data_1SOM
# 
_entry.id   1SOM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SOM         
RCSB  RCSB000673   
WWPDB D_1000000673 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SOM 
_pdbx_database_status.recvd_initial_deposition_date   1999-03-17 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Greenblatt, H.M.' 1 
'Millard, C.B.'    2 
'Sussman, J.L.'    3 
'Silman, I.'       4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structures of aged phosphonylated acetylcholinesterase: nerve agent reaction products at the atomic level.' 
Biochemistry                                                     38 7032 7039 1999 BICHAW US 0006-2960 0033 ? 10353814 
10.1021/bi982678l 
1       
;Crystal Structural of "Aged" Phosphorylated and Phosphonylated Torpedo Californica Acetylcholinesterase
;
'Structure and Function of Cholinesterases and Related Proteins' ?  425  ?    1998 ?      ?  ?         9999 
'New York : Plenum Press' ?        ?                 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Millard, C.B.'    1  ? 
primary 'Kryger, G.'       2  ? 
primary 'Ordentlich, A.'   3  ? 
primary 'Greenblatt, H.M.' 4  ? 
primary 'Harel, M.'        5  ? 
primary 'Raves, M.L.'      6  ? 
primary 'Segall, Y.'       7  ? 
primary 'Barak, D.'        8  ? 
primary 'Shafferman, A.'   9  ? 
primary 'Silman, I.'       10 ? 
primary 'Sussman, J.L.'    11 ? 
1       'Millard, C.B.'    12 ? 
1       'Kryger, G.'       13 ? 
1       'Ordentlich, A.'   14 ? 
1       'Harel, M.'        15 ? 
1       'Raves, M.L.'      16 ? 
1       'Greenblat, H.M.'  17 ? 
1       'Segall, Y.'       18 ? 
1       'Barak, D.'        19 ? 
1       'Shafferman, A.'   20 ? 
1       'Silman, I.'       21 ? 
1       'Sussman, J.L.'    22 ? 
# 
loop_
_citation_editor.citation_id 
_citation_editor.name 
_citation_editor.ordinal 
1 'Doctor, B.P.'  1 
1 'Taylor, P.'    2 
1 'Quinn, D.M.'   3 
1 'Rotundo, R.L.' 4 
1 'K Gentry, M.'  5 
# 
_cell.entry_id           1SOM 
_cell.length_a           111.560 
_cell.length_b           111.560 
_cell.length_c           137.002 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SOM 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'PROTEIN (ACETYLCHOLINESTERASE)'         61325.090 1   3.1.1.7 ? ? 
'NERVE AGENT GD (SOMAN) COVALENTLY BOUND TO CATALYTIC SERINE (SER200)' 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   2   ?       ? ? ? 
3 non-polymer syn 'UNKNOWN ATOM OR ION'                    ?         10  ?       ? ? ? 
4 non-polymer syn 'METHYLPHOSPHONIC ACID ESTER GROUP'      79.015    1   ?       ? ? ? 
5 water       nat water                                    18.015    184 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
1 538 ASP n 
1 539 GLY n 
1 540 GLU n 
1 541 LEU n 
1 542 SER n 
1 543 SER n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'Pacific electric ray' 
_entity_src_nat.pdbx_organism_scientific   'Torpedo californica' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      Torpedo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               'G2 FORM' 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1SOM 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 543 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  564 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose 
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
UNX non-polymer                  . 'UNKNOWN ATOM OR ION'                    ? ?                ?       
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
VXA non-polymer                  . 'METHYLPHOSPHONIC ACID ESTER GROUP'      ? 'C H4 O2 P -1'   79.015  
# 
_exptl.entry_id          1SOM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.8 
_exptl_crystal.density_percent_sol   68 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
;PROTEIN WAS CRYSTALLIZED FROM 
35-40% W/V PEG 200 
0.15M MES PH 6.0 
0.05M NACL 
4 DEG. CELSIUS 
, temperature 277.0K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS II' 
_diffrn_detector.pdbx_collection_date   1997-12 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1SOM 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30. 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   49048 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.05 
_reflns.pdbx_netI_over_sigmaI        15.6 
_reflns.B_iso_Wilson_estimate        24.0 
_reflns.pdbx_redundancy              5.8 
_reflns.R_free_details               ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.2 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   94.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.297 
_reflns_shell.meanI_over_sigI_obs    2.6 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1SOM 
_refine.ls_number_reflns_obs                     48792 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           2163305.50 
_refine.ls_d_res_low                             29.50 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    96.5 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21 
_refine.ls_R_factor_R_free                       0.251 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2460 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               35.3 
_refine.aniso_B[1][1]                            7.77 
_refine.aniso_B[2][2]                            7.77 
_refine.aniso_B[3][3]                            -15.5 
_refine.aniso_B[1][2]                            3.42 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.366 
_refine.solvent_model_param_bsol                 49.78 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;REFINED INITIALLY WITH REFMAC TO AN R OF 23.4 AND RFREE OF 27.9

CONTINUOUS ELECTRON DENSITY FEATURES IN FRONT OF THE INDOLE
RINGS OF TRP84 AND TRP279 DID NOT SATISFACTORILY REFINE
WITH WATER MOLECULES. THESE FEATURES WERE LEFT EMPTY DURING
REFINEMENT, BUT THEIR POSITIONS ARE INDICATED IN THE MODEL
BY OXYGEN ATOMS WITH ZERO OCCUPANCY (RESIDUES 1000 - 1009)
;
_refine.pdbx_starting_model                      2ACE 
_refine.pdbx_method_to_determine_struct          OTHER 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1SOM 
_refine_analyze.Luzzati_coordinate_error_obs    0.26 
_refine_analyze.Luzzati_sigma_a_obs             0.25 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.32 
_refine_analyze.Luzzati_sigma_a_free            0.27 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4174 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         42 
_refine_hist.number_atoms_solvent             184 
_refine_hist.number_atoms_total               4400 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        29.50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.019 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.9   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      23.9  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.22  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.34 
_refine_ls_shell.number_reflns_R_work             7455 
_refine_ls_shell.R_factor_R_work                  0.264 
_refine_ls_shell.percent_reflns_obs               94.5 
_refine_ls_shell.R_factor_R_free                  0.292 
_refine_ls_shell.R_factor_R_free_error            0.015 
_refine_ls_shell.percent_reflns_R_free            5.1 
_refine_ls_shell.number_reflns_R_free             398 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM  PROTEIN.TOP      'X-RAY DIFFRACTION' 
2 CARBOHYDRATE.PARAM CARBOHYDRATE.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM    WATER.TOP        'X-RAY DIFFRACTION' 
4 CIS_PEPTIDE.PARAM  SOMAN.TOP        'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1SOM 
_struct.title                     'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE INHIBITED BY NERVE AGENT GD (SOMAN).' 
_struct.pdbx_descriptor           ACETYLCHOLINESTERASE 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SOM 
_struct_keywords.pdbx_keywords   'SERINE HYDROLASE' 
_struct_keywords.text            'SERINE HYDROLASE, CHOLINESTERASE, NERVE AGENT, ORGANOPHOSPHOROUS ACID ANHYDRIDE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 4 ? 
O N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1A  SER A 79  ? ASN A 85  ? SER A 79  ASN A 85  1 ? 7  
HELX_P HELX_P2  2A  GLY A 132 ? GLU A 139 ? GLY A 132 GLU A 139 1 ? 8  
HELX_P HELX_P3  3A  VAL A 168 ? ASN A 183 ? VAL A 168 ASN A 183 1 ? 16 
HELX_P HELX_P4  4A  SER A 200 ? LEU A 211 ? SER A 200 LEU A 211 1 ? 12 
HELX_P HELX_P5  5A  VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P6  6A  ASP A 259 ? GLU A 268 ? ASP A 259 GLU A 268 1 ? 10 
HELX_P HELX_P7  7A  PRO A 271 ? GLU A 278 ? PRO A 271 GLU A 278 1 ? 8  
HELX_P HELX_P8  8A  LEU A 305 ? SER A 311 ? LEU A 305 SER A 311 1 ? 7  
HELX_P HELX_P9  9A  SER A 329 ? GLY A 335 ? SER A 329 GLY A 335 1 ? 7  
HELX_P HELX_P10 10A ARG A 349 ? VAL A 360 ? ARG A 349 VAL A 360 1 ? 12 
HELX_P HELX_P11 11A ASP A 365 ? THR A 376 ? ASP A 365 THR A 376 1 ? 12 
HELX_P HELX_P12 12A GLY A 384 ? TYR A 411 ? GLY A 384 TYR A 411 1 ? 28 
HELX_P HELX_P13 13A GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P14 14A ALA A 460 ? THR A 479 ? ALA A 460 THR A 479 1 ? 20 
HELX_P HELX_P15 15A VAL A 518 ? THR A 535 ? VAL A 518 THR A 535 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94   1_555 ? ? ? ? ? ? ? 2.059 ? ?               
disulf2 disulf ?    ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265  1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf3 disulf ?    ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521  1_555 ? ? ? ? ? ? ? 2.026 ? ?               
covale1 covale one  ? A ASN 59  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 59  A NAG 545  1_555 ? ? ? ? ? ? ? 1.463 ? N-Glycosylation 
covale2 covale none ? A SER 200 OG  ? ? ? 1_555 N VXA .   P1 ? ? A SER 200 A VXA 1010 1_555 ? ? ? ? ? ? ? 1.528 ? ?               
covale3 covale one  ? A ASN 416 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 416 A NAG 544  1_555 ? ? ? ? ? ? ? 1.440 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       1.35 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 6   ? THR A 10  ? LEU A 6   THR A 10  
A 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
A 3  VAL A 57  ? ALA A 60  ? VAL A 57  ALA A 60  
B 1  MET A 16  ? PRO A 21  ? MET A 16  PRO A 21  
B 2  HIS A 26  ? PRO A 34  ? HIS A 26  PRO A 34  
B 3  TYR A 96  ? PRO A 102 ? TYR A 96  PRO A 102 
B 4  VAL A 142 ? SER A 147 ? VAL A 142 SER A 147 
B 5  THR A 109 ? TYR A 116 ? THR A 109 TYR A 116 
B 6  THR A 193 ? GLU A 199 ? THR A 193 GLU A 199 
B 7  ARG A 220 ? SER A 226 ? ARG A 220 SER A 226 
B 8  GLN A 318 ? ASN A 324 ? GLN A 318 ASN A 324 
B 9  GLY A 417 ? PHE A 423 ? GLY A 417 PHE A 423 
B 10 PHE A 502 ? LEU A 505 ? PHE A 502 LEU A 505 
B 11 MET A 510 ? GLN A 514 ? MET A 510 GLN A 514 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O VAL A 8   ? O VAL A 8   N VAL A 15  ? N VAL A 15  
A 2  3  O LYS A 14  ? O LYS A 14  N TRP A 58  ? N TRP A 58  
B 1  2  N THR A 18  ? N THR A 18  O ALA A 29  ? O ALA A 29  
B 2  3  O PHE A 30  ? O PHE A 30  N ILE A 99  ? N ILE A 99  
B 3  4  O TRP A 100 ? O TRP A 100 N LEU A 143 ? N LEU A 143 
B 4  5  O VAL A 142 ? O VAL A 142 N MET A 112 ? N MET A 112 
B 5  6  N VAL A 113 ? N VAL A 113 O THR A 195 ? O THR A 195 
B 6  7  O ILE A 196 ? O ILE A 196 N ILE A 223 ? N ILE A 223 
B 7  8  O LEU A 224 ? O LEU A 224 N GLY A 322 ? N GLY A 322 
B 8  9  O LEU A 321 ? O LEU A 321 N TYR A 421 ? N TYR A 421 
B 9  10 O LEU A 420 ? O LEU A 420 N ILE A 503 ? N ILE A 503 
B 10 11 O PHE A 502 ? O PHE A 502 N HIS A 513 ? N HIS A 513 
# 
_struct_site.id                   CAT 
_struct_site.pdbx_evidence_code   Author 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    3 
_struct_site.details              'CATALYTIC TRIAD' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 CAT 3 SER A 200 ? SER A 200 . ? 1_555 ? 
2 CAT 3 GLU A 327 ? GLU A 327 . ? 1_555 ? 
3 CAT 3 HIS A 440 ? HIS A 440 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1SOM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SOM 
_atom_sites.fract_transf_matrix[1][1]   0.008964 
_atom_sites.fract_transf_matrix[1][2]   0.005175 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010350 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007299 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
X 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -12.670 87.662 34.097 1.00 46.33 ? 4    SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -12.214 87.869 35.513 1.00 46.56 ? 4    SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -11.103 86.934 35.961 1.00 46.08 ? 4    SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -11.194 85.725 35.795 1.00 46.10 ? 4    SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -13.368 87.714 36.508 1.00 46.76 ? 4    SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -12.887 87.910 37.847 1.00 48.13 ? 4    SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -10.071 87.522 36.562 1.00 45.90 ? 5    GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -8.921  86.795 37.076 1.00 45.41 ? 5    GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -9.321  85.770 38.136 1.00 44.79 ? 5    GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -8.674  84.734 38.259 1.00 44.81 ? 5    GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -7.913  87.774 37.683 1.00 45.97 ? 5    GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -6.528  87.174 37.973 1.00 47.08 ? 5    GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -5.484  88.246 38.089 1.00 48.03 ? 5    GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -5.910  89.419 38.106 1.00 48.83 ? 5    GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -4.257  87.952 38.157 1.00 48.59 ? 5    GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -10.376 86.059 38.893 1.00 43.69 ? 6    LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -10.825 85.165 39.950 1.00 42.80 ? 6    LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -11.839 84.108 39.529 1.00 42.23 ? 6    LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -12.340 83.352 40.358 1.00 42.23 ? 6    LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -11.380 85.996 41.119 1.00 42.39 ? 6    LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -10.416 87.083 41.617 1.00 42.20 ? 6    LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -11.144 87.880 42.693 1.00 42.50 ? 6    LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -9.097  86.511 42.182 1.00 42.00 ? 6    LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -12.144 84.028 38.248 1.00 41.73 ? 7    LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -13.102 83.026 37.832 1.00 41.34 ? 7    LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -12.387 82.047 36.934 1.00 40.67 ? 7    LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -11.756 82.415 35.944 1.00 40.50 ? 7    LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -14.283 83.660 37.100 1.00 42.15 ? 7    LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -15.365 82.684 36.612 1.00 42.97 ? 7    LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -16.039 82.004 37.815 1.00 43.45 ? 7    LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? -16.417 83.454 35.779 1.00 43.71 ? 7    LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? -12.450 80.785 37.301 1.00 39.94 ? 8    VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? -11.774 79.785 36.504 1.00 39.25 ? 8    VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? -12.785 78.714 36.228 1.00 39.07 ? 8    VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? -13.550 78.299 37.085 1.00 38.94 ? 8    VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? -10.547 79.202 37.251 1.00 39.34 ? 8    VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? -9.918  78.060 36.445 1.00 38.54 ? 8    VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? -9.535  80.311 37.518 1.00 38.74 ? 8    VAL A CG2 1 
ATOM   39   N N   . ASN A 1 9   ? -12.777 78.280 34.991 1.00 39.31 ? 9    ASN A N   1 
ATOM   40   C CA  . ASN A 1 9   ? -13.678 77.260 34.536 1.00 39.34 ? 9    ASN A CA  1 
ATOM   41   C C   . ASN A 1 9   ? -12.963 75.935 34.530 1.00 38.32 ? 9    ASN A C   1 
ATOM   42   O O   . ASN A 1 9   ? -12.049 75.770 33.752 1.00 38.50 ? 9    ASN A O   1 
ATOM   43   C CB  . ASN A 1 9   ? -14.073 77.595 33.141 1.00 40.51 ? 9    ASN A CB  1 
ATOM   44   C CG  . ASN A 1 9   ? -15.479 77.368 32.924 1.00 43.20 ? 9    ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 9   ? -16.023 76.284 33.294 1.00 43.96 ? 9    ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 9   ? -16.153 78.388 32.336 1.00 44.52 ? 9    ASN A ND2 1 
ATOM   47   N N   . THR A 1 10  ? -13.359 74.987 35.363 1.00 37.57 ? 10   THR A N   1 
ATOM   48   C CA  . THR A 1 10  ? -12.638 73.706 35.357 1.00 36.60 ? 10   THR A CA  1 
ATOM   49   C C   . THR A 1 10  ? -13.553 72.634 34.808 1.00 36.74 ? 10   THR A C   1 
ATOM   50   O O   . THR A 1 10  ? -14.712 72.919 34.526 1.00 36.70 ? 10   THR A O   1 
ATOM   51   C CB  . THR A 1 10  ? -12.200 73.247 36.789 1.00 35.79 ? 10   THR A CB  1 
ATOM   52   O OG1 . THR A 1 10  ? -13.336 72.730 37.474 1.00 34.72 ? 10   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 10  ? -11.586 74.388 37.596 1.00 34.82 ? 10   THR A CG2 1 
ATOM   54   N N   . LYS A 1 11  ? -13.045 71.399 34.691 1.00 36.78 ? 11   LYS A N   1 
ATOM   55   C CA  . LYS A 1 11  ? -13.841 70.265 34.210 1.00 36.70 ? 11   LYS A CA  1 
ATOM   56   C C   . LYS A 1 11  ? -14.897 69.868 35.241 1.00 37.24 ? 11   LYS A C   1 
ATOM   57   O O   . LYS A 1 11  ? -15.854 69.171 34.926 1.00 37.34 ? 11   LYS A O   1 
ATOM   58   C CB  . LYS A 1 11  ? -12.931 69.058 33.917 1.00 36.37 ? 11   LYS A CB  1 
ATOM   59   C CG  . LYS A 1 11  ? -11.846 69.352 32.863 1.00 35.89 ? 11   LYS A CG  1 
ATOM   60   C CD  . LYS A 1 11  ? -10.807 68.270 32.764 1.00 34.83 ? 11   LYS A CD  1 
ATOM   61   C CE  . LYS A 1 11  ? -9.807  68.612 31.647 1.00 34.29 ? 11   LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 11  ? -8.721  67.609 31.522 1.00 33.64 ? 11   LYS A NZ  1 
ATOM   63   N N   . SER A 1 12  ? -14.734 70.288 36.484 1.00 37.71 ? 12   SER A N   1 
ATOM   64   C CA  . SER A 1 12  ? -15.743 69.934 37.474 1.00 38.38 ? 12   SER A CA  1 
ATOM   65   C C   . SER A 1 12  ? -16.799 71.032 37.687 1.00 38.44 ? 12   SER A C   1 
