7.62  ? 102 ILE A CB  1 
ATOM   847  C CG1 . ILE A 1 102 ? 35.367 -10.500 -69.637 1.00 8.83  ? 102 ILE A CG1 1 
ATOM   848  C CG2 . ILE A 1 102 ? 35.864 -11.076 -67.186 1.00 9.13  ? 102 ILE A CG2 1 
ATOM   849  C CD1 . ILE A 1 102 ? 35.099 -11.893 -70.145 1.00 10.11 ? 102 ILE A CD1 1 
ATOM   850  N N   . ALA A 1 103 ? 37.294 -8.341  -65.923 1.00 6.59  ? 103 ALA A N   1 
ATOM   851  C CA  . ALA A 1 103 ? 38.134 -8.102  -64.755 1.00 6.35  ? 103 ALA A CA  1 
ATOM   852  C C   . ALA A 1 103 ? 37.506 -8.787  -63.550 1.00 7.05  ? 103 ALA A C   1 
ATOM   853  O O   . ALA A 1 103 ? 36.317 -8.587  -63.291 1.00 9.28  ? 103 ALA A O   1 
ATOM   854  C CB  . ALA A 1 103 ? 38.274 -6.599  -64.508 1.00 8.08  ? 103 ALA A CB  1 
ATOM   855  N N   . ALA A 1 104 ? 38.289 -9.584  -62.806 1.00 6.28  ? 104 ALA A N   1 
ATOM   856  C CA  . ALA A 1 104 ? 37.789 -10.333 -61.675 1.00 6.14  ? 104 ALA A CA  1 
ATOM   857  C C   . ALA A 1 104 ? 38.770 -10.360 -60.540 1.00 6.27  ? 104 ALA A C   1 
ATOM   858  O O   . ALA A 1 104 ? 39.973 -10.542 -60.752 1.00 7.18  ? 104 ALA A O   1 
ATOM   859  C CB  . ALA A 1 104 ? 37.440 -11.760 -62.109 1.00 6.65  ? 104 ALA A CB  1 
ATOM   860  N N   . ILE A 1 105 ? 38.309 -10.180 -59.296 1.00 7.35  ? 105 ILE A N   1 
ATOM   861  C CA  . ILE A 1 105 ? 39.202 -10.124 -58.148 1.00 7.20  ? 105 ILE A CA  1 
ATOM   862  C C   . ILE A 1 105 ? 38.888 -11.183 -57.083 1.00 7.81  ? 105 ILE A C   1 
ATOM   863  O O   . ILE A 1 105 ? 37.715 -11.506 -56.844 1.00 8.25  ? 105 ILE A O   1 
ATOM   864  C CB  . ILE A 1 105 ? 39.222 -8.684  -57.575 1.00 6.65  ? 105 ILE A CB  1 
ATOM   865  C CG1 . ILE A 1 105 ? 40.198 -8.521  -56.415 1.00 6.48  ? 105 ILE A CG1 1 
ATOM   866  C CG2 . ILE A 1 105 ? 37.822 -8.169  -57.224 1.00 8.40  ? 105 ILE A CG2 1 
ATOM   867  C CD1 . ILE A 1 105 ? 40.573 -7.087  -56.113 1.00 7.49  ? 105 ILE A CD1 1 
HETATM 868  N N   . CSD A 1 106 ? 39.943 -11.732 -56.424 1.00 8.77  ? 106 CSD A N   1 
HETATM 869  C CA  . CSD A 1 106 ? 39.863 -12.529 -55.156 1.00 8.26  ? 106 CSD A CA  1 
HETATM 870  C CB  . CSD A 1 106 ? 39.172 -11.758 -54.063 1.00 8.56  ? 106 CSD A CB  1 
HETATM 871  S SG  . CSD A 1 106 ? 38.904 -12.602 -52.439 0.76 6.60  ? 106 CSD A SG  1 
HETATM 872  C C   . CSD A 1 106 ? 39.280 -13.931 -55.500 1.00 6.86  ? 106 CSD A C   1 
HETATM 873  O O   . CSD A 1 106 ? 39.972 -14.680 -56.187 1.00 7.79  ? 106 CSD A O   1 
HETATM 874  O OD1 . CSD A 1 106 ? 38.865 -11.424 -51.498 0.76 6.46  ? 106 CSD A OD1 1 
HETATM 875  O OD2 . CSD A 1 106 ? 37.486 -13.190 -52.569 0.76 6.35  ? 106 CSD A OD2 1 
ATOM   876  N N   . ALA A 1 107 ? 38.050 -14.301 -55.129 1.00 7.24  ? 107 ALA A N   1 
ATOM   877  C CA  . ALA A 1 107 ? 37.397 -15.528 -55.606 1.00 6.87  ? 107 ALA A CA  1 
ATOM   878  C C   . ALA A 1 107 ? 36.677 -15.307 -56.945 1.00 6.69  ? 107 ALA A C   1 
ATOM   879  O O   . ALA A 1 107 ? 36.276 -16.269 -57.609 1.00 6.79  ? 107 ALA A O   1 
ATOM   880  C CB  . ALA A 1 107 ? 36.370 -16.059 -54.598 1.00 10.98 ? 107 ALA A CB  1 
ATOM   881  N N   . GLY A 1 108 ? 36.474 -14.039 -57.316 1.00 6.78  ? 108 GLY A N   1 
ATOM   882  C CA  . GLY A 1 108 ? 35.792 -13.736 -58.579 1.00 7.14  ? 108 GLY A CA  1 
ATOM   883  C C   . GLY A 1 108 ? 36.284 -14.508 -59.771 1.00 5.98  ? 108 GLY A C   1 
ATOM   884  O O   . GLY A 1 108 ? 35.468 -14.926 -60.604 1.00 6.42  ? 108 GLY A O   1 
ATOM   885  N N   . PRO A 1 109 ? 37.584 -14.687 -59.950 1.00 5.84  ? 109 PRO A N   1 
ATOM   886  C CA  . PRO A 1 109 ? 38.049 -15.402 -61.162 1.00 6.07  ? 109 PRO A CA  1 
ATOM   887  C C   . PRO A 1 109 ? 37.543 -16.849 -61.234 1.00 5.80  ? 109 PRO A C   1 
ATOM   888  O O   . PRO A 1 109 ? 37.522 -17.416 -62.333 1.00 6.43  ? 109 PRO A O   1 
ATOM   889  C CB  . PRO A 1 109 ? 39.573 -15.334 -61.064 1.00 6.52  ? 109 PRO A CB  1 
ATOM   890  C CG  . PRO A 1 109 ? 39.844 -14.093 -60.232 1.00 6.44  ? 109 PRO A CG  1 
ATOM   891  C CD  . PRO A 1 109 ? 38.731 -14.115 -59.221 1.00 6.66  ? 109 PRO A CD  1 
ATOM   892  N N   . THR A 1 110 ? 37.119 -17.455 -60.105 1.00 5.80  ? 110 THR A N   1 
ATOM   893  C CA  . THR A 1 110 ? 36.602 -18.825 -60.194 1.00 6.74  ? 110 THR A CA  1 
ATOM   894  C C   . THR A 1 110 ? 35.285 -18.870 -60.944 1.00 6.33  ? 110 THR A C   1 
ATOM   895  O O   . THR A 1 110 ? 34.929 -19.949 -61.462 1.00 7.27  ? 110 THR A O   1 
ATOM   896  C CB  . THR A 1 110 ? 36.456 -19.494 -58.828 1.00 7.32  ? 110 THR A CB  1 
ATOM   897  O OG1 . THR A 1 110 ? 35.462 -18.826 -58.033 1.00 7.66  ? 110 THR A OG1 1 
ATOM   898  C CG2 . THR A 1 110 ? 37.810 -19.518 -58.098 1.00 8.58  ? 110 THR A CG2 1 
ATOM   899  N N   . ALA A 1 111 ? 34.574 -17.766 -61.101 1.00 6.82  ? 111 ALA A N   1 
ATOM   900  C CA  . ALA A 1 111 ? 33.421 -17.703 -62.004 1.00 7.07  ? 111 ALA A CA  1 
ATOM   901  C C   . ALA A 1 111 ? 33.828 -17.805 -63.459 1.00 7.24  ? 111 ALA A C   1 
ATOM   902  O O   . ALA A 1 111 ? 33.071 -18.327 -64.313 1.00 8.59  ? 111 ALA A O   1 
ATOM   903  C CB  . ALA A 1 111 ? 32.574 -16.464 -61.775 1.00 7.94  ? 111 ALA A CB  1 
ATOM   904  N N   . LEU A 1 112 ? 35.021 -17.323 -63.818 1.00 7.13  ? 112 LEU A N   1 
ATOM   905  C CA  . LEU A 1 112 ? 35.562 -17.530 -65.156 1.00 7.36  ? 112 LEU A CA  1 
ATOM   906  C C   . LEU A 1 112 ? 35.763 -19.025 -65.404 1.00 7.07  ? 112 LEU A C   1 
ATOM   907  O O   . LEU A 1 112 ? 35.414 -19.529 -66.482 1.00 7.83  ? 112 LEU A O   1 
ATOM   908  C CB  . LEU A 1 112 ? 36.895 -16.768 -65.362 1.00 7.80  ? 112 LEU A CB  1 
ATOM   909  C CG  . LEU A 1 112 ? 36.853 -15.268 -65.052 1.00 8.50  ? 112 LEU A CG  1 
ATOM   910  C CD1 . LEU A 1 112 ? 38.233 -14.643 -65.212 1.00 10.97 ? 112 LEU A CD1 1 
ATOM   911  C CD2 . LEU A 1 112 ? 35.818 -14.527 -65.867 1.00 11.41 ? 112 LEU A CD2 1 
ATOM   912  N N   . LEU A 1 113 ? 36.312 -19.754 -64.438 1.00 6.82  ? 113 LEU A N   1 
ATOM   913  C CA  . LEU A 1 113 ? 36.439 -21.184 -64.569 1.00 7.28  ? 113 LEU A CA  1 
ATOM   914  C C   . LEU A 1 113 ? 35.094 -21.824 -64.781 1.00 8.11  ? 113 LEU A C   1 
ATOM   915  O O   . LEU A 1 113 ? 34.914 -22.656 -65.712 1.00 8.64  ? 113 LEU A O   1 
ATOM   916  C CB  . LEU A 1 113 ? 37.134 -21.784 -63.298 1.00 8.06  ? 113 LEU A CB  1 
ATOM   917  C CG  . LEU A 1 113 ? 37.210 -23.316 -63.326 1.00 7.79  ? 113 LEU A CG  1 
ATOM   918  C CD1 . LEU A 1 113 ? 37.962 -23.899 -64.537 1.00 9.20  ? 113 LEU A CD1 1 
ATOM   919  C CD2 . LEU A 1 113 ? 37.844 -23.758 -62.024 1.00 9.34  ? 113 LEU A CD2 1 
ATOM   920  N N   . ALA A 1 114 ? 34.096 -21.519 -63.942 1.00 8.12  ? 114 ALA A N   1 
ATOM   921  C CA  . ALA A 1 114 ? 32.771 -22.098 -64.020 1.00 8.84  ? 114 ALA A CA  1 
ATOM   922  C C   . ALA A 1 114 ? 32.131 -21.936 -65.399 1.00 8.74  ? 114 ALA A C   1 
ATOM   923  O O   . ALA A 1 114 ? 31.444 -22.854 -65.877 1.00 10.81 ? 114 ALA A O   1 
ATOM   924  C CB  . ALA A 1 114 ? 31.855 -21.508 -62.956 1.00 9.33  ? 114 ALA A CB  1 
ATOM   925  N N   . HIS A 1 115 ? 32.386 -20.807 -66.011 1.00 8.92  ? 115 HIS A N   1 
ATOM   926  C CA  . HIS A 1 115 ? 31.768 -20.451 -67.277 1.00 9.14  ? 115 HIS A CA  1 
ATOM   927  C C   . HIS A 1 115 ? 32.696 -20.684 -68.477 1.00 8.97  ? 115 HIS A C   1 
ATOM   928  O O   . HIS A 1 115 ? 32.328 -20.311 -69.607 1.00 10.27 ? 115 HIS A O   1 
ATOM   929  C CB  . HIS A 1 115 ? 31.275 -19.005 -67.228 1.00 8.94  ? 115 HIS A CB  1 
ATOM   930  C CG  . HIS A 1 115 ? 30.176 -18.829 -66.206 1.00 8.68  ? 115 HIS A CG  1 
ATOM   931  N ND1 . HIS A 1 115 ? 29.095 -19.701 -66.137 1.00 9.78  ? 115 HIS A ND1 1 
ATOM   932  C CD2 . HIS A 1 115 ? 30.042 -17.896 -65.229 1.00 8.71  ? 115 HIS A CD2 1 
ATOM   933  C CE1 . HIS A 1 115 ? 28.353 -19.253 -65.127 1.00 9.40  ? 115 HIS A CE1 1 
ATOM   934  N NE2 . HIS A 1 115 ? 28.865 -18.176 -64.563 1.00 9.27  ? 115 HIS A NE2 1 
ATOM   935  N N   A GLU A 1 116 ? 33.839 -21.279 -68.225 0.73 8.99  ? 116 GLU A N   1 
ATOM   936  N N   B GLU A 1 116 ? 33.823 -21.365 -68.401 0.27 10.27 ? 116 GLU A N   1 
ATOM   937  C CA  A GLU A 1 116 ? 34.825 -21.701 -69.233 0.73 9.74  ? 116 GLU A CA  1 
ATOM   938  C CA  B GLU A 1 116 ? 34.744 -21.681 -69.498 0.27 9.52  ? 116 GLU A CA  1 
ATOM   939  C C   A GLU A 1 116 ? 35.336 -20.495 -70.031 0.73 8.04  ? 116 GLU A C   1 
ATOM   940  C C   B GLU A 1 116 ? 35.195 -20.373 -70.160 0.27 8.76  ? 116 GLU A C   1 
ATOM   941  O O   A GLU A 1 116 ? 35.509 -20.550 -71.248 0.73 9.48  ? 116 GLU A O   1 
ATOM   942  O O   B GLU A 1 116 ? 35.172 -20.244 -71.381 0.27 11.78 ? 116 GLU A O   1 
ATOM   943  C CB  A GLU A 1 116 ? 34.297 -22.849 -70.137 0.73 9.85  ? 116 GLU A CB  1 
ATOM   944  C CB  B GLU A 1 116 ? 34.233 -22.673 -70.569 0.27 15.24 ? 116 GLU A CB  1 
ATOM   945  C CG  A GLU A 1 116 ? 34.031 -24.125 -69.363 0.73 11.39 ? 116 GLU A CG  1 
ATOM   946  C CG  B GLU A 1 116 ? 35.196 -23.022 -71.686 0.27 29.09 ? 116 GLU A CG  1 
ATOM   947  C CD  A GLU A 1 116 ? 33.661 -25.314 -70.250 0.73 15.50 ? 116 GLU A CD  1 
ATOM   948  C CD  B GLU A 1 116 ? 34.840 -23.941 -72.845 0.27 30.36 ? 116 GLU A CD  1 
ATOM   949  O OE1 A GLU A 1 116 ? 33.202 -25.115 -71.370 0.73 17.51 ? 116 GLU A OE1 1 
ATOM   950  O OE1 B GLU A 1 116 ? 35.368 -23.894 -74.004 0.27 15.19 ? 116 GLU A OE1 1 
ATOM   951  O OE2 A GLU A 1 116 ? 33.833 -26.456 -69.829 0.73 18.25 ? 116 GLU A OE2 1 
ATOM   952  O OE2 B GLU A 1 116 ? 33.976 -24.821 -72.621 0.27 26.30 ? 116 GLU A OE2 1 
ATOM   953  N N   . ILE A 1 117 ? 35.621 -19.402 -69.351 1.00 8.22  ? 117 ILE A N   1 
ATOM   954  C CA  . ILE A 1 117 ? 36.056 -18.131 -69.929 1.00 7.85  ? 117 ILE A CA  1 
ATOM   955  C C   . ILE A 1 117 ? 37.558 -17.969 -69.792 1.00 7.64  ? 117 ILE A C   1 
ATOM   956  O O   . ILE A 1 117 ? 38.122 -18.146 -68.717 1.00 9.18  ? 117 ILE A O   1 
ATOM   957  C CB  . ILE A 1 117 ? 35.369 -16.964 -69.199 1.00 8.88  ? 117 ILE A CB  1 
ATOM   958  C CG1 . ILE A 1 117 ? 33.850 -17.082 -69.212 1.00 9.50  ? 117 ILE A CG1 1 
ATOM   959  C CG2 . ILE A 1 117 ? 35.846 -15.633 -69.812 1.00 9.53  ? 117 ILE A CG2 1 
ATOM   960  C CD1 . ILE A 1 117 ? 33.228 -16.899 -70.564 1.00 11.85 ? 117 ILE A CD1 1 
ATOM   961  N N   . GLY A 1 118 ? 38.242 -17.611 -70.884 1.00 8.44  ? 118 GLY A N   1 
ATOM   962  C CA  . GLY A 1 118 ? 39.624 -17.257 -70.837 1.00 8.69  ? 118 GLY A CA  1 
ATOM   963  C C   . GLY A 1 118 ? 40.615 -18.354 -70.602 1.00 7.59  ? 118 GLY A C   1 
ATOM   964  O O   . GLY A 1 118 ? 41.738 -18.070 -70.168 1.00 7.71  ? 118 GLY A O   1 
ATOM   965  N N   . PHE A 1 119 ? 40.275 -19.604 -70.878 1.00 7.64  ? 119 PHE A N   1 
ATOM   966  C CA  . PHE A 1 119 ? 41.237 -20.676 -70.672 1.00 7.35  ? 119 PHE A CA  1 
ATOM   967  C C   . PHE A 1 119 ? 42.490 -20.395 -71.490 1.00 7.69  ? 119 PHE A C   1 
ATOM   968  O O   . PHE A 1 119 ? 42.436 -19.861 -72.615 1.00 8.78  ? 119 PHE A O   1 
ATOM   969  C CB  . PHE A 1 119 ? 40.655 -22.031 -71.099 1.00 7.79  ? 119 PHE A CB  1 
ATOM   970  C CG  . PHE A 1 119 ? 39.616 -22.627 -70.189 1.00 7.20  ? 119 PHE A CG  1 
ATOM   971  C CD1 . PHE A 1 119 ? 39.127 -23.909 -70.360 1.00 7.59  ? 119 PHE A CD1 1 
ATOM   972  C CD2 . PHE A 1 119 ? 39.119 -21.923 -69.092 1.00 7.98  ? 119 PHE A CD2 1 
ATOM   973  C CE1 . PHE A 1 119 ? 38.233 -24.527 -69.554 1.00 8.15  ? 119 PHE A CE1 1 
ATOM   974  C CE2 . PHE A 1 119 ? 38.206 -22.558 -68.230 1.00 8.63  ? 119 PHE A CE2 1 
ATOM   975  C CZ  . PHE A 1 119 ? 37.777 -23.858 -68.457 1.00 7.80  ? 119 PHE A CZ  1 
ATOM   976  N N   . GLY A 1 120 ? 43.619 -20.768 -70.910 1.00 7.06  ? 120 GLY A N   1 
ATOM   977  C CA  . GLY A 1 120 ? 44.945 -20.546 -71.495 1.00 8.02  ? 120 GLY A CA  1 
ATOM   978  C C   . GLY A 1 120 ? 45.582 -19.234 -71.090 1.00 8.00  ? 120 GLY A C   1 
ATOM   979  O O   . GLY A 1 120 ? 46.682 -18.958 -71.569 1.00 9.72  ? 120 GLY A O   1 
ATOM   980  N N   . SER A 1 121 ? 44.922 -18.439 -70.261 1.00 8.09  ? 121 SER A N   1 
ATOM   981  C CA  . SER A 1 121 ? 45.408 -17.193 -69.707 1.00 7.59  ? 121 SER A CA  1 
ATOM   982  C C   . SER A 1 121 ? 46.216 -17.394 -68.428 1.00 7.34  ? 121 SER A C   1 
ATOM   983  O O   . SER A 1 121 ? 45.962 -18.336 -67.680 1.00 9.25  ? 121 SER A O   1 
ATOM   984  C CB  . SER A 1 121 ? 44.240 -16.239 -69.355 1.00 8.27  ? 121 SER A CB  1 
ATOM   985  O OG  . SER A 1 121 ? 43.394 -15.949 -70.469 1.00 9.36  ? 121 SER A OG  1 
ATOM   986  N N   A LYS A 1 122 ? 47.075 -16.426 -68.169 0.40 6.50  ? 122 LYS A N   1 
ATOM   987  N N   B LYS A 1 122 ? 47.105 -16.450 -68.155 0.60 7.83  ? 122 LYS A N   1 
ATOM   988  C CA  A LYS A 1 122 ? 47.684 -16.184 -66.878 0.40 6.30  ? 122 LYS A CA  1 
ATOM   989  C CA  B LYS A 1 122 ? 47.757 -16.306 -66.843 0.60 8.18  ? 122 LYS A CA  1 
ATOM   990  C C   A LYS A 1 122 ? 46.662 -15.497 -65.979 0.40 5.57  ? 122 LYS A C   1 
ATOM   991  C C   B LYS A 1 122 ? 46.802 -15.502 -65.954 0.60 8.61  ? 122 LYS A C   1 
ATOM   992  O O   A LYS A 1 122 ? 46.017 -14.541 -66.426 0.40 6.35  ? 122 LYS A O   1 
ATOM   993  O O   B LYS A 1 122 ? 46.306 -14.432 -66.354 0.60 10.84 ? 122 LYS A O   1 
ATOM   994  C CB  A LYS A 1 122 ? 48.924 -15.300 -66.999 0.40 6.45  ? 122 LYS A CB  1 
ATOM   995  C CB  B LYS A 1 122 ? 49.151 -15.729 -67.069 0.60 9.01  ? 122 LYS A CB  1 
ATOM   996  C CG  A LYS A 1 122 ? 50.010 -15.651 -66.026 0.40 10.31 ? 122 LYS A CG  1 
ATOM   997  C CG  B LYS A 1 122 ? 50.192 -16.603 -67.783 0.60 18.41 ? 122 LYS A CG  1 
ATOM   998  C CD  A LYS A 1 122 ? 51.404 -15.173 -66.248 0.40 8.27  ? 122 LYS A CD  1 
ATOM   999  C CD  B LYS A 1 122 ? 50.929 -15.935 -68.923 0.60 15.73 ? 122 LYS A CD  1 
ATOM   1000 C CE  A LYS A 1 122 ? 52.241 -14.859 -65.004 0.40 11.92 ? 122 LYS A CE  1 
ATOM   1001 C CE  B LYS A 1 122 ? 51.680 -16.691 -69.985 0.60 7.09  ? 122 LYS A CE  1 
ATOM   1002 N NZ  A LYS A 1 122 ? 53.684 -14.983 -65.398 0.40 11.00 ? 122 LYS A NZ  1 
ATOM   1003 N NZ  B LYS A 1 122 ? 51.001 -17.885 -70.242 0.60 40.53 ? 122 LYS A NZ  1 
ATOM   1004 N N   . VAL A 1 123 ? 46.528 -15.980 -64.742 1.00 6.60  ? 123 VAL A N   1 
ATOM   1005 C CA  . VAL A 1 123 ? 45.576 -15.428 -63.796 1.00 6.44  ? 123 VAL A CA  1 
ATOM   1006 C C   . VAL A 1 123 ? 46.134 -15.465 -62.412 1.00 6.61  ? 123 VAL A C   1 
ATOM   1007 O O   . VAL A 1 123 ? 46.988 -16.289 -62.074 1.00 7.53  ? 123 VAL A O   1 
ATOM   1008 C CB  . VAL A 1 123 ? 44.227 -16.223 -63.792 1.00 7.32  ? 123 VAL A CB  1 
ATOM   1009 C CG1 . VAL A 1 123 ? 43.571 -16.198 -65.152 1.00 8.68  ? 123 VAL A CG1 1 
ATOM   1010 C CG2 . VAL A 1 123 ? 44.413 -17.643 -63.253 1.00 8.97  ? 123 VAL A CG2 1 
ATOM   1011 N N   . THR A 1 124 ? 45.646 -14.544 -61.571 1.00 6.23  ? 124 THR A N   1 
ATOM   1012 C CA  . THR A 1 124 ? 45.812 -14.631 -60.132 1.00 6.34  ? 124 THR A CA  1 
ATOM   1013 C C   . THR A 1 124 ? 44.434 -14.663 -59.478 1.00 6.42  ? 124 THR A C   1 
ATOM   1014 O O   . THR A 1 124 ? 43.402 -14.417 -60.115 1.00 6.64  ? 124 THR A O   1 
ATOM   1015 C CB  . THR A 1 124 ? 46.695 -13.491 -59.583 1.00 6.63  ? 124 THR A CB  1 
ATOM   1016 O OG1 . THR A 1 124 ? 47.095 -13.853 -58.220 1.00 7.02  ? 124 THR A OG1 1 
ATOM   1017 C CG2 . THR A 1 124 ? 45.972 -12.161 -59.602 1.00 6.74  ? 124 THR A CG2 1 
ATOM   1018 N N   . THR A 1 125 ? 44.426 -15.015 -58.180 1.00 5.90  ? 125 THR A N   1 
ATOM   1019 C CA  . THR A 1 125 ? 43.263 -15.077 -57.351 1.00 6.06  ? 125 THR A CA  1 
ATOM   1020 C C   . THR A 1 125 ? 43.705 -14.765 -55.903 1.00 5.85  ? 125 THR A C   1 
ATOM   1021 O O   . THR A 1 125 ? 44.902 -14.658 -55.614 1.00 6.60  ? 125 THR A O   1 
ATOM   1022 C CB  . THR A 1 125 ? 42.590 -16.454 -57.312 1.00 6.17  ? 125 THR A CB  1 
ATOM   1023 O OG1 . THR A 1 125 ? 43.471 -17.387 -56.649 1.00 6.73  ? 125 THR A OG1 1 
ATOM   1024 C CG2 . THR A 1 125 ? 42.282 -16.994 -58.691 1.00 7.96  ? 125 THR A CG2 1 
ATOM   1025 N N   . HIS A 1 126 ? 42.743 -14.745 -54.987 1.00 5.88  ? 126 HIS A N   1 
ATOM   1026 C CA  . HIS A 1 126 ? 43.143 -14.807 -53.586 1.00 5.65  ? 126 HIS A CA  1 
ATOM   1027 C C   . HIS A 1 126 ? 43.947 -16.081 -53.373 1.00 5.97  ? 126 HIS A C   1 
ATOM   1028 O O   . HIS A 1 126 ? 43.584 -17.135 -53.943 1.00 6.39  ? 126 HIS A O   1 
ATOM   1029 C CB  . HIS A 1 126 ? 41.913 -14.823 -52.658 1.00 6.36  ? 126 HIS A CB  1 
ATOM   1030 C CG  . HIS A 1 126 ? 42.250 -14.595 -51.228 1.00 6.09  ? 126 HIS A CG  1 
ATOM   1031 N ND1 . HIS A 1 126 ? 42.714 -15.574 -50.380 1.00 7.51  ? 126 HIS A ND1 1 
ATOM   1032 C CD2 . HIS A 1 126 ? 42.265 -13.416 -50.542 1.00 7.36  ? 126 HIS A CD2 1 
ATOM   1033 C CE1 . HIS A 1 126 ? 42.965 -14.985 -49.228 1.00 7.70  ? 126 HIS A CE1 1 
ATOM   1034 N NE2 . HIS A 1 126 ? 42.703 -13.688 -49.281 1.00 7.71  ? 126 HIS A NE2 1 
ATOM   1035 N N   . PRO A 1 127 ? 44.982 -16.086 -52.536 1.00 6.29  ? 127 PRO A N   1 
ATOM   1036 C CA  . PRO A 1 127 ? 45.684 -17.345 -52.265 1.00 6.87  ? 127 PRO A CA  1 
ATOM   1037 C C   . PRO A 1 127 ? 44.772 -18.519 -51.893 1.00 6.98  ? 127 PRO A C   1 
ATOM   1038 O O   . PRO A 1 127 ? 45.041 -19.654 -52.360 1.00 8.03  ? 127 PRO A O   1 
ATOM   1039 C CB  . PRO A 1 127 ? 46.614 -16.961 -51.134 1.00 9.60  ? 127 PRO A CB  1 
ATOM   1040 C CG  . PRO A 1 127 ? 46.809 -15.501 -51.208 1.00 12.35 ? 127 PRO A CG  1 
ATOM   1041 C CD  . PRO A 1 127 ? 45.597 -14.931 -51.854 1.00 7.68  ? 127 PRO A CD  1 
ATOM   1042 N N   . LEU A 1 128 ? 43.717 -18.303 -51.142 1.00 6.84  ? 128 LEU A N   1 
ATOM   1043 C CA  . LEU A 1 128 ? 42.862 -19.404 -50.733 1.00 7.67  ? 128 LEU A CA  1 
ATOM   1044 C C   . LEU A 1 128 ? 41.964 -19.903 -51.833 1.00 8.61  ? 128 LEU A C   1 
ATOM   1045 O O   . LEU A 1 128 ? 41.389 -20.981 -51.674 1.00 10.76 ? 128 LEU A O   1 
ATOM   1046 C CB  . LEU A 1 128 ? 42.026 -18.990 -49.502 1.00 8.21  ? 128 LEU A CB  1 
ATOM   1047 C CG  . LEU A 1 128 ? 42.859 -18.620 -48.267 1.00 9.48  ? 128 LEU A CG  1 
ATOM   1048 C CD1 . LEU A 1 128 ? 41.932 -18.005 -47.203 1.00 12.53 ? 128 LEU A CD1 1 
ATOM   1049 C CD2 . LEU A 1 128 ? 43.594 -19.818 -47.694 1.00 18.02 ? 128 LEU A CD2 1 
ATOM   1050 N N   . ALA A 1 129 ? 41.848 -19.186 -52.964 1.00 6.92  ? 129 ALA A N   1 
ATOM   1051 C CA  . ALA A 1 129 ? 41.076 -19.601 -54.104 1.00 7.23  ? 129 ALA A CA  1 
ATOM   1052 C C   . ALA A 1 129 ? 41.900 -20.233 -55.208 1.00 7.39  ? 129 ALA A C   1 
ATOM   1053 O O   . ALA A 1 129 ? 41.342 -20.653 -56.233 1.00 7.75  ? 129 ALA A O   1 
ATOM   1054 C CB  . ALA A 1 129 ? 40.323 -18.374 -54.696 1.00 8.61  ? 129 ALA A CB  1 
ATOM   1055 N N   . LYS A 1 130 ? 43.222 -20.342 -55.009 1.00 7.10  ? 130 LYS A N   1 
ATOM   1056 C CA  . LYS A 1 130 ? 44.094 -20.884 -56.048 1.00 6.84  ? 130 LYS A CA  1 
ATOM   1057 C C   . LYS A 1 130 ? 43.708 -22.287 -56.485 1.00 7.55  ? 130 LYS A C   1 
ATOM   1058 O O   . LYS A 1 130 ? 43.610 -22.613 -57.659 1.00 7.59  ? 130 LYS A O   1 
ATOM   1059 C CB  . LYS A 1 130 ? 45.560 -20.869 -55.593 1.00 7.74  ? 130 LYS A CB  1 
ATOM   1060 C CG  . LYS A 1 130 ? 46.512 -21.547 -56.568 1.00 7.91  ? 130 LYS A CG  1 
ATOM   1061 C CD  . LYS A 1 130 ? 47.953 -21.549 -56.138 1.00 9.70  ? 130 LYS A CD  1 
ATOM   1062 C CE  . LYS A 1 130 ? 48.846 -22.201 -57.238 1.00 11.51 ? 130 LYS A CE  1 
ATOM   1063 N NZ  . LYS A 1 130 ? 50.265 -22.240 -56.856 1.00 15.22 ? 130 LYS A NZ  1 
ATOM   1064 N N   . ASP A 1 131 ? 43.513 -23.186 -55.494 1.00 7.71  ? 131 ASP A N   1 
ATOM   1065 C CA  . ASP A 1 131 ? 43.271 -24.593 -55.852 1.00 8.01  ? 131 ASP A CA  1 
ATOM   1066 C C   . ASP A 1 131 ? 41.991 -24.737 -56.626 1.00 8.23  ? 131 ASP A C   1 
ATOM   1067 O O   . ASP A 1 131 ? 41.934 -25.514 -57.580 1.00 8.81  ? 131 ASP A O   1 
ATOM   1068 C CB  . ASP A 1 131 ? 43.245 -25.452 -54.574 1.00 10.06 ? 131 ASP A CB  1 
ATOM   1069 C CG  . ASP A 1 131 ? 44.570 -25.580 -53.881 1.00 12.03 ? 131 ASP A CG  1 
ATOM   1070 O OD1 . ASP A 1 131 ? 45.639 -25.172 -54.390 1.00 14.01 ? 131 ASP A OD1 1 
ATOM   1071 O OD2 . ASP A 1 131 ? 44.542 -26.100 -52.742 1.00 20.00 ? 131 ASP A OD2 1 
ATOM   1072 N N   . LYS A 1 132 ? 40.945 -23.984 -56.277 1.00 7.64  ? 132 LYS A N   1 
ATOM   1073 C CA  . LYS A 1 132 ? 39.678 -24.046 -57.012 1.00 8.44  ? 132 LYS A CA  1 
ATOM   1074 C C   . LYS A 1 132 ? 39.900 -23.580 -58.456 1.00 7.59  ? 132 LYS A C   1 
ATOM   1075 O O   . LYS A 1 132 ? 39.475 -24.224 -59.411 1.00 8.37  ? 132 LYS A O   1 
ATOM   1076 C CB  . LYS A 1 132 ? 38.594 -23.235 -56.287 1.00 10.12 ? 132 LYS A CB  1 
ATOM   1077 C CG  . LYS A 1 132 ? 37.263 -23.188 -57.004 1.00 15.14 ? 132 LYS A CG  1 
ATOM   1078 C CD  . LYS A 1 132 ? 36.292 -22.496 -55.992 1.00 25.87 ? 132 LYS A CD  1 
ATOM   1079 C CE  . LYS A 1 132 ? 34.890 -22.590 -56.352 1.00 28.65 ? 132 LYS A CE  1 
ATOM   1080 N NZ  . LYS A 1 132 ? 34.168 -23.826 -56.060 1.00 29.93 ? 132 LYS A NZ  1 
ATOM   1081 N N   . MET A 1 133 ? 40.573 -22.439 -58.624 1.00 6.80  ? 133 MET A N   1 
ATOM   1082 C CA  . MET A 1 133 ? 40.813 -21.851 -59.925 1.00 6.28  ? 133 MET A CA  1 
ATOM   1083 C C   . MET A 1 133 ? 41.613 -22.794 -60.834 1.00 6.05  ? 133 MET A C   1 
ATOM   1084 O O   . MET A 1 133 ? 41.418 -22.813 -62.041 1.00 6.76  ? 133 MET A O   1 
ATOM   1085 C CB  . MET A 1 133 ? 41.530 -20.523 -59.765 1.00 6.83  ? 133 MET A CB  1 
ATOM   1086 C CG  . MET A 1 133 ? 41.699 -19.779 -61.065 1.00 6.73  ? 133 MET A CG  1 
ATOM   1087 S SD  . MET A 1 133 ? 40.104 -19.133 -61.646 1.00 7.21  ? 133 MET A SD  1 
ATOM   1088 C CE  . MET A 1 133 ? 40.662 -18.176 -63.078 1.00 7.66  ? 133 MET A CE  1 
ATOM   1089 N N   . MET A 1 134 ? 42.554 -23.498 -60.221 1.00 6.17  ? 134 MET A N   1 
ATOM   1090 C CA  . MET A 1 134 ? 43.526 -24.330 -60.927 1.00 6.54  ? 134 MET A CA  1 
ATOM   1091 C C   . MET A 1 134 ? 43.049 -25.730 -61.173 1.00 6.13  ? 134 MET A C   1 
ATOM   1092 O O   . MET A 1 134 ? 43.780 -26.518 -61.772 1.00 6.77  ? 134 MET A O   1 
ATOM   1093 C CB  . MET A 1 134 ? 44.872 -24.307 -60.190 1.00 6.95  ? 134 MET A CB  1 
ATOM   1094 C CG  . MET A 1 134 ? 45.553 -22.962 -60.342 1.00 7.50  ? 134 MET A CG  1 
ATOM   1095 S SD  . MET A 1 134 ? 45.975 -22.465 -62.009 1.00 7.85  ? 134 MET A SD  1 
ATOM   1096 C CE  . MET A 1 134 ? 47.193 -23.707 -62.393 1.00 8.52  ? 134 MET A CE  1 
ATOM   1097 N N   . ASN A 1 135 ? 41.822 -26.089 -60.797 1.00 6.65  ? 135 ASN A N   1 
ATOM   1098 C CA  . ASN A 1 135 ? 41.327 -27.438 -61.027 1.00 6.65  ? 135 ASN A CA  1 
ATOM   1099 C C   . ASN A 1 135 ? 41.196 -27.720 -62.509 1.00 6.63  ? 135 ASN A C   1 
ATOM   1100 O O   . ASN A 1 135 ? 40.451 -27.069 -63.229 1.00 7.64  ? 135 ASN A O   1 
ATOM   1101 C CB  . ASN A 1 135 ? 39.946 -27.562 -60.332 1.00 8.55  ? 135 ASN A CB  1 
ATOM   1102 C CG  . ASN A 1 135 ? 39.427 -28.964 -60.322 1.00 12.25 ? 135 ASN A CG  1 
ATOM   1103 O OD1 . ASN A 1 135 ? 39.684 -29.773 -61.196 1.00 17.37 ? 135 ASN A OD1 1 
ATOM   1104 N ND2 . ASN A 1 135 ? 38.580 -29.235 -59.367 1.00 24.41 ? 135 ASN A ND2 1 
ATOM   1105 N N   . GLY A 1 136 ? 41.980 -28.692 -62.986 1.00 7.20  ? 136 GLY A N   1 
ATOM   1106 C CA  . GLY A 1 136 ? 42.101 -29.018 -64.381 1.00 6.56  ? 136 GLY A CA  1 
ATOM   1107 C C   . GLY A 1 136 ? 43.242 -28.388 -65.141 1.00 6.41  ? 136 GLY A C   1 
ATOM   1108 O O   . GLY A 1 136 ? 43.486 -28.734 -66.296 1.00 7.99  ? 136 GLY A O   1 
ATOM   1109 N N   . GLY A 1 137 ? 43.940 -27.419 -64.533 1.00 6.47  ? 137 GLY A N   1 
ATOM   1110 C CA  . GLY A 1 137 ? 45.063 -26.799 -65.190 1.00 6.58  ? 137 GLY A CA  1 
ATOM   1111 C C   . GLY A 1 137 ? 44.729 -25.962 -66.401 1.00 5.77  ? 137 GLY A C   1 
ATOM   1112 O O   . GLY A 1 137 ? 45.539 -25.874 -67.323 1.00 7.33  ? 137 GLY A O   1 
ATOM   1113 N N   . HIS A 1 138 ? 43.559 -25.307 -66.397 1.00 5.84  ? 138 HIS A N   1 
ATOM   1114 C CA  . HIS A 1 138 ? 43.085 -24.597 -67.544 1.00 6.50  ? 138 HIS A CA  1 
ATOM   1115 C C   . HIS A 1 138 ? 43.677 -23.185 -67.685 1.00 6.41  ? 138 HIS A C   1 
ATOM   1116 O O   . HIS A 1 138 ? 43.539 -22.572 -68.751 1.00 7.88  ? 138 HIS A O   1 
ATOM   1117 C CB  . HIS A 1 138 ? 41.572 -24.507 -67.546 1.00 7.54  ? 138 HIS A CB  1 
ATOM   1118 C CG  . HIS A 1 138 ? 40.912 -25.845 -67.694 1.00 6.75  ? 138 HIS A CG  1 
ATOM   1119 N ND1 . HIS A 1 138 ? 40.959 -26.589 -68.855 1.00 7.67  ? 138 HIS A ND1 1 
ATOM   1120 C CD2 . HIS A 1 138 ? 40.178 -26.543 -66.816 1.00 8.21  ? 138 HIS A CD2 1 
ATOM   1121 C CE1 . HIS A 1 138 ? 40.273 -27.726 -68.664 1.00 8.21  ? 138 HIS A CE1 1 
ATOM   1122 N NE2 . HIS A 1 138 ? 39.789 -27.727 -67.425 1.00 7.66  ? 138 HIS A NE2 1 
ATOM   1123 N N   . TYR A 1 139 ? 44.284 -22.699 -66.624 1.00 7.02  ? 139 TYR A N   1 
ATOM   1124 C CA  . TYR A 1 139 ? 44.953 -21.413 -66.526 1.00 7.11  ? 139 TYR A CA  1 
ATOM   1125 C C   . TYR A 1 139 ? 46.338 -21.620 -65.979 1.00 7.62  ? 139 TYR A C   1 
ATOM   1126 O O   . TYR A 1 139 ? 46.588 -22.673 -65.389 1.00 8.63  ? 139 TYR A O   1 
ATOM   1127 C CB  . TYR A 1 139 ? 44.223 -20.463 -65.578 1.00 7.50  ? 139 TYR A CB  1 
ATOM   1128 C CG  . TYR A 1 139 ? 42.746 -20.257 -65.844 1.00 7.35  ? 139 TYR A CG  1 
ATOM   1129 C CD1 . TYR A 1 139 ? 41.755 -20.992 -65.197 1.00 7.68  ? 139 TYR A CD1 1 
ATOM   1130 C CD2 . TYR A 1 139 ? 42.315 -19.338 -66.784 1.00 7.06  ? 139 TYR A CD2 1 
ATOM   1131 C CE1 . TYR A 1 139 ? 40.408 -20.841 -65.428 1.00 7.95  ? 139 TYR A CE1 1 
ATOM   1132 C CE2 . TYR A 1 139 ? 40.979 -19.140 -67.031 1.00 6.76  ? 139 TYR A CE2 1 
ATOM   1133 C CZ  . TYR A 1 139 ? 39.999 -19.889 -66.372 1.00 7.16  ? 139 TYR A CZ  1 
ATOM   1134 O OH  . TYR A 1 139 ? 38.658 -19.709 -66.562 1.00 8.33  ? 139 TYR A OH  1 
ATOM   1135 N N   . THR A 1 140 ? 47.216 -20.636 -66.116 1.00 7.54  ? 140 THR A N   1 
ATOM   1136 C CA  . THR A 1 140 ? 48.546 -20.636 -65.499 1.00 7.57  ? 140 THR A CA  1 
ATOM   1137 C C   . THR A 1 140 ? 48.507 -19.615 -64.383 1.00 7.00  ? 140 THR A C   1 
ATOM   1138 O O   . THR A 1 140 ? 48.037 -18.480 -64.540 1.00 8.38  ? 140 THR A O   1 
ATOM   1139 C CB  . THR A 1 140 ? 49.635 -20.255 -66.545 1.00 9.70  ? 140 THR A CB  1 
ATOM   1140 O OG1 . THR A 1 140 ? 49.573 -21.316 -67.488 1.00 11.62 ? 140 THR A OG1 1 
ATOM   1141 C CG2 . THR A 1 140 ? 50.996 -20.203 -65.939 1.00 14.65 ? 140 THR A CG2 1 
ATOM   1142 N N   . TYR A 1 141 ? 48.977 -20.004 -63.203 1.00 7.49  ? 141 TYR A N   1 
ATOM   1143 C CA  . TYR A 1 141 ? 48.856 -19.172 -62.029 1.00 7.52  ? 141 TYR A CA  1 
ATOM   1144 C C   . TYR A 1 141 ? 49.931 -18.154 -61.875 1.00 8.28  ? 141 TYR A C   1 
ATOM   1145 O O   . TYR A 1 141 ? 51.088 -18.420 -62.207 1.00 14.74 ? 141 TYR A O   1 
ATOM   1146 C CB  . TYR A 1 141 ? 48.790 -20.057 -60.764 1.00 8.22  ? 141 TYR A CB  1 
ATOM   1147 C CG  . TYR A 1 141 ? 48.111 -19.329 -59.622 1.00 7.34  ? 141 TYR A CG  1 
ATOM   1148 C CD1 . TYR A 1 141 ? 46.728 -19.145 -59.651 1.00 7.55  ? 141 TYR A CD1 1 
ATOM   1149 C CD2 . TYR A 1 141 ? 48.802 -18.824 -58.521 1.00 7.51  ? 141 TYR A CD2 1 
ATOM   1150 C CE1 . TYR A 1 141 ? 46.072 -18.465 -58.611 1.00 7.51  ? 141 TYR A CE1 1 
ATOM   1151 C CE2 . TYR A 1 141 ? 48.194 -18.143 -57.504 1.00 8.31  ? 141 TYR A CE2 1 
ATOM   1152 C CZ  . TYR A 1 141 ? 46.800 -17.986 -57.541 1.00 7.43  ? 141 TYR A CZ  1 
ATOM   1153 O OH  . TYR A 1 141 ? 46.207 -17.282 -56.495 1.00 7.98  ? 141 TYR A OH  1 
ATOM   1154 N N   . SER A 1 142 ? 49.586 -17.025 -61.318 1.00 7.88  ? 142 SER A N   1 
ATOM   1155 C CA  . SER A 1 142 ? 50.464 -15.901 -61.018 1.00 8.70  ? 142 SER A CA  1 
ATOM   1156 C C   . SER A 1 142 ? 50.276 -15.413 -59.598 1.00 8.02  ? 142 SER A C   1 
ATOM   1157 O O   . SER A 1 142 ? 49.132 -15.396 -59.134 1.00 8.35  ? 142 SER A O   1 
ATOM   1158 C CB  . SER A 1 142 ? 50.110 -14.774 -61.946 1.00 11.21 ? 142 SER A CB  1 
ATOM   1159 O OG  . SER A 1 142 ? 50.738 -13.576 -61.661 1.00 12.60 ? 142 SER A OG  1 
ATOM   1160 N N   . GLU A 1 143 ? 51.349 -14.992 -58.953 1.00 8.84  ? 143 GLU A N   1 
ATOM   1161 C CA  . GLU A 1 143 ? 51.270 -14.347 -57.687 1.00 10.43 ? 143 GLU A CA  1 
ATOM   1162 C C   . GLU A 1 143 ? 51.374 -12.818 -57.773 1.00 9.83  ? 143 GLU A C   1 
ATOM   1163 O O   . GLU A 1 143 ? 51.469 -12.134 -56.748 1.00 12.29 ? 143 GLU A O   1 
ATOM   1164 C CB  . GLU A 1 143 ? 52.372 -14.910 -56.780 1.00 14.58 ? 143 GLU A CB  1 
ATOM   1165 C CG  . GLU A 1 143 ? 52.209 -16.393 -56.422 1.00 20.57 ? 143 GLU A CG  1 
ATOM   1166 C CD  . GLU A 1 143 ? 53.341 -16.846 -55.499 1.00 34.58 ? 143 GLU A CD  1 
ATOM   1167 O OE1 . GLU A 1 143 ? 53.021 -17.735 -54.679 1.00 59.35 ? 143 GLU A OE1 1 
ATOM   1168 O OE2 . GLU A 1 143 ? 54.503 -16.364 -55.552 1.00 55.21 ? 143 GLU A OE2 1 
ATOM   1169 N N   . ASN A 1 144 ? 51.347 -12.266 -58.989 1.00 9.13  ? 144 ASN A N   1 
ATOM   1170 C CA  . ASN A 1 144 ? 51.321 -10.818 -59.088 1.00 9.40  ? 144 ASN A CA  1 
ATOM   1171 C C   . ASN A 1 144 ? 50.030 -10.262 -58.470 1.00 8.07  ? 144 ASN A C   1 
ATOM   1172 O O   . ASN A 1 144 ? 48.957 -10.859 -58.531 1.00 9.08  ? 144 ASN A O   1 
ATOM   1173 C CB  . ASN A 1 144 ? 51.424 -10.402 -60.556 1.00 10.46 ? 144 ASN A CB  1 
ATOM   1174 C CG  . ASN A 1 144 ? 52.802 -10.640 -61.135 1.00 14.16 ? 144 ASN A CG  1 
ATOM   1175 O OD1 . ASN A 1 144 ? 53.785 -10.501 -60.431 1.00 19.85 ? 144 ASN A OD1 1 
ATOM   1176 N ND2 . ASN A 1 144 ? 52.804 -10.986 -62.394 1.00 16.30 ? 144 ASN A ND2 1 
ATOM   1177 N N   . ARG A 1 145 ? 50.133 -9.080  -57.889 1.00 8.36  ? 145 ARG A N   1 
ATOM   1178 C CA  . ARG A 1 145 ? 49.015 -8.470  -57.190 1.00 7.75  ? 145 ARG A CA  1 
ATOM   1179 C C   . ARG A 1 145 ? 47.877 -8.120  -58.128 1.00 7.14  ? 145 ARG A C   1 
ATOM   1180 O O   . ARG A 1 145 ? 46.702 -8.251  -57.757 1.00 7.40  ? 145 ARG A O   1 
ATOM   1181 C CB  . ARG A 1 145 ? 49.512 -7.253  -56.420 1.00 8.64  ? 145 ARG A CB  1 
ATOM   1182 C CG  . ARG A 1 145 ? 50.386 -7.643  -55.215 1.00 10.47 ? 145 ARG A CG  1 
ATOM   1183 C CD  . ARG A 1 145 ? 51.027 -6.449  -54.522 1.00 10.28 ? 145 ARG A CD  1 
ATOM   1184 N NE  . ARG A 1 145 ? 50.025 -5.590  -53.906 1.00 10.68 ? 145 ARG A NE  1 
ATOM   1185 C CZ  . ARG A 1 145 ? 49.392 -5.881  -52.743 1.00 11.96 ? 145 ARG A CZ  1 
ATOM   1186 N NH1 . ARG A 1 145 ? 49.675 -6.955  -52.051 1.00 15.91 ? 145 ARG A NH1 1 
ATOM   1187 N NH2 . ARG A 1 145 ? 48.491 -5.063  -52.309 1.00 15.99 ? 145 ARG A NH2 1 
ATOM   1188 N N   . VAL A 1 146 ? 48.212 -7.715  -59.337 1.00 7.31  ? 146 VAL A N   1 
ATOM   1189 C CA  . VAL A 1 146 ? 47.310 -7.575  -60.464 1.00 6.82  ? 146 VAL A CA  1 
ATOM   1190 C C   . VAL A 1 146 ? 47.964 -8.345  -61.635 1.00 7.23  ? 146 VAL A C   1 
ATOM   1191 O O   . VAL A 1 146 ? 49.170 -8.179  -61.872 1.00 9.34  ? 146 VAL A O   1 
ATOM   1192 C CB  . VAL A 1 146 ? 47.060 -6.154  -60.896 1.00 8.24  ? 146 VAL A CB  1 
ATOM   1193 C CG1 . VAL A 1 146 ? 46.166 -6.095  -62.120 1.00 10.50 ? 146 VAL A CG1 1 
ATOM   1194 C CG2 . VAL A 1 146 ? 46.436 -5.392  -59.728 1.00 9.49  ? 146 VAL A CG2 1 
ATOM   1195 N N   . GLU A 1 147 ? 47.214 -9.182  -62.330 1.00 7.53  ? 147 GLU A N   1 
ATOM   1196 C CA  . GLU A 1 147 ? 47.684 -9.908  -63.514 1.00 7.28  ? 147 GLU A CA  1 
ATOM   1197 C C   . GLU A 1 147 ? 46.798 -9.515  -64.675 1.00 7.43  ? 147 GLU A C   1 
ATOM   1198 O O   . GLU A 1 147 ? 45.589 -9.412  -64.573 1.00 10.71 ? 147 GLU A O   1 
ATOM   1199 C CB  . GLU A 1 147 ? 47.636 -11.421 -63.266 1.00 8.55  ? 147 GLU A CB  1 
ATOM   1200 C CG  . GLU A 1 147 ? 48.276 -12.278 -64.356 1.00 9.56  ? 147 GLU A CG  1 
ATOM   1201 C CD  . GLU A 1 147 ? 49.699 -11.835 -64.605 1.00 11.10 ? 147 GLU A CD  1 
ATOM   1202 O OE1 . GLU A 1 147 ? 50.545 -12.018 -63.748 1.00 12.84 ? 147 GLU A OE1 1 
ATOM   1203 O OE2 . GLU A 1 147 ? 49.997 -11.201 -65.642 1.00 18.21 ? 147 GLU A OE2 1 