ATOM   66   O O   . SER A 1 12  ? -17.852 70.798 38.318 1.00 38.38 ? 12   SER A O   1 
ATOM   67   C CB  . SER A 1 12  ? -15.050 69.554 38.789 1.00 38.82 ? 12   SER A CB  1 
ATOM   68   O OG  . SER A 1 12  ? -14.370 68.307 38.607 1.00 40.27 ? 12   SER A OG  1 
ATOM   69   N N   . GLY A 1 13  ? -16.541 72.208 37.119 1.00 38.59 ? 13   GLY A N   1 
ATOM   70   C CA  . GLY A 1 13  ? -17.468 73.322 37.247 1.00 38.74 ? 13   GLY A CA  1 
ATOM   71   C C   . GLY A 1 13  ? -16.703 74.617 37.362 1.00 38.95 ? 13   GLY A C   1 
ATOM   72   O O   . GLY A 1 13  ? -15.468 74.594 37.329 1.00 38.92 ? 13   GLY A O   1 
ATOM   73   N N   . LYS A 1 14  ? -17.406 75.748 37.486 1.00 39.14 ? 14   LYS A N   1 
ATOM   74   C CA  . LYS A 1 14  ? -16.717 77.038 37.617 1.00 39.42 ? 14   LYS A CA  1 
ATOM   75   C C   . LYS A 1 14  ? -16.369 77.273 39.072 1.00 39.29 ? 14   LYS A C   1 
ATOM   76   O O   . LYS A 1 14  ? -17.064 76.826 39.987 1.00 38.90 ? 14   LYS A O   1 
ATOM   77   C CB  . LYS A 1 14  ? -17.573 78.206 37.111 1.00 40.28 ? 14   LYS A CB  1 
ATOM   78   C CG  . LYS A 1 14  ? -17.616 78.319 35.593 1.00 42.51 ? 14   LYS A CG  1 
ATOM   79   C CD  . LYS A 1 14  ? -18.517 79.484 35.106 1.00 43.84 ? 14   LYS A CD  1 
ATOM   80   C CE  . LYS A 1 14  ? -18.973 79.262 33.661 1.00 45.00 ? 14   LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 14  ? -20.128 80.145 33.228 1.00 45.83 ? 14   LYS A NZ  1 
ATOM   82   N N   . VAL A 1 15  ? -15.281 77.978 39.294 1.00 39.39 ? 15   VAL A N   1 
ATOM   83   C CA  . VAL A 1 15  ? -14.873 78.241 40.653 1.00 39.95 ? 15   VAL A CA  1 
ATOM   84   C C   . VAL A 1 15  ? -14.534 79.730 40.751 1.00 39.87 ? 15   VAL A C   1 
ATOM   85   O O   . VAL A 1 15  ? -13.934 80.294 39.829 1.00 39.38 ? 15   VAL A O   1 
ATOM   86   C CB  . VAL A 1 15  ? -13.652 77.288 41.029 1.00 39.67 ? 15   VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 15  ? -12.355 77.855 40.564 1.00 39.90 ? 15   VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 15  ? -13.598 77.077 42.473 1.00 40.51 ? 15   VAL A CG2 1 
ATOM   89   N N   . MET A 1 16  ? -14.949 80.362 41.852 1.00 40.47 ? 16   MET A N   1 
ATOM   90   C CA  . MET A 1 16  ? -14.673 81.796 42.068 1.00 40.94 ? 16   MET A CA  1 
ATOM   91   C C   . MET A 1 16  ? -13.728 81.978 43.220 1.00 40.39 ? 16   MET A C   1 
ATOM   92   O O   . MET A 1 16  ? -14.028 81.650 44.366 1.00 40.05 ? 16   MET A O   1 
ATOM   93   C CB  . MET A 1 16  ? -15.961 82.598 42.350 1.00 42.56 ? 16   MET A CB  1 
ATOM   94   C CG  . MET A 1 16  ? -15.760 84.139 42.577 1.00 44.32 ? 16   MET A CG  1 
ATOM   95   S SD  . MET A 1 16  ? -15.208 85.004 41.051 1.00 47.66 ? 16   MET A SD  1 
ATOM   96   C CE  . MET A 1 16  ? -15.117 86.767 41.664 1.00 47.38 ? 16   MET A CE  1 
ATOM   97   N N   . GLY A 1 17  ? -12.581 82.532 42.902 1.00 40.35 ? 17   GLY A N   1 
ATOM   98   C CA  . GLY A 1 17  ? -11.586 82.749 43.921 1.00 40.90 ? 17   GLY A CA  1 
ATOM   99   C C   . GLY A 1 17  ? -11.704 84.077 44.646 1.00 41.25 ? 17   GLY A C   1 
ATOM   100  O O   . GLY A 1 17  ? -12.752 84.723 44.625 1.00 40.83 ? 17   GLY A O   1 
ATOM   101  N N   . THR A 1 18  ? -10.601 84.465 45.284 1.00 41.73 ? 18   THR A N   1 
ATOM   102  C CA  . THR A 1 18  ? -10.518 85.697 46.060 1.00 42.28 ? 18   THR A CA  1 
ATOM   103  C C   . THR A 1 18  ? -9.134  86.250 45.940 1.00 42.26 ? 18   THR A C   1 
ATOM   104  O O   . THR A 1 18  ? -8.179  85.507 45.807 1.00 41.95 ? 18   THR A O   1 
ATOM   105  C CB  . THR A 1 18  ? -10.820 85.443 47.548 1.00 42.64 ? 18   THR A CB  1 
ATOM   106  O OG1 . THR A 1 18  ? -10.855 86.692 48.233 1.00 43.17 ? 18   THR A OG1 1 
ATOM   107  C CG2 . THR A 1 18  ? -9.725  84.566 48.193 1.00 42.89 ? 18   THR A CG2 1 
ATOM   108  N N   . ARG A 1 19  ? -9.029  87.569 45.978 1.00 42.74 ? 19   ARG A N   1 
ATOM   109  C CA  . ARG A 1 19  ? -7.754  88.248 45.845 1.00 43.05 ? 19   ARG A CA  1 
ATOM   110  C C   . ARG A 1 19  ? -7.123  88.396 47.227 1.00 42.83 ? 19   ARG A C   1 
ATOM   111  O O   . ARG A 1 19  ? -7.797  88.755 48.186 1.00 42.82 ? 19   ARG A O   1 
ATOM   112  C CB  . ARG A 1 19  ? -7.972  89.606 45.178 1.00 44.27 ? 19   ARG A CB  1 
ATOM   113  C CG  . ARG A 1 19  ? -6.748  90.493 45.187 1.00 46.47 ? 19   ARG A CG  1 
ATOM   114  C CD  . ARG A 1 19  ? -6.812  91.579 44.090 1.00 48.74 ? 19   ARG A CD  1 
ATOM   115  N NE  . ARG A 1 19  ? -5.638  91.470 43.218 1.00 50.87 ? 19   ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 19  ? -4.878  92.488 42.816 1.00 51.35 ? 19   ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 19  ? -5.170  93.744 43.196 1.00 52.01 ? 19   ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 19  ? -3.783  92.231 42.094 1.00 51.51 ? 19   ARG A NH2 1 
ATOM   119  N N   . VAL A 1 20  ? -5.839  88.080 47.355 1.00 42.44 ? 20   VAL A N   1 
ATOM   120  C CA  . VAL A 1 20  ? -5.219  88.179 48.672 1.00 42.07 ? 20   VAL A CA  1 
ATOM   121  C C   . VAL A 1 20  ? -3.962  88.972 48.653 1.00 41.42 ? 20   VAL A C   1 
ATOM   122  O O   . VAL A 1 20  ? -3.193  88.904 47.719 1.00 41.19 ? 20   VAL A O   1 
ATOM   123  C CB  . VAL A 1 20  ? -4.913  86.777 49.304 1.00 42.11 ? 20   VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 20  ? -6.100  85.869 49.098 1.00 42.47 ? 20   VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 20  ? -3.673  86.165 48.693 1.00 42.59 ? 20   VAL A CG2 1 
ATOM   126  N N   . PRO A 1 21  ? -3.748  89.762 49.702 1.00 41.61 ? 21   PRO A N   1 
ATOM   127  C CA  . PRO A 1 21  ? -2.525  90.576 49.760 1.00 41.56 ? 21   PRO A CA  1 
ATOM   128  C C   . PRO A 1 21  ? -1.338  89.704 50.216 1.00 41.63 ? 21   PRO A C   1 
ATOM   129  O O   . PRO A 1 21  ? -1.520  88.697 50.921 1.00 41.63 ? 21   PRO A O   1 
ATOM   130  C CB  . PRO A 1 21  ? -2.906  91.711 50.727 1.00 41.29 ? 21   PRO A CB  1 
ATOM   131  C CG  . PRO A 1 21  ? -3.873  91.058 51.668 1.00 41.31 ? 21   PRO A CG  1 
ATOM   132  C CD  . PRO A 1 21  ? -4.698  90.107 50.778 1.00 41.18 ? 21   PRO A CD  1 
ATOM   133  N N   . VAL A 1 22  ? -0.140  90.083 49.782 1.00 41.45 ? 22   VAL A N   1 
ATOM   134  C CA  . VAL A 1 22  ? 1.077   89.349 50.080 1.00 41.87 ? 22   VAL A CA  1 
ATOM   135  C C   . VAL A 1 22  ? 2.268   90.271 49.866 1.00 41.97 ? 22   VAL A C   1 
ATOM   136  O O   . VAL A 1 22  ? 2.478   90.749 48.759 1.00 41.44 ? 22   VAL A O   1 
ATOM   137  C CB  . VAL A 1 22  ? 1.331   88.166 49.069 1.00 41.97 ? 22   VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 22  ? 2.475   87.293 49.568 1.00 41.19 ? 22   VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 22  ? 0.080   87.372 48.835 1.00 42.24 ? 22   VAL A CG2 1 
ATOM   140  N N   . LEU A 1 23  ? 3.063   90.476 50.905 1.00 42.67 ? 23   LEU A N   1 
ATOM   141  C CA  . LEU A 1 23  ? 4.260   91.306 50.801 1.00 43.69 ? 23   LEU A CA  1 
ATOM   142  C C   . LEU A 1 23  ? 4.066   92.609 49.952 1.00 44.08 ? 23   LEU A C   1 
ATOM   143  O O   . LEU A 1 23  ? 4.846   92.907 49.043 1.00 44.07 ? 23   LEU A O   1 
ATOM   144  C CB  . LEU A 1 23  ? 5.391   90.429 50.235 1.00 43.65 ? 23   LEU A CB  1 
ATOM   145  C CG  . LEU A 1 23  ? 5.790   89.191 51.060 1.00 43.67 ? 23   LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 23  ? 6.932   88.443 50.392 1.00 43.63 ? 23   LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 23  ? 6.214   89.634 52.463 1.00 44.06 ? 23   LEU A CD2 1 
ATOM   148  N N   . SER A 1 24  ? 2.997   93.338 50.279 1.00 44.55 ? 24   SER A N   1 
ATOM   149  C CA  . SER A 1 24  ? 2.581   94.603 49.642 1.00 45.46 ? 24   SER A CA  1 
ATOM   150  C C   . SER A 1 24  ? 2.139   94.494 48.184 1.00 45.30 ? 24   SER A C   1 
ATOM   151  O O   . SER A 1 24  ? 2.201   95.476 47.437 1.00 45.94 ? 24   SER A O   1 
ATOM   152  C CB  . SER A 1 24  ? 3.670   95.676 49.747 1.00 45.68 ? 24   SER A CB  1 
ATOM   153  O OG  . SER A 1 24  ? 4.611   95.467 48.707 1.00 47.26 ? 24   SER A OG  1 
ATOM   154  N N   . SER A 1 25  ? 1.686   93.303 47.791 1.00 44.84 ? 25   SER A N   1 
ATOM   155  C CA  . SER A 1 25  ? 1.184   93.042 46.452 1.00 43.68 ? 25   SER A CA  1 
ATOM   156  C C   . SER A 1 25  ? -0.044  92.151 46.645 1.00 43.11 ? 25   SER A C   1 
ATOM   157  O O   . SER A 1 25  ? -0.618  92.105 47.750 1.00 42.22 ? 25   SER A O   1 
ATOM   158  C CB  . SER A 1 25  ? 2.275   92.373 45.607 1.00 44.11 ? 25   SER A CB  1 
ATOM   159  O OG  . SER A 1 25  ? 1.828   92.066 44.295 1.00 44.21 ? 25   SER A OG  1 
ATOM   160  N N   . HIS A 1 26  ? -0.467  91.468 45.584 1.00 42.85 ? 26   HIS A N   1 
ATOM   161  C CA  . HIS A 1 26  ? -1.636  90.591 45.651 1.00 42.86 ? 26   HIS A CA  1 
ATOM   162  C C   . HIS A 1 26  ? -1.540  89.438 44.673 1.00 42.38 ? 26   HIS A C   1 
ATOM   163  O O   . HIS A 1 26  ? -0.907  89.561 43.628 1.00 41.88 ? 26   HIS A O   1 
ATOM   164  C CB  . HIS A 1 26  ? -2.933  91.347 45.282 1.00 44.30 ? 26   HIS A CB  1 
ATOM   165  C CG  . HIS A 1 26  ? -3.188  92.577 46.103 1.00 46.06 ? 26   HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 26  ? -2.616  93.803 45.813 1.00 46.87 ? 26   HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 26  ? -3.923  92.763 47.230 1.00 46.77 ? 26   HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 26  ? -2.988  94.686 46.727 1.00 47.40 ? 26   HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 26  ? -3.783  94.080 47.599 1.00 47.53 ? 26   HIS A NE2 1 
ATOM   170  N N   . ILE A 1 27  ? -2.180  88.320 45.018 1.00 41.73 ? 27   ILE A N   1 
ATOM   171  C CA  . ILE A 1 27  ? -2.275  87.189 44.111 1.00 41.22 ? 27   ILE A CA  1 
ATOM   172  C C   . ILE A 1 27  ? -3.663  86.642 44.296 1.00 40.62 ? 27   ILE A C   1 
ATOM   173  O O   . ILE A 1 27  ? -4.399  87.129 45.153 1.00 40.26 ? 27   ILE A O   1 
ATOM   174  C CB  . ILE A 1 27  ? -1.245  86.107 44.378 1.00 41.51 ? 27   ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 27  ? -1.402  85.552 45.772 1.00 41.91 ? 27   ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 27  ? 0.150   86.675 44.218 1.00 41.69 ? 27   ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 27  ? -0.384  84.459 46.027 1.00 42.68 ? 27   ILE A CD1 1 
ATOM   178  N N   . SER A 1 28  ? -4.031  85.644 43.496 1.00 39.95 ? 28   SER A N   1 
ATOM   179  C CA  . SER A 1 28  ? -5.368  85.062 43.597 1.00 39.31 ? 28   SER A CA  1 
ATOM   180  C C   . SER A 1 28  ? -5.303  83.784 44.422 1.00 38.99 ? 28   SER A C   1 
ATOM   181  O O   . SER A 1 28  ? -4.273  83.082 44.410 1.00 39.09 ? 28   SER A O   1 
ATOM   182  C CB  . SER A 1 28  ? -5.936  84.695 42.212 1.00 39.16 ? 28   SER A CB  1 
ATOM   183  O OG  . SER A 1 28  ? -5.476  85.554 41.175 1.00 39.66 ? 28   SER A OG  1 
ATOM   184  N N   . ALA A 1 29  ? -6.406  83.474 45.107 1.00 37.99 ? 29   ALA A N   1 
ATOM   185  C CA  . ALA A 1 29  ? -6.491  82.250 45.889 1.00 37.11 ? 29   ALA A CA  1 
ATOM   186  C C   . ALA A 1 29  ? -7.816  81.552 45.648 1.00 36.68 ? 29   ALA A C   1 
ATOM   187  O O   . ALA A 1 29  ? -8.884  82.189 45.631 1.00 36.67 ? 29   ALA A O   1 
ATOM   188  C CB  . ALA A 1 29  ? -6.320  82.533 47.383 1.00 36.72 ? 29   ALA A CB  1 
ATOM   189  N N   . PHE A 1 30  ? -7.757  80.244 45.440 1.00 35.81 ? 30   PHE A N   1 
ATOM   190  C CA  . PHE A 1 30  ? -8.987  79.482 45.267 1.00 35.49 ? 30   PHE A CA  1 
ATOM   191  C C   . PHE A 1 30  ? -8.939  78.502 46.401 1.00 35.22 ? 30   PHE A C   1 
ATOM   192  O O   . PHE A 1 30  ? -8.223  77.490 46.350 1.00 35.78 ? 30   PHE A O   1 
ATOM   193  C CB  . PHE A 1 30  ? -9.021  78.792 43.901 1.00 35.26 ? 30   PHE A CB  1 
ATOM   194  C CG  . PHE A 1 30  ? -8.913  79.763 42.745 1.00 35.35 ? 30   PHE A CG  1 
ATOM   195  C CD1 . PHE A 1 30  ? -7.664  80.319 42.409 1.00 34.72 ? 30   PHE A CD1 1 
ATOM   196  C CD2 . PHE A 1 30  ? -10.079 80.169 42.043 1.00 34.80 ? 30   PHE A CD2 1 
ATOM   197  C CE1 . PHE A 1 30  ? -7.549  81.270 41.395 1.00 35.30 ? 30   PHE A CE1 1 
ATOM   198  C CE2 . PHE A 1 30  ? -9.999  81.121 41.022 1.00 34.72 ? 30   PHE A CE2 1 
ATOM   199  C CZ  . PHE A 1 30  ? -8.727  81.688 40.684 1.00 35.39 ? 30   PHE A CZ  1 
ATOM   200  N N   . LEU A 1 31  ? -9.685  78.819 47.441 1.00 34.69 ? 31   LEU A N   1 
ATOM   201  C CA  . LEU A 1 31  ? -9.671  78.028 48.643 1.00 34.40 ? 31   LEU A CA  1 
ATOM   202  C C   . LEU A 1 31  ? -10.828 77.078 48.708 1.00 34.50 ? 31   LEU A C   1 
ATOM   203  O O   . LEU A 1 31  ? -11.932 77.418 48.292 1.00 34.89 ? 31   LEU A O   1 
ATOM   204  C CB  . LEU A 1 31  ? -9.694  78.963 49.864 1.00 33.62 ? 31   LEU A CB  1 
ATOM   205  C CG  . LEU A 1 31  ? -8.630  80.066 49.825 1.00 33.66 ? 31   LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 31  ? -8.611  80.847 51.176 1.00 32.63 ? 31   LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 31  ? -7.238  79.412 49.542 1.00 33.32 ? 31   LEU A CD2 1 
ATOM   208  N N   . GLY A 1 32  ? -10.571 75.877 49.219 1.00 34.15 ? 32   GLY A N   1 
ATOM   209  C CA  . GLY A 1 32  ? -11.636 74.891 49.392 1.00 33.86 ? 32   GLY A CA  1 
ATOM   210  C C   . GLY A 1 32  ? -12.325 74.324 48.161 1.00 33.80 ? 32   GLY A C   1 
ATOM   211  O O   . GLY A 1 32  ? -13.530 74.164 48.179 1.00 33.90 ? 32   GLY A O   1 
ATOM   212  N N   . ILE A 1 33  ? -11.574 74.054 47.089 1.00 33.45 ? 33   ILE A N   1 
ATOM   213  C CA  . ILE A 1 33  ? -12.148 73.462 45.905 1.00 33.08 ? 33   ILE A CA  1 
ATOM   214  C C   . ILE A 1 33  ? -12.301 71.962 46.246 1.00 32.97 ? 33   ILE A C   1 
ATOM   215  O O   . ILE A 1 33  ? -11.336 71.312 46.667 1.00 32.73 ? 33   ILE A O   1 
ATOM   216  C CB  . ILE A 1 33  ? -11.200 73.610 44.681 1.00 33.03 ? 33   ILE A CB  1 
ATOM   217  C CG1 . ILE A 1 33  ? -11.060 75.080 44.283 1.00 32.83 ? 33   ILE A CG1 1 
ATOM   218  C CG2 . ILE A 1 33  ? -11.729 72.798 43.527 1.00 32.88 ? 33   ILE A CG2 1 
ATOM   219  C CD1 . ILE A 1 33  ? -10.084 75.325 43.150 1.00 32.60 ? 33   ILE A CD1 1 
ATOM   220  N N   . PRO A 1 34  ? -13.516 71.408 46.098 1.00 32.64 ? 34   PRO A N   1 
ATOM   221  C CA  . PRO A 1 34  ? -13.745 69.987 46.398 1.00 32.37 ? 34   PRO A CA  1 
ATOM   222  C C   . PRO A 1 34  ? -13.150 69.062 45.315 1.00 32.28 ? 34   PRO A C   1 
ATOM   223  O O   . PRO A 1 34  ? -13.235 69.366 44.118 1.00 32.15 ? 34   PRO A O   1 
ATOM   224  C CB  . PRO A 1 34  ? -15.265 69.895 46.451 1.00 32.62 ? 34   PRO A CB  1 
ATOM   225  C CG  . PRO A 1 34  ? -15.687 70.921 45.317 1.00 32.64 ? 34   PRO A CG  1 
ATOM   226  C CD  . PRO A 1 34  ? -14.766 72.089 45.679 1.00 32.74 ? 34   PRO A CD  1 
ATOM   227  N N   . PHE A 1 35  ? -12.551 67.935 45.698 1.00 31.84 ? 35   PHE A N   1 
ATOM   228  C CA  . PHE A 1 35  ? -12.012 67.076 44.640 1.00 31.66 ? 35   PHE A CA  1 
ATOM   229  C C   . PHE A 1 35  ? -12.526 65.669 44.758 1.00 31.74 ? 35   PHE A C   1 
ATOM   230  O O   . PHE A 1 35  ? -12.212 64.810 43.933 1.00 31.86 ? 35   PHE A O   1 
ATOM   231  C CB  . PHE A 1 35  ? -10.473 67.086 44.634 1.00 31.31 ? 35   PHE A CB  1 
ATOM   232  C CG  . PHE A 1 35  ? -9.862  66.573 45.914 1.00 30.84 ? 35   PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 35  ? -9.797  65.197 46.165 1.00 30.64 ? 35   PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 35  ? -9.364  67.470 46.869 1.00 30.08 ? 35   PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 35  ? -9.229  64.713 47.365 1.00 30.95 ? 35   PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 35  ? -8.793  67.002 48.072 1.00 30.27 ? 35   PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 35  ? -8.720  65.622 48.323 1.00 30.48 ? 35   PHE A CZ  1 
ATOM   238  N N   . ALA A 1 36  ? -13.341 65.438 45.773 1.00 32.02 ? 36   ALA A N   1 
ATOM   239  C CA  . ALA A 1 36  ? -13.923 64.122 45.990 1.00 32.84 ? 36   ALA A CA  1 
ATOM   240  C C   . ALA A 1 36  ? -15.294 64.292 46.583 1.00 33.88 ? 36   ALA A C   1 
ATOM   241  O O   . ALA A 1 36  ? -15.605 65.348 47.142 1.00 33.79 ? 36   ALA A O   1 
ATOM   242  C CB  . ALA A 1 36  ? -13.068 63.326 46.966 1.00 31.74 ? 36   ALA A CB  1 
ATOM   243  N N   . GLU A 1 37  ? -16.128 63.259 46.455 1.00 35.09 ? 37   GLU A N   1 
ATOM   244  C CA  . GLU A 1 37  ? -17.437 63.282 47.101 1.00 35.90 ? 37   GLU A CA  1 
ATOM   245  C C   . GLU A 1 37  ? -17.133 63.195 48.621 1.00 36.20 ? 37   GLU A C   1 
ATOM   246  O O   . GLU A 1 37  ? -16.128 62.590 49.010 1.00 36.14 ? 37   GLU A O   1 
ATOM   247  C CB  . GLU A 1 37  ? -18.260 62.062 46.678 1.00 36.71 ? 37   GLU A CB  1 
ATOM   248  C CG  . GLU A 1 37  ? -18.992 62.239 45.305 1.00 37.83 ? 37   GLU A CG  1 
ATOM   249  C CD  . GLU A 1 37  ? -19.912 63.472 45.320 1.00 38.25 ? 37   GLU A CD  1 
ATOM   250  O OE1 . GLU A 1 37  ? -20.848 63.486 46.139 1.00 39.15 ? 37   GLU A OE1 1 
ATOM   251  O OE2 . GLU A 1 37  ? -19.690 64.429 44.550 1.00 38.79 ? 37   GLU A OE2 1 
ATOM   252  N N   . PRO A 1 38  ? -17.980 63.815 49.484 1.00 36.24 ? 38   PRO A N   1 
ATOM   253  C CA  . PRO A 1 38  ? -17.761 63.760 50.944 1.00 36.28 ? 38   PRO A CA  1 
ATOM   254  C C   . PRO A 1 38  ? -17.803 62.305 51.421 1.00 36.55 ? 38   PRO A C   1 
ATOM   255  O O   . PRO A 1 38  ? -18.815 61.648 51.298 1.00 36.14 ? 38   PRO A O   1 
ATOM   256  C CB  . PRO A 1 38  ? -18.930 64.571 51.511 1.00 35.95 ? 38   PRO A CB  1 
ATOM   257  C CG  . PRO A 1 38  ? -19.126 65.648 50.445 1.00 35.75 ? 38   PRO A CG  1 
ATOM   258  C CD  . PRO A 1 38  ? -19.027 64.813 49.143 1.00 35.71 ? 38   PRO A CD  1 
ATOM   259  N N   . PRO A 1 39  ? -16.707 61.811 52.021 1.00 36.63 ? 39   PRO A N   1 
ATOM   260  C CA  . PRO A 1 39  ? -16.587 60.433 52.513 1.00 36.67 ? 39   PRO A CA  1 
ATOM   261  C C   . PRO A 1 39  ? -17.287 60.213 53.839 1.00 37.42 ? 39   PRO A C   1 
ATOM   262  O O   . PRO A 1 39  ? -16.680 59.834 54.849 1.00 37.28 ? 39   PRO A O   1 
ATOM   263  C CB  . PRO A 1 39  ? -15.082 60.251 52.590 1.00 37.03 ? 39   PRO A CB  1 
ATOM   264  C CG  . PRO A 1 39  ? -14.616 61.615 53.036 1.00 36.93 ? 39   PRO A CG  1 
ATOM   265  C CD  . PRO A 1 39  ? -15.460 62.564 52.210 1.00 36.28 ? 39   PRO A CD  1 
ATOM   266  N N   . VAL A 1 40  ? -18.593 60.421 53.808 1.00 37.75 ? 40   VAL A N   1 
ATOM   267  C CA  . VAL A 1 40  ? -19.418 60.359 54.990 1.00 38.05 ? 40   VAL A CA  1 
ATOM   268  C C   . VAL A 1 40  ? -20.424 59.234 54.951 1.00 38.34 ? 40   VAL A C   1 
ATOM   269  O O   . VAL A 1 40  ? -20.695 58.685 53.890 1.00 39.03 ? 40   VAL A O   1 
ATOM   270  C CB  . VAL A 1 40  ? -20.176 61.668 55.103 1.00 37.79 ? 40   VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 40  ? -19.183 62.830 55.074 1.00 37.84 ? 40   VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 40  ? -21.139 61.783 53.887 1.00 37.97 ? 40   VAL A CG2 1 