ATOM   1204 N N   . LYS A 1 148 ? 47.405 -9.233  -65.800 1.00 9.83  ? 148 LYS A N   1 
ATOM   1205 C CA  . LYS A 1 148 ? 46.620 -8.899  -66.991 1.00 10.94 ? 148 LYS A CA  1 
ATOM   1206 C C   . LYS A 1 148 ? 47.231 -9.691  -68.145 1.00 10.45 ? 148 LYS A C   1 
ATOM   1207 O O   . LYS A 1 148 ? 48.393 -9.471  -68.508 1.00 14.06 ? 148 LYS A O   1 
ATOM   1208 C CB  . LYS A 1 148 ? 46.642 -7.408  -67.292 1.00 11.74 ? 148 LYS A CB  1 
ATOM   1209 C CG  . LYS A 1 148 ? 45.720 -6.988  -68.432 1.00 11.62 ? 148 LYS A CG  1 
ATOM   1210 C CD  . LYS A 1 148 ? 45.779 -5.514  -68.704 1.00 13.29 ? 148 LYS A CD  1 
ATOM   1211 C CE  . LYS A 1 148 ? 44.813 -4.966  -69.704 1.00 15.56 ? 148 LYS A CE  1 
ATOM   1212 N NZ  . LYS A 1 148 ? 45.039 -5.585  -71.027 1.00 16.32 ? 148 LYS A NZ  1 
ATOM   1213 N N   . ASP A 1 149 ? 46.447 -10.561 -68.721 1.00 9.40  ? 149 ASP A N   1 
ATOM   1214 C CA  . ASP A 1 149 ? 46.876 -11.338 -69.862 1.00 9.63  ? 149 ASP A CA  1 
ATOM   1215 C C   . ASP A 1 149 ? 45.847 -10.974 -70.915 1.00 11.79 ? 149 ASP A C   1 
ATOM   1216 O O   . ASP A 1 149 ? 44.776 -11.551 -71.007 1.00 11.49 ? 149 ASP A O   1 
ATOM   1217 C CB  . ASP A 1 149 ? 46.953 -12.826 -69.564 1.00 11.06 ? 149 ASP A CB  1 
ATOM   1218 C CG  . ASP A 1 149 ? 47.704 -13.621 -70.586 1.00 11.19 ? 149 ASP A CG  1 
ATOM   1219 O OD1 . ASP A 1 149 ? 48.208 -13.056 -71.598 1.00 15.62 ? 149 ASP A OD1 1 
ATOM   1220 O OD2 . ASP A 1 149 ? 47.804 -14.863 -70.384 1.00 10.11 ? 149 ASP A OD2 1 
ATOM   1221 N N   . GLY A 1 150 ? 46.188 -9.948  -71.702 1.00 14.47 ? 150 GLY A N   1 
ATOM   1222 C CA  . GLY A 1 150 ? 45.285 -9.447  -72.697 1.00 15.78 ? 150 GLY A CA  1 
ATOM   1223 C C   . GLY A 1 150 ? 44.008 -8.958  -72.056 1.00 11.36 ? 150 GLY A C   1 
ATOM   1224 O O   . GLY A 1 150 ? 43.945 -8.090  -71.148 1.00 15.83 ? 150 GLY A O   1 
ATOM   1225 N N   . LEU A 1 151 ? 42.894 -9.540  -72.489 1.00 11.59 ? 151 LEU A N   1 
ATOM   1226 C CA  . LEU A 1 151 ? 41.549 -9.162  -72.071 1.00 9.80  ? 151 LEU A CA  1 
ATOM   1227 C C   . LEU A 1 151 ? 41.042 -9.865  -70.802 1.00 7.80  ? 151 LEU A C   1 
ATOM   1228 O O   . LEU A 1 151 ? 39.876 -9.683  -70.470 1.00 9.08  ? 151 LEU A O   1 
ATOM   1229 C CB  . LEU A 1 151 ? 40.568 -9.354  -73.250 1.00 11.25 ? 151 LEU A CB  1 
ATOM   1230 C CG  . LEU A 1 151 ? 40.896 -8.466  -74.467 1.00 13.98 ? 151 LEU A CG  1 
ATOM   1231 C CD1 . LEU A 1 151 ? 40.173 -9.047  -75.671 1.00 18.79 ? 151 LEU A CD1 1 
ATOM   1232 C CD2 . LEU A 1 151 ? 40.505 -7.023  -74.147 1.00 15.84 ? 151 LEU A CD2 1 
ATOM   1233 N N   . ILE A 1 152 ? 41.894 -10.571 -70.094 1.00 7.79  ? 152 ILE A N   1 
ATOM   1234 C CA  . ILE A 1 152 ? 41.554 -11.171 -68.764 1.00 7.62  ? 152 ILE A CA  1 
ATOM   1235 C C   . ILE A 1 152 ? 42.430 -10.512 -67.723 1.00 6.88  ? 152 ILE A C   1 
ATOM   1236 O O   . ILE A 1 152 ? 43.664 -10.699 -67.735 1.00 7.78  ? 152 ILE A O   1 
ATOM   1237 C CB  . ILE A 1 152 ? 41.721 -12.697 -68.814 1.00 7.84  ? 152 ILE A CB  1 
ATOM   1238 C CG1 . ILE A 1 152 ? 40.818 -13.360 -69.869 1.00 8.81  ? 152 ILE A CG1 1 
ATOM   1239 C CG2 . ILE A 1 152 ? 41.500 -13.254 -67.404 1.00 8.90  ? 152 ILE A CG2 1 
ATOM   1240 C CD1 . ILE A 1 152 ? 39.346 -13.316 -69.576 1.00 10.32 ? 152 ILE A CD1 1 
ATOM   1241 N N   . LEU A 1 153 ? 41.828 -9.755  -66.826 1.00 6.42  ? 153 LEU A N   1 
ATOM   1242 C CA  . LEU A 1 153 ? 42.500 -8.949  -65.797 1.00 6.46  ? 153 LEU A CA  1 
ATOM   1243 C C   . LEU A 1 153 ? 42.028 -9.477  -64.435 1.00 5.84  ? 153 LEU A C   1 
ATOM   1244 O O   . LEU A 1 153 ? 40.835 -9.465  -64.154 1.00 7.10  ? 153 LEU A O   1 
ATOM   1245 C CB  . LEU A 1 153 ? 42.160 -7.479  -66.016 1.00 7.40  ? 153 LEU A CB  1 
ATOM   1246 C CG  . LEU A 1 153 ? 42.982 -6.443  -65.235 1.00 10.01 ? 153 LEU A CG  1 
ATOM   1247 C CD1 . LEU A 1 153 ? 42.803 -5.061  -65.921 1.00 12.64 ? 153 LEU A CD1 1 
ATOM   1248 C CD2 . LEU A 1 153 ? 42.630 -6.340  -63.791 1.00 11.36 ? 153 LEU A CD2 1 
ATOM   1249 N N   . THR A 1 154 ? 42.969 -9.944  -63.616 1.00 5.81  ? 154 THR A N   1 
ATOM   1250 C CA  . THR A 1 154 ? 42.633 -10.514 -62.352 1.00 5.91  ? 154 THR A CA  1 
ATOM   1251 C C   . THR A 1 154 ? 43.435 -9.914  -61.202 1.00 5.78  ? 154 THR A C   1 
ATOM   1252 O O   . THR A 1 154 ? 44.483 -9.282  -61.435 1.00 6.69  ? 154 THR A O   1 
ATOM   1253 C CB  . THR A 1 154 ? 42.796 -12.072 -62.385 1.00 6.60  ? 154 THR A CB  1 
ATOM   1254 O OG1 . THR A 1 154 ? 44.121 -12.418 -62.805 1.00 7.00  ? 154 THR A OG1 1 
ATOM   1255 C CG2 . THR A 1 154 ? 41.791 -12.748 -63.309 1.00 7.17  ? 154 THR A CG2 1 
ATOM   1256 N N   . SER A 1 155 ? 42.995 -10.135 -59.975 1.00 5.69  ? 155 SER A N   1 
ATOM   1257 C CA  . SER A 1 155 ? 43.691 -9.581  -58.807 1.00 5.80  ? 155 SER A CA  1 
ATOM   1258 C C   . SER A 1 155 ? 43.327 -10.406 -57.589 1.00 5.90  ? 155 SER A C   1 
ATOM   1259 O O   . SER A 1 155 ? 42.524 -11.351 -57.668 1.00 7.09  ? 155 SER A O   1 
ATOM   1260 C CB  . SER A 1 155 ? 43.345 -8.118  -58.683 1.00 6.05  ? 155 SER A CB  1 
ATOM   1261 O OG  . SER A 1 155 ? 44.151 -7.452  -57.715 1.00 6.90  ? 155 SER A OG  1 
ATOM   1262 N N   . ARG A 1 156 ? 43.912 -10.077 -56.444 1.00 6.15  ? 156 ARG A N   1 
ATOM   1263 C CA  . ARG A 1 156 ? 43.971 -11.018 -55.316 1.00 6.48  ? 156 ARG A CA  1 
ATOM   1264 C C   . ARG A 1 156 ? 43.073 -10.813 -54.144 1.00 6.27  ? 156 ARG A C   1 
ATOM   1265 O O   . ARG A 1 156 ? 42.648 -11.815 -53.539 1.00 8.80  ? 156 ARG A O   1 
ATOM   1266 C CB  . ARG A 1 156 ? 45.431 -11.144 -54.833 1.00 6.52  ? 156 ARG A CB  1 
ATOM   1267 C CG  . ARG A 1 156 ? 46.431 -11.399 -55.937 1.00 7.23  ? 156 ARG A CG  1 
ATOM   1268 C CD  . ARG A 1 156 ? 47.715 -12.072 -55.415 1.00 8.17  ? 156 ARG A CD  1 
ATOM   1269 N NE  . ARG A 1 156 ? 47.510 -13.503 -55.250 1.00 7.95  ? 156 ARG A NE  1 
ATOM   1270 C CZ  . ARG A 1 156 ? 48.321 -14.378 -54.691 1.00 7.21  ? 156 ARG A CZ  1 
ATOM   1271 N NH1 . ARG A 1 156 ? 49.433 -13.974 -54.128 1.00 10.70 ? 156 ARG A NH1 1 
ATOM   1272 N NH2 . ARG A 1 156 ? 47.986 -15.655 -54.713 1.00 8.60  ? 156 ARG A NH2 1 
ATOM   1273 N N   . GLY A 1 157 ? 42.800 -9.612  -53.661 1.00 6.40  ? 157 GLY A N   1 
ATOM   1274 C CA  . GLY A 1 157 ? 42.097 -9.468  -52.397 1.00 7.25  ? 157 GLY A CA  1 
ATOM   1275 C C   . GLY A 1 157 ? 41.678 -8.040  -52.116 1.00 6.62  ? 157 GLY A C   1 
ATOM   1276 O O   . GLY A 1 157 ? 41.925 -7.144  -52.909 1.00 6.88  ? 157 GLY A O   1 
ATOM   1277 N N   . PRO A 1 158 ? 41.079 -7.806  -50.940 1.00 6.85  ? 158 PRO A N   1 
ATOM   1278 C CA  . PRO A 1 158 ? 40.661 -6.432  -50.621 1.00 7.60  ? 158 PRO A CA  1 
ATOM   1279 C C   . PRO A 1 158 ? 41.814 -5.446  -50.749 1.00 6.79  ? 158 PRO A C   1 
ATOM   1280 O O   . PRO A 1 158 ? 41.613 -4.346  -51.275 1.00 7.84  ? 158 PRO A O   1 
ATOM   1281 C CB  . PRO A 1 158 ? 40.126 -6.560  -49.198 1.00 8.73  ? 158 PRO A CB  1 
ATOM   1282 C CG  . PRO A 1 158 ? 39.609 -7.987  -49.135 1.00 9.06  ? 158 PRO A CG  1 
ATOM   1283 C CD  . PRO A 1 158 ? 40.641 -8.768  -49.912 1.00 7.98  ? 158 PRO A CD  1 
ATOM   1284 N N   . GLY A 1 159 ? 42.985 -5.863  -50.295 1.00 6.60  ? 159 GLY A N   1 
ATOM   1285 C CA  . GLY A 1 159 ? 44.173 -5.041  -50.274 1.00 6.78  ? 159 GLY A CA  1 
ATOM   1286 C C   . GLY A 1 159 ? 44.841 -4.826  -51.610 1.00 6.79  ? 159 GLY A C   1 
ATOM   1287 O O   . GLY A 1 159 ? 45.821 -4.070  -51.693 1.00 9.02  ? 159 GLY A O   1 
ATOM   1288 N N   . THR A 1 160 ? 44.342 -5.457  -52.677 1.00 6.29  ? 160 THR A N   1 
ATOM   1289 C CA  . THR A 1 160 ? 44.791 -5.200  -54.023 1.00 6.16  ? 160 THR A CA  1 
ATOM   1290 C C   . THR A 1 160 ? 43.696 -4.500  -54.834 1.00 6.56  ? 160 THR A C   1 
ATOM   1291 O O   . THR A 1 160 ? 43.870 -4.301  -56.046 1.00 6.79  ? 160 THR A O   1 
ATOM   1292 C CB  . THR A 1 160 ? 45.244 -6.452  -54.790 1.00 6.27  ? 160 THR A CB  1 
ATOM   1293 O OG1 . THR A 1 160 ? 44.138 -7.328  -55.033 1.00 6.67  ? 160 THR A OG1 1 
ATOM   1294 C CG2 . THR A 1 160 ? 46.332 -7.246  -54.053 1.00 8.24  ? 160 THR A CG2 1 
ATOM   1295 N N   . SER A 1 161 ? 42.597 -4.102  -54.203 1.00 6.31  ? 161 SER A N   1 
ATOM   1296 C CA  . SER A 1 161 ? 41.470 -3.548  -54.935 1.00 5.96  ? 161 SER A CA  1 
ATOM   1297 C C   . SER A 1 161 ? 41.776 -2.202  -55.553 1.00 5.86  ? 161 SER A C   1 
ATOM   1298 O O   . SER A 1 161 ? 41.241 -1.920  -56.666 1.00 6.55  ? 161 SER A O   1 
ATOM   1299 C CB  . SER A 1 161 ? 40.238 -3.397  -54.029 1.00 7.58  ? 161 SER A CB  1 
ATOM   1300 O OG  . SER A 1 161 ? 39.778 -4.655  -53.591 1.00 9.55  ? 161 SER A OG  1 
ATOM   1301 N N   . PHE A 1 162 ? 42.560 -1.338  -54.889 1.00 6.13  ? 162 PHE A N   1 
ATOM   1302 C CA  . PHE A 1 162 ? 42.928 -0.080  -55.573 1.00 6.80  ? 162 PHE A CA  1 
ATOM   1303 C C   . PHE A 1 162 ? 43.786 -0.317  -56.802 1.00 6.97  ? 162 PHE A C   1 
ATOM   1304 O O   . PHE A 1 162 ? 43.567 0.278   -57.870 1.00 7.49  ? 162 PHE A O   1 
ATOM   1305 C CB  . PHE A 1 162 ? 43.638 0.897   -54.642 1.00 6.81  ? 162 PHE A CB  1 
ATOM   1306 C CG  . PHE A 1 162 ? 42.740 1.552   -53.620 1.00 6.62  ? 162 PHE A CG  1 
ATOM   1307 C CD1 . PHE A 1 162 ? 42.614 1.085   -52.319 1.00 8.62  ? 162 PHE A CD1 1 
ATOM   1308 C CD2 . PHE A 1 162 ? 41.999 2.646   -54.006 1.00 7.37  ? 162 PHE A CD2 1 
ATOM   1309 C CE1 . PHE A 1 162 ? 41.758 1.751   -51.445 1.00 10.61 ? 162 PHE A CE1 1 
ATOM   1310 C CE2 . PHE A 1 162 ? 41.161 3.308   -53.157 1.00 8.63  ? 162 PHE A CE2 1 
ATOM   1311 C CZ  . PHE A 1 162 ? 41.027 2.840   -51.873 1.00 9.87  ? 162 PHE A CZ  1 
ATOM   1312 N N   . GLU A 1 163 ? 44.777 -1.210  -56.691 1.00 7.20  ? 163 GLU A N   1 
ATOM   1313 C CA  . GLU A 1 163 ? 45.611 -1.549  -57.819 1.00 7.51  ? 163 GLU A CA  1 
ATOM   1314 C C   . GLU A 1 163 ? 44.794 -2.137  -58.983 1.00 6.83  ? 163 GLU A C   1 
ATOM   1315 O O   . GLU A 1 163 ? 45.010 -1.815  -60.146 1.00 7.18  ? 163 GLU A O   1 
ATOM   1316 C CB  . GLU A 1 163 ? 46.720 -2.520  -57.353 1.00 8.36  ? 163 GLU A CB  1 
ATOM   1317 C CG  . GLU A 1 163 ? 47.744 -1.928  -56.378 1.00 11.19 ? 163 GLU A CG  1 
ATOM   1318 C CD  . GLU A 1 163 ? 48.309 -2.991  -55.448 1.00 15.18 ? 163 GLU A CD  1 
ATOM   1319 O OE1 . GLU A 1 163 ? 49.252 -3.667  -55.859 1.00 18.06 ? 163 GLU A OE1 1 
ATOM   1320 O OE2 . GLU A 1 163 ? 47.816 -3.209  -54.360 1.00 19.93 ? 163 GLU A OE2 1 
ATOM   1321 N N   . PHE A 1 164 ? 43.845 -3.023  -58.642 1.00 5.88  ? 164 PHE A N   1 
ATOM   1322 C CA  . PHE A 1 164 ? 42.940 -3.632  -59.617 1.00 6.00  ? 164 PHE A CA  1 
ATOM   1323 C C   . PHE A 1 164 ? 42.120 -2.563  -60.329 1.00 5.85  ? 164 PHE A C   1 
ATOM   1324 O O   . PHE A 1 164 ? 42.033 -2.531  -61.544 1.00 6.41  ? 164 PHE A O   1 
ATOM   1325 C CB  . PHE A 1 164 ? 42.071 -4.618  -58.860 1.00 6.24  ? 164 PHE A CB  1 
ATOM   1326 C CG  . PHE A 1 164 ? 40.919 -5.258  -59.616 1.00 6.09  ? 164 PHE A CG  1 
ATOM   1327 C CD1 . PHE A 1 164 ? 41.136 -6.182  -60.623 1.00 6.13  ? 164 PHE A CD1 1 
ATOM   1328 C CD2 . PHE A 1 164 ? 39.604 -4.971  -59.251 1.00 6.69  ? 164 PHE A CD2 1 
ATOM   1329 C CE1 . PHE A 1 164 ? 40.064 -6.836  -61.195 1.00 6.75  ? 164 PHE A CE1 1 
ATOM   1330 C CE2 . PHE A 1 164 ? 38.523 -5.603  -59.818 1.00 7.31  ? 164 PHE A CE2 1 
ATOM   1331 C CZ  . PHE A 1 164 ? 38.783 -6.546  -60.807 1.00 7.17  ? 164 PHE A CZ  1 
ATOM   1332 N N   . ALA A 1 165 ? 41.502 -1.670  -59.539 1.00 5.86  ? 165 ALA A N   1 
ATOM   1333 C CA  . ALA A 1 165 ? 40.661 -0.635  -60.121 1.00 6.05  ? 165 ALA A CA  1 
ATOM   1334 C C   . ALA A 1 165 ? 41.477 0.289   -61.012 1.00 6.02  ? 165 ALA A C   1 
ATOM   1335 O O   . ALA A 1 165 ? 41.004 0.666   -62.091 1.00 6.59  ? 165 ALA A O   1 
ATOM   1336 C CB  . ALA A 1 165 ? 40.008 0.172   -58.993 1.00 7.53  ? 165 ALA A CB  1 
ATOM   1337 N N   . LEU A 1 166 ? 42.672 0.674   -60.568 1.00 6.30  ? 166 LEU A N   1 
ATOM   1338 C CA  . LEU A 1 166 ? 43.514 1.573   -61.385 1.00 6.85  ? 166 LEU A CA  1 
ATOM   1339 C C   . LEU A 1 166 ? 43.994 0.857   -62.651 1.00 6.67  ? 166 LEU A C   1 
ATOM   1340 O O   . LEU A 1 166 ? 44.196 1.535   -63.661 1.00 7.86  ? 166 LEU A O   1 
ATOM   1341 C CB  . LEU A 1 166 ? 44.656 2.136   -60.546 1.00 7.73  ? 166 LEU A CB  1 
ATOM   1342 C CG  . LEU A 1 166 ? 44.205 3.167   -59.490 1.00 8.00  ? 166 LEU A CG  1 
ATOM   1343 C CD1 . LEU A 1 166 ? 45.318 3.399   -58.510 1.00 10.21 ? 166 LEU A CD1 1 
ATOM   1344 C CD2 . LEU A 1 166 ? 43.724 4.460   -60.135 1.00 10.00 ? 166 LEU A CD2 1 
ATOM   1345 N N   . ALA A 1 167 ? 44.187 -0.448  -62.605 1.00 7.46  ? 167 ALA A N   1 
ATOM   1346 C CA  . ALA A 1 167 ? 44.554 -1.192  -63.808 1.00 7.35  ? 167 ALA A CA  1 
ATOM   1347 C C   . ALA A 1 167 ? 43.394 -1.187  -64.797 1.00 7.31  ? 167 ALA A C   1 
ATOM   1348 O O   . ALA A 1 167 ? 43.600 -1.062  -66.039 1.00 8.57  ? 167 ALA A O   1 
ATOM   1349 C CB  . ALA A 1 167 ? 44.956 -2.605  -63.431 1.00 8.22  ? 167 ALA A CB  1 
ATOM   1350 N N   . ILE A 1 168 ? 42.172 -1.298  -64.348 1.00 6.81  ? 168 ILE A N   1 
ATOM   1351 C CA  . ILE A 1 168 ? 41.004 -1.163  -65.207 1.00 7.16  ? 168 ILE A CA  1 
ATOM   1352 C C   . ILE A 1 168 ? 40.966 0.241   -65.845 1.00 7.55  ? 168 ILE A C   1 
ATOM   1353 O O   . ILE A 1 168 ? 40.759 0.414   -67.051 1.00 8.07  ? 168 ILE A O   1 
ATOM   1354 C CB  . ILE A 1 168 ? 39.710 -1.498  -64.472 1.00 7.30  ? 168 ILE A CB  1 
ATOM   1355 C CG1 . ILE A 1 168 ? 39.622 -2.915  -63.974 1.00 8.03  ? 168 ILE A CG1 1 
ATOM   1356 C CG2 . ILE A 1 168 ? 38.475 -1.185  -65.360 1.00 8.68  ? 168 ILE A CG2 1 
ATOM   1357 C CD1 . ILE A 1 168 ? 38.547 -3.155  -62.936 1.00 10.29 ? 168 ILE A CD1 1 
ATOM   1358 N N   . VAL A 1 169 ? 41.136 1.256   -65.015 1.00 7.57  ? 169 VAL A N   1 
ATOM   1359 C CA  . VAL A 1 169 ? 41.155 2.651   -65.519 1.00 7.24  ? 169 VAL A CA  1 
ATOM   1360 C C   . VAL A 1 169 ? 42.231 2.818   -66.578 1.00 7.64  ? 169 VAL A C   1 
ATOM   1361 O O   . VAL A 1 169 ? 42.005 3.404   -67.625 1.00 8.99  ? 169 VAL A O   1 
ATOM   1362 C CB  . VAL A 1 169 ? 41.341 3.646   -64.353 1.00 6.86  ? 169 VAL A CB  1 
ATOM   1363 C CG1 . VAL A 1 169 ? 41.601 5.047   -64.877 1.00 7.90  ? 169 VAL A CG1 1 
ATOM   1364 C CG2 . VAL A 1 169 ? 40.157 3.658   -63.416 1.00 7.92  ? 169 VAL A CG2 1 
ATOM   1365 N N   A GLU A 1 170 ? 43.443 2.292   -66.317 0.61 8.18  ? 170 GLU A N   1 
ATOM   1366 N N   B GLU A 1 170 ? 43.425 2.281   -66.295 0.39 7.97  ? 170 GLU A N   1 
ATOM   1367 C CA  A GLU A 1 170 ? 44.483 2.445   -67.333 0.61 8.86  ? 170 GLU A CA  1 
ATOM   1368 C CA  B GLU A 1 170 ? 44.506 2.379   -67.271 0.39 8.65  ? 170 GLU A CA  1 
ATOM   1369 C C   A GLU A 1 170 ? 44.130 1.731   -68.628 0.61 8.99  ? 170 GLU A C   1 
ATOM   1370 C C   B GLU A 1 170 ? 44.124 1.736   -68.597 0.39 9.37  ? 170 GLU A C   1 
ATOM   1371 O O   A GLU A 1 170 ? 44.397 2.224   -69.734 0.61 12.29 ? 170 GLU A O   1 
ATOM   1372 O O   B GLU A 1 170 ? 44.346 2.282   -69.688 0.39 7.66  ? 170 GLU A O   1 
ATOM   1373 C CB  A GLU A 1 170 ? 45.805 1.935   -66.735 0.61 9.62  ? 170 GLU A CB  1 
ATOM   1374 C CB  B GLU A 1 170 ? 45.760 1.748   -66.640 0.39 10.18 ? 170 GLU A CB  1 
ATOM   1375 C CG  A GLU A 1 170 ? 46.886 1.795   -67.805 0.61 11.31 ? 170 GLU A CG  1 
ATOM   1376 C CG  B GLU A 1 170 ? 47.018 2.083   -67.419 0.39 14.37 ? 170 GLU A CG  1 
ATOM   1377 C CD  A GLU A 1 170 ? 48.216 1.368   -67.212 0.61 17.20 ? 170 GLU A CD  1 
ATOM   1378 C CD  B GLU A 1 170 ? 48.301 2.079   -66.618 0.39 18.54 ? 170 GLU A CD  1 
ATOM   1379 O OE1 A GLU A 1 170 ? 48.348 1.348   -65.958 0.61 23.58 ? 170 GLU A OE1 1 
ATOM   1380 O OE1 B GLU A 1 170 ? 48.475 2.548   -65.481 0.39 23.70 ? 170 GLU A OE1 1 
ATOM   1381 O OE2 A GLU A 1 170 ? 49.106 1.075   -68.035 0.61 24.85 ? 170 GLU A OE2 1 
ATOM   1382 O OE2 B GLU A 1 170 ? 49.261 1.578   -67.263 0.39 23.21 ? 170 GLU A OE2 1 
ATOM   1383 N N   . ALA A 1 171 ? 43.543 0.542   -68.533 1.00 9.35  ? 171 ALA A N   1 
ATOM   1384 C CA  . ALA A 1 171 ? 43.165 -0.203  -69.740 1.00 10.13 ? 171 ALA A CA  1 
ATOM   1385 C C   . ALA A 1 171 ? 42.111 0.504   -70.563 1.00 11.05 ? 171 ALA A C   1 
ATOM   1386 O O   . ALA A 1 171 ? 42.154 0.445   -71.789 1.00 13.55 ? 171 ALA A O   1 
ATOM   1387 C CB  . ALA A 1 171 ? 42.608 -1.588  -69.390 1.00 11.43 ? 171 ALA A CB  1 
ATOM   1388 N N   . LEU A 1 172 ? 41.162 1.172   -69.888 1.00 9.85  ? 172 LEU A N   1 
ATOM   1389 C CA  . LEU A 1 172 ? 40.096 1.847   -70.624 1.00 9.92  ? 172 LEU A CA  1 
ATOM   1390 C C   . LEU A 1 172 ? 40.428 3.270   -71.012 1.00 10.39 ? 172 LEU A C   1 
ATOM   1391 O O   . LEU A 1 172 ? 40.107 3.691   -72.138 1.00 12.16 ? 172 LEU A O   1 
ATOM   1392 C CB  . LEU A 1 172 ? 38.823 1.894   -69.729 1.00 10.24 ? 172 LEU A CB  1 
ATOM   1393 C CG  . LEU A 1 172 ? 37.854 0.740   -69.877 1.00 12.93 ? 172 LEU A CG  1 
ATOM   1394 C CD1 . LEU A 1 172 ? 38.559 -0.566  -69.943 1.00 17.06 ? 172 LEU A CD1 1 
ATOM   1395 C CD2 . LEU A 1 172 ? 36.777 0.695   -68.849 1.00 12.79 ? 172 LEU A CD2 1 
ATOM   1396 N N   . ASN A 1 173 ? 41.038 4.045   -70.083 1.00 10.57 ? 173 ASN A N   1 
ATOM   1397 C CA  . ASN A 1 173 ? 41.214 5.482   -70.250 1.00 10.53 ? 173 ASN A CA  1 
ATOM   1398 C C   . ASN A 1 173 ? 42.666 5.922   -70.359 1.00 11.83 ? 173 ASN A C   1 
ATOM   1399 O O   . ASN A 1 173 ? 42.889 7.122   -70.610 1.00 12.38 ? 173 ASN A O   1 
ATOM   1400 C CB  . ASN A 1 173 ? 40.520 6.264   -69.162 1.00 11.82 ? 173 ASN A CB  1 
ATOM   1401 C CG  . ASN A 1 173 ? 39.018 6.243   -69.282 1.00 14.33 ? 173 ASN A CG  1 
ATOM   1402 O OD1 . ASN A 1 173 ? 38.455 5.761   -70.280 1.00 17.02 ? 173 ASN A OD1 1 
ATOM   1403 N ND2 . ASN A 1 173 ? 38.266 6.758   -68.309 1.00 18.92 ? 173 ASN A ND2 1 
ATOM   1404 N N   . GLY A 1 174 ? 43.602 5.001   -70.186 1.00 10.53 ? 174 GLY A N   1 
ATOM   1405 C CA  . GLY A 1 174 ? 45.013 5.254   -70.365 1.00 11.84 ? 174 GLY A CA  1 
ATOM   1406 C C   . GLY A 1 174 ? 45.764 5.611   -69.075 1.00 10.24 ? 174 GLY A C   1 
ATOM   1407 O O   . GLY A 1 174 ? 45.178 5.894   -68.038 1.00 10.18 ? 174 GLY A O   1 
ATOM   1408 N N   . LYS A 1 175 ? 47.114 5.600   -69.184 1.00 11.54 ? 175 LYS A N   1 
ATOM   1409 C CA  . LYS A 1 175 ? 47.990 5.802   -68.014 1.00 12.47 ? 175 LYS A CA  1 
ATOM   1410 C C   . LYS A 1 175 ? 47.860 7.161   -67.370 1.00 11.68 ? 175 LYS A C   1 
ATOM   1411 O O   . LYS A 1 175 ? 47.955 7.278   -66.160 1.00 11.75 ? 175 LYS A O   1 
ATOM   1412 C CB  . LYS A 1 175 ? 49.467 5.605   -68.432 1.00 18.30 ? 175 LYS A CB  1 
ATOM   1413 C CG  . LYS A 1 175 ? 49.791 4.153   -68.678 1.00 36.22 ? 175 LYS A CG  1 
ATOM   1414 C CD  . LYS A 1 175 ? 51.289 3.915   -68.735 1.00 48.76 ? 175 LYS A CD  1 
ATOM   1415 C CE  . LYS A 1 175 ? 51.686 2.495   -68.325 1.00 58.41 ? 175 LYS A CE  1 
ATOM   1416 N NZ  . LYS A 1 175 ? 52.641 2.529   -67.163 1.00 82.95 ? 175 LYS A NZ  1 
ATOM   1417 N N   . GLU A 1 176 ? 47.666 8.225   -68.197 1.00 11.46 ? 176 GLU A N   1 
ATOM   1418 C CA  . GLU A 1 176 ? 47.618 9.575   -67.635 1.00 12.19 ? 176 GLU A CA  1 
ATOM   1419 C C   . GLU A 1 176 ? 46.390 9.777   -66.770 1.00 10.22 ? 176 GLU A C   1 
ATOM   1420 O O   . GLU A 1 176 ? 46.482 10.310  -65.679 1.00 10.65 ? 176 GLU A O   1 
ATOM   1421 C CB  . GLU A 1 176 ? 47.628 10.656  -68.744 1.00 15.67 ? 176 GLU A CB  1 
ATOM   1422 C CG  . GLU A 1 176 ? 47.359 12.086  -68.353 1.00 37.32 ? 176 GLU A CG  1 
ATOM   1423 C CD  . GLU A 1 176 ? 47.852 13.102  -69.366 1.00 54.89 ? 176 GLU A CD  1 
ATOM   1424 O OE1 . GLU A 1 176 ? 47.823 12.805  -70.579 1.00 92.46 ? 176 GLU A OE1 1 
ATOM   1425 O OE2 . GLU A 1 176 ? 48.314 14.204  -69.013 1.00 71.58 ? 176 GLU A OE2 1 
ATOM   1426 N N   . VAL A 1 177 ? 45.227 9.318   -67.263 1.00 9.78  ? 177 VAL A N   1 
ATOM   1427 C CA  . VAL A 1 177 ? 44.034 9.374   -66.429 1.00 9.43  ? 177 VAL A CA  1 
ATOM   1428 C C   . VAL A 1 177 ? 44.205 8.561   -65.178 1.00 8.54  ? 177 VAL A C   1 
ATOM   1429 O O   . VAL A 1 177 ? 43.843 9.012   -64.076 1.00 8.57  ? 177 VAL A O   1 
ATOM   1430 C CB  . VAL A 1 177 ? 42.798 8.961   -67.231 1.00 8.75  ? 177 VAL A CB  1 
ATOM   1431 C CG1 . VAL A 1 177 ? 41.579 8.754   -66.316 1.00 9.92  ? 177 VAL A CG1 1 
ATOM   1432 C CG2 . VAL A 1 177 ? 42.488 10.013  -68.294 1.00 11.81 ? 177 VAL A CG2 1 
ATOM   1433 N N   . ALA A 1 178 ? 44.761 7.356   -65.268 1.00 8.66  ? 178 ALA A N   1 
ATOM   1434 C CA  . ALA A 1 178 ? 44.970 6.548   -64.061 1.00 8.39  ? 178 ALA A CA  1 
ATOM   1435 C C   . ALA A 1 178 ? 45.844 7.332   -63.050 1.00 7.86  ? 178 ALA A C   1 
ATOM   1436 O O   . ALA A 1 178 ? 45.534 7.299   -61.852 1.00 8.03  ? 178 ALA A O   1 
ATOM   1437 C CB  . ALA A 1 178 ? 45.570 5.185   -64.378 1.00 9.68  ? 178 ALA A CB  1 
ATOM   1438 N N   . ALA A 1 179 ? 46.915 7.960   -63.500 1.00 8.39  ? 179 ALA A N   1 
ATOM   1439 C CA  . ALA A 1 179 ? 47.792 8.705   -62.594 1.00 8.30  ? 179 ALA A CA  1 
ATOM   1440 C C   . ALA A 1 179 ? 47.075 9.888   -61.970 1.00 7.42  ? 179 ALA A C   1 
ATOM   1441 O O   . ALA A 1 179 ? 47.240 10.190  -60.779 1.00 8.24  ? 179 ALA A O   1 
ATOM   1442 C CB  . ALA A 1 179 ? 49.069 9.186   -63.300 1.00 10.31 ? 179 ALA A CB  1 
ATOM   1443 N N   . GLN A 1 180 ? 46.244 10.583  -62.762 1.00 7.56  ? 180 GLN A N   1 
ATOM   1444 C CA  . GLN A 1 180 ? 45.491 11.723  -62.236 1.00 7.42  ? 180 GLN A CA  1 
ATOM   1445 C C   . GLN A 1 180 ? 44.499 11.279  -61.191 1.00 6.78  ? 180 GLN A C   1 
ATOM   1446 O O   . GLN A 1 180 ? 44.302 11.991  -60.176 1.00 7.97  ? 180 GLN A O   1 
ATOM   1447 C CB  . GLN A 1 180 ? 44.742 12.441  -63.374 1.00 8.50  ? 180 GLN A CB  1 
ATOM   1448 C CG  . GLN A 1 180 ? 45.579 13.107  -64.442 1.00 14.48 ? 180 GLN A CG  1 
ATOM   1449 C CD  . GLN A 1 180 ? 44.776 13.404  -65.734 1.00 17.29 ? 180 GLN A CD  1 
ATOM   1450 O OE1 . GLN A 1 180 ? 43.572 13.057  -65.954 1.00 18.51 ? 180 GLN A OE1 1 
ATOM   1451 N NE2 . GLN A 1 180 ? 45.501 14.073  -66.621 1.00 23.60 ? 180 GLN A NE2 1 
ATOM   1452 N N   . VAL A 1 181 ? 43.801 10.173  -61.407 1.00 6.76  ? 181 VAL A N   1 
ATOM   1453 C CA  . VAL A 1 181 ? 42.838 9.633   -60.430 1.00 6.83  ? 181 VAL A CA  1 
ATOM   1454 C C   . VAL A 1 181 ? 43.529 9.166   -59.180 1.00 6.20  ? 181 VAL A C   1 
ATOM   1455 O O   . VAL A 1 181 ? 43.050 9.303   -58.045 1.00 6.94  ? 181 VAL A O   1 
ATOM   1456 C CB  . VAL A 1 181 ? 41.999 8.521   -61.088 1.00 7.12  ? 181 VAL A CB  1 
ATOM   1457 C CG1 . VAL A 1 181 ? 41.146 7.766   -60.040 1.00 8.18  ? 181 VAL A CG1 1 
ATOM   1458 C CG2 . VAL A 1 181 ? 41.098 9.112   -62.165 1.00 8.63  ? 181 VAL A CG2 1 
ATOM   1459 N N   . LYS A 1 182 ? 44.732 8.585   -59.333 1.00 6.60  ? 182 LYS A N   1 
ATOM   1460 C CA  . LYS A 1 182 ? 45.450 7.998   -58.222 1.00 6.72  ? 182 LYS A CA  1 
ATOM   1461 C C   . LYS A 1 182 ? 45.887 9.037   -57.209 1.00 6.87  ? 182 LYS A C   1 
ATOM   1462 O O   . LYS A 1 182 ? 45.808 8.786   -55.984 1.00 7.54  ? 182 LYS A O   1 
ATOM   1463 C CB  . LYS A 1 182 ? 46.694 7.242   -58.719 1.00 7.65  ? 182 LYS A CB  1 
ATOM   1464 C CG  . LYS A 1 182 ? 47.472 6.545   -57.626 1.00 7.98  ? 182 LYS A CG  1 
ATOM   1465 C CD  . LYS A 1 182 ? 48.656 5.757   -58.155 1.00 10.65 ? 182 LYS A CD  1 
ATOM   1466 C CE  . LYS A 1 182 ? 49.346 4.985   -57.043 1.00 15.08 ? 182 LYS A CE  1 
ATOM   1467 N NZ  . LYS A 1 182 ? 50.543 4.242   -57.602 1.00 19.98 ? 182 LYS A NZ  1 
ATOM   1468 N N   . ALA A 1 183 ? 46.396 10.194  -57.659 1.00 7.37  ? 183 ALA A N   1 
ATOM   1469 C CA  . ALA A 1 183 ? 47.039 11.105  -56.673 1.00 8.47  ? 183 ALA A CA  1 
ATOM   1470 C C   . ALA A 1 183 ? 46.109 11.527  -55.544 1.00 8.12  ? 183 ALA A C   1 
ATOM   1471 O O   . ALA A 1 183 ? 46.568 11.522  -54.375 1.00 8.88  ? 183 ALA A O   1 
ATOM   1472 C CB  . ALA A 1 183 ? 47.714 12.298  -57.412 1.00 11.17 ? 183 ALA A CB  1 
ATOM   1473 N N   . PRO A 1 184 ? 44.877 11.943  -55.806 1.00 6.85  ? 184 PRO A N   1 
ATOM   1474 C CA  . PRO A 1 184 ? 44.011 12.382  -54.710 1.00 7.71  ? 184 PRO A CA  1 
ATOM   1475 C C   . PRO A 1 184 ? 43.544 11.280  -53.760 1.00 7.77  ? 184 PRO A C   1 
ATOM   1476 O O   . PRO A 1 184 ? 42.878 11.573  -52.766 1.00 9.35  ? 184 PRO A O   1 
ATOM   1477 C CB  . PRO A 1 184 ? 42.800 13.015  -55.435 1.00 8.10  ? 184 PRO A CB  1 
ATOM   1478 C CG  . PRO A 1 184 ? 43.353 13.400  -56.776 1.00 8.89  ? 184 PRO A CG  1 
ATOM   1479 C CD  . PRO A 1 184 ? 44.283 12.265  -57.099 1.00 7.26  ? 184 PRO A CD  1 
ATOM   1480 N N   . LEU A 1 185 ? 43.878 10.017  -54.061 1.00 7.71  ? 185 LEU A N   1 
ATOM   1481 C CA  . LEU A 1 185 ? 43.488 8.925   -53.185 1.00 7.10  ? 185 LEU A CA  1 
ATOM   1482 C C   . LEU A 1 185 ? 44.403 8.762   -51.984 1.00 7.21  ? 185 LEU A C   1 
ATOM   1483 O O   . LEU A 1 185 ? 43.984 8.120   -51.018 1.00 8.21  ? 185 LEU A O   1 
ATOM   1484 C CB  . LEU A 1 185 ? 43.452 7.585   -53.966 1.00 7.27  ? 185 LEU A CB  1 
ATOM   1485 C CG  . LEU A 1 185 ? 42.501 7.522   -55.155 1.00 7.47  ? 185 LEU A CG  1 
ATOM   1486 C CD1 . LEU A 1 185 ? 42.656 6.213   -55.899 1.00 8.88  ? 185 LEU A CD1 1 
ATOM   1487 C CD2 . LEU A 1 185 ? 41.049 7.701   -54.693 1.00 10.00 ? 185 LEU A CD2 1 
ATOM   1488 N N   . VAL A 1 186 ? 45.602 9.318   -52.011 1.00 7.62  ? 186 VAL A N   1 
ATOM   1489 C CA  . VAL A 1 186 ? 46.554 9.168   -50.892 1.00 8.22  ? 186 VAL A CA  1 
ATOM   1490 C C   . VAL A 1 186 ? 46.929 7.707   -50.690 1.00 8.20  ? 186 VAL A C   1 
ATOM   1491 O O   . VAL A 1 186 ? 46.997 7.161   -49.579 1.00 10.30 ? 186 VAL A O   1 
ATOM   1492 C CB  . VAL A 1 186 ? 46.112 9.836   -49.562 1.00 8.30  ? 186 VAL A CB  1 
ATOM   1493 C CG1 . VAL A 1 186 ? 47.348 10.125  -48.714 1.00 9.48  ? 186 VAL A CG1 1 
ATOM   1494 C CG2 . VAL A 1 186 ? 45.315 11.118  -49.823 1.00 9.69  ? 186 VAL A CG2 1 
ATOM   1495 N N   . LEU A 1 187 ? 47.252 7.045   -51.794 1.00 8.78  ? 187 LEU A N   1 
ATOM   1496 C CA  . LEU A 1 187 ? 47.862 5.704   -51.783 1.00 9.78  ? 187 LEU A CA  1 
ATOM   1497 C C   . LEU A 1 187 ? 49.345 5.775   -51.434 1.00 13.16 ? 187 LEU A C   1 
ATOM   1498 O O   . LEU A 1 187 ? 49.921 6.851   -51.559 1.00 25.41 ? 187 LEU A O   1 
ATOM   1499 C CB  . LEU A 1 187 ? 47.610 4.993   -53.121 1.00 10.20 ? 187 LEU A CB  1 
ATOM   1500 C CG  . LEU A 1 187 ? 46.131 4.528   -53.277 1.00 9.82  ? 187 LEU A CG  1 
ATOM   1501 C CD1 . LEU A 1 187 ? 45.819 4.287   -54.738 1.00 12.34 ? 187 LEU A CD1 1 
ATOM   1502 C CD2 . LEU A 1 187 ? 45.860 3.288   -52.468 1.00 11.02 ? 187 LEU A CD2 1 
ATOM   1503 N N   . LYS A 1 188 ? 49.976 4.690   -50.957 1.00 18.24 ? 188 LYS A N   1 
ATOM   1504 C CA  . LYS A 1 188 ? 51.425 4.729   -50.684 1.00 27.08 ? 188 LYS A CA  1 
ATOM   1505 C C   . LYS A 1 188 ? 52.126 4.356   -52.013 1.00 38.81 ? 188 LYS A C   1 
ATOM   1506 C CB  . LYS A 1 188 ? 51.863 3.793   -49.558 1.00 37.38 ? 188 LYS A CB  1 
ATOM   1507 C CG  . LYS A 1 188 ? 53.013 4.203   -48.644 1.00 51.71 ? 188 LYS A CG  1 
ATOM   1508 C CD  . LYS A 1 188 ? 53.001 3.541   -47.266 1.00 57.85 ? 188 LYS A CD  1 
ATOM   1509 C CE  . LYS A 1 188 ? 54.282 3.864   -46.500 1.00 72.93 ? 188 LYS A CE  1 
ATOM   1510 N NZ  . LYS A 1 188 ? 54.157 3.876   -45.018 1.00 81.23 ? 188 LYS A NZ  1 
HETATM 1511 O O   . HOH B 2 .   ? 41.797 -24.738 -64.109 1.00 7.29  ? 190 HOH A O   1 
HETATM 1512 O O   . HOH B 2 .   ? 38.253 11.634  -51.350 1.00 9.64  ? 191 HOH A O   1 
HETATM 1513 O O   . HOH B 2 .   ? 44.045 -24.099 -71.145 1.00 9.33  ? 192 HOH A O   1 
HETATM 1514 O O   . HOH B 2 .   ? 43.818 -29.982 -61.159 1.00 8.14  ? 193 HOH A O   1 
HETATM 1515 O O   . HOH B 2 .   ? 45.650 -29.837 -67.680 1.00 7.80  ? 194 HOH A O   1 
HETATM 1516 O O   . HOH B 2 .   ? 37.939 -20.678 -72.412 1.00 11.47 ? 195 HOH A O   1 
HETATM 1517 O O   . HOH B 2 .   ? 29.110 -10.011 -56.921 1.00 9.10  ? 196 HOH A O   1 
HETATM 1518 O O   . HOH B 2 .   ? 44.630 -12.398 -65.499 1.00 8.31  ? 197 HOH A O   1 
HETATM 1519 O O   . HOH B 2 .   ? 31.337 -14.455 -49.293 1.00 8.04  ? 198 HOH A O   1 
HETATM 1520 O O   . HOH B 2 .   ? 31.202 -11.669 -56.021 1.00 7.46  ? 199 HOH A O   1 
HETATM 1521 O O   . HOH B 2 .   ? 28.637 6.021   -63.364 1.00 8.72  ? 200 HOH A O   1 
HETATM 1522 O O   . HOH B 2 .   ? 42.328 -26.316 -71.280 1.00 10.32 ? 201 HOH A O   1 
HETATM 1523 O O   . HOH B 2 .   ? 45.844 -28.045 -60.700 1.00 8.43  ? 202 HOH A O   1 
HETATM 1524 O O   . HOH B 2 .   ? 35.510 -15.395 -48.840 1.00 11.00 ? 203 HOH A O   1 
HETATM 1525 O O   . HOH B 2 .   ? 45.081 8.772   -70.201 1.00 13.26 ? 204 HOH A O   1 
HETATM 1526 O O   . HOH B 2 .   ? 24.996 1.375   -55.298 1.00 8.30  ? 205 HOH A O   1 
HETATM 1527 O O   . HOH B 2 .   ? 45.393 14.516  -59.903 1.00 11.73 ? 206 HOH A O   1 
HETATM 1528 O O   . HOH B 2 .   ? 43.653 -27.571 -58.220 1.00 16.42 ? 207 HOH A O   1 
HETATM 1529 O O   . HOH B 2 .   ? 45.498 -1.899  -53.912 1.00 10.36 ? 208 HOH A O   1 
HETATM 1530 O O   . HOH B 2 .   ? 25.593 -3.069  -42.602 1.00 8.19  ? 209 HOH A O   1 
HETATM 1531 O O   . HOH B 2 .   ? 24.920 -12.115 -47.486 1.00 13.27 ? 210 HOH A O   1 
HETATM 1532 O O   . HOH B 2 .   ? 37.796 -11.088 -72.016 1.00 12.41 ? 211 HOH A O   1 
HETATM 1533 O O   . HOH B 2 .   ? 40.668 -22.971 -53.480 1.00 11.68 ? 212 HOH A O   1 
HETATM 1534 O O   . HOH B 2 .   ? 46.830 -25.207 -56.839 1.00 14.81 ? 213 HOH A O   1 
HETATM 1535 O O   . HOH B 2 .   ? 47.874 8.487   -54.135 1.00 11.44 ? 214 HOH A O   1 
HETATM 1536 O O   . HOH B 2 .   ? 52.812 -7.793  -58.027 1.00 19.57 ? 215 HOH A O   1 
HETATM 1537 O O   . HOH B 2 .   ? 38.430 11.212  -67.350 1.00 14.79 ? 216 HOH A O   1 
HETATM 1538 O O   . HOH B 2 .   ? 31.703 10.018  -62.643 1.00 10.83 ? 217 HOH A O   1 
HETATM 1539 O O   . HOH B 2 .   ? 21.208 -10.127 -50.652 1.00 13.15 ? 218 HOH A O   1 
HETATM 1540 O O   . HOH B 2 .   ? 39.972 12.603  -53.232 1.00 10.86 ? 219 HOH A O   1 
HETATM 1541 O O   . HOH B 2 .   ? 48.633 -24.113 -66.492 1.00 11.27 ? 220 HOH A O   1 
HETATM 1542 O O   . HOH B 2 .   ? 43.384 -13.649 -72.048 1.00 12.97 ? 221 HOH A O   1 
HETATM 1543 O O   . HOH B 2 .   ? 37.901 -27.724 -63.804 1.00 16.98 ? 222 HOH A O   1 
HETATM 1544 O O   . HOH B 2 .   ? 37.476 -15.424 -50.829 1.00 15.10 ? 223 HOH A O   1 
HETATM 1545 O O   . HOH B 2 .   ? 50.909 -6.288  -59.637 1.00 15.80 ? 224 HOH A O   1 
HETATM 1546 O O   . HOH B 2 .   ? 27.252 1.882   -67.536 1.00 13.02 ? 225 HOH A O   1 
HETATM 1547 O O   . HOH B 2 .   ? 49.709 9.681   -59.651 1.00 14.36 ? 226 HOH A O   1 
HETATM 1548 O O   . HOH B 2 .   ? 33.008 -19.669 -57.130 1.00 18.42 ? 227 HOH A O   1 
HETATM 1549 O O   . HOH B 2 .   ? 38.191 -18.910 -74.473 1.00 13.81 ? 228 HOH A O   1 
HETATM 1550 O O   . HOH B 2 .   ? 23.188 -17.726 -59.067 1.00 17.39 ? 229 HOH A O   1 
HETATM 1551 O O   . HOH B 2 .   ? 38.239 -12.172 -76.230 1.00 17.42 ? 230 HOH A O   1 
HETATM 1552 O O   . HOH B 2 .   ? 34.076 -22.363 -60.023 1.00 19.24 ? 231 HOH A O   1 
HETATM 1553 O O   . HOH B 2 .   ? 20.407 -16.811 -64.618 1.00 19.14 ? 232 HOH A O   1 
HETATM 1554 O O   . HOH B 2 .   ? 23.587 -19.073 -70.169 1.00 24.29 ? 233 HOH A O   1 
HETATM 1555 O O   . HOH B 2 .   ? 21.945 -9.584  -56.513 1.00 15.34 ? 234 HOH A O   1 
HETATM 1556 O O   . HOH B 2 .   ? 40.835 -18.083 -74.071 1.00 15.41 ? 235 HOH A O   1 
HETATM 1557 O O   . HOH B 2 .   ? 45.897 -2.151  -67.260 1.00 17.80 ? 236 HOH A O   1 
HETATM 1558 O O   . HOH B 2 .   ? 34.371 -25.359 -65.522 1.00 17.86 ? 237 HOH A O   1 
HETATM 1559 O O   . HOH B 2 .   ? 16.529 -2.425  -63.300 1.00 19.56 ? 238 HOH A O   1 
HETATM 1560 O O   . HOH B 2 .   ? 25.690 -14.720 -48.340 1.00 18.04 ? 239 HOH A O   1 
HETATM 1561 O O   . HOH B 2 .   ? 44.177 -22.491 -52.637 1.00 13.41 ? 240 HOH A O   1 
HETATM 1562 O O   . HOH B 2 .   ? 29.598 -6.208  -72.319 1.00 20.68 ? 241 HOH A O   1 
HETATM 1563 O O   . HOH B 2 .   ? 22.979 -6.693  -43.260 1.00 18.70 ? 242 HOH A O   1 
HETATM 1564 O O   . HOH B 2 .   ? 18.829 -9.031  -53.765 1.00 20.10 ? 243 HOH A O   1 
HETATM 1565 O O   . HOH B 2 .   ? 37.218 -25.874 -59.212 1.00 15.90 ? 244 HOH A O   1 
HETATM 1566 O O   . HOH B 2 .   ? 35.676 -12.618 -48.662 1.00 12.26 ? 245 HOH A O   1 
HETATM 1567 O O   . HOH B 2 .   ? 50.202 -3.939  -58.362 1.00 22.45 ? 246 HOH A O   1 
HETATM 1568 O O   . HOH B 2 .   ? 19.854 -7.679  -56.404 1.00 27.50 ? 247 HOH A O   1 
HETATM 1569 O O   . HOH B 2 .   ? 34.196 -19.600 -73.450 1.00 24.49 ? 248 HOH A O   1 
HETATM 1570 O O   . HOH B 2 .   ? 37.247 -3.773  -73.641 1.00 15.95 ? 249 HOH A O   1 
HETATM 1571 O O   . HOH B 2 .   ? 43.342 -1.970  -51.980 1.00 15.14 ? 250 HOH A O   1 
HETATM 1572 O O   . HOH B 2 .   ? 22.229 -12.051 -55.335 1.00 21.41 ? 251 HOH A O   1 
HETATM 1573 O O   . HOH B 2 .   ? 31.296 9.010   -65.317 1.00 15.18 ? 252 HOH A O   1 
HETATM 1574 O O   . HOH B 2 .   ? 22.541 -12.606 -69.512 1.00 23.44 ? 253 HOH A O   1 
HETATM 1575 O O   . HOH B 2 .   ? 20.880 -19.514 -63.625 1.00 23.70 ? 254 HOH A O   1 
HETATM 1576 O O   . HOH B 2 .   ? 30.117 -24.719 -64.414 1.00 25.72 ? 255 HOH A O   1 
HETATM 1577 O O   . HOH B 2 .   ? 51.231 -19.887 -56.038 1.00 27.87 ? 256 HOH A O   1 
HETATM 1578 O O   . HOH B 2 .   ? 52.861 -20.943 -62.847 1.00 18.01 ? 257 HOH A O   1 
HETATM 1579 O O   . HOH B 2 .   ? 28.222 -8.975  -72.413 1.00 22.10 ? 258 HOH A O   1 
HETATM 1580 O O   . HOH B 2 .   ? 21.991 2.603   -56.833 1.00 16.17 ? 259 HOH A O   1 
HETATM 1581 O O   . HOH B 2 .   ? 49.607 5.756   -64.673 1.00 20.46 ? 260 HOH A O   1 
HETATM 1582 O O   . HOH B 2 .   ? 38.513 -18.941 -49.206 1.00 28.00 ? 261 HOH A O   1 
HETATM 1583 O O   . HOH B 2 .   ? 50.492 -11.388 -53.531 1.00 32.08 ? 262 HOH A O   1 
HETATM 1584 O O   . HOH B 2 .   ? 18.531 -9.704  -62.794 1.00 28.06 ? 263 HOH A O   1 
HETATM 1585 O O   . HOH B 2 .   ? 22.988 -19.374 -57.057 1.00 24.55 ? 264 HOH A O   1 
HETATM 1586 O O   . HOH B 2 .   ? 38.488 -29.810 -66.064 1.00 21.11 ? 265 HOH A O   1 
HETATM 1587 O O   . HOH B 2 .   ? 47.483 -0.928  -61.012 1.00 21.68 ? 266 HOH A O   1 
HETATM 1588 O O   . HOH B 2 .   ? 36.246 -27.404 -68.776 1.00 24.24 ? 267 HOH A O   1 
HETATM 1589 O O   . HOH B 2 .   ? 39.750 -5.858  -77.977 1.00 27.76 ? 268 HOH A O   1 
HETATM 1590 O O   . HOH B 2 .   ? 49.336 -18.048 -53.745 1.00 23.83 ? 269 HOH A O   1 
HETATM 1591 O O   . HOH B 2 .   ? 26.873 -18.935 -52.652 1.00 18.43 ? 270 HOH A O   1 
HETATM 1592 O O   . HOH B 2 .   ? 47.761 8.308   -71.157 1.00 24.73 ? 271 HOH A O   1 
HETATM 1593 O O   . HOH B 2 .   ? 51.334 -9.155  -52.315 1.00 27.62 ? 272 HOH A O   1 
HETATM 1594 O O   . HOH B 2 .   ? 29.463 -10.963 -78.522 1.00 20.41 ? 273 HOH A O   1 
HETATM 1595 O O   . HOH B 2 .   ? 42.030 13.769  -67.929 1.00 20.39 ? 274 HOH A O   1 
HETATM 1596 O O   . HOH B 2 .   ? 25.941 -23.758 -54.009 1.00 20.28 ? 275 HOH A O   1 
HETATM 1597 O O   . HOH B 2 .   ? 48.911 -17.228 -71.653 1.00 22.83 ? 276 HOH A O   1 
HETATM 1598 O O   . HOH B 2 .   ? 49.103 11.109  -53.156 1.00 28.49 ? 277 HOH A O   1 
HETATM 1599 O O   . HOH B 2 .   ? 52.315 6.329   -58.568 1.00 29.02 ? 278 HOH A O   1 
HETATM 1600 O O   . HOH B 2 .   ? 21.102 -15.231 -62.598 1.00 19.60 ? 279 HOH A O   1 
HETATM 1601 O O   . HOH B 2 .   ? 50.546 -11.960 -68.177 1.00 25.78 ? 280 HOH A O   1 
HETATM 1602 O O   . HOH B 2 .   ? 23.555 0.361   -67.871 1.00 18.38 ? 281 HOH A O   1 
HETATM 1603 O O   . HOH B 2 .   ? 53.529 -12.671 -67.389 1.00 26.70 ? 282 HOH A O   1 
HETATM 1604 O O   . HOH B 2 .   ? 38.387 -19.197 -51.887 1.00 32.67 ? 283 HOH A O   1 
HETATM 1605 O O   . HOH B 2 .   ? 20.193 -12.555 -63.138 1.00 23.50 ? 284 HOH A O   1 
HETATM 1606 O O   . HOH B 2 .   ? 47.125 2.020   -63.498 1.00 23.28 ? 285 HOH A O   1 
HETATM 1607 O O   . HOH B 2 .   ? 41.212 8.705   -72.095 1.00 29.02 ? 286 HOH A O   1 
HETATM 1608 O O   . HOH B 2 .   ? 22.221 -15.933 -46.081 1.00 32.70 ? 287 HOH A O   1 
HETATM 1609 O O   . HOH B 2 .   ? 34.292 2.056   -76.322 1.00 30.69 ? 288 HOH A O   1 
HETATM 1610 O O   . HOH B 2 .   ? 50.650 -16.190 -52.449 1.00 34.86 ? 289 HOH A O   1 
HETATM 1611 O O   . HOH B 2 .   ? 47.750 -20.210 -52.519 1.00 20.40 ? 290 HOH A O   1 
HETATM 1612 O O   . HOH B 2 .   ? 37.950 0.115   -74.017 1.00 32.69 ? 291 HOH A O   1 
HETATM 1613 O O   . HOH B 2 .   ? 25.161 -20.575 -54.061 1.00 22.97 ? 292 HOH A O   1 
HETATM 1614 O O   . HOH B 2 .   ? 45.074 15.879  -69.360 1.00 41.90 ? 293 HOH A O   1 
HETATM 1615 O O   . HOH B 2 .   ? 43.422 -11.261 -74.831 1.00 22.02 ? 294 HOH A O   1 
HETATM 1616 O O   . HOH B 2 .   ? 30.394 -23.626 -68.594 1.00 36.76 ? 295 HOH A O   1 
HETATM 1617 O O   . HOH B 2 .   ? 39.177 6.409   -73.385 1.00 43.93 ? 296 HOH A O   1 
HETATM 1618 O O   . HOH B 2 .   ? 27.135 -7.972  -39.278 1.00 23.25 ? 297 HOH A O   1 
HETATM 1619 O O   . HOH B 2 .   ? 16.797 -1.336  -59.709 1.00 51.35 ? 298 HOH A O   1 
HETATM 1620 O O   . HOH B 2 .   ? 46.670 13.527  -52.378 1.00 24.38 ? 299 HOH A O   1 
HETATM 1621 O O   . HOH B 2 .   ? 25.916 -17.566 -74.383 1.00 36.98 ? 300 HOH A O   1 
HETATM 1622 O O   . HOH B 2 .   ? 39.104 -15.426 -73.511 1.00 41.30 ? 301 HOH A O   1 
HETATM 1623 O O   . HOH B 2 .   ? 27.398 -22.625 -63.915 1.00 34.38 ? 302 HOH A O   1 
HETATM 1624 O O   . HOH B 2 .   ? 17.576 -1.122  -69.278 1.00 35.56 ? 303 HOH A O   1 
HETATM 1625 O O   . HOH B 2 .   ? 25.047 -6.143  -73.119 1.00 33.34 ? 304 HOH A O   1 
HETATM 1626 O O   . HOH B 2 .   ? 49.369 2.863   -60.124 1.00 43.62 ? 305 HOH A O   1 
HETATM 1627 O O   . HOH B 2 .   ? 48.240 4.905   -71.766 1.00 30.19 ? 306 HOH A O   1 
HETATM 1628 O O   . HOH B 2 .   ? 33.479 -19.351 -54.643 1.00 23.98 ? 307 HOH A O   1 
HETATM 1629 O O   . HOH B 2 .   ? 25.957 3.183   -69.425 1.00 46.21 ? 308 HOH A O   1 
HETATM 1630 O O   . HOH B 2 .   ? 32.906 -21.595 -53.123 1.00 36.34 ? 309 HOH A O   1 
HETATM 1631 O O   . HOH B 2 .   ? 16.691 -8.466  -56.628 1.00 38.96 ? 310 HOH A O   1 
HETATM 1632 O O   . HOH B 2 .   ? 14.487 -6.633  -63.873 1.00 40.39 ? 311 HOH A O   1 
HETATM 1633 O O   . HOH B 2 .   ? 47.630 -5.441  -71.887 1.00 43.51 ? 312 HOH A O   1 
HETATM 1634 O O   . HOH B 2 .   ? 51.420 -7.905  -63.338 1.00 33.36 ? 313 HOH A O   1 
HETATM 1635 O O   . HOH B 2 .   ? 55.215 -11.560 -64.107 1.00 45.90 ? 314 HOH A O   1 
HETATM 1636 O O   . HOH B 2 .   ? 18.050 -8.415  -70.972 1.00 32.21 ? 315 HOH A O   1 
HETATM 1637 O O   . HOH B 2 .   ? 47.863 -2.263  -50.634 1.00 27.48 ? 316 HOH A O   1 
HETATM 1638 O O   . HOH B 2 .   ? 31.042 1.935   -74.459 1.00 37.06 ? 317 HOH A O   1 
HETATM 1639 O O   . HOH B 2 .   ? 49.037 -2.053  -48.676 1.00 46.90 ? 318 HOH A O   1 
HETATM 1640 O O   . HOH B 2 .   ? 35.421 7.032   -69.722 1.00 18.62 ? 319 HOH A O   1 
HETATM 1641 O O   . HOH B 2 .   ? 24.891 -16.149 -50.886 1.00 25.86 ? 320 HOH A O   1 
HETATM 1642 O O   . HOH B 2 .   ? 29.153 5.805   -73.457 1.00 38.76 ? 321 HOH A O   1 
HETATM 1643 O O   . HOH B 2 .   ? 33.128 -28.627 -70.988 1.00 39.84 ? 322 HOH A O   1 
HETATM 1644 O O   . HOH B 2 .   ? 33.212 -17.214 -76.137 1.00 41.34 ? 323 HOH A O   1 
HETATM 1645 O O   . HOH B 2 .   ? 53.912 -15.157 -60.097 1.00 30.77 ? 324 HOH A O   1 
HETATM 1646 O O   . HOH B 2 .   ? 48.625 -8.143  -71.734 1.00 37.41 ? 325 HOH A O   1 
HETATM 1647 O O   . HOH B 2 .   ? 38.559 -31.496 -62.944 1.00 37.48 ? 326 HOH A O   1 
HETATM 1648 O O   . HOH B 2 .   ? 22.936 -16.713 -51.956 1.00 38.93 ? 327 HOH A O   1 
HETATM 1649 O O   . HOH B 2 .   ? 56.385 -14.944 -66.425 1.00 38.00 ? 328 HOH A O   1 
HETATM 1650 O O   . HOH B 2 .   ? 47.832 -11.854 -73.969 1.00 35.77 ? 329 HOH A O   1 
HETATM 1651 O O   . HOH B 2 .   ? 32.524 -26.612 -67.130 1.00 33.96 ? 330 HOH A O   1 
HETATM 1652 O O   . HOH B 2 .   ? 32.583 -21.988 -58.220 1.00 32.49 ? 331 HOH A O   1 
HETATM 1653 O O   . HOH B 2 .   ? 39.059 -12.790 -73.692 1.00 15.83 ? 332 HOH A O   1 
HETATM 1654 O O   . HOH B 2 .   ? 51.020 7.554   -60.774 1.00 21.22 ? 333 HOH A O   1 
HETATM 1655 O O   . HOH B 2 .   ? 46.615 -1.538  -69.819 1.00 26.14 ? 334 HOH A O   1 
HETATM 1656 O O   . HOH B 2 .   ? 38.843 -16.734 -48.653 1.00 28.55 ? 335 HOH A O   1 
HETATM 1657 O O   . HOH B 2 .   ? 20.276 -11.084 -53.086 1.00 24.54 ? 336 HOH A O   1 
HETATM 1658 O O   . HOH B 2 .   ? 36.373 -27.084 -66.048 1.00 22.09 ? 337 HOH A O   1 
HETATM 1659 O O   . HOH B 2 .   ? 40.012 -25.281 -52.272 1.00 24.52 ? 338 HOH A O   1 
HETATM 1660 O O   . HOH B 2 .   ? 47.422 0.219   -53.533 1.00 26.09 ? 339 HOH A O   1 
HETATM 1661 O O   . HOH B 2 .   ? 31.478 -25.857 -56.354 1.00 35.48 ? 340 HOH A O   1 
HETATM 1662 O O   . HOH B 2 .   ? 28.285 -23.793 -52.943 1.00 19.70 ? 341 HOH A O   1 
HETATM 1663 O O   . HOH B 2 .   ? 21.121 -0.168  -66.625 1.00 29.34 ? 342 HOH A O   1 
HETATM 1664 O O   . HOH B 2 .   ? 19.168 -11.690 -65.482 1.00 25.49 ? 343 HOH A O   1 
HETATM 1665 O O   . HOH B 2 .   ? 31.830 -25.391 -54.146 1.00 45.07 ? 344 HOH A O   1 
HETATM 1666 O O   . HOH B 2 .   ? 50.117 9.405   -56.992 1.00 23.04 ? 345 HOH A O   1 
HETATM 1667 O O   . HOH B 2 .   ? 49.463 5.623   -61.976 1.00 23.45 ? 346 HOH A O   1 
HETATM 1668 O O   . HOH B 2 .   ? 40.026 -3.214  -73.780 1.00 35.30 ? 347 HOH A O   1 
HETATM 1669 O O   . HOH B 2 .   ? 45.409 15.998  -52.938 1.00 23.56 ? 348 HOH A O   1 
HETATM 1670 O O   . HOH B 2 .   ? 41.835 12.629  -70.382 1.00 30.96 ? 349 HOH A O   1 
HETATM 1671 O O   . HOH B 2 .   ? 28.443 9.522   -65.522 1.00 28.02 ? 350 HOH A O   1 
HETATM 1672 O O   . HOH B 2 .   ? 47.797 3.772   -61.522 1.00 24.90 ? 351 HOH A O   1 
HETATM 1673 O O   . HOH B 2 .   ? 25.564 -19.021 -72.327 1.00 30.05 ? 352 HOH A O   1 
HETATM 1674 O O   . HOH B 2 .   ? 28.704 -21.282 -51.624 1.00 24.49 ? 353 HOH A O   1 
HETATM 1675 O O   . HOH B 2 .   ? 37.998 -21.623 -53.094 1.00 23.50 ? 354 HOH A O   1 
HETATM 1676 O O   . HOH B 2 .   ? 48.398 1.701   -55.499 1.00 28.75 ? 355 HOH A O   1 
HETATM 1677 O O   . HOH B 2 .   ? 36.239 -27.150 -61.550 1.00 30.03 ? 356 HOH A O   1 
HETATM 1678 O O   . HOH B 2 .   ? 41.826 -13.060 -74.024 1.00 24.68 ? 357 HOH A O   1 
HETATM 1679 O O   . HOH B 2 .   ? 44.518 11.326  -71.131 1.00 29.55 ? 358 HOH A O   1 
HETATM 1680 O O   . HOH B 2 .   ? 20.966 -16.394 -60.083 1.00 31.88 ? 359 HOH A O   1 
HETATM 1681 O O   . HOH B 2 .   ? 37.686 -27.353 -57.085 1.00 30.37 ? 360 HOH A O   1 
HETATM 1682 O O   . HOH B 2 .   ? 21.189 1.976   -64.702 1.00 30.15 ? 361 HOH A O   1 
HETATM 1683 O O   . HOH B 2 .   ? 36.797 -29.592 -69.162 1.00 38.34 ? 362 HOH A O   1 
HETATM 1684 O O   . HOH B 2 .   ? 48.693 13.164  -51.354 1.00 42.14 ? 363 HOH A O   1 
HETATM 1685 O O   . HOH B 2 .   ? 50.321 7.410   -55.029 1.00 27.43 ? 364 HOH A O   1 
HETATM 1686 O O   . HOH B 2 .   ? 22.269 -14.549 -56.226 1.00 43.05 ? 365 HOH A O   1 
HETATM 1687 O O   . HOH B 2 .   ? 39.106 9.833   -69.694 1.00 36.23 ? 366 HOH A O   1 
HETATM 1688 O O   . HOH B 2 .   ? 48.155 -0.402  -63.294 1.00 33.76 ? 367 HOH A O   1 
HETATM 1689 O O   . HOH B 2 .   ? 47.571 -20.238 -49.619 1.00 39.12 ? 368 HOH A O   1 
HETATM 1690 O O   . HOH B 2 .   ? 37.057 -19.835 -76.754 1.00 36.98 ? 369 HOH A O   1 
HETATM 1691 O O   . HOH B 2 .   ? 52.054 7.261   -65.230 1.00 39.21 ? 370 HOH A O   1 
HETATM 1692 O O   . HOH B 2 .   ? 35.867 -3.521  -76.182 1.00 43.80 ? 371 HOH A O   1 
HETATM 1693 O O   . HOH B 2 .   ? 40.913 -3.955  -76.491 1.00 34.16 ? 372 HOH A O   1 
HETATM 1694 O O   . HOH B 2 .   ? 18.672 -0.056  -67.362 1.00 37.24 ? 373 HOH A O   1 
HETATM 1695 O O   . HOH B 2 .   ? 17.004 -0.318  -65.299 1.00 49.99 ? 374 HOH A O   1 
HETATM 1696 O O   . HOH B 2 .   ? 25.976 6.079   -63.909 1.00 32.83 ? 375 HOH A O   1 
HETATM 1697 O O   . HOH B 2 .   ? 23.550 -21.825 -69.243 1.00 41.19 ? 376 HOH A O   1 
HETATM 1698 O O   . HOH B 2 .   ? 50.729 12.091  -60.406 1.00 45.19 ? 377 HOH A O   1 
HETATM 1699 O O   . HOH B 2 .   ? 49.781 -9.140  -74.322 1.00 48.22 ? 378 HOH A O   1 
HETATM 1700 O O   . HOH B 2 .   ? 31.277 -20.799 -51.426 1.00 32.12 ? 379 HOH A O   1 
HETATM 1701 O O   . HOH B 2 .   ? 42.010 16.384  -68.902 1.00 31.86 ? 380 HOH A O   1 
HETATM 1702 O O   . HOH B 2 .   ? 47.061 -18.050 -47.744 1.00 27.66 ? 381 HOH A O   1 
HETATM 1703 O O   . HOH B 2 .   ? 52.057 -9.605  -65.545 1.00 32.01 ? 382 HOH A O   1 
HETATM 1704 O O   . HOH B 2 .   ? 31.812 -1.781  -75.774 1.00 39.28 ? 383 HOH A O   1 
HETATM 1705 O O   . HOH B 2 .   ? 43.756 -1.572  -72.965 1.00 38.33 ? 384 HOH A O   1 
HETATM 1706 O O   . HOH B 2 .   ? 18.508 -10.780 -70.081 1.00 33.72 ? 385 HOH A O   1 
HETATM 1707 O O   . HOH B 2 .   ? 19.500 -12.696 -71.974 1.00 37.02 ? 386 HOH A O   1 
HETATM 1708 O O   . HOH B 2 .   ? 49.028 11.958  -65.316 1.00 37.95 ? 387 HOH A O   1 
HETATM 1709 O O   . HOH B 2 .   ? 42.613 -4.081  -72.432 1.00 25.76 ? 388 HOH A O   1 
HETATM 1710 O O   . HOH B 2 .   ? 51.362 8.757   -67.123 1.00 34.21 ? 389 HOH A O   1 
HETATM 1711 O O   . HOH B 2 .   ? 16.508 -10.259 -53.543 1.00 37.72 ? 390 HOH A O   1 
HETATM 1712 O O   . HOH B 2 .   ? 45.378 -0.953  -50.703 1.00 32.41 ? 391 HOH A O   1 
HETATM 1713 O O   . HOH B 2 .   ? 32.845 -28.826 -74.288 1.00 45.09 ? 392 HOH A O   1 
HETATM 1714 O O   . HOH B 2 .   ? 20.545 -11.030 -68.061 1.00 40.05 ? 393 HOH A O   1 
HETATM 1715 O O   . HOH B 2 .   ? 50.199 -8.148  -65.729 1.00 42.62 ? 394 HOH A O   1 
HETATM 1716 O O   . HOH B 2 .   ? 17.194 0.903   -62.891 1.00 43.34 ? 395 HOH A O   1 
HETATM 1717 O O   . HOH B 2 .   ? 34.812 -10.561 -82.245 1.00 29.01 ? 396 HOH A O   1 
HETATM 1718 O O   . HOH B 2 .   ? 20.081 -18.764 -60.321 1.00 58.47 ? 397 HOH A O   1 
HETATM 1719 O O   . HOH B 2 .   ? 25.152 -7.066  -38.549 1.00 45.01 ? 398 HOH A O   1 
HETATM 1720 O O   . HOH B 2 .   ? 47.487 -21.081 -69.370 1.00 31.75 ? 399 HOH A O   1 
HETATM 1721 O O   . HOH B 2 .   ? 49.346 -2.688  -60.675 1.00 38.66 ? 400 HOH A O   1 
HETATM 1722 O O   . HOH B 2 .   ? 34.797 -21.310 -75.287 1.00 36.04 ? 401 HOH A O   1 
HETATM 1723 O O   . HOH B 2 .   ? 48.590 14.585  -66.136 1.00 41.77 ? 402 HOH A O   1 
HETATM 1724 O O   . HOH B 2 .   ? 24.261 -22.472 -52.203 1.00 37.79 ? 403 HOH A O   1 
HETATM 1725 O O   . HOH B 2 .   ? 24.380 3.941   -62.892 1.00 29.75 ? 404 HOH A O   1 
HETATM 1726 O O   . HOH B 2 .   ? 47.634 -3.610  -65.865 1.00 45.35 ? 405 HOH A O   1 
HETATM 1727 O O   . HOH B 2 .   ? 23.946 -22.194 -64.696 1.00 39.12 ? 406 HOH A O   1 
HETATM 1728 O O   . HOH B 2 .   ? 12.750 -2.488  -65.176 1.00 42.48 ? 407 HOH A O   1 
HETATM 1729 O O   . HOH B 2 .   ? 15.846 -10.225 -62.285 1.00 43.09 ? 408 HOH A O   1 
HETATM 1730 O O   . HOH B 2 .   ? 20.340 -13.156 -45.403 1.00 34.87 ? 409 HOH A O   1 
HETATM 1731 O O   . HOH B 2 .   ? 34.785 -30.837 -70.515 1.00 45.02 ? 410 HOH A O   1 
HETATM 1732 O O   . HOH B 2 .   ? 38.920 -20.999 -48.344 1.00 30.55 ? 411 HOH A O   1 
HETATM 1733 O O   . HOH B 2 .   ? 49.173 13.102  -62.653 1.00 34.11 ? 412 HOH A O   1 
HETATM 1734 O O   . HOH B 2 .   ? 44.481 16.368  -54.974 1.00 39.82 ? 413 HOH A O   1 
HETATM 1735 O O   . HOH B 2 .   ? 52.754 8.382   -62.511 1.00 33.44 ? 414 HOH A O   1 
HETATM 1736 O O   . HOH B 2 .   ? 26.336 -15.389 -74.950 1.00 35.38 ? 415 HOH A O   1 
HETATM 1737 O O   . HOH B 2 .   ? 45.843 -11.951 -75.806 1.00 27.85 ? 416 HOH A O   1 
HETATM 1738 O O   . HOH B 2 .   ? 43.215 -23.247 -50.196 1.00 34.37 ? 417 HOH A O   1 
HETATM 1739 O O   . HOH B 2 .   ? 19.926 -11.073 -48.312 1.00 36.98 ? 418 HOH A O   1 
HETATM 1740 O O   . HOH B 2 .   ? 51.097 11.071  -66.013 1.00 43.17 ? 419 HOH A O   1 
HETATM 1741 O O   . HOH B 2 .   ? 35.783 -4.754  -78.242 1.00 40.03 ? 420 HOH A O   1 
HETATM 1742 O O   . HOH B 2 .   ? 51.186 11.490  -55.699 1.00 38.94 ? 421 HOH A O   1 
HETATM 1743 O O   . HOH B 2 .   ? 34.390 -29.534 -65.604 1.00 45.91 ? 422 HOH A O   1 
HETATM 1744 O O   . HOH B 2 .   ? 36.550 -31.590 -59.311 1.00 45.88 ? 423 HOH A O   1 
HETATM 1745 O O   . HOH B 2 .   ? 36.083 -1.240  -75.471 1.00 35.43 ? 424 HOH A O   1 
HETATM 1746 O O   . HOH B 2 .   ? 18.708 -16.262 -66.668 1.00 46.41 ? 425 HOH A O   1 
HETATM 1747 O O   . HOH B 2 .   ? 34.909 -7.099  -81.510 1.00 48.54 ? 426 HOH A O   1 
HETATM 1748 O O   . HOH B 2 .   ? 47.764 -23.206 -52.479 1.00 45.61 ? 427 HOH A O   1 
HETATM 1749 O O   . HOH B 2 .   ? 19.264 -13.295 -52.980 1.00 38.68 ? 428 HOH A O   1 
HETATM 1750 O O   . HOH B 2 .   ? 18.223 -13.142 -50.326 1.00 44.10 ? 429 HOH A O   1 
HETATM 1751 O O   . HOH B 2 .   ? 21.004 -15.339 -53.869 1.00 47.16 ? 430 HOH A O   1 
HETATM 1752 O O   . HOH B 2 .   ? 26.642 -8.686  -75.431 1.00 53.05 ? 431 HOH A O   1 
HETATM 1753 O O   . HOH B 2 .   ? 28.206 -13.447 -78.701 1.00 38.53 ? 432 HOH A O   1 
HETATM 1754 O O   . HOH B 2 .   ? 48.408 0.958   -58.672 1.00 48.14 ? 433 HOH A O   1 
HETATM 1755 O O   . HOH B 2 .   ? 33.855 4.802   -75.964 1.00 48.19 ? 434 HOH A O   1 
HETATM 1756 O O   . HOH B 2 .   ? 40.472 -0.364  -73.981 1.00 43.84 ? 435 HOH A O   1 
HETATM 1757 O O   . HOH B 2 .   ? 50.746 -13.530 -70.290 1.00 45.75 ? 436 HOH A O   1 
HETATM 1758 O O   . HOH B 2 .   ? 49.461 -1.335  -52.552 1.00 39.32 ? 437 HOH A O   1 
HETATM 1759 O O   . HOH B 2 .   ? 30.281 -24.884 -59.157 1.00 53.73 ? 438 HOH A O   1 
HETATM 1760 O O   . HOH B 2 .   ? 50.131 -8.630  -69.804 1.00 43.39 ? 439 HOH A O   1 
HETATM 1761 O O   . HOH B 2 .   ? 50.261 9.280   -51.435 1.00 46.05 ? 440 HOH A O   1 
HETATM 1762 O O   . HOH B 2 .   ? 45.193 -6.237  -74.568 1.00 50.14 ? 441 HOH A O   1 
HETATM 1763 O O   . HOH B 2 .   ? 36.592 -19.481 -54.127 1.00 44.55 ? 442 HOH A O   1 
HETATM 1764 O O   . HOH B 2 .   ? 47.367 15.286  -58.444 1.00 54.67 ? 443 HOH A O   1 
HETATM 1765 O O   . HOH B 2 .   ? 26.212 -24.616 -61.498 1.00 48.50 ? 444 HOH A O   1 
HETATM 1766 O O   . HOH B 2 .   ? 28.043 -15.494 -77.375 1.00 48.68 ? 445 HOH A O   1 
HETATM 1767 O O   . HOH B 2 .   ? 48.424 10.639  -72.255 1.00 45.36 ? 446 HOH A O   1 
HETATM 1768 O O   . HOH B 2 .   ? 22.374 7.077   -64.878 1.00 47.91 ? 447 HOH A O   1 
HETATM 1769 O O   . HOH B 2 .   ? 40.102 -27.681 -53.818 1.00 48.72 ? 448 HOH A O   1 
HETATM 1770 O O   . HOH B 2 .   ? 20.121 -15.582 -69.172 1.00 43.46 ? 449 HOH A O   1 
HETATM 1771 O O   . HOH B 2 .   ? 41.566 -7.840  -78.920 1.00 53.69 ? 450 HOH A O   1 
HETATM 1772 O O   . HOH B 2 .   ? 28.836 -23.904 -61.510 1.00 50.42 ? 451 HOH A O   1 
HETATM 1773 O O   . HOH B 2 .   ? 29.406 9.563   -73.473 1.00 48.12 ? 452 HOH A O   1 
HETATM 1774 O O   . HOH B 2 .   ? 19.350 -7.900  -73.378 1.00 50.83 ? 453 HOH A O   1 
HETATM 1775 O O   . HOH B 2 .   ? 48.670 -3.489  -62.911 1.00 54.87 ? 454 HOH A O   1 
HETATM 1776 O O   . HOH B 2 .   ? 46.246 -27.286 -51.233 1.00 47.40 ? 455 HOH A O   1 
HETATM 1777 O O   . HOH B 2 .   ? 53.183 10.532  -63.486 1.00 59.19 ? 456 HOH A O   1 
HETATM 1778 O O   . HOH B 2 .   ? 18.017 -0.558  -56.492 1.00 41.25 ? 457 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ALA A 2   ? 0.8927 0.9821 0.4224 -0.4164 -0.2684 0.4861  2   ALA A N   
2    C CA  . ALA A 2   ? 0.8224 0.4500 0.2321 -0.1554 -0.1925 0.1642  2   ALA A CA  
3    C C   . ALA A 2   ? 0.5719 0.3963 0.1500 -0.0362 -0.0494 0.0757  2   ALA A C   
4    O O   . ALA A 2   ? 0.6003 0.7056 0.2693 0.0551  0.1406  0.2065  2   ALA A O   
5    C CB  . ALA A 2   ? 0.6545 0.4069 0.3404 -0.0740 -0.1950 0.2012  2   ALA A CB  
6    N N   . SER A 3   ? 0.4201 0.1393 0.2027 0.0292  -0.0626 0.0489  3   SER A N   
7    C CA  . SER A 3   ? 0.3365 0.1044 0.1447 0.0502  -0.0024 0.0121  3   SER A CA  
8    C C   . SER A 3   ? 0.2775 0.1100 0.1304 0.0419  -0.0442 0.0006  3   SER A C   
9    O O   . SER A 3   ? 0.3311 0.1556 0.1881 0.0277  -0.1272 0.0247  3   SER A O   
10   C CB  . SER A 3   ? 0.4206 0.1232 0.2435 0.0258  0.0908  -0.0197 3   SER A CB  
11   O OG  . SER A 3   ? 1.1087 0.1093 0.4425 0.1055  0.4109  0.0040  3   SER A OG  
12   N N   . LYS A 4   ? 0.2034 0.0919 0.1094 0.0077  -0.0081 0.0039  4   LYS A N   
13   C CA  . LYS A 4   ? 0.1979 0.0895 0.0993 0.0152  -0.0081 0.0050  4   LYS A CA  
14   C C   . LYS A 4   ? 0.2077 0.0765 0.0762 0.0277  -0.0139 -0.0001 4   LYS A C   
15   O O   . LYS A 4   ? 0.2128 0.0956 0.0893 0.0146  -0.0067 -0.0144 4   LYS A O   
16   C CB  . LYS A 4   ? 0.2102 0.1397 0.1322 0.0386  0.0046  0.0370  4   LYS A CB  
17   C CG  . LYS A 4   ? 0.2054 0.1667 0.1663 0.0097  0.0171  0.0229  4   LYS A CG  
18   C CD  . LYS A 4   ? 0.3765 0.1981 0.1900 -0.0579 0.1102  -0.0108 4   LYS A CD  
19   C CE  . LYS A 4   ? 0.3501 0.2939 0.2246 -0.1072 0.1211  -0.0415 4   LYS A CE  
20   N NZ  . LYS A 4   ? 0.6484 0.4343 0.5983 0.0058  0.4189  -0.0467 4   LYS A NZ  
21   N N   A ARG A 5   ? 0.1753 0.0818 0.0859 0.0295  -0.0002 0.0000  5   ARG A N   
22   N N   B ARG A 5   ? 0.2037 0.0859 0.0734 0.0162  -0.0033 0.0015  5   ARG A N   
23   C CA  A ARG A 5   ? 0.1408 0.1052 0.0833 0.0479  -0.0098 0.0142  5   ARG A CA  
24   C CA  B ARG A 5   ? 0.2023 0.1037 0.0733 0.0267  0.0103  0.0042  5   ARG A CA  
25   C C   A ARG A 5   ? 0.1197 0.0913 0.0801 0.0487  0.0064  0.0040  5   ARG A C   
26   C C   B ARG A 5   ? 0.1868 0.0999 0.0806 0.0215  0.0165  0.0066  5   ARG A C   
27   O O   A ARG A 5   ? 0.1370 0.1145 0.0763 0.0554  -0.0244 -0.0387 5   ARG A O   
28   O O   B ARG A 5   ? 0.1950 0.1062 0.0697 0.0232  0.0280  0.0099  5   ARG A O   
29   C CB  A ARG A 5   ? 0.1691 0.1414 0.1373 0.0298  -0.0465 0.0373  5   ARG A CB  
30   C CB  B ARG A 5   ? 0.1982 0.1552 0.1490 0.0149  -0.0176 0.0274  5   ARG A CB  
31   C CG  A ARG A 5   ? 0.2531 0.1819 0.1529 0.0187  -0.1002 0.0624  5   ARG A CG  
32   C CG  B ARG A 5   ? 0.1926 0.1455 0.1245 0.0326  -0.0091 -0.0011 5   ARG A CG  
33   C CD  A ARG A 5   ? 0.2876 0.2819 0.1993 -0.0142 -0.1390 0.0784  5   ARG A CD  
34   C CD  B ARG A 5   ? 0.2202 0.2803 0.2164 0.0175  -0.0715 0.0403  5   ARG A CD  
35   N NE  A ARG A 5   ? 0.2824 0.3435 0.2625 -0.0553 -0.1302 0.0908  5   ARG A NE  
36   N NE  B ARG A 5   ? 0.4101 0.3107 0.2503 0.0968  -0.1535 0.0118  5   ARG A NE  
37   C CZ  A ARG A 5   ? 0.3567 0.3451 0.2845 -0.0911 -0.0826 0.0154  5   ARG A CZ  
38   C CZ  B ARG A 5   ? 0.4196 0.3315 0.3649 0.1042  -0.1927 0.0370  5   ARG A CZ  
39   N NH1 A ARG A 5   ? 0.4321 0.2907 0.2887 0.0212  -0.1891 0.0752  5   ARG A NH1 
40   N NH1 B ARG A 5   ? 0.5218 0.5804 0.7175 -0.1147 -0.2771 0.1279  5   ARG A NH1 
41   N NH2 A ARG A 5   ? 0.4628 0.5061 0.4180 -0.2547 0.0660  -0.1364 5   ARG A NH2 
42   N NH2 B ARG A 5   ? 0.8723 0.3787 0.4810 0.2447  -0.3972 0.0116  5   ARG A NH2 
43   N N   . ALA A 6   ? 0.1384 0.0877 0.0765 0.0336  0.0032  0.0012  6   ALA A N   
44   C CA  . ALA A 6   ? 0.1456 0.0807 0.0735 0.0214  -0.0229 -0.0041 6   ALA A CA  
45   C C   . ALA A 6   ? 0.1283 0.0782 0.0745 0.0279  -0.0313 -0.0014 6   ALA A C   
46   O O   . ALA A 6   ? 0.1628 0.0880 0.0973 0.0411  -0.0034 -0.0096 6   ALA A O   
47   C CB  . ALA A 6   ? 0.1259 0.0958 0.0837 0.0241  -0.0187 -0.0217 6   ALA A CB  
48   N N   . LEU A 7   ? 0.1139 0.0851 0.0684 0.0269  0.0013  -0.0063 7   LEU A N   
49   C CA  . LEU A 7   ? 0.1107 0.0914 0.0708 0.0240  -0.0072 0.0005  7   LEU A CA  
50   C C   . LEU A 7   ? 0.1120 0.0848 0.0686 0.0269  -0.0061 -0.0014 7   LEU A C   
51   O O   . LEU A 7   ? 0.1278 0.1175 0.0875 0.0503  0.0129  0.0111  7   LEU A O   
52   C CB  . LEU A 7   ? 0.1167 0.1013 0.0765 0.0171  -0.0092 -0.0076 7   LEU A CB  
53   C CG  . LEU A 7   ? 0.1162 0.1016 0.0969 0.0170  -0.0099 0.0034  7   LEU A CG  
54   C CD1 . LEU A 7   ? 0.1192 0.1456 0.1366 0.0193  0.0140  -0.0080 7   LEU A CD1 
55   C CD2 . LEU A 7   ? 0.1365 0.1170 0.1243 -0.0035 -0.0065 -0.0134 7   LEU A CD2 
56   N N   . VAL A 8   ? 0.1149 0.0729 0.0749 0.0271  -0.0024 0.0029  8   VAL A N   
57   C CA  . VAL A 8   ? 0.1010 0.0808 0.0723 0.0300  -0.0059 -0.0021 8   VAL A CA  
58   C C   . VAL A 8   ? 0.0942 0.0944 0.0763 0.0159  -0.0151 0.0049  8   VAL A C   
59   O O   . VAL A 8   ? 0.0989 0.0906 0.1218 0.0218  -0.0121 -0.0012 8   VAL A O   
60   C CB  . VAL A 8   ? 0.1187 0.0924 0.0730 0.0074  -0.0078 -0.0076 8   VAL A CB  
61   C CG1 . VAL A 8   ? 0.1448 0.1096 0.0867 0.0078  -0.0143 0.0143  8   VAL A CG1 
62   C CG2 . VAL A 8   ? 0.1085 0.0975 0.0864 0.0186  0.0002  0.0016  8   VAL A CG2 
63   N N   . ILE A 9   ? 0.0655 0.0954 0.0795 0.0121  -0.0027 -0.0082 9   ILE A N   
64   C CA  . ILE A 9   ? 0.0913 0.0962 0.0678 0.0012  -0.0105 -0.0061 9   ILE A CA  
65   C C   . ILE A 9   ? 0.0826 0.0883 0.0748 0.0047  -0.0123 -0.0029 9   ILE A C   
66   O O   . ILE A 9   ? 0.0970 0.1181 0.0866 0.0168  -0.0152 0.0108  9   ILE A O   
67   C CB  . ILE A 9   ? 0.1094 0.0886 0.0780 0.0101  -0.0143 -0.0061 9   ILE A CB  
68   C CG1 . ILE A 9   ? 0.1180 0.0993 0.0773 0.0078  -0.0126 -0.0073 9   ILE A CG1 
69   C CG2 . ILE A 9   ? 0.1360 0.1107 0.0984 -0.0237 -0.0184 -0.0012 9   ILE A CG2 
70   C CD1 . ILE A 9   ? 0.1576 0.1197 0.0788 0.0027  -0.0068 -0.0167 9   ILE A CD1 
71   N N   . LEU A 10  ? 0.0922 0.1070 0.0722 0.0051  -0.0016 0.0027  10  LEU A N   
72   C CA  . LEU A 10  ? 0.0905 0.0960 0.0731 0.0155  -0.0079 0.0035  10  LEU A CA  
73   C C   . LEU A 10  ? 0.1026 0.0968 0.0711 0.0064  -0.0101 0.0002  10  LEU A C   
74   O O   . LEU A 10  ? 0.1017 0.1110 0.1209 0.0086  -0.0036 0.0145  10  LEU A O   
75   C CB  . LEU A 10  ? 0.0942 0.0942 0.0837 0.0070  -0.0041 0.0030  10  LEU A CB  
76   C CG  . LEU A 10  ? 0.1139 0.0843 0.0791 -0.0078 -0.0016 0.0065  10  LEU A CG  
77   C CD1 . LEU A 10  ? 0.1399 0.1177 0.0920 -0.0025 -0.0233 -0.0084 10  LEU A CD1 
78   C CD2 . LEU A 10  ? 0.1829 0.1005 0.0988 0.0082  0.0103  -0.0146 10  LEU A CD2 
79   N N   . ALA A 11  ? 0.0954 0.0985 0.0876 -0.0141 -0.0256 0.0028  11  ALA A N   
80   C CA  . ALA A 11  ? 0.0958 0.0975 0.0961 -0.0046 -0.0162 0.0093  11  ALA A CA  
81   C C   . ALA A 11  ? 0.0978 0.0899 0.0922 -0.0063 -0.0102 -0.0036 11  ALA A C   
82   O O   . ALA A 11  ? 0.0968 0.0971 0.1013 -0.0061 -0.0142 0.0018  11  ALA A O   
83   C CB  . ALA A 11  ? 0.2120 0.0987 0.0832 -0.0093 -0.0027 -0.0038 11  ALA A CB  
84   N N   A LYS A 12  ? 0.1545 0.1311 0.0935 -0.0729 -0.0365 0.0178  12  LYS A N   
85   N N   B LYS A 12  ? 0.0639 0.0807 0.0989 0.0252  0.0008  -0.0109 12  LYS A N   
86   C CA  A LYS A 12  ? 0.1245 0.0733 0.0843 -0.0168 -0.0160 -0.0070 12  LYS A CA  
87   C CA  B LYS A 12  ? 0.1047 0.0812 0.0981 -0.0096 -0.0108 -0.0008 12  LYS A CA  
88   C C   A LYS A 12  ? 0.1143 0.0858 0.0940 -0.0202 -0.0118 -0.0146 12  LYS A C   
89   C C   B LYS A 12  ? 0.1060 0.0798 0.0775 -0.0073 -0.0056 -0.0001 12  LYS A C   
90   O O   A LYS A 12  ? 0.1236 0.0914 0.1018 -0.0070 -0.0246 -0.0134 12  LYS A O   
91   O O   B LYS A 12  ? 0.0908 0.0919 0.0915 -0.0157 0.0030  -0.0092 12  LYS A O   
92   C CB  A LYS A 12  ? 0.1203 0.1001 0.1199 -0.0108 -0.0033 0.0147  12  LYS A CB  
93   C CB  B LYS A 12  ? 0.1085 0.0868 0.1256 -0.0071 0.0059  -0.0007 12  LYS A CB  
94   C CG  A LYS A 12  ? 0.1106 0.1154 0.1165 -0.0238 0.0065  -0.0002 12  LYS A CG  
95   C CG  B LYS A 12  ? 0.1498 0.1035 0.1222 -0.0365 0.0348  -0.0212 12  LYS A CG  
96   C CD  A LYS A 12  ? 0.1474 0.1820 0.1679 -0.0613 0.0178  0.0244  12  LYS A CD  
97   C CD  B LYS A 12  ? 0.1242 0.1315 0.1396 -0.0239 0.0245  -0.0053 12  LYS A CD  
98   C CE  A LYS A 12  ? 0.2049 0.2213 0.1986 -0.0557 0.0900  0.0120  12  LYS A CE  
99   C CE  B LYS A 12  ? 0.1269 0.1870 0.1544 -0.0294 0.0223  0.0396  12  LYS A CE  
100  N NZ  A LYS A 12  ? 0.3887 0.4747 0.1646 -0.1414 -0.0205 0.1105  12  LYS A NZ  
101  N NZ  B LYS A 12  ? 0.1895 0.2682 0.2408 -0.1181 0.0981  -0.0194 12  LYS A NZ  
102  N N   . GLY A 13  ? 0.0940 0.0781 0.0900 -0.0018 -0.0062 -0.0041 13  GLY A N   
103  C CA  . GLY A 13  ? 0.0987 0.0829 0.0879 0.0010  -0.0075 -0.0003 13  GLY A CA  
104  C C   . GLY A 13  ? 0.0973 0.0942 0.0672 -0.0062 -0.0136 -0.0123 13  GLY A C   
105  O O   . GLY A 13  ? 0.0985 0.0892 0.0840 -0.0035 -0.0160 -0.0066 13  GLY A O   
106  N N   . ALA A 14  ? 0.0847 0.0867 0.0788 -0.0066 -0.0103 -0.0104 14  ALA A N   
107  C CA  . ALA A 14  ? 0.0760 0.0947 0.0673 0.0027  -0.0101 -0.0103 14  ALA A CA  
108  C C   . ALA A 14  ? 0.0896 0.0728 0.0621 -0.0026 -0.0041 -0.0017 14  ALA A C   
109  O O   . ALA A 14  ? 0.0906 0.0802 0.0739 -0.0058 0.0016  -0.0095 14  ALA A O   
110  C CB  . ALA A 14  ? 0.0994 0.1283 0.0698 -0.0077 -0.0096 0.0065  14  ALA A CB  
111  N N   . GLU A 15  ? 0.0902 0.0722 0.0519 -0.0034 0.0002  -0.0145 15  GLU A N   
112  C CA  . GLU A 15  ? 0.0849 0.0696 0.0586 -0.0004 -0.0025 0.0026  15  GLU A CA  
113  C C   . GLU A 15  ? 0.1009 0.0643 0.0553 0.0051  -0.0189 -0.0051 15  GLU A C   
114  O O   . GLU A 15  ? 0.0834 0.0683 0.0623 0.0135  -0.0101 0.0033  15  GLU A O   
115  C CB  . GLU A 15  ? 0.0888 0.0684 0.0596 0.0071  0.0013  0.0017  15  GLU A CB  
116  C CG  . GLU A 15  ? 0.0849 0.0807 0.0639 0.0059  -0.0013 -0.0067 15  GLU A CG  
117  C CD  . GLU A 15  ? 0.0901 0.0662 0.0713 0.0056  -0.0076 -0.0004 15  GLU A CD  
118  O OE1 . GLU A 15  ? 0.0973 0.0751 0.0783 -0.0053 -0.0260 -0.0003 15  GLU A OE1 
119  O OE2 . GLU A 15  ? 0.1298 0.0892 0.0673 0.0095  -0.0164 -0.0075 15  GLU A OE2 
120  N N   . GLU A 16  ? 0.1034 0.0606 0.0677 -0.0001 0.0018  -0.0004 16  GLU A N   
121  C CA  . GLU A 16  ? 0.0863 0.0622 0.0625 0.0017  -0.0059 -0.0034 16  GLU A CA  
122  C C   . GLU A 16  ? 0.0821 0.0760 0.0560 0.0013  -0.0022 0.0042  16  GLU A C   
123  O O   . GLU A 16  ? 0.0935 0.0661 0.0684 0.0068  -0.0016 0.0084  16  GLU A O   
124  C CB  . GLU A 16  ? 0.0980 0.0647 0.0581 -0.0058 0.0098  -0.0079 16  GLU A CB  
125  C CG  . GLU A 16  ? 0.0868 0.0685 0.0664 0.0068  0.0154  0.0045  16  GLU A CG  
126  C CD  . GLU A 16  ? 0.0972 0.0695 0.0609 -0.0061 -0.0008 -0.0016 16  GLU A CD  
127  O OE1 . GLU A 16  ? 0.1026 0.0681 0.0767 -0.0009 0.0009  -0.0033 16  GLU A OE1 
128  O OE2 . GLU A 16  ? 0.0908 0.0802 0.0801 0.0040  0.0136  0.0096  16  GLU A OE2 
129  N N   . MET A 17  ? 0.0878 0.0638 0.0503 -0.0020 -0.0073 0.0017  17  MET A N   
130  C CA  . MET A 17  ? 0.0743 0.0646 0.0641 0.0052  0.0046  0.0046  17  MET A CA  
131  C C   . MET A 17  ? 0.0815 0.0574 0.0681 0.0062  0.0023  0.0046  17  MET A C   
132  O O   . MET A 17  ? 0.0978 0.0671 0.0644 -0.0056 0.0100  0.0085  17  MET A O   
133  C CB  . MET A 17  ? 0.0806 0.0666 0.0648 -0.0053 0.0012  -0.0003 17  MET A CB  
134  C CG  . MET A 17  ? 0.1017 0.0799 0.0673 0.0056  0.0016  0.0037  17  MET A CG  
135  S SD  . MET A 17  ? 0.1207 0.0868 0.0809 0.0035  -0.0274 -0.0041 17  MET A SD  
136  C CE  . MET A 17  ? 0.1014 0.0903 0.0987 0.0173  0.0050  0.0058  17  MET A CE  
137  N N   . GLU A 18  ? 0.1139 0.0607 0.0583 -0.0077 0.0083  0.0015  18  GLU A N   
138  C CA  . GLU A 18  ? 0.1061 0.0732 0.0652 -0.0065 0.0003  -0.0047 18  GLU A CA  
139  C C   . GLU A 18  ? 0.1059 0.0752 0.0657 0.0072  -0.0009 -0.0090 18  GLU A C   
140  O O   . GLU A 18  ? 0.1376 0.0931 0.0684 0.0343  0.0132  0.0062  18  GLU A O   
141  C CB  . GLU A 18  ? 0.0964 0.0763 0.0666 -0.0002 -0.0044 -0.0089 18  GLU A CB  
142  C CG  . GLU A 18  ? 0.0966 0.0947 0.0677 0.0019  -0.0048 -0.0031 18  GLU A CG  
143  C CD  . GLU A 18  ? 0.0880 0.1011 0.0570 0.0105  0.0027  -0.0091 18  GLU A CD  