ATOM   273  N N   . GLY A 1 41  ? -20.989 58.914 56.113 1.00 38.39 ? 41   GLY A N   1 
ATOM   274  C CA  . GLY A 1 41  ? -21.989 57.872 56.197 1.00 38.30 ? 41   GLY A CA  1 
ATOM   275  C C   . GLY A 1 41  ? -21.398 56.527 55.844 1.00 38.78 ? 41   GLY A C   1 
ATOM   276  O O   . GLY A 1 41  ? -20.342 56.092 56.395 1.00 38.92 ? 41   GLY A O   1 
ATOM   277  N N   . ASN A 1 42  ? -22.076 55.844 54.927 1.00 38.44 ? 42   ASN A N   1 
ATOM   278  C CA  . ASN A 1 42  ? -21.625 54.548 54.499 1.00 38.18 ? 42   ASN A CA  1 
ATOM   279  C C   . ASN A 1 42  ? -20.365 54.665 53.640 1.00 37.94 ? 42   ASN A C   1 
ATOM   280  O O   . ASN A 1 42  ? -19.792 53.669 53.290 1.00 37.57 ? 42   ASN A O   1 
ATOM   281  C CB  . ASN A 1 42  ? -22.751 53.826 53.750 1.00 38.64 ? 42   ASN A CB  1 
ATOM   282  N N   . MET A 1 43  ? -19.941 55.876 53.287 1.00 38.40 ? 43   MET A N   1 
ATOM   283  C CA  . MET A 1 43  ? -18.692 56.039 52.509 1.00 39.01 ? 43   MET A CA  1 
ATOM   284  C C   . MET A 1 43  ? -17.429 56.195 53.441 1.00 37.85 ? 43   MET A C   1 
ATOM   285  O O   . MET A 1 43  ? -16.288 56.347 52.953 1.00 37.33 ? 43   MET A O   1 
ATOM   286  C CB  . MET A 1 43  ? -18.762 57.263 51.585 1.00 41.43 ? 43   MET A CB  1 
ATOM   287  C CG  . MET A 1 43  ? -19.765 57.198 50.447 1.00 44.35 ? 43   MET A CG  1 
ATOM   288  S SD  . MET A 1 43  ? -19.484 55.702 49.529 1.00 49.53 ? 43   MET A SD  1 
ATOM   289  C CE  . MET A 1 43  ? -18.019 56.227 48.413 1.00 47.99 ? 43   MET A CE  1 
ATOM   290  N N   . ARG A 1 44  ? -17.643 56.180 54.762 1.00 36.60 ? 44   ARG A N   1 
ATOM   291  C CA  . ARG A 1 44  ? -16.544 56.290 55.733 1.00 35.76 ? 44   ARG A CA  1 
ATOM   292  C C   . ARG A 1 44  ? -15.708 55.023 55.613 1.00 35.64 ? 44   ARG A C   1 
ATOM   293  O O   . ARG A 1 44  ? -16.252 53.927 55.604 1.00 36.24 ? 44   ARG A O   1 
ATOM   294  C CB  . ARG A 1 44  ? -17.073 56.461 57.181 1.00 34.99 ? 44   ARG A CB  1 
ATOM   295  C CG  . ARG A 1 44  ? -15.955 56.368 58.246 1.00 34.38 ? 44   ARG A CG  1 
ATOM   296  C CD  . ARG A 1 44  ? -16.444 56.303 59.693 1.00 32.97 ? 44   ARG A CD  1 
ATOM   297  N NE  . ARG A 1 44  ? -17.078 57.543 60.114 1.00 32.65 ? 44   ARG A NE  1 
ATOM   298  C CZ  . ARG A 1 44  ? -17.777 57.686 61.227 1.00 31.86 ? 44   ARG A CZ  1 
ATOM   299  N NH1 . ARG A 1 44  ? -17.956 56.654 62.045 1.00 31.91 ? 44   ARG A NH1 1 
ATOM   300  N NH2 . ARG A 1 44  ? -18.229 58.882 61.561 1.00 31.94 ? 44   ARG A NH2 1 
ATOM   301  N N   . PHE A 1 45  ? -14.394 55.180 55.500 1.00 35.20 ? 45   PHE A N   1 
ATOM   302  C CA  . PHE A 1 45  ? -13.439 54.081 55.325 1.00 35.05 ? 45   PHE A CA  1 
ATOM   303  C C   . PHE A 1 45  ? -13.307 53.643 53.878 1.00 35.10 ? 45   PHE A C   1 
ATOM   304  O O   . PHE A 1 45  ? -12.319 52.954 53.523 1.00 35.05 ? 45   PHE A O   1 
ATOM   305  C CB  . PHE A 1 45  ? -13.764 52.834 56.175 1.00 34.81 ? 45   PHE A CB  1 
ATOM   306  C CG  . PHE A 1 45  ? -13.948 53.120 57.638 1.00 35.01 ? 45   PHE A CG  1 
ATOM   307  C CD1 . PHE A 1 45  ? -12.986 53.819 58.354 1.00 34.55 ? 45   PHE A CD1 1 
ATOM   308  C CD2 . PHE A 1 45  ? -15.101 52.687 58.301 1.00 35.10 ? 45   PHE A CD2 1 
ATOM   309  C CE1 . PHE A 1 45  ? -13.164 54.092 59.723 1.00 35.14 ? 45   PHE A CE1 1 
ATOM   310  C CE2 . PHE A 1 45  ? -15.307 52.945 59.670 1.00 35.23 ? 45   PHE A CE2 1 
ATOM   311  C CZ  . PHE A 1 45  ? -14.327 53.658 60.395 1.00 35.38 ? 45   PHE A CZ  1 
ATOM   312  N N   . ARG A 1 46  ? -14.273 54.016 53.030 1.00 35.24 ? 46   ARG A N   1 
ATOM   313  C CA  . ARG A 1 46  ? -14.177 53.630 51.612 1.00 35.80 ? 46   ARG A CA  1 
ATOM   314  C C   . ARG A 1 46  ? -13.183 54.485 50.805 1.00 35.53 ? 46   ARG A C   1 
ATOM   315  O O   . ARG A 1 46  ? -12.788 55.590 51.214 1.00 33.95 ? 46   ARG A O   1 
ATOM   316  C CB  . ARG A 1 46  ? -15.535 53.745 50.868 1.00 36.80 ? 46   ARG A CB  1 
ATOM   317  C CG  . ARG A 1 46  ? -16.685 52.841 51.346 1.00 38.23 ? 46   ARG A CG  1 
ATOM   318  C CD  . ARG A 1 46  ? -17.814 52.849 50.257 1.00 39.33 ? 46   ARG A CD  1 
ATOM   319  N NE  . ARG A 1 46  ? -19.038 52.146 50.677 1.00 40.96 ? 46   ARG A NE  1 
ATOM   320  N N   . ARG A 1 47  ? -12.840 53.961 49.631 1.00 35.82 ? 47   ARG A N   1 
ATOM   321  C CA  . ARG A 1 47  ? -11.991 54.665 48.703 1.00 36.40 ? 47   ARG A CA  1 
ATOM   322  C C   . ARG A 1 47  ? -12.758 55.938 48.328 1.00 35.87 ? 47   ARG A C   1 
ATOM   323  O O   . ARG A 1 47  ? -13.998 55.961 48.346 1.00 35.12 ? 47   ARG A O   1 
ATOM   324  C CB  . ARG A 1 47  ? -11.745 53.812 47.464 1.00 38.24 ? 47   ARG A CB  1 
ATOM   325  C CG  . ARG A 1 47  ? -11.009 52.553 47.793 1.00 41.53 ? 47   ARG A CG  1 
ATOM   326  C CD  . ARG A 1 47  ? -10.891 51.637 46.582 1.00 44.42 ? 47   ARG A CD  1 
ATOM   327  N NE  . ARG A 1 47  ? -10.512 50.260 46.966 1.00 47.31 ? 47   ARG A NE  1 
ATOM   328  C CZ  . ARG A 1 47  ? -9.297  49.744 46.774 1.00 48.48 ? 47   ARG A CZ  1 
ATOM   329  N NH1 . ARG A 1 47  ? -8.346  50.490 46.212 1.00 49.76 ? 47   ARG A NH1 1 
ATOM   330  N NH2 . ARG A 1 47  ? -9.038  48.475 47.093 1.00 49.05 ? 47   ARG A NH2 1 
ATOM   331  N N   . PRO A 1 48  ? -12.029 57.017 48.017 1.00 35.35 ? 48   PRO A N   1 
ATOM   332  C CA  . PRO A 1 48  ? -12.710 58.247 47.657 1.00 35.85 ? 48   PRO A CA  1 
ATOM   333  C C   . PRO A 1 48  ? -13.371 58.153 46.289 1.00 36.09 ? 48   PRO A C   1 
ATOM   334  O O   . PRO A 1 48  ? -12.888 57.452 45.419 1.00 35.47 ? 48   PRO A O   1 
ATOM   335  C CB  . PRO A 1 48  ? -11.584 59.270 47.630 1.00 35.70 ? 48   PRO A CB  1 
ATOM   336  C CG  . PRO A 1 48  ? -10.427 58.456 47.096 1.00 35.31 ? 48   PRO A CG  1 
ATOM   337  C CD  . PRO A 1 48  ? -10.564 57.161 47.882 1.00 35.61 ? 48   PRO A CD  1 
ATOM   338  N N   . GLU A 1 49  ? -14.466 58.881 46.120 1.00 36.72 ? 49   GLU A N   1 
ATOM   339  C CA  . GLU A 1 49  ? -15.169 58.942 44.848 1.00 37.69 ? 49   GLU A CA  1 
ATOM   340  C C   . GLU A 1 49  ? -14.933 60.341 44.287 1.00 36.84 ? 49   GLU A C   1 
ATOM   341  O O   . GLU A 1 49  ? -14.933 61.304 45.027 1.00 36.43 ? 49   GLU A O   1 
ATOM   342  C CB  . GLU A 1 49  ? -16.669 58.752 45.063 1.00 39.42 ? 49   GLU A CB  1 
ATOM   343  C CG  . GLU A 1 49  ? -17.215 57.724 44.146 1.00 43.06 ? 49   GLU A CG  1 
ATOM   344  C CD  . GLU A 1 49  ? -16.775 56.298 44.520 1.00 44.95 ? 49   GLU A CD  1 
ATOM   345  O OE1 . GLU A 1 49  ? -17.505 55.660 45.331 1.00 46.05 ? 49   GLU A OE1 1 
ATOM   346  O OE2 . GLU A 1 49  ? -15.714 55.821 44.014 1.00 45.55 ? 49   GLU A OE2 1 
ATOM   347  N N   . PRO A 1 50  ? -14.762 60.473 42.972 1.00 36.51 ? 50   PRO A N   1 
ATOM   348  C CA  . PRO A 1 50  ? -14.540 61.816 42.419 1.00 36.39 ? 50   PRO A CA  1 
ATOM   349  C C   . PRO A 1 50  ? -15.748 62.744 42.597 1.00 36.62 ? 50   PRO A C   1 
ATOM   350  O O   . PRO A 1 50  ? -16.883 62.289 42.585 1.00 36.37 ? 50   PRO A O   1 
ATOM   351  C CB  . PRO A 1 50  ? -14.206 61.547 40.951 1.00 36.37 ? 50   PRO A CB  1 
ATOM   352  C CG  . PRO A 1 50  ? -14.921 60.295 40.653 1.00 36.85 ? 50   PRO A CG  1 
ATOM   353  C CD  . PRO A 1 50  ? -14.807 59.443 41.922 1.00 36.34 ? 50   PRO A CD  1 
ATOM   354  N N   . LYS A 1 51  ? -15.491 64.038 42.785 1.00 36.75 ? 51   LYS A N   1 
ATOM   355  C CA  . LYS A 1 51  ? -16.544 65.028 43.000 1.00 37.28 ? 51   LYS A CA  1 
ATOM   356  C C   . LYS A 1 51  ? -17.445 65.144 41.755 1.00 37.90 ? 51   LYS A C   1 
ATOM   357  O O   . LYS A 1 51  ? -16.947 65.304 40.642 1.00 37.61 ? 51   LYS A O   1 
ATOM   358  C CB  . LYS A 1 51  ? -15.889 66.383 43.308 1.00 37.12 ? 51   LYS A CB  1 
ATOM   359  C CG  . LYS A 1 51  ? -16.850 67.530 43.511 1.00 37.03 ? 51   LYS A CG  1 
ATOM   360  C CD  . LYS A 1 51  ? -17.818 67.250 44.663 1.00 37.27 ? 51   LYS A CD  1 
ATOM   361  C CE  . LYS A 1 51  ? -18.759 68.428 44.911 1.00 37.28 ? 51   LYS A CE  1 
ATOM   362  N NZ  . LYS A 1 51  ? -19.685 68.143 46.051 1.00 37.47 ? 51   LYS A NZ  1 
ATOM   363  N N   . LYS A 1 52  ? -18.760 65.044 41.924 1.00 38.49 ? 52   LYS A N   1 
ATOM   364  C CA  . LYS A 1 52  ? -19.644 65.162 40.753 1.00 39.25 ? 52   LYS A CA  1 
ATOM   365  C C   . LYS A 1 52  ? -19.590 66.610 40.284 1.00 38.92 ? 52   LYS A C   1 
ATOM   366  O O   . LYS A 1 52  ? -19.589 67.523 41.098 1.00 39.15 ? 52   LYS A O   1 
ATOM   367  C CB  . LYS A 1 52  ? -21.072 64.774 41.116 1.00 40.09 ? 52   LYS A CB  1 
ATOM   368  C CG  . LYS A 1 52  ? -21.180 63.404 41.829 1.00 42.11 ? 52   LYS A CG  1 
ATOM   369  C CD  . LYS A 1 52  ? -20.915 62.191 40.864 1.00 43.76 ? 52   LYS A CD  1 
ATOM   370  C CE  . LYS A 1 52  ? -19.399 61.731 40.677 1.00 44.34 ? 52   LYS A CE  1 
ATOM   371  N NZ  . LYS A 1 52  ? -18.886 60.556 41.559 1.00 44.38 ? 52   LYS A NZ  1 
ATOM   372  N N   . PRO A 1 53  ? -19.501 66.844 38.966 1.00 38.86 ? 53   PRO A N   1 
ATOM   373  C CA  . PRO A 1 53  ? -19.452 68.247 38.545 1.00 38.85 ? 53   PRO A CA  1 
ATOM   374  C C   . PRO A 1 53  ? -20.674 69.018 39.023 1.00 38.70 ? 53   PRO A C   1 
ATOM   375  O O   . PRO A 1 53  ? -21.768 68.459 39.199 1.00 38.72 ? 53   PRO A O   1 
ATOM   376  C CB  . PRO A 1 53  ? -19.349 68.145 37.037 1.00 38.88 ? 53   PRO A CB  1 
ATOM   377  C CG  . PRO A 1 53  ? -18.525 66.893 36.866 1.00 39.10 ? 53   PRO A CG  1 
ATOM   378  C CD  . PRO A 1 53  ? -19.222 65.953 37.828 1.00 38.85 ? 53   PRO A CD  1 
ATOM   379  N N   . TRP A 1 54  ? -20.467 70.286 39.298 1.00 38.42 ? 54   TRP A N   1 
ATOM   380  C CA  . TRP A 1 54  ? -21.552 71.120 39.764 1.00 38.40 ? 54   TRP A CA  1 
ATOM   381  C C   . TRP A 1 54  ? -21.837 72.204 38.711 1.00 39.17 ? 54   TRP A C   1 
ATOM   382  O O   . TRP A 1 54  ? -20.966 72.562 37.902 1.00 38.72 ? 54   TRP A O   1 
ATOM   383  C CB  . TRP A 1 54  ? -21.179 71.765 41.117 1.00 37.31 ? 54   TRP A CB  1 
ATOM   384  C CG  . TRP A 1 54  ? -19.962 72.625 41.045 1.00 36.25 ? 54   TRP A CG  1 
ATOM   385  C CD1 . TRP A 1 54  ? -19.908 73.906 40.589 1.00 35.92 ? 54   TRP A CD1 1 
ATOM   386  C CD2 . TRP A 1 54  ? -18.596 72.209 41.228 1.00 35.82 ? 54   TRP A CD2 1 
ATOM   387  N NE1 . TRP A 1 54  ? -18.603 74.313 40.451 1.00 35.55 ? 54   TRP A NE1 1 
ATOM   388  C CE2 . TRP A 1 54  ? -17.774 73.294 40.836 1.00 35.58 ? 54   TRP A CE2 1 
ATOM   389  C CE3 . TRP A 1 54  ? -17.989 71.029 41.684 1.00 35.29 ? 54   TRP A CE3 1 
ATOM   390  C CZ2 . TRP A 1 54  ? -16.384 73.236 40.877 1.00 35.17 ? 54   TRP A CZ2 1 
ATOM   391  C CZ3 . TRP A 1 54  ? -16.617 70.965 41.732 1.00 35.10 ? 54   TRP A CZ3 1 
ATOM   392  C CH2 . TRP A 1 54  ? -15.815 72.069 41.325 1.00 35.44 ? 54   TRP A CH2 1 
ATOM   393  N N   . SER A 1 55  ? -23.067 72.716 38.688 1.00 39.74 ? 55   SER A N   1 
ATOM   394  C CA  . SER A 1 55  ? -23.314 73.795 37.753 1.00 40.61 ? 55   SER A CA  1 
ATOM   395  C C   . SER A 1 55  ? -23.221 75.064 38.616 1.00 40.52 ? 55   SER A C   1 
ATOM   396  O O   . SER A 1 55  ? -23.059 74.983 39.839 1.00 40.31 ? 55   SER A O   1 
ATOM   397  C CB  . SER A 1 55  ? -24.684 73.640 37.104 1.00 41.28 ? 55   SER A CB  1 
ATOM   398  O OG  . SER A 1 55  ? -25.662 73.686 38.112 1.00 42.74 ? 55   SER A OG  1 
ATOM   399  N N   . GLY A 1 56  ? -23.283 76.238 38.010 1.00 40.40 ? 56   GLY A N   1 
ATOM   400  C CA  . GLY A 1 56  ? -23.174 77.411 38.850 1.00 40.05 ? 56   GLY A CA  1 
ATOM   401  C C   . GLY A 1 56  ? -21.721 77.617 39.258 1.00 39.93 ? 56   GLY A C   1 
ATOM   402  O O   . GLY A 1 56  ? -20.822 76.934 38.763 1.00 39.09 ? 56   GLY A O   1 
ATOM   403  N N   . VAL A 1 57  ? -21.506 78.551 40.177 1.00 39.68 ? 57   VAL A N   1 
ATOM   404  C CA  . VAL A 1 57  ? -20.167 78.912 40.608 1.00 39.69 ? 57   VAL A CA  1 
ATOM   405  C C   . VAL A 1 57  ? -19.812 78.491 42.024 1.00 39.63 ? 57   VAL A C   1 
ATOM   406  O O   . VAL A 1 57  ? -20.511 78.850 42.983 1.00 39.40 ? 57   VAL A O   1 
ATOM   407  C CB  . VAL A 1 57  ? -19.977 80.424 40.474 1.00 39.81 ? 57   VAL A CB  1 
ATOM   408  C CG1 . VAL A 1 57  ? -18.539 80.802 40.817 1.00 40.10 ? 57   VAL A CG1 1 
ATOM   409  C CG2 . VAL A 1 57  ? -20.322 80.839 39.025 1.00 39.81 ? 57   VAL A CG2 1 
ATOM   410  N N   . TRP A 1 58  ? -18.734 77.710 42.150 1.00 39.16 ? 58   TRP A N   1 
ATOM   411  C CA  . TRP A 1 58  ? -18.299 77.270 43.458 1.00 38.65 ? 58   TRP A CA  1 
ATOM   412  C C   . TRP A 1 58  ? -17.581 78.450 44.100 1.00 38.86 ? 58   TRP A C   1 
ATOM   413  O O   . TRP A 1 58  ? -16.641 79.003 43.522 1.00 38.93 ? 58   TRP A O   1 
ATOM   414  C CB  . TRP A 1 58  ? -17.348 76.066 43.355 1.00 37.84 ? 58   TRP A CB  1 
ATOM   415  C CG  . TRP A 1 58  ? -17.076 75.481 44.699 1.00 36.97 ? 58   TRP A CG  1 
ATOM   416  C CD1 . TRP A 1 58  ? -16.253 75.993 45.666 1.00 36.73 ? 58   TRP A CD1 1 
ATOM   417  C CD2 . TRP A 1 58  ? -17.773 74.384 45.303 1.00 36.63 ? 58   TRP A CD2 1 
ATOM   418  N NE1 . TRP A 1 58  ? -16.404 75.297 46.828 1.00 36.87 ? 58   TRP A NE1 1 
ATOM   419  C CE2 . TRP A 1 58  ? -17.329 74.299 46.639 1.00 36.46 ? 58   TRP A CE2 1 
ATOM   420  C CE3 . TRP A 1 58  ? -18.733 73.468 44.840 1.00 36.42 ? 58   TRP A CE3 1 
ATOM   421  C CZ2 . TRP A 1 58  ? -17.810 73.326 47.532 1.00 36.65 ? 58   TRP A CZ2 1 
ATOM   422  C CZ3 . TRP A 1 58  ? -19.217 72.503 45.710 1.00 36.77 ? 58   TRP A CZ3 1 
ATOM   423  C CH2 . TRP A 1 58  ? -18.755 72.435 47.054 1.00 36.71 ? 58   TRP A CH2 1 
ATOM   424  N N   . ASN A 1 59  ? -18.025 78.838 45.289 1.00 39.33 ? 59   ASN A N   1 
ATOM   425  C CA  . ASN A 1 59  ? -17.407 79.952 46.017 1.00 40.24 ? 59   ASN A CA  1 
ATOM   426  C C   . ASN A 1 59  ? -16.104 79.404 46.609 1.00 39.45 ? 59   ASN A C   1 
ATOM   427  O O   . ASN A 1 59  ? -16.179 78.556 47.482 1.00 39.25 ? 59   ASN A O   1 
ATOM   428  C CB  . ASN A 1 59  ? -18.330 80.421 47.164 1.00 42.50 ? 59   ASN A CB  1 
ATOM   429  C CG  . ASN A 1 59  ? -17.827 81.677 47.844 1.00 46.20 ? 59   ASN A CG  1 
ATOM   430  O OD1 . ASN A 1 59  ? -16.626 81.908 47.897 1.00 46.21 ? 59   ASN A OD1 1 
ATOM   431  N ND2 . ASN A 1 59  ? -18.734 82.487 48.394 1.00 50.26 ? 59   ASN A ND2 1 
ATOM   432  N N   . ALA A 1 60  ? -14.940 79.872 46.144 1.00 38.34 ? 60   ALA A N   1 
ATOM   433  C CA  . ALA A 1 60  ? -13.640 79.388 46.645 1.00 37.77 ? 60   ALA A CA  1 
ATOM   434  C C   . ALA A 1 60  ? -12.907 80.528 47.316 1.00 37.52 ? 60   ALA A C   1 
ATOM   435  O O   . ALA A 1 60  ? -11.713 80.738 47.087 1.00 36.93 ? 60   ALA A O   1 
ATOM   436  C CB  . ALA A 1 60  ? -12.784 78.888 45.505 1.00 37.05 ? 60   ALA A CB  1 
ATOM   437  N N   . SER A 1 61  ? -13.612 81.271 48.149 1.00 37.32 ? 61   SER A N   1 
ATOM   438  C CA  . SER A 1 61  ? -12.977 82.409 48.787 1.00 37.28 ? 61   SER A CA  1 
ATOM   439  C C   . SER A 1 61  ? -12.522 82.106 50.217 1.00 36.97 ? 61   SER A C   1 
ATOM   440  O O   . SER A 1 61  ? -11.817 82.897 50.818 1.00 37.17 ? 61   SER A O   1 
ATOM   441  C CB  . SER A 1 61  ? -13.949 83.581 48.761 1.00 36.79 ? 61   SER A CB  1 
ATOM   442  O OG  . SER A 1 61  ? -15.081 83.194 49.508 1.00 37.70 ? 61   SER A OG  1 
ATOM   443  N N   . THR A 1 62  ? -12.901 80.957 50.762 1.00 36.84 ? 62   THR A N   1 
ATOM   444  C CA  . THR A 1 62  ? -12.507 80.659 52.137 1.00 36.84 ? 62   THR A CA  1 
ATOM   445  C C   . THR A 1 62  ? -12.037 79.217 52.390 1.00 36.04 ? 62   THR A C   1 
ATOM   446  O O   . THR A 1 62  ? -12.430 78.285 51.701 1.00 36.07 ? 62   THR A O   1 
ATOM   447  C CB  . THR A 1 62  ? -13.669 80.989 53.103 1.00 37.31 ? 62   THR A CB  1 
ATOM   448  O OG1 . THR A 1 62  ? -14.729 80.073 52.893 1.00 37.89 ? 62   THR A OG1 1 
ATOM   449  C CG2 . THR A 1 62  ? -14.240 82.366 52.802 1.00 38.17 ? 62   THR A CG2 1 
ATOM   450  N N   . TYR A 1 63  ? -11.183 79.046 53.390 1.00 35.06 ? 63   TYR A N   1 
ATOM   451  C CA  . TYR A 1 63  ? -10.680 77.729 53.711 1.00 33.97 ? 63   TYR A CA  1 
ATOM   452  C C   . TYR A 1 63  ? -11.788 76.723 54.020 1.00 33.53 ? 63   TYR A C   1 
ATOM   453  O O   . TYR A 1 63  ? -12.829 77.058 54.545 1.00 33.43 ? 63   TYR A O   1 
ATOM   454  C CB  . TYR A 1 63  ? -9.743  77.792 54.907 1.00 33.66 ? 63   TYR A CB  1 
ATOM   455  C CG  . TYR A 1 63  ? -8.336  78.193 54.560 1.00 33.76 ? 63   TYR A CG  1 
ATOM   456  C CD1 . TYR A 1 63  ? -7.671  77.624 53.461 1.00 33.50 ? 63   TYR A CD1 1 
ATOM   457  C CD2 . TYR A 1 63  ? -7.618  79.056 55.393 1.00 33.83 ? 63   TYR A CD2 1 
ATOM   458  C CE1 . TYR A 1 63  ? -6.327  77.893 53.225 1.00 33.48 ? 63   TYR A CE1 1 
ATOM   459  C CE2 . TYR A 1 63  ? -6.260  79.337 55.161 1.00 33.58 ? 63   TYR A CE2 1 
ATOM   460  C CZ  . TYR A 1 63  ? -5.628  78.746 54.092 1.00 33.44 ? 63   TYR A CZ  1 
ATOM   461  O OH  . TYR A 1 63  ? -4.290  78.944 53.941 1.00 33.62 ? 63   TYR A OH  1 
ATOM   462  N N   . PRO A 1 64  ? -11.545 75.450 53.699 1.00 32.89 ? 64   PRO A N   1 
ATOM   463  C CA  . PRO A 1 64  ? -12.478 74.369 53.929 1.00 32.15 ? 64   PRO A CA  1 
ATOM   464  C C   . PRO A 1 64  ? -12.329 73.835 55.367 1.00 32.08 ? 64   PRO A C   1 
ATOM   465  O O   . PRO A 1 64  ? -11.504 74.294 56.115 1.00 30.97 ? 64   PRO A O   1 
ATOM   466  C CB  . PRO A 1 64  ? -12.015 73.352 52.918 1.00 32.40 ? 64   PRO A CB  1 
ATOM   467  C CG  . PRO A 1 64  ? -10.513 73.481 53.026 1.00 32.18 ? 64   PRO A CG  1 
ATOM   468  C CD  . PRO A 1 64  ? -10.339 74.969 52.989 1.00 32.73 ? 64   PRO A CD  1 
ATOM   469  N N   . ASN A 1 65  ? -13.173 72.885 55.750 1.00 32.51 ? 65   ASN A N   1 
ATOM   470  C CA  . ASN A 1 65  ? -13.038 72.264 57.050 1.00 33.26 ? 65   ASN A CA  1 
ATOM   471  C C   . ASN A 1 65  ? -11.745 71.403 57.027 1.00 32.94 ? 65   ASN A C   1 
ATOM   472  O O   . ASN A 1 65  ? -11.191 71.080 55.971 1.00 32.76 ? 65   ASN A O   1 
ATOM   473  C CB  . ASN A 1 65  ? -14.212 71.326 57.322 1.00 34.64 ? 65   ASN A CB  1 
ATOM   474  C CG  . ASN A 1 65  ? -15.579 72.044 57.347 1.00 36.07 ? 65   ASN A CG  1 
ATOM   475  O OD1 . ASN A 1 65  ? -15.782 73.031 58.069 1.00 36.22 ? 65   ASN A OD1 1 
ATOM   476  N ND2 . ASN A 1 65  ? -16.526 71.520 56.556 1.00 36.30 ? 65   ASN A ND2 1 
ATOM   477  N N   . ASN A 1 66  ? -11.256 71.031 58.193 1.00 32.78 ? 66   ASN A N   1 
ATOM   478  C CA  . ASN A 1 66  ? -10.082 70.169 58.236 1.00 32.40 ? 66   ASN A CA  1 
ATOM   479  C C   . ASN A 1 66  ? -10.688 68.810 58.564 1.00 32.65 ? 66   ASN A C   1 
ATOM   480  O O   . ASN A 1 66  ? -11.783 68.753 59.172 1.00 32.56 ? 66   ASN A O   1 
ATOM   481  C CB  . ASN A 1 66  ? -9.150  70.607 59.354 1.00 32.14 ? 66   ASN A CB  1 
ATOM   482  C CG  . ASN A 1 66  ? -8.688  72.070 59.198 1.00 32.76 ? 66   ASN A CG  1 
ATOM   483  O OD1 . ASN A 1 66  ? -8.576  72.793 60.186 1.00 32.87 ? 66   ASN A OD1 1 
ATOM   484  N ND2 . ASN A 1 66  ? -8.410  72.495 57.959 1.00 31.78 ? 66   ASN A ND2 1 
ATOM   485  N N   . CYS A 1 67  ? -10.000 67.728 58.192 1.00 32.24 ? 67   CYS A N   1 
ATOM   486  C CA  . CYS A 1 67  ? -10.491 66.385 58.510 1.00 32.08 ? 67   CYS A CA  1 
ATOM   487  C C   . CYS A 1 67  ? -10.536 66.145 59.997 1.00 31.86 ? 67   CYS A C   1 
ATOM   488  O O   . CYS A 1 67  ? -9.834  66.820 60.749 1.00 32.00 ? 67   CYS A O   1 
ATOM   489  C CB  . CYS A 1 67  ? -9.614  65.312 57.853 1.00 31.63 ? 67   CYS A CB  1 
ATOM   490  S SG  . CYS A 1 67  ? -9.635  65.446 56.042 1.00 32.62 ? 67   CYS A SG  1 
ATOM   491  N N   . GLN A 1 68  ? -11.342 65.163 60.413 1.00 31.67 ? 68   GLN A N   1 
ATOM   492  C CA  . GLN A 1 68  ? -11.493 64.816 61.815 1.00 31.48 ? 68   GLN A CA  1 
ATOM   493  C C   . GLN A 1 68  ? -10.190 64.219 62.333 1.00 31.53 ? 68   GLN A C   1 
ATOM   494  O O   . GLN A 1 68  ? -9.634  63.296 61.710 1.00 31.67 ? 68   GLN A O   1 
ATOM   495  C CB  . GLN A 1 68  ? -12.635 63.815 62.000 1.00 32.04 ? 68   GLN A CB  1 
ATOM   496  C CG  . GLN A 1 68  ? -14.038 64.417 61.857 1.00 32.19 ? 68   GLN A CG  1 
ATOM   497  C CD  . GLN A 1 68  ? -14.455 65.216 63.089 1.00 32.89 ? 68   GLN A CD  1 
ATOM   498  O OE1 . GLN A 1 68  ? -15.592 65.724 63.185 1.00 33.31 ? 68   GLN A OE1 1 
ATOM   499  N NE2 . GLN A 1 68  ? -13.543 65.333 64.035 1.00 31.74 ? 68   GLN A NE2 1 
ATOM   500  N N   . GLN A 1 69  ? -9.723  64.729 63.474 1.00 31.06 ? 69   GLN A N   1 
ATOM   501  C CA  . GLN A 1 69  ? -8.451  64.272 64.048 1.00 30.91 ? 69   GLN A CA  1 
ATOM   502  C C   . GLN A 1 69  ? -8.254  64.538 65.536 1.00 30.97 ? 69   GLN A C   1 
ATOM   503  O O   . GLN A 1 69  ? -8.903  65.420 66.147 1.00 30.66 ? 69   GLN A O   1 
ATOM   504  C CB  . GLN A 1 69  ? -7.283  64.961 63.328 1.00 30.48 ? 69   GLN A CB  1 
ATOM   505  C CG  . GLN A 1 69  ? -7.409  66.499 63.313 1.00 29.37 ? 69   GLN A CG  1 
ATOM   506  C CD  . GLN A 1 69  ? -6.426  67.206 62.341 1.00 29.18 ? 69   GLN A CD  1 
ATOM   507  O OE1 . GLN A 1 69  ? -5.279  67.531 62.697 1.00 28.59 ? 69   GLN A OE1 1 
ATOM   508  N NE2 . GLN A 1 69  ? -6.884  67.441 61.108 1.00 28.44 ? 69   GLN A NE2 1 
ATOM   509  N N   . TYR A 1 70  ? -7.318  63.784 66.096 1.00 30.85 ? 70   TYR A N   1 
ATOM   510  C CA  . TYR A 1 70  ? -6.891  63.993 67.480 1.00 31.49 ? 70   TYR A CA  1 
ATOM   511  C C   . TYR A 1 70  ? -6.384  65.448 67.542 1.00 31.72 ? 70   TYR A C   1 
ATOM   512  O O   . TYR A 1 70  ? -5.728  65.925 66.608 1.00 31.30 ? 70   TYR A O   1 
ATOM   513  C CB  . TYR A 1 70  ? -5.723  63.074 67.810 1.00 31.71 ? 70   TYR A CB  1 
ATOM   514  C CG  . TYR A 1 70  ? -5.091  63.334 69.166 1.00 32.60 ? 70   TYR A CG  1 
ATOM   515  C CD1 . TYR A 1 70  ? -5.654  62.828 70.348 1.00 32.47 ? 70   TYR A CD1 1 
ATOM   516  C CD2 . TYR A 1 70  ? -3.917  64.053 69.253 1.00 32.55 ? 70   TYR A CD2 1 
ATOM   517  C CE1 . TYR A 1 70  ? -5.030  63.041 71.589 1.00 33.67 ? 70   TYR A CE1 1 
ATOM   518  C CE2 . TYR A 1 70  ? -3.288  64.274 70.481 1.00 33.83 ? 70   TYR A CE2 1 
ATOM   519  C CZ  . TYR A 1 70  ? -3.836  63.778 71.634 1.00 34.08 ? 70   TYR A CZ  1 
ATOM   520  O OH  . TYR A 1 70  ? -3.171  64.066 72.828 1.00 36.02 ? 70   TYR A OH  1 
ATOM   521  N N   . VAL A 1 71  ? -6.680  66.154 68.623 1.00 32.22 ? 71   VAL A N   1 
ATOM   522  C CA  . VAL A 1 71  ? -6.237  67.539 68.729 1.00 33.25 ? 71   VAL A CA  1 
ATOM   523  C C   . VAL A 1 71  ? -5.266  67.621 69.895 1.00 34.38 ? 71   VAL A C   1 
ATOM   524  O O   . VAL A 1 71  ? -5.576  67.156 71.009 1.00 34.49 ? 71   VAL A O   1 
ATOM   525  C CB  . VAL A 1 71  ? -7.432  68.508 69.000 1.00 32.80 ? 71   VAL A CB  1 
ATOM   526  C CG1 . VAL A 1 71  ? -6.922  69.876 69.341 1.00 32.80 ? 71   VAL A CG1 1 
ATOM   527  C CG2 . VAL A 1 71  ? -8.353  68.577 67.783 1.00 32.79 ? 71   VAL A CG2 1 
ATOM   528  N N   . ASP A 1 72  ? -4.101  68.219 69.653 1.00 35.21 ? 72   ASP A N   1 
ATOM   529  C CA  . ASP A 1 72  ? -3.079  68.346 70.691 1.00 35.82 ? 72   ASP A CA  1 
ATOM   530  C C   . ASP A 1 72  ? -3.483  69.353 71.771 1.00 36.36 ? 72   ASP A C   1 
ATOM   531  O O   . ASP A 1 72  ? -3.653  70.511 71.500 1.00 36.36 ? 72   ASP A O   1 
ATOM   532  C CB  . ASP A 1 72  ? -1.769  68.784 70.031 1.00 35.84 ? 72   ASP A CB  1 
ATOM   533  C CG  . ASP A 1 72  ? -0.619  68.953 71.015 1.00 35.99 ? 72   ASP A CG  1 
ATOM   534  O OD1 . ASP A 1 72  ? -0.811  68.877 72.239 1.00 36.39 ? 72   ASP A OD1 1 
ATOM   535  O OD2 . ASP A 1 72  ? 0.507   69.162 70.552 1.00 36.08 ? 72   ASP A OD2 1 
ATOM   536  N N   . GLU A 1 73  ? -3.641  68.881 73.002 1.00 37.63 ? 73   GLU A N   1 
ATOM   537  C CA  . GLU A 1 73  ? -3.977  69.726 74.135 1.00 38.75 ? 73   GLU A CA  1 
ATOM   538  C C   . GLU A 1 73  ? -2.878  69.689 75.219 1.00 39.46 ? 73   GLU A C   1 
ATOM   539  O O   . GLU A 1 73  ? -3.121  70.066 76.356 1.00 39.61 ? 73   GLU A O   1 
ATOM   540  C CB  . GLU A 1 73  ? -5.307  69.289 74.727 1.00 39.18 ? 73   GLU A CB  1 
ATOM   541  C CG  . GLU A 1 73  ? -6.466  69.794 73.951 1.00 40.66 ? 73   GLU A CG  1 
ATOM   542  C CD  . GLU A 1 73  ? -7.806  69.349 74.526 1.00 42.18 ? 73   GLU A CD  1 
ATOM   543  O OE1 . GLU A 1 73  ? -8.056  69.493 75.756 1.00 42.86 ? 73   GLU A OE1 1 
ATOM   544  O OE2 . GLU A 1 73  ? -8.628  68.868 73.720 1.00 42.92 ? 73   GLU A OE2 1 
ATOM   545  N N   . GLN A 1 74  ? -1.685  69.198 74.881 1.00 40.08 ? 74   GLN A N   1 
ATOM   546  C CA  . GLN A 1 74  ? -0.591  69.163 75.855 1.00 40.66 ? 74   GLN A CA  1 
ATOM   547  C C   . GLN A 1 74  ? -0.254  70.518 76.471 1.00 40.13 ? 74   GLN A C   1 
ATOM   548  O O   . GLN A 1 74  ? 0.070   70.596 77.632 1.00 39.82 ? 74   GLN A O   1 
ATOM   549  C CB  . GLN A 1 74  ? 0.698   68.621 75.242 1.00 41.47 ? 74   GLN A CB  1 
ATOM   550  C CG  . GLN A 1 74  ? 0.930   67.185 75.534 1.00 43.28 ? 74   GLN A CG  1 
ATOM   551  C CD  . GLN A 1 74  ? 0.718   66.849 77.001 1.00 44.90 ? 74   GLN A CD  1 
ATOM   552  O OE1 . GLN A 1 74  ? 1.547   67.179 77.860 1.00 45.82 ? 74   GLN A OE1 1 
ATOM   553  N NE2 . GLN A 1 74  ? -0.429  66.221 77.304 1.00 45.61 ? 74   GLN A NE2 1 
ATOM   554  N N   . PHE A 1 75  ? -0.320  71.579 75.682 1.00 39.64 ? 75   PHE A N   1 
ATOM   555  C CA  . PHE A 1 75  ? 0.011   72.919 76.173 1.00 39.36 ? 75   PHE A CA  1 
ATOM   556  C C   . PHE A 1 75  ? -1.037  73.937 75.724 1.00 39.27 ? 75   PHE A C   1 
ATOM   557  O O   . PHE A 1 75  ? -0.757  74.783 74.870 1.00 39.17 ? 75   PHE A O   1 
ATOM   558  C CB  . PHE A 1 75  ? 1.388   73.325 75.634 1.00 38.51 ? 75   PHE A CB  1 
ATOM   559  C CG  . PHE A 1 75  ? 2.459   72.343 75.954 1.00 37.97 ? 75   PHE A CG  1 
ATOM   560  C CD1 . PHE A 1 75  ? 2.958   72.237 77.266 1.00 37.24 ? 75   PHE A CD1 1 
ATOM   561  C CD2 . PHE A 1 75  ? 2.963   71.494 74.965 1.00 37.59 ? 75   PHE A CD2 1 
ATOM   562  C CE1 . PHE A 1 75  ? 3.923   71.321 77.573 1.00 37.05 ? 75   PHE A CE1 1 
ATOM   563  C CE2 . PHE A 1 75  ? 3.950   70.555 75.268 1.00 37.48 ? 75   PHE A CE2 1 
ATOM   564  C CZ  . PHE A 1 75  ? 4.434   70.465 76.570 1.00 37.32 ? 75   PHE A CZ  1 
ATOM   565  N N   . PRO A 1 76  ? -2.259  73.856 76.298 1.00 39.56 ? 76   PRO A N   1 
ATOM   566  C CA  . PRO A 1 76  ? -3.395  74.739 75.990 1.00 39.28 ? 76   PRO A CA  1 
ATOM   567  C C   . PRO A 1 76  ? -2.939  76.154 75.777 1.00 39.21 ? 76   PRO A C   1 
ATOM   568  O O   . PRO A 1 76  ? -2.237  76.719 76.620 1.00 39.26 ? 76   PRO A O   1 
ATOM   569  C CB  . PRO A 1 76  ? -4.281  74.597 77.215 1.00 38.96 ? 76   PRO A CB  1 
ATOM   570  C CG  . PRO A 1 76  ? -4.088  73.194 77.571 1.00 39.40 ? 76   PRO A CG  1 
ATOM   571  C CD  . PRO A 1 76  ? -2.579  73.016 77.472 1.00 39.43 ? 76   PRO A CD  1 
ATOM   572  N N   . GLY A 1 77  ? -3.315  76.727 74.640 1.00 39.28 ? 77   GLY A N   1 
ATOM   573  C CA  . GLY A 1 77  ? -2.896  78.092 74.361 1.00 39.13 ? 77   GLY A CA  1 
ATOM   574  C C   . GLY A 1 77  ? -1.445  78.325 73.916 1.00 38.80 ? 77   GLY A C   1 
ATOM   575  O O   . GLY A 1 77  ? -1.136  79.386 73.403 1.00 39.74 ? 77   GLY A O   1 
ATOM   576  N N   . PHE A 1 78  ? -0.547  77.369 74.097 1.00 37.72 ? 78   PHE A N   1 
ATOM   577  C CA  . PHE A 1 78  ? 0.843   77.562 73.692 1.00 36.73 ? 78   PHE A CA  1 
ATOM   578  C C   . PHE A 1 78  ? 0.904   77.603 72.150 1.00 36.57 ? 78   PHE A C   1 
ATOM   579  O O   . PHE A 1 78  ? 0.419   76.697 71.483 1.00 36.24 ? 78   PHE A O   1 
ATOM   580  C CB  . PHE A 1 78  ? 1.673   76.408 74.235 1.00 36.06 ? 78   PHE A CB  1 
ATOM   581  C CG  . PHE A 1 78  ? 3.122   76.529 73.939 1.00 35.72 ? 78   PHE A CG  1 
ATOM   582  C CD1 . PHE A 1 78  ? 3.831   77.692 74.313 1.00 35.38 ? 78   PHE A CD1 1 
ATOM   583  C CD2 . PHE A 1 78  ? 3.793   75.501 73.288 1.00 35.06 ? 78   PHE A CD2 1 
ATOM   584  C CE1 . PHE A 1 78  ? 5.184   77.823 74.038 1.00 34.67 ? 78   PHE A CE1 1 
ATOM   585  C CE2 . PHE A 1 78  ? 5.144   75.614 73.010 1.00 34.89 ? 78   PHE A CE2 1 
ATOM   586  C CZ  . PHE A 1 78  ? 5.841   76.788 73.390 1.00 34.97 ? 78   PHE A CZ  1 
ATOM   587  N N   . SER A 1 79  ? 1.498   78.639 71.574 1.00 36.32 ? 79   SER A N   1 
ATOM   588  C CA  . SER A 1 79  ? 1.502   78.746 70.116 1.00 36.18 ? 79   SER A CA  1 
ATOM   589  C C   . SER A 1 79  ? 2.377   77.676 69.446 1.00 35.97 ? 79   SER A C   1 
ATOM   590  O O   . SER A 1 79  ? 2.118   77.275 68.293 1.00 35.73 ? 79   SER A O   1 
ATOM   591  C CB  . SER A 1 79  ? 1.963   80.149 69.659 1.00 35.80 ? 79   SER A CB  1 
ATOM   592  O OG  . SER A 1 79  ? 3.326   80.364 70.026 1.00 36.80 ? 79   SER A OG  1 
ATOM   593  N N   . GLY A 1 80  ? 3.396   77.218 70.176 1.00 35.35 ? 80   GLY A N   1 
ATOM   594  C CA  . GLY A 1 80  ? 4.303   76.215 69.641 1.00 34.92 ? 80   GLY A CA  1 
ATOM   595  C C   . GLY A 1 80  ? 3.602   74.951 69.188 1.00 34.60 ? 80   GLY A C   1 
ATOM   596  O O   . GLY A 1 80  ? 3.970   74.365 68.173 1.00 34.02 ? 80   GLY A O   1 
ATOM   597  N N   . SER A 1 81  ? 2.596   74.529 69.951 1.00 34.32 ? 81   SER A N   1 
ATOM   598  C CA  . SER A 1 81  ? 1.848   73.323 69.621 1.00 34.26 ? 81   SER A CA  1 
ATOM   599  C C   . SER A 1 81  ? 0.540   73.602 68.916 1.00 34.31 ? 81   SER A C   1 
ATOM   600  O O   . SER A 1 81  ? 0.105   72.798 68.094 1.00 33.81 ? 81   SER A O   1 
ATOM   601  C CB  . SER A 1 81  ? 1.552   72.527 70.878 1.00 34.33 ? 81   SER A CB  1 
ATOM   602  O OG  . SER A 1 81  ? 0.991   73.385 71.828 1.00 34.46 ? 81   SER A OG  1 
ATOM   603  N N   . GLU A 1 82  ? -0.093  74.739 69.204 1.00 34.51 ? 82   GLU A N   1 
ATOM   604  C CA  . GLU A 1 82  ? -1.381  74.992 68.559 1.00 35.12 ? 82   GLU A CA  1 
ATOM   605  C C   . GLU A 1 82  ? -1.283  75.433 67.111 1.00 34.34 ? 82   GLU A C   1 
ATOM   606  O O   . GLU A 1 82  ? -2.259  75.353 66.375 1.00 33.60 ? 82   GLU A O   1 
ATOM   607  C CB  . GLU A 1 82  ? -2.223  75.964 69.396 1.00 37.15 ? 82   GLU A CB  1 
ATOM   608  C CG  . GLU A 1 82  ? -3.337  75.236 70.212 1.00 40.10 ? 82   GLU A CG  1 
ATOM   609  C CD  . GLU A 1 82  ? -3.490  75.843 71.584 1.00 42.00 ? 82   GLU A CD  1 
ATOM   610  O OE1 . GLU A 1 82  ? -3.239  77.066 71.668 1.00 43.30 ? 82   GLU A OE1 1 
ATOM   611  O OE2 . GLU A 1 82  ? -3.852  75.140 72.576 1.00 43.25 ? 82   GLU A OE2 1 
ATOM   612  N N   . MET A 1 83  ? -0.083  75.845 66.688 1.00 33.60 ? 83   MET A N   1 
ATOM   613  C CA  . MET A 1 83  ? 0.109   76.242 65.301 1.00 33.06 ? 83   MET A CA  1 
ATOM   614  C C   . MET A 1 83  ? -0.018  75.015 64.375 1.00 32.89 ? 83   MET A C   1 
ATOM   615  O O   . MET A 1 83  ? -0.108  75.157 63.167 1.00 33.00 ? 83   MET A O   1 
ATOM   616  C CB  . MET A 1 83  ? 1.481   76.874 65.116 1.00 32.80 ? 83   MET A CB  1 
ATOM   617  C CG  . MET A 1 83  ? 2.641   75.885 65.264 1.00 33.09 ? 83   MET A CG  1 
ATOM   618  S SD  . MET A 1 83  ? 4.228   76.734 65.065 1.00 33.70 ? 83   MET A SD  1 
ATOM   619  C CE  . MET A 1 83  ? 4.394   76.747 63.239 1.00 31.87 ? 83   MET A CE  1 
ATOM   620  N N   . TRP A 1 84  ? -0.029  73.821 64.967 1.00 32.43 ? 84   TRP A N   1 
ATOM   621  C CA  . TRP A 1 84  ? -0.155  72.579 64.228 1.00 32.24 ? 84   TRP A CA  1 
ATOM   622  C C   . TRP A 1 84  ? -1.568  71.994 64.282 1.00 32.17 ? 84   TRP A C   1 
ATOM   623  O O   . TRP A 1 84  ? -1.903  71.129 63.487 1.00 32.10 ? 84   TRP A O   1 
ATOM   624  C CB  . TRP A 1 84  ? 0.842   71.548 64.775 1.00 31.66 ? 84   TRP A CB  1 
ATOM   625  C CG  . TRP A 1 84  ? 2.225   72.038 64.691 1.00 31.07 ? 84   TRP A CG  1 
ATOM   626  C CD1 . TRP A 1 84  ? 3.026   72.419 65.723 1.00 30.93 ? 84   TRP A CD1 1 
ATOM   627  C CD2 . TRP A 1 84  ? 2.966   72.284 63.486 1.00 30.55 ? 84   TRP A CD2 1 
ATOM   628  N NE1 . TRP A 1 84  ? 4.233   72.887 65.234 1.00 31.00 ? 84   TRP A NE1 1 
ATOM   629  C CE2 . TRP A 1 84  ? 4.217   72.819 63.865 1.00 30.59 ? 84   TRP A CE2 1 
ATOM   630  C CE3 . TRP A 1 84  ? 2.689   72.103 62.119 1.00 29.89 ? 84   TRP A CE3 1 
ATOM   631  C CZ2 . TRP A 1 84  ? 5.201   73.178 62.923 1.00 30.53 ? 84   TRP A CZ2 1 
ATOM   632  C CZ3 . TRP A 1 84  ? 3.668   72.458 61.179 1.00 29.64 ? 84   TRP A CZ3 1 
ATOM   633  C CH2 . TRP A 1 84  ? 4.904   72.987 61.590 1.00 30.13 ? 84   TRP A CH2 1 
ATOM   634  N N   . ASN A 1 85  ? -2.380  72.462 65.223 1.00 32.39 ? 85   ASN A N   1 
ATOM   635  C CA  . ASN A 1 85  ? -3.738  71.958 65.393 1.00 32.54 ? 85   ASN A CA  1 
ATOM   636  C C   . ASN A 1 85  ? -4.655  72.511 64.347 1.00 32.63 ? 85   ASN A C   1 
ATOM   637  O O   . ASN A 1 85  ? -4.356  73.521 63.738 1.00 32.89 ? 85   ASN A O   1 
ATOM   638  C CB  . ASN A 1 85  ? -4.308  72.346 66.760 1.00 33.06 ? 85   ASN A CB  1 
ATOM   639  C CG  . ASN A 1 85  ? -3.843  71.424 67.905 1.00 33.53 ? 85   ASN A CG  1 
ATOM   640  O OD1 . ASN A 1 85  ? -3.540  70.235 67.696 1.00 33.87 ? 85   ASN A OD1 1 
ATOM   641  N ND2 . ASN A 1 85  ? -3.815  71.976 69.142 1.00 33.63 ? 85   ASN A ND2 1 
ATOM   642  N N   . PRO A 1 86  ? -5.783  71.835 64.095 1.00 32.64 ? 86   PRO A N   1 
ATOM   643  C CA  . PRO A 1 86  ? -6.760  72.292 63.099 1.00 32.56 ? 86   PRO A CA  1 
ATOM   644  C C   . PRO A 1 86  ? -7.158  73.748 63.448 1.00 33.42 ? 86   PRO A C   1 
ATOM   645  O O   . PRO A 1 86  ? -7.470  74.026 64.601 1.00 32.71 ? 86   PRO A O   1 
ATOM   646  C CB  . PRO A 1 86  ? -7.958  71.394 63.334 1.00 32.26 ? 86   PRO A CB  1 
ATOM   647  C CG  . PRO A 1 86  ? -7.411  70.183 63.933 1.00 32.78 ? 86   PRO A CG  1 
ATOM   648  C CD  . PRO A 1 86  ? -6.221  70.602 64.768 1.00 31.77 ? 86   PRO A CD  1 
ATOM   649  N N   . ASN A 1 87  ? -7.171  74.646 62.466 1.00 33.71 ? 87   ASN A N   1 
ATOM   650  C CA  . ASN A 1 87  ? -7.571  76.019 62.716 1.00 34.60 ? 87   ASN A CA  1 
ATOM   651  C C   . ASN A 1 87  ? -8.924  76.273 62.039 1.00 35.33 ? 87   ASN A C   1 
ATOM   652  O O   . ASN A 1 87  ? -9.364  77.404 61.880 1.00 35.29 ? 87   ASN A O   1 
ATOM   653  C CB  . ASN A 1 87  ? -6.511  76.979 62.203 1.00 33.94 ? 87   ASN A CB  1 
ATOM   654  C CG  . ASN A 1 87  ? -6.284  76.835 60.723 1.00 34.79 ? 87   ASN A CG  1 
ATOM   655  O OD1 . ASN A 1 87  ? -6.741  75.859 60.089 1.00 34.62 ? 87   ASN A OD1 1 
ATOM   656  N ND2 . ASN A 1 87  ? -5.578  77.810 60.143 1.00 34.75 ? 87   ASN A ND2 1 
ATOM   657  N N   . ARG A 1 88  ? -9.581  75.199 61.644 1.00 36.12 ? 88   ARG A N   1 
ATOM   658  C CA  . ARG A 1 88  ? -10.911 75.284 61.058 1.00 37.24 ? 88   ARG A CA  1 
ATOM   659  C C   . ARG A 1 88  ? -11.776 74.301 61.807 1.00 37.32 ? 88   ARG A C   1 
ATOM   660  O O   . ARG A 1 88  ? -11.274 73.469 62.522 1.00 37.12 ? 88   ARG A O   1 
ATOM   661  C CB  . ARG A 1 88  ? -10.886 74.856 59.598 1.00 38.16 ? 88   ARG A CB  1 
ATOM   662  C CG  . ARG A 1 88  ? -10.241 75.875 58.776 1.00 39.82 ? 88   ARG A CG  1 
ATOM   663  C CD  . ARG A 1 88  ? -11.293 76.866 58.521 1.00 41.02 ? 88   ARG A CD  1 
ATOM   664  N NE  . ARG A 1 88  ? -10.735 78.158 58.765 1.00 43.06 ? 88   ARG A NE  1 
ATOM   665  C CZ  . ARG A 1 88  ? -11.227 79.253 58.238 1.00 43.42 ? 88   ARG A CZ  1 
ATOM   666  N NH1 . ARG A 1 88  ? -12.309 79.156 57.445 1.00 43.89 ? 88   ARG A NH1 1 
ATOM   667  N NH2 . ARG A 1 88  ? -10.592 80.402 58.453 1.00 43.48 ? 88   ARG A NH2 1 
ATOM   668  N N   . GLU A 1 89  ? -13.081 74.380 61.613 1.00 37.70 ? 89   GLU A N   1 
ATOM   669  C CA  . GLU A 1 89  ? -13.961 73.442 62.254 1.00 37.85 ? 89   GLU A CA  1 
ATOM   670  C C   . GLU A 1 89  ? -13.614 72.069 61.637 1.00 36.87 ? 89   GLU A C   1 
ATOM   671  O O   . GLU A 1 89  ? -13.281 71.972 60.460 1.00 36.68 ? 89   GLU A O   1 
ATOM   672  C CB  . GLU A 1 89  ? -15.427 73.812 61.957 1.00 39.83 ? 89   GLU A CB  1 
ATOM   673  C CG  . GLU A 1 89  ? -16.401 72.882 62.673 1.00 43.63 ? 89   GLU A CG  1 
ATOM   674  C CD  . GLU A 1 89  ? -17.869 72.875 62.132 1.00 46.04 ? 89   GLU A CD  1 
ATOM   675  O OE1 . GLU A 1 89  ? -18.287 73.764 61.313 1.00 47.28 ? 89   GLU A OE1 1 
ATOM   676  O OE2 . GLU A 1 89  ? -18.614 71.943 62.561 1.00 47.49 ? 89   GLU A OE2 1 
ATOM   677  N N   . MET A 1 90  ? -13.666 70.999 62.408 1.00 35.85 ? 90   MET A N   1 
ATOM   678  C CA  . MET A 1 90  ? -13.368 69.723 61.796 1.00 35.17 ? 90   MET A CA  1 
ATOM   679  C C   . MET A 1 90  ? -14.637 69.116 61.236 1.00 35.06 ? 90   MET A C   1 
ATOM   680  O O   . MET A 1 90  ? -15.755 69.359 61.728 1.00 34.93 ? 90   MET A O   1 
ATOM   681  C CB  . MET A 1 90  ? -12.768 68.755 62.807 1.00 34.62 ? 90   MET A CB  1 
ATOM   682  C CG  . MET A 1 90  ? -11.390 69.155 63.307 1.00 33.80 ? 90   MET A CG  1 
ATOM   683  S SD  . MET A 1 90  ? -10.672 67.914 64.455 1.00 33.10 ? 90   MET A SD  1 
ATOM   684  C CE  . MET A 1 90  ? -11.613 68.232 66.032 1.00 32.44 ? 90   MET A CE  1 
ATOM   685  N N   . SER A 1 91  ? -14.458 68.295 60.221 1.00 34.80 ? 91   SER A N   1 
ATOM   686  C CA  . SER A 1 91  ? -15.582 67.613 59.611 1.00 34.62 ? 91   SER A CA  1 
ATOM   687  C C   . SER A 1 91  ? -15.097 66.445 58.771 1.00 34.44 ? 91   SER A C   1 
ATOM   688  O O   . SER A 1 91  ? -14.028 66.519 58.182 1.00 34.05 ? 91   SER A O   1 
ATOM   689  C CB  . SER A 1 91  ? -16.351 68.581 58.707 1.00 34.31 ? 91   SER A CB  1 
ATOM   690  O OG  . SER A 1 91  ? -17.319 67.886 57.967 1.00 34.21 ? 91   SER A OG  1 
ATOM   691  N N   . GLU A 1 92  ? -15.884 65.375 58.697 1.00 34.33 ? 92   GLU A N   1 
ATOM   692  C CA  . GLU A 1 92  ? -15.507 64.274 57.814 1.00 34.31 ? 92   GLU A CA  1 
ATOM   693  C C   . GLU A 1 92  ? -15.612 64.747 56.365 1.00 34.27 ? 92   GLU A C   1 