144  O OE1 . GLU A 18  ? 0.1011 0.0986 0.0917 0.0128  -0.0123 -0.0173 18  GLU A OE1 
145  O OE2 . GLU A 18  ? 0.1183 0.1099 0.0784 0.0149  -0.0269 -0.0008 18  GLU A OE2 
146  N N   . THR A 19  ? 0.1007 0.0829 0.0692 -0.0033 -0.0001 -0.0114 19  THR A N   
147  C CA  . THR A 19  ? 0.0999 0.0747 0.0746 -0.0032 -0.0015 -0.0150 19  THR A CA  
148  C C   . THR A 19  ? 0.0920 0.0771 0.0630 -0.0012 0.0046  -0.0062 19  THR A C   
149  O O   . THR A 19  ? 0.1064 0.0909 0.0691 0.0018  -0.0018 -0.0002 19  THR A O   
150  C CB  . THR A 19  ? 0.0960 0.0791 0.0944 -0.0038 0.0011  -0.0127 19  THR A CB  
151  O OG1 . THR A 19  ? 0.1245 0.0799 0.0898 -0.0129 -0.0016 -0.0176 19  THR A OG1 
152  C CG2 . THR A 19  ? 0.1072 0.0965 0.1306 -0.0119 -0.0171 0.0051  19  THR A CG2 
153  N N   . VAL A 20  ? 0.1067 0.0689 0.0575 -0.0036 0.0039  0.0006  20  VAL A N   
154  C CA  . VAL A 20  ? 0.0794 0.0764 0.0691 0.0053  -0.0074 0.0004  20  VAL A CA  
155  C C   . VAL A 20  ? 0.0873 0.0758 0.0488 0.0000  -0.0128 -0.0023 20  VAL A C   
156  O O   . VAL A 20  ? 0.1028 0.0825 0.0691 0.0072  -0.0002 0.0150  20  VAL A O   
157  C CB  . VAL A 20  ? 0.1000 0.0883 0.0889 0.0060  0.0227  -0.0200 20  VAL A CB  
158  C CG1 . VAL A 20  ? 0.1606 0.0831 0.1373 0.0148  0.0047  -0.0139 20  VAL A CG1 
159  C CG2 . VAL A 20  ? 0.0954 0.1134 0.0914 0.0203  0.0105  -0.0018 20  VAL A CG2 
160  N N   . ILE A 21  ? 0.0823 0.0632 0.0713 0.0005  0.0000  0.0102  21  ILE A N   
161  C CA  . ILE A 21  ? 0.0842 0.0511 0.0620 0.0027  0.0016  -0.0007 21  ILE A CA  
162  C C   . ILE A 21  ? 0.0867 0.0637 0.0599 0.0020  -0.0065 0.0088  21  ILE A C   
163  O O   . ILE A 21  ? 0.0904 0.0763 0.0768 0.0006  0.0051  0.0103  21  ILE A O   
164  C CB  . ILE A 21  ? 0.0826 0.0548 0.0585 0.0038  -0.0058 0.0053  21  ILE A CB  
165  C CG1 . ILE A 21  ? 0.1169 0.0805 0.0625 0.0099  -0.0105 -0.0005 21  ILE A CG1 
166  C CG2 . ILE A 21  ? 0.0937 0.0744 0.0795 0.0052  0.0063  0.0016  21  ILE A CG2 
167  C CD1 . ILE A 21  ? 0.1094 0.0938 0.0645 0.0147  -0.0150 0.0063  21  ILE A CD1 
168  N N   . PRO A 22  ? 0.0943 0.0685 0.0579 0.0050  -0.0043 -0.0015 22  PRO A N   
169  C CA  . PRO A 22  ? 0.0937 0.0728 0.0648 0.0102  0.0017  0.0030  22  PRO A CA  
170  C C   . PRO A 22  ? 0.0968 0.0644 0.0541 0.0060  0.0001  -0.0084 22  PRO A C   
171  O O   . PRO A 22  ? 0.1063 0.0715 0.0584 0.0190  0.0053  0.0056  22  PRO A O   
172  C CB  . PRO A 22  ? 0.1220 0.0720 0.0672 0.0220  0.0055  -0.0109 22  PRO A CB  
173  C CG  . PRO A 22  ? 0.1046 0.0711 0.0702 0.0110  0.0111  0.0017  22  PRO A CG  
174  C CD  . PRO A 22  ? 0.0855 0.0644 0.0718 0.0111  -0.0049 0.0027  22  PRO A CD  
175  N N   . VAL A 23  ? 0.0917 0.0654 0.0653 0.0049  0.0032  0.0015  23  VAL A N   
176  C CA  . VAL A 23  ? 0.0971 0.0643 0.0560 0.0119  -0.0079 0.0000  23  VAL A CA  
177  C C   . VAL A 23  ? 0.0984 0.0691 0.0548 0.0087  -0.0051 0.0078  23  VAL A C   
178  O O   . VAL A 23  ? 0.0957 0.0751 0.0674 0.0063  -0.0042 0.0033  23  VAL A O   
179  C CB  . VAL A 23  ? 0.0909 0.0754 0.0527 0.0049  -0.0105 -0.0053 23  VAL A CB  
180  C CG1 . VAL A 23  ? 0.1022 0.0838 0.0760 0.0133  -0.0102 -0.0030 23  VAL A CG1 
181  C CG2 . VAL A 23  ? 0.1044 0.0819 0.0686 0.0030  -0.0114 -0.0109 23  VAL A CG2 
182  N N   . ASP A 24  ? 0.0912 0.0591 0.0612 0.0060  -0.0022 0.0049  24  ASP A N   
183  C CA  . ASP A 24  ? 0.0913 0.0593 0.0660 0.0130  -0.0010 0.0047  24  ASP A CA  
184  C C   . ASP A 24  ? 0.0980 0.0539 0.0629 0.0159  0.0102  -0.0043 24  ASP A C   
185  O O   . ASP A 24  ? 0.1018 0.0613 0.0797 0.0119  0.0124  0.0080  24  ASP A O   
186  C CB  . ASP A 24  ? 0.0893 0.0648 0.0647 0.0079  0.0074  0.0043  24  ASP A CB  
187  C CG  . ASP A 24  ? 0.0873 0.0736 0.0653 0.0078  0.0024  0.0078  24  ASP A CG  
188  O OD1 . ASP A 24  ? 0.1094 0.0865 0.0620 -0.0083 0.0086  -0.0073 24  ASP A OD1 
189  O OD2 . ASP A 24  ? 0.1131 0.0847 0.0572 0.0032  0.0208  -0.0035 24  ASP A OD2 
190  N N   . VAL A 25  ? 0.0895 0.0491 0.0640 0.0021  0.0045  0.0071  25  VAL A N   
191  C CA  . VAL A 25  ? 0.0971 0.0565 0.0544 0.0039  0.0114  -0.0002 25  VAL A CA  
192  C C   . VAL A 25  ? 0.1063 0.0594 0.0555 0.0044  0.0003  0.0001  25  VAL A C   
193  O O   . VAL A 25  ? 0.0880 0.0738 0.0598 0.0121  0.0051  0.0048  25  VAL A O   
194  C CB  . VAL A 25  ? 0.0819 0.0605 0.0724 0.0002  0.0002  0.0045  25  VAL A CB  
195  C CG1 . VAL A 25  ? 0.0832 0.0895 0.0935 0.0021  0.0018  0.0182  25  VAL A CG1 
196  C CG2 . VAL A 25  ? 0.0933 0.0849 0.0830 -0.0035 -0.0098 -0.0007 25  VAL A CG2 
197  N N   . MET A 26  ? 0.1064 0.0652 0.0509 0.0099  -0.0017 -0.0020 26  MET A N   
198  C CA  . MET A 26  ? 0.1052 0.0629 0.0563 0.0136  -0.0096 0.0008  26  MET A CA  
199  C C   . MET A 26  ? 0.1125 0.0652 0.0636 0.0159  0.0015  -0.0067 26  MET A C   
200  O O   . MET A 26  ? 0.1042 0.0736 0.0573 0.0055  0.0024  0.0096  26  MET A O   
201  C CB  . MET A 26  ? 0.0947 0.0762 0.0633 0.0160  -0.0058 -0.0160 26  MET A CB  
202  C CG  . MET A 26  ? 0.1182 0.0646 0.0864 0.0150  -0.0015 -0.0134 26  MET A CG  
203  S SD  . MET A 26  ? 0.1270 0.0753 0.0788 0.0139  0.0015  -0.0118 26  MET A SD  
204  C CE  . MET A 26  ? 0.1137 0.0803 0.0795 0.0016  -0.0070 -0.0075 26  MET A CE  
205  N N   . ARG A 27  ? 0.0958 0.0637 0.0637 0.0108  0.0025  0.0116  27  ARG A N   
206  C CA  . ARG A 27  ? 0.0916 0.0658 0.0626 0.0118  0.0006  -0.0021 27  ARG A CA  
207  C C   . ARG A 27  ? 0.0848 0.0628 0.0584 0.0161  0.0092  -0.0009 27  ARG A C   
208  O O   . ARG A 27  ? 0.0979 0.0649 0.0814 0.0044  -0.0024 0.0115  27  ARG A O   
209  C CB  . ARG A 27  ? 0.0871 0.0731 0.0630 0.0074  -0.0049 0.0045  27  ARG A CB  
210  C CG  . ARG A 27  ? 0.0881 0.0784 0.0693 0.0107  -0.0030 -0.0093 27  ARG A CG  
211  C CD  . ARG A 27  ? 0.0915 0.0776 0.0740 0.0022  0.0025  -0.0044 27  ARG A CD  
212  N NE  . ARG A 27  ? 0.0943 0.0820 0.0663 0.0050  0.0006  -0.0107 27  ARG A NE  
213  C CZ  . ARG A 27  ? 0.0835 0.0896 0.0812 0.0097  0.0040  -0.0152 27  ARG A CZ  
214  N NH1 . ARG A 27  ? 0.0859 0.0868 0.0736 0.0101  0.0033  -0.0037 27  ARG A NH1 
215  N NH2 . ARG A 27  ? 0.1001 0.1162 0.0862 -0.0111 -0.0108 -0.0032 27  ARG A NH2 
216  N N   . ARG A 28  ? 0.0917 0.0654 0.0613 0.0097  -0.0017 -0.0020 28  ARG A N   
217  C CA  . ARG A 28  ? 0.0918 0.0624 0.0664 0.0132  0.0076  -0.0091 28  ARG A CA  
218  C C   . ARG A 28  ? 0.0948 0.0663 0.0631 0.0114  0.0043  -0.0031 28  ARG A C   
219  O O   . ARG A 28  ? 0.1071 0.0809 0.0710 -0.0025 0.0022  0.0058  28  ARG A O   
220  C CB  . ARG A 28  ? 0.0896 0.0665 0.0662 0.0036  0.0068  -0.0034 28  ARG A CB  
221  C CG  . ARG A 28  ? 0.1047 0.0573 0.0642 0.0065  0.0038  0.0036  28  ARG A CG  
222  C CD  . ARG A 28  ? 0.0856 0.0778 0.0660 0.0055  0.0008  -0.0075 28  ARG A CD  
223  N NE  . ARG A 28  ? 0.0969 0.0762 0.0663 -0.0004 0.0113  -0.0062 28  ARG A NE  
224  C CZ  . ARG A 28  ? 0.0930 0.0773 0.0616 0.0034  0.0049  0.0006  28  ARG A CZ  
225  N NH1 . ARG A 28  ? 0.1050 0.0715 0.0751 -0.0060 0.0223  -0.0087 28  ARG A NH1 
226  N NH2 . ARG A 28  ? 0.0962 0.0906 0.0547 -0.0123 0.0020  0.0035  28  ARG A NH2 
227  N N   . ALA A 29  ? 0.0976 0.0711 0.0649 0.0094  0.0159  0.0019  29  ALA A N   
228  C CA  . ALA A 29  ? 0.1009 0.0796 0.0614 0.0181  0.0118  0.0018  29  ALA A CA  
229  C C   . ALA A 29  ? 0.1053 0.1038 0.0714 0.0189  0.0089  0.0101  29  ALA A C   
230  O O   . ALA A 29  ? 0.1460 0.1234 0.0657 0.0166  0.0114  0.0044  29  ALA A O   
231  C CB  . ALA A 29  ? 0.1296 0.0839 0.0779 0.0238  0.0100  -0.0013 29  ALA A CB  
232  N N   . GLY A 30  ? 0.1086 0.0886 0.0748 0.0163  -0.0028 0.0057  30  GLY A N   
233  C CA  . GLY A 30  ? 0.1274 0.0812 0.1023 0.0163  -0.0263 0.0022  30  GLY A CA  
234  C C   . GLY A 30  ? 0.1382 0.0771 0.0614 0.0267  -0.0080 -0.0050 30  GLY A C   
235  O O   . GLY A 30  ? 0.1955 0.0937 0.0848 0.0254  -0.0376 0.0089  30  GLY A O   
236  N N   . ILE A 31  ? 0.1442 0.0738 0.0676 0.0194  -0.0068 0.0002  31  ILE A N   
237  C CA  . ILE A 31  ? 0.1366 0.0785 0.0531 0.0238  -0.0148 -0.0044 31  ILE A CA  
238  C C   . ILE A 31  ? 0.1297 0.0896 0.0618 0.0335  -0.0197 -0.0028 31  ILE A C   
239  O O   . ILE A 31  ? 0.1187 0.1224 0.0805 0.0190  -0.0090 -0.0228 31  ILE A O   
240  C CB  . ILE A 31  ? 0.1234 0.0777 0.0677 0.0211  -0.0023 -0.0030 31  ILE A CB  
241  C CG1 . ILE A 31  ? 0.1239 0.0894 0.0886 0.0166  -0.0005 -0.0047 31  ILE A CG1 
242  C CG2 . ILE A 31  ? 0.1311 0.0774 0.0878 0.0175  0.0022  -0.0044 31  ILE A CG2 
243  C CD1 . ILE A 31  ? 0.1291 0.0910 0.1087 0.0250  -0.0103 -0.0069 31  ILE A CD1 
244  N N   . LYS A 32  ? 0.1338 0.0984 0.0706 0.0310  -0.0157 0.0025  32  LYS A N   
245  C CA  . LYS A 32  ? 0.1294 0.0963 0.0933 0.0262  -0.0222 0.0022  32  LYS A CA  
246  C C   . LYS A 32  ? 0.1296 0.0951 0.0839 0.0252  -0.0264 -0.0074 32  LYS A C   
247  O O   . LYS A 32  ? 0.1562 0.0987 0.0859 0.0191  -0.0223 0.0045  32  LYS A O   
248  C CB  . LYS A 32  ? 0.1742 0.1270 0.1389 0.0033  -0.0719 0.0213  32  LYS A CB  
249  C CG  . LYS A 32  ? 0.3697 0.1900 0.2819 -0.0497 -0.1606 0.1258  32  LYS A CG  
250  C CD  . LYS A 32  ? 0.7707 0.2856 0.4664 -0.2138 -0.4374 0.2523  32  LYS A CD  
251  C CE  . LYS A 32  ? 0.7937 0.4328 0.7420 -0.3030 -0.6039 0.2582  32  LYS A CE  
252  N NZ  . LYS A 32  ? 0.9790 0.6180 0.9149 -0.2784 -0.7681 0.3274  32  LYS A NZ  
253  N N   . VAL A 33  ? 0.1444 0.0770 0.0924 0.0214  -0.0174 -0.0068 33  VAL A N   
254  C CA  . VAL A 33  ? 0.1199 0.0878 0.0805 0.0206  -0.0022 -0.0096 33  VAL A CA  
255  C C   . VAL A 33  ? 0.1129 0.0857 0.0770 0.0292  -0.0233 -0.0134 33  VAL A C   
256  O O   . VAL A 33  ? 0.1202 0.1145 0.0903 0.0342  -0.0155 -0.0244 33  VAL A O   
257  C CB  . VAL A 33  ? 0.1078 0.1037 0.0781 0.0291  -0.0044 -0.0165 33  VAL A CB  
258  C CG1 . VAL A 33  ? 0.1067 0.1170 0.0936 0.0173  -0.0285 -0.0079 33  VAL A CG1 
259  C CG2 . VAL A 33  ? 0.1116 0.1000 0.0937 0.0351  -0.0141 -0.0158 33  VAL A CG2 
260  N N   . THR A 34  ? 0.1006 0.0903 0.0899 0.0218  -0.0115 -0.0151 34  THR A N   
261  C CA  . THR A 34  ? 0.1050 0.1152 0.0968 0.0215  -0.0184 -0.0023 34  THR A CA  
262  C C   . THR A 34  ? 0.1038 0.1050 0.0870 0.0243  -0.0145 -0.0070 34  THR A C   
263  O O   . THR A 34  ? 0.1129 0.1118 0.1057 0.0246  -0.0093 -0.0060 34  THR A O   
264  C CB  . THR A 34  ? 0.1175 0.1530 0.1052 0.0122  -0.0398 0.0020  34  THR A CB  
265  O OG1 . THR A 34  ? 0.1538 0.1396 0.1135 0.0308  -0.0314 0.0157  34  THR A OG1 
266  C CG2 . THR A 34  ? 0.1191 0.1437 0.1467 0.0089  -0.0375 0.0123  34  THR A CG2 
267  N N   . VAL A 35  ? 0.1094 0.0885 0.0903 0.0223  -0.0177 -0.0057 35  VAL A N   
268  C CA  . VAL A 35  ? 0.0900 0.1090 0.0946 0.0109  -0.0115 -0.0009 35  VAL A CA  
269  C C   . VAL A 35  ? 0.0832 0.1050 0.1136 0.0139  -0.0165 -0.0079 35  VAL A C   
270  O O   . VAL A 35  ? 0.0893 0.1155 0.1179 0.0155  -0.0168 -0.0092 35  VAL A O   
271  C CB  . VAL A 35  ? 0.0875 0.1259 0.0954 0.0023  -0.0248 0.0002  35  VAL A CB  
272  C CG1 . VAL A 35  ? 0.1327 0.1509 0.1022 -0.0060 -0.0320 0.0183  35  VAL A CG1 
273  C CG2 . VAL A 35  ? 0.1201 0.1436 0.1131 -0.0208 -0.0469 0.0018  35  VAL A CG2 
274  N N   . ALA A 36  ? 0.0726 0.1149 0.1045 0.0089  -0.0178 -0.0078 36  ALA A N   
275  C CA  . ALA A 36  ? 0.0864 0.1138 0.1051 0.0066  -0.0148 -0.0077 36  ALA A CA  
276  C C   . ALA A 36  ? 0.0891 0.1036 0.0988 0.0039  -0.0115 -0.0214 36  ALA A C   
277  O O   . ALA A 36  ? 0.0884 0.1156 0.1185 0.0136  0.0000  0.0062  36  ALA A O   
278  C CB  . ALA A 36  ? 0.1554 0.1291 0.0943 0.0172  -0.0351 -0.0077 36  ALA A CB  
279  N N   . GLY A 37  ? 0.0857 0.1276 0.1180 0.0080  -0.0071 -0.0026 37  GLY A N   
280  C CA  . GLY A 37  ? 0.0998 0.1387 0.1348 -0.0101 -0.0162 0.0067  37  GLY A CA  
281  C C   . GLY A 37  ? 0.1448 0.1423 0.1208 -0.0039 -0.0039 0.0092  37  GLY A C   
282  O O   . GLY A 37  ? 0.1258 0.1452 0.2085 -0.0078 -0.0368 -0.0373 37  GLY A O   
283  N N   . LEU A 38  ? 0.2433 0.1382 0.1581 0.0278  -0.0343 -0.0023 38  LEU A N   
284  C CA  . LEU A 38  ? 0.2083 0.1522 0.1858 0.0108  0.0016  0.0023  38  LEU A CA  
285  C C   . LEU A 38  ? 0.1883 0.2115 0.1849 0.0003  -0.0180 -0.0379 38  LEU A C   
286  O O   . LEU A 38  ? 0.3077 0.2734 0.2373 -0.0204 -0.0900 -0.0364 38  LEU A O   
287  C CB  . LEU A 38  ? 0.1953 0.1436 0.2038 0.0156  0.0105  0.0180  38  LEU A CB  
288  C CG  . LEU A 38  ? 0.1753 0.1654 0.1561 -0.0019 -0.0179 0.0006  38  LEU A CG  
289  C CD1 . LEU A 38  ? 0.2377 0.2757 0.1615 0.0091  0.0133  0.0104  38  LEU A CD1 
290  C CD2 . LEU A 38  ? 0.2290 0.1364 0.1735 0.0010  -0.0378 -0.0156 38  LEU A CD2 
291  N N   . ALA A 39  ? 0.2087 0.2018 0.2056 -0.0457 -0.0008 0.0085  39  ALA A N   
292  C CA  . ALA A 39  ? 0.1818 0.3369 0.2306 -0.0418 -0.0195 0.0396  39  ALA A CA  
293  C C   . ALA A 39  ? 0.2128 0.3379 0.1742 -0.0178 -0.0098 0.0064  39  ALA A C   
294  O O   . ALA A 39  ? 0.1875 0.4762 0.6383 -0.0105 -0.0022 0.2165  39  ALA A O   
295  C CB  . ALA A 39  ? 0.1996 0.3639 0.2401 -0.0647 -0.0183 0.0740  39  ALA A CB  
296  N N   . GLY A 40  ? 0.2082 0.3040 0.2641 0.0141  0.0335  -0.0122 40  GLY A N   
297  C CA  . GLY A 40  ? 0.2898 0.3729 0.2604 0.1106  0.0043  -0.0728 40  GLY A CA  
298  C C   . GLY A 40  ? 0.2858 0.3999 0.2582 0.1329  0.0169  -0.1456 40  GLY A C   
299  O O   . GLY A 40  ? 0.2286 0.2349 0.5254 0.0710  0.1393  0.0510  40  GLY A O   
300  N N   . LYS A 41  ? 0.2597 0.3627 0.2493 0.1143  -0.0630 -0.0442 41  LYS A N   
301  C CA  . LYS A 41  ? 0.2506 0.3040 0.2082 0.1219  0.0447  0.0341  41  LYS A CA  
302  C C   . LYS A 41  ? 0.1254 0.2653 0.2260 -0.0132 -0.0304 0.0245  41  LYS A C   
303  O O   . LYS A 41  ? 0.1859 0.2361 0.2892 -0.0315 -0.0204 0.0379  41  LYS A O   
304  C CB  . LYS A 41  ? 0.6123 0.4994 0.3546 0.3282  -0.2012 0.0018  41  LYS A CB  
305  C CG  . LYS A 41  ? 0.5888 0.9262 0.3369 0.3762  -0.1496 -0.0002 41  LYS A CG  
306  C CD  . LYS A 41  ? 0.6399 1.2053 0.4405 0.3122  -0.2586 0.0895  41  LYS A CD  
307  C CE  . LYS A 41  ? 0.6028 1.3721 0.2294 0.4322  -0.1512 0.0504  41  LYS A CE  
308  N NZ  . LYS A 41  ? 0.7867 1.6738 0.6655 0.3413  -0.4602 0.2090  41  LYS A NZ  
309  N N   . ASP A 42  ? 0.1448 0.2172 0.1717 0.0049  -0.0310 -0.0197 42  ASP A N   
310  C CA  . ASP A 42  ? 0.1168 0.2241 0.1802 -0.0066 -0.0304 -0.0331 42  ASP A CA  
311  C C   . ASP A 42  ? 0.0974 0.1672 0.1604 0.0093  -0.0201 -0.0042 42  ASP A C   
312  O O   . ASP A 42  ? 0.1149 0.1658 0.1494 0.0023  -0.0087 -0.0132 42  ASP A O   
313  C CB  . ASP A 42  ? 0.2325 0.3993 0.2460 -0.1693 -0.0678 0.0698  42  ASP A CB  
314  C CG  . ASP A 42  ? 0.2853 0.6908 0.5183 -0.3029 -0.1596 0.2192  42  ASP A CG  
315  O OD1 . ASP A 42  ? 0.2233 0.9042 0.5874 -0.2146 -0.1514 0.3289  42  ASP A OD1 
316  O OD2 . ASP A 42  ? 0.5530 0.7826 0.6998 -0.5088 -0.3221 0.2722  42  ASP A OD2 
317  N N   A PRO A 43  ? 0.0872 0.2035 0.1384 0.0035  -0.0058 0.0042  43  PRO A N   
318  N N   B PRO A 43  ? 0.0894 0.2049 0.1528 0.0178  -0.0144 -0.0063 43  PRO A N   
319  C CA  A PRO A 43  ? 0.0988 0.1679 0.1534 0.0204  -0.0207 -0.0055 43  PRO A CA  
320  C CA  B PRO A 43  ? 0.0979 0.1665 0.1577 0.0197  -0.0206 -0.0117 43  PRO A CA  
321  C C   A PRO A 43  ? 0.0900 0.1343 0.1342 -0.0144 0.0019  0.0015  43  PRO A C   
322  C C   B PRO A 43  ? 0.0901 0.1312 0.1278 -0.0177 -0.0179 0.0053  43  PRO A C   
323  O O   A PRO A 43  ? 0.1015 0.1695 0.2518 -0.0374 0.0426  0.0255  43  PRO A O   
324  O O   B PRO A 43  ? 0.1076 0.1651 0.1985 -0.0523 -0.0559 0.0481  43  PRO A O   
325  C CB  A PRO A 43  ? 0.1362 0.1911 0.1738 0.0539  -0.0394 -0.0305 43  PRO A CB  
326  C CB  B PRO A 43  ? 0.1108 0.2251 0.1838 0.0219  -0.0176 -0.0506 43  PRO A CB  
327  C CG  A PRO A 43  ? 0.1179 0.2354 0.1810 0.0582  -0.0323 -0.0308 43  PRO A CG  
328  C CG  B PRO A 43  ? 0.1397 0.2651 0.1609 -0.0183 0.0044  -0.0168 43  PRO A CG  
329  C CD  A PRO A 43  ? 0.0998 0.2748 0.1871 0.0155  -0.0018 -0.0370 43  PRO A CD  
330  C CD  B PRO A 43  ? 0.0992 0.2614 0.1793 0.0179  -0.0064 -0.0230 43  PRO A CD  
331  N N   . VAL A 44  ? 0.0866 0.0928 0.1264 -0.0111 -0.0050 -0.0006 44  VAL A N   
332  C CA  . VAL A 44  ? 0.0998 0.0838 0.1031 -0.0184 -0.0076 -0.0015 44  VAL A CA  
333  C C   . VAL A 44  ? 0.0955 0.0826 0.1115 -0.0110 -0.0134 -0.0129 44  VAL A C   
334  O O   . VAL A 44  ? 0.0979 0.0917 0.1139 -0.0169 -0.0115 -0.0131 44  VAL A O   
335  C CB  . VAL A 44  ? 0.0843 0.1123 0.1140 -0.0007 -0.0099 -0.0083 44  VAL A CB  
336  C CG1 . VAL A 44  ? 0.1208 0.1043 0.1340 0.0125  0.0082  0.0246  44  VAL A CG1 
337  C CG2 . VAL A 44  ? 0.1164 0.1383 0.1092 -0.0064 -0.0157 0.0008  44  VAL A CG2 
338  N N   . GLN A 45  ? 0.0844 0.0918 0.1027 -0.0098 -0.0132 -0.0106 45  GLN A N   
339  C CA  . GLN A 45  ? 0.0831 0.0963 0.1044 -0.0092 -0.0054 -0.0120 45  GLN A CA  
340  C C   . GLN A 45  ? 0.0898 0.0594 0.0824 -0.0099 -0.0087 0.0013  45  GLN A C   
341  O O   . GLN A 45  ? 0.0922 0.0773 0.1078 -0.0150 -0.0103 -0.0037 45  GLN A O   
342  C CB  . GLN A 45  ? 0.1059 0.1181 0.1173 -0.0292 -0.0066 -0.0010 45  GLN A CB  
343  C CG  . GLN A 45  ? 0.1134 0.1491 0.1108 -0.0215 -0.0019 -0.0038 45  GLN A CG  
344  C CD  . GLN A 45  ? 0.1291 0.2523 0.1376 -0.0553 0.0188  0.0434  45  GLN A CD  
345  O OE1 . GLN A 45  ? 0.2385 0.2908 0.2085 -0.1432 -0.0218 0.0792  45  GLN A OE1 
346  N NE2 . GLN A 45  ? 0.2037 0.3656 0.1616 -0.1093 0.0014  0.0842  45  GLN A NE2 
347  N N   . CYS A 46  ? 0.0804 0.0743 0.0874 -0.0008 -0.0051 -0.0150 46  CYS A N   
348  C CA  . CYS A 46  ? 0.0838 0.0821 0.0810 0.0011  -0.0010 -0.0082 46  CYS A CA  
349  C C   . CYS A 46  ? 0.0896 0.0687 0.0821 -0.0022 -0.0028 -0.0115 46  CYS A C   
350  O O   . CYS A 46  ? 0.0862 0.0910 0.0832 -0.0173 0.0100  -0.0102 46  CYS A O   
351  C CB  . CYS A 46  ? 0.0837 0.0827 0.0644 -0.0058 -0.0119 -0.0111 46  CYS A CB  
352  S SG  . CYS A 46  ? 0.1147 0.1031 0.0844 -0.0077 -0.0125 0.0074  46  CYS A SG  
353  N N   . SER A 47  ? 0.0965 0.0814 0.0678 0.0042  0.0024  -0.0029 47  SER A N   
354  C CA  . SER A 47  ? 0.0944 0.0790 0.0722 -0.0065 -0.0053 -0.0020 47  SER A CA  
355  C C   . SER A 47  ? 0.1180 0.0688 0.0652 0.0015  0.0119  0.0011  47  SER A C   
356  O O   . SER A 47  ? 0.1990 0.0764 0.0698 -0.0169 -0.0061 0.0135  47  SER A O   
357  C CB  . SER A 47  ? 0.0898 0.1016 0.0610 -0.0001 -0.0102 -0.0157 47  SER A CB  
358  O OG  . SER A 47  ? 0.0852 0.0945 0.0765 -0.0077 -0.0015 -0.0102 47  SER A OG  
359  N N   . ARG A 48  ? 0.0945 0.0711 0.0618 -0.0129 -0.0024 0.0055  48  ARG A N   
360  C CA  . ARG A 48  ? 0.0992 0.0820 0.0553 -0.0085 -0.0012 0.0036  48  ARG A CA  
361  C C   . ARG A 48  ? 0.1018 0.0820 0.0554 -0.0046 -0.0130 0.0031  48  ARG A C   
362  O O   . ARG A 48  ? 0.1065 0.0884 0.0728 -0.0054 -0.0046 -0.0099 48  ARG A O   
363  C CB  . ARG A 48  ? 0.0988 0.0933 0.0629 -0.0042 -0.0081 -0.0096 48  ARG A CB  
364  C CG  . ARG A 48  ? 0.1100 0.0946 0.0770 -0.0009 -0.0195 -0.0115 48  ARG A CG  
365  C CD  . ARG A 48  ? 0.0907 0.0969 0.0723 0.0061  -0.0125 -0.0014 48  ARG A CD  
366  N NE  . ARG A 48  ? 0.1004 0.0968 0.0803 0.0108  -0.0245 -0.0078 48  ARG A NE  
367  C CZ  . ARG A 48  ? 0.0706 0.0790 0.0729 -0.0125 -0.0053 0.0032  48  ARG A CZ  
368  N NH1 . ARG A 48  ? 0.0938 0.0905 0.0767 0.0013  -0.0084 -0.0050 48  ARG A NH1 
369  N NH2 . ARG A 48  ? 0.1069 0.0970 0.0776 0.0047  -0.0070 -0.0046 48  ARG A NH2 
370  N N   . ASP A 49  ? 0.0926 0.0847 0.0637 -0.0063 -0.0010 -0.0080 49  ASP A N   
371  C CA  . ASP A 49  ? 0.1039 0.0870 0.0772 0.0057  0.0015  0.0000  49  ASP A CA  
372  C C   . ASP A 49  ? 0.0872 0.0783 0.0733 -0.0069 0.0014  -0.0140 49  ASP A C   
373  O O   . ASP A 49  ? 0.0833 0.1035 0.0934 0.0051  0.0135  0.0004  49  ASP A O   
374  C CB  . ASP A 49  ? 0.1238 0.0859 0.0763 -0.0071 0.0107  -0.0104 49  ASP A CB  
375  C CG  . ASP A 49  ? 0.1381 0.1122 0.0944 -0.0295 0.0140  0.0098  49  ASP A CG  
376  O OD1 . ASP A 49  ? 0.1570 0.0966 0.1321 -0.0383 -0.0002 0.0019  49  ASP A OD1 
377  O OD2 . ASP A 49  ? 0.2292 0.1651 0.1174 -0.0773 -0.0156 0.0517  49  ASP A OD2 
378  N N   . VAL A 50  ? 0.0829 0.0844 0.0727 0.0074  0.0053  -0.0061 50  VAL A N   
379  C CA  . VAL A 50  ? 0.0892 0.0810 0.0733 0.0084  0.0023  -0.0033 50  VAL A CA  
380  C C   . VAL A 50  ? 0.0872 0.0634 0.0874 -0.0011 0.0002  0.0055  50  VAL A C   
381  O O   . VAL A 50  ? 0.0996 0.0784 0.1023 -0.0029 -0.0047 -0.0134 50  VAL A O   
382  C CB  . VAL A 50  ? 0.0770 0.0834 0.0858 0.0048  0.0050  -0.0130 50  VAL A CB  
383  C CG1 . VAL A 50  ? 0.1021 0.0909 0.1133 0.0142  0.0199  0.0042  50  VAL A CG1 
384  C CG2 . VAL A 50  ? 0.0982 0.1091 0.0910 0.0011  -0.0006 -0.0220 50  VAL A CG2 
385  N N   . VAL A 51  ? 0.0919 0.0786 0.0821 0.0049  -0.0034 -0.0055 51  VAL A N   
386  C CA  . VAL A 51  ? 0.0878 0.0974 0.0764 0.0045  0.0006  -0.0018 51  VAL A CA  
387  C C   . VAL A 51  ? 0.0793 0.0899 0.0854 0.0044  -0.0078 -0.0034 51  VAL A C   
388  O O   . VAL A 51  ? 0.1185 0.0860 0.0929 0.0062  0.0007  -0.0055 51  VAL A O   
389  C CB  . VAL A 51  ? 0.0913 0.1146 0.0904 -0.0108 0.0028  -0.0092 51  VAL A CB  
390  C CG1 . VAL A 51  ? 0.0913 0.1500 0.1235 -0.0161 -0.0052 0.0101  51  VAL A CG1 
391  C CG2 . VAL A 51  ? 0.1043 0.1176 0.1298 -0.0079 0.0112  0.0159  51  VAL A CG2 
392  N N   . ILE A 52  ? 0.1020 0.0828 0.0777 0.0024  -0.0052 0.0046  52  ILE A N   
393  C CA  . ILE A 52  ? 0.1030 0.1019 0.0742 0.0000  -0.0045 -0.0013 52  ILE A CA  
394  C C   . ILE A 52  ? 0.1054 0.0925 0.0827 -0.0048 -0.0138 0.0010  52  ILE A C   
395  O O   . ILE A 52  ? 0.1443 0.0944 0.1039 -0.0116 -0.0193 -0.0064 52  ILE A O   
396  C CB  . ILE A 52  ? 0.1007 0.1023 0.1036 -0.0037 0.0088  0.0204  52  ILE A CB  
397  C CG1 . ILE A 52  ? 0.1004 0.1483 0.1086 -0.0264 0.0082  0.0142  52  ILE A CG1 
398  C CG2 . ILE A 52  ? 0.1465 0.1043 0.0974 -0.0104 0.0169  0.0157  52  ILE A CG2 
399  C CD1 . ILE A 52  ? 0.1073 0.1813 0.1358 -0.0253 0.0116  0.0206  52  ILE A CD1 
400  N N   A CYS A 53  ? 0.0881 0.0932 0.1073 -0.0057 -0.0129 -0.0053 53  CYS A N   
401  N N   B CYS A 53  ? 0.1533 0.0949 0.0718 -0.0178 -0.0357 0.0169  53  CYS A N   
402  C CA  A CYS A 53  ? 0.0862 0.1172 0.1132 0.0003  -0.0143 0.0087  53  CYS A CA  
403  C CA  B CYS A 53  ? 0.1296 0.0977 0.1003 -0.0165 -0.0311 0.0234  53  CYS A CA  
404  C C   A CYS A 53  ? 0.0939 0.1318 0.1122 -0.0242 -0.0212 0.0021  53  CYS A C   
405  C C   B CYS A 53  ? 0.0669 0.1004 0.0942 0.0287  -0.0569 0.0224  53  CYS A C   
406  O O   A CYS A 53  ? 0.0851 0.1284 0.1590 -0.0202 -0.0006 0.0187  53  CYS A O   
407  O O   B CYS A 53  ? 0.1723 0.1119 0.0503 0.0000  -0.0423 0.0185  53  CYS A O   
408  C CB  A CYS A 53  ? 0.0963 0.1374 0.1524 0.0099  -0.0041 0.0232  53  CYS A CB  
409  C CB  B CYS A 53  ? 0.1303 0.1309 0.1203 -0.0081 0.0191  0.0298  53  CYS A CB  
410  S SG  A CYS A 53  ? 0.2039 0.2333 0.1879 0.0357  0.0701  -0.0055 53  CYS A SG  
411  S SG  B CYS A 53  ? 0.1268 0.2752 0.4260 0.0174  -0.0428 -0.0002 53  CYS A SG  
412  N N   . PRO A 54  ? 0.0862 0.1248 0.1106 -0.0060 -0.0273 0.0068  54  PRO A N   
413  C CA  . PRO A 54  ? 0.0993 0.1277 0.1131 0.0146  -0.0121 0.0117  54  PRO A CA  
414  C C   . PRO A 54  ? 0.1013 0.1112 0.1063 0.0265  -0.0091 -0.0040 54  PRO A C   
415  O O   . PRO A 54  ? 0.0986 0.1519 0.1261 0.0190  -0.0119 0.0145  54  PRO A O   
416  C CB  . PRO A 54  ? 0.2238 0.1147 0.1226 0.0235  -0.0159 0.0077  54  PRO A CB  
417  C CG  . PRO A 54  ? 0.5186 0.1979 0.1577 -0.1708 0.0571  -0.0448 54  PRO A CG  
418  C CD  . PRO A 54  ? 0.1417 0.1221 0.1389 -0.0222 -0.0058 -0.0007 54  PRO A CD  
419  N N   . ASP A 55  ? 0.0848 0.1214 0.1109 0.0232  -0.0265 0.0124  55  ASP A N   
420  C CA  . ASP A 55  ? 0.0902 0.1202 0.1264 0.0175  -0.0294 0.0176  55  ASP A CA  
421  C C   . ASP A 55  ? 0.0995 0.1424 0.1166 0.0205  -0.0394 0.0036  55  ASP A C   
422  O O   . ASP A 55  ? 0.1147 0.1624 0.1501 0.0344  -0.0520 -0.0028 55  ASP A O   
423  C CB  . ASP A 55  ? 0.1088 0.1270 0.0956 0.0114  -0.0196 -0.0039 55  ASP A CB  
424  C CG  . ASP A 55  ? 0.1003 0.1087 0.1028 0.0209  -0.0178 -0.0082 55  ASP A CG  
425  O OD1 . ASP A 55  ? 0.1043 0.1722 0.1496 0.0140  -0.0116 -0.0615 55  ASP A OD1 
426  O OD2 . ASP A 55  ? 0.0992 0.1110 0.1332 0.0041  -0.0051 -0.0283 55  ASP A OD2 
427  N N   . ALA A 56  ? 0.1076 0.1321 0.1219 0.0136  -0.0412 0.0090  56  ALA A N   
428  C CA  . ALA A 56  ? 0.1612 0.1362 0.1433 0.0204  -0.0720 -0.0042 56  ALA A CA  
429  C C   . ALA A 56  ? 0.1217 0.1367 0.1811 0.0128  -0.0565 -0.0061 56  ALA A C   
430  O O   . ALA A 56  ? 0.1104 0.1350 0.1663 0.0217  -0.0436 -0.0004 56  ALA A O   
431  C CB  . ALA A 56  ? 0.1825 0.1803 0.1424 -0.0290 -0.0768 -0.0031 56  ALA A CB  
432  N N   . SER A 57  ? 0.1207 0.1515 0.1880 0.0047  -0.0458 -0.0309 57  SER A N   
433  C CA  . SER A 57  ? 0.1133 0.1529 0.2192 0.0024  -0.0277 -0.0367 57  SER A CA  
434  C C   . SER A 57  ? 0.1021 0.1394 0.2129 -0.0121 -0.0315 -0.0303 57  SER A C   
435  O O   . SER A 57  ? 0.1310 0.1500 0.1933 -0.0065 -0.0505 -0.0261 57  SER A O   
436  C CB  . SER A 57  ? 0.1187 0.1837 0.2457 -0.0244 -0.0051 -0.0384 57  SER A CB  
437  O OG  . SER A 57  ? 0.1437 0.2055 0.2869 -0.0110 -0.0801 -0.0304 57  SER A OG  
438  N N   . LEU A 58  ? 0.1069 0.1591 0.2021 0.0075  -0.0285 -0.0118 58  LEU A N   
439  C CA  . LEU A 58  ? 0.1248 0.1534 0.1834 0.0101  -0.0353 -0.0258 58  LEU A CA  
440  C C   . LEU A 58  ? 0.1349 0.2152 0.2253 0.0448  -0.0707 -0.0600 58  LEU A C   
441  O O   . LEU A 58  ? 0.1867 0.2868 0.1863 0.0515  -0.0849 -0.0653 58  LEU A O   
442  C CB  . LEU A 58  ? 0.1264 0.1459 0.2143 0.0053  -0.0304 -0.0177 58  LEU A CB  
443  C CG  . LEU A 58  ? 0.1268 0.1279 0.2023 -0.0007 -0.0374 -0.0193 58  LEU A CG  
444  C CD1 . LEU A 58  ? 0.1518 0.1199 0.2437 -0.0107 -0.0061 -0.0260 58  LEU A CD1 
445  C CD2 . LEU A 58  ? 0.1545 0.1167 0.2265 -0.0018 -0.0395 -0.0250 58  LEU A CD2 
446  N N   A GLU A 59  ? 0.1402 0.2342 0.3306 0.0275  -0.0743 -0.1260 59  GLU A N   
447  N N   B GLU A 59  ? 0.1379 0.2507 0.3395 0.0279  -0.0765 -0.1257 59  GLU A N   
448  C CA  A GLU A 59  ? 0.1831 0.2784 0.3857 0.0208  -0.1230 -0.1558 59  GLU A CA  
449  C CA  B GLU A 59  ? 0.1941 0.2820 0.3859 0.0003  -0.1283 -0.1578 59  GLU A CA  
450  C C   A GLU A 59  ? 0.2283 0.3156 0.3112 0.0277  -0.1321 -0.1485 59  GLU A C   
451  C C   B GLU A 59  ? 0.2008 0.3165 0.3224 0.0400  -0.1209 -0.1427 59  GLU A C   
452  O O   A GLU A 59  ? 0.2830 0.4258 0.3057 0.1140  -0.1393 -0.1662 59  GLU A O   
453  O O   B GLU A 59  ? 0.2107 0.3704 0.2951 0.1216  -0.1694 -0.1715 59  GLU A O   
454  C CB  A GLU A 59  ? 0.2301 0.4187 0.5864 -0.1053 -0.1487 -0.1129 59  GLU A CB  
455  C CB  B GLU A 59  ? 0.2337 0.3957 0.4876 -0.0749 -0.1333 -0.1608 59  GLU A CB  
456  C CG  A GLU A 59  ? 0.2561 0.5124 0.6115 -0.0943 -0.1902 -0.1243 59  GLU A CG  
457  C CG  B GLU A 59  ? 0.3992 0.3988 0.5848 -0.1282 0.0392  -0.1966 59  GLU A CG  
458  C CD  A GLU A 59  ? 0.2789 0.7024 0.6963 -0.1861 -0.2081 -0.0864 59  GLU A CD  
459  C CD  B GLU A 59  ? 0.3697 0.4223 0.7029 -0.0808 0.0367  -0.1554 59  GLU A CD  
460  O OE1 A GLU A 59  ? 0.4528 0.9474 0.7657 -0.3705 -0.3583 0.0715  59  GLU A OE1 
461  O OE1 B GLU A 59  ? 0.1384 0.5545 0.6044 0.0951  -0.1957 -0.1697 59  GLU A OE1 
462  O OE2 A GLU A 59  ? 0.2702 0.6998 0.8132 0.0044  -0.1167 -0.0033 59  GLU A OE2 
463  O OE2 B GLU A 59  ? 0.5219 0.2839 0.9500 -0.2213 0.2770  -0.1867 59  GLU A OE2 
464  N N   A ASP A 60  ? 0.1879 0.2914 0.2847 0.0599  -0.1246 -0.1089 60  ASP A N   
465  N N   B ASP A 60  ? 0.1650 0.3037 0.2607 0.0669  -0.1273 -0.0990 60  ASP A N   
466  C CA  A ASP A 60  ? 0.1725 0.3294 0.2494 0.1000  -0.1182 -0.0889 60  ASP A CA  
467  C CA  B ASP A 60  ? 0.1756 0.3214 0.2147 0.0844  -0.1329 -0.0904 60  ASP A CA  
468  C C   A ASP A 60  ? 0.1868 0.3583 0.2115 0.1052  -0.1058 -0.0378 60  ASP A C   
469  C C   B ASP A 60  ? 0.2016 0.3645 0.2090 0.0833  -0.1191 -0.0375 60  ASP A C   
470  O O   . ASP A 60  ? 0.2450 0.4981 0.2381 0.1176  -0.1218 0.0367  60  ASP A O   
471  C CB  A ASP A 60  ? 0.1538 0.3297 0.2143 0.1117  -0.1431 -0.0816 60  ASP A CB  
472  C CB  B ASP A 60  ? 0.2073 0.2913 0.1959 0.0553  -0.1299 -0.0794 60  ASP A CB  
473  C CG  A ASP A 60  ? 0.1938 0.3600 0.1877 0.0661  -0.0994 -0.0954 60  ASP A CG  
474  C CG  B ASP A 60  ? 0.2219 0.3259 0.2004 0.0780  -0.0815 -0.0774 60  ASP A CG  
475  O OD1 A ASP A 60  ? 0.1559 0.4316 0.3425 0.0886  -0.1049 -0.2084 60  ASP A OD1 
476  O OD1 B ASP A 60  ? 0.1584 0.3429 0.3237 0.0749  -0.0654 -0.1149 60  ASP A OD1 
477  O OD2 A ASP A 60  ? 0.1665 0.4067 0.2670 0.1177  -0.1176 -0.1484 60  ASP A OD2 
478  O OD2 B ASP A 60  ? 0.3135 0.2985 0.3174 0.0966  -0.0644 -0.1024 60  ASP A OD2 
479  N N   . ALA A 61  ? 0.1651 0.2518 0.1773 0.0817  -0.0788 -0.0454 61  ALA A N   
480  C CA  . ALA A 61  ? 0.1880 0.2547 0.1518 0.0629  -0.0741 0.0042  61  ALA A CA  
481  C C   . ALA A 61  ? 0.1506 0.3275 0.1567 0.0202  -0.0813 -0.0315 61  ALA A C   
482  O O   . ALA A 61  ? 0.1827 0.3501 0.1772 0.0441  -0.0540 -0.0013 61  ALA A O   
483  C CB  . ALA A 61  ? 0.1787 0.2316 0.1349 -0.0259 -0.0684 0.0382  61  ALA A CB  
484  N N   . LYS A 62  ? 0.1436 0.3550 0.2072 -0.0058 -0.0473 -0.0863 62  LYS A N   
485  C CA  . LYS A 62  ? 0.2233 0.4136 0.2204 0.0906  -0.0635 -0.1021 62  LYS A CA  
486  C C   . LYS A 62  ? 0.2036 0.5972 0.2120 0.0586  -0.0682 -0.0457 62  LYS A C   
487  O O   . LYS A 62  ? 0.2448 0.6778 0.2212 0.0289  -0.0471 -0.0719 62  LYS A O   
488  C CB  . LYS A 62  ? 0.2826 0.4162 0.3439 0.0821  0.0480  -0.1640 62  LYS A CB  
489  C CG  . LYS A 62  ? 0.2930 0.4608 0.3272 0.1239  0.0078  -0.1705 62  LYS A CG  
490  C CD  . LYS A 62  ? 0.3733 0.4510 0.4584 0.0922  0.0532  -0.2199 62  LYS A CD  
491  C CE  . LYS A 62  ? 0.4477 0.4552 0.3107 0.0595  0.0548  -0.1975 62  LYS A CE  
492  N NZ  . LYS A 62  ? 0.5056 0.7688 0.4663 0.1392  -0.1401 -0.3141 62  LYS A NZ  
493  N N   . LYS A 63  ? 0.2470 0.4870 0.1711 0.0772  -0.0704 -0.0537 63  LYS A N   
494  C CA  . LYS A 63  ? 0.2792 0.5625 0.1926 0.1222  -0.0703 -0.0464 63  LYS A CA  
495  C C   . LYS A 63  ? 0.3154 0.6444 0.1959 0.0793  -0.1207 0.0572  63  LYS A C   
496  O O   . LYS A 63  ? 0.3417 0.8197 0.1906 0.1411  -0.0649 0.0969  63  LYS A O   
497  C CB  . LYS A 63  ? 0.2433 0.7112 0.2221 0.0849  -0.1143 -0.0838 63  LYS A CB  
498  C CG  . LYS A 63  ? 0.3727 0.7843 0.5234 -0.0125 0.0826  -0.2216 63  LYS A CG  
499  C CD  . LYS A 63  ? 0.5775 0.9769 0.7414 -0.1565 0.2599  -0.2062 63  LYS A CD  
500  C CE  . LYS A 63  ? 0.6099 1.0604 0.8231 -0.2175 0.2378  -0.2016 63  LYS A CE  
501  N NZ  . LYS A 63  ? 0.6820 1.4122 1.0215 -0.3592 0.3643  -0.1822 63  LYS A NZ  
502  N N   . GLU A 64  ? 0.2549 0.5218 0.2437 0.1343  -0.0934 0.0131  64  GLU A N   
503  C CA  . GLU A 64  ? 0.3340 0.4393 0.2409 0.2015  -0.0639 0.0325  64  GLU A CA  
504  C C   . GLU A 64  ? 0.3510 0.3799 0.2197 0.1181  -0.0248 0.0232  64  GLU A C   
505  O O   . GLU A 64  ? 0.4400 0.3797 0.3351 0.0801  -0.0643 0.0608  64  GLU A O   
506  C CB  . GLU A 64  ? 0.4999 0.4121 0.2840 0.2338  0.0059  0.0092  64  GLU A CB  
507  C CG  . GLU A 64  ? 0.4940 0.4602 0.3633 0.2650  0.0083  -0.0067 64  GLU A CG  
508  C CD  . GLU A 64  ? 0.4421 0.7480 0.5771 0.1103  -0.0945 0.1852  64  GLU A CD  
509  O OE1 . GLU A 64  ? 0.5169 0.8836 0.5108 0.1549  -0.0894 0.2445  64  GLU A OE1 
510  O OE2 . GLU A 64  ? 0.4670 0.9359 0.8085 0.0391  -0.0862 0.1380  64  GLU A OE2 