ATOM   694  O O   . GLU A 1 92  ? -15.066 64.115 55.461 1.00 34.16 ? 92   GLU A O   1 
ATOM   695  C CB  . GLU A 1 92  ? -16.413 63.057 58.024 1.00 34.57 ? 92   GLU A CB  1 
ATOM   696  C CG  . GLU A 1 92  ? -15.941 62.112 59.111 1.00 34.49 ? 92   GLU A CG  1 
ATOM   697  C CD  . GLU A 1 92  ? -16.848 60.890 59.232 1.00 35.48 ? 92   GLU A CD  1 
ATOM   698  O OE1 . GLU A 1 92  ? -17.959 61.039 59.791 1.00 35.43 ? 92   GLU A OE1 1 
ATOM   699  O OE2 . GLU A 1 92  ? -16.465 59.788 58.758 1.00 35.28 ? 92   GLU A OE2 1 
ATOM   700  N N   . ASP A 1 93  ? -16.334 65.845 56.132 1.00 34.02 ? 93   ASP A N   1 
ATOM   701  C CA  . ASP A 1 93  ? -16.478 66.395 54.785 1.00 34.09 ? 93   ASP A CA  1 
ATOM   702  C C   . ASP A 1 93  ? -15.288 67.316 54.713 1.00 33.57 ? 93   ASP A C   1 
ATOM   703  O O   . ASP A 1 93  ? -15.409 68.496 54.975 1.00 33.20 ? 93   ASP A O   1 
ATOM   704  C CB  . ASP A 1 93  ? -17.782 67.199 54.670 1.00 35.13 ? 93   ASP A CB  1 
ATOM   705  C CG  . ASP A 1 93  ? -17.947 67.901 53.297 1.00 36.37 ? 93   ASP A CG  1 
ATOM   706  O OD1 . ASP A 1 93  ? -16.988 67.942 52.464 1.00 36.12 ? 93   ASP A OD1 1 
ATOM   707  O OD2 . ASP A 1 93  ? -19.068 68.439 53.077 1.00 37.08 ? 93   ASP A OD2 1 
ATOM   708  N N   . CYS A 1 94  ? -14.143 66.780 54.307 1.00 32.84 ? 94   CYS A N   1 
ATOM   709  C CA  . CYS A 1 94  ? -12.926 67.580 54.360 1.00 32.19 ? 94   CYS A CA  1 
ATOM   710  C C   . CYS A 1 94  ? -12.045 67.399 53.155 1.00 32.03 ? 94   CYS A C   1 
ATOM   711  O O   . CYS A 1 94  ? -10.883 67.834 53.153 1.00 32.01 ? 94   CYS A O   1 
ATOM   712  C CB  . CYS A 1 94  ? -12.140 67.177 55.626 1.00 31.33 ? 94   CYS A CB  1 
ATOM   713  S SG  . CYS A 1 94  ? -11.652 65.408 55.632 1.00 31.55 ? 94   CYS A SG  1 
ATOM   714  N N   . LEU A 1 95  ? -12.566 66.744 52.131 1.00 31.51 ? 95   LEU A N   1 
ATOM   715  C CA  . LEU A 1 95  ? -11.721 66.527 50.977 1.00 31.15 ? 95   LEU A CA  1 
ATOM   716  C C   . LEU A 1 95  ? -11.690 67.658 49.954 1.00 31.09 ? 95   LEU A C   1 
ATOM   717  O O   . LEU A 1 95  ? -12.320 67.586 48.880 1.00 30.83 ? 95   LEU A O   1 
ATOM   718  C CB  . LEU A 1 95  ? -12.062 65.201 50.324 1.00 30.67 ? 95   LEU A CB  1 
ATOM   719  C CG  . LEU A 1 95  ? -11.755 63.991 51.187 1.00 30.80 ? 95   LEU A CG  1 
ATOM   720  C CD1 . LEU A 1 95  ? -11.862 62.745 50.309 1.00 29.83 ? 95   LEU A CD1 1 
ATOM   721  C CD2 . LEU A 1 95  ? -10.343 64.115 51.828 1.00 30.31 ? 95   LEU A CD2 1 
ATOM   722  N N   . TYR A 1 96  ? -10.889 68.670 50.286 1.00 31.05 ? 96   TYR A N   1 
ATOM   723  C CA  . TYR A 1 96  ? -10.712 69.870 49.460 1.00 31.32 ? 96   TYR A CA  1 
ATOM   724  C C   . TYR A 1 96  ? -9.241  70.200 49.205 1.00 31.36 ? 96   TYR A C   1 
ATOM   725  O O   . TYR A 1 96  ? -8.341  69.682 49.874 1.00 31.52 ? 96   TYR A O   1 
ATOM   726  C CB  . TYR A 1 96  ? -11.395 71.077 50.144 1.00 31.61 ? 96   TYR A CB  1 
ATOM   727  C CG  . TYR A 1 96  ? -12.856 70.811 50.432 1.00 31.73 ? 96   TYR A CG  1 
ATOM   728  C CD1 . TYR A 1 96  ? -13.239 70.000 51.504 1.00 31.52 ? 96   TYR A CD1 1 
ATOM   729  C CD2 . TYR A 1 96  ? -13.854 71.321 49.588 1.00 31.61 ? 96   TYR A CD2 1 
ATOM   730  C CE1 . TYR A 1 96  ? -14.581 69.696 51.722 1.00 31.68 ? 96   TYR A CE1 1 
ATOM   731  C CE2 . TYR A 1 96  ? -15.195 71.028 49.794 1.00 31.56 ? 96   TYR A CE2 1 
ATOM   732  C CZ  . TYR A 1 96  ? -15.555 70.218 50.850 1.00 32.15 ? 96   TYR A CZ  1 
ATOM   733  O OH  . TYR A 1 96  ? -16.882 69.892 51.016 1.00 31.79 ? 96   TYR A OH  1 
ATOM   734  N N   . LEU A 1 97  ? -9.006  71.041 48.211 1.00 31.24 ? 97   LEU A N   1 
ATOM   735  C CA  . LEU A 1 97  ? -7.663  71.487 47.892 1.00 31.23 ? 97   LEU A CA  1 
ATOM   736  C C   . LEU A 1 97  ? -7.640  73.024 47.747 1.00 31.05 ? 97   LEU A C   1 
ATOM   737  O O   . LEU A 1 97  ? -8.644  73.650 47.449 1.00 31.32 ? 97   LEU A O   1 
ATOM   738  C CB  . LEU A 1 97  ? -7.155  70.779 46.635 1.00 30.85 ? 97   LEU A CB  1 
ATOM   739  C CG  . LEU A 1 97  ? -7.759  70.873 45.226 1.00 31.24 ? 97   LEU A CG  1 
ATOM   740  C CD1 . LEU A 1 97  ? -7.280  72.152 44.490 1.00 30.92 ? 97   LEU A CD1 1 
ATOM   741  C CD2 . LEU A 1 97  ? -7.254  69.629 44.410 1.00 30.89 ? 97   LEU A CD2 1 
ATOM   742  N N   . ASN A 1 98  ? -6.488  73.628 47.958 1.00 31.14 ? 98   ASN A N   1 
ATOM   743  C CA  . ASN A 1 98  ? -6.359  75.079 47.867 1.00 31.24 ? 98   ASN A CA  1 
ATOM   744  C C   . ASN A 1 98  ? -5.319  75.412 46.823 1.00 31.24 ? 98   ASN A C   1 
ATOM   745  O O   . ASN A 1 98  ? -4.342  74.688 46.691 1.00 31.31 ? 98   ASN A O   1 
ATOM   746  C CB  . ASN A 1 98  ? -5.925  75.672 49.227 1.00 30.95 ? 98   ASN A CB  1 
ATOM   747  C CG  . ASN A 1 98  ? -6.727  75.112 50.383 1.00 31.29 ? 98   ASN A CG  1 
ATOM   748  O OD1 . ASN A 1 98  ? -7.917  75.375 50.505 1.00 31.10 ? 98   ASN A OD1 1 
ATOM   749  N ND2 . ASN A 1 98  ? -6.073  74.324 51.239 1.00 30.49 ? 98   ASN A ND2 1 
ATOM   750  N N   . ILE A 1 99  ? -5.526  76.506 46.087 1.00 31.59 ? 99   ILE A N   1 
ATOM   751  C CA  . ILE A 1 99  ? -4.574  76.918 45.062 1.00 31.98 ? 99   ILE A CA  1 
ATOM   752  C C   . ILE A 1 99  ? -4.189  78.409 45.138 1.00 32.49 ? 99   ILE A C   1 
ATOM   753  O O   . ILE A 1 99  ? -5.054  79.278 45.192 1.00 32.63 ? 99   ILE A O   1 
ATOM   754  C CB  . ILE A 1 99  ? -5.127  76.672 43.615 1.00 31.43 ? 99   ILE A CB  1 
ATOM   755  C CG1 . ILE A 1 99  ? -5.802  75.295 43.472 1.00 31.32 ? 99   ILE A CG1 1 
ATOM   756  C CG2 . ILE A 1 99  ? -3.996  76.780 42.639 1.00 31.20 ? 99   ILE A CG2 1 
ATOM   757  C CD1 . ILE A 1 99  ? -6.332  75.002 42.000 1.00 30.02 ? 99   ILE A CD1 1 
ATOM   758  N N   . TRP A 1 100 ? -2.904  78.712 45.130 1.00 32.88 ? 100  TRP A N   1 
ATOM   759  C CA  . TRP A 1 100 ? -2.481  80.116 45.120 1.00 33.36 ? 100  TRP A CA  1 
ATOM   760  C C   . TRP A 1 100 ? -1.895  80.339 43.736 1.00 33.86 ? 100  TRP A C   1 
ATOM   761  O O   . TRP A 1 100 ? -0.986  79.594 43.305 1.00 33.75 ? 100  TRP A O   1 
ATOM   762  C CB  . TRP A 1 100 ? -1.442  80.404 46.187 1.00 33.08 ? 100  TRP A CB  1 
ATOM   763  C CG  . TRP A 1 100 ? -2.050  80.530 47.531 1.00 33.43 ? 100  TRP A CG  1 
ATOM   764  C CD1 . TRP A 1 100 ? -2.488  81.662 48.135 1.00 33.32 ? 100  TRP A CD1 1 
ATOM   765  C CD2 . TRP A 1 100 ? -2.262  79.475 48.467 1.00 33.82 ? 100  TRP A CD2 1 
ATOM   766  N NE1 . TRP A 1 100 ? -2.955  81.393 49.403 1.00 33.19 ? 100  TRP A NE1 1 
ATOM   767  C CE2 . TRP A 1 100 ? -2.827  80.053 49.634 1.00 33.46 ? 100  TRP A CE2 1 
ATOM   768  C CE3 . TRP A 1 100 ? -2.026  78.088 48.441 1.00 33.76 ? 100  TRP A CE3 1 
ATOM   769  C CZ2 . TRP A 1 100 ? -3.154  79.300 50.756 1.00 33.70 ? 100  TRP A CZ2 1 
ATOM   770  C CZ3 . TRP A 1 100 ? -2.362  77.331 49.583 1.00 33.56 ? 100  TRP A CZ3 1 
ATOM   771  C CH2 . TRP A 1 100 ? -2.913  77.941 50.710 1.00 33.43 ? 100  TRP A CH2 1 
ATOM   772  N N   . VAL A 1 101 ? -2.423  81.350 43.042 1.00 34.05 ? 101  VAL A N   1 
ATOM   773  C CA  . VAL A 1 101 ? -2.022  81.650 41.661 1.00 34.72 ? 101  VAL A CA  1 
ATOM   774  C C   . VAL A 1 101 ? -1.498  83.064 41.497 1.00 35.14 ? 101  VAL A C   1 
ATOM   775  O O   . VAL A 1 101 ? -2.193  84.027 41.835 1.00 35.41 ? 101  VAL A O   1 
ATOM   776  C CB  . VAL A 1 101 ? -3.233  81.509 40.677 1.00 34.64 ? 101  VAL A CB  1 
ATOM   777  C CG1 . VAL A 1 101 ? -2.799  81.825 39.245 1.00 34.31 ? 101  VAL A CG1 1 
ATOM   778  C CG2 . VAL A 1 101 ? -3.858  80.121 40.788 1.00 34.61 ? 101  VAL A CG2 1 
ATOM   779  N N   . PRO A 1 102 ? -0.272  83.205 40.962 1.00 35.55 ? 102  PRO A N   1 
ATOM   780  C CA  . PRO A 1 102 ? 0.360   84.511 40.727 1.00 35.73 ? 102  PRO A CA  1 
ATOM   781  C C   . PRO A 1 102 ? -0.611  85.425 39.952 1.00 36.74 ? 102  PRO A C   1 
ATOM   782  O O   . PRO A 1 102 ? -1.495  84.943 39.225 1.00 36.57 ? 102  PRO A O   1 
ATOM   783  C CB  . PRO A 1 102 ? 1.555   84.159 39.877 1.00 35.24 ? 102  PRO A CB  1 
ATOM   784  C CG  . PRO A 1 102 ? 1.917   82.741 40.381 1.00 35.30 ? 102  PRO A CG  1 
ATOM   785  C CD  . PRO A 1 102 ? 0.595   82.090 40.528 1.00 35.18 ? 102  PRO A CD  1 
ATOM   786  N N   . SER A 1 103 ? -0.455  86.741 40.114 1.00 37.42 ? 103  SER A N   1 
ATOM   787  C CA  . SER A 1 103 ? -1.300  87.705 39.407 1.00 38.10 ? 103  SER A CA  1 
ATOM   788  C C   . SER A 1 103 ? -0.395  88.663 38.675 1.00 38.23 ? 103  SER A C   1 
ATOM   789  O O   . SER A 1 103 ? 0.464   89.268 39.265 1.00 38.06 ? 103  SER A O   1 
ATOM   790  C CB  . SER A 1 103 ? -2.178  88.502 40.365 1.00 38.40 ? 103  SER A CB  1 
ATOM   791  O OG  . SER A 1 103 ? -3.048  89.336 39.604 1.00 39.20 ? 103  SER A OG  1 
ATOM   792  N N   . PRO A 1 104 ? -0.596  88.835 37.367 1.00 38.70 ? 104  PRO A N   1 
ATOM   793  C CA  . PRO A 1 104 ? -1.631  88.215 36.526 1.00 38.70 ? 104  PRO A CA  1 
ATOM   794  C C   . PRO A 1 104 ? -1.443  86.696 36.333 1.00 38.59 ? 104  PRO A C   1 
ATOM   795  O O   . PRO A 1 104 ? -0.337  86.176 36.433 1.00 38.60 ? 104  PRO A O   1 
ATOM   796  C CB  . PRO A 1 104 ? -1.511  88.994 35.205 1.00 38.71 ? 104  PRO A CB  1 
ATOM   797  C CG  . PRO A 1 104 ? -0.001  89.275 35.111 1.00 39.05 ? 104  PRO A CG  1 
ATOM   798  C CD  . PRO A 1 104 ? 0.364   89.628 36.571 1.00 38.86 ? 104  PRO A CD  1 
ATOM   799  N N   . ARG A 1 105 ? -2.537  86.013 36.020 1.00 38.46 ? 105  ARG A N   1 
ATOM   800  C CA  . ARG A 1 105 ? -2.550  84.560 35.826 1.00 38.43 ? 105  ARG A CA  1 
ATOM   801  C C   . ARG A 1 105 ? -1.498  84.039 34.871 1.00 38.49 ? 105  ARG A C   1 
ATOM   802  O O   . ARG A 1 105 ? -1.443  84.452 33.731 1.00 38.32 ? 105  ARG A O   1 
ATOM   803  C CB  . ARG A 1 105 ? -3.928  84.111 35.339 1.00 38.04 ? 105  ARG A CB  1 
ATOM   804  C CG  . ARG A 1 105 ? -4.156  82.617 35.465 1.00 38.44 ? 105  ARG A CG  1 
ATOM   805  C CD  . ARG A 1 105 ? -5.506  82.213 34.880 1.00 37.46 ? 105  ARG A CD  1 
ATOM   806  N NE  . ARG A 1 105 ? -6.599  82.742 35.676 1.00 37.83 ? 105  ARG A NE  1 
ATOM   807  C CZ  . ARG A 1 105 ? -7.868  82.678 35.295 1.00 37.95 ? 105  ARG A CZ  1 
ATOM   808  N NH1 . ARG A 1 105 ? -8.169  82.104 34.140 1.00 38.37 ? 105  ARG A NH1 1 
ATOM   809  N NH2 . ARG A 1 105 ? -8.832  83.199 36.031 1.00 37.53 ? 105  ARG A NH2 1 
ATOM   810  N N   . PRO A 1 106 ? -0.659  83.089 35.321 1.00 38.54 ? 106  PRO A N   1 
ATOM   811  C CA  . PRO A 1 106 ? 0.382   82.530 34.437 1.00 38.26 ? 106  PRO A CA  1 
ATOM   812  C C   . PRO A 1 106 ? -0.317  81.799 33.299 1.00 38.15 ? 106  PRO A C   1 
ATOM   813  O O   . PRO A 1 106 ? -1.506  81.546 33.365 1.00 38.25 ? 106  PRO A O   1 
ATOM   814  C CB  . PRO A 1 106 ? 1.113   81.545 35.336 1.00 37.82 ? 106  PRO A CB  1 
ATOM   815  C CG  . PRO A 1 106 ? 0.820   82.038 36.699 1.00 38.18 ? 106  PRO A CG  1 
ATOM   816  C CD  . PRO A 1 106 ? -0.617  82.453 36.636 1.00 38.08 ? 106  PRO A CD  1 
ATOM   817  N N   . LYS A 1 107 ? 0.415   81.448 32.265 1.00 38.29 ? 107  LYS A N   1 
ATOM   818  C CA  . LYS A 1 107 ? -0.175  80.705 31.180 1.00 38.82 ? 107  LYS A CA  1 
ATOM   819  C C   . LYS A 1 107 ? 0.107   79.216 31.378 1.00 38.87 ? 107  LYS A C   1 
ATOM   820  O O   . LYS A 1 107 ? -0.778  78.379 31.233 1.00 39.07 ? 107  LYS A O   1 
ATOM   821  C CB  . LYS A 1 107 ? 0.419   81.136 29.845 1.00 39.42 ? 107  LYS A CB  1 
ATOM   822  C CG  . LYS A 1 107 ? 0.136   82.581 29.540 1.00 40.25 ? 107  LYS A CG  1 
ATOM   823  C CD  . LYS A 1 107 ? -1.360  82.810 29.687 1.00 40.99 ? 107  LYS A CD  1 
ATOM   824  C CE  . LYS A 1 107 ? -1.658  84.303 29.665 1.00 41.74 ? 107  LYS A CE  1 
ATOM   825  N NZ  . LYS A 1 107 ? -3.130  84.565 29.582 1.00 42.35 ? 107  LYS A NZ  1 
ATOM   826  N N   . SER A 1 108 ? 1.347   78.887 31.704 1.00 38.43 ? 108  SER A N   1 
ATOM   827  C CA  . SER A 1 108 ? 1.694   77.491 31.893 1.00 38.05 ? 108  SER A CA  1 
ATOM   828  C C   . SER A 1 108 ? 2.950   77.439 32.744 1.00 37.25 ? 108  SER A C   1 
ATOM   829  O O   . SER A 1 108 ? 4.023   77.189 32.239 1.00 37.84 ? 108  SER A O   1 
ATOM   830  C CB  . SER A 1 108 ? 1.950   76.848 30.537 1.00 37.95 ? 108  SER A CB  1 
ATOM   831  O OG  . SER A 1 108 ? 2.143   75.451 30.647 1.00 38.61 ? 108  SER A OG  1 
ATOM   832  N N   . THR A 1 109 ? 2.815   77.661 34.032 1.00 35.90 ? 109  THR A N   1 
ATOM   833  C CA  . THR A 1 109 ? 3.987   77.690 34.876 1.00 35.13 ? 109  THR A CA  1 
ATOM   834  C C   . THR A 1 109 ? 4.173   76.477 35.822 1.00 34.34 ? 109  THR A C   1 
ATOM   835  O O   . THR A 1 109 ? 3.268   75.649 35.968 1.00 34.64 ? 109  THR A O   1 
ATOM   836  C CB  . THR A 1 109 ? 3.989   78.983 35.732 1.00 34.93 ? 109  THR A CB  1 
ATOM   837  O OG1 . THR A 1 109 ? 5.280   79.113 36.346 1.00 36.03 ? 109  THR A OG1 1 
ATOM   838  C CG2 . THR A 1 109 ? 2.941   78.923 36.844 1.00 34.12 ? 109  THR A CG2 1 
ATOM   839  N N   . THR A 1 110 ? 5.329   76.417 36.481 1.00 33.20 ? 110  THR A N   1 
ATOM   840  C CA  . THR A 1 110 ? 5.620   75.350 37.433 1.00 32.18 ? 110  THR A CA  1 
ATOM   841  C C   . THR A 1 110 ? 4.587   75.254 38.576 1.00 31.39 ? 110  THR A C   1 
ATOM   842  O O   . THR A 1 110 ? 4.172   76.277 39.177 1.00 31.00 ? 110  THR A O   1 
ATOM   843  C CB  . THR A 1 110 ? 7.009   75.520 38.070 1.00 32.41 ? 110  THR A CB  1 
ATOM   844  O OG1 . THR A 1 110 ? 8.026   75.488 37.062 1.00 32.29 ? 110  THR A OG1 1 
ATOM   845  C CG2 . THR A 1 110 ? 7.274   74.377 39.091 1.00 32.31 ? 110  THR A CG2 1 
ATOM   846  N N   . VAL A 1 111 ? 4.172   74.014 38.848 1.00 30.31 ? 111  VAL A N   1 
ATOM   847  C CA  . VAL A 1 111 ? 3.224   73.698 39.904 1.00 29.22 ? 111  VAL A CA  1 
ATOM   848  C C   . VAL A 1 111 ? 3.888   72.905 41.056 1.00 29.18 ? 111  VAL A C   1 
ATOM   849  O O   . VAL A 1 111 ? 4.680   71.951 40.811 1.00 28.85 ? 111  VAL A O   1 
ATOM   850  C CB  . VAL A 1 111 ? 2.050   72.838 39.360 1.00 29.25 ? 111  VAL A CB  1 
ATOM   851  C CG1 . VAL A 1 111 ? 1.014   72.557 40.478 1.00 28.20 ? 111  VAL A CG1 1 
ATOM   852  C CG2 . VAL A 1 111 ? 1.406   73.515 38.161 1.00 29.31 ? 111  VAL A CG2 1 
ATOM   853  N N   . MET A 1 112 ? 3.549   73.293 42.297 1.00 28.88 ? 112  MET A N   1 
ATOM   854  C CA  . MET A 1 112 ? 4.042   72.621 43.504 1.00 29.08 ? 112  MET A CA  1 
ATOM   855  C C   . MET A 1 112 ? 2.807   72.287 44.339 1.00 29.06 ? 112  MET A C   1 
ATOM   856  O O   . MET A 1 112 ? 1.945   73.156 44.575 1.00 29.31 ? 112  MET A O   1 
ATOM   857  C CB  . MET A 1 112 ? 5.017   73.508 44.296 1.00 29.18 ? 112  MET A CB  1 
ATOM   858  C CG  . MET A 1 112 ? 6.303   73.822 43.514 1.00 29.49 ? 112  MET A CG  1 
ATOM   859  S SD  . MET A 1 112 ? 7.458   74.853 44.448 1.00 31.23 ? 112  MET A SD  1 
ATOM   860  C CE  . MET A 1 112 ? 7.925   73.765 45.802 1.00 29.79 ? 112  MET A CE  1 
ATOM   861  N N   . VAL A 1 113 ? 2.706   71.007 44.715 1.00 28.42 ? 113  VAL A N   1 
ATOM   862  C CA  . VAL A 1 113 ? 1.604   70.476 45.487 1.00 27.58 ? 113  VAL A CA  1 
ATOM   863  C C   . VAL A 1 113 ? 2.135   69.964 46.817 1.00 27.80 ? 113  VAL A C   1 
ATOM   864  O O   . VAL A 1 113 ? 2.899   68.984 46.884 1.00 27.94 ? 113  VAL A O   1 
ATOM   865  C CB  . VAL A 1 113 ? 0.890   69.267 44.779 1.00 27.51 ? 113  VAL A CB  1 
ATOM   866  C CG1 . VAL A 1 113 ? -0.395  68.820 45.629 1.00 25.80 ? 113  VAL A CG1 1 
ATOM   867  C CG2 . VAL A 1 113 ? 0.534   69.628 43.339 1.00 26.39 ? 113  VAL A CG2 1 
ATOM   868  N N   . TRP A 1 114 ? 1.665   70.619 47.870 1.00 27.55 ? 114  TRP A N   1 
ATOM   869  C CA  . TRP A 1 114 ? 2.029   70.316 49.239 1.00 26.86 ? 114  TRP A CA  1 
ATOM   870  C C   . TRP A 1 114 ? 1.141   69.242 49.859 1.00 26.38 ? 114  TRP A C   1 
ATOM   871  O O   . TRP A 1 114 ? -0.095  69.288 49.757 1.00 26.16 ? 114  TRP A O   1 
ATOM   872  C CB  . TRP A 1 114 ? 1.934   71.594 50.091 1.00 26.08 ? 114  TRP A CB  1 
ATOM   873  C CG  . TRP A 1 114 ? 2.185   71.347 51.576 1.00 25.73 ? 114  TRP A CG  1 
ATOM   874  C CD1 . TRP A 1 114 ? 1.285   71.457 52.596 1.00 25.88 ? 114  TRP A CD1 1 
ATOM   875  C CD2 . TRP A 1 114 ? 3.444   71.072 52.185 1.00 25.68 ? 114  TRP A CD2 1 
ATOM   876  N NE1 . TRP A 1 114 ? 1.901   71.285 53.816 1.00 26.08 ? 114  TRP A NE1 1 
ATOM   877  C CE2 . TRP A 1 114 ? 3.237   71.057 53.591 1.00 26.20 ? 114  TRP A CE2 1 
ATOM   878  C CE3 . TRP A 1 114 ? 4.733   70.847 51.678 1.00 25.16 ? 114  TRP A CE3 1 
ATOM   879  C CZ2 . TRP A 1 114 ? 4.280   70.839 54.503 1.00 26.35 ? 114  TRP A CZ2 1 
ATOM   880  C CZ3 . TRP A 1 114 ? 5.780   70.629 52.580 1.00 25.58 ? 114  TRP A CZ3 1 
ATOM   881  C CH2 . TRP A 1 114 ? 5.546   70.632 53.984 1.00 25.68 ? 114  TRP A CH2 1 
ATOM   882  N N   . ILE A 1 115 ? 1.792   68.290 50.516 1.00 26.21 ? 115  ILE A N   1 
ATOM   883  C CA  . ILE A 1 115 ? 1.101   67.221 51.217 1.00 26.04 ? 115  ILE A CA  1 
ATOM   884  C C   . ILE A 1 115 ? 1.530   67.310 52.668 1.00 26.33 ? 115  ILE A C   1 
ATOM   885  O O   . ILE A 1 115 ? 2.723   67.043 52.994 1.00 26.26 ? 115  ILE A O   1 
ATOM   886  C CB  . ILE A 1 115 ? 1.486   65.820 50.674 1.00 26.25 ? 115  ILE A CB  1 
ATOM   887  C CG1 . ILE A 1 115 ? 1.258   65.782 49.155 1.00 25.56 ? 115  ILE A CG1 1 
ATOM   888  C CG2 . ILE A 1 115 ? 0.647   64.711 51.438 1.00 25.69 ? 115  ILE A CG2 1 
ATOM   889  C CD1 . ILE A 1 115 ? 1.590   64.429 48.521 1.00 26.39 ? 115  ILE A CD1 1 
ATOM   890  N N   . TYR A 1 116 ? 0.585   67.682 53.541 1.00 26.10 ? 116  TYR A N   1 
ATOM   891  C CA  . TYR A 1 116 ? 0.888   67.817 54.973 1.00 26.26 ? 116  TYR A CA  1 
ATOM   892  C C   . TYR A 1 116 ? 1.208   66.517 55.719 1.00 26.52 ? 116  TYR A C   1 
ATOM   893  O O   . TYR A 1 116 ? 0.777   65.439 55.326 1.00 26.63 ? 116  TYR A O   1 
ATOM   894  C CB  . TYR A 1 116 ? -0.241  68.570 55.739 1.00 25.89 ? 116  TYR A CB  1 
ATOM   895  C CG  . TYR A 1 116 ? -1.644  67.928 55.769 1.00 25.70 ? 116  TYR A CG  1 
ATOM   896  C CD1 . TYR A 1 116 ? -1.916  66.727 56.471 1.00 25.40 ? 116  TYR A CD1 1 
ATOM   897  C CD2 . TYR A 1 116 ? -2.696  68.531 55.085 1.00 25.46 ? 116  TYR A CD2 1 
ATOM   898  C CE1 . TYR A 1 116 ? -3.213  66.159 56.467 1.00 25.16 ? 116  TYR A CE1 1 
ATOM   899  C CE2 . TYR A 1 116 ? -3.977  67.985 55.065 1.00 24.90 ? 116  TYR A CE2 1 
ATOM   900  C CZ  . TYR A 1 116 ? -4.244  66.809 55.736 1.00 25.80 ? 116  TYR A CZ  1 
ATOM   901  O OH  . TYR A 1 116 ? -5.525  66.283 55.594 1.00 26.00 ? 116  TYR A OH  1 
ATOM   902  N N   . GLY A 1 117 ? 2.008   66.679 56.778 1.00 26.74 ? 117  GLY A N   1 
ATOM   903  C CA  . GLY A 1 117 ? 2.396   65.611 57.686 1.00 26.37 ? 117  GLY A CA  1 
ATOM   904  C C   . GLY A 1 117 ? 1.438   65.637 58.881 1.00 26.28 ? 117  GLY A C   1 