511  N N   . GLY A 65  ? 0.2616 0.3996 0.1706 0.1120  -0.0547 -0.0218 65  GLY A N   
512  C CA  . GLY A 65  ? 0.2436 0.4640 0.1748 0.0858  -0.0450 0.0225  65  GLY A CA  
513  C C   . GLY A 65  ? 0.2242 0.6705 0.1448 0.0930  -0.0861 -0.0045 65  GLY A C   
514  O O   . GLY A 65  ? 0.2671 0.8384 0.2320 0.1286  -0.1057 0.0981  65  GLY A O   
515  N N   . PRO A 66  ? 0.2416 0.7428 0.1358 0.1008  -0.0828 -0.0619 66  PRO A N   
516  C CA  . PRO A 66  ? 0.2228 0.5900 0.1625 0.0821  -0.0983 -0.1173 66  PRO A CA  
517  C C   . PRO A 66  ? 0.2166 0.3643 0.1406 0.0730  -0.0675 0.0381  66  PRO A C   
518  O O   . PRO A 66  ? 0.3260 0.3954 0.2048 0.1632  -0.0508 0.0980  66  PRO A O   
519  C CB  . PRO A 66  ? 0.3032 0.7048 0.1492 0.1117  -0.0785 -0.1305 66  PRO A CB  
520  C CG  . PRO A 66  ? 0.3093 0.7916 0.2045 0.1606  -0.0308 -0.0547 66  PRO A CG  
521  C CD  . PRO A 66  ? 0.2392 0.8842 0.1554 0.1017  -0.0739 -0.0386 66  PRO A CD  
522  N N   . TYR A 67  ? 0.1656 0.2089 0.0983 0.0603  -0.0409 -0.0326 67  TYR A N   
523  C CA  . TYR A 67  ? 0.1739 0.1281 0.0802 0.0344  -0.0102 -0.0091 67  TYR A CA  
524  C C   . TYR A 67  ? 0.1698 0.1009 0.0577 0.0343  -0.0103 0.0021  67  TYR A C   
525  O O   . TYR A 67  ? 0.1847 0.1054 0.0949 0.0319  -0.0138 -0.0139 67  TYR A O   
526  C CB  . TYR A 67  ? 0.1509 0.1325 0.0870 -0.0020 -0.0203 0.0191  67  TYR A CB  
527  C CG  . TYR A 67  ? 0.1489 0.1255 0.0848 0.0104  -0.0288 0.0105  67  TYR A CG  
528  C CD1 . TYR A 67  ? 0.1465 0.1553 0.1000 0.0021  -0.0260 0.0067  67  TYR A CD1 
529  C CD2 . TYR A 67  ? 0.1932 0.1388 0.0936 0.0134  -0.0132 0.0069  67  TYR A CD2 
530  C CE1 . TYR A 67  ? 0.1518 0.1616 0.0925 -0.0055 -0.0116 0.0008  67  TYR A CE1 
531  C CE2 . TYR A 67  ? 0.2047 0.1340 0.1349 0.0237  0.0014  -0.0066 67  TYR A CE2 
532  C CZ  . TYR A 67  ? 0.1924 0.1715 0.1091 0.0057  0.0160  0.0033  67  TYR A CZ  
533  O OH  . TYR A 67  ? 0.1943 0.1974 0.1935 0.0343  0.0152  -0.0014 67  TYR A OH  
534  N N   . ASP A 68  ? 0.1772 0.1009 0.0691 0.0305  -0.0079 -0.0005 68  ASP A N   
535  C CA  . ASP A 68  ? 0.1743 0.1023 0.0681 0.0257  0.0042  0.0039  68  ASP A CA  
536  C C   . ASP A 68  ? 0.1624 0.0975 0.0720 0.0208  -0.0046 0.0024  68  ASP A C   
537  O O   . ASP A 68  ? 0.1753 0.1236 0.0874 0.0380  0.0163  0.0127  68  ASP A O   
538  C CB  . ASP A 68  ? 0.1960 0.1021 0.0688 0.0195  0.0051  0.0007  68  ASP A CB  
539  C CG  . ASP A 68  ? 0.2494 0.1152 0.0600 0.0422  -0.0039 0.0015  68  ASP A CG  
540  O OD1 . ASP A 68  ? 0.3248 0.1526 0.0772 0.0641  0.0340  0.0164  68  ASP A OD1 
541  O OD2 . ASP A 68  ? 0.2548 0.1062 0.0867 0.0413  0.0024  -0.0030 68  ASP A OD2 
542  N N   . VAL A 69  ? 0.1417 0.0873 0.0797 0.0279  -0.0050 0.0005  69  VAL A N   
543  C CA  . VAL A 69  ? 0.1277 0.0908 0.0853 0.0254  -0.0057 0.0080  69  VAL A CA  
544  C C   . VAL A 69  ? 0.1133 0.0844 0.0745 0.0142  -0.0353 -0.0030 69  VAL A C   
545  O O   . VAL A 69  ? 0.1181 0.0846 0.0968 0.0277  -0.0161 -0.0047 69  VAL A O   
546  C CB  . VAL A 69  ? 0.1160 0.0814 0.0887 0.0142  0.0007  0.0097  69  VAL A CB  
547  C CG1 . VAL A 69  ? 0.1352 0.0963 0.0969 0.0219  -0.0002 0.0031  69  VAL A CG1 
548  C CG2 . VAL A 69  ? 0.1146 0.0983 0.0952 0.0161  -0.0144 -0.0023 69  VAL A CG2 
549  N N   . VAL A 70  ? 0.1164 0.0816 0.0755 0.0244  -0.0041 0.0010  70  VAL A N   
550  C CA  . VAL A 70  ? 0.1036 0.0902 0.0667 0.0109  -0.0193 -0.0031 70  VAL A CA  
551  C C   . VAL A 70  ? 0.0936 0.0788 0.0696 0.0071  -0.0119 -0.0072 70  VAL A C   
552  O O   . VAL A 70  ? 0.0976 0.0936 0.0658 0.0230  -0.0070 -0.0040 70  VAL A O   
553  C CB  . VAL A 70  ? 0.1093 0.1043 0.0648 0.0084  -0.0116 -0.0210 70  VAL A CB  
554  C CG1 . VAL A 70  ? 0.1480 0.1161 0.0964 -0.0215 -0.0061 -0.0089 70  VAL A CG1 
555  C CG2 . VAL A 70  ? 0.1220 0.1187 0.0763 0.0133  -0.0192 -0.0250 70  VAL A CG2 
556  N N   . VAL A 71  ? 0.0934 0.0853 0.0663 0.0267  -0.0094 0.0000  71  VAL A N   
557  C CA  . VAL A 71  ? 0.0927 0.0859 0.0695 0.0053  -0.0133 -0.0025 71  VAL A CA  
558  C C   . VAL A 71  ? 0.0782 0.0942 0.0615 0.0089  -0.0057 -0.0017 71  VAL A C   
559  O O   . VAL A 71  ? 0.0871 0.0974 0.0885 0.0207  -0.0065 -0.0041 71  VAL A O   
560  C CB  . VAL A 71  ? 0.1016 0.0841 0.0827 0.0142  -0.0002 -0.0121 71  VAL A CB  
561  C CG1 . VAL A 71  ? 0.1170 0.1053 0.0900 0.0090  -0.0170 -0.0317 71  VAL A CG1 
562  C CG2 . VAL A 71  ? 0.1155 0.0828 0.1209 0.0097  -0.0119 0.0045  71  VAL A CG2 
563  N N   . LEU A 72  ? 0.0839 0.0861 0.0596 0.0166  0.0002  -0.0030 72  LEU A N   
564  C CA  . LEU A 72  ? 0.0899 0.0907 0.0628 0.0094  0.0113  -0.0014 72  LEU A CA  
565  C C   . LEU A 72  ? 0.0891 0.1058 0.0590 0.0091  0.0017  -0.0009 72  LEU A C   
566  O O   . LEU A 72  ? 0.0858 0.1297 0.0668 0.0162  0.0102  -0.0069 72  LEU A O   
567  C CB  . LEU A 72  ? 0.1025 0.0928 0.0584 0.0087  0.0044  -0.0016 72  LEU A CB  
568  C CG  . LEU A 72  ? 0.1121 0.1082 0.0771 0.0105  -0.0148 -0.0109 72  LEU A CG  
569  C CD1 . LEU A 72  ? 0.1360 0.1163 0.1128 0.0281  -0.0399 -0.0382 72  LEU A CD1 
570  C CD2 . LEU A 72  ? 0.1183 0.1093 0.0953 0.0125  -0.0221 -0.0069 72  LEU A CD2 
571  N N   . PRO A 73  ? 0.0772 0.0993 0.0629 0.0094  -0.0066 0.0002  73  PRO A N   
572  C CA  . PRO A 73  ? 0.0946 0.0818 0.0613 0.0018  -0.0126 -0.0032 73  PRO A CA  
573  C C   . PRO A 73  ? 0.0781 0.0760 0.0658 0.0028  -0.0127 -0.0079 73  PRO A C   
574  O O   . PRO A 73  ? 0.1018 0.0860 0.0680 -0.0024 -0.0153 -0.0110 73  PRO A O   
575  C CB  . PRO A 73  ? 0.1076 0.0773 0.0681 0.0060  -0.0104 -0.0134 73  PRO A CB  
576  C CG  . PRO A 73  ? 0.1094 0.1126 0.0812 0.0216  -0.0117 -0.0170 73  PRO A CG  
577  C CD  . PRO A 73  ? 0.0918 0.1053 0.0796 0.0179  -0.0123 -0.0176 73  PRO A CD  
578  N N   . GLY A 74  ? 0.0857 0.0711 0.0652 0.0053  -0.0055 -0.0037 74  GLY A N   
579  C CA  . GLY A 74  ? 0.0971 0.0776 0.0660 0.0149  -0.0032 -0.0066 74  GLY A CA  
580  C C   . GLY A 74  ? 0.0799 0.0599 0.0654 -0.0021 -0.0095 -0.0069 74  GLY A C   
581  O O   . GLY A 74  ? 0.0875 0.0882 0.0716 0.0099  -0.0144 -0.0102 74  GLY A O   
582  N N   . GLY A 75  ? 0.0860 0.0770 0.0757 0.0035  -0.0122 0.0032  75  GLY A N   
583  C CA  . GLY A 75  ? 0.1026 0.0788 0.0793 0.0018  -0.0035 0.0111  75  GLY A CA  
584  C C   . GLY A 75  ? 0.0889 0.0872 0.0744 -0.0048 -0.0140 0.0069  75  GLY A C   
585  O O   . GLY A 75  ? 0.1493 0.1008 0.0887 -0.0135 -0.0274 0.0050  75  GLY A O   
586  N N   . ASN A 76  ? 0.1076 0.0846 0.0754 -0.0030 -0.0025 0.0023  76  ASN A N   
587  C CA  . ASN A 76  ? 0.1191 0.0783 0.0901 -0.0070 0.0103  0.0022  76  ASN A CA  
588  C C   . ASN A 76  ? 0.1183 0.0866 0.0828 -0.0087 0.0024  -0.0024 76  ASN A C   
589  O O   . ASN A 76  ? 0.1347 0.0806 0.0796 -0.0034 0.0014  -0.0105 76  ASN A O   
590  C CB  . ASN A 76  ? 0.1318 0.0947 0.0961 0.0069  -0.0019 0.0067  76  ASN A CB  
591  C CG  . ASN A 76  ? 0.1173 0.1661 0.1103 -0.0102 -0.0055 0.0217  76  ASN A CG  
592  O OD1 . ASN A 76  ? 0.1828 0.2312 0.1504 0.0243  0.0540  0.0621  76  ASN A OD1 
593  N ND2 . ASN A 76  ? 0.1421 0.2681 0.1370 0.0291  -0.0116 0.0628  76  ASN A ND2 
594  N N   A LEU A 77  ? 0.1170 0.1056 0.0648 -0.0175 0.0022  -0.0056 77  LEU A N   
595  N N   B LEU A 77  ? 0.1126 0.0956 0.0649 -0.0146 -0.0044 -0.0061 77  LEU A N   
596  C CA  A LEU A 77  ? 0.1190 0.0903 0.0718 -0.0149 0.0123  -0.0090 77  LEU A CA  
597  C CA  B LEU A 77  ? 0.1107 0.0772 0.0962 0.0115  -0.0192 -0.0080 77  LEU A CA  
598  C C   A LEU A 77  ? 0.1014 0.0944 0.0663 0.0022  0.0108  -0.0151 77  LEU A C   
599  C C   B LEU A 77  ? 0.1307 0.1066 0.0927 -0.0131 -0.0255 0.0078  77  LEU A C   
600  O O   A LEU A 77  ? 0.1291 0.1354 0.0608 -0.0441 0.0183  -0.0067 77  LEU A O   
601  O O   B LEU A 77  ? 0.0880 0.0649 0.1729 0.0360  -0.0607 0.0064  77  LEU A O   
602  C CB  A LEU A 77  ? 0.1373 0.0959 0.0756 -0.0213 0.0284  -0.0067 77  LEU A CB  
603  C CB  B LEU A 77  ? 0.0878 0.1498 0.0852 0.0076  -0.0296 -0.0113 77  LEU A CB  
604  C CG  A LEU A 77  ? 0.1751 0.1244 0.0928 0.0394  0.0413  0.0133  77  LEU A CG  
605  C CG  B LEU A 77  ? 0.1294 0.0942 0.1058 -0.0106 0.0095  -0.0508 77  LEU A CG  
606  C CD1 A LEU A 77  ? 0.1476 0.2342 0.0907 0.0178  0.0490  0.0470  77  LEU A CD1 
607  C CD1 B LEU A 77  ? 0.2488 0.2445 0.1996 -0.1552 -0.1422 -0.0091 77  LEU A CD1 
608  C CD2 A LEU A 77  ? 0.1673 0.1521 0.0832 0.0301  0.0436  0.0351  77  LEU A CD2 
609  C CD2 B LEU A 77  ? 0.2551 0.1324 0.1643 -0.1220 -0.1596 0.0357  77  LEU A CD2 
610  N N   . GLY A 78  ? 0.1128 0.0882 0.0602 0.0112  -0.0055 -0.0109 78  GLY A N   
611  C CA  . GLY A 78  ? 0.1194 0.0871 0.0724 0.0019  -0.0076 -0.0124 78  GLY A CA  
612  C C   . GLY A 78  ? 0.1032 0.0842 0.0634 -0.0040 -0.0006 0.0012  78  GLY A C   
613  O O   . GLY A 78  ? 0.1154 0.0952 0.0712 -0.0090 -0.0111 -0.0077 78  GLY A O   
614  N N   . ALA A 79  ? 0.1023 0.0844 0.0756 -0.0048 -0.0049 -0.0098 79  ALA A N   
615  C CA  . ALA A 79  ? 0.0980 0.0877 0.0639 -0.0072 0.0011  -0.0032 79  ALA A CA  
616  C C   . ALA A 79  ? 0.1202 0.0805 0.0814 0.0015  0.0014  -0.0088 79  ALA A C   
617  O O   . ALA A 79  ? 0.1145 0.0900 0.0813 0.0035  -0.0070 -0.0143 79  ALA A O   
618  C CB  . ALA A 79  ? 0.1113 0.1101 0.0858 0.0104  0.0047  -0.0163 79  ALA A CB  
619  N N   A GLN A 80  ? 0.1923 0.0904 0.0782 -0.0396 -0.0299 0.0090  80  GLN A N   
620  N N   B GLN A 80  ? 0.0751 0.0648 0.0833 0.0230  0.0126  -0.0110 80  GLN A N   
621  C CA  A GLN A 80  ? 0.1495 0.0734 0.0871 -0.0070 -0.0109 -0.0162 80  GLN A CA  
622  C CA  B GLN A 80  ? 0.1329 0.0895 0.0842 -0.0102 -0.0074 -0.0040 80  GLN A CA  
623  C C   A GLN A 80  ? 0.1367 0.0774 0.1002 -0.0109 0.0072  0.0032  80  GLN A C   
624  C C   B GLN A 80  ? 0.1348 0.0766 0.0866 -0.0180 -0.0162 -0.0188 80  GLN A C   
625  O O   A GLN A 80  ? 0.1541 0.0895 0.1274 0.0258  -0.0356 -0.0188 80  GLN A O   
626  O O   B GLN A 80  ? 0.1325 0.1156 0.0542 -0.0847 0.0252  -0.0141 80  GLN A O   
627  C CB  A GLN A 80  ? 0.2635 0.1095 0.1356 -0.0632 -0.0481 0.0419  80  GLN A CB  
628  C CB  B GLN A 80  ? 0.0878 0.1044 0.0916 0.0050  0.0283  0.0023  80  GLN A CB  
629  C CG  A GLN A 80  ? 0.3941 0.1698 0.1320 -0.1513 0.0069  -0.0162 80  GLN A CG  
630  C CG  B GLN A 80  ? 0.1678 0.0698 0.1402 0.0200  -0.0262 0.0191  80  GLN A CG  
631  C CD  A GLN A 80  ? 0.4235 0.1161 0.2033 -0.0846 -0.0289 0.0285  80  GLN A CD  
632  C CD  B GLN A 80  ? 0.2042 0.1103 0.2006 -0.0143 0.0790  -0.0193 80  GLN A CD  
633  O OE1 A GLN A 80  ? 0.9214 0.1301 0.3415 -0.0976 -0.0467 0.0914  80  GLN A OE1 
634  O OE1 B GLN A 80  ? 0.1954 0.1786 0.4119 0.0373  0.0581  -0.0412 80  GLN A OE1 
635  N NE2 A GLN A 80  ? 0.2528 0.1444 0.2008 0.0279  -0.0210 -0.0025 80  GLN A NE2 
636  N NE2 B GLN A 80  ? 0.3518 0.0186 0.2725 -0.0647 0.0967  0.0068  80  GLN A NE2 
637  N N   . ASN A 81  ? 0.1147 0.0898 0.0854 -0.0207 -0.0038 -0.0108 81  ASN A N   
638  C CA  . ASN A 81  ? 0.1237 0.0917 0.0915 -0.0168 -0.0045 -0.0092 81  ASN A CA  
639  C C   . ASN A 81  ? 0.0946 0.1107 0.0920 -0.0147 -0.0090 0.0001  81  ASN A C   
640  O O   . ASN A 81  ? 0.1212 0.1277 0.1051 -0.0370 -0.0215 -0.0028 81  ASN A O   
641  C CB  . ASN A 81  ? 0.1159 0.0899 0.1075 -0.0192 0.0071  -0.0067 81  ASN A CB  
642  C CG  . ASN A 81  ? 0.1511 0.1005 0.1155 -0.0197 0.0277  -0.0091 81  ASN A CG  
643  O OD1 . ASN A 81  ? 0.2292 0.1297 0.1555 -0.0761 0.0808  -0.0327 81  ASN A OD1 
644  N ND2 . ASN A 81  ? 0.1558 0.1296 0.1210 -0.0346 0.0487  -0.0244 81  ASN A ND2 
645  N N   . LEU A 82  ? 0.1126 0.0893 0.0822 -0.0175 -0.0080 -0.0048 82  LEU A N   
646  C CA  . LEU A 82  ? 0.1130 0.0919 0.0723 -0.0065 -0.0042 -0.0052 82  LEU A CA  
647  C C   . LEU A 82  ? 0.1044 0.0987 0.0779 -0.0069 -0.0099 -0.0078 82  LEU A C   
648  O O   . LEU A 82  ? 0.1427 0.1162 0.0758 0.0000  -0.0140 -0.0086 82  LEU A O   
649  C CB  . LEU A 82  ? 0.1097 0.0928 0.0764 -0.0017 0.0074  -0.0021 82  LEU A CB  
650  C CG  . LEU A 82  ? 0.0969 0.0993 0.0846 -0.0077 -0.0008 -0.0135 82  LEU A CG  
651  C CD1 . LEU A 82  ? 0.1179 0.1195 0.0828 -0.0304 -0.0062 0.0036  82  LEU A CD1 
652  C CD2 . LEU A 82  ? 0.1161 0.0889 0.1012 -0.0006 0.0042  -0.0091 82  LEU A CD2 
653  N N   A SER A 83  ? 0.1380 0.0952 0.0757 -0.0032 -0.0123 -0.0087 83  SER A N   
654  N N   B SER A 83  ? 0.1255 0.0979 0.0836 0.0014  -0.0063 -0.0047 83  SER A N   
655  C CA  A SER A 83  ? 0.1396 0.1043 0.0857 0.0009  -0.0037 -0.0147 83  SER A CA  
656  C CA  B SER A 83  ? 0.1391 0.0995 0.0684 0.0028  -0.0128 -0.0027 83  SER A CA  
657  C C   A SER A 83  ? 0.1720 0.1140 0.0760 -0.0191 -0.0175 -0.0157 83  SER A C   
658  C C   B SER A 83  ? 0.1553 0.1072 0.0843 -0.0057 -0.0269 -0.0051 83  SER A C   
659  O O   A SER A 83  ? 0.2257 0.1322 0.1087 -0.0279 -0.0134 -0.0414 83  SER A O   
660  O O   B SER A 83  ? 0.1563 0.1163 0.1023 0.0062  -0.0336 -0.0204 83  SER A O   
661  C CB  A SER A 83  ? 0.1465 0.1033 0.0830 -0.0001 -0.0005 -0.0046 83  SER A CB  
662  C CB  B SER A 83  ? 0.1614 0.0973 0.0798 0.0102  -0.0316 -0.0138 83  SER A CB  
663  O OG  A SER A 83  ? 0.1355 0.1043 0.0952 0.0038  0.0035  -0.0077 83  SER A OG  
664  O OG  B SER A 83  ? 0.1185 0.1391 0.0297 0.0254  -0.0552 -0.0210 83  SER A OG  
665  N N   . GLU A 84  ? 0.1660 0.0980 0.0950 -0.0410 -0.0102 -0.0124 84  GLU A N   
666  C CA  . GLU A 84  ? 0.1809 0.1165 0.1129 -0.0528 -0.0251 -0.0133 84  GLU A CA  
667  C C   . GLU A 84  ? 0.1861 0.1276 0.1241 -0.0538 -0.0348 -0.0069 84  GLU A C   
668  O O   . GLU A 84  ? 0.2074 0.1501 0.1951 -0.0764 -0.0680 0.0126  84  GLU A O   
669  C CB  . GLU A 84  ? 0.1940 0.1231 0.1233 -0.0530 -0.0038 -0.0083 84  GLU A CB  
670  C CG  . GLU A 84  ? 0.2164 0.1225 0.1430 -0.0562 -0.0374 -0.0045 84  GLU A CG  
671  C CD  . GLU A 84  ? 0.2904 0.2114 0.1522 -0.0358 -0.0260 0.0286  84  GLU A CD  
672  O OE1 . GLU A 84  ? 0.3013 0.2425 0.1724 -0.0416 0.0179  0.0320  84  GLU A OE1 
673  O OE2 . GLU A 84  ? 0.3665 0.1913 0.1886 -0.0514 -0.0459 0.0402  84  GLU A OE2 
674  N N   . SER A 85  ? 0.1811 0.1168 0.1556 -0.0482 -0.0492 -0.0095 85  SER A N   
675  C CA  . SER A 85  ? 0.1418 0.1377 0.1436 -0.0405 -0.0233 0.0026  85  SER A CA  
676  C C   . SER A 85  ? 0.1876 0.1395 0.1456 -0.0718 -0.0414 -0.0035 85  SER A C   
677  O O   . SER A 85  ? 0.1682 0.1282 0.1212 -0.0328 -0.0391 0.0019  85  SER A O   
678  C CB  . SER A 85  ? 0.1304 0.1420 0.1287 -0.0135 -0.0257 -0.0040 85  SER A CB  
679  O OG  . SER A 85  ? 0.1519 0.1489 0.1504 -0.0168 -0.0498 0.0102  85  SER A OG  
680  N N   . ALA A 86  ? 0.1726 0.1525 0.1666 -0.0446 -0.0612 -0.0039 86  ALA A N   
681  C CA  . ALA A 86  ? 0.1732 0.1665 0.1623 -0.0494 -0.0507 -0.0123 86  ALA A CA  
682  C C   . ALA A 86  ? 0.1541 0.1651 0.1353 -0.0349 -0.0651 -0.0175 86  ALA A C   
683  O O   . ALA A 86  ? 0.1924 0.1830 0.1208 -0.0318 -0.0561 -0.0210 86  ALA A O   
684  C CB  . ALA A 86  ? 0.2719 0.1726 0.2493 -0.0852 -0.1568 0.0100  86  ALA A CB  
685  N N   . ALA A 87  ? 0.1609 0.1777 0.1277 -0.0270 -0.0353 0.0037  87  ALA A N   
686  C CA  . ALA A 87  ? 0.1506 0.1650 0.1665 -0.0139 -0.0424 -0.0045 87  ALA A CA  
687  C C   . ALA A 87  ? 0.1503 0.1375 0.1464 -0.0078 -0.0535 -0.0013 87  ALA A C   
688  O O   . ALA A 87  ? 0.1517 0.1782 0.1414 -0.0058 -0.0645 0.0304  87  ALA A O   
689  C CB  . ALA A 87  ? 0.1409 0.2072 0.2028 0.0101  -0.0553 -0.0202 87  ALA A CB  
690  N N   . VAL A 88  ? 0.1529 0.1493 0.1216 -0.0225 -0.0366 0.0096  88  VAL A N   
691  C CA  . VAL A 88  ? 0.1494 0.1246 0.1198 -0.0160 -0.0469 -0.0032 88  VAL A CA  
692  C C   . VAL A 88  ? 0.1460 0.1466 0.1246 -0.0197 -0.0485 -0.0200 88  VAL A C   
693  O O   . VAL A 88  ? 0.1594 0.1627 0.1121 -0.0261 -0.0490 -0.0002 88  VAL A O   
694  C CB  . VAL A 88  ? 0.1372 0.1137 0.1126 -0.0117 -0.0263 0.0095  88  VAL A CB  
695  C CG1 . VAL A 88  ? 0.1455 0.1216 0.1178 -0.0214 -0.0396 -0.0065 88  VAL A CG1 
696  C CG2 . VAL A 88  ? 0.1594 0.1049 0.1241 -0.0090 -0.0379 -0.0068 88  VAL A CG2 
697  N N   A LYS A 89  ? 0.1608 0.1442 0.1085 -0.0207 -0.0508 -0.0125 89  LYS A N   
698  N N   B LYS A 89  ? 0.1409 0.1428 0.1089 -0.0143 -0.0639 -0.0130 89  LYS A N   
699  C CA  A LYS A 89  ? 0.1718 0.1485 0.1125 -0.0158 -0.0645 -0.0270 89  LYS A CA  
700  C CA  B LYS A 89  ? 0.1709 0.1514 0.1001 -0.0165 -0.0527 -0.0122 89  LYS A CA  
701  C C   A LYS A 89  ? 0.1761 0.1660 0.1078 0.0047  -0.0482 -0.0336 89  LYS A C   
702  C C   B LYS A 89  ? 0.1917 0.1584 0.1063 -0.0137 -0.0606 -0.0147 89  LYS A C   
703  O O   A LYS A 89  ? 0.1863 0.1558 0.1421 -0.0232 -0.0352 -0.0201 89  LYS A O   
704  O O   B LYS A 89  ? 0.2241 0.1706 0.0839 0.0190  -0.0428 -0.0164 89  LYS A O   
705  C CB  A LYS A 89  ? 0.1412 0.1761 0.1488 -0.0425 -0.0131 -0.0499 89  LYS A CB  
706  C CB  B LYS A 89  ? 0.1773 0.1358 0.1662 0.0136  -0.0878 -0.0155 89  LYS A CB  
707  C CG  A LYS A 89  ? 0.2024 0.1473 0.1114 -0.0190 -0.0278 -0.0280 89  LYS A CG  
708  C CG  B LYS A 89  ? 0.2948 0.1348 0.0962 -0.0496 -0.0745 -0.0002 89  LYS A CG  
709  C CD  A LYS A 89  ? 0.2508 0.1609 0.2178 -0.0466 -0.0136 -0.0378 89  LYS A CD  
710  C CD  B LYS A 89  ? 0.4451 0.1395 0.1970 -0.0509 -0.0340 -0.0449 89  LYS A CD  
711  C CE  A LYS A 89  ? 0.2172 0.1220 0.2608 -0.0438 -0.0806 -0.0104 89  LYS A CE  
712  C CE  B LYS A 89  ? 0.3818 0.1783 0.2067 0.0261  -0.0913 -0.0318 89  LYS A CE  
713  N NZ  A LYS A 89  ? 0.1827 0.0893 0.3483 -0.0432 -0.1196 -0.0715 89  LYS A NZ  
714  N NZ  B LYS A 89  ? 0.2589 0.6738 0.2599 -0.0983 -0.0265 0.1255  89  LYS A NZ  
715  N N   A GLU A 90  ? 0.1779 0.1493 0.1250 -0.0206 -0.0578 -0.0004 90  GLU A N   
716  N N   B GLU A 90  ? 0.1941 0.1667 0.1158 -0.0255 -0.0766 -0.0023 90  GLU A N   
717  C CA  A GLU A 90  ? 0.1759 0.1944 0.1104 -0.0312 -0.0590 0.0006  90  GLU A CA  
718  C CA  B GLU A 90  ? 0.1943 0.1846 0.1194 -0.0316 -0.0697 0.0141  90  GLU A CA  
719  C C   A GLU A 90  ? 0.1675 0.1656 0.1058 0.0045  -0.0575 0.0127  90  GLU A C   
720  C C   B GLU A 90  ? 0.2098 0.1806 0.1199 -0.0303 -0.0396 0.0009  90  GLU A C   
721  O O   A GLU A 90  ? 0.2562 0.1994 0.0938 -0.0332 -0.0533 0.0221  90  GLU A O   
722  O O   B GLU A 90  ? 0.0661 0.1310 0.1449 0.0550  -0.0398 -0.0046 90  GLU A O   
723  C CB  A GLU A 90  ? 0.1739 0.2834 0.1292 -0.0294 -0.0629 0.0313  90  GLU A CB  
724  C CB  B GLU A 90  ? 0.1912 0.2842 0.1538 -0.0324 -0.0753 0.0726  90  GLU A CB  
725  C CG  A GLU A 90  ? 0.2514 0.3454 0.2835 -0.0153 -0.1261 0.1195  90  GLU A CG  
726  C CG  B GLU A 90  ? 0.2210 0.3331 0.1525 -0.0850 -0.1397 0.1335  90  GLU A CG  
727  C CD  A GLU A 90  ? 0.2597 0.4844 0.2906 0.0513  -0.1393 0.0672  90  GLU A CD  
728  C CD  B GLU A 90  ? 0.1949 0.4763 0.3364 -0.0726 -0.1860 0.0864  90  GLU A CD  
729  O OE1 A GLU A 90  ? 0.3093 0.4775 0.4343 0.0461  -0.1094 -0.0315 90  GLU A OE1 
730  O OE1 B GLU A 90  ? 0.2101 0.5530 0.4774 -0.0062 -0.2072 0.0039  90  GLU A OE1 
731  O OE2 A GLU A 90  ? 0.2194 0.7408 0.5224 0.0412  -0.1296 -0.1888 90  GLU A OE2 
732  O OE2 B GLU A 90  ? 0.1838 0.5864 0.4700 -0.1398 -0.2294 0.0263  90  GLU A OE2 
733  N N   . ILE A 91  ? 0.1426 0.1599 0.1112 -0.0038 -0.0426 0.0155  91  ILE A N   
734  C CA  . ILE A 91  ? 0.1342 0.1505 0.1384 0.0097  -0.0317 0.0065  91  ILE A CA  
735  C C   . ILE A 91  ? 0.1369 0.1353 0.1044 0.0098  -0.0417 0.0070  91  ILE A C   
736  O O   . ILE A 91  ? 0.1400 0.1292 0.1155 0.0130  -0.0284 0.0000  91  ILE A O   
737  C CB  . ILE A 91  ? 0.1643 0.1583 0.1687 -0.0001 0.0020  -0.0109 91  ILE A CB  
738  C CG1 . ILE A 91  ? 0.1846 0.2163 0.2255 0.0413  -0.0176 -0.0445 91  ILE A CG1 
739  C CG2 . ILE A 91  ? 0.1979 0.1477 0.1746 0.0001  0.0098  -0.0233 91  ILE A CG2 
740  C CD1 . ILE A 91  ? 0.1993 0.3044 0.2959 0.0116  0.0259  -0.1042 91  ILE A CD1 
741  N N   . LEU A 92  ? 0.1364 0.1258 0.1056 0.0122  -0.0450 -0.0070 92  LEU A N   
742  C CA  . LEU A 92  ? 0.1249 0.1233 0.0956 0.0020  -0.0426 -0.0135 92  LEU A CA  
743  C C   . LEU A 92  ? 0.1534 0.1318 0.0910 0.0020  -0.0410 -0.0107 92  LEU A C   
744  O O   . LEU A 92  ? 0.1592 0.1215 0.1013 0.0174  -0.0288 -0.0146 92  LEU A O   
745  C CB  . LEU A 92  ? 0.1294 0.1189 0.0943 0.0056  -0.0480 -0.0197 92  LEU A CB  
746  C CG  . LEU A 92  ? 0.1261 0.1232 0.0889 0.0096  -0.0409 -0.0176 92  LEU A CG  
747  C CD1 . LEU A 92  ? 0.1366 0.1264 0.1071 -0.0027 -0.0395 -0.0047 92  LEU A CD1 
748  C CD2 . LEU A 92  ? 0.1764 0.1204 0.0899 -0.0049 -0.0240 -0.0187 92  LEU A CD2 
749  N N   A LYS A 93  ? 0.1701 0.1190 0.1083 0.0080  -0.0481 -0.0243 93  LYS A N   
750  N N   B LYS A 93  ? 0.1786 0.1337 0.1073 -0.0023 -0.0395 -0.0262 93  LYS A N   
751  C CA  A LYS A 93  ? 0.1641 0.1457 0.1192 0.0157  -0.0359 -0.0341 93  LYS A CA  
752  C CA  B LYS A 93  ? 0.1924 0.1376 0.1169 0.0145  -0.0384 -0.0346 93  LYS A CA  
753  C C   A LYS A 93  ? 0.2059 0.1483 0.1037 0.0073  -0.0482 -0.0406 93  LYS A C   
754  C C   B LYS A 93  ? 0.2025 0.1515 0.1046 0.0079  -0.0344 -0.0331 93  LYS A C   
755  O O   A LYS A 93  ? 0.2133 0.1409 0.1024 0.0267  -0.0457 -0.0344 93  LYS A O   
756  O O   B LYS A 93  ? 0.2317 0.1783 0.0828 0.0249  -0.0342 -0.0523 93  LYS A O   
757  C CB  A LYS A 93  ? 0.2874 0.1596 0.1168 -0.0332 -0.0509 -0.0465 93  LYS A CB  
758  C CB  B LYS A 93  ? 0.2221 0.1381 0.1146 0.0165  -0.0986 -0.0221 93  LYS A CB  
759  C CG  A LYS A 93  ? 0.4722 0.1674 0.1862 -0.0656 -0.0837 -0.0080 93  LYS A CG  
760  C CG  B LYS A 93  ? 0.3571 0.1990 0.0741 -0.0566 -0.0654 -0.0457 93  LYS A CG  
761  C CD  A LYS A 93  ? 0.6750 0.1861 0.2475 0.0682  -0.1461 -0.0354 93  LYS A CD  
762  C CD  B LYS A 93  ? 0.4968 0.1566 0.1523 0.0055  -0.0238 -0.0444 93  LYS A CD  
763  C CE  A LYS A 93  ? 0.7584 0.2590 0.2758 0.0850  -0.1238 0.0176  93  LYS A CE  
764  C CE  B LYS A 93  ? 0.6154 0.2057 0.2684 0.0780  -0.0930 -0.0070 93  LYS A CE  
765  N NZ  A LYS A 93  ? 0.9158 0.2859 0.5400 0.2255  -0.1217 0.0391  93  LYS A NZ  
766  N NZ  B LYS A 93  ? 0.7497 0.2191 0.4389 0.2106  -0.0519 -0.0310 93  LYS A NZ  
767  N N   . GLU A 94  ? 0.1821 0.1591 0.0956 0.0042  -0.0371 -0.0089 94  GLU A N   
768  C CA  . GLU A 94  ? 0.1998 0.1826 0.1042 -0.0038 -0.0532 0.0047  94  GLU A CA  
769  C C   . GLU A 94  ? 0.2041 0.1336 0.0995 0.0202  -0.0360 -0.0075 94  GLU A C   
770  O O   . GLU A 94  ? 0.1942 0.1382 0.1051 0.0181  -0.0280 -0.0016 94  GLU A O   
771  C CB  . GLU A 94  ? 0.2108 0.1845 0.1285 0.0115  -0.0526 0.0270  94  GLU A CB  
772  C CG  . GLU A 94  ? 0.1957 0.4367 0.5904 -0.0504 0.0049  -0.1993 94  GLU A CG  
773  C CD  . GLU A 94  ? 0.2031 0.6527 1.0288 0.0051  -0.0613 -0.2385 94  GLU A CD  
774  O OE1 . GLU A 94  ? 0.4684 0.8690 1.3176 0.2782  0.0898  -0.3980 94  GLU A OE1 
775  O OE2 . GLU A 94  ? 0.3387 0.7481 1.5868 -0.1289 -0.3969 -0.2106 94  GLU A OE2 
776  N N   . GLN A 95  ? 0.1625 0.1510 0.0987 0.0189  -0.0381 -0.0014 95  GLN A N   
777  C CA  . GLN A 95  ? 0.1558 0.1264 0.0925 0.0335  -0.0236 -0.0016 95  GLN A CA  
778  C C   . GLN A 95  ? 0.1700 0.1167 0.0638 0.0283  -0.0234 0.0003  95  GLN A C   
779  O O   . GLN A 95  ? 0.1778 0.1224 0.0826 0.0364  -0.0103 -0.0101 95  GLN A O   
780  C CB  . GLN A 95  ? 0.1537 0.1430 0.0908 0.0068  -0.0035 -0.0087 95  GLN A CB  
781  C CG  . GLN A 95  ? 0.1443 0.1142 0.0802 0.0271  -0.0033 -0.0001 95  GLN A CG  
782  C CD  . GLN A 95  ? 0.1594 0.1145 0.1164 0.0434  -0.0473 -0.0284 95  GLN A CD  
783  O OE1 . GLN A 95  ? 0.2413 0.1346 0.1527 0.0610  -0.1162 -0.0368 95  GLN A OE1 
784  N NE2 . GLN A 95  ? 0.1580 0.1117 0.0912 0.0265  -0.0249 -0.0146 95  GLN A NE2 
785  N N   . GLU A 96  ? 0.1605 0.1237 0.0879 0.0350  -0.0251 -0.0042 96  GLU A N   
786  C CA  . GLU A 96  ? 0.1826 0.1319 0.1041 0.0412  -0.0151 -0.0033 96  GLU A CA  
787  C C   . GLU A 96  ? 0.1986 0.1109 0.1116 0.0480  -0.0086 -0.0342 96  GLU A C   
788  O O   . GLU A 96  ? 0.2116 0.1423 0.1151 0.0539  0.0036  -0.0131 96  GLU A O   
789  C CB  . GLU A 96  ? 0.2424 0.1024 0.1472 0.0363  0.0038  -0.0131 96  GLU A CB  
790  C CG  . GLU A 96  ? 0.2740 0.1718 0.1786 0.0967  -0.0136 -0.0079 96  GLU A CG  
791  C CD  . GLU A 96  ? 0.3109 0.1603 0.2452 0.1086  0.0241  -0.0058 96  GLU A CD  
792  O OE1 . GLU A 96  ? 0.3534 0.2200 0.2665 0.0559  -0.0088 0.0366  96  GLU A OE1 
793  O OE2 . GLU A 96  ? 0.3807 0.1745 0.1231 0.0678  -0.0570 0.0084  96  GLU A OE2 
794  N N   A ASN A 97  ? 0.2062 0.1325 0.1021 0.0452  -0.0148 -0.0367 97  ASN A N   
795  N N   B ASN A 97  ? 0.2130 0.1403 0.1070 0.0387  -0.0199 -0.0337 97  ASN A N   
796  C CA  A ASN A 97  ? 0.2466 0.1658 0.1042 0.0262  -0.0106 -0.0441 97  ASN A CA  
797  C CA  B ASN A 97  ? 0.2704 0.1650 0.1078 0.0084  -0.0193 -0.0413 97  ASN A CA  
798  C C   A ASN A 97  ? 0.2817 0.1839 0.1028 0.0270  0.0079  -0.0255 97  ASN A C   
799  C C   B ASN A 97  ? 0.2763 0.1804 0.1082 0.0204  0.0138  -0.0282 97  ASN A C   
800  O O   A ASN A 97  ? 0.2998 0.2213 0.1010 0.0651  0.0122  -0.0208 97  ASN A O   
801  O O   B ASN A 97  ? 0.3457 0.2179 0.1254 0.0434  0.0487  -0.0262 97  ASN A O   
802  C CB  A ASN A 97  ? 0.3164 0.2616 0.1515 -0.0589 -0.0483 -0.0729 97  ASN A CB  
803  C CB  B ASN A 97  ? 0.2949 0.1991 0.1193 -0.0132 -0.0444 -0.0412 97  ASN A CB  
804  C CG  A ASN A 97  ? 0.3543 0.2672 0.2052 -0.0791 -0.0086 -0.0752 97  ASN A CG  
805  C CG  B ASN A 97  ? 0.3096 0.1940 0.1185 -0.0126 -0.0346 -0.0463 97  ASN A CG  
806  O OD1 A ASN A 97  ? 0.4550 0.2661 0.3164 0.0102  0.0226  -0.0931 97  ASN A OD1 
807  O OD1 B ASN A 97  ? 0.2288 0.2191 0.1277 -0.0253 -0.0746 -0.0708 97  ASN A OD1 
808  N ND2 A ASN A 97  ? 0.4203 0.4337 0.1846 -0.1901 0.0188  -0.0285 97  ASN A ND2 
809  N ND2 B ASN A 97  ? 0.4215 0.1278 0.0858 0.0223  -0.0286 -0.0643 97  ASN A ND2 
810  N N   . ARG A 98  ? 0.2246 0.1694 0.0745 0.0331  -0.0209 -0.0077 98  ARG A N   
811  C CA  . ARG A 98  ? 0.2047 0.1828 0.0926 0.0276  -0.0163 0.0056  98  ARG A CA  
812  C C   . ARG A 98  ? 0.2132 0.1713 0.0735 0.0333  -0.0249 0.0033  98  ARG A C   
813  O O   . ARG A 98  ? 0.2275 0.1751 0.1222 0.0266  -0.0074 0.0258  98  ARG A O   
814  C CB  . ARG A 98  ? 0.2174 0.1710 0.1169 0.0306  -0.0070 -0.0043 98  ARG A CB  
815  C CG  . ARG A 98  ? 0.2566 0.1833 0.1152 0.0556  -0.0200 0.0027  98  ARG A CG  
816  C CD  . ARG A 98  ? 0.3442 0.2388 0.1530 0.1220  -0.0088 -0.0340 98  ARG A CD  
817  N NE  . ARG A 98  ? 0.4130 0.2405 0.2590 0.1403  -0.1035 0.0033  98  ARG A NE  
818  C CZ  . ARG A 98  ? 0.7959 0.2848 0.2101 -0.0283 -0.1510 0.0592  98  ARG A CZ  
819  N NH1 . ARG A 98  ? 0.5526 0.3941 0.1652 0.1952  -0.0615 -0.0997 98  ARG A NH1 
820  N NH2 . ARG A 98  ? 0.5717 0.3657 0.3751 0.0004  0.0632  0.1732  98  ARG A NH2 
821  N N   . LYS A 99  ? 0.1988 0.1650 0.0678 0.0220  -0.0140 0.0035  99  LYS A N   
822  C CA  . LYS A 99  ? 0.1830 0.1446 0.0887 0.0294  -0.0031 0.0068  99  LYS A CA  
823  C C   . LYS A 99  ? 0.1805 0.1599 0.0837 0.0135  -0.0022 0.0066  99  LYS A C   
824  O O   . LYS A 99  ? 0.2057 0.1670 0.1371 -0.0024 0.0190  -0.0085 99  LYS A O   
825  C CB  . LYS A 99  ? 0.1940 0.2034 0.1094 0.0228  0.0130  -0.0130 99  LYS A CB  
826  C CG  . LYS A 99  ? 0.2348 0.2242 0.1296 0.0310  0.0257  -0.0324 99  LYS A CG  
827  C CD  . LYS A 99  ? 0.3128 0.2907 0.1439 0.0613  0.0677  -0.0282 99  LYS A CD  
828  C CE  . LYS A 99  ? 0.3571 0.3373 0.1945 0.1181  0.0575  -0.0800 99  LYS A CE  
829  N NZ  . LYS A 99  ? 0.3428 0.5008 0.2173 0.0934  0.0802  -0.1464 99  LYS A NZ  
830  N N   . GLY A 100 ? 0.1686 0.1726 0.0630 -0.0019 -0.0175 -0.0070 100 GLY A N   
831  C CA  . GLY A 100 ? 0.2126 0.1409 0.0658 0.0210  -0.0196 0.0060  100 GLY A CA  
832  C C   . GLY A 100 ? 0.1475 0.1303 0.0801 0.0175  -0.0242 0.0053  100 GLY A C   
833  O O   . GLY A 100 ? 0.1918 0.1279 0.0937 0.0387  -0.0223 0.0022  100 GLY A O   
834  N N   . LEU A 101 ? 0.1401 0.1423 0.0709 0.0002  -0.0099 0.0128  101 LEU A N   
835  C CA  . LEU A 101 ? 0.1572 0.1168 0.0629 0.0025  -0.0084 0.0072  101 LEU A CA  
836  C C   . LEU A 101 ? 0.1463 0.0807 0.0598 0.0224  -0.0100 -0.0023 101 LEU A C   
837  O O   . LEU A 101 ? 0.1430 0.0923 0.0799 0.0276  -0.0069 0.0098  101 LEU A O   
838  C CB  . LEU A 101 ? 0.1440 0.1090 0.0975 0.0005  -0.0154 0.0105  101 LEU A CB  
839  C CG  . LEU A 101 ? 0.1302 0.1017 0.0924 0.0083  -0.0032 -0.0007 101 LEU A CG  
840  C CD1 . LEU A 101 ? 0.1414 0.1330 0.1142 0.0205  -0.0040 -0.0023 101 LEU A CD1 
841  C CD2 . LEU A 101 ? 0.1694 0.1298 0.1192 0.0088  -0.0222 -0.0216 101 LEU A CD2 
842  N N   . ILE A 102 ? 0.1257 0.0876 0.0631 0.0257  0.0013  -0.0053 102 ILE A N   
843  C CA  . ILE A 102 ? 0.1216 0.0857 0.0520 0.0155  -0.0030 -0.0137 102 ILE A CA  
844  C C   . ILE A 102 ? 0.1128 0.0723 0.0678 0.0255  -0.0134 -0.0112 102 ILE A C   
845  O O   . ILE A 102 ? 0.1167 0.1074 0.0724 0.0297  -0.0037 -0.0026 102 ILE A O   
846  C CB  . ILE A 102 ? 0.1231 0.0789 0.0876 0.0191  -0.0224 -0.0088 102 ILE A CB  
847  C CG1 . ILE A 102 ? 0.1307 0.0951 0.1099 0.0140  -0.0390 -0.0208 102 ILE A CG1 
848  C CG2 . ILE A 102 ? 0.1380 0.1033 0.1055 -0.0119 -0.0288 0.0088  102 ILE A CG2 
849  C CD1 . ILE A 102 ? 0.1576 0.0915 0.1350 0.0167  -0.0408 -0.0297 102 ILE A CD1 
850  N N   . ALA A 103 ? 0.1104 0.0860 0.0542 0.0239  -0.0097 -0.0031 103 ALA A N   
851  C CA  . ALA A 103 ? 0.0975 0.0868 0.0571 0.0127  -0.0091 -0.0007 103 ALA A CA  
852  C C   . ALA A 103 ? 0.1061 0.0990 0.0629 0.0183  -0.0060 0.0002  103 ALA A C   
853  O O   . ALA A 103 ? 0.1079 0.1567 0.0880 0.0341  0.0088  0.0317  103 ALA A O   
854  C CB  . ALA A 103 ? 0.1375 0.0916 0.0780 0.0083  -0.0027 -0.0140 103 ALA A CB  
855  N N   . ALA A 104 ? 0.0894 0.0777 0.0717 0.0138  0.0087  0.0023  104 ALA A N   
856  C CA  . ALA A 104 ? 0.0909 0.0793 0.0633 -0.0049 0.0026  -0.0020 104 ALA A CA  
857  C C   . ALA A 104 ? 0.0868 0.0864 0.0650 -0.0029 0.0007  0.0018  104 ALA A C   
858  O O   . ALA A 104 ? 0.0957 0.1031 0.0740 0.0052  0.0014  0.0073  104 ALA A O   
859  C CB  . ALA A 104 ? 0.0994 0.0779 0.0755 -0.0018 -0.0008 -0.0052 104 ALA A CB  
860  N N   . ILE A 105 ? 0.1006 0.1117 0.0670 -0.0040 0.0017  -0.0153 105 ILE A N   
861  C CA  . ILE A 105 ? 0.1053 0.1001 0.0682 -0.0095 -0.0070 -0.0130 105 ILE A CA  
862  C C   . ILE A 105 ? 0.1177 0.0964 0.0825 -0.0112 -0.0064 -0.0096 105 ILE A C   
863  O O   . ILE A 105 ? 0.1225 0.0922 0.0989 -0.0055 0.0009  -0.0101 105 ILE A O   
864  C CB  . ILE A 105 ? 0.0961 0.1010 0.0555 0.0047  -0.0002 -0.0062 105 ILE A CB  
865  C CG1 . ILE A 105 ? 0.0983 0.0816 0.0662 0.0108  -0.0064 -0.0086 105 ILE A CG1 
866  C CG2 . ILE A 105 ? 0.0975 0.1298 0.0917 0.0056  -0.0082 -0.0230 105 ILE A CG2 
867  C CD1 . ILE A 105 ? 0.1148 0.0881 0.0817 -0.0006 -0.0060 -0.0027 105 ILE A CD1 
868  N N   . CSD A 106 ? 0.1366 0.0892 0.1073 0.0123  0.0082  0.0069  106 CSD A N   
869  C CA  . CSD A 106 ? 0.1487 0.0765 0.0885 0.0137  0.0104  -0.0010 106 CSD A CA  
870  C CB  . CSD A 106 ? 0.1421 0.1021 0.0811 0.0226  0.0075  -0.0015 106 CSD A CB  
871  S SG  . CSD A 106 ? 0.0953 0.0837 0.0719 0.0160  -0.0107 -0.0137 106 CSD A SG  
872  C C   . CSD A 106 ? 0.0961 0.0880 0.0765 0.0097  -0.0051 -0.0033 106 CSD A C   
873  O O   . CSD A 106 ? 0.1005 0.0920 0.1035 0.0066  -0.0033 -0.0036 106 CSD A O   
874  O OD1 . CSD A 106 ? 0.0956 0.0713 0.0785 0.0139  -0.0105 -0.0150 106 CSD A OD1 
875  O OD2 . CSD A 106 ? 0.0856 0.0960 0.0596 0.0148  -0.0123 -0.0114 106 CSD A OD2 
876  N N   . ALA A 107 ? 0.1030 0.0902 0.0818 0.0166  -0.0083 -0.0279 107 ALA A N   