ATOM   905  O O   . GLY A 1 117 ? 0.388   66.320 58.860 1.00 26.18 ? 117  GLY A O   1 
ATOM   906  N N   . GLY A 1 118 ? 1.794   64.890 59.925 1.00 25.94 ? 118  GLY A N   1 
ATOM   907  C CA  . GLY A 1 118 ? 0.969   64.780 61.109 1.00 25.21 ? 118  GLY A CA  1 
ATOM   908  C C   . GLY A 1 118 ? 0.837   63.299 61.511 1.00 26.00 ? 118  GLY A C   1 
ATOM   909  O O   . GLY A 1 118 ? -0.188  62.922 62.092 1.00 26.00 ? 118  GLY A O   1 
ATOM   910  N N   . GLY A 1 119 ? 1.862   62.466 61.207 1.00 25.81 ? 119  GLY A N   1 
ATOM   911  C CA  . GLY A 1 119 ? 1.858   61.048 61.572 1.00 25.56 ? 119  GLY A CA  1 
ATOM   912  C C   . GLY A 1 119 ? 0.690   60.213 61.023 1.00 25.98 ? 119  GLY A C   1 
ATOM   913  O O   . GLY A 1 119 ? 0.418   59.140 61.513 1.00 25.53 ? 119  GLY A O   1 
ATOM   914  N N   . PHE A 1 120 ? 0.042   60.699 59.966 1.00 26.43 ? 120  PHE A N   1 
ATOM   915  C CA  . PHE A 1 120 ? -1.123  60.042 59.353 1.00 26.88 ? 120  PHE A CA  1 
ATOM   916  C C   . PHE A 1 120 ? -2.329  60.053 60.297 1.00 27.33 ? 120  PHE A C   1 
ATOM   917  O O   . PHE A 1 120 ? -3.384  59.460 59.980 1.00 27.62 ? 120  PHE A O   1 
ATOM   918  C CB  . PHE A 1 120 ? -0.797  58.589 58.921 1.00 25.85 ? 120  PHE A CB  1 
ATOM   919  C CG  . PHE A 1 120 ? 0.202   58.508 57.820 1.00 24.69 ? 120  PHE A CG  1 
ATOM   920  C CD1 . PHE A 1 120 ? -0.124  58.947 56.543 1.00 23.75 ? 120  PHE A CD1 1 
ATOM   921  C CD2 . PHE A 1 120 ? 1.486   57.970 58.057 1.00 24.46 ? 120  PHE A CD2 1 
ATOM   922  C CE1 . PHE A 1 120 ? 0.811   58.850 55.489 1.00 24.60 ? 120  PHE A CE1 1 
ATOM   923  C CE2 . PHE A 1 120 ? 2.449   57.855 57.030 1.00 23.87 ? 120  PHE A CE2 1 
ATOM   924  C CZ  . PHE A 1 120 ? 2.122   58.294 55.724 1.00 24.22 ? 120  PHE A CZ  1 
ATOM   925  N N   . TYR A 1 121 ? -2.199  60.723 61.448 1.00 27.58 ? 121  TYR A N   1 
ATOM   926  C CA  . TYR A 1 121 ? -3.336  60.797 62.374 1.00 27.63 ? 121  TYR A CA  1 
ATOM   927  C C   . TYR A 1 121 ? -3.832  62.237 62.542 1.00 28.35 ? 121  TYR A C   1 
ATOM   928  O O   . TYR A 1 121 ? -4.823  62.492 63.267 1.00 28.85 ? 121  TYR A O   1 
ATOM   929  C CB  . TYR A 1 121 ? -2.971  60.258 63.746 1.00 27.91 ? 121  TYR A CB  1 
ATOM   930  C CG  . TYR A 1 121 ? -2.038  61.139 64.571 1.00 27.86 ? 121  TYR A CG  1 
ATOM   931  C CD1 . TYR A 1 121 ? -2.542  62.177 65.375 1.00 27.89 ? 121  TYR A CD1 1 
ATOM   932  C CD2 . TYR A 1 121 ? -0.637  60.944 64.517 1.00 28.41 ? 121  TYR A CD2 1 
ATOM   933  C CE1 . TYR A 1 121 ? -1.664  63.030 66.110 1.00 28.28 ? 121  TYR A CE1 1 
ATOM   934  C CE2 . TYR A 1 121 ? 0.265   61.774 65.254 1.00 28.05 ? 121  TYR A CE2 1 
ATOM   935  C CZ  . TYR A 1 121 ? -0.267  62.817 66.042 1.00 28.92 ? 121  TYR A CZ  1 
ATOM   936  O OH  . TYR A 1 121 ? 0.601   63.650 66.737 1.00 29.86 ? 121  TYR A OH  1 
ATOM   937  N N   . SER A 1 122 ? -3.142  63.186 61.913 1.00 28.02 ? 122  SER A N   1 
ATOM   938  C CA  . SER A 1 122 ? -3.529  64.559 62.053 1.00 28.10 ? 122  SER A CA  1 
ATOM   939  C C   . SER A 1 122 ? -2.960  65.347 60.896 1.00 27.96 ? 122  SER A C   1 
ATOM   940  O O   . SER A 1 122 ? -2.220  64.784 60.075 1.00 27.60 ? 122  SER A O   1 
ATOM   941  C CB  . SER A 1 122 ? -3.020  65.131 63.395 1.00 28.34 ? 122  SER A CB  1 
ATOM   942  O OG  . SER A 1 122 ? -1.592  65.108 63.476 1.00 29.28 ? 122  SER A OG  1 
ATOM   943  N N   . GLY A 1 123 ? -3.295  66.645 60.864 1.00 27.56 ? 123  GLY A N   1 
ATOM   944  C CA  . GLY A 1 123 ? -2.832  67.524 59.805 1.00 27.50 ? 123  GLY A CA  1 
ATOM   945  C C   . GLY A 1 123 ? -3.951  68.300 59.106 1.00 27.78 ? 123  GLY A C   1 
ATOM   946  O O   . GLY A 1 123 ? -5.080  67.842 59.010 1.00 27.57 ? 123  GLY A O   1 
ATOM   947  N N   . SER A 1 124 ? -3.610  69.474 58.597 1.00 28.16 ? 124  SER A N   1 
ATOM   948  C CA  . SER A 1 124 ? -4.566  70.378 57.942 1.00 28.33 ? 124  SER A CA  1 
ATOM   949  C C   . SER A 1 124 ? -3.839  71.129 56.847 1.00 28.80 ? 124  SER A C   1 
ATOM   950  O O   . SER A 1 124 ? -2.657  71.460 56.981 1.00 28.84 ? 124  SER A O   1 
ATOM   951  C CB  . SER A 1 124 ? -5.080  71.420 58.946 1.00 27.95 ? 124  SER A CB  1 
ATOM   952  O OG  . SER A 1 124 ? -5.632  70.808 60.094 1.00 27.85 ? 124  SER A OG  1 
ATOM   953  N N   . SER A 1 125 ? -4.536  71.410 55.769 1.00 29.01 ? 125  SER A N   1 
ATOM   954  C CA  . SER A 1 125 ? -3.906  72.130 54.698 1.00 30.39 ? 125  SER A CA  1 
ATOM   955  C C   . SER A 1 125 ? -4.001  73.650 54.901 1.00 30.93 ? 125  SER A C   1 
ATOM   956  O O   . SER A 1 125 ? -3.377  74.400 54.146 1.00 31.60 ? 125  SER A O   1 
ATOM   957  C CB  . SER A 1 125 ? -4.588  71.807 53.369 1.00 30.06 ? 125  SER A CB  1 
ATOM   958  O OG  . SER A 1 125 ? -5.912  72.288 53.407 1.00 30.43 ? 125  SER A OG  1 
ATOM   959  N N   . THR A 1 126 ? -4.732  74.057 55.941 1.00 31.05 ? 126  THR A N   1 
ATOM   960  C CA  . THR A 1 126 ? -5.074  75.450 56.219 1.00 31.26 ? 126  THR A CA  1 
ATOM   961  C C   . THR A 1 126 ? -4.292  76.205 57.263 1.00 31.60 ? 126  THR A C   1 
ATOM   962  O O   . THR A 1 126 ? -4.612  77.348 57.571 1.00 31.65 ? 126  THR A O   1 
ATOM   963  C CB  . THR A 1 126 ? -6.570  75.507 56.618 1.00 30.68 ? 126  THR A CB  1 
ATOM   964  O OG1 . THR A 1 126 ? -6.764  74.773 57.829 1.00 29.83 ? 126  THR A OG1 1 
ATOM   965  C CG2 . THR A 1 126 ? -7.424  74.880 55.544 1.00 30.35 ? 126  THR A CG2 1 
ATOM   966  N N   . LEU A 1 127 ? -3.299  75.537 57.829 1.00 32.12 ? 127  LEU A N   1 
ATOM   967  C CA  . LEU A 1 127 ? -2.419  76.091 58.851 1.00 32.31 ? 127  LEU A CA  1 
ATOM   968  C C   . LEU A 1 127 ? -1.684  77.344 58.369 1.00 32.60 ? 127  LEU A C   1 
ATOM   969  O O   . LEU A 1 127 ? -1.257  77.404 57.200 1.00 32.46 ? 127  LEU A O   1 
ATOM   970  C CB  . LEU A 1 127 ? -1.374  75.032 59.236 1.00 31.63 ? 127  LEU A CB  1 
ATOM   971  C CG  . LEU A 1 127 ? -1.890  73.700 59.815 1.00 31.43 ? 127  LEU A CG  1 
ATOM   972  C CD1 . LEU A 1 127 ? -0.692  72.855 60.276 1.00 30.44 ? 127  LEU A CD1 1 
ATOM   973  C CD2 . LEU A 1 127 ? -2.860  73.959 60.977 1.00 30.84 ? 127  LEU A CD2 1 
ATOM   974  N N   . ASP A 1 128 ? -1.508  78.334 59.250 1.00 33.01 ? 128  ASP A N   1 
ATOM   975  C CA  . ASP A 1 128 ? -0.778  79.533 58.820 1.00 33.05 ? 128  ASP A CA  1 
ATOM   976  C C   . ASP A 1 128 ? 0.607   79.191 58.280 1.00 32.73 ? 128  ASP A C   1 
ATOM   977  O O   . ASP A 1 128 ? 1.016   79.801 57.295 1.00 33.12 ? 128  ASP A O   1 
ATOM   978  C CB  . ASP A 1 128 ? -0.666  80.584 59.939 1.00 34.13 ? 128  ASP A CB  1 
ATOM   979  C CG  . ASP A 1 128 ? -2.029  81.077 60.419 1.00 35.62 ? 128  ASP A CG  1 
ATOM   980  O OD1 . ASP A 1 128 ? -3.035  81.069 59.671 1.00 36.49 ? 128  ASP A OD1 1 
ATOM   981  O OD2 . ASP A 1 128 ? -2.104  81.475 61.584 1.00 38.03 ? 128  ASP A OD2 1 
ATOM   982  N N   . VAL A 1 129 ? 1.333   78.224 58.876 1.00 32.35 ? 129  VAL A N   1 
ATOM   983  C CA  . VAL A 1 129 ? 2.650   77.880 58.340 1.00 31.79 ? 129  VAL A CA  1 
ATOM   984  C C   . VAL A 1 129 ? 2.553   77.248 56.973 1.00 31.66 ? 129  VAL A C   1 
ATOM   985  O O   . VAL A 1 129 ? 3.603   77.027 56.366 1.00 31.55 ? 129  VAL A O   1 
ATOM   986  C CB  . VAL A 1 129 ? 3.481   76.789 59.093 1.00 31.83 ? 129  VAL A CB  1 
ATOM   987  C CG1 . VAL A 1 129 ? 4.577   77.404 59.867 1.00 31.79 ? 129  VAL A CG1 1 
ATOM   988  C CG2 . VAL A 1 129 ? 2.585   75.860 59.823 1.00 31.31 ? 129  VAL A CG2 1 
ATOM   989  N N   . TYR A 1 130 ? 1.359   76.877 56.502 1.00 31.02 ? 130  TYR A N   1 
ATOM   990  C CA  . TYR A 1 130 ? 1.306   76.292 55.153 1.00 31.13 ? 130  TYR A CA  1 
ATOM   991  C C   . TYR A 1 130 ? 0.724   77.273 54.105 1.00 32.06 ? 130  TYR A C   1 
ATOM   992  O O   . TYR A 1 130 ? 0.431   76.881 52.975 1.00 31.58 ? 130  TYR A O   1 
ATOM   993  C CB  . TYR A 1 130 ? 0.468   75.009 55.133 1.00 30.05 ? 130  TYR A CB  1 
ATOM   994  C CG  . TYR A 1 130 ? 0.925   73.868 56.022 1.00 28.51 ? 130  TYR A CG  1 
ATOM   995  C CD1 . TYR A 1 130 ? 2.280   73.687 56.358 1.00 28.11 ? 130  TYR A CD1 1 
ATOM   996  C CD2 . TYR A 1 130 ? -0.007  72.930 56.485 1.00 28.11 ? 130  TYR A CD2 1 
ATOM   997  C CE1 . TYR A 1 130 ? 2.692   72.591 57.144 1.00 27.50 ? 130  TYR A CE1 1 
ATOM   998  C CE2 . TYR A 1 130 ? 0.373   71.845 57.243 1.00 27.25 ? 130  TYR A CE2 1 
ATOM   999  C CZ  . TYR A 1 130 ? 1.725   71.675 57.580 1.00 27.20 ? 130  TYR A CZ  1 
ATOM   1000 O OH  . TYR A 1 130 ? 2.062   70.619 58.377 1.00 26.03 ? 130  TYR A OH  1 
ATOM   1001 N N   . ASN A 1 131 ? 0.570   78.547 54.480 1.00 33.09 ? 131  ASN A N   1 
ATOM   1002 C CA  . ASN A 1 131 ? -0.004  79.561 53.565 1.00 33.78 ? 131  ASN A CA  1 
ATOM   1003 C C   . ASN A 1 131 ? 0.828   79.648 52.322 1.00 33.64 ? 131  ASN A C   1 
ATOM   1004 O O   . ASN A 1 131 ? 1.973   80.128 52.382 1.00 33.52 ? 131  ASN A O   1 
ATOM   1005 C CB  . ASN A 1 131 ? -0.041  80.939 54.231 1.00 34.54 ? 131  ASN A CB  1 
ATOM   1006 C CG  . ASN A 1 131 ? -0.953  81.936 53.491 1.00 35.96 ? 131  ASN A CG  1 
ATOM   1007 O OD1 . ASN A 1 131 ? -1.177  81.851 52.271 1.00 36.37 ? 131  ASN A OD1 1 
ATOM   1008 N ND2 . ASN A 1 131 ? -1.466  82.912 54.249 1.00 36.68 ? 131  ASN A ND2 1 
ATOM   1009 N N   . GLY A 1 132 ? 0.238   79.252 51.186 1.00 34.05 ? 132  GLY A N   1 
ATOM   1010 C CA  . GLY A 1 132 ? 1.004   79.208 49.941 1.00 34.42 ? 132  GLY A CA  1 
ATOM   1011 C C   . GLY A 1 132 ? 1.287   80.505 49.205 1.00 34.85 ? 132  GLY A C   1 
ATOM   1012 O O   . GLY A 1 132 ? 2.040   80.539 48.212 1.00 34.85 ? 132  GLY A O   1 
ATOM   1013 N N   . LYS A 1 133 ? 0.714   81.589 49.706 1.00 35.30 ? 133  LYS A N   1 
ATOM   1014 C CA  . LYS A 1 133 ? 0.861   82.862 49.031 1.00 35.78 ? 133  LYS A CA  1 
ATOM   1015 C C   . LYS A 1 133 ? 2.286   83.366 48.908 1.00 36.02 ? 133  LYS A C   1 
ATOM   1016 O O   . LYS A 1 133 ? 2.649   83.890 47.847 1.00 35.89 ? 133  LYS A O   1 
ATOM   1017 C CB  . LYS A 1 133 ? -0.050  83.911 49.683 1.00 35.47 ? 133  LYS A CB  1 
ATOM   1018 C CG  . LYS A 1 133 ? 0.553   84.662 50.851 1.00 35.23 ? 133  LYS A CG  1 
ATOM   1019 C CD  . LYS A 1 133 ? -0.572  85.325 51.652 1.00 34.67 ? 133  LYS A CD  1 
ATOM   1020 C CE  . LYS A 1 133 ? -0.009  86.411 52.554 1.00 34.63 ? 133  LYS A CE  1 
ATOM   1021 N NZ  . LYS A 1 133 ? -1.140  87.153 53.158 1.00 35.00 ? 133  LYS A NZ  1 
ATOM   1022 N N   . TYR A 1 134 ? 3.114   83.190 49.942 1.00 36.41 ? 134  TYR A N   1 
ATOM   1023 C CA  . TYR A 1 134 ? 4.495   83.695 49.850 1.00 36.74 ? 134  TYR A CA  1 
ATOM   1024 C C   . TYR A 1 134 ? 5.305   82.977 48.778 1.00 36.98 ? 134  TYR A C   1 
ATOM   1025 O O   . TYR A 1 134 ? 6.031   83.599 47.966 1.00 37.28 ? 134  TYR A O   1 
ATOM   1026 C CB  . TYR A 1 134 ? 5.223   83.597 51.210 1.00 36.73 ? 134  TYR A CB  1 
ATOM   1027 C CG  . TYR A 1 134 ? 4.462   84.227 52.328 1.00 36.73 ? 134  TYR A CG  1 
ATOM   1028 C CD1 . TYR A 1 134 ? 4.219   85.615 52.340 1.00 36.98 ? 134  TYR A CD1 1 
ATOM   1029 C CD2 . TYR A 1 134 ? 3.916   83.451 53.342 1.00 36.46 ? 134  TYR A CD2 1 
ATOM   1030 C CE1 . TYR A 1 134 ? 3.450   86.207 53.335 1.00 36.34 ? 134  TYR A CE1 1 
ATOM   1031 C CE2 . TYR A 1 134 ? 3.134   84.022 54.334 1.00 36.68 ? 134  TYR A CE2 1 
ATOM   1032 C CZ  . TYR A 1 134 ? 2.908   85.413 54.324 1.00 37.11 ? 134  TYR A CZ  1 
ATOM   1033 O OH  . TYR A 1 134 ? 2.145   85.997 55.318 1.00 37.58 ? 134  TYR A OH  1 
ATOM   1034 N N   . LEU A 1 135 ? 5.176   81.665 48.733 1.00 36.86 ? 135  LEU A N   1 
ATOM   1035 C CA  . LEU A 1 135 ? 5.939   80.913 47.733 1.00 36.71 ? 135  LEU A CA  1 
ATOM   1036 C C   . LEU A 1 135 ? 5.416   81.177 46.316 1.00 36.61 ? 135  LEU A C   1 
ATOM   1037 O O   . LEU A 1 135 ? 6.193   81.389 45.366 1.00 36.60 ? 135  LEU A O   1 
ATOM   1038 C CB  . LEU A 1 135 ? 5.864   79.422 48.086 1.00 36.87 ? 135  LEU A CB  1 
ATOM   1039 C CG  . LEU A 1 135 ? 6.771   78.355 47.484 1.00 36.87 ? 135  LEU A CG  1 
ATOM   1040 C CD1 . LEU A 1 135 ? 8.232   78.765 47.451 1.00 36.44 ? 135  LEU A CD1 1 
ATOM   1041 C CD2 . LEU A 1 135 ? 6.560   77.123 48.384 1.00 36.39 ? 135  LEU A CD2 1 
ATOM   1042 N N   . ALA A 1 136 ? 4.095   81.190 46.177 1.00 36.40 ? 136  ALA A N   1 
ATOM   1043 C CA  . ALA A 1 136 ? 3.503   81.389 44.874 1.00 36.97 ? 136  ALA A CA  1 
ATOM   1044 C C   . ALA A 1 136 ? 3.971   82.719 44.315 1.00 37.33 ? 136  ALA A C   1 
ATOM   1045 O O   . ALA A 1 136 ? 4.513   82.819 43.197 1.00 37.38 ? 136  ALA A O   1 
ATOM   1046 C CB  . ALA A 1 136 ? 1.978   81.346 44.974 1.00 36.00 ? 136  ALA A CB  1 
ATOM   1047 N N   . TYR A 1 137 ? 3.786   83.733 45.140 1.00 37.74 ? 137  TYR A N   1 
ATOM   1048 C CA  . TYR A 1 137 ? 4.132   85.070 44.779 1.00 38.10 ? 137  TYR A CA  1 
ATOM   1049 C C   . TYR A 1 137 ? 5.612   85.266 44.546 1.00 37.93 ? 137  TYR A C   1 
ATOM   1050 O O   . TYR A 1 137 ? 6.015   85.773 43.494 1.00 37.88 ? 137  TYR A O   1 
ATOM   1051 C CB  . TYR A 1 137 ? 3.635   86.032 45.856 1.00 38.83 ? 137  TYR A CB  1 
ATOM   1052 C CG  . TYR A 1 137 ? 4.164   87.402 45.652 1.00 40.14 ? 137  TYR A CG  1 
ATOM   1053 C CD1 . TYR A 1 137 ? 3.607   88.238 44.658 1.00 41.13 ? 137  TYR A CD1 1 
ATOM   1054 C CD2 . TYR A 1 137 ? 5.226   87.882 46.423 1.00 40.72 ? 137  TYR A CD2 1 
ATOM   1055 C CE1 . TYR A 1 137 ? 4.101   89.536 44.439 1.00 41.80 ? 137  TYR A CE1 1 
ATOM   1056 C CE2 . TYR A 1 137 ? 5.735   89.185 46.228 1.00 41.66 ? 137  TYR A CE2 1 
ATOM   1057 C CZ  . TYR A 1 137 ? 5.161   90.002 45.228 1.00 42.07 ? 137  TYR A CZ  1 
ATOM   1058 O OH  . TYR A 1 137 ? 5.649   91.254 44.988 1.00 42.70 ? 137  TYR A OH  1 
ATOM   1059 N N   . THR A 1 138 ? 6.431   84.831 45.489 1.00 37.58 ? 138  THR A N   1 
ATOM   1060 C CA  . THR A 1 138 ? 7.872   85.053 45.363 1.00 37.44 ? 138  THR A CA  1 
ATOM   1061 C C   . THR A 1 138 ? 8.495   84.274 44.247 1.00 37.81 ? 138  THR A C   1 
ATOM   1062 O O   . THR A 1 138 ? 9.375   84.778 43.551 1.00 38.39 ? 138  THR A O   1 
ATOM   1063 C CB  . THR A 1 138 ? 8.669   84.690 46.663 1.00 37.10 ? 138  THR A CB  1 
ATOM   1064 O OG1 . THR A 1 138 ? 8.150   85.411 47.791 1.00 36.09 ? 138  THR A OG1 1 
ATOM   1065 C CG2 . THR A 1 138 ? 10.124  85.052 46.480 1.00 36.53 ? 138  THR A CG2 1 
ATOM   1066 N N   . GLU A 1 139 ? 8.057   83.040 44.039 1.00 37.84 ? 139  GLU A N   1 
ATOM   1067 C CA  . GLU A 1 139 ? 8.711   82.275 42.988 1.00 37.97 ? 139  GLU A CA  1 
ATOM   1068 C C   . GLU A 1 139 ? 7.910   82.117 41.713 1.00 37.97 ? 139  GLU A C   1 
ATOM   1069 O O   . GLU A 1 139 ? 8.350   81.466 40.800 1.00 37.27 ? 139  GLU A O   1 
ATOM   1070 C CB  . GLU A 1 139 ? 9.174   80.910 43.547 1.00 38.10 ? 139  GLU A CB  1 
ATOM   1071 C CG  . GLU A 1 139 ? 10.242  81.034 44.663 1.00 37.93 ? 139  GLU A CG  1 
ATOM   1072 C CD  . GLU A 1 139 ? 11.603  81.433 44.137 1.00 38.16 ? 139  GLU A CD  1 
ATOM   1073 O OE1 . GLU A 1 139 ? 11.971  80.982 43.038 1.00 38.40 ? 139  GLU A OE1 1 
ATOM   1074 O OE2 . GLU A 1 139 ? 12.336  82.174 44.821 1.00 38.76 ? 139  GLU A OE2 1 
ATOM   1075 N N   . GLU A 1 140 ? 6.728   82.730 41.663 1.00 38.68 ? 140  GLU A N   1 
ATOM   1076 C CA  . GLU A 1 140 ? 5.910   82.671 40.477 1.00 39.42 ? 140  GLU A CA  1 
ATOM   1077 C C   . GLU A 1 140 ? 5.526   81.236 40.143 1.00 38.50 ? 140  GLU A C   1 
ATOM   1078 O O   . GLU A 1 140 ? 5.699   80.769 39.010 1.00 38.69 ? 140  GLU A O   1 
ATOM   1079 C CB  . GLU A 1 140 ? 6.679   83.277 39.303 1.00 41.53 ? 140  GLU A CB  1 
ATOM   1080 C CG  . GLU A 1 140 ? 6.007   84.463 38.628 1.00 45.14 ? 140  GLU A CG  1 
ATOM   1081 C CD  . GLU A 1 140 ? 6.950   85.662 38.536 1.00 47.07 ? 140  GLU A CD  1 
ATOM   1082 O OE1 . GLU A 1 140 ? 8.202   85.460 38.408 1.00 48.49 ? 140  GLU A OE1 1 
ATOM   1083 O OE2 . GLU A 1 140 ? 6.442   86.812 38.591 1.00 48.25 ? 140  GLU A OE2 1 
ATOM   1084 N N   . VAL A 1 141 ? 5.024   80.517 41.133 1.00 37.15 ? 141  VAL A N   1 
ATOM   1085 C CA  . VAL A 1 141 ? 4.600   79.166 40.865 1.00 35.57 ? 141  VAL A CA  1 
ATOM   1086 C C   . VAL A 1 141 ? 3.154   79.082 41.288 1.00 34.86 ? 141  VAL A C   1 
ATOM   1087 O O   . VAL A 1 141 ? 2.671   79.914 42.066 1.00 34.07 ? 141  VAL A O   1 
ATOM   1088 C CB  . VAL A 1 141 ? 5.421   78.106 41.686 1.00 35.55 ? 141  VAL A CB  1 
ATOM   1089 C CG1 . VAL A 1 141 ? 6.940   78.153 41.306 1.00 35.00 ? 141  VAL A CG1 1 
ATOM   1090 C CG2 . VAL A 1 141 ? 5.248   78.352 43.161 1.00 35.17 ? 141  VAL A CG2 1 
ATOM   1091 N N   . VAL A 1 142 ? 2.456   78.091 40.734 1.00 34.20 ? 142  VAL A N   1 
ATOM   1092 C CA  . VAL A 1 142 ? 1.092   77.814 41.155 1.00 33.42 ? 142  VAL A CA  1 
ATOM   1093 C C   . VAL A 1 142 ? 1.261   76.806 42.301 1.00 33.23 ? 142  VAL A C   1 
ATOM   1094 O O   . VAL A 1 142 ? 1.714   75.666 42.090 1.00 33.32 ? 142  VAL A O   1 
ATOM   1095 C CB  . VAL A 1 142 ? 0.250   77.173 40.046 1.00 33.12 ? 142  VAL A CB  1 
ATOM   1096 C CG1 . VAL A 1 142 ? -1.055  76.613 40.650 1.00 32.84 ? 142  VAL A CG1 1 
ATOM   1097 C CG2 . VAL A 1 142 ? -0.063  78.221 38.960 1.00 32.69 ? 142  VAL A CG2 1 
ATOM   1098 N N   . LEU A 1 143 ? 0.916   77.239 43.504 1.00 32.61 ? 143  LEU A N   1 
ATOM   1099 C CA  . LEU A 1 143 ? 1.048   76.396 44.669 1.00 31.87 ? 143  LEU A CA  1 
ATOM   1100 C C   . LEU A 1 143 ? -0.255  75.771 45.108 1.00 31.27 ? 143  LEU A C   1 
ATOM   1101 O O   . LEU A 1 143 ? -1.248  76.465 45.360 1.00 31.35 ? 143  LEU A O   1 
ATOM   1102 C CB  . LEU A 1 143 ? 1.651   77.166 45.854 1.00 32.66 ? 143  LEU A CB  1 
ATOM   1103 C CG  . LEU A 1 143 ? 1.945   76.030 46.840 1.00 33.65 ? 143  LEU A CG  1 
ATOM   1104 C CD1 . LEU A 1 143 ? 3.450   75.771 46.961 1.00 33.87 ? 143  LEU A CD1 1 
ATOM   1105 C CD2 . LEU A 1 143 ? 1.267   76.312 48.130 1.00 33.51 ? 143  LEU A CD2 1 
ATOM   1106 N N   . VAL A 1 144 ? -0.242  74.447 45.218 1.00 30.14 ? 144  VAL A N   1 
ATOM   1107 C CA  . VAL A 1 144 ? -1.416  73.711 45.634 1.00 29.00 ? 144  VAL A CA  1 
ATOM   1108 C C   . VAL A 1 144 ? -1.184  72.955 46.938 1.00 28.35 ? 144  VAL A C   1 
ATOM   1109 O O   . VAL A 1 144 ? -0.143  72.324 47.114 1.00 27.64 ? 144  VAL A O   1 
ATOM   1110 C CB  . VAL A 1 144 ? -1.816  72.601 44.565 1.00 29.00 ? 144  VAL A CB  1 
ATOM   1111 C CG1 . VAL A 1 144 ? -3.084  71.825 45.039 1.00 28.12 ? 144  VAL A CG1 1 
ATOM   1112 C CG2 . VAL A 1 144 ? -2.018  73.220 43.176 1.00 28.61 ? 144  VAL A CG2 1 
ATOM   1113 N N   . SER A 1 145 ? -2.154  73.018 47.847 1.00 28.01 ? 145  SER A N   1 
ATOM   1114 C CA  . SER A 1 145 ? -2.077  72.162 49.049 1.00 27.57 ? 145  SER A CA  1 