877  C CA  . ALA A 107 ? 0.0964 0.0857 0.0790 -0.0018 0.0020  -0.0037 107 ALA A CA  
878  C C   . ALA A 107 ? 0.0988 0.0757 0.0795 -0.0007 0.0028  -0.0149 107 ALA A C   
879  O O   . ALA A 107 ? 0.1071 0.0732 0.0775 -0.0103 -0.0022 -0.0052 107 ALA A O   
880  C CB  . ALA A 107 ? 0.1142 0.2161 0.0869 -0.0338 0.0156  0.0085  107 ALA A CB  
881  N N   . GLY A 108 ? 0.1085 0.0745 0.0744 0.0031  -0.0119 -0.0209 108 GLY A N   
882  C CA  . GLY A 108 ? 0.0980 0.1033 0.0699 0.0072  -0.0008 -0.0218 108 GLY A CA  
883  C C   . GLY A 108 ? 0.0881 0.0655 0.0737 0.0076  -0.0032 -0.0085 108 GLY A C   
884  O O   . GLY A 108 ? 0.0828 0.0794 0.0815 0.0065  -0.0119 -0.0138 108 GLY A O   
885  N N   . PRO A 109 ? 0.0786 0.0779 0.0652 0.0075  -0.0057 -0.0148 109 PRO A N   
886  C CA  . PRO A 109 ? 0.0937 0.0791 0.0577 0.0186  -0.0212 -0.0145 109 PRO A CA  
887  C C   . PRO A 109 ? 0.0754 0.0726 0.0724 0.0266  -0.0094 -0.0142 109 PRO A C   
888  O O   . PRO A 109 ? 0.0916 0.0858 0.0671 0.0132  -0.0015 -0.0242 109 PRO A O   
889  C CB  . PRO A 109 ? 0.0913 0.0897 0.0667 0.0062  0.0050  -0.0223 109 PRO A CB  
890  C CG  . PRO A 109 ? 0.0811 0.0741 0.0894 0.0049  -0.0030 -0.0080 109 PRO A CG  
891  C CD  . PRO A 109 ? 0.0873 0.1021 0.0635 0.0106  -0.0078 -0.0263 109 PRO A CD  
892  N N   . THR A 110 ? 0.0846 0.0717 0.0642 0.0174  -0.0012 -0.0198 110 THR A N   
893  C CA  . THR A 110 ? 0.1006 0.0811 0.0743 0.0058  -0.0024 -0.0181 110 THR A CA  
894  C C   . THR A 110 ? 0.0870 0.0687 0.0847 0.0056  0.0006  -0.0044 110 THR A C   
895  O O   . THR A 110 ? 0.1083 0.0752 0.0927 0.0041  -0.0149 -0.0094 110 THR A O   
896  C CB  . THR A 110 ? 0.1184 0.0783 0.0813 0.0153  -0.0111 -0.0031 110 THR A CB  
897  O OG1 . THR A 110 ? 0.1140 0.0936 0.0834 -0.0104 0.0077  -0.0023 110 THR A OG1 
898  C CG2 . THR A 110 ? 0.1218 0.1010 0.1033 0.0082  -0.0219 0.0192  110 THR A CG2 
899  N N   . ALA A 111 ? 0.0959 0.0712 0.0920 0.0020  -0.0106 -0.0224 111 ALA A N   
900  C CA  . ALA A 111 ? 0.0905 0.0749 0.1030 -0.0015 -0.0182 -0.0132 111 ALA A CA  
901  C C   . ALA A 111 ? 0.1020 0.0740 0.0989 0.0057  -0.0118 0.0042  111 ALA A C   
902  O O   . ALA A 111 ? 0.1121 0.1130 0.1012 -0.0042 -0.0200 -0.0114 111 ALA A O   
903  C CB  . ALA A 111 ? 0.1120 0.0858 0.1039 0.0077  -0.0109 -0.0047 111 ALA A CB  
904  N N   . LEU A 112 ? 0.1054 0.0837 0.0819 -0.0006 -0.0216 -0.0080 112 LEU A N   
905  C CA  . LEU A 112 ? 0.1033 0.0971 0.0790 0.0084  -0.0157 -0.0109 112 LEU A CA  
906  C C   . LEU A 112 ? 0.1012 0.0930 0.0744 -0.0063 -0.0114 0.0004  112 LEU A C   
907  O O   . LEU A 112 ? 0.1142 0.0995 0.0838 0.0033  -0.0249 -0.0072 112 LEU A O   
908  C CB  . LEU A 112 ? 0.1170 0.0967 0.0828 -0.0099 -0.0232 -0.0071 112 LEU A CB  
909  C CG  . LEU A 112 ? 0.1367 0.0963 0.0901 -0.0038 -0.0036 -0.0069 112 LEU A CG  
910  C CD1 . LEU A 112 ? 0.1861 0.1329 0.0977 -0.0547 0.0118  -0.0013 112 LEU A CD1 
911  C CD2 . LEU A 112 ? 0.2228 0.0996 0.1110 0.0056  -0.0502 0.0000  112 LEU A CD2 
912  N N   . LEU A 113 ? 0.1041 0.0829 0.0721 0.0091  -0.0167 -0.0188 113 LEU A N   
913  C CA  . LEU A 113 ? 0.1124 0.0855 0.0785 0.0066  0.0002  -0.0100 113 LEU A CA  
914  C C   . LEU A 113 ? 0.1153 0.0896 0.1033 -0.0007 -0.0162 -0.0161 113 LEU A C   
915  O O   . LEU A 113 ? 0.1334 0.0926 0.1021 0.0093  -0.0234 -0.0132 113 LEU A O   
916  C CB  . LEU A 113 ? 0.1198 0.0818 0.1047 0.0028  -0.0196 -0.0068 113 LEU A CB  
917  C CG  . LEU A 113 ? 0.1091 0.0879 0.0990 0.0046  -0.0097 -0.0066 113 LEU A CG  
918  C CD1 . LEU A 113 ? 0.1522 0.0890 0.1083 0.0233  -0.0025 -0.0093 113 LEU A CD1 
919  C CD2 . LEU A 113 ? 0.1429 0.1118 0.1002 0.0049  -0.0019 0.0214  113 LEU A CD2 
920  N N   . ALA A 114 ? 0.1113 0.0851 0.1120 -0.0040 -0.0131 -0.0130 114 ALA A N   
921  C CA  . ALA A 114 ? 0.1245 0.1199 0.0914 -0.0281 -0.0103 -0.0084 114 ALA A CA  
922  C C   . ALA A 114 ? 0.1045 0.1175 0.1099 -0.0122 -0.0078 -0.0096 114 ALA A C   
923  O O   . ALA A 114 ? 0.1399 0.1250 0.1460 -0.0232 -0.0462 -0.0310 114 ALA A O   
924  C CB  . ALA A 114 ? 0.1177 0.1275 0.1093 -0.0072 -0.0155 -0.0174 114 ALA A CB  
925  N N   . HIS A 115 ? 0.1185 0.1094 0.1110 -0.0010 -0.0207 -0.0031 115 HIS A N   
926  C CA  . HIS A 115 ? 0.1257 0.1188 0.1029 0.0089  -0.0312 -0.0224 115 HIS A CA  
927  C C   . HIS A 115 ? 0.1235 0.1146 0.1029 0.0062  -0.0306 -0.0182 115 HIS A C   
928  O O   . HIS A 115 ? 0.1477 0.1386 0.1040 0.0170  -0.0332 -0.0167 115 HIS A O   
929  C CB  . HIS A 115 ? 0.1183 0.1145 0.1069 0.0034  -0.0088 0.0003  115 HIS A CB  
930  C CG  . HIS A 115 ? 0.1188 0.1083 0.1026 0.0028  -0.0105 -0.0030 115 HIS A CG  
931  N ND1 . HIS A 115 ? 0.1324 0.1536 0.0857 -0.0286 -0.0146 -0.0123 115 HIS A ND1 
932  C CD2 . HIS A 115 ? 0.1085 0.1081 0.1142 0.0074  -0.0237 -0.0104 115 HIS A CD2 
933  C CE1 . HIS A 115 ? 0.1366 0.1417 0.0789 -0.0267 -0.0098 -0.0076 115 HIS A CE1 
934  N NE2 . HIS A 115 ? 0.1104 0.1369 0.1049 0.0033  -0.0224 -0.0131 115 HIS A NE2 
935  N N   A GLU A 116 ? 0.1148 0.1211 0.1056 -0.0023 -0.0298 -0.0277 116 GLU A N   
936  N N   B GLU A 116 ? 0.1265 0.1139 0.1496 0.0128  -0.0196 -0.0015 116 GLU A N   
937  C CA  A GLU A 116 ? 0.1629 0.1053 0.1017 0.0042  -0.0057 -0.0387 116 GLU A CA  
938  C CA  B GLU A 116 ? 0.1140 0.1131 0.1348 -0.0011 -0.0340 -0.0194 116 GLU A CA  
939  C C   A GLU A 116 ? 0.1083 0.1060 0.0912 0.0199  -0.0245 -0.0327 116 GLU A C   
940  C C   B GLU A 116 ? 0.1284 0.1021 0.1023 0.0225  -0.0284 -0.0252 116 GLU A C   
941  O O   A GLU A 116 ? 0.1539 0.1214 0.0851 0.0422  -0.0272 -0.0210 116 GLU A O   
942  O O   B GLU A 116 ? 0.2250 0.1201 0.1025 -0.0115 -0.0411 -0.0315 116 GLU A O   
943  C CB  A GLU A 116 ? 0.1530 0.1211 0.1002 -0.0110 -0.0302 -0.0245 116 GLU A CB  
944  C CB  B GLU A 116 ? 0.2423 0.1384 0.1983 -0.0275 -0.0432 -0.0643 116 GLU A CB  
945  C CG  A GLU A 116 ? 0.1756 0.1267 0.1304 -0.0246 -0.0260 -0.0169 116 GLU A CG  
946  C CG  B GLU A 116 ? 0.4365 0.2806 0.3881 -0.0270 0.0952  -0.2418 116 GLU A CG  
947  C CD  A GLU A 116 ? 0.2747 0.1320 0.1820 -0.0426 -0.0235 -0.0396 116 GLU A CD  
948  C CD  B GLU A 116 ? 0.4181 0.2829 0.4525 -0.0736 0.1073  -0.2771 116 GLU A CD  
949  O OE1 A GLU A 116 ? 0.2819 0.1722 0.2114 0.0095  -0.0809 -0.0945 116 GLU A OE1 
950  O OE1 B GLU A 116 ? 0.1607 0.1060 0.3104 0.0931  -0.1220 -0.1388 116 GLU A OE1 
951  O OE2 A GLU A 116 ? 0.2997 0.1337 0.2600 -0.0511 -0.0187 -0.0260 116 GLU A OE2 
952  O OE2 B GLU A 116 ? 0.3284 0.1406 0.5301 0.0535  0.0646  -0.1773 116 GLU A OE2 
953  N N   . ILE A 117 ? 0.1296 0.0992 0.0836 0.0056  -0.0130 -0.0139 117 ILE A N   
954  C CA  . ILE A 117 ? 0.1147 0.0994 0.0844 0.0201  0.0050  -0.0076 117 ILE A CA  
955  C C   . ILE A 117 ? 0.1268 0.0844 0.0790 0.0103  -0.0122 -0.0222 117 ILE A C   
956  O O   . ILE A 117 ? 0.1375 0.1108 0.1003 0.0231  -0.0245 -0.0175 117 ILE A O   
957  C CB  . ILE A 117 ? 0.1334 0.1023 0.1017 0.0154  0.0019  -0.0222 117 ILE A CB  
958  C CG1 . ILE A 117 ? 0.1274 0.1138 0.1199 0.0332  0.0104  -0.0235 117 ILE A CG1 
959  C CG2 . ILE A 117 ? 0.1359 0.1046 0.1216 0.0363  0.0093  -0.0053 117 ILE A CG2 
960  C CD1 . ILE A 117 ? 0.1564 0.1538 0.1400 0.0460  -0.0258 -0.0552 117 ILE A CD1 
961  N N   . GLY A 118 ? 0.1159 0.0984 0.1066 0.0079  -0.0032 -0.0049 118 GLY A N   
962  C CA  . GLY A 118 ? 0.1209 0.0981 0.1114 0.0148  -0.0019 -0.0101 118 GLY A CA  
963  C C   . GLY A 118 ? 0.1162 0.0938 0.0782 0.0183  -0.0020 -0.0164 118 GLY A C   
964  O O   . GLY A 118 ? 0.1145 0.0905 0.0878 0.0084  0.0073  -0.0052 118 GLY A O   
965  N N   . PHE A 119 ? 0.1027 0.0955 0.0919 0.0131  -0.0006 -0.0056 119 PHE A N   
966  C CA  . PHE A 119 ? 0.1129 0.0914 0.0749 0.0164  -0.0066 -0.0030 119 PHE A CA  
967  C C   . PHE A 119 ? 0.1234 0.0877 0.0810 0.0202  0.0092  -0.0014 119 PHE A C   
968  O O   . PHE A 119 ? 0.1505 0.1105 0.0727 0.0192  0.0058  -0.0001 119 PHE A O   
969  C CB  . PHE A 119 ? 0.1193 0.0946 0.0820 0.0180  0.0031  -0.0100 119 PHE A CB  
970  C CG  . PHE A 119 ? 0.1217 0.0838 0.0681 0.0194  -0.0086 -0.0056 119 PHE A CG  
971  C CD1 . PHE A 119 ? 0.1052 0.0933 0.0899 0.0189  -0.0038 -0.0163 119 PHE A CD1 
972  C CD2 . PHE A 119 ? 0.1171 0.0966 0.0895 0.0043  0.0061  -0.0183 119 PHE A CD2 
973  C CE1 . PHE A 119 ? 0.1162 0.1152 0.0782 0.0011  -0.0012 -0.0102 119 PHE A CE1 
974  C CE2 . PHE A 119 ? 0.1136 0.1087 0.1057 0.0168  0.0192  -0.0173 119 PHE A CE2 
975  C CZ  . PHE A 119 ? 0.1121 0.1019 0.0822 0.0052  -0.0009 -0.0066 119 PHE A CZ  
976  N N   . GLY A 120 ? 0.1182 0.0810 0.0692 0.0155  0.0209  0.0018  120 GLY A N   
977  C CA  . GLY A 120 ? 0.1177 0.1068 0.0803 0.0028  0.0077  -0.0008 120 GLY A CA  
978  C C   . GLY A 120 ? 0.1297 0.0825 0.0917 0.0090  0.0165  0.0159  120 GLY A C   
979  O O   . GLY A 120 ? 0.1286 0.0981 0.1425 -0.0013 0.0174  -0.0006 120 GLY A O   
980  N N   . SER A 121 ? 0.1286 0.0937 0.0853 -0.0003 0.0015  0.0027  121 SER A N   
981  C CA  . SER A 121 ? 0.1067 0.0971 0.0848 -0.0081 -0.0020 0.0054  121 SER A CA  
982  C C   . SER A 121 ? 0.1044 0.0843 0.0900 0.0000  0.0038  0.0076  121 SER A C   
983  O O   . SER A 121 ? 0.1632 0.0929 0.0954 -0.0085 -0.0016 0.0170  121 SER A O   
984  C CB  . SER A 121 ? 0.1236 0.0900 0.1006 0.0014  -0.0197 0.0054  121 SER A CB  
985  O OG  . SER A 121 ? 0.1331 0.1123 0.1103 0.0075  -0.0156 0.0248  121 SER A OG  
986  N N   A LYS A 122 ? 0.0610 0.1220 0.0641 -0.0064 0.0342  -0.0123 122 LYS A N   
987  N N   B LYS A 122 ? 0.1257 0.0809 0.0909 -0.0019 -0.0038 -0.0107 122 LYS A N   
988  C CA  A LYS A 122 ? 0.0899 0.0723 0.0773 0.0285  0.0102  -0.0059 122 LYS A CA  
989  C CA  B LYS A 122 ? 0.1219 0.1139 0.0749 -0.0183 0.0249  -0.0168 122 LYS A CA  
990  C C   A LYS A 122 ? 0.0734 0.0769 0.0613 0.0128  -0.0079 -0.0173 122 LYS A C   
991  C C   B LYS A 122 ? 0.1649 0.0747 0.0876 0.0033  0.0341  0.0041  122 LYS A C   
992  O O   A LYS A 122 ? 0.1324 0.0703 0.0385 0.0419  0.0156  -0.0287 122 LYS A O   
993  O O   B LYS A 122 ? 0.1871 0.1262 0.0985 0.0388  -0.0112 0.0232  122 LYS A O   
994  C CB  A LYS A 122 ? 0.0796 0.0748 0.0909 0.0297  0.0079  -0.0536 122 LYS A CB  
995  C CB  B LYS A 122 ? 0.1174 0.1229 0.1021 -0.0284 -0.0075 0.0587  122 LYS A CB  
996  C CG  A LYS A 122 ? 0.1167 0.1355 0.1396 -0.0494 -0.0231 0.0869  122 LYS A CG  
997  C CG  B LYS A 122 ? 0.1553 0.2817 0.2624 -0.0469 0.1142  0.0006  122 LYS A CG  
998  C CD  A LYS A 122 ? 0.0940 0.1237 0.0964 -0.0247 -0.0078 0.0286  122 LYS A CD  
999  C CD  B LYS A 122 ? 0.1371 0.2124 0.2483 0.0546  0.0780  0.0427  122 LYS A CD  
1000 C CE  A LYS A 122 ? 0.0724 0.2978 0.0827 0.0104  -0.0021 0.0187  122 LYS A CE  
1001 C CE  B LYS A 122 ? 0.0595 0.1271 0.0828 0.0199  -0.0286 0.0716  122 LYS A CE  
1002 N NZ  A LYS A 122 ? 0.0741 0.1567 0.1873 -0.0059 0.0072  -0.1204 122 LYS A NZ  
1003 N NZ  B LYS A 122 ? 0.9738 0.1928 0.3732 -0.1915 -0.2878 -0.0047 122 LYS A NZ  
1004 N N   . VAL A 123 ? 0.0990 0.0837 0.0680 0.0237  0.0077  -0.0065 123 VAL A N   
1005 C CA  . VAL A 123 ? 0.0906 0.0815 0.0726 0.0211  0.0074  -0.0174 123 VAL A CA  
1006 C C   . VAL A 123 ? 0.1179 0.0678 0.0653 0.0233  0.0083  -0.0037 123 VAL A C   
1007 O O   . VAL A 123 ? 0.1142 0.0922 0.0795 0.0323  0.0085  -0.0030 123 VAL A O   
1008 C CB  . VAL A 123 ? 0.1077 0.0901 0.0801 0.0095  0.0128  -0.0148 123 VAL A CB  
1009 C CG1 . VAL A 123 ? 0.1133 0.1231 0.0934 0.0089  -0.0040 -0.0280 123 VAL A CG1 
1010 C CG2 . VAL A 123 ? 0.1324 0.0815 0.1268 0.0184  0.0110  -0.0102 123 VAL A CG2 
1011 N N   . THR A 124 ? 0.1070 0.0658 0.0639 0.0105  -0.0010 -0.0027 124 THR A N   
1012 C CA  . THR A 124 ? 0.0967 0.0876 0.0567 0.0081  0.0005  -0.0108 124 THR A CA  
1013 C C   . THR A 124 ? 0.1001 0.0765 0.0674 0.0090  0.0028  0.0001  124 THR A C   
1014 O O   . THR A 124 ? 0.1012 0.0830 0.0682 0.0072  0.0003  0.0006  124 THR A O   
1015 C CB  . THR A 124 ? 0.0924 0.0918 0.0676 0.0153  0.0034  -0.0225 124 THR A CB  
1016 O OG1 . THR A 124 ? 0.1049 0.0946 0.0674 -0.0061 -0.0067 -0.0086 124 THR A OG1 
1017 C CG2 . THR A 124 ? 0.0883 0.0850 0.0829 0.0082  -0.0002 -0.0127 124 THR A CG2 
1018 N N   . THR A 125 ? 0.0847 0.0734 0.0660 0.0046  0.0005  -0.0029 125 THR A N   
1019 C CA  . THR A 125 ? 0.0810 0.0778 0.0716 0.0041  0.0051  -0.0046 125 THR A CA  
1020 C C   . THR A 125 ? 0.0896 0.0649 0.0677 0.0008  0.0027  0.0080  125 THR A C   
1021 O O   . THR A 125 ? 0.0849 0.0891 0.0769 0.0098  0.0040  -0.0044 125 THR A O   
1022 C CB  . THR A 125 ? 0.0883 0.0736 0.0723 0.0028  -0.0020 0.0029  125 THR A CB  
1023 O OG1 . THR A 125 ? 0.1052 0.0696 0.0810 0.0078  -0.0020 -0.0022 125 THR A OG1 
1024 C CG2 . THR A 125 ? 0.1460 0.0848 0.0716 0.0063  -0.0119 -0.0024 125 THR A CG2 
1025 N N   . HIS A 126 ? 0.0766 0.0853 0.0615 0.0038  -0.0032 0.0024  126 HIS A N   
1026 C CA  . HIS A 126 ? 0.0676 0.0792 0.0678 0.0051  -0.0063 -0.0054 126 HIS A CA  
1027 C C   . HIS A 126 ? 0.0749 0.0834 0.0685 0.0103  -0.0054 -0.0078 126 HIS A C   
1028 O O   . HIS A 126 ? 0.0879 0.0810 0.0739 0.0052  -0.0044 -0.0030 126 HIS A O   
1029 C CB  . HIS A 126 ? 0.0782 0.0880 0.0755 0.0044  0.0073  -0.0104 126 HIS A CB  
1030 C CG  . HIS A 126 ? 0.0929 0.0691 0.0692 0.0078  0.0027  -0.0040 126 HIS A CG  
1031 N ND1 . HIS A 126 ? 0.1313 0.0863 0.0678 0.0147  0.0067  -0.0028 126 HIS A ND1 
1032 C CD2 . HIS A 126 ? 0.1279 0.0834 0.0685 0.0041  0.0003  -0.0052 126 HIS A CD2 
1033 C CE1 . HIS A 126 ? 0.1221 0.0997 0.0706 0.0271  0.0010  -0.0083 126 HIS A CE1 
1034 N NE2 . HIS A 126 ? 0.1179 0.0962 0.0789 0.0173  -0.0130 -0.0140 126 HIS A NE2 
1035 N N   . PRO A 127 ? 0.0857 0.0844 0.0691 0.0100  -0.0107 0.0024  127 PRO A N   
1036 C CA  . PRO A 127 ? 0.0958 0.0904 0.0749 0.0202  -0.0032 0.0127  127 PRO A CA  
1037 C C   . PRO A 127 ? 0.1168 0.0906 0.0578 0.0161  0.0061  0.0097  127 PRO A C   
1038 O O   . PRO A 127 ? 0.1231 0.0894 0.0928 0.0158  -0.0064 -0.0077 127 PRO A O   
1039 C CB  . PRO A 127 ? 0.0932 0.1509 0.1206 -0.0035 -0.0356 0.0445  127 PRO A CB  
1040 C CG  . PRO A 127 ? 0.1703 0.1442 0.1546 0.0063  -0.0904 -0.0122 127 PRO A CG  
1041 C CD  . PRO A 127 ? 0.1205 0.0944 0.0770 -0.0093 -0.0213 -0.0013 127 PRO A CD  
1042 N N   . LEU A 128 ? 0.1075 0.0874 0.0649 0.0078  0.0040  0.0088  128 LEU A N   
1043 C CA  . LEU A 128 ? 0.1345 0.0885 0.0683 0.0023  0.0109  0.0153  128 LEU A CA  
1044 C C   . LEU A 128 ? 0.1543 0.1057 0.0670 -0.0219 0.0185  0.0000  128 LEU A C   
1045 O O   . LEU A 128 ? 0.2026 0.1163 0.0898 -0.0456 0.0040  0.0149  128 LEU A O   
1046 C CB  . LEU A 128 ? 0.1348 0.1113 0.0657 -0.0138 0.0090  0.0037  128 LEU A CB  
1047 C CG  . LEU A 128 ? 0.1511 0.1403 0.0687 0.0183  -0.0043 -0.0021 128 LEU A CG  
1048 C CD1 . LEU A 128 ? 0.1507 0.2424 0.0831 -0.0364 0.0245  -0.0479 128 LEU A CD1 
1049 C CD2 . LEU A 128 ? 0.3308 0.1833 0.1704 0.0723  -0.1090 0.0002  128 LEU A CD2 
1050 N N   . ALA A 129 ? 0.1143 0.0758 0.0729 -0.0033 0.0049  -0.0068 129 ALA A N   
1051 C CA  . ALA A 129 ? 0.1096 0.0862 0.0788 0.0120  0.0024  -0.0172 129 ALA A CA  
1052 C C   . ALA A 129 ? 0.1101 0.0865 0.0842 0.0078  0.0012  -0.0179 129 ALA A C   
1053 O O   . ALA A 129 ? 0.1205 0.0892 0.0848 -0.0079 0.0033  -0.0189 129 ALA A O   
1054 C CB  . ALA A 129 ? 0.1130 0.1056 0.1086 0.0232  -0.0156 -0.0225 129 ALA A CB  
1055 N N   . LYS A 130 ? 0.1117 0.0968 0.0614 0.0114  0.0074  -0.0034 130 LYS A N   
1056 C CA  . LYS A 130 ? 0.1182 0.0790 0.0628 0.0269  0.0096  0.0027  130 LYS A CA  
1057 C C   . LYS A 130 ? 0.1198 0.0863 0.0808 0.0245  -0.0070 -0.0030 130 LYS A C   
1058 O O   . LYS A 130 ? 0.1142 0.0940 0.0802 0.0070  -0.0030 -0.0159 130 LYS A O   
1059 C CB  . LYS A 130 ? 0.1180 0.0997 0.0764 0.0153  0.0019  -0.0052 130 LYS A CB  
1060 C CG  . LYS A 130 ? 0.1069 0.0893 0.1045 0.0194  0.0014  -0.0129 130 LYS A CG  
1061 C CD  . LYS A 130 ? 0.1153 0.1046 0.1488 0.0107  -0.0114 -0.0169 130 LYS A CD  
1062 C CE  . LYS A 130 ? 0.1097 0.1170 0.2108 0.0368  0.0230  -0.0040 130 LYS A CE  
1063 N NZ  . LYS A 130 ? 0.1348 0.1660 0.2776 0.0352  -0.0218 -0.0887 130 LYS A NZ  
1064 N N   . ASP A 131 ? 0.1342 0.0783 0.0806 0.0210  0.0095  -0.0101 131 ASP A N   
1065 C CA  . ASP A 131 ? 0.1402 0.0802 0.0839 0.0211  0.0051  -0.0118 131 ASP A CA  
1066 C C   . ASP A 131 ? 0.1397 0.1077 0.0653 0.0106  0.0085  -0.0079 131 ASP A C   
1067 O O   . ASP A 131 ? 0.1377 0.1095 0.0877 0.0188  -0.0008 -0.0166 131 ASP A O   
1068 C CB  . ASP A 131 ? 0.1934 0.0858 0.1028 0.0112  -0.0261 0.0032  131 ASP A CB  
1069 C CG  . ASP A 131 ? 0.2187 0.1286 0.1100 0.0450  -0.0381 -0.0078 131 ASP A CG  
1070 O OD1 . ASP A 131 ? 0.1776 0.1753 0.1796 0.0600  -0.0408 -0.0237 131 ASP A OD1 
1071 O OD2 . ASP A 131 ? 0.3442 0.2632 0.1525 0.0668  -0.0680 0.0734  131 ASP A OD2 
1072 N N   . LYS A 132 ? 0.1377 0.0802 0.0725 -0.0015 0.0021  -0.0111 132 LYS A N   
1073 C CA  . LYS A 132 ? 0.1324 0.1064 0.0817 -0.0029 0.0051  -0.0177 132 LYS A CA  
1074 C C   . LYS A 132 ? 0.1148 0.0818 0.0917 0.0028  -0.0053 -0.0043 132 LYS A C   
1075 O O   . LYS A 132 ? 0.1252 0.1020 0.0907 -0.0050 -0.0017 -0.0263 132 LYS A O   
1076 C CB  . LYS A 132 ? 0.1390 0.1055 0.1398 -0.0030 0.0279  -0.0204 132 LYS A CB  
1077 C CG  . LYS A 132 ? 0.1394 0.2008 0.2352 0.0125  0.0129  -0.0302 132 LYS A CG  
1078 C CD  . LYS A 132 ? 0.2202 0.2649 0.4979 0.1023  0.0927  -0.1061 132 LYS A CD  
1079 C CE  . LYS A 132 ? 0.2109 0.3844 0.4931 0.0542  0.1291  -0.0035 132 LYS A CE  
1080 N NZ  . LYS A 132 ? 0.2994 0.5421 0.2959 -0.0594 0.1067  0.1316  132 LYS A NZ  
1081 N N   . MET A 133 ? 0.1010 0.0834 0.0741 0.0103  -0.0018 -0.0204 133 MET A N   
1082 C CA  . MET A 133 ? 0.0992 0.0675 0.0718 0.0240  -0.0125 -0.0072 133 MET A CA  
1083 C C   . MET A 133 ? 0.1074 0.0562 0.0662 0.0087  0.0011  0.0037  133 MET A C   
1084 O O   . MET A 133 ? 0.1041 0.0772 0.0758 0.0237  -0.0068 -0.0070 133 MET A O   
1085 C CB  . MET A 133 ? 0.1071 0.0762 0.0762 0.0182  -0.0021 -0.0138 133 MET A CB  
1086 C CG  . MET A 133 ? 0.1026 0.0729 0.0803 0.0169  0.0035  -0.0148 133 MET A CG  
1087 S SD  . MET A 133 ? 0.1009 0.0858 0.0874 0.0135  -0.0009 -0.0026 133 MET A SD  
1088 C CE  . MET A 133 ? 0.1077 0.1040 0.0793 0.0083  0.0060  0.0027  133 MET A CE  
1089 N N   . MET A 134 ? 0.0925 0.0715 0.0703 0.0165  0.0039  -0.0096 134 MET A N   
1090 C CA  . MET A 134 ? 0.0972 0.0746 0.0768 0.0103  0.0082  -0.0106 134 MET A CA  
1091 C C   . MET A 134 ? 0.0890 0.0615 0.0826 0.0232  0.0006  -0.0052 134 MET A C   
1092 O O   . MET A 134 ? 0.1031 0.0783 0.0758 0.0192  0.0138  -0.0039 134 MET A O   
1093 C CB  . MET A 134 ? 0.0907 0.0897 0.0837 0.0154  0.0077  -0.0121 134 MET A CB  
1094 C CG  . MET A 134 ? 0.1011 0.0802 0.1038 0.0110  0.0128  -0.0158 134 MET A CG  
1095 S SD  . MET A 134 ? 0.0999 0.0902 0.1083 0.0127  0.0147  -0.0066 134 MET A SD  
1096 C CE  . MET A 134 ? 0.1031 0.1130 0.1077 0.0411  0.0169  -0.0027 134 MET A CE  
1097 N N   . ASN A 135 ? 0.0965 0.0701 0.0861 0.0127  0.0084  -0.0067 135 ASN A N   
1098 C CA  . ASN A 135 ? 0.1049 0.0709 0.0770 0.0015  0.0124  0.0008  135 ASN A CA  
1099 C C   . ASN A 135 ? 0.0875 0.0757 0.0889 -0.0007 0.0082  -0.0054 135 ASN A C   
1100 O O   . ASN A 135 ? 0.1080 0.0794 0.1028 0.0110  -0.0090 0.0006  135 ASN A O   
1101 C CB  . ASN A 135 ? 0.1067 0.1125 0.1055 0.0065  0.0274  -0.0010 135 ASN A CB  
1102 C CG  . ASN A 135 ? 0.1413 0.1561 0.1680 -0.0553 0.0475  -0.0345 135 ASN A CG  
1103 O OD1 . ASN A 135 ? 0.2432 0.1445 0.2721 -0.0514 0.1242  -0.0568 135 ASN A OD1 
1104 N ND2 . ASN A 135 ? 0.3739 0.2019 0.3518 -0.1202 0.2509  -0.0671 135 ASN A ND2 
1105 N N   . GLY A 136 ? 0.1203 0.0718 0.0813 0.0104  0.0131  -0.0041 136 GLY A N   
1106 C CA  . GLY A 136 ? 0.0981 0.0842 0.0669 -0.0048 -0.0033 -0.0039 136 GLY A CA  
1107 C C   . GLY A 136 ? 0.1156 0.0535 0.0744 0.0129  0.0082  0.0053  136 GLY A C   
1108 O O   . GLY A 136 ? 0.1224 0.1046 0.0766 0.0096  0.0238  -0.0088 136 GLY A O   
1109 N N   . GLY A 137 ? 0.0875 0.0712 0.0873 0.0107  0.0154  -0.0002 137 GLY A N   
1110 C CA  . GLY A 137 ? 0.0771 0.0885 0.0844 0.0179  0.0131  0.0034  137 GLY A CA  
1111 C C   . GLY A 137 ? 0.0809 0.0779 0.0604 0.0202  0.0006  -0.0109 137 GLY A C   
1112 O O   . GLY A 137 ? 0.0920 0.1048 0.0817 0.0202  0.0162  -0.0042 137 GLY A O   
1113 N N   . HIS A 138 ? 0.0824 0.0729 0.0665 0.0127  0.0106  0.0014  138 HIS A N   
1114 C CA  . HIS A 138 ? 0.0917 0.0703 0.0851 0.0207  -0.0064 -0.0006 138 HIS A CA  
1115 C C   . HIS A 138 ? 0.0916 0.0771 0.0747 0.0206  -0.0018 0.0024  138 HIS A C   
1116 O O   . HIS A 138 ? 0.1263 0.0857 0.0874 0.0027  -0.0059 0.0157  138 HIS A O   
1117 C CB  . HIS A 138 ? 0.0947 0.0874 0.1045 0.0164  -0.0074 -0.0084 138 HIS A CB  
1118 C CG  . HIS A 138 ? 0.0924 0.0756 0.0884 0.0213  -0.0114 -0.0029 138 HIS A CG  
1119 N ND1 . HIS A 138 ? 0.1114 0.0898 0.0902 0.0165  0.0054  -0.0030 138 HIS A ND1 
1120 C CD2 . HIS A 138 ? 0.1098 0.1110 0.0911 0.0027  -0.0052 -0.0035 138 HIS A CD2 
1121 C CE1 . HIS A 138 ? 0.1194 0.0907 0.1019 0.0076  -0.0063 -0.0064 138 HIS A CE1 
1122 N NE2 . HIS A 138 ? 0.1010 0.0889 0.1011 0.0194  -0.0009 -0.0027 138 HIS A NE2 
1123 N N   . TYR A 139 ? 0.1140 0.0711 0.0817 0.0097  -0.0042 -0.0083 139 TYR A N   
1124 C CA  . TYR A 139 ? 0.1095 0.0842 0.0765 0.0022  0.0033  0.0017  139 TYR A CA  
1125 C C   . TYR A 139 ? 0.1132 0.0843 0.0919 0.0074  -0.0031 -0.0053 139 TYR A C   
1126 O O   . TYR A 139 ? 0.1182 0.0924 0.1174 0.0219  0.0037  0.0113  139 TYR A O   
1127 C CB  . TYR A 139 ? 0.1191 0.0761 0.0897 0.0051  -0.0121 -0.0086 139 TYR A CB  
1128 C CG  . TYR A 139 ? 0.1154 0.0889 0.0748 0.0126  -0.0023 -0.0085 139 TYR A CG  
1129 C CD1 . TYR A 139 ? 0.1242 0.0872 0.0805 0.0093  -0.0028 -0.0016 139 TYR A CD1 
1130 C CD2 . TYR A 139 ? 0.1048 0.0787 0.0847 0.0010  -0.0050 -0.0106 139 TYR A CD2 
1131 C CE1 . TYR A 139 ? 0.1244 0.0845 0.0933 0.0055  -0.0043 -0.0125 139 TYR A CE1 
1132 C CE2 . TYR A 139 ? 0.1108 0.0806 0.0654 0.0148  -0.0081 -0.0191 139 TYR A CE2 
1133 C CZ  . TYR A 139 ? 0.1076 0.0957 0.0688 0.0021  -0.0057 -0.0139 139 TYR A CZ  
1134 O OH  . TYR A 139 ? 0.1089 0.1001 0.1075 0.0115  -0.0059 -0.0296 139 TYR A OH  
1135 N N   . THR A 140 ? 0.1068 0.0850 0.0948 0.0084  0.0039  -0.0072 140 THR A N   
1136 C CA  . THR A 140 ? 0.1052 0.0986 0.0837 0.0006  0.0099  -0.0088 140 THR A CA  
1137 C C   . THR A 140 ? 0.1054 0.0819 0.0787 0.0016  0.0177  -0.0065 140 THR A C   
1138 O O   . THR A 140 ? 0.1353 0.1059 0.0772 0.0297  0.0101  0.0009  140 THR A O   
1139 C CB  . THR A 140 ? 0.1135 0.1723 0.0826 -0.0060 0.0205  -0.0481 140 THR A CB  
1140 O OG1 . THR A 140 ? 0.1361 0.1642 0.1413 -0.0030 0.0445  -0.0637 140 THR A OG1 
1141 C CG2 . THR A 140 ? 0.1034 0.3278 0.1253 -0.0322 0.0316  -0.0579 140 THR A CG2 
1142 N N   . TYR A 141 ? 0.1265 0.0725 0.0857 0.0410  0.0182  -0.0169 141 TYR A N   
1143 C CA  . TYR A 141 ? 0.1210 0.0807 0.0841 0.0200  0.0052  -0.0124 141 TYR A CA  
1144 C C   . TYR A 141 ? 0.0969 0.0981 0.1197 0.0154  0.0206  -0.0187 141 TYR A C   
1145 O O   . TYR A 141 ? 0.1282 0.1304 0.3015 0.0106  0.0653  -0.0918 141 TYR A O   
1146 C CB  . TYR A 141 ? 0.1406 0.0917 0.0799 0.0240  0.0069  -0.0037 141 TYR A CB  
1147 C CG  . TYR A 141 ? 0.1194 0.0734 0.0862 0.0254  0.0000  -0.0056 141 TYR A CG  
1148 C CD1 . TYR A 141 ? 0.1197 0.0813 0.0856 0.0243  -0.0123 -0.0023 141 TYR A CD1 
1149 C CD2 . TYR A 141 ? 0.1109 0.0959 0.0784 0.0152  -0.0017 -0.0010 141 TYR A CD2 
1150 C CE1 . TYR A 141 ? 0.1091 0.0868 0.0895 0.0252  -0.0051 -0.0003 141 TYR A CE1 
1151 C CE2 . TYR A 141 ? 0.1211 0.1065 0.0880 0.0375  -0.0162 -0.0156 141 TYR A CE2 
1152 C CZ  . TYR A 141 ? 0.1230 0.0843 0.0749 0.0234  -0.0011 0.0027  141 TYR A CZ  
1153 O OH  . TYR A 141 ? 0.1232 0.0941 0.0858 0.0315  0.0026  -0.0049 141 TYR A OH  
1154 N N   . SER A 142 ? 0.1014 0.0828 0.1152 0.0196  0.0105  -0.0121 142 SER A N   
1155 C CA  . SER A 142 ? 0.1017 0.1005 0.1284 0.0227  0.0128  -0.0281 142 SER A CA  
1156 C C   . SER A 142 ? 0.0954 0.0811 0.1281 0.0068  0.0114  -0.0175 142 SER A C   
1157 O O   . SER A 142 ? 0.0964 0.1036 0.1172 0.0115  0.0067  -0.0266 142 SER A O   
1158 C CB  . SER A 142 ? 0.2030 0.1003 0.1228 -0.0082 0.0019  -0.0090 142 SER A CB  
1159 O OG  . SER A 142 ? 0.2229 0.1122 0.1435 -0.0097 -0.0116 -0.0248 142 SER A OG  
1160 N N   . GLU A 143 ? 0.0962 0.1012 0.1384 0.0150  -0.0009 -0.0228 143 GLU A N   
1161 C CA  . GLU A 143 ? 0.1506 0.1091 0.1364 0.0162  -0.0224 -0.0161 143 GLU A CA  
1162 C C   . GLU A 143 ? 0.1277 0.1021 0.1436 0.0017  -0.0369 -0.0212 143 GLU A C   
1163 O O   . GLU A 143 ? 0.1924 0.1295 0.1452 0.0091  -0.0315 -0.0337 143 GLU A O   
1164 C CB  . GLU A 143 ? 0.2283 0.1265 0.1991 0.0259  -0.0939 -0.0085 143 GLU A CB  
1165 C CG  . GLU A 143 ? 0.4180 0.1130 0.2506 0.0584  -0.0952 -0.0117 143 GLU A CG  
1166 C CD  . GLU A 143 ? 0.5271 0.3532 0.4334 0.1900  -0.1469 0.1355  143 GLU A CD  
1167 O OE1 . GLU A 143 ? 0.7781 0.6789 0.7982 0.1136  -0.2296 0.4888  143 GLU A OE1 
1168 O OE2 . GLU A 143 ? 0.6038 0.7624 0.7315 -0.0119 -0.4175 0.3596  143 GLU A OE2 
1169 N N   . ASN A 144 ? 0.1196 0.0878 0.1395 0.0195  -0.0102 -0.0256 144 ASN A N   
1170 C CA  . ASN A 144 ? 0.1116 0.0911 0.1546 0.0096  -0.0038 -0.0158 144 ASN A CA  
1171 C C   . ASN A 144 ? 0.1029 0.0692 0.1345 0.0060  -0.0092 0.0007  144 ASN A C   
1172 O O   . ASN A 144 ? 0.1112 0.0988 0.1352 -0.0031 0.0002  -0.0175 144 ASN A O   
1173 C CB  . ASN A 144 ? 0.1418 0.0855 0.1701 0.0027  0.0267  -0.0161 144 ASN A CB  
1174 C CG  . ASN A 144 ? 0.1328 0.1987 0.2063 -0.0292 0.0427  -0.0412 144 ASN A CG  
1175 O OD1 . ASN A 144 ? 0.1367 0.3726 0.2449 -0.0207 0.0262  -0.0478 144 ASN A OD1 
1176 N ND2 . ASN A 144 ? 0.1658 0.2441 0.2097 -0.0092 0.0594  -0.0396 144 ASN A ND2 
1177 N N   . ARG A 145 ? 0.0879 0.1006 0.1293 -0.0027 0.0017  -0.0183 145 ARG A N   
1178 C CA  . ARG A 145 ? 0.0933 0.1033 0.0981 -0.0058 0.0021  -0.0168 145 ARG A CA  
1179 C C   . ARG A 145 ? 0.0939 0.0898 0.0876 0.0007  0.0073  -0.0277 145 ARG A C   
1180 O O   . ARG A 145 ? 0.0925 0.1003 0.0885 0.0043  0.0068  -0.0185 145 ARG A O   
1181 C CB  . ARG A 145 ? 0.0919 0.0960 0.1403 0.0103  -0.0248 -0.0215 145 ARG A CB  
1182 C CG  . ARG A 145 ? 0.1180 0.1344 0.1452 -0.0156 -0.0454 -0.0105 145 ARG A CG  
1183 C CD  . ARG A 145 ? 0.1293 0.1330 0.1281 -0.0122 -0.0204 -0.0236 145 ARG A CD  
1184 N NE  . ARG A 145 ? 0.1351 0.1448 0.1258 -0.0167 -0.0032 -0.0097 145 ARG A NE  
1185 C CZ  . ARG A 145 ? 0.1733 0.1764 0.1046 -0.0436 -0.0036 -0.0442 145 ARG A CZ  
1186 N NH1 . ARG A 145 ? 0.2511 0.2229 0.1303 -0.0737 0.0034  0.0153  145 ARG A NH1 
1187 N NH2 . ARG A 145 ? 0.1551 0.2588 0.1937 -0.0457 0.0232  -0.1040 145 ARG A NH2 
1188 N N   . VAL A 146 ? 0.0843 0.0971 0.0962 -0.0042 0.0107  -0.0134 146 VAL A N   
1189 C CA  . VAL A 146 ? 0.0870 0.0715 0.1005 0.0027  0.0054  -0.0218 146 VAL A CA  
1190 C C   . VAL A 146 ? 0.1053 0.0727 0.0968 0.0055  0.0190  -0.0130 146 VAL A C   
1191 O O   . VAL A 146 ? 0.1027 0.1352 0.1171 0.0023  0.0223  -0.0317 146 VAL A O   
1192 C CB  . VAL A 146 ? 0.1122 0.0726 0.1283 0.0154  0.0035  -0.0233 146 VAL A CB  
1193 C CG1 . VAL A 146 ? 0.1809 0.0965 0.1217 0.0143  -0.0150 0.0007  146 VAL A CG1 
1194 C CG2 . VAL A 146 ? 0.1607 0.0799 0.1200 0.0306  0.0134  -0.0061 146 VAL A CG2 
1195 N N   . GLU A 147 ? 0.1156 0.0864 0.0840 0.0051  0.0154  -0.0186 147 GLU A N   
1196 C CA  . GLU A 147 ? 0.0978 0.0965 0.0824 0.0152  0.0232  -0.0111 147 GLU A CA  
1197 C C   . GLU A 147 ? 0.1021 0.0923 0.0880 -0.0022 0.0142  -0.0162 147 GLU A C   
1198 O O   . GLU A 147 ? 0.0955 0.2138 0.0977 -0.0034 0.0188  0.0259  147 GLU A O   
1199 C CB  . GLU A 147 ? 0.1187 0.0853 0.1211 0.0079  -0.0038 -0.0302 147 GLU A CB  
1200 C CG  . GLU A 147 ? 0.1473 0.1006 0.1155 0.0072  0.0210  -0.0280 147 GLU A CG  
1201 C CD  . GLU A 147 ? 0.1487 0.1246 0.1487 0.0130  0.0361  -0.0102 147 GLU A CD  
1202 O OE1 . GLU A 147 ? 0.1231 0.1706 0.1942 0.0136  0.0385  0.0194  147 GLU A OE1 
1203 O OE2 . GLU A 147 ? 0.2155 0.3071 0.1692 -0.0306 0.0645  0.0416  147 GLU A OE2 
1204 N N   . LYS A 148 ? 0.1049 0.1798 0.0889 0.0068  0.0282  0.0104  148 LYS A N   
1205 C CA  . LYS A 148 ? 0.1398 0.1792 0.0967 0.0189  0.0158  0.0072  148 LYS A CA  
1206 C C   . LYS A 148 ? 0.1254 0.1783 0.0935 0.0080  0.0315  0.0098  148 LYS A C   
1207 O O   . LYS A 148 ? 0.1452 0.2573 0.1319 -0.0401 0.0488  -0.0288 148 LYS A O   
1208 C CB  . LYS A 148 ? 0.1615 0.1833 0.1013 0.0263  0.0391  0.0131  148 LYS A CB  
1209 C CG  . LYS A 148 ? 0.1716 0.1650 0.1051 0.0349  0.0230  -0.0019 148 LYS A CG  
1210 C CD  . LYS A 148 ? 0.1961 0.1646 0.1444 0.0432  0.0336  0.0030  148 LYS A CD  
1211 C CE  . LYS A 148 ? 0.2474 0.1882 0.1554 0.0505  0.0230  0.0306  148 LYS A CE  
1212 N NZ  . LYS A 148 ? 0.2903 0.1731 0.1567 0.0373  -0.0029 0.0280  148 LYS A NZ  
1213 N N   . ASP A 149 ? 0.1166 0.1280 0.1124 0.0192  0.0458  0.0217  149 ASP A N   
1214 C CA  . ASP A 149 ? 0.1226 0.1298 0.1134 0.0103  0.0429  0.0187  149 ASP A CA  
1215 C C   . ASP A 149 ? 0.1611 0.1806 0.1063 0.0126  0.0346  0.0340  149 ASP A C   
1216 O O   . ASP A 149 ? 0.1610 0.1662 0.1093 0.0098  0.0020  -0.0188 149 ASP A O   
1217 C CB  . ASP A 149 ? 0.1731 0.1295 0.1177 0.0141  0.0308  0.0175  149 ASP A CB  
1218 C CG  . ASP A 149 ? 0.2309 0.1074 0.0869 -0.0156 0.0207  -0.0043 149 ASP A CG  
1219 O OD1 . ASP A 149 ? 0.3368 0.1259 0.1307 -0.0248 0.0930  0.0038  149 ASP A OD1 
1220 O OD2 . ASP A 149 ? 0.1679 0.1169 0.0994 -0.0239 0.0101  0.0009  149 ASP A OD2 
1221 N N   . GLY A 150 ? 0.1593 0.2259 0.1645 0.0176  0.0235  0.0803  150 GLY A N   
1222 C CA  . GLY A 150 ? 0.1664 0.2913 0.1418 0.0385  0.0400  0.0937  150 GLY A CA  
1223 C C   . GLY A 150 ? 0.1589 0.1703 0.1024 0.0031  0.0174  0.0556  150 GLY A C   
1224 O O   . GLY A 150 ? 0.2333 0.2223 0.1458 -0.0196 -0.0058 -0.0002 150 GLY A O   
1225 N N   . LEU A 151 ? 0.1641 0.1808 0.0954 0.0075  0.0189  0.0177  151 LEU A N   
1226 C CA  . LEU A 151 ? 0.1583 0.1459 0.0681 0.0356  0.0008  0.0130  151 LEU A CA  
1227 C C   . LEU A 151 ? 0.1371 0.0932 0.0662 0.0273  -0.0002 -0.0083 151 LEU A C   
1228 O O   . LEU A 151 ? 0.1365 0.1277 0.0808 0.0333  0.0036  -0.0039 151 LEU A O   
1229 C CB  . LEU A 151 ? 0.1865 0.1715 0.0694 0.0165  -0.0120 -0.0019 151 LEU A CB  
1230 C CG  . LEU A 151 ? 0.2233 0.2303 0.0776 0.0569  -0.0064 0.0339  151 LEU A CG  
1231 C CD1 . LEU A 151 ? 0.2947 0.3452 0.0741 0.0218  -0.0215 0.0186  151 LEU A CD1 
1232 C CD2 . LEU A 151 ? 0.2399 0.2140 0.1479 0.0430  0.0133  0.0699  151 LEU A CD2 
1233 N N   . ILE A 152 ? 0.1199 0.1014 0.0745 0.0153  0.0058  0.0016  152 ILE A N   
1234 C CA  . ILE A 152 ? 0.1455 0.0760 0.0682 0.0196  0.0022  -0.0104 152 ILE A CA  
1235 C C   . ILE A 152 ? 0.1170 0.0837 0.0606 0.0183  0.0133  -0.0032 152 ILE A C   
1236 O O   . ILE A 152 ? 0.1169 0.0967 0.0819 0.0201  0.0235  -0.0083 152 ILE A O   
1237 C CB  . ILE A 152 ? 0.1264 0.0808 0.0906 0.0299  -0.0053 -0.0097 152 ILE A CB  
1238 C CG1 . ILE A 152 ? 0.1410 0.1032 0.0904 0.0183  -0.0047 -0.0252 152 ILE A CG1 
1239 C CG2 . ILE A 152 ? 0.1466 0.0902 0.1012 0.0092  -0.0230 0.0103  152 ILE A CG2 
1240 C CD1 . ILE A 152 ? 0.1370 0.1102 0.1450 0.0036  -0.0227 -0.0187 152 ILE A CD1 
1241 N N   . LEU A 153 ? 0.1021 0.0844 0.0573 0.0151  0.0035  -0.0061 153 LEU A N   
1242 C CA  . LEU A 153 ? 0.1065 0.0724 0.0667 0.0021  -0.0014 0.0016  153 LEU A CA  