ATOM   1115 C C   . SER A 1 145 ? -3.342  71.297 49.016 1.00 27.97 ? 145  SER A C   1 
ATOM   1116 O O   . SER A 1 145 ? -4.461  71.810 48.847 1.00 27.46 ? 145  SER A O   1 
ATOM   1117 C CB  . SER A 1 145 ? -1.995  72.931 50.382 1.00 27.19 ? 145  SER A CB  1 
ATOM   1118 O OG  . SER A 1 145 ? -2.988  73.926 50.566 1.00 26.08 ? 145  SER A OG  1 
ATOM   1119 N N   . LEU A 1 146 ? -3.171  69.978 49.133 1.00 28.01 ? 146  LEU A N   1 
ATOM   1120 C CA  . LEU A 1 146 ? -4.341  69.091 49.153 1.00 28.25 ? 146  LEU A CA  1 
ATOM   1121 C C   . LEU A 1 146 ? -4.692  68.676 50.612 1.00 28.67 ? 146  LEU A C   1 
ATOM   1122 O O   . LEU A 1 146 ? -4.119  69.183 51.563 1.00 28.93 ? 146  LEU A O   1 
ATOM   1123 C CB  . LEU A 1 146 ? -4.074  67.863 48.261 1.00 27.99 ? 146  LEU A CB  1 
ATOM   1124 C CG  . LEU A 1 146 ? -2.729  67.137 48.417 1.00 27.58 ? 146  LEU A CG  1 
ATOM   1125 C CD1 . LEU A 1 146 ? -2.751  66.369 49.720 1.00 27.48 ? 146  LEU A CD1 1 
ATOM   1126 C CD2 . LEU A 1 146 ? -2.468  66.197 47.235 1.00 27.25 ? 146  LEU A CD2 1 
ATOM   1127 N N   . SER A 1 147 ? -5.667  67.799 50.793 1.00 28.86 ? 147  SER A N   1 
ATOM   1128 C CA  . SER A 1 147 ? -5.993  67.328 52.118 1.00 28.90 ? 147  SER A CA  1 
ATOM   1129 C C   . SER A 1 147 ? -6.265  65.854 51.908 1.00 28.46 ? 147  SER A C   1 
ATOM   1130 O O   . SER A 1 147 ? -6.408  65.406 50.761 1.00 28.37 ? 147  SER A O   1 
ATOM   1131 C CB  . SER A 1 147 ? -7.233  68.023 52.666 1.00 29.67 ? 147  SER A CB  1 
ATOM   1132 O OG  . SER A 1 147 ? -8.367  67.768 51.831 1.00 31.77 ? 147  SER A OG  1 
ATOM   1133 N N   . TYR A 1 148 ? -6.299  65.089 52.992 1.00 27.92 ? 148  TYR A N   1 
ATOM   1134 C CA  . TYR A 1 148 ? -6.580  63.658 52.910 1.00 27.24 ? 148  TYR A CA  1 
ATOM   1135 C C   . TYR A 1 148 ? -7.011  63.169 54.288 1.00 27.44 ? 148  TYR A C   1 
ATOM   1136 O O   . TYR A 1 148 ? -6.624  63.744 55.315 1.00 27.44 ? 148  TYR A O   1 
ATOM   1137 C CB  . TYR A 1 148 ? -5.361  62.851 52.431 1.00 26.48 ? 148  TYR A CB  1 
ATOM   1138 C CG  . TYR A 1 148 ? -4.132  62.987 53.316 1.00 26.14 ? 148  TYR A CG  1 
ATOM   1139 C CD1 . TYR A 1 148 ? -3.277  64.079 53.169 1.00 25.99 ? 148  TYR A CD1 1 
ATOM   1140 C CD2 . TYR A 1 148 ? -3.833  62.039 54.293 1.00 24.94 ? 148  TYR A CD2 1 
ATOM   1141 C CE1 . TYR A 1 148 ? -2.147  64.239 53.975 1.00 25.57 ? 148  TYR A CE1 1 
ATOM   1142 C CE2 . TYR A 1 148 ? -2.695  62.175 55.114 1.00 25.00 ? 148  TYR A CE2 1 
ATOM   1143 C CZ  . TYR A 1 148 ? -1.859  63.279 54.953 1.00 25.52 ? 148  TYR A CZ  1 
ATOM   1144 O OH  . TYR A 1 148 ? -0.745  63.452 55.746 1.00 24.35 ? 148  TYR A OH  1 
ATOM   1145 N N   . ARG A 1 149 ? -7.829  62.126 54.312 1.00 27.50 ? 149  ARG A N   1 
ATOM   1146 C CA  . ARG A 1 149 ? -8.305  61.604 55.579 1.00 27.74 ? 149  ARG A CA  1 
ATOM   1147 C C   . ARG A 1 149 ? -7.108  61.035 56.393 1.00 27.67 ? 149  ARG A C   1 
ATOM   1148 O O   . ARG A 1 149 ? -6.157  60.448 55.808 1.00 27.62 ? 149  ARG A O   1 
ATOM   1149 C CB  . ARG A 1 149 ? -9.366  60.520 55.326 1.00 27.68 ? 149  ARG A CB  1 
ATOM   1150 C CG  . ARG A 1 149 ? -10.698 61.067 54.794 1.00 27.26 ? 149  ARG A CG  1 
ATOM   1151 C CD  . ARG A 1 149 ? -11.590 59.929 54.372 1.00 26.84 ? 149  ARG A CD  1 
ATOM   1152 N NE  . ARG A 1 149 ? -11.278 59.501 53.013 1.00 26.49 ? 149  ARG A NE  1 
ATOM   1153 C CZ  . ARG A 1 149 ? -11.833 58.457 52.407 1.00 26.19 ? 149  ARG A CZ  1 
ATOM   1154 N NH1 . ARG A 1 149 ? -12.723 57.720 53.064 1.00 26.67 ? 149  ARG A NH1 1 
ATOM   1155 N NH2 . ARG A 1 149 ? -11.545 58.179 51.130 1.00 25.41 ? 149  ARG A NH2 1 
ATOM   1156 N N   . VAL A 1 150 ? -7.149  61.266 57.710 1.00 26.79 ? 150  VAL A N   1 
ATOM   1157 C CA  . VAL A 1 150 ? -6.128  60.780 58.612 1.00 26.97 ? 150  VAL A CA  1 
ATOM   1158 C C   . VAL A 1 150 ? -6.799  59.911 59.682 1.00 27.55 ? 150  VAL A C   1 
ATOM   1159 O O   . VAL A 1 150 ? -8.044  59.784 59.737 1.00 27.12 ? 150  VAL A O   1 
ATOM   1160 C CB  . VAL A 1 150 ? -5.349  61.969 59.297 1.00 26.71 ? 150  VAL A CB  1 
ATOM   1161 C CG1 . VAL A 1 150 ? -4.566  62.766 58.211 1.00 26.60 ? 150  VAL A CG1 1 
ATOM   1162 C CG2 . VAL A 1 150 ? -6.308  62.899 60.041 1.00 25.69 ? 150  VAL A CG2 1 
ATOM   1163 N N   . GLY A 1 151 ? -5.977  59.342 60.560 1.00 27.91 ? 151  GLY A N   1 
ATOM   1164 C CA  . GLY A 1 151 ? -6.521  58.500 61.608 1.00 28.22 ? 151  GLY A CA  1 
ATOM   1165 C C   . GLY A 1 151 ? -7.273  57.292 61.059 1.00 28.81 ? 151  GLY A C   1 
ATOM   1166 O O   . GLY A 1 151 ? -7.011  56.815 59.943 1.00 28.97 ? 151  GLY A O   1 
ATOM   1167 N N   . ALA A 1 152 ? -8.219  56.776 61.835 1.00 29.13 ? 152  ALA A N   1 
ATOM   1168 C CA  . ALA A 1 152 ? -8.968  55.609 61.395 1.00 29.22 ? 152  ALA A CA  1 
ATOM   1169 C C   . ALA A 1 152 ? -9.746  55.910 60.093 1.00 29.21 ? 152  ALA A C   1 
ATOM   1170 O O   . ALA A 1 152 ? -9.823  55.064 59.204 1.00 29.11 ? 152  ALA A O   1 
ATOM   1171 C CB  . ALA A 1 152 ? -9.940  55.136 62.535 1.00 29.67 ? 152  ALA A CB  1 
ATOM   1172 N N   . PHE A 1 153 ? -10.299 57.118 59.989 1.00 29.08 ? 153  PHE A N   1 
ATOM   1173 C CA  . PHE A 1 153 ? -11.041 57.537 58.796 1.00 29.12 ? 153  PHE A CA  1 
ATOM   1174 C C   . PHE A 1 153 ? -10.242 57.407 57.518 1.00 28.94 ? 153  PHE A C   1 
ATOM   1175 O O   . PHE A 1 153 ? -10.837 57.162 56.456 1.00 28.98 ? 153  PHE A O   1 
ATOM   1176 C CB  . PHE A 1 153 ? -11.461 58.990 58.930 1.00 29.24 ? 153  PHE A CB  1 
ATOM   1177 C CG  . PHE A 1 153 ? -12.063 59.307 60.259 1.00 30.15 ? 153  PHE A CG  1 
ATOM   1178 C CD1 . PHE A 1 153 ? -13.444 59.137 60.476 1.00 30.38 ? 153  PHE A CD1 1 
ATOM   1179 C CD2 . PHE A 1 153 ? -11.256 59.774 61.304 1.00 29.72 ? 153  PHE A CD2 1 
ATOM   1180 C CE1 . PHE A 1 153 ? -14.006 59.442 61.737 1.00 30.37 ? 153  PHE A CE1 1 
ATOM   1181 C CE2 . PHE A 1 153 ? -11.787 60.080 62.547 1.00 30.09 ? 153  PHE A CE2 1 
ATOM   1182 C CZ  . PHE A 1 153 ? -13.174 59.916 62.773 1.00 30.40 ? 153  PHE A CZ  1 
ATOM   1183 N N   . GLY A 1 154 ? -8.910  57.574 57.602 1.00 28.69 ? 154  GLY A N   1 
ATOM   1184 C CA  . GLY A 1 154 ? -8.085  57.456 56.405 1.00 28.21 ? 154  GLY A CA  1 
ATOM   1185 C C   . GLY A 1 154 ? -7.305  56.143 56.278 1.00 28.25 ? 154  GLY A C   1 
ATOM   1186 O O   . GLY A 1 154 ? -6.918  55.735 55.176 1.00 27.79 ? 154  GLY A O   1 
ATOM   1187 N N   . PHE A 1 155 ? -7.099  55.445 57.389 1.00 28.16 ? 155  PHE A N   1 
ATOM   1188 C CA  . PHE A 1 155 ? -6.251  54.271 57.307 1.00 28.33 ? 155  PHE A CA  1 
ATOM   1189 C C   . PHE A 1 155 ? -6.670  52.990 57.996 1.00 28.66 ? 155  PHE A C   1 
ATOM   1190 O O   . PHE A 1 155 ? -5.862  52.062 58.100 1.00 28.43 ? 155  PHE A O   1 
ATOM   1191 C CB  . PHE A 1 155 ? -4.837  54.690 57.761 1.00 27.97 ? 155  PHE A CB  1 
ATOM   1192 C CG  . PHE A 1 155 ? -4.238  55.750 56.887 1.00 27.61 ? 155  PHE A CG  1 
ATOM   1193 C CD1 . PHE A 1 155 ? -3.631  55.413 55.677 1.00 27.55 ? 155  PHE A CD1 1 
ATOM   1194 C CD2 . PHE A 1 155 ? -4.417  57.092 57.193 1.00 26.80 ? 155  PHE A CD2 1 
ATOM   1195 C CE1 . PHE A 1 155 ? -3.215  56.405 54.768 1.00 27.71 ? 155  PHE A CE1 1 
ATOM   1196 C CE2 . PHE A 1 155 ? -4.013  58.088 56.307 1.00 26.89 ? 155  PHE A CE2 1 
ATOM   1197 C CZ  . PHE A 1 155 ? -3.411  57.751 55.088 1.00 27.33 ? 155  PHE A CZ  1 
ATOM   1198 N N   . LEU A 1 156 ? -7.903  52.944 58.491 1.00 29.41 ? 156  LEU A N   1 
ATOM   1199 C CA  . LEU A 1 156 ? -8.430  51.706 59.103 1.00 30.67 ? 156  LEU A CA  1 
ATOM   1200 C C   . LEU A 1 156 ? -8.281  50.670 58.013 1.00 30.64 ? 156  LEU A C   1 
ATOM   1201 O O   . LEU A 1 156 ? -8.773  50.879 56.926 1.00 30.73 ? 156  LEU A O   1 
ATOM   1202 C CB  . LEU A 1 156 ? -9.918  51.849 59.423 1.00 31.29 ? 156  LEU A CB  1 
ATOM   1203 C CG  . LEU A 1 156 ? -10.459 50.667 60.221 1.00 32.50 ? 156  LEU A CG  1 
ATOM   1204 C CD1 . LEU A 1 156 ? -10.361 50.935 61.732 1.00 32.04 ? 156  LEU A CD1 1 
ATOM   1205 C CD2 . LEU A 1 156 ? -11.927 50.464 59.815 1.00 32.71 ? 156  LEU A CD2 1 
ATOM   1206 N N   . ALA A 1 157 ? -7.589  49.573 58.276 1.00 31.58 ? 157  ALA A N   1 
ATOM   1207 C CA  . ALA A 1 157 ? -7.380  48.555 57.238 1.00 32.37 ? 157  ALA A CA  1 
ATOM   1208 C C   . ALA A 1 157 ? -7.822  47.102 57.576 1.00 33.59 ? 157  ALA A C   1 
ATOM   1209 O O   . ALA A 1 157 ? -7.293  46.452 58.478 1.00 33.35 ? 157  ALA A O   1 
ATOM   1210 C CB  . ALA A 1 157 ? -5.936  48.538 56.826 1.00 31.04 ? 157  ALA A CB  1 
ATOM   1211 N N   . LEU A 1 158 ? -8.795  46.604 56.825 1.00 35.13 ? 158  LEU A N   1 
ATOM   1212 C CA  . LEU A 1 158 ? -9.284  45.234 56.987 1.00 36.42 ? 158  LEU A CA  1 
ATOM   1213 C C   . LEU A 1 158 ? -9.111  44.639 55.595 1.00 37.12 ? 158  LEU A C   1 
ATOM   1214 O O   . LEU A 1 158 ? -10.031 44.594 54.798 1.00 37.42 ? 158  LEU A O   1 
ATOM   1215 C CB  . LEU A 1 158 ? -10.749 45.254 57.422 1.00 36.27 ? 158  LEU A CB  1 
ATOM   1216 C CG  . LEU A 1 158 ? -11.001 45.669 58.882 1.00 36.77 ? 158  LEU A CG  1 
ATOM   1217 C CD1 . LEU A 1 158 ? -12.490 46.013 59.080 1.00 36.02 ? 158  LEU A CD1 1 
ATOM   1218 C CD2 . LEU A 1 158 ? -10.535 44.518 59.847 1.00 36.40 ? 158  LEU A CD2 1 
ATOM   1219 N N   . HIS A 1 159 ? -7.888  44.236 55.296 1.00 38.59 ? 159  HIS A N   1 
ATOM   1220 C CA  . HIS A 1 159 ? -7.528  43.674 53.992 1.00 39.73 ? 159  HIS A CA  1 
ATOM   1221 C C   . HIS A 1 159 ? -8.510  42.621 53.556 1.00 40.89 ? 159  HIS A C   1 
ATOM   1222 O O   . HIS A 1 159 ? -8.890  41.768 54.359 1.00 41.13 ? 159  HIS A O   1 
ATOM   1223 C CB  . HIS A 1 159 ? -6.156  43.053 54.048 1.00 39.33 ? 159  HIS A CB  1 
ATOM   1224 C CG  . HIS A 1 159 ? -5.623  42.693 52.707 1.00 39.58 ? 159  HIS A CG  1 
ATOM   1225 N ND1 . HIS A 1 159 ? -5.588  43.597 51.658 1.00 39.60 ? 159  HIS A ND1 1 
ATOM   1226 C CD2 . HIS A 1 159 ? -5.104  41.536 52.232 1.00 39.25 ? 159  HIS A CD2 1 
ATOM   1227 C CE1 . HIS A 1 159 ? -5.071  43.004 50.596 1.00 39.40 ? 159  HIS A CE1 1 
ATOM   1228 N NE2 . HIS A 1 159 ? -4.770  41.756 50.918 1.00 39.19 ? 159  HIS A NE2 1 
ATOM   1229 N N   . GLY A 1 160 ? -8.917  42.675 52.287 1.00 42.00 ? 160  GLY A N   1 
ATOM   1230 C CA  . GLY A 1 160 ? -9.893  41.724 51.784 1.00 43.05 ? 160  GLY A CA  1 
ATOM   1231 C C   . GLY A 1 160 ? -11.283 42.340 51.773 1.00 44.01 ? 160  GLY A C   1 
ATOM   1232 O O   . GLY A 1 160 ? -12.142 41.951 50.997 1.00 44.15 ? 160  GLY A O   1 
ATOM   1233 N N   . SER A 1 161 ? -11.531 43.291 52.663 1.00 44.76 ? 161  SER A N   1 
ATOM   1234 C CA  . SER A 1 161 ? -12.826 43.944 52.681 1.00 45.47 ? 161  SER A CA  1 
ATOM   1235 C C   . SER A 1 161 ? -12.784 45.087 51.666 1.00 45.76 ? 161  SER A C   1 
ATOM   1236 O O   . SER A 1 161 ? -11.751 45.742 51.512 1.00 46.21 ? 161  SER A O   1 
ATOM   1237 C CB  . SER A 1 161 ? -13.110 44.503 54.065 1.00 46.08 ? 161  SER A CB  1 
ATOM   1238 O OG  . SER A 1 161 ? -14.025 45.596 53.947 1.00 47.99 ? 161  SER A OG  1 
ATOM   1239 N N   . GLN A 1 162 ? -13.879 45.341 50.961 1.00 45.68 ? 162  GLN A N   1 
ATOM   1240 C CA  . GLN A 1 162 ? -13.852 46.426 50.001 1.00 45.70 ? 162  GLN A CA  1 
ATOM   1241 C C   . GLN A 1 162 ? -14.419 47.651 50.665 1.00 44.80 ? 162  GLN A C   1 
ATOM   1242 O O   . GLN A 1 162 ? -14.325 48.740 50.132 1.00 44.62 ? 162  GLN A O   1 
ATOM   1243 C CB  . GLN A 1 162 ? -14.644 46.076 48.721 1.00 47.31 ? 162  GLN A CB  1 
ATOM   1244 C CG  . GLN A 1 162 ? -13.880 45.144 47.775 1.00 49.18 ? 162  GLN A CG  1 
ATOM   1245 C CD  . GLN A 1 162 ? -12.438 45.635 47.549 1.00 50.72 ? 162  GLN A CD  1 
ATOM   1246 O OE1 . GLN A 1 162 ? -12.202 46.846 47.315 1.00 51.80 ? 162  GLN A OE1 1 
ATOM   1247 N NE2 . GLN A 1 162 ? -11.472 44.710 47.619 1.00 51.12 ? 162  GLN A NE2 1 
ATOM   1248 N N   . GLU A 1 163 ? -15.002 47.456 51.843 1.00 43.99 ? 163  GLU A N   1 
ATOM   1249 C CA  . GLU A 1 163 ? -15.582 48.540 52.622 1.00 43.05 ? 163  GLU A CA  1 
ATOM   1250 C C   . GLU A 1 163 ? -14.553 49.394 53.393 1.00 42.02 ? 163  GLU A C   1 
ATOM   1251 O O   . GLU A 1 163 ? -14.743 50.612 53.527 1.00 41.82 ? 163  GLU A O   1 
ATOM   1252 C CB  . GLU A 1 163 ? -16.636 47.971 53.574 1.00 44.16 ? 163  GLU A CB  1 
ATOM   1253 C CG  . GLU A 1 163 ? -17.851 47.405 52.843 1.00 44.99 ? 163  GLU A CG  1 
ATOM   1254 C CD  . GLU A 1 163 ? -18.481 48.429 51.931 1.00 45.78 ? 163  GLU A CD  1 
ATOM   1255 O OE1 . GLU A 1 163 ? -18.621 49.612 52.332 1.00 45.56 ? 163  GLU A OE1 1 
ATOM   1256 O OE2 . GLU A 1 163 ? -18.828 48.033 50.793 1.00 46.68 ? 163  GLU A OE2 1 
ATOM   1257 N N   . ALA A 1 164 ? -13.496 48.760 53.916 1.00 40.34 ? 164  ALA A N   1 
ATOM   1258 C CA  . ALA A 1 164 ? -12.403 49.467 54.625 1.00 39.00 ? 164  ALA A CA  1 
ATOM   1259 C C   . ALA A 1 164 ? -11.137 48.716 54.186 1.00 37.93 ? 164  ALA A C   1 
ATOM   1260 O O   . ALA A 1 164 ? -10.533 47.929 54.942 1.00 38.03 ? 164  ALA A O   1 
ATOM   1261 C CB  . ALA A 1 164 ? -12.569 49.399 56.161 1.00 38.35 ? 164  ALA A CB  1 
ATOM   1262 N N   . PRO A 1 165 ? -10.720 48.949 52.946 1.00 36.75 ? 165  PRO A N   1 
ATOM   1263 C CA  . PRO A 1 165 ? -9.533  48.262 52.442 1.00 36.23 ? 165  PRO A CA  1 
ATOM   1264 C C   . PRO A 1 165 ? -8.209  48.766 52.978 1.00 35.70 ? 165  PRO A C   1 
ATOM   1265 O O   . PRO A 1 165 ? -7.222  48.043 52.962 1.00 36.43 ? 165  PRO A O   1 
ATOM   1266 C CB  . PRO A 1 165 ? -9.652  48.434 50.927 1.00 36.20 ? 165  PRO A CB  1 
ATOM   1267 C CG  . PRO A 1 165 ? -10.252 49.820 50.782 1.00 36.18 ? 165  PRO A CG  1 
ATOM   1268 C CD  . PRO A 1 165 ? -11.263 49.911 51.970 1.00 36.52 ? 165  PRO A CD  1 
ATOM   1269 N N   . GLY A 1 166 ? -8.194  49.991 53.475 1.00 34.56 ? 166  GLY A N   1 
ATOM   1270 C CA  . GLY A 1 166 ? -6.946  50.575 53.948 1.00 33.50 ? 166  GLY A CA  1 
ATOM   1271 C C   . GLY A 1 166 ? -6.417  51.535 52.874 1.00 32.49 ? 166  GLY A C   1 
ATOM   1272 O O   . GLY A 1 166 ? -6.928  51.553 51.749 1.00 32.35 ? 166  GLY A O   1 
ATOM   1273 N N   . ASN A 1 167 ? -5.445  52.357 53.245 1.00 31.39 ? 167  ASN A N   1 
ATOM   1274 C CA  . ASN A 1 167 ? -4.812  53.283 52.325 1.00 30.17 ? 167  ASN A CA  1 
ATOM   1275 C C   . ASN A 1 167 ? -5.716  54.325 51.693 1.00 29.33 ? 167  ASN A C   1 
ATOM   1276 O O   . ASN A 1 167 ? -5.256  55.063 50.833 1.00 28.77 ? 167  ASN A O   1 
ATOM   1277 C CB  . ASN A 1 167 ? -4.086  52.482 51.218 1.00 29.51 ? 167  ASN A CB  1 
ATOM   1278 C CG  . ASN A 1 167 ? -2.899  51.671 51.771 1.00 29.92 ? 167  ASN A CG  1 
ATOM   1279 O OD1 . ASN A 1 167 ? -2.350  52.018 52.803 1.00 29.73 ? 167  ASN A OD1 1 
ATOM   1280 N ND2 . ASN A 1 167 ? -2.502  50.605 51.081 1.00 28.41 ? 167  ASN A ND2 1 
ATOM   1281 N N   . VAL A 1 168 ? -6.967  54.437 52.142 1.00 28.92 ? 168  VAL A N   1 
ATOM   1282 C CA  . VAL A 1 168 ? -7.873  55.374 51.474 1.00 28.56 ? 168  VAL A CA  1 
ATOM   1283 C C   . VAL A 1 168 ? -7.392  56.832 51.564 1.00 28.66 ? 168  VAL A C   1 
ATOM   1284 O O   . VAL A 1 168 ? -7.609  57.647 50.623 1.00 28.97 ? 168  VAL A O   1 
ATOM   1285 C CB  . VAL A 1 168 ? -9.416  55.151 51.900 1.00 28.63 ? 168  VAL A CB  1 
ATOM   1286 C CG1 . VAL A 1 168 ? -9.770  53.641 51.746 1.00 28.05 ? 168  VAL A CG1 1 
ATOM   1287 C CG2 . VAL A 1 168 ? -9.732  55.623 53.306 1.00 27.45 ? 168  VAL A CG2 1 
ATOM   1288 N N   . GLY A 1 169 ? -6.648  57.124 52.634 1.00 28.02 ? 169  GLY A N   1 
ATOM   1289 C CA  . GLY A 1 169 ? -6.092  58.449 52.801 1.00 27.54 ? 169  GLY A CA  1 
ATOM   1290 C C   . GLY A 1 169 ? -5.090  58.699 51.693 1.00 27.10 ? 169  GLY A C   1 
ATOM   1291 O O   . GLY A 1 169 ? -4.997  59.814 51.176 1.00 26.93 ? 169  GLY A O   1 
ATOM   1292 N N   . LEU A 1 170 ? -4.357  57.655 51.309 1.00 26.78 ? 170  LEU A N   1 
ATOM   1293 C CA  . LEU A 1 170 ? -3.380  57.783 50.226 1.00 26.66 ? 170  LEU A CA  1 
ATOM   1294 C C   . LEU A 1 170 ? -4.149  57.968 48.916 1.00 26.69 ? 170  LEU A C   1 
ATOM   1295 O O   . LEU A 1 170 ? -3.719  58.754 48.063 1.00 26.71 ? 170  LEU A O   1 
ATOM   1296 C CB  . LEU A 1 170 ? -2.460  56.547 50.147 1.00 25.85 ? 170  LEU A CB  1 
ATOM   1297 C CG  . LEU A 1 170 ? -1.354  56.512 51.234 1.00 25.69 ? 170  LEU A CG  1 
ATOM   1298 C CD1 . LEU A 1 170 ? -0.661  55.141 51.307 1.00 24.81 ? 170  LEU A CD1 1 
ATOM   1299 C CD2 . LEU A 1 170 ? -0.292  57.590 50.926 1.00 25.37 ? 170  LEU A CD2 1 
ATOM   1300 N N   . LEU A 1 171 ? -5.276  57.258 48.779 1.00 26.66 ? 171  LEU A N   1 
ATOM   1301 C CA  . LEU A 1 171 ? -6.097  57.363 47.581 1.00 27.75 ? 171  LEU A CA  1 
ATOM   1302 C C   . LEU A 1 171 ? -6.708  58.768 47.531 1.00 27.88 ? 171  LEU A C   1 
ATOM   1303 O O   . LEU A 1 171 ? -6.843  59.304 46.454 1.00 27.47 ? 171  LEU A O   1 
ATOM   1304 C CB  . LEU A 1 171 ? -7.169  56.263 47.552 1.00 28.18 ? 171  LEU A CB  1 
ATOM   1305 C CG  . LEU A 1 171 ? -6.563  54.868 47.332 1.00 28.71 ? 171  LEU A CG  1 
ATOM   1306 C CD1 . LEU A 1 171 ? -7.756  53.862 47.270 1.00 28.96 ? 171  LEU A CD1 1 
ATOM   1307 C CD2 . LEU A 1 171 ? -5.711  54.816 46.048 1.00 27.37 ? 171  LEU A CD2 1 
ATOM   1308 N N   . ASP A 1 172 ? -7.043  59.371 48.695 1.00 28.24 ? 172  ASP A N   1 
ATOM   1309 C CA  . ASP A 1 172 ? -7.499  60.776 48.672 1.00 28.45 ? 172  ASP A CA  1 
ATOM   1310 C C   . ASP A 1 172 ? -6.390  61.663 48.045 1.00 28.02 ? 172  ASP A C   1 
ATOM   1311 O O   . ASP A 1 172 ? -6.650  62.536 47.209 1.00 27.54 ? 172  ASP A O   1 
ATOM   1312 C CB  . ASP A 1 172 ? -7.788  61.338 50.090 1.00 28.61 ? 172  ASP A CB  1 
ATOM   1313 C CG  . ASP A 1 172 ? -8.938  60.616 50.805 1.00 29.88 ? 172  ASP A CG  1 
ATOM   1314 O OD1 . ASP A 1 172 ? -9.744  59.913 50.138 1.00 29.66 ? 172  ASP A OD1 1 
ATOM   1315 O OD2 . ASP A 1 172 ? -9.028  60.764 52.053 1.00 30.63 ? 172  ASP A OD2 1 
ATOM   1316 N N   . GLN A 1 173 ? -5.142  61.421 48.436 1.00 27.88 ? 173  GLN A N   1 
ATOM   1317 C CA  . GLN A 1 173 ? -4.077  62.279 47.937 1.00 27.84 ? 173  GLN A CA  1 
ATOM   1318 C C   . GLN A 1 173 ? -3.950  62.081 46.464 1.00 28.19 ? 173  GLN A C   1 
ATOM   1319 O O   . GLN A 1 173 ? -3.709  63.044 45.734 1.00 28.11 ? 173  GLN A O   1 
ATOM   1320 C CB  . GLN A 1 173 ? -2.720  61.982 48.610 1.00 27.26 ? 173  GLN A CB  1 
ATOM   1321 C CG  . GLN A 1 173 ? -2.656  62.145 50.129 1.00 26.06 ? 173  GLN A CG  1 
ATOM   1322 C CD  . GLN A 1 173 ? -1.331  61.610 50.707 1.00 26.70 ? 173  GLN A CD  1 
ATOM   1323 O OE1 . GLN A 1 173 ? -0.369  61.331 49.962 1.00 25.15 ? 173  GLN A OE1 1 
ATOM   1324 N NE2 . GLN A 1 173 ? -1.278  61.476 52.043 1.00 26.21 ? 173  GLN A NE2 1 
ATOM   1325 N N   . ARG A 1 174 ? -4.128  60.829 46.025 1.00 28.45 ? 174  ARG A N   1 