1243 C C   . LEU A 153 ? 0.0894 0.0693 0.0632 0.0017  -0.0076 -0.0055 153 LEU A C   
1244 O O   . LEU A 153 ? 0.0862 0.1086 0.0750 0.0142  -0.0013 0.0110  153 LEU A O   
1245 C CB  . LEU A 153 ? 0.1230 0.0798 0.0783 0.0119  0.0064  0.0077  153 LEU A CB  
1246 C CG  . LEU A 153 ? 0.2062 0.0704 0.1038 0.0093  -0.0054 -0.0167 153 LEU A CG  
1247 C CD1 . LEU A 153 ? 0.2479 0.0861 0.1462 0.0040  -0.0154 0.0063  153 LEU A CD1 
1248 C CD2 . LEU A 153 ? 0.1875 0.1383 0.1059 0.0141  0.0035  -0.0171 153 LEU A CD2 
1249 N N   . THR A 154 ? 0.0797 0.0807 0.0604 0.0110  0.0095  -0.0105 154 THR A N   
1250 C CA  . THR A 154 ? 0.0964 0.0710 0.0572 0.0137  0.0039  -0.0048 154 THR A CA  
1251 C C   . THR A 154 ? 0.0848 0.0717 0.0632 0.0149  0.0072  -0.0024 154 THR A C   
1252 O O   . THR A 154 ? 0.0976 0.0873 0.0693 0.0020  0.0086  -0.0095 154 THR A O   
1253 C CB  . THR A 154 ? 0.0973 0.0757 0.0778 0.0172  0.0029  -0.0075 154 THR A CB  
1254 O OG1 . THR A 154 ? 0.1035 0.0807 0.0818 0.0258  -0.0025 -0.0076 154 THR A OG1 
1255 C CG2 . THR A 154 ? 0.1212 0.0727 0.0784 0.0042  -0.0034 -0.0036 154 THR A CG2 
1256 N N   . SER A 155 ? 0.0823 0.0835 0.0503 0.0128  0.0074  -0.0104 155 SER A N   
1257 C CA  . SER A 155 ? 0.0877 0.0694 0.0632 0.0116  0.0068  -0.0081 155 SER A CA  
1258 C C   . SER A 155 ? 0.0910 0.0778 0.0553 0.0129  -0.0035 -0.0091 155 SER A C   
1259 O O   . SER A 155 ? 0.1107 0.0916 0.0672 -0.0082 -0.0001 -0.0031 155 SER A O   
1260 C CB  . SER A 155 ? 0.0940 0.0676 0.0682 0.0103  -0.0055 -0.0140 155 SER A CB  
1261 O OG  . SER A 155 ? 0.1117 0.0764 0.0741 0.0041  -0.0092 -0.0122 155 SER A OG  
1262 N N   . ARG A 156 ? 0.1167 0.0557 0.0613 0.0063  -0.0121 -0.0068 156 ARG A N   
1263 C CA  . ARG A 156 ? 0.1047 0.0800 0.0616 0.0053  -0.0100 -0.0023 156 ARG A CA  
1264 C C   . ARG A 156 ? 0.1001 0.0661 0.0721 -0.0098 -0.0055 -0.0040 156 ARG A C   
1265 O O   . ARG A 156 ? 0.1536 0.0754 0.1053 -0.0076 0.0262  0.0063  156 ARG A O   
1266 C CB  . ARG A 156 ? 0.1068 0.0791 0.0619 -0.0035 -0.0127 -0.0038 156 ARG A CB  
1267 C CG  . ARG A 156 ? 0.1036 0.0789 0.0922 -0.0021 -0.0005 0.0021  156 ARG A CG  
1268 C CD  . ARG A 156 ? 0.1011 0.1011 0.1083 -0.0102 -0.0089 0.0059  156 ARG A CD  
1269 N NE  . ARG A 156 ? 0.0836 0.0861 0.1323 0.0041  -0.0071 -0.0102 156 ARG A NE  
1270 C CZ  . ARG A 156 ? 0.0798 0.1051 0.0891 0.0078  0.0085  0.0035  156 ARG A CZ  
1271 N NH1 . ARG A 156 ? 0.1058 0.1288 0.1722 0.0100  -0.0381 0.0060  156 ARG A NH1 
1272 N NH2 . ARG A 156 ? 0.1292 0.0935 0.1039 0.0207  -0.0086 -0.0018 156 ARG A NH2 
1273 N N   . GLY A 157 ? 0.1066 0.0667 0.0699 0.0005  0.0005  0.0105  157 GLY A N   
1274 C CA  . GLY A 157 ? 0.1111 0.0915 0.0728 0.0020  0.0071  -0.0017 157 GLY A CA  
1275 C C   . GLY A 157 ? 0.0993 0.0848 0.0673 -0.0040 -0.0104 -0.0060 157 GLY A C   
1276 O O   . GLY A 157 ? 0.1064 0.0870 0.0681 0.0036  -0.0073 -0.0041 157 GLY A O   
1277 N N   . PRO A 158 ? 0.1061 0.0892 0.0649 0.0027  -0.0019 0.0000  158 PRO A N   
1278 C CA  . PRO A 158 ? 0.1078 0.1039 0.0770 0.0093  0.0102  -0.0093 158 PRO A CA  
1279 C C   . PRO A 158 ? 0.1128 0.0760 0.0691 0.0194  0.0079  -0.0004 158 PRO A C   
1280 O O   . PRO A 158 ? 0.1426 0.0819 0.0736 0.0313  0.0091  -0.0079 158 PRO A O   
1281 C CB  . PRO A 158 ? 0.1415 0.1035 0.0869 -0.0051 0.0248  -0.0059 158 PRO A CB  
1282 C CG  . PRO A 158 ? 0.1397 0.1210 0.0835 -0.0209 0.0206  -0.0167 158 PRO A CG  
1283 C CD  . PRO A 158 ? 0.1185 0.1018 0.0827 -0.0128 -0.0023 -0.0049 158 PRO A CD  
1284 N N   . GLY A 159 ? 0.1155 0.0655 0.0700 0.0030  0.0034  0.0001  159 GLY A N   
1285 C CA  . GLY A 159 ? 0.1252 0.0631 0.0695 0.0016  -0.0001 0.0019  159 GLY A CA  
1286 C C   . GLY A 159 ? 0.1222 0.0634 0.0722 -0.0081 0.0021  -0.0040 159 GLY A C   
1287 O O   . GLY A 159 ? 0.1455 0.1093 0.0877 -0.0349 0.0044  -0.0172 159 GLY A O   
1288 N N   . THR A 160 ? 0.0991 0.0790 0.0607 -0.0032 0.0010  -0.0092 160 THR A N   
1289 C CA  . THR A 160 ? 0.0934 0.0683 0.0722 -0.0043 0.0038  -0.0002 160 THR A CA  
1290 C C   . THR A 160 ? 0.1037 0.0773 0.0681 -0.0008 0.0030  -0.0049 160 THR A C   
1291 O O   . THR A 160 ? 0.0983 0.0899 0.0699 0.0049  0.0004  -0.0034 160 THR A O   
1292 C CB  . THR A 160 ? 0.0931 0.0819 0.0632 -0.0026 0.0033  -0.0098 160 THR A CB  
1293 O OG1 . THR A 160 ? 0.0950 0.0729 0.0855 0.0008  0.0047  -0.0018 160 THR A OG1 
1294 C CG2 . THR A 160 ? 0.1157 0.1005 0.0971 0.0229  -0.0090 -0.0089 160 THR A CG2 
1295 N N   . SER A 161 ? 0.0929 0.0824 0.0646 -0.0057 0.0000  -0.0049 161 SER A N   
1296 C CA  . SER A 161 ? 0.0980 0.0731 0.0552 -0.0016 0.0058  -0.0099 161 SER A CA  
1297 C C   . SER A 161 ? 0.0746 0.0813 0.0669 -0.0013 0.0144  -0.0067 161 SER A C   
1298 O O   . SER A 161 ? 0.0985 0.0745 0.0761 -0.0045 0.0018  -0.0025 161 SER A O   
1299 C CB  . SER A 161 ? 0.0919 0.1285 0.0676 -0.0168 0.0136  0.0059  161 SER A CB  
1300 O OG  . SER A 161 ? 0.1057 0.1446 0.1123 -0.0330 -0.0086 0.0405  161 SER A OG  
1301 N N   . PHE A 162 ? 0.1003 0.0685 0.0641 0.0007  0.0012  -0.0106 162 PHE A N   
1302 C CA  . PHE A 162 ? 0.1058 0.0740 0.0786 0.0017  0.0012  -0.0088 162 PHE A CA  
1303 C C   . PHE A 162 ? 0.1084 0.0746 0.0818 -0.0102 0.0090  -0.0079 162 PHE A C   
1304 O O   . PHE A 162 ? 0.1265 0.0736 0.0845 -0.0109 0.0028  -0.0067 162 PHE A O   
1305 C CB  . PHE A 162 ? 0.1061 0.0739 0.0785 0.0031  -0.0060 -0.0122 162 PHE A CB  
1306 C CG  . PHE A 162 ? 0.1096 0.0666 0.0753 -0.0072 -0.0020 -0.0110 162 PHE A CG  
1307 C CD1 . PHE A 162 ? 0.1552 0.0964 0.0758 -0.0254 0.0033  -0.0033 162 PHE A CD1 
1308 C CD2 . PHE A 162 ? 0.1231 0.0651 0.0919 0.0005  -0.0035 -0.0165 162 PHE A CD2 
1309 C CE1 . PHE A 162 ? 0.1421 0.1969 0.0640 -0.0216 0.0060  -0.0073 162 PHE A CE1 
1310 C CE2 . PHE A 162 ? 0.1270 0.0789 0.1219 -0.0056 0.0023  -0.0367 162 PHE A CE2 
1311 C CZ  . PHE A 162 ? 0.1190 0.1457 0.1103 -0.0355 0.0145  -0.0566 162 PHE A CZ  
1312 N N   . GLU A 163 ? 0.1010 0.0939 0.0785 -0.0046 0.0071  -0.0150 163 GLU A N   
1313 C CA  . GLU A 163 ? 0.1145 0.0879 0.0830 -0.0083 0.0218  -0.0013 163 GLU A CA  
1314 C C   . GLU A 163 ? 0.1052 0.0743 0.0799 0.0119  0.0178  -0.0064 163 GLU A C   
1315 O O   . GLU A 163 ? 0.1023 0.0883 0.0821 0.0088  0.0138  0.0051  163 GLU A O   
1316 C CB  . GLU A 163 ? 0.0942 0.1149 0.1085 0.0010  0.0115  -0.0165 163 GLU A CB  
1317 C CG  . GLU A 163 ? 0.1364 0.1357 0.1530 -0.0178 -0.0208 -0.0282 163 GLU A CG  
1318 C CD  . GLU A 163 ? 0.1367 0.2804 0.1595 0.0668  -0.0184 0.0197  163 GLU A CD  
1319 O OE1 . GLU A 163 ? 0.1984 0.2194 0.2683 0.0588  0.0396  0.0076  163 GLU A OE1 
1320 O OE2 . GLU A 163 ? 0.2748 0.3322 0.1501 0.0881  0.0223  0.0191  163 GLU A OE2 
1321 N N   . PHE A 164 ? 0.0877 0.0794 0.0563 0.0159  0.0037  -0.0072 164 PHE A N   
1322 C CA  . PHE A 164 ? 0.0996 0.0615 0.0667 0.0140  0.0051  -0.0010 164 PHE A CA  
1323 C C   . PHE A 164 ? 0.0921 0.0564 0.0738 0.0102  -0.0061 -0.0041 164 PHE A C   
1324 O O   . PHE A 164 ? 0.0997 0.0724 0.0717 0.0142  0.0047  0.0015  164 PHE A O   
1325 C CB  . PHE A 164 ? 0.0988 0.0667 0.0715 0.0143  -0.0038 0.0056  164 PHE A CB  
1326 C CG  . PHE A 164 ? 0.1053 0.0544 0.0717 0.0109  -0.0015 0.0058  164 PHE A CG  
1327 C CD1 . PHE A 164 ? 0.1015 0.0698 0.0616 0.0152  0.0061  0.0015  164 PHE A CD1 
1328 C CD2 . PHE A 164 ? 0.0978 0.0818 0.0747 0.0150  -0.0007 -0.0069 164 PHE A CD2 
1329 C CE1 . PHE A 164 ? 0.1071 0.0759 0.0736 0.0092  -0.0051 0.0030  164 PHE A CE1 
1330 C CE2 . PHE A 164 ? 0.1078 0.0766 0.0932 0.0138  -0.0134 -0.0039 164 PHE A CE2 
1331 C CZ  . PHE A 164 ? 0.1087 0.0835 0.0803 0.0057  -0.0066 -0.0017 164 PHE A CZ  
1332 N N   . ALA A 165 ? 0.0964 0.0516 0.0744 0.0099  0.0028  0.0060  165 ALA A N   
1333 C CA  . ALA A 165 ? 0.1034 0.0499 0.0764 0.0096  0.0041  0.0032  165 ALA A CA  
1334 C C   . ALA A 165 ? 0.0993 0.0592 0.0702 0.0198  0.0129  0.0090  165 ALA A C   
1335 O O   . ALA A 165 ? 0.1057 0.0722 0.0725 0.0165  0.0090  0.0037  165 ALA A O   
1336 C CB  . ALA A 165 ? 0.1187 0.0730 0.0945 0.0199  0.0283  -0.0028 165 ALA A CB  
1337 N N   . LEU A 166 ? 0.1011 0.0677 0.0705 0.0122  0.0124  0.0101  166 LEU A N   
1338 C CA  . LEU A 166 ? 0.1065 0.0745 0.0791 0.0094  0.0202  0.0017  166 LEU A CA  
1339 C C   . LEU A 166 ? 0.0955 0.0744 0.0836 0.0138  0.0181  0.0002  166 LEU A C   
1340 O O   . LEU A 166 ? 0.1403 0.0830 0.0753 0.0119  0.0185  0.0088  166 LEU A O   
1341 C CB  . LEU A 166 ? 0.1189 0.0887 0.0860 -0.0045 0.0166  -0.0027 166 LEU A CB  
1342 C CG  . LEU A 166 ? 0.1382 0.0736 0.0922 -0.0071 0.0193  -0.0029 166 LEU A CG  
1343 C CD1 . LEU A 166 ? 0.1562 0.1245 0.1073 -0.0253 0.0112  -0.0215 166 LEU A CD1 
1344 C CD2 . LEU A 166 ? 0.1886 0.0756 0.1156 0.0014  0.0365  0.0023  166 LEU A CD2 
1345 N N   . ALA A 167 ? 0.1231 0.0707 0.0896 0.0035  0.0221  -0.0081 167 ALA A N   
1346 C CA  . ALA A 167 ? 0.1069 0.0756 0.0968 0.0220  0.0185  -0.0053 167 ALA A CA  
1347 C C   . ALA A 167 ? 0.1168 0.0718 0.0891 0.0193  0.0223  0.0010  167 ALA A C   
1348 O O   . ALA A 167 ? 0.1389 0.1025 0.0843 0.0094  0.0250  -0.0095 167 ALA A O   
1349 C CB  . ALA A 167 ? 0.1289 0.0802 0.1032 0.0287  0.0177  0.0002  167 ALA A CB  
1350 N N   . ILE A 168 ? 0.1116 0.0674 0.0796 0.0036  0.0131  0.0003  168 ILE A N   
1351 C CA  . ILE A 168 ? 0.1218 0.0740 0.0761 0.0193  0.0058  -0.0119 168 ILE A CA  
1352 C C   . ILE A 168 ? 0.1417 0.0734 0.0716 0.0183  0.0068  -0.0100 168 ILE A C   
1353 O O   . ILE A 168 ? 0.1437 0.0978 0.0652 0.0135  0.0113  -0.0029 168 ILE A O   
1354 C CB  . ILE A 168 ? 0.1104 0.0844 0.0826 0.0158  0.0075  -0.0090 168 ILE A CB  
1355 C CG1 . ILE A 168 ? 0.1274 0.0894 0.0883 0.0033  0.0026  -0.0110 168 ILE A CG1 
1356 C CG2 . ILE A 168 ? 0.1243 0.1187 0.0867 0.0200  0.0041  -0.0102 168 ILE A CG2 
1357 C CD1 . ILE A 168 ? 0.1388 0.1212 0.1308 -0.0183 0.0207  0.0083  168 ILE A CD1 
1358 N N   . VAL A 169 ? 0.1413 0.0735 0.0729 0.0047  0.0028  -0.0026 169 VAL A N   
1359 C CA  . VAL A 169 ? 0.1230 0.0725 0.0795 0.0129  0.0086  -0.0010 169 VAL A CA  
1360 C C   . VAL A 169 ? 0.1424 0.0722 0.0756 0.0194  0.0148  0.0027  169 VAL A C   
1361 O O   . VAL A 169 ? 0.1651 0.0991 0.0773 0.0151  0.0149  0.0166  169 VAL A O   
1362 C CB  . VAL A 169 ? 0.1011 0.0687 0.0909 0.0254  0.0036  -0.0032 169 VAL A CB  
1363 C CG1 . VAL A 169 ? 0.1230 0.0655 0.1117 0.0149  0.0325  -0.0094 169 VAL A CG1 
1364 C CG2 . VAL A 169 ? 0.1156 0.0976 0.0877 0.0157  0.0227  0.0001  169 VAL A CG2 
1365 N N   A GLU A 170 ? 0.1299 0.0897 0.0911 0.0095  0.0220  0.0036  170 GLU A N   
1366 N N   B GLU A 170 ? 0.1336 0.0877 0.0815 0.0135  0.0235  0.0023  170 GLU A N   
1367 C CA  A GLU A 170 ? 0.1325 0.1091 0.0950 -0.0097 0.0244  -0.0004 170 GLU A CA  
1368 C CA  B GLU A 170 ? 0.1438 0.0966 0.0882 0.0062  0.0328  -0.0028 170 GLU A CA  
1369 C C   A GLU A 170 ? 0.1496 0.1030 0.0891 0.0075  0.0175  0.0063  170 GLU A C   
1370 C C   B GLU A 170 ? 0.1605 0.1079 0.0877 -0.0012 0.0347  -0.0028 170 GLU A C   
1371 O O   A GLU A 170 ? 0.2386 0.1398 0.0887 -0.0377 0.0171  0.0087  170 GLU A O   
1372 O O   B GLU A 170 ? 0.1206 0.0891 0.0814 0.0347  0.0550  -0.0163 170 GLU A O   
1373 C CB  A GLU A 170 ? 0.1255 0.1449 0.0952 -0.0144 0.0284  0.0225  170 GLU A CB  
1374 C CB  B GLU A 170 ? 0.1430 0.1258 0.1181 0.0255  0.0270  -0.0222 170 GLU A CB  
1375 C CG  A GLU A 170 ? 0.1675 0.1437 0.1187 0.0273  0.0496  -0.0375 170 GLU A CG  
1376 C CG  B GLU A 170 ? 0.1495 0.1935 0.2030 0.0207  0.0501  0.0177  170 GLU A CG  
1377 C CD  A GLU A 170 ? 0.1423 0.3120 0.1992 0.0240  0.0339  -0.0361 170 GLU A CD  
1378 C CD  B GLU A 170 ? 0.1518 0.2968 0.2559 0.0011  0.0268  0.0284  170 GLU A CD  
1379 O OE1 A GLU A 170 ? 0.2037 0.4855 0.2066 0.1046  -0.0121 -0.0424 170 GLU A OE1 
1380 O OE1 B GLU A 170 ? 0.2036 0.4952 0.2019 0.1038  -0.0018 0.0435  170 GLU A OE1 
1381 O OE2 A GLU A 170 ? 0.1729 0.5116 0.2596 0.0864  0.0930  0.0569  170 GLU A OE2 
1382 O OE2 B GLU A 170 ? 0.1622 0.4543 0.2656 0.0606  -0.0060 -0.0216 170 GLU A OE2 
1383 N N   . ALA A 171 ? 0.1636 0.1003 0.0912 0.0052  0.0344  -0.0067 171 ALA A N   
1384 C CA  . ALA A 171 ? 0.1755 0.1063 0.1031 0.0123  0.0338  -0.0222 171 ALA A CA  
1385 C C   . ALA A 171 ? 0.1868 0.1462 0.0869 0.0088  0.0323  -0.0064 171 ALA A C   
1386 O O   . ALA A 171 ? 0.2287 0.2088 0.0774 0.0004  0.0312  -0.0221 171 ALA A O   
1387 C CB  . ALA A 171 ? 0.1836 0.1231 0.1275 -0.0165 0.0195  -0.0169 171 ALA A CB  
1388 N N   . LEU A 172 ? 0.1695 0.1224 0.0822 0.0105  0.0178  -0.0064 172 LEU A N   
1389 C CA  . LEU A 172 ? 0.1881 0.1090 0.0798 -0.0026 0.0047  0.0066  172 LEU A CA  
1390 C C   . LEU A 172 ? 0.1963 0.1221 0.0764 -0.0198 0.0024  0.0140  172 LEU A C   
1391 O O   . LEU A 172 ? 0.2353 0.1437 0.0831 -0.0214 -0.0163 0.0241  172 LEU A O   
1392 C CB  . LEU A 172 ? 0.1529 0.1350 0.1011 -0.0017 -0.0119 0.0318  172 LEU A CB  
1393 C CG  . LEU A 172 ? 0.2369 0.1276 0.1268 -0.0372 0.0320  -0.0146 172 LEU A CG  
1394 C CD1 . LEU A 172 ? 0.1679 0.1430 0.3373 -0.0215 0.0337  0.0491  172 LEU A CD1 
1395 C CD2 . LEU A 172 ? 0.2022 0.1602 0.1234 -0.0402 0.0069  0.0139  172 LEU A CD2 
1396 N N   . ASN A 173 ? 0.1979 0.1152 0.0884 -0.0103 -0.0130 0.0132  173 ASN A N   
1397 C CA  . ASN A 173 ? 0.1985 0.1140 0.0876 -0.0057 -0.0187 0.0110  173 ASN A CA  
1398 C C   . ASN A 173 ? 0.2062 0.1245 0.1188 -0.0176 -0.0051 0.0373  173 ASN A C   
1399 O O   . ASN A 173 ? 0.2045 0.1259 0.1400 -0.0089 0.0003  0.0333  173 ASN A O   
1400 C CB  . ASN A 173 ? 0.2430 0.1254 0.0806 -0.0283 0.0085  0.0013  173 ASN A CB  
1401 C CG  . ASN A 173 ? 0.2399 0.1740 0.1306 -0.0147 0.0417  -0.0083 173 ASN A CG  
1402 O OD1 . ASN A 173 ? 0.1970 0.2220 0.2278 -0.0142 0.0130  -0.0662 173 ASN A OD1 
1403 N ND2 . ASN A 173 ? 0.3153 0.2177 0.1861 -0.0099 0.1109  -0.0103 173 ASN A ND2 
1404 N N   . GLY A 174 ? 0.1903 0.1223 0.0875 -0.0194 0.0180  0.0226  174 GLY A N   
1405 C CA  . GLY A 174 ? 0.1975 0.1573 0.0949 -0.0312 0.0220  0.0113  174 GLY A CA  
1406 C C   . GLY A 174 ? 0.1678 0.1274 0.0940 -0.0142 0.0302  0.0105  174 GLY A C   
1407 O O   . GLY A 174 ? 0.1636 0.1313 0.0919 0.0039  0.0354  0.0111  174 GLY A O   
1408 N N   . LYS A 175 ? 0.1617 0.1621 0.1148 0.0098  0.0393  -0.0111 175 LYS A N   
1409 C CA  . LYS A 175 ? 0.1510 0.1745 0.1483 0.0056  0.0299  -0.0229 175 LYS A CA  
1410 C C   . LYS A 175 ? 0.1534 0.1656 0.1246 -0.0002 0.0418  -0.0117 175 LYS A C   
1411 O O   . LYS A 175 ? 0.1627 0.1645 0.1193 0.0255  0.0287  -0.0016 175 LYS A O   
1412 C CB  . LYS A 175 ? 0.1525 0.2635 0.2795 0.0526  0.0184  -0.0871 175 LYS A CB  
1413 C CG  . LYS A 175 ? 0.3252 0.3056 0.7453 0.1373  0.1013  -0.1165 175 LYS A CG  
1414 C CD  . LYS A 175 ? 0.3504 0.4576 1.0446 0.2498  0.0714  -0.0938 175 LYS A CD  
1415 C CE  . LYS A 175 ? 0.4011 0.4945 1.3235 0.2647  0.1921  0.0341  175 LYS A CE  
1416 N NZ  . LYS A 175 ? 0.6611 0.7446 1.7460 0.4420  -0.1763 0.1518  175 LYS A NZ  
1417 N N   . GLU A 176 ? 0.1491 0.1730 0.1134 -0.0199 0.0361  -0.0023 176 GLU A N   
1418 C CA  . GLU A 176 ? 0.1696 0.1619 0.1316 -0.0275 0.0494  0.0015  176 GLU A CA  
1419 C C   . GLU A 176 ? 0.1483 0.1494 0.0906 -0.0081 0.0230  0.0215  176 GLU A C   
1420 O O   . GLU A 176 ? 0.1620 0.1375 0.1053 -0.0107 0.0142  0.0062  176 GLU A O   
1421 C CB  . GLU A 176 ? 0.2371 0.1855 0.1729 -0.0178 0.1097  0.0295  176 GLU A CB  
1422 C CG  . GLU A 176 ? 0.8218 0.1403 0.4559 -0.0366 0.0365  0.0099  176 GLU A CG  
1423 C CD  . GLU A 176 ? 1.4063 0.2102 0.4692 -0.2276 -0.0566 0.0726  176 GLU A CD  
1424 O OE1 . GLU A 176 ? 2.3924 0.7077 0.4127 -0.7811 -0.2404 0.1530  176 GLU A OE1 
1425 O OE2 . GLU A 176 ? 1.6882 0.3184 0.7129 -0.4346 0.3201  -0.0990 176 GLU A OE2 
1426 N N   . VAL A 177 ? 0.1546 0.1249 0.0920 0.0029  0.0195  0.0040  177 VAL A N   
1427 C CA  . VAL A 177 ? 0.1327 0.1238 0.1017 0.0142  0.0123  0.0123  177 VAL A CA  
1428 C C   . VAL A 177 ? 0.1227 0.1100 0.0918 0.0169  0.0098  0.0032  177 VAL A C   
1429 O O   . VAL A 177 ? 0.1149 0.1128 0.0978 0.0091  0.0111  0.0014  177 VAL A O   
1430 C CB  . VAL A 177 ? 0.1460 0.1011 0.0853 0.0325  0.0065  -0.0071 177 VAL A CB  
1431 C CG1 . VAL A 177 ? 0.1327 0.1170 0.1274 0.0098  0.0074  -0.0116 177 VAL A CG1 
1432 C CG2 . VAL A 177 ? 0.2069 0.1196 0.1224 0.0304  -0.0134 0.0240  177 VAL A CG2 
1433 N N   . ALA A 178 ? 0.1266 0.1162 0.0864 0.0156  0.0214  -0.0014 178 ALA A N   
1434 C CA  . ALA A 178 ? 0.1250 0.1081 0.0859 0.0076  0.0164  0.0054  178 ALA A CA  
1435 C C   . ALA A 178 ? 0.1031 0.1071 0.0884 0.0223  0.0181  0.0044  178 ALA A C   
1436 O O   . ALA A 178 ? 0.1079 0.1056 0.0917 0.0183  0.0154  0.0046  178 ALA A O   
1437 C CB  . ALA A 178 ? 0.1379 0.1186 0.1113 0.0206  0.0196  -0.0055 178 ALA A CB  
1438 N N   . ALA A 179 ? 0.1076 0.1154 0.0956 0.0143  0.0255  0.0045  179 ALA A N   
1439 C CA  . ALA A 179 ? 0.1134 0.1018 0.1003 0.0124  0.0258  0.0126  179 ALA A CA  
1440 C C   . ALA A 179 ? 0.0900 0.0978 0.0940 0.0075  0.0254  0.0153  179 ALA A C   
1441 O O   . ALA A 179 ? 0.0917 0.1182 0.1033 0.0128  -0.0002 0.0041  179 ALA A O   
1442 C CB  . ALA A 179 ? 0.1001 0.1355 0.1563 0.0155  0.0458  0.0039  179 ALA A CB  
1443 N N   . GLN A 180 ? 0.0967 0.1027 0.0876 0.0018  0.0119  0.0107  180 GLN A N   
1444 C CA  . GLN A 180 ? 0.0897 0.0920 0.1001 0.0023  0.0115  0.0226  180 GLN A CA  
1445 C C   . GLN A 180 ? 0.0890 0.0793 0.0893 0.0126  0.0054  0.0127  180 GLN A C   
1446 O O   . GLN A 180 ? 0.1054 0.1082 0.0891 0.0045  0.0152  0.0079  180 GLN A O   
1447 C CB  . GLN A 180 ? 0.0961 0.1164 0.1105 0.0023  0.0087  0.0344  180 GLN A CB  
1448 C CG  . GLN A 180 ? 0.2288 0.1475 0.1737 0.0870  0.1224  0.1013  180 GLN A CG  
1449 C CD  . GLN A 180 ? 0.3173 0.1720 0.1675 0.0336  0.0723  0.0967  180 GLN A CD  
1450 O OE1 . GLN A 180 ? 0.3869 0.1845 0.1320 -0.0774 0.0676  0.0263  180 GLN A OE1 
1451 N NE2 . GLN A 180 ? 0.2346 0.4121 0.2501 0.0855  0.0951  0.2175  180 GLN A NE2 
1452 N N   . VAL A 181 ? 0.0870 0.0917 0.0782 0.0046  0.0142  0.0107  181 VAL A N   
1453 C CA  . VAL A 181 ? 0.0753 0.0978 0.0865 0.0036  0.0086  0.0151  181 VAL A CA  
1454 C C   . VAL A 181 ? 0.0767 0.0771 0.0817 0.0085  0.0111  0.0068  181 VAL A C   
1455 O O   . VAL A 181 ? 0.0895 0.0881 0.0860 0.0148  0.0229  0.0084  181 VAL A O   
1456 C CB  . VAL A 181 ? 0.0946 0.0857 0.0903 0.0047  -0.0067 0.0238  181 VAL A CB  
1457 C CG1 . VAL A 181 ? 0.1106 0.0938 0.1066 -0.0107 0.0095  0.0184  181 VAL A CG1 
1458 C CG2 . VAL A 181 ? 0.0993 0.1265 0.1021 0.0020  -0.0136 0.0293  181 VAL A CG2 
1459 N N   . LYS A 182 ? 0.0828 0.0983 0.0697 0.0114  0.0130  0.0062  182 LYS A N   
1460 C CA  . LYS A 182 ? 0.0940 0.0799 0.0816 0.0152  0.0103  0.0143  182 LYS A CA  
1461 C C   . LYS A 182 ? 0.0967 0.0772 0.0872 0.0096  0.0003  0.0133  182 LYS A C   
1462 O O   . LYS A 182 ? 0.1031 0.0972 0.0862 0.0025  -0.0001 0.0142  182 LYS A O   
1463 C CB  . LYS A 182 ? 0.1057 0.0911 0.0938 0.0215  0.0023  0.0049  182 LYS A CB  
1464 C CG  . LYS A 182 ? 0.0897 0.0969 0.1166 0.0064  -0.0217 0.0044  182 LYS A CG  
1465 C CD  . LYS A 182 ? 0.1005 0.1170 0.1871 0.0240  -0.0094 0.0223  182 LYS A CD  
1466 C CE  . LYS A 182 ? 0.1561 0.2086 0.2084 0.0867  -0.0269 0.0319  182 LYS A CE  
1467 N NZ  . LYS A 182 ? 0.1620 0.2466 0.3504 0.1081  -0.0061 0.0328  182 LYS A NZ  
1468 N N   . ALA A 183 ? 0.1034 0.0908 0.0858 -0.0052 0.0071  0.0156  183 ALA A N   
1469 C CA  . ALA A 183 ? 0.1060 0.1051 0.1107 -0.0133 0.0038  0.0041  183 ALA A CA  
1470 C C   . ALA A 183 ? 0.1221 0.0874 0.0990 0.0086  -0.0113 0.0011  183 ALA A C   
1471 O O   . ALA A 183 ? 0.1282 0.1138 0.0953 0.0076  -0.0222 -0.0077 183 ALA A O   
1472 C CB  . ALA A 183 ? 0.1384 0.1172 0.1689 -0.0337 0.0195  0.0143  183 ALA A CB  
1473 N N   . PRO A 184 ? 0.1113 0.0796 0.0692 0.0008  -0.0003 -0.0017 184 PRO A N   
1474 C CA  . PRO A 184 ? 0.1200 0.0891 0.0837 -0.0090 0.0081  0.0010  184 PRO A CA  
1475 C C   . PRO A 184 ? 0.1328 0.0874 0.0748 -0.0039 0.0094  0.0050  184 PRO A C   
1476 O O   . PRO A 184 ? 0.1837 0.0923 0.0793 -0.0205 0.0328  -0.0122 184 PRO A O   
1477 C CB  . PRO A 184 ? 0.1192 0.0849 0.1034 0.0013  0.0110  0.0160  184 PRO A CB  
1478 C CG  . PRO A 184 ? 0.1197 0.1194 0.0986 0.0103  0.0014  0.0118  184 PRO A CG  
1479 C CD  . PRO A 184 ? 0.1118 0.0821 0.0821 -0.0115 -0.0057 -0.0018 184 PRO A CD  
1480 N N   . LEU A 185 ? 0.1313 0.0865 0.0752 -0.0089 0.0222  0.0075  185 LEU A N   
1481 C CA  . LEU A 185 ? 0.1167 0.0891 0.0640 -0.0127 0.0094  0.0033  185 LEU A CA  
1482 C C   . LEU A 185 ? 0.1068 0.1006 0.0665 0.0023  0.0161  0.0045  185 LEU A C   
1483 O O   . LEU A 185 ? 0.1386 0.0943 0.0790 -0.0106 0.0078  0.0143  185 LEU A O   
1484 C CB  . LEU A 185 ? 0.1099 0.0853 0.0810 0.0040  0.0062  0.0053  185 LEU A CB  
1485 C CG  . LEU A 185 ? 0.1372 0.0827 0.0638 -0.0124 0.0073  0.0039  185 LEU A CG  
1486 C CD1 . LEU A 185 ? 0.1269 0.1004 0.1100 -0.0158 0.0184  -0.0273 185 LEU A CD1 
1487 C CD2 . LEU A 185 ? 0.1227 0.1286 0.1288 0.0435  -0.0207 -0.0129 185 LEU A CD2 
1488 N N   . VAL A 186 ? 0.1053 0.0933 0.0910 -0.0027 0.0136  -0.0075 186 VAL A N   
1489 C CA  . VAL A 186 ? 0.1189 0.1101 0.0833 -0.0091 0.0098  0.0019  186 VAL A CA  
1490 C C   . VAL A 186 ? 0.1201 0.1115 0.0800 -0.0107 0.0019  -0.0012 186 VAL A C   
1491 O O   . VAL A 186 ? 0.1659 0.1341 0.0915 0.0098  0.0193  0.0200  186 VAL A O   
1492 C CB  . VAL A 186 ? 0.1091 0.1153 0.0910 -0.0048 0.0118  -0.0022 186 VAL A CB  
1493 C CG1 . VAL A 186 ? 0.1178 0.1468 0.0955 -0.0156 0.0089  -0.0117 186 VAL A CG1 
1494 C CG2 . VAL A 186 ? 0.1600 0.1003 0.1078 0.0000  0.0079  -0.0015 186 VAL A CG2 
1495 N N   . LEU A 187 ? 0.1170 0.1305 0.0862 0.0122  -0.0082 -0.0032 187 LEU A N   
1496 C CA  . LEU A 187 ? 0.1106 0.1418 0.1192 0.0213  -0.0043 -0.0104 187 LEU A CA  
1497 C C   . LEU A 187 ? 0.1094 0.2224 0.1681 0.0383  -0.0172 -0.0286 187 LEU A C   
1498 O O   . LEU A 187 ? 0.1332 0.3356 0.4967 -0.0571 -0.0662 0.1187  187 LEU A O   
1499 C CB  . LEU A 187 ? 0.1370 0.1282 0.1225 0.0113  0.0054  -0.0143 187 LEU A CB  
1500 C CG  . LEU A 187 ? 0.1386 0.1275 0.1069 0.0095  0.0008  -0.0092 187 LEU A CG  
1501 C CD1 . LEU A 187 ? 0.1960 0.1767 0.0961 -0.0406 0.0093  0.0038  187 LEU A CD1 
1502 C CD2 . LEU A 187 ? 0.1761 0.1352 0.1073 0.0027  0.0214  -0.0049 187 LEU A CD2 
1503 N N   . LYS A 188 ? 0.1440 0.2713 0.2779 0.1002  -0.0304 -0.0421 188 LYS A N   
1504 C CA  . LYS A 188 ? 0.1878 0.3517 0.4895 0.1413  -0.1630 -0.1380 188 LYS A CA  
1505 C C   . LYS A 188 ? 0.2366 0.4618 0.7763 0.2076  0.1646  -0.0438 188 LYS A C   
1506 C CB  . LYS A 188 ? 0.3515 0.4088 0.6599 0.2121  -0.2910 -0.0837 188 LYS A CB  
1507 C CG  . LYS A 188 ? 0.4177 0.7819 0.7649 0.2332  -0.4074 -0.0941 188 LYS A CG  
1508 C CD  . LYS A 188 ? 0.5577 0.8567 0.7837 0.3459  -0.4475 -0.0579 188 LYS A CD  
1509 C CE  . LYS A 188 ? 0.8144 1.0519 0.9048 0.1646  -0.6417 -0.0304 188 LYS A CE  
1510 N NZ  . LYS A 188 ? 0.9284 1.2663 0.8917 0.0886  -0.6779 0.1544  188 LYS A NZ  
1511 O O   . HOH B .   ? 0.0963 0.0939 0.0866 0.0235  0.0030  -0.0010 190 HOH A O   
1512 O O   . HOH B .   ? 0.1354 0.1283 0.1025 -0.0253 0.0063  -0.0128 191 HOH A O   
1513 O O   . HOH B .   ? 0.1315 0.1286 0.0942 0.0183  0.0087  -0.0043 192 HOH A O   
1514 O O   . HOH B .   ? 0.1113 0.0941 0.1039 0.0196  -0.0020 0.0082  193 HOH A O   
1515 O O   . HOH B .   ? 0.1040 0.0979 0.0944 0.0077  0.0147  0.0136  194 HOH A O   
1516 O O   . HOH B .   ? 0.1666 0.1325 0.1366 0.0178  -0.0296 -0.0289 195 HOH A O   
1517 O O   . HOH B .   ? 0.1048 0.1387 0.1022 0.0173  -0.0054 0.0153  196 HOH A O   
1518 O O   . HOH B .   ? 0.1304 0.1120 0.0735 0.0291  0.0098  -0.0038 197 HOH A O   
1519 O O   . HOH B .   ? 0.1152 0.0923 0.0979 -0.0044 -0.0038 0.0010  198 HOH A O   
1520 O O   . HOH B .   ? 0.0978 0.0872 0.0986 0.0039  -0.0126 0.0007  199 HOH A O   
1521 O O   . HOH B .   ? 0.1380 0.1087 0.0846 0.0230  -0.0046 -0.0032 200 HOH A O   
1522 O O   . HOH B .   ? 0.1144 0.1627 0.1149 -0.0161 0.0066  -0.0189 201 HOH A O   
1523 O O   . HOH B .   ? 0.1004 0.1029 0.1171 0.0190  -0.0003 -0.0039 202 HOH A O   
1524 O O   . HOH B .   ? 0.1432 0.1485 0.1260 -0.0121 -0.0002 -0.0038 203 HOH A O   
1525 O O   . HOH B .   ? 0.2158 0.1759 0.1119 -0.0466 0.0353  0.0049  204 HOH A O   
1526 O O   . HOH B .   ? 0.1128 0.1057 0.0969 -0.0080 -0.0001 -0.0252 205 HOH A O   
1527 O O   . HOH B .   ? 0.1517 0.1148 0.1791 -0.0061 0.0246  0.0009  206 HOH A O   
1528 O O   . HOH B .   ? 0.2227 0.1456 0.2557 0.0683  -0.0653 -0.0842 207 HOH A O   
1529 O O   . HOH B .   ? 0.1805 0.1008 0.1125 -0.0067 -0.0383 0.0089  208 HOH A O   
1530 O O   . HOH B .   ? 0.1057 0.1145 0.0910 0.0091  0.0030  -0.0109 209 HOH A O   
1531 O O   . HOH B .   ? 0.2546 0.1236 0.1259 -0.0001 -0.0249 0.0076  210 HOH A O   
1532 O O   . HOH B .   ? 0.1818 0.1500 0.1397 0.0081  -0.0011 0.0038  211 HOH A O   
1533 O O   . HOH B .   ? 0.2212 0.1265 0.0960 -0.0342 0.0225  -0.0153 212 HOH A O   
1534 O O   . HOH B .   ? 0.2006 0.1352 0.2267 -0.0021 0.0258  0.0076  213 HOH A O   
1535 O O   . HOH B .   ? 0.1285 0.1954 0.1108 0.0278  0.0069  0.0298  214 HOH A O   
1536 O O   . HOH B .   ? 0.1514 0.2500 0.3421 -0.0168 0.0387  -0.0044 215 HOH A O   
1537 O O   . HOH B .   ? 0.1527 0.1750 0.2343 0.0339  0.0426  0.1067  216 HOH A O   
1538 O O   . HOH B .   ? 0.1431 0.0874 0.1811 0.0208  0.0038  0.0216  217 HOH A O   
1539 O O   . HOH B .   ? 0.1748 0.1237 0.2012 -0.0574 -0.0762 0.0172  218 HOH A O   
1540 O O   . HOH B .   ? 0.1691 0.1483 0.0952 -0.0340 0.0227  -0.0261 219 HOH A O   
1541 O O   . HOH B .   ? 0.1776 0.1513 0.0993 0.0740  0.0198  0.0141  220 HOH A O   
1542 O O   . HOH B .   ? 0.2174 0.1264 0.1489 0.0308  0.0185  0.0081  221 HOH A O   
1543 O O   . HOH B .   ? 0.1742 0.1945 0.2766 -0.0288 -0.0628 0.0690  222 HOH A O   
1544 O O   . HOH B .   ? 0.1913 0.2399 0.1425 -0.0048 0.0042  0.0196  223 HOH A O   
1545 O O   . HOH B .   ? 0.2045 0.2046 0.1914 -0.0258 0.0396  -0.0159 224 HOH A O   
1546 O O   . HOH B .   ? 0.1682 0.1889 0.1375 -0.0083 -0.0313 0.0033  225 HOH A O   
1547 O O   . HOH B .   ? 0.1270 0.2177 0.2011 0.0311  -0.0079 -0.0090 226 HOH A O   
1548 O O   . HOH B .   ? 0.1427 0.2460 0.3112 -0.0096 0.0510  -0.0644 227 HOH A O   
1549 O O   . HOH B .   ? 0.2249 0.1702 0.1298 0.0345  0.0050  -0.0058 228 HOH A O   
1550 O O   . HOH B .   ? 0.1421 0.2104 0.3082 -0.0475 -0.0178 0.0412  229 HOH A O   
1551 O O   . HOH B .   ? 0.1851 0.2954 0.1812 0.0356  0.0206  0.0431  230 HOH A O   
1552 O O   . HOH B .   ? 0.2789 0.1932 0.2589 -0.0691 -0.0896 0.0351  231 HOH A O   
1553 O O   . HOH B .   ? 0.2173 0.2615 0.2484 -0.0441 -0.0280 -0.0140 232 HOH A O   
1554 O O   . HOH B .   ? 0.3871 0.2912 0.2446 -0.0388 -0.1061 -0.0689 233 HOH A O   
1555 O O   . HOH B .   ? 0.2229 0.1986 0.1612 -0.0683 -0.0439 -0.0217 234 HOH A O   
1556 O O   . HOH B .   ? 0.1918 0.2313 0.1622 0.0636  0.0281  0.0352  235 HOH A O   
1557 O O   . HOH B .   ? 0.2037 0.2550 0.2177 0.0614  0.0871  -0.0154 236 HOH A O   
1558 O O   . HOH B .   ? 0.2680 0.1751 0.2353 -0.0168 -0.0393 -0.0143 237 HOH A O   
1559 O O   . HOH B .   ? 0.1802 0.2604 0.3025 0.0690  -0.1208 -0.0621 238 HOH A O   
1560 O O   . HOH B .   ? 0.2736 0.2068 0.2052 0.0882  0.0172  0.0674  239 HOH A O   
1561 O O   . HOH B .   ? 0.2710 0.1381 0.1003 0.0191  0.0088  -0.0050 240 HOH A O   
1562 O O   . HOH B .   ? 0.2572 0.2003 0.3283 0.0305  -0.0445 -0.1005 241 HOH A O   
1563 O O   . HOH B .   ? 0.1953 0.3229 0.1921 -0.0333 -0.0013 0.0771  242 HOH A O   
1564 O O   . HOH B .   ? 0.2014 0.2790 0.2834 -0.0470 -0.0518 0.0271  243 HOH A O   
1565 O O   . HOH B .   ? 0.1763 0.2400 0.1878 -0.0149 0.0349  -0.0120 244 HOH A O   
1566 O O   . HOH B .   ? 0.1642 0.2132 0.0886 0.0286  0.0057  -0.0108 245 HOH A O   
1567 O O   . HOH B .   ? 0.3208 0.2483 0.2838 0.0345  0.1149  0.0522  246 HOH A O   
1568 O O   . HOH B .   ? 0.1240 0.6940 0.2270 -0.0621 0.0016  -0.1274 247 HOH A O   
1569 O O   . HOH B .   ? 0.4501 0.2584 0.2221 0.1238  -0.1775 -0.0566 248 HOH A O   
1570 O O   . HOH B .   ? 0.2885 0.1934 0.1242 0.0132  0.0360  0.0025  249 HOH A O   
1571 O O   . HOH B .   ? 0.2550 0.1686 0.1518 0.0230  -0.0006 -0.0114 250 HOH A O   
1572 O O   . HOH B .   ? 0.1958 0.3776 0.2401 -0.1508 -0.1035 0.1401  251 HOH A O   
1573 O O   . HOH B .   ? 0.2133 0.1560 0.2074 0.0076  0.0163  -0.0394 252 HOH A O   
1574 O O   . HOH B .   ? 0.2098 0.3541 0.3266 -0.0487 -0.1125 0.0965  253 HOH A O   
1575 O O   . HOH B .   ? 0.2302 0.4348 0.2355 -0.1687 -0.0202 0.0387  254 HOH A O   
1576 O O   . HOH B .   ? 0.2630 0.2326 0.4814 -0.0624 -0.0563 0.0796  255 HOH A O   
1577 O O   . HOH B .   ? 0.2383 0.1869 0.6338 -0.0230 -0.1782 0.0316  256 HOH A O   
1578 O O   . HOH B .   ? 0.2758 0.2377 0.1707 -0.0608 0.0350  -0.0100 257 HOH A O   
1579 O O   . HOH B .   ? 0.2939 0.3356 0.2102 0.1264  0.0215  0.0762  258 HOH A O   
1580 O O   . HOH B .   ? 0.2158 0.2112 0.1873 0.0051  0.0149  0.0023  259 HOH A O   
1581 O O   . HOH B .   ? 0.2704 0.2994 0.2077 0.1272  -0.0213 -0.0553 260 HOH A O   
1582 O O   . HOH B .   ? 0.1979 0.5621 0.3039 0.0759  -0.0776 -0.0365 261 HOH A O   
1583 O O   . HOH B .   ? 0.3369 0.2163 0.6656 -0.0769 -0.2706 0.0226  262 HOH A O   
1584 O O   . HOH B .   ? 0.2564 0.2366 0.5729 -0.0242 0.0887  0.0001  263 HOH A O   
1585 O O   . HOH B .   ? 0.2791 0.3809 0.2728 0.0308  0.0742  0.0754  264 HOH A O   
1586 O O   . HOH B .   ? 0.1551 0.2026 0.4443 -0.0124 0.0234  0.1505  265 HOH A O   
1587 O O   . HOH B .   ? 0.1773 0.3441 0.3023 -0.0462 0.0492  0.0476  266 HOH A O   
1588 O O   . HOH B .   ? 0.3395 0.3163 0.2652 -0.0692 -0.0020 0.0744  267 HOH A O   
1589 O O   . HOH B .   ? 0.3953 0.3515 0.3080 -0.0591 0.1137  0.0315  268 HOH A O   
1590 O O   . HOH B .   ? 0.1927 0.3512 0.3613 0.0612  -0.0523 0.1435  269 HOH A O   
1591 O O   . HOH B .   ? 0.2763 0.2342 0.1897 -0.0527 0.0150  0.0016  270 HOH A O   
1592 O O   . HOH B .   ? 0.4115 0.3693 0.1589 -0.0111 0.0933  0.0600  271 HOH A O   
1593 O O   . HOH B .   ? 0.4547 0.2820 0.3126 -0.0483 -0.1980 0.0937  272 HOH A O   
1594 O O   . HOH B .   ? 0.2898 0.3015 0.1840 0.0071  -0.0617 0.0171  273 HOH A O   
1595 O O   . HOH B .   ? 0.2314 0.2466 0.2968 0.0384  0.0267  0.0145  274 HOH A O   
1596 O O   . HOH B .   ? 0.3395 0.2628 0.1683 -0.0263 -0.0068 -0.0077 275 HOH A O   
1597 O O   . HOH B .   ? 0.1876 0.2550 0.4249 -0.0062 0.0495  -0.0613 276 HOH A O   
1598 O O   . HOH B .   ? 0.3362 0.4064 0.3398 -0.0682 -0.1282 0.0425  277 HOH A O   
1599 O O   . HOH B .   ? 0.2316 0.4411 0.4298 0.1194  0.0083  0.0753  278 HOH A O   
1600 O O   . HOH B .   ? 0.1989 0.3387 0.2072 -0.0079 -0.0269 -0.0103 279 HOH A O   
1601 O O   . HOH B .   ? 0.4533 0.2883 0.2381 0.0457  0.0477  -0.0070 280 HOH A O   
1602 O O   . HOH B .   ? 0.2496 0.2685 0.1803 0.0585  -0.0933 -0.0085 281 HOH A O   
1603 O O   . HOH B .   ? 0.3579 0.3282 0.3285 0.0768  0.0176  -0.1337 282 HOH A O   
1604 O O   . HOH B .   ? 0.3434 0.5440 0.3539 -0.0019 0.1593  -0.0826 283 HOH A O   
1605 O O   . HOH B .   ? 0.3742 0.2802 0.2387 -0.0481 -0.0730 -0.0390 284 HOH A O   
1606 O O   . HOH B .   ? 0.3106 0.3216 0.2525 0.0540  0.0103  -0.0174 285 HOH A O   
1607 O O   . HOH B .   ? 0.4866 0.3167 0.2994 -0.0750 -0.1918 0.1175  286 HOH A O   
1608 O O   . HOH B .   ? 0.2855 0.4062 0.5508 0.0355  -0.0617 0.2497  287 HOH A O   
1609 O O   . HOH B .   ? 0.6163 0.3388 0.2111 0.0105  -0.0040 0.1014  288 HOH A O   
1610 O O   . HOH B .   ? 0.3434 0.3691 0.6122 0.1683  -0.1406 0.1180  289 HOH A O   
1611 O O   . HOH B .   ? 0.1939 0.3323 0.2491 0.0763  -0.0112 -0.0314 290 HOH A O   
1612 O O   . HOH B .   ? 0.5079 0.3083 0.4261 -0.0478 0.2160  -0.0888 291 HOH A O   
1613 O O   . HOH B .   ? 0.2769 0.3477 0.2482 -0.0041 -0.0351 -0.0433 292 HOH A O   
1614 O O   . HOH B .   ? 0.5140 0.6532 0.4248 0.0030  -0.1393 0.1231  293 HOH A O   
1615 O O   . HOH B .   ? 0.3397 0.2544 0.2427 0.0486  0.0237  -0.0921 294 HOH A O   
1616 O O   . HOH B .   ? 0.3100 0.5545 0.5323 -0.1262 0.0411  -0.3177 295 HOH A O   
1617 O O   . HOH B .   ? 0.8667 0.4323 0.3702 -0.1942 -0.3362 0.2021  296 HOH A O   
1618 O O   . HOH B .   ? 0.4331 0.2078 0.2424 -0.0381 -0.0688 0.0335  297 HOH A O   
1619 O O   . HOH B .   ? 0.7763 0.5065 0.6684 -0.2276 0.1827  -0.1704 298 HOH A O   
1620 O O   . HOH B .   ? 0.3978 0.3059 0.2227 -0.0262 -0.0138 -0.0705 299 HOH A O   
1621 O O   . HOH B .   ? 0.4865 0.4744 0.4441 -0.1512 0.0240  -0.0961 300 HOH A O   
1622 O O   . HOH B .   ? 0.9812 0.2171 0.3709 -0.0860 -0.3845 0.0975  301 HOH A O   
1623 O O   . HOH B .   ? 0.5046 0.4107 0.3908 -0.1997 0.0713  -0.1613 302 HOH A O   
1624 O O   . HOH B .   ? 0.4371 0.4855 0.4286 0.0865  -0.0380 0.0166  303 HOH A O   
1625 O O   . HOH B .   ? 0.2749 0.4428 0.5491 0.0935  0.0662  0.0411  304 HOH A O   
1626 O O   . HOH B .   ? 0.6619 0.3300 0.6657 0.1280  0.2285  -0.1841 305 HOH A O   
1627 O O   . HOH B .   ? 0.2714 0.6632 0.2125 -0.0287 0.0687  -0.1793 306 HOH A O   
1628 O O   . HOH B .   ? 0.3297 0.2562 0.3252 -0.0062 0.0770  -0.0128 307 HOH A O   
1629 O O   . HOH B .   ? 0.6303 0.5746 0.5509 -0.1681 -0.3986 0.2975  308 HOH A O   
1630 O O   . HOH B .   ? 0.5202 0.5707 0.2899 0.0731  0.0502  -0.1522 309 HOH A O   
1631 O O   . HOH B .   ? 0.4015 0.3816 0.6973 -0.0791 0.0681  -0.1524 310 HOH A O   
1632 O O   . HOH B .   ? 0.1548 0.6606 0.7194 -0.0768 -0.1128 -0.1225 311 HOH A O   
1633 O O   . HOH B .   ? 0.3823 0.6663 0.6046 -0.0193 0.1854  0.0442  312 HOH A O   
1634 O O   . HOH B .   ? 0.3329 0.4144 0.5203 -0.0849 0.1680  0.0413  313 HOH A O   
1635 O O   . HOH B .   ? 0.4527 0.7404 0.5508 0.0090  0.2584  -0.2526 314 HOH A O   
1636 O O   . HOH B .   ? 0.4402 0.4291 0.3545 0.0815  -0.1044 -0.1612 315 HOH A O   
1637 O O   . HOH B .   ? 0.3908 0.3011 0.3524 -0.1259 -0.0142 -0.1043 316 HOH A O   
1638 O O   . HOH B .   ? 0.4985 0.5835 0.3261 0.2740  -0.1201 -0.0407 317 HOH A O   
1639 O O   . HOH B .   ? 0.2714 0.6997 0.8108 -0.0096 0.0616  0.1332  318 HOH A O   
1640 O O   . HOH B .   ? 0.3028 0.2200 0.1848 -0.0552 -0.0435 0.0156  319 HOH A O   
1641 O O   . HOH B .   ? 0.4292 0.3473 0.2061 0.0945  0.0217  0.0541  320 HOH A O   
1642 O O   . HOH B .   ? 0.5065 0.4742 0.4920 0.0506  -0.0988 0.1380  321 HOH A O   
1643 O O   . HOH B .   ? 0.5564 0.4303 0.5272 -0.1966 0.2681  -0.2040 322 HOH A O   
1644 O O   . HOH B .   ? 0.4239 0.7573 0.3897 -0.0020 -0.1667 0.0808  323 HOH A O   
1645 O O   . HOH B .   ? 0.1267 0.6769 0.3655 0.0083  0.0426  -0.1028 324 HOH A O   
1646 O O   . HOH B .   ? 0.3201 0.6810 0.4202 -0.2018 -0.0851 0.1752  325 HOH A O   
1647 O O   . HOH B .   ? 0.2590 0.7660 0.3991 -0.1680 0.0427  -0.2992 326 HOH A O   
1648 O O   . HOH B .   ? 0.6911 0.3356 0.4523 0.0405  0.1011  0.0623  327 HOH A O   
1649 O O   . HOH B .   ? 0.3913 0.5191 0.5335 -0.1243 0.1359  -0.1287 328 HOH A O   
1650 O O   . HOH B .   ? 0.8787 0.2940 0.1864 -0.0225 0.0621  0.0217  329 HOH A O   
1651 O O   . HOH B .   ? 0.3497 0.4875 0.4531 -0.1164 -0.0161 0.0741  330 HOH A O   
1652 O O   . HOH B .   ? 0.5419 0.1975 0.4950 0.1222  -0.0580 0.0020  331 HOH A O   
1653 O O   . HOH B .   ? 0.2210 0.2404 0.1401 0.0160  -0.0310 -0.0026 332 HOH A O   
1654 O O   . HOH B .   ? 0.2299 0.3045 0.2717 0.0777  0.0112  0.0067  333 HOH A O   
1655 O O   . HOH B .   ? 0.3536 0.3553 0.2842 0.0329  0.0988  0.0173  334 HOH A O   
1656 O O   . HOH B .   ? 0.4865 0.4231 0.1752 0.2172  -0.1310 -0.1312 335 HOH A O   
1657 O O   . HOH B .   ? 0.3541 0.2767 0.3015 0.0193  -0.1984 -0.0595 336 HOH A O   
1658 O O   . HOH B .   ? 0.2753 0.2522 0.3118 0.0115  -0.0570 -0.0020 337 HOH A O   
1659 O O   . HOH B .   ? 0.4134 0.2042 0.3140 -0.0347 0.1545  0.0190  338 HOH A O   
1660 O O   . HOH B .   ? 0.3506 0.2903 0.3503 0.0411  0.0520  -0.0488 339 HOH A O   
1661 O O   . HOH B .   ? 0.2874 0.5499 0.5108 0.0540  -0.0140 -0.2300 340 HOH A O   
1662 O O   . HOH B .   ? 0.3821 0.1988 0.1677 -0.0102 -0.0388 -0.0017 341 HOH A O   
1663 O O   . HOH B .   ? 0.2904 0.4433 0.3809 0.0941  -0.0065 -0.0729 342 HOH A O   
1664 O O   . HOH B .   ? 0.3544 0.2759 0.3382 0.0292  -0.0893 0.0192  343 HOH A O   
1665 O O   . HOH B .   ? 0.7178 0.4967 0.4980 0.0928  0.1263  0.3529  344 HOH A O   
1666 O O   . HOH B .   ? 0.3142 0.3453 0.2159 0.1220  -0.0491 -0.0054 345 HOH A O   
1667 O O   . HOH B .   ? 0.3843 0.2615 0.2452 0.0679  0.0057  0.0406  346 HOH A O   
1668 O O   . HOH B .   ? 0.3086 0.5292 0.5033 -0.1270 0.1540  -0.0722 347 HOH A O   
1669 O O   . HOH B .   ? 0.2738 0.2357 0.3859 -0.0243 0.2184  -0.0100 348 HOH A O   
1670 O O   . HOH B .   ? 0.5925 0.2963 0.2875 -0.0130 -0.1207 0.1223  349 HOH A O   
1671 O O   . HOH B .   ? 0.3341 0.2871 0.4435 0.0064  -0.1039 -0.0503 350 HOH A O   
1672 O O   . HOH B .   ? 0.2205 0.4431 0.2825 -0.0455 -0.0197 0.0230  351 HOH A O   
1673 O O   . HOH B .   ? 0.4892 0.3785 0.2741 -0.0763 -0.0255 -0.0424 352 HOH A O   
1674 O O   . HOH B .   ? 0.4063 0.2681 0.2563 0.0118  -0.0939 -0.0329 353 HOH A O   
1675 O O   . HOH B .   ? 0.2574 0.3018 0.3338 0.0058  0.0334  -0.0619 354 HOH A O   
1676 O O   . HOH B .   ? 0.4373 0.2672 0.3881 0.0169  0.0527  -0.0196 355 HOH A O   
1677 O O   . HOH B .   ? 0.3119 0.5113 0.3176 -0.1416 -0.0460 0.1244  356 HOH A O   
1678 O O   . HOH B .   ? 0.3221 0.3462 0.2695 0.0837  -0.0224 0.1157  357 HOH A O   
1679 O O   . HOH B .   ? 0.4033 0.3133 0.4062 0.0145  0.1267  0.1454  358 HOH A O   
1680 O O   . HOH B .   ? 0.3326 0.4909 0.3880 -0.0321 -0.0661 0.1010  359 HOH A O   
1681 O O   . HOH B .   ? 0.4854 0.2903 0.3783 0.0013  0.1149  -0.0380 360 HOH A O   
1682 O O   . HOH B .   ? 0.3648 0.3478 0.4329 -0.0100 0.0347  -0.0876 361 HOH A O   
1683 O O   . HOH B .   ? 0.7124 0.4388 0.3054 -0.2087 -0.1769 0.0972  362 HOH A O   
1684 O O   . HOH B .   ? 0.3748 0.6236 0.6027 0.1305  0.0501  -0.2014 363 HOH A O   
1685 O O   . HOH B .   ? 0.2787 0.4454 0.3182 0.0548  0.0429  -0.0760 364 HOH A O   
1686 O O   . HOH B .   ? 0.3526 0.7983 0.4848 0.1291  0.1862  0.2573  365 HOH A O   
1687 O O   . HOH B .   ? 0.3468 0.3685 0.6611 0.1920  -0.2425 -0.3090 366 HOH A O   
1688 O O   . HOH B .   ? 0.4000 0.3927 0.4899 -0.0324 0.2090  -0.0196 367 HOH A O   
1689 O O   . HOH B .   ? 0.7349 0.3204 0.4312 0.0248  -0.1435 0.0457  368 HOH A O   
1690 O O   . HOH B .   ? 0.5057 0.4940 0.4055 0.0027  -0.1291 -0.1645 369 HOH A O   
1691 O O   . HOH B .   ? 0.4875 0.6095 0.3928 0.0766  0.0627  -0.0482 370 HOH A O   
1692 O O   . HOH B .   ? 0.8536 0.4516 0.3590 -0.0596 -0.1735 0.1548  371 HOH A O   
1693 O O   . HOH B .   ? 0.5350 0.4425 0.3203 -0.1321 0.0843  -0.0995 372 HOH A O   
1694 O O   . HOH B .   ? 0.2967 0.6428 0.4756 0.0118  -0.0822 -0.0568 373 HOH A O   
1695 O O   . HOH B .   ? 0.4562 0.6915 0.7517 -0.0312 -0.2009 -0.0597 374 HOH A O   
1696 O O   . HOH B .   ? 0.1950 0.3259 0.7264 0.0467  -0.1103 0.0361  375 HOH A O   
1697 O O   . HOH B .   ? 0.6966 0.4268 0.4414 -0.1076 0.1065  -0.0353 376 HOH A O   
1698 O O   . HOH B .   ? 0.4523 0.5925 0.6724 -0.2108 0.0022  0.0313  377 HOH A O   
1699 O O   . HOH B .   ? 0.8293 0.4720 0.5309 -0.0346 -0.2451 0.0562  378 HOH A O   
1700 O O   . HOH B .   ? 0.3758 0.4567 0.3880 0.0547  -0.0967 -0.0797 379 HOH A O   
1701 O O   . HOH B .   ? 0.5002 0.3060 0.4044 -0.1079 -0.0467 0.1038  380 HOH A O   
1702 O O   . HOH B .   ? 0.5404 0.3037 0.2067 0.0867  -0.0762 -0.0047 381 HOH A O   
1703 O O   . HOH B .   ? 0.3386 0.5290 0.3488 -0.1794 0.0496  -0.0446 382 HOH A O   
1704 O O   . HOH B .   ? 0.6328 0.4499 0.4098 -0.0701 0.0382  -0.1247 383 HOH A O   
1705 O O   . HOH B .   ? 0.7014 0.4329 0.3220 -0.2109 0.2559  -0.1281 384 HOH A O   
1706 O O   . HOH B .   ? 0.3443 0.4257 0.5113 0.0228  -0.0006 -0.0207 385 HOH A O   
1707 O O   . HOH B .   ? 0.4910 0.4505 0.4653 0.0151  0.0091  -0.0701 386 HOH A O   
1708 O O   . HOH B .   ? 0.5090 0.4394 0.4936 0.1082  0.1789  0.1111  387 HOH A O   
1709 O O   . HOH B .   ? 0.4885 0.2872 0.2030 0.0474  -0.0673 0.0429  388 HOH A O   
1710 O O   . HOH B .   ? 0.3988 0.4580 0.4429 -0.1261 0.0907  -0.0890 389 HOH A O   
1711 O O   . HOH B .   ? 0.3668 0.3175 0.7491 -0.0793 -0.0171 -0.0762 390 HOH A O   
1712 O O   . HOH B .   ? 0.4279 0.4150 0.3884 -0.1123 -0.1630 0.1057  391 HOH A O   
1713 O O   . HOH B .   ? 0.3595 0.6915 0.6623 0.0507  -0.2037 -0.0138 392 HOH A O   
1714 O O   . HOH B .   ? 0.4628 0.3625 0.6963 0.1631  0.0210  0.1304  393 HOH A O   
1715 O O   . HOH B .   ? 0.2810 0.8529 0.4857 -0.2281 0.0220  -0.0297 394 HOH A O   
1716 O O   . HOH B .   ? 0.5056 0.5831 0.5581 0.1180  -0.2762 -0.0451 395 HOH A O   
1717 O O   . HOH B .   ? 0.3806 0.4761 0.2456 -0.0252 -0.0050 -0.0144 396 HOH A O   
1718 O O   . HOH B .   ? 0.9061 0.7306 0.5848 -0.1804 -0.3410 0.2711  397 HOH A O   
1719 O O   . HOH B .   ? 0.5147 0.5486 0.6471 0.1114  -0.0058 0.0036  398 HOH A O   
1720 O O   . HOH B .   ? 0.5079 0.3514 0.3472 0.1139  0.0890  -0.0248 399 HOH A O   
1721 O O   . HOH B .   ? 0.4175 0.5623 0.4893 0.1740  0.0942  0.0564  400 HOH A O   
1722 O O   . HOH B .   ? 0.6159 0.4368 0.3167 0.1883  -0.1453 -0.1179 401 HOH A O   
1723 O O   . HOH B .   ? 0.4659 0.6702 0.4509 -0.0068 0.0763  0.2263  402 HOH A O   
1724 O O   . HOH B .   ? 0.5983 0.4529 0.3846 0.0312  -0.3041 -0.0353 403 HOH A O   
1725 O O   . HOH B .   ? 0.2777 0.4013 0.4512 0.0646  -0.0430 0.0509  404 HOH A O   
1726 O O   . HOH B .   ? 0.2789 0.7819 0.6624 0.1374  0.0814  -0.0481 405 HOH A O   
1727 O O   . HOH B .   ? 0.6718 0.3695 0.4452 0.0676  -0.2385 -0.1314 406 HOH A O   
1728 O O   . HOH B .   ? 0.2740 0.7998 0.5402 0.1532  0.0130  -0.0441 407 HOH A O   
1729 O O   . HOH B .   ? 0.4074 0.7383 0.4917 -0.2036 -0.0181 -0.1864 408 HOH A O   
1730 O O   . HOH B .   ? 0.3716 0.4602 0.4931 -0.1874 0.0476  0.1223  409 HOH A O   
1731 O O   . HOH B .   ? 0.5635 0.4165 0.7305 0.0512  -0.0615 -0.1315 410 HOH A O   
1732 O O   . HOH B .   ? 0.3201 0.5470 0.2937 -0.2292 0.1462  -0.0930 411 HOH A O   
1733 O O   . HOH B .   ? 0.3549 0.4116 0.5295 0.0401  -0.0128 0.0110  412 HOH A O   
1734 O O   . HOH B .   ? 0.2540 0.5153 0.7434 -0.0023 0.0134  -0.3941 413 HOH A O   
1735 O O   . HOH B .   ? 0.2778 0.5644 0.4284 0.0236  -0.0071 0.1240  414 HOH A O   
1736 O O   . HOH B .   ? 0.4074 0.6473 0.2895 -0.0693 -0.0799 -0.0691 415 HOH A O   
1737 O O   . HOH B .   ? 0.3405 0.3997 0.3181 -0.0433 0.0404  -0.0558 416 HOH A O   
1738 O O   . HOH B .   ? 0.4490 0.5359 0.3211 -0.1027 0.0268  0.1788  417 HOH A O   
1739 O O   . HOH B .   ? 0.3545 0.6397 0.4106 -0.1610 -0.0189 0.2148  418 HOH A O   
1740 O O   . HOH B .   ? 0.2836 0.6258 0.7309 -0.0302 0.1528  0.1102  419 HOH A O   
1741 O O   . HOH B .   ? 0.6301 0.4738 0.4170 0.0485  -0.1553 0.0943  420 HOH A O   
1742 O O   . HOH B .   ? 0.4386 0.5465 0.4945 -0.0865 -0.1825 0.0201  421 HOH A O   
1743 O O   . HOH B .   ? 0.7104 0.3301 0.7039 0.0039  0.0917  -0.0156 422 HOH A O   
1744 O O   . HOH B .   ? 0.2797 0.7516 0.7117 0.0175  0.1064  0.0566  423 HOH A O   
1745 O O   . HOH B .   ? 0.4656 0.5379 0.3428 0.1921  0.1255  -0.0381 424 HOH A O   
1746 O O   . HOH B .   ? 0.3630 0.6928 0.7077 -0.0815 -0.2292 0.0065  425 HOH A O   
1747 O O   . HOH B .   ? 0.6798 0.7017 0.4629 -0.1090 -0.2137 0.3608  426 HOH A O   
1748 O O   . HOH B .   ? 0.7306 0.4805 0.5219 0.3890  0.0318  0.0700  427 HOH A O   
1749 O O   . HOH B .   ? 0.4755 0.4375 0.5566 -0.0532 -0.2667 -0.0790 428 HOH A O   
1750 O O   . HOH B .   ? 0.3058 0.8769 0.4929 -0.1606 -0.0116 -0.0188 429 HOH A O   
1751 O O   . HOH B .   ? 0.4121 0.7489 0.6310 -0.2734 -0.0052 -0.0511 430 HOH A O   
1752 O O   . HOH B .   ? 0.5838 0.4823 0.9496 0.2484  -0.0549 -0.1244 431 HOH A O   
1753 O O   . HOH B .   ? 0.5484 0.6160 0.2997 -0.2375 -0.1873 0.0371  432 HOH A O   
1754 O O   . HOH B .   ? 0.3962 0.7676 0.6654 -0.0202 0.1563  0.0742  433 HOH A O   
1755 O O   . HOH B .   ? 0.7952 0.4542 0.5817 0.2330  -0.2007 0.1217  434 HOH A O   
1756 O O   . HOH B .   ? 0.7021 0.5401 0.4236 -0.0287 0.1772  -0.1380 435 HOH A O   
1757 O O   . HOH B .   ? 0.6114 0.5377 0.5890 0.0637  0.2603  -0.1691 436 HOH A O   
1758 O O   . HOH B .   ? 0.5703 0.4396 0.4840 -0.0606 -0.0262 0.1078  437 HOH A O   
1759 O O   . HOH B .   ? 0.9869 0.7460 0.3087 -0.4545 0.0744  -0.1934 438 HOH A O   
1760 O O   . HOH B .   ? 0.3031 0.9554 0.3901 -0.2131 0.1641  -0.0416 439 HOH A O   
1761 O O   . HOH B .   ? 0.7788 0.3155 0.6552 -0.0179 -0.3637 -0.0075 440 HOH A O   
1762 O O   . HOH B .   ? 1.0708 0.4424 0.3920 -0.0285 -0.0555 0.1267  441 HOH A O   
1763 O O   . HOH B .   ? 0.6144 0.5463 0.5321 0.0655  0.1586  0.0277  442 HOH A O   
1764 O O   . HOH B .   ? 0.6165 0.5811 0.8795 0.0112  -0.4667 0.1710  443 HOH A O   
1765 O O   . HOH B .   ? 0.9514 0.4212 0.4701 -0.1619 0.0674  0.0882  444 HOH A O   
1766 O O   . HOH B .   ? 0.7798 0.6632 0.4067 -0.0417 -0.0521 0.1250  445 HOH A O   
1767 O O   . HOH B .   ? 0.7291 0.5473 0.4470 -0.0473 0.1101  0.1223  446 HOH A O   
1768 O O   . HOH B .   ? 0.5190 0.5454 0.7559 0.1370  -0.0698 0.2124  447 HOH A O   
1769 O O   . HOH B .   ? 0.5615 0.5312 0.7583 -0.1482 0.1555  -0.1695 448 HOH A O   
1770 O O   . HOH B .   ? 0.4123 0.8030 0.4362 -0.1224 -0.1507 -0.1488 449 HOH A O   
1771 O O   . HOH B .   ? 0.4614 0.7272 0.8513 0.1278  0.3381  -0.1672 450 HOH A O   
1772 O O   . HOH B .   ? 0.7310 0.5760 0.6086 -0.2242 0.2159  -0.2793 451 HOH A O   
1773 O O   . HOH B .   ? 0.6476 0.4892 0.6914 0.2034  0.0628  -0.0367 452 HOH A O   
1774 O O   . HOH B .   ? 0.6932 0.6008 0.6374 0.0974  -0.2400 0.0019  453 HOH A O   
1775 O O   . HOH B .   ? 0.6400 0.7195 0.7255 -0.1096 -0.1268 0.3494  454 HOH A O   
1776 O O   . HOH B .   ? 0.5487 0.6291 0.6230 0.0406  -0.2466 0.2100  455 HOH A O   
1777 O O   . HOH B .   ? 0.6848 0.6037 0.9603 0.1861  -0.1244 0.1311  456 HOH A O   
1778 O O   . HOH B .   ? 0.3583 0.4160 0.7931 -0.0292 0.2633  -0.0094 457 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   2   ALA ALA A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   LYS 4   4   4   LYS LYS A . n 
A 1 5   ARG 5   5   5   ARG ARG A . n 
A 1 6   ALA 6   6   6   ALA ALA A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  LYS 12  12  12  LYS LYS A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  ALA 14  14  14  ALA ALA A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  GLU 16  16  16  GLU GLU A . n 
A 1 17  MET 17  17  17  MET MET A . n 
A 1 18  GLU 18  18  18  GLU GLU A . n 
A 1 19  THR 19  19  19  THR THR A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  ILE 21  21  21  ILE ILE A . n 
A 1 22  PRO 22  22  22  PRO PRO A . n 
A 1 23  VAL 23  23  23  VAL VAL A . n 
A 1 24  ASP 24  24  24  ASP ASP A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  MET 26  26  26  MET MET A . n 
A 1 27  ARG 27  27  27  ARG ARG A . n 
A 1 28  ARG 28  28  28  ARG ARG A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  THR 34  34  34  THR THR A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  ASP 42  42  42  ASP ASP A . n 
A 1 43  PRO 43  43  43  PRO PRO A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  GLN 45  45  45  GLN GLN A . n 
A 1 46  CYS 46  46  46  CYS CYS A . n 
A 1 47  SER 47  47  47  SER SER A . n 
A 1 48  ARG 48  48  48  ARG ARG A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  VAL 50  50  50  VAL VAL A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  ILE 52  52  52  ILE ILE A . n 
A 1 53  CYS 53  53  53  CYS CYS A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  ASP 55  55  55  ASP ASP A . n 
A 1 56  ALA 56  56  56  ALA ALA A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  PRO 66  66  66  PRO PRO A . n 
A 1 67  TYR 67  67  67  TYR TYR A . n 
A 1 68  ASP 68  68  68  ASP ASP A . n 
A 1 69  VAL 69  69  69  VAL VAL A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  PRO 73  73  73  PRO PRO A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  ASN 76  76  76  ASN ASN A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  GLN 80  80  80  GLN GLN A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  GLU 90  90  90  GLU GLU A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  GLN 95  95  95  GLN GLN A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  ASN 97  97  97  ASN ASN A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 ILE 102 102 102 ILE ILE A . n 
A 1 103 ALA 103 103 103 ALA ALA A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 CSD 106 106 106 CSD CSD A . n 
A 1 107 ALA 107 107 107 ALA ALA A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 PRO 109 109 109 PRO PRO A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 HIS 115 115 115 HIS HIS A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 ILE 117 117 117 ILE ILE A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 PHE 119 119 119 PHE PHE A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 LYS 122 122 122 LYS LYS A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 THR 124 124 124 THR THR A . n 
A 1 125 THR 125 125 125 THR THR A . n 
A 1 126 HIS 126 126 126 HIS HIS A . n 
A 1 127 PRO 127 127 127 PRO PRO A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 LYS 132 132 132 LYS LYS A . n 
A 1 133 MET 133 133 133 MET MET A . n 
A 1 134 MET 134 134 134 MET MET A . n 
A 1 135 ASN 135 135 135 ASN ASN A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 GLY 137 137 137 GLY GLY A . n 
A 1 138 HIS 138 138 138 HIS HIS A . n 
A 1 139 TYR 139 139 139 TYR TYR A . n 
A 1 140 THR 140 140 140 THR THR A . n 
A 1 141 TYR 141 141 141 TYR TYR A . n 
A 1 142 SER 142 142 142 SER SER A . n 
A 1 143 GLU 143 143 143 GLU GLU A . n 
A 1 144 ASN 144 144 144 ASN ASN A . n 
A 1 145 ARG 145 145 145 ARG ARG A . n 
A 1 146 VAL 146 146 146 VAL VAL A . n 
A 1 147 GLU 147 147 147 GLU GLU A . n 
A 1 148 LYS 148 148 148 LYS LYS A . n 
A 1 149 ASP 149 149 149 ASP ASP A . n 
A 1 150 GLY 150 150 150 GLY GLY A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 ILE 152 152 152 ILE ILE A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 THR 154 154 154 THR THR A . n 
A 1 155 SER 155 155 155 SER SER A . n 
A 1 156 ARG 156 156 156 ARG ARG A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 PRO 158 158 158 PRO PRO A . n 
A 1 159 GLY 159 159 159 GLY GLY A . n 
A 1 160 THR 160 160 160 THR THR A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 PHE 162 162 162 PHE PHE A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 PHE 164 164 164 PHE PHE A . n 
A 1 165 ALA 165 165 165 ALA ALA A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 ILE 168 168 168 ILE ILE A . n 
A 1 169 VAL 169 169 169 VAL VAL A . n 
A 1 170 GLU 170 170 170 GLU GLU A . n 
A 1 171 ALA 171 171 171 ALA ALA A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 ASN 173 173 173 ASN ASN A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 LYS 175 175 175 LYS LYS A . n 
A 1 176 GLU 176 176 176 GLU GLU A . n 
A 1 177 VAL 177 177 177 VAL VAL A . n 
A 1 178 ALA 178 178 178 ALA ALA A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 GLN 180 180 180 GLN GLN A . n 
A 1 181 VAL 181 181 181 VAL VAL A . n 
A 1 182 LYS 182 182 182 LYS LYS A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 PRO 184 184 184 PRO PRO A . n 
A 1 185 LEU 185 185 185 LEU LEU A . n 
A 1 186 VAL 186 186 186 VAL VAL A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 LYS 188 188 188 LYS LYS A . n 
A 1 189 ASP 189 189 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   190 1   HOH HOH A . 
B 2 HOH 2   191 2   HOH HOH A . 
B 2 HOH 3   192 3   HOH HOH A . 
B 2 HOH 4   193 4   HOH HOH A . 
B 2 HOH 5   194 5   HOH HOH A . 
B 2 HOH 6   195 6   HOH HOH A . 
B 2 HOH 7   196 7   HOH HOH A . 
B 2 HOH 8   197 8   HOH HOH A . 
B 2 HOH 9   198 9   HOH HOH A . 
B 2 HOH 10  199 10  HOH HOH A . 
B 2 HOH 11  200 11  HOH HOH A . 
B 2 HOH 12  201 12  HOH HOH A . 
B 2 HOH 13  202 13  HOH HOH A . 
B 2 HOH 14  203 14  HOH HOH A . 
B 2 HOH 15  204 15  HOH HOH A . 
B 2 HOH 16  205 16  HOH HOH A . 
B 2 HOH 17  206 17  HOH HOH A . 
B 2 HOH 18  207 18  HOH HOH A . 
B 2 HOH 19  208 19  HOH HOH A . 
B 2 HOH 20  209 20  HOH HOH A . 
B 2 HOH 21  210 21  HOH HOH A . 
B 2 HOH 22  211 22  HOH HOH A . 
B 2 HOH 23  212 23  HOH HOH A . 
B 2 HOH 24  213 24  HOH HOH A . 
B 2 HOH 25  214 25  HOH HOH A . 
B 2 HOH 26  215 26  HOH HOH A . 
B 2 HOH 27  216 27  HOH HOH A . 
B 2 HOH 28  217 28  HOH HOH A . 
B 2 HOH 29  218 29  HOH HOH A . 
B 2 HOH 30  219 30  HOH HOH A . 
B 2 HOH 31  220 31  HOH HOH A . 
B 2 HOH 32  221 32  HOH HOH A . 
B 2 HOH 33  222 33  HOH HOH A . 
B 2 HOH 34  223 34  HOH HOH A . 
B 2 HOH 35  224 35  HOH HOH A . 
B 2 HOH 36  225 36  HOH HOH A . 
B 2 HOH 37  226 37  HOH HOH A . 
B 2 HOH 38  227 38  HOH HOH A . 
B 2 HOH 39  228 39  HOH HOH A . 
B 2 HOH 40  229 40  HOH HOH A . 
B 2 HOH 41  230 41  HOH HOH A . 
B 2 HOH 42  231 42  HOH HOH A . 
B 2 HOH 43  232 43  HOH HOH A . 
B 2 HOH 44  233 44  HOH HOH A . 
B 2 HOH 45  234 45  HOH HOH A . 
B 2 HOH 46  235 46  HOH HOH A . 
B 2 HOH 47  236 47  HOH HOH A . 
B 2 HOH 48  237 48  HOH HOH A . 
B 2 HOH 49  238 49  HOH HOH A . 
B 2 HOH 50  239 50  HOH HOH A . 
B 2 HOH 51  240 51  HOH HOH A . 
B 2 HOH 52  241 52  HOH HOH A . 
B 2 HOH 53  242 53  HOH HOH A . 
B 2 HOH 54  243 54  HOH HOH A . 
B 2 HOH 55  244 55  HOH HOH A . 
B 2 HOH 56  245 56  HOH HOH A . 
B 2 HOH 57  246 57  HOH HOH A . 
B 2 HOH 58  247 58  HOH HOH A . 
B 2 HOH 59  248 59  HOH HOH A . 
B 2 HOH 60  249 60  HOH HOH A . 
B 2 HOH 61  250 61  HOH HOH A . 
B 2 HOH 62  251 62  HOH HOH A . 
B 2 HOH 63  252 63  HOH HOH A . 
B 2 HOH 64  253 64  HOH HOH A . 
B 2 HOH 65  254 65  HOH HOH A . 
B 2 HOH 66  255 66  HOH HOH A . 
B 2 HOH 67  256 67  HOH HOH A . 
B 2 HOH 68  257 68  HOH HOH A . 
B 2 HOH 69  258 69  HOH HOH A . 
B 2 HOH 70  259 70  HOH HOH A . 
B 2 HOH 71  260 71  HOH HOH A . 
B 2 HOH 72  261 72  HOH HOH A . 
B 2 HOH 73  262 73  HOH HOH A . 
B 2 HOH 74  263 74  HOH HOH A . 
B 2 HOH 75  264 75  HOH HOH A . 
B 2 HOH 76  265 76  HOH HOH A . 
B 2 HOH 77  266 77  HOH HOH A . 
B 2 HOH 78  267 78  HOH HOH A . 
B 2 HOH 79  268 79  HOH HOH A . 
B 2 HOH 80  269 80  HOH HOH A . 
B 2 HOH 81  270 81  HOH HOH A . 
B 2 HOH 82  271 82  HOH HOH A . 
B 2 HOH 83  272 83  HOH HOH A . 
B 2 HOH 84  273 84  HOH HOH A . 
B 2 HOH 85  274 85  HOH HOH A . 
B 2 HOH 86  275 86  HOH HOH A . 
B 2 HOH 87  276 87  HOH HOH A . 
B 2 HOH 88  277 88  HOH HOH A . 
B 2 HOH 89  278 89  HOH HOH A . 
B 2 HOH 90  279 90  HOH HOH A . 
B 2 HOH 91  280 91  HOH HOH A . 
B 2 HOH 92  281 92  HOH HOH A . 
B 2 HOH 93  282 93  HOH HOH A . 
B 2 HOH 94  283 94  HOH HOH A . 
B 2 HOH 95  284 95  HOH HOH A . 
B 2 HOH 96  285 96  HOH HOH A . 
B 2 HOH 97  286 97  HOH HOH A . 
B 2 HOH 98  287 98  HOH HOH A . 
B 2 HOH 99  288 99  HOH HOH A . 
B 2 HOH 100 289 100 HOH HOH A . 
B 2 HOH 101 290 101 HOH HOH A . 
B 2 HOH 102 291 102 HOH HOH A . 
B 2 HOH 103 292 103 HOH HOH A . 
B 2 HOH 104 293 104 HOH HOH A . 
B 2 HOH 105 294 105 HOH HOH A . 
B 2 HOH 106 295 106 HOH HOH A . 
B 2 HOH 107 296 107 HOH HOH A . 
B 2 HOH 108 297 108 HOH HOH A . 
B 2 HOH 109 298 109 HOH HOH A . 
B 2 HOH 110 299 110 HOH HOH A . 
B 2 HOH 111 300 111 HOH HOH A . 
B 2 HOH 112 301 112 HOH HOH A . 
B 2 HOH 113 302 113 HOH HOH A . 
B 2 HOH 114 303 114 HOH HOH A . 
B 2 HOH 115 304 115 HOH HOH A . 
B 2 HOH 116 305 116 HOH HOH A . 
B 2 HOH 117 306 117 HOH HOH A . 
B 2 HOH 118 307 118 HOH HOH A . 
B 2 HOH 119 308 119 HOH HOH A . 
B 2 HOH 120 309 120 HOH HOH A . 
B 2 HOH 121 310 121 HOH HOH A . 
B 2 HOH 122 311 122 HOH HOH A . 
B 2 HOH 123 312 123 HOH HOH A . 
B 2 HOH 124 313 124 HOH HOH A . 
B 2 HOH 125 314 125 HOH HOH A . 
B 2 HOH 126 315 126 HOH HOH A . 
B 2 HOH 127 316 127 HOH HOH A . 
B 2 HOH 128 317 128 HOH HOH A . 
B 2 HOH 129 318 129 HOH HOH A . 
B 2 HOH 130 319 130 HOH HOH A . 
B 2 HOH 131 320 131 HOH HOH A . 
B 2 HOH 132 321 132 HOH HOH A . 
B 2 HOH 133 322 133 HOH HOH A . 
B 2 HOH 134 323 134 HOH HOH A . 
B 2 HOH 135 324 135 HOH HOH A . 
B 2 HOH 136 325 136 HOH HOH A . 
B 2 HOH 137 326 137 HOH HOH A . 
B 2 HOH 138 327 138 HOH HOH A . 
B 2 HOH 139 328 139 HOH HOH A . 
B 2 HOH 140 329 140 HOH HOH A . 
B 2 HOH 141 330 141 HOH HOH A . 
B 2 HOH 142 331 142 HOH HOH A . 
B 2 HOH 143 332 143 HOH HOH A . 
B 2 HOH 144 333 144 HOH HOH A . 
B 2 HOH 145 334 145 HOH HOH A . 
B 2 HOH 146 335 146 HOH HOH A . 
B 2 HOH 147 336 147 HOH HOH A . 
B 2 HOH 148 337 148 HOH HOH A . 
B 2 HOH 149 338 149 HOH HOH A . 
B 2 HOH 150 339 150 HOH HOH A . 
B 2 HOH 151 340 151 HOH HOH A . 
B 2 HOH 152 341 152 HOH HOH A . 
B 2 HOH 153 342 153 HOH HOH A . 
B 2 HOH 154 343 154 HOH HOH A . 
B 2 HOH 155 344 155 HOH HOH A . 
B 2 HOH 156 345 156 HOH HOH A . 
B 2 HOH 157 346 157 HOH HOH A . 
B 2 HOH 158 347 158 HOH HOH A . 
B 2 HOH 159 348 159 HOH HOH A . 
B 2 HOH 160 349 160 HOH HOH A . 
B 2 HOH 161 350 161 HOH HOH A . 
B 2 HOH 162 351 162 HOH HOH A . 
B 2 HOH 163 352 163 HOH HOH A . 
B 2 HOH 164 353 164 HOH HOH A . 
B 2 HOH 165 354 165 HOH HOH A . 
B 2 HOH 166 355 166 HOH HOH A . 
B 2 HOH 167 356 167 HOH HOH A . 
B 2 HOH 168 357 168 HOH HOH A . 
B 2 HOH 169 358 169 HOH HOH A . 
B 2 HOH 170 359 170 HOH HOH A . 
B 2 HOH 171 360 171 HOH HOH A . 
B 2 HOH 172 361 172 HOH HOH A . 
B 2 HOH 173 362 173 HOH HOH A . 
B 2 HOH 174 363 174 HOH HOH A . 
B 2 HOH 175 364 175 HOH HOH A . 
B 2 HOH 176 365 176 HOH HOH A . 
B 2 HOH 177 366 177 HOH HOH A . 
B 2 HOH 178 367 178 HOH HOH A . 
B 2 HOH 179 368 179 HOH HOH A . 
B 2 HOH 180 369 180 HOH HOH A . 
B 2 HOH 181 370 181 HOH HOH A . 
B 2 HOH 182 371 182 HOH HOH A . 
B 2 HOH 183 372 183 HOH HOH A . 
B 2 HOH 184 373 184 HOH HOH A . 
B 2 HOH 185 374 185 HOH HOH A . 
B 2 HOH 186 375 186 HOH HOH A . 
B 2 HOH 187 376 187 HOH HOH A . 
B 2 HOH 188 377 188 HOH HOH A . 
B 2 HOH 189 378 189 HOH HOH A . 
B 2 HOH 190 379 190 HOH HOH A . 
B 2 HOH 191 380 191 HOH HOH A . 
B 2 HOH 192 381 192 HOH HOH A . 
B 2 HOH 193 382 193 HOH HOH A . 
B 2 HOH 194 383 194 HOH HOH A . 
B 2 HOH 195 384 195 HOH HOH A . 
B 2 HOH 196 385 196 HOH HOH A . 
B 2 HOH 197 386 197 HOH HOH A . 
B 2 HOH 198 387 198 HOH HOH A . 
B 2 HOH 199 388 199 HOH HOH A . 
B 2 HOH 200 389 200 HOH HOH A . 
B 2 HOH 201 390 201 HOH HOH A . 
B 2 HOH 202 391 202 HOH HOH A . 
B 2 HOH 203 392 203 HOH HOH A . 
B 2 HOH 204 393 204 HOH HOH A . 
B 2 HOH 205 394 205 HOH HOH A . 
B 2 HOH 206 395 206 HOH HOH A . 
B 2 HOH 207 396 207 HOH HOH A . 
B 2 HOH 208 397 208 HOH HOH A . 
B 2 HOH 209 398 209 HOH HOH A . 
B 2 HOH 210 399 210 HOH HOH A . 
B 2 HOH 211 400 211 HOH HOH A . 
B 2 HOH 212 401 212 HOH HOH A . 
B 2 HOH 213 402 213 HOH HOH A . 
B 2 HOH 214 403 214 HOH HOH A . 
B 2 HOH 215 404 215 HOH HOH A . 
B 2 HOH 216 405 216 HOH HOH A . 
B 2 HOH 217 406 217 HOH HOH A . 
B 2 HOH 218 407 218 HOH HOH A . 
B 2 HOH 219 408 219 HOH HOH A . 
B 2 HOH 220 409 220 HOH HOH A . 
B 2 HOH 221 410 221 HOH HOH A . 
B 2 HOH 222 411 222 HOH HOH A . 
B 2 HOH 223 412 223 HOH HOH A . 
B 2 HOH 224 413 224 HOH HOH A . 
B 2 HOH 225 414 225 HOH HOH A . 
B 2 HOH 226 415 226 HOH HOH A . 
B 2 HOH 227 416 227 HOH HOH A . 
B 2 HOH 228 417 228 HOH HOH A . 
B 2 HOH 229 418 229 HOH HOH A . 
B 2 HOH 230 419 230 HOH HOH A . 
B 2 HOH 231 420 231 HOH HOH A . 
B 2 HOH 232 421 232 HOH HOH A . 
B 2 HOH 233 422 233 HOH HOH A . 
B 2 HOH 234 423 234 HOH HOH A . 
B 2 HOH 235 424 235 HOH HOH A . 
B 2 HOH 236 425 236 HOH HOH A . 
B 2 HOH 237 426 237 HOH HOH A . 
B 2 HOH 238 427 238 HOH HOH A . 
B 2 HOH 239 428 239 HOH HOH A . 
B 2 HOH 240 429 240 HOH HOH A . 
B 2 HOH 241 430 241 HOH HOH A . 
B 2 HOH 242 431 242 HOH HOH A . 
B 2 HOH 243 432 243 HOH HOH A . 
B 2 HOH 244 433 244 HOH HOH A . 
B 2 HOH 245 434 245 HOH HOH A . 
B 2 HOH 246 435 246 HOH HOH A . 
B 2 HOH 247 436 247 HOH HOH A . 
B 2 HOH 248 437 248 HOH HOH A . 
B 2 HOH 249 438 249 HOH HOH A . 
B 2 HOH 250 439 250 HOH HOH A . 
B 2 HOH 251 440 251 HOH HOH A . 
B 2 HOH 252 441 252 HOH HOH A . 
B 2 HOH 253 442 253 HOH HOH A . 
B 2 HOH 254 443 254 HOH HOH A . 
B 2 HOH 255 444 255 HOH HOH A . 
B 2 HOH 256 445 256 HOH HOH A . 
B 2 HOH 257 446 257 HOH HOH A . 
B 2 HOH 258 447 258 HOH HOH A . 
B 2 HOH 259 448 259 HOH HOH A . 
B 2 HOH 260 449 260 HOH HOH A . 
B 2 HOH 261 450 261 HOH HOH A . 
B 2 HOH 262 451 262 HOH HOH A . 
B 2 HOH 263 452 263 HOH HOH A . 
B 2 HOH 264 453 264 HOH HOH A . 
B 2 HOH 265 454 265 HOH HOH A . 
B 2 HOH 266 455 266 HOH HOH A . 
B 2 HOH 267 456 267 HOH HOH A . 
B 2 HOH 268 457 268 HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    CSD 
_pdbx_struct_mod_residue.label_seq_id     106 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     CSD 
_pdbx_struct_mod_residue.auth_seq_id      106 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   CYS 
_pdbx_struct_mod_residue.details          3-SULFINOALANINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2700  ? 
1 MORE         -17   ? 
1 'SSA (A^2)'  15070 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000    
2 'crystal symmetry operation' 5_553 x-y,-y,-z-4/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -100.1253333333 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-06-22 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2014-11-12 
5 'Structure model' 1 4 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Non-polymer description'   
5 5 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    5 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    5 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHELX     'model building' . ? 1 
SHELXL-97 refinement       . ? 2 
DENZO     'data reduction' . ? 3 
SCALEPACK 'data scaling'   . ? 4 
SHELXL-97 phasing          . ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 98 ? ? CZ A ARG 98 ? ? NH1 A ARG 98 ? ? 124.21 120.30 3.91  0.50 N 
2 1 NE A ARG 98 ? ? CZ A ARG 98 ? ? NH2 A ARG 98 ? ? 113.18 120.30 -7.12 0.50 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    CSD 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     106 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             73.77 
_pdbx_validate_torsion.psi             -109.22 
# 
_pdbx_unobs_or_zero_occ_atoms.id               1 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id     LYS 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id      188 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id     O 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id     ? 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id    A 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id    LYS 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id     188 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id    O 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? A MET 1   
2 1 Y 1 A ASP 189 ? A ASP 189 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#