ATOM   1326 C CA  . ARG A 1 174 ? -3.970  60.532 44.620 1.00 29.09 ? 174  ARG A CA  1 
ATOM   1327 C C   . ARG A 1 174 ? -5.065  61.244 43.812 1.00 29.42 ? 174  ARG A C   1 
ATOM   1328 O O   . ARG A 1 174 ? -4.785  61.784 42.733 1.00 28.60 ? 174  ARG A O   1 
ATOM   1329 C CB  . ARG A 1 174 ? -4.002  59.004 44.347 1.00 28.89 ? 174  ARG A CB  1 
ATOM   1330 C CG  . ARG A 1 174 ? -3.777  58.640 42.869 1.00 28.94 ? 174  ARG A CG  1 
ATOM   1331 C CD  . ARG A 1 174 ? -3.991  57.140 42.603 1.00 28.73 ? 174  ARG A CD  1 
ATOM   1332 N NE  . ARG A 1 174 ? -2.912  56.329 43.133 1.00 27.92 ? 174  ARG A NE  1 
ATOM   1333 C CZ  . ARG A 1 174 ? -2.950  55.003 43.255 1.00 28.83 ? 174  ARG A CZ  1 
ATOM   1334 N NH1 . ARG A 1 174 ? -4.031  54.297 42.892 1.00 28.01 ? 174  ARG A NH1 1 
ATOM   1335 N NH2 . ARG A 1 174 ? -1.864  54.363 43.691 1.00 28.80 ? 174  ARG A NH2 1 
ATOM   1336 N N   . MET A 1 175 ? -6.294  61.218 44.336 1.00 30.20 ? 175  MET A N   1 
ATOM   1337 C CA  . MET A 1 175 ? -7.404  61.862 43.654 1.00 31.25 ? 175  MET A CA  1 
ATOM   1338 C C   . MET A 1 175 ? -7.107  63.349 43.486 1.00 31.03 ? 175  MET A C   1 
ATOM   1339 O O   . MET A 1 175 ? -7.356  63.915 42.429 1.00 31.49 ? 175  MET A O   1 
ATOM   1340 C CB  . MET A 1 175 ? -8.725  61.668 44.407 1.00 32.36 ? 175  MET A CB  1 
ATOM   1341 C CG  . MET A 1 175 ? -9.952  62.018 43.515 1.00 34.02 ? 175  MET A CG  1 
ATOM   1342 S SD  . MET A 1 175 ? -11.354 60.953 43.834 1.00 37.26 ? 175  MET A SD  1 
ATOM   1343 C CE  . MET A 1 175 ? -11.774 61.580 45.106 1.00 35.53 ? 175  MET A CE  1 
ATOM   1344 N N   . ALA A 1 176 ? -6.558  63.984 44.513 1.00 30.71 ? 176  ALA A N   1 
ATOM   1345 C CA  . ALA A 1 176 ? -6.225  65.396 44.388 1.00 30.04 ? 176  ALA A CA  1 
ATOM   1346 C C   . ALA A 1 176 ? -5.133  65.557 43.310 1.00 29.97 ? 176  ALA A C   1 
ATOM   1347 O O   . ALA A 1 176 ? -5.168  66.504 42.498 1.00 29.79 ? 176  ALA A O   1 
ATOM   1348 C CB  . ALA A 1 176 ? -5.754  65.946 45.747 1.00 29.92 ? 176  ALA A CB  1 
ATOM   1349 N N   . LEU A 1 177 ? -4.141  64.664 43.294 1.00 29.40 ? 177  LEU A N   1 
ATOM   1350 C CA  . LEU A 1 177 ? -3.121  64.791 42.249 1.00 29.54 ? 177  LEU A CA  1 
ATOM   1351 C C   . LEU A 1 177 ? -3.781  64.614 40.850 1.00 29.13 ? 177  LEU A C   1 
ATOM   1352 O O   . LEU A 1 177 ? -3.391  65.268 39.900 1.00 28.75 ? 177  LEU A O   1 
ATOM   1353 C CB  . LEU A 1 177 ? -1.973  63.779 42.432 1.00 29.05 ? 177  LEU A CB  1 
ATOM   1354 C CG  . LEU A 1 177 ? -1.190  63.944 43.721 1.00 29.70 ? 177  LEU A CG  1 
ATOM   1355 C CD1 . LEU A 1 177 ? -0.059  62.936 43.774 1.00 29.80 ? 177  LEU A CD1 1 
ATOM   1356 C CD2 . LEU A 1 177 ? -0.618  65.389 43.815 1.00 29.67 ? 177  LEU A CD2 1 
ATOM   1357 N N   . GLN A 1 178 ? -4.768  63.723 40.749 1.00 29.44 ? 178  GLN A N   1 
ATOM   1358 C CA  . GLN A 1 178 ? -5.483  63.484 39.475 1.00 29.56 ? 178  GLN A CA  1 
ATOM   1359 C C   . GLN A 1 178 ? -6.188  64.772 39.059 1.00 29.43 ? 178  GLN A C   1 
ATOM   1360 O O   . GLN A 1 178 ? -6.097  65.173 37.896 1.00 29.62 ? 178  GLN A O   1 
ATOM   1361 C CB  . GLN A 1 178 ? -6.540  62.353 39.604 1.00 29.90 ? 178  GLN A CB  1 
ATOM   1362 C CG  . GLN A 1 178 ? -7.224  61.912 38.248 1.00 30.07 ? 178  GLN A CG  1 
ATOM   1363 C CD  . GLN A 1 178 ? -6.201  61.352 37.268 1.00 30.28 ? 178  GLN A CD  1 
ATOM   1364 O OE1 . GLN A 1 178 ? -5.612  60.307 37.521 1.00 31.22 ? 178  GLN A OE1 1 
ATOM   1365 N NE2 . GLN A 1 178 ? -5.950  62.068 36.173 1.00 29.88 ? 178  GLN A NE2 1 
ATOM   1366 N N   . TRP A 1 179 ? -6.845  65.426 40.020 1.00 29.03 ? 179  TRP A N   1 
ATOM   1367 C CA  . TRP A 1 179 ? -7.588  66.661 39.766 1.00 29.20 ? 179  TRP A CA  1 
ATOM   1368 C C   . TRP A 1 179 ? -6.653  67.744 39.278 1.00 29.26 ? 179  TRP A C   1 
ATOM   1369 O O   . TRP A 1 179 ? -6.957  68.419 38.283 1.00 29.19 ? 179  TRP A O   1 
ATOM   1370 C CB  . TRP A 1 179 ? -8.312  67.109 41.022 1.00 29.21 ? 179  TRP A CB  1 
ATOM   1371 C CG  . TRP A 1 179 ? -9.368  68.111 40.773 1.00 29.60 ? 179  TRP A CG  1 
ATOM   1372 C CD1 . TRP A 1 179 ? -10.699 67.873 40.486 1.00 29.75 ? 179  TRP A CD1 1 
ATOM   1373 C CD2 . TRP A 1 179 ? -9.186  69.536 40.682 1.00 29.44 ? 179  TRP A CD2 1 
ATOM   1374 N NE1 . TRP A 1 179 ? -11.329 69.074 40.220 1.00 29.83 ? 179  TRP A NE1 1 
ATOM   1375 C CE2 . TRP A 1 179 ? -10.425 70.097 40.338 1.00 28.82 ? 179  TRP A CE2 1 
ATOM   1376 C CE3 . TRP A 1 179 ? -8.089  70.385 40.859 1.00 28.94 ? 179  TRP A CE3 1 
ATOM   1377 C CZ2 . TRP A 1 179 ? -10.598 71.463 40.169 1.00 28.89 ? 179  TRP A CZ2 1 
ATOM   1378 C CZ3 . TRP A 1 179 ? -8.278  71.750 40.682 1.00 29.17 ? 179  TRP A CZ3 1 
ATOM   1379 C CH2 . TRP A 1 179 ? -9.514  72.267 40.345 1.00 28.64 ? 179  TRP A CH2 1 
ATOM   1380 N N   . VAL A 1 180 ? -5.505  67.886 39.948 1.00 29.28 ? 180  VAL A N   1 
ATOM   1381 C CA  . VAL A 1 180 ? -4.464  68.847 39.538 1.00 29.33 ? 180  VAL A CA  1 
ATOM   1382 C C   . VAL A 1 180 ? -4.013  68.520 38.088 1.00 29.50 ? 180  VAL A C   1 
ATOM   1383 O O   . VAL A 1 180 ? -3.890  69.410 37.233 1.00 29.18 ? 180  VAL A O   1 
ATOM   1384 C CB  . VAL A 1 180 ? -3.198  68.760 40.497 1.00 29.33 ? 180  VAL A CB  1 
ATOM   1385 C CG1 . VAL A 1 180 ? -1.984  69.456 39.882 1.00 29.05 ? 180  VAL A CG1 1 
ATOM   1386 C CG2 . VAL A 1 180 ? -3.513  69.403 41.839 1.00 29.37 ? 180  VAL A CG2 1 
ATOM   1387 N N   . HIS A 1 181 ? -3.754  67.242 37.824 1.00 29.61 ? 181  HIS A N   1 
ATOM   1388 C CA  . HIS A 1 181 ? -3.324  66.807 36.506 1.00 29.76 ? 181  HIS A CA  1 
ATOM   1389 C C   . HIS A 1 181 ? -4.333  67.267 35.484 1.00 30.37 ? 181  HIS A C   1 
ATOM   1390 O O   . HIS A 1 181 ? -3.975  67.853 34.467 1.00 29.87 ? 181  HIS A O   1 
ATOM   1391 C CB  . HIS A 1 181 ? -3.233  65.270 36.444 1.00 30.27 ? 181  HIS A CB  1 
ATOM   1392 C CG  . HIS A 1 181 ? -2.845  64.729 35.088 1.00 31.27 ? 181  HIS A CG  1 
ATOM   1393 N ND1 . HIS A 1 181 ? -3.775  64.288 34.153 1.00 31.10 ? 181  HIS A ND1 1 
ATOM   1394 C CD2 . HIS A 1 181 ? -1.628  64.574 34.510 1.00 31.26 ? 181  HIS A CD2 1 
ATOM   1395 C CE1 . HIS A 1 181 ? -3.143  63.881 33.063 1.00 31.59 ? 181  HIS A CE1 1 
ATOM   1396 N NE2 . HIS A 1 181 ? -1.840  64.042 33.251 1.00 32.35 ? 181  HIS A NE2 1 
ATOM   1397 N N   . ASP A 1 182 ? -5.601  66.993 35.776 1.00 30.99 ? 182  ASP A N   1 
ATOM   1398 C CA  . ASP A 1 182 ? -6.684  67.325 34.864 1.00 31.98 ? 182  ASP A CA  1 
ATOM   1399 C C   . ASP A 1 182 ? -7.131  68.807 34.756 1.00 32.62 ? 182  ASP A C   1 
ATOM   1400 O O   . ASP A 1 182 ? -7.655  69.222 33.707 1.00 33.03 ? 182  ASP A O   1 
ATOM   1401 C CB  . ASP A 1 182 ? -7.920  66.496 35.212 1.00 31.94 ? 182  ASP A CB  1 
ATOM   1402 C CG  . ASP A 1 182 ? -7.690  64.991 35.079 1.00 32.63 ? 182  ASP A CG  1 
ATOM   1403 O OD1 . ASP A 1 182 ? -6.783  64.543 34.325 1.00 33.39 ? 182  ASP A OD1 1 
ATOM   1404 O OD2 . ASP A 1 182 ? -8.432  64.244 35.739 1.00 32.94 ? 182  ASP A OD2 1 
ATOM   1405 N N   . ASN A 1 183 ? -6.914  69.592 35.805 1.00 32.43 ? 183  ASN A N   1 
ATOM   1406 C CA  . ASN A 1 183 ? -7.419  70.953 35.821 1.00 32.58 ? 183  ASN A CA  1 
ATOM   1407 C C   . ASN A 1 183 ? -6.477  72.122 36.057 1.00 32.93 ? 183  ASN A C   1 
ATOM   1408 O O   . ASN A 1 183 ? -6.835  73.295 35.820 1.00 33.36 ? 183  ASN A O   1 
ATOM   1409 C CB  . ASN A 1 183 ? -8.499  71.008 36.887 1.00 32.34 ? 183  ASN A CB  1 
ATOM   1410 C CG  . ASN A 1 183 ? -9.690  70.103 36.568 1.00 32.32 ? 183  ASN A CG  1 
ATOM   1411 O OD1 . ASN A 1 183 ? -10.592 70.475 35.769 1.00 31.41 ? 183  ASN A OD1 1 
ATOM   1412 N ND2 . ASN A 1 183 ? -9.714  68.913 37.195 1.00 31.40 ? 183  ASN A ND2 1 
ATOM   1413 N N   . ILE A 1 184 ? -5.273  71.845 36.519 1.00 32.81 ? 184  ILE A N   1 
ATOM   1414 C CA  . ILE A 1 184 ? -4.394  72.946 36.836 1.00 32.84 ? 184  ILE A CA  1 
ATOM   1415 C C   . ILE A 1 184 ? -4.067  73.837 35.629 1.00 33.13 ? 184  ILE A C   1 
ATOM   1416 O O   . ILE A 1 184 ? -3.684  75.003 35.794 1.00 33.63 ? 184  ILE A O   1 
ATOM   1417 C CB  . ILE A 1 184 ? -3.103  72.430 37.565 1.00 32.19 ? 184  ILE A CB  1 
ATOM   1418 C CG1 . ILE A 1 184 ? -2.601  73.504 38.545 1.00 32.12 ? 184  ILE A CG1 1 
ATOM   1419 C CG2 . ILE A 1 184 ? -2.022  72.014 36.550 1.00 31.63 ? 184  ILE A CG2 1 
ATOM   1420 C CD1 . ILE A 1 184 ? -3.611  73.866 39.730 1.00 31.54 ? 184  ILE A CD1 1 
ATOM   1421 N N   . GLN A 1 185 ? -4.242  73.315 34.420 1.00 33.10 ? 185  GLN A N   1 
ATOM   1422 C CA  . GLN A 1 185 ? -3.939  74.108 33.237 1.00 32.99 ? 185  GLN A CA  1 
ATOM   1423 C C   . GLN A 1 185 ? -4.816  75.356 33.213 1.00 33.18 ? 185  GLN A C   1 
ATOM   1424 O O   . GLN A 1 185 ? -4.373  76.422 32.775 1.00 33.16 ? 185  GLN A O   1 
ATOM   1425 C CB  . GLN A 1 185 ? -4.157  73.295 31.948 1.00 32.83 ? 185  GLN A CB  1 
ATOM   1426 C CG  . GLN A 1 185 ? -5.598  73.001 31.623 1.00 33.28 ? 185  GLN A CG  1 
ATOM   1427 C CD  . GLN A 1 185 ? -5.772  71.757 30.711 1.00 33.81 ? 185  GLN A CD  1 
ATOM   1428 O OE1 . GLN A 1 185 ? -5.462  70.631 31.113 1.00 34.42 ? 185  GLN A OE1 1 
ATOM   1429 N NE2 . GLN A 1 185 ? -6.265  71.965 29.496 1.00 33.33 ? 185  GLN A NE2 1 
ATOM   1430 N N   . PHE A 1 186 ? -6.045  75.222 33.694 1.00 32.88 ? 186  PHE A N   1 
ATOM   1431 C CA  . PHE A 1 186 ? -6.977  76.353 33.690 1.00 33.28 ? 186  PHE A CA  1 
ATOM   1432 C C   . PHE A 1 186 ? -6.594  77.437 34.687 1.00 33.34 ? 186  PHE A C   1 
ATOM   1433 O O   . PHE A 1 186 ? -7.112  78.552 34.605 1.00 33.63 ? 186  PHE A O   1 
ATOM   1434 C CB  . PHE A 1 186 ? -8.409  75.863 33.962 1.00 32.70 ? 186  PHE A CB  1 
ATOM   1435 C CG  . PHE A 1 186 ? -8.854  74.819 32.990 1.00 33.09 ? 186  PHE A CG  1 
ATOM   1436 C CD1 . PHE A 1 186 ? -8.880  75.101 31.629 1.00 32.46 ? 186  PHE A CD1 1 
ATOM   1437 C CD2 . PHE A 1 186 ? -9.108  73.510 33.409 1.00 32.59 ? 186  PHE A CD2 1 
ATOM   1438 C CE1 . PHE A 1 186 ? -9.143  74.089 30.689 1.00 32.97 ? 186  PHE A CE1 1 
ATOM   1439 C CE2 . PHE A 1 186 ? -9.366  72.501 32.482 1.00 32.92 ? 186  PHE A CE2 1 
ATOM   1440 C CZ  . PHE A 1 186 ? -9.384  72.790 31.103 1.00 32.27 ? 186  PHE A CZ  1 
ATOM   1441 N N   . PHE A 1 187 ? -5.690  77.118 35.610 1.00 32.79 ? 187  PHE A N   1 
ATOM   1442 C CA  . PHE A 1 187 ? -5.268  78.092 36.597 1.00 32.70 ? 187  PHE A CA  1 
ATOM   1443 C C   . PHE A 1 187 ? -3.937  78.632 36.175 1.00 32.87 ? 187  PHE A C   1 
ATOM   1444 O O   . PHE A 1 187 ? -3.312  79.402 36.890 1.00 33.38 ? 187  PHE A O   1 
ATOM   1445 C CB  . PHE A 1 187 ? -5.149  77.470 37.997 1.00 32.01 ? 187  PHE A CB  1 
ATOM   1446 C CG  . PHE A 1 187 ? -6.478  77.074 38.592 1.00 31.56 ? 187  PHE A CG  1 
ATOM   1447 C CD1 . PHE A 1 187 ? -7.026  75.822 38.340 1.00 30.95 ? 187  PHE A CD1 1 
ATOM   1448 C CD2 . PHE A 1 187 ? -7.200  77.981 39.384 1.00 31.37 ? 187  PHE A CD2 1 
ATOM   1449 C CE1 . PHE A 1 187 ? -8.265  75.471 38.861 1.00 30.47 ? 187  PHE A CE1 1 
ATOM   1450 C CE2 . PHE A 1 187 ? -8.436  77.638 39.907 1.00 30.93 ? 187  PHE A CE2 1 
ATOM   1451 C CZ  . PHE A 1 187 ? -8.974  76.365 39.639 1.00 30.43 ? 187  PHE A CZ  1 
ATOM   1452 N N   . GLY A 1 188 ? -3.499  78.228 34.994 1.00 32.87 ? 188  GLY A N   1 
ATOM   1453 C CA  . GLY A 1 188 ? -2.214  78.700 34.531 1.00 32.86 ? 188  GLY A CA  1 
ATOM   1454 C C   . GLY A 1 188 ? -1.057  77.770 34.868 1.00 33.11 ? 188  GLY A C   1 
ATOM   1455 O O   . GLY A 1 188 ? 0.110   78.078 34.546 1.00 32.71 ? 188  GLY A O   1 
ATOM   1456 N N   . GLY A 1 189 ? -1.375  76.646 35.517 1.00 32.88 ? 189  GLY A N   1 
ATOM   1457 C CA  . GLY A 1 189 ? -0.342  75.692 35.873 1.00 33.01 ? 189  GLY A CA  1 
ATOM   1458 C C   . GLY A 1 189 ? -0.025  74.696 34.754 1.00 33.17 ? 189  GLY A C   1 
ATOM   1459 O O   . GLY A 1 189 ? -0.886  74.342 33.948 1.00 33.21 ? 189  GLY A O   1 
ATOM   1460 N N   . ASP A 1 190 ? 1.229   74.256 34.694 1.00 33.00 ? 190  ASP A N   1 
ATOM   1461 C CA  . ASP A 1 190 ? 1.638   73.273 33.700 1.00 33.10 ? 190  ASP A CA  1 
ATOM   1462 C C   . ASP A 1 190 ? 1.504   71.850 34.312 1.00 32.76 ? 190  ASP A C   1 
ATOM   1463 O O   . ASP A 1 190 ? 2.313   71.441 35.130 1.00 33.60 ? 190  ASP A O   1 
ATOM   1464 C CB  . ASP A 1 190 ? 3.083   73.575 33.268 1.00 33.10 ? 190  ASP A CB  1 
ATOM   1465 C CG  . ASP A 1 190 ? 3.655   72.523 32.340 1.00 33.20 ? 190  ASP A CG  1 
ATOM   1466 O OD1 . ASP A 1 190 ? 2.933   71.601 31.937 1.00 33.57 ? 190  ASP A OD1 1 
ATOM   1467 O OD2 . ASP A 1 190 ? 4.841   72.618 32.017 1.00 33.30 ? 190  ASP A OD2 1 
ATOM   1468 N N   . PRO A 1 191 ? 0.496   71.083 33.911 1.00 32.11 ? 191  PRO A N   1 
ATOM   1469 C CA  . PRO A 1 191 ? 0.378   69.757 34.494 1.00 32.02 ? 191  PRO A CA  1 
ATOM   1470 C C   . PRO A 1 191 ? 1.566   68.834 34.202 1.00 32.43 ? 191  PRO A C   1 
ATOM   1471 O O   . PRO A 1 191 ? 1.678   67.771 34.790 1.00 31.91 ? 191  PRO A O   1 
ATOM   1472 C CB  . PRO A 1 191 ? -0.933  69.244 33.910 1.00 32.03 ? 191  PRO A CB  1 
ATOM   1473 C CG  . PRO A 1 191 ? -0.937  69.887 32.515 1.00 31.61 ? 191  PRO A CG  1 
ATOM   1474 C CD  . PRO A 1 191 ? -0.404  71.261 32.757 1.00 32.24 ? 191  PRO A CD  1 
ATOM   1475 N N   . LYS A 1 192 ? 2.466   69.225 33.305 1.00 32.80 ? 192  LYS A N   1 
ATOM   1476 C CA  . LYS A 1 192 ? 3.594   68.343 33.029 1.00 33.17 ? 192  LYS A CA  1 
ATOM   1477 C C   . LYS A 1 192 ? 4.763   68.702 33.916 1.00 32.43 ? 192  LYS A C   1 
ATOM   1478 O O   . LYS A 1 192 ? 5.818   68.048 33.879 1.00 31.98 ? 192  LYS A O   1 
ATOM   1479 C CB  . LYS A 1 192 ? 4.009   68.412 31.556 1.00 34.27 ? 192  LYS A CB  1 
ATOM   1480 C CG  . LYS A 1 192 ? 2.841   68.126 30.634 1.00 37.74 ? 192  LYS A CG  1 
ATOM   1481 C CD  . LYS A 1 192 ? 1.895   66.958 31.161 1.00 39.50 ? 192  LYS A CD  1 
ATOM   1482 C CE  . LYS A 1 192 ? 0.607   66.866 30.295 1.00 40.90 ? 192  LYS A CE  1 
ATOM   1483 N NZ  . LYS A 1 192 ? -0.659  66.434 31.002 1.00 41.40 ? 192  LYS A NZ  1 
ATOM   1484 N N   . THR A 1 193 ? 4.594   69.748 34.706 1.00 31.45 ? 193  THR A N   1 
ATOM   1485 C CA  . THR A 1 193 ? 5.700   70.100 35.571 1.00 31.25 ? 193  THR A CA  1 
ATOM   1486 C C   . THR A 1 193 ? 5.225   70.323 37.015 1.00 30.83 ? 193  THR A C   1 
ATOM   1487 O O   . THR A 1 193 ? 5.357   71.431 37.560 1.00 30.65 ? 193  THR A O   1 
ATOM   1488 C CB  . THR A 1 193 ? 6.431   71.328 34.990 1.00 31.26 ? 193  THR A CB  1 
ATOM   1489 O OG1 . THR A 1 193 ? 6.646   71.086 33.601 1.00 31.89 ? 193  THR A OG1 1 
ATOM   1490 C CG2 . THR A 1 193 ? 7.793   71.540 35.634 1.00 30.60 ? 193  THR A CG2 1 
ATOM   1491 N N   . VAL A 1 194 ? 4.615   69.276 37.582 1.00 30.22 ? 194  VAL A N   1 
ATOM   1492 C CA  . VAL A 1 194 ? 4.131   69.297 38.956 1.00 30.08 ? 194  VAL A CA  1 
ATOM   1493 C C   . VAL A 1 194 ? 5.100   68.570 39.882 1.00 29.62 ? 194  VAL A C   1 
ATOM   1494 O O   . VAL A 1 194 ? 5.515   67.448 39.613 1.00 29.73 ? 194  VAL A O   1 
ATOM   1495 C CB  . VAL A 1 194 ? 2.717   68.614 39.095 1.00 30.79 ? 194  VAL A CB  1 
ATOM   1496 C CG1 . VAL A 1 194 ? 2.698   67.374 38.332 1.00 32.48 ? 194  VAL A CG1 1 
ATOM   1497 C CG2 . VAL A 1 194 ? 2.416   68.215 40.546 1.00 29.80 ? 194  VAL A CG2 1 
ATOM   1498 N N   . THR A 1 195 ? 5.472   69.234 40.967 1.00 29.26 ? 195  THR A N   1 
ATOM   1499 C CA  . THR A 1 195 ? 6.337   68.648 41.962 1.00 28.59 ? 195  THR A CA  1 
ATOM   1500 C C   . THR A 1 195 ? 5.498   68.417 43.223 1.00 28.45 ? 195  THR A C   1 
ATOM   1501 O O   . THR A 1 195 ? 4.850   69.373 43.722 1.00 28.98 ? 195  THR A O   1 
ATOM   1502 C CB  . THR A 1 195 ? 7.486   69.599 42.348 1.00 28.79 ? 195  THR A CB  1 
ATOM   1503 O OG1 . THR A 1 195 ? 8.376   69.733 41.241 1.00 29.35 ? 195  THR A OG1 1 
ATOM   1504 C CG2 . THR A 1 195 ? 8.268   69.051 43.569 1.00 27.66 ? 195  THR A CG2 1 
ATOM   1505 N N   . ILE A 1 196 ? 5.439   67.180 43.727 1.00 27.71 ? 196  ILE A N   1 
ATOM   1506 C CA  . ILE A 1 196 ? 4.755   66.974 45.004 1.00 26.93 ? 196  ILE A CA  1 
ATOM   1507 C C   . ILE A 1 196 ? 5.827   67.136 46.100 1.00 26.74 ? 196  ILE A C   1 
ATOM   1508 O O   . ILE A 1 196 ? 6.995   66.791 45.908 1.00 26.63 ? 196  ILE A O   1 
ATOM   1509 C CB  . ILE A 1 196 ? 4.063   65.591 45.095 1.00 27.12 ? 196  ILE A CB  1 
ATOM   1510 C CG1 . ILE A 1 196 ? 5.045   64.452 44.848 1.00 26.58 ? 196  ILE A CG1 1 
ATOM   1511 C CG2 . ILE A 1 196 ? 2.917   65.536 44.095 1.00 26.89 ? 196  ILE A CG2 1 
ATOM   1512 C CD1 . ILE A 1 196 ? 4.364   63.115 44.999 1.00 26.23 ? 196  ILE A CD1 1 
ATOM   1513 N N   . PHE A 1 197 ? 5.480   67.768 47.211 1.00 26.69 ? 197  PHE A N   1 
ATOM   1514 C CA  . PHE A 1 197 ? 6.453   67.939 48.285 1.00 26.36 ? 197  PHE A CA  1 
ATOM   1515 C C   . PHE A 1 197 ? 5.711   67.899 49.596 1.00 26.32 ? 197  PHE A C   1 
ATOM   1516 O O   . PHE A 1 197 ? 4.560   68.296 49.665 1.00 26.83 ? 197  PHE A O   1 
ATOM   1517 C CB  . PHE A 1 197 ? 7.303   69.240 48.103 1.00 26.78 ? 197  PHE A CB  1 
ATOM   1518 C CG  . PHE A 1 197 ? 6.591   70.549 48.370 1.00 26.74 ? 197  PHE A CG  1 
ATOM   1519 C CD1 . PHE A 1 197 ? 5.442   70.916 47.669 1.00 27.60 ? 197  PHE A CD1 1 
ATOM   1520 C CD2 . PHE A 1 197 ? 7.161   71.480 49.250 1.00 27.60 ? 197  PHE A CD2 1 
ATOM   1521 C CE1 . PHE A 1 197 ? 4.868   72.195 47.835 1.00 27.56 ? 197  PHE A CE1 1 
ATOM   1522 C CE2 . PHE A 1 197 ? 6.607   72.770 49.445 1.00 27.56 ? 197  PHE A CE2 1 
ATOM   1523 C CZ  . PHE A 1 197 ? 5.463   73.136 48.741 1.00 28.29 ? 197  PHE A CZ  1 
ATOM   1524 N N   . GLY A 1 198 ? 6.349   67.395 50.641 1.00 26.19 ? 198  GLY A N   1 
ATOM   1525 C CA  . GLY A 1 198 ? 5.671   67.284 51.919 1.00 25.57 ? 198  GLY A CA  1 
ATOM   1526 C C   . GLY A 1 198 ? 6.639   66.990 53.038 1.00 25.38 ? 198  GLY A C   1 
ATOM   1527 O O   . GLY A 1 198 ? 7.780   66.649 52.785 1.00 25.05 ? 198  GLY A O   1 
ATOM   1528 N N   . GLU A 1 199 ? 6.188   67.153 54.276 1.00 25.40 ? 199  GLU A N   1 
ATOM   1529 C CA  . GLU A 1 199 ? 7.044   66.947 55.416 1.00 25.57 ? 199  GLU A CA  1 
ATOM   1530 C C   . GLU A 1 199 ? 6.562   65.811 56.312 1.00 25.55 ? 199  GLU A C   1 
ATOM   1531 O O   . GLU A 1 199 ? 5.363   65.662 56.503 1.00 25.93 ? 199  GLU A O   1 
ATOM   1532 C CB  . GLU A 1 199 ? 7.158   68.272 56.215 1.00 25.25 ? 199  GLU A CB  1 
ATOM   1533 C CG  . GLU A 1 199 ? 8.138   68.224 57.360 1.00 25.36 ? 199  GLU A CG  1 
ATOM   1534 C CD  . GLU A 1 199 ? 7.480   67.835 58.686 1.00 26.40 ? 199  GLU A CD  1 
ATOM   1535 O OE1 . GLU A 1 199 ? 6.238   67.669 58.710 1.00 26.87 ? 199  GLU A OE1 1 
ATOM   1536 O OE2 . GLU A 1 199 ? 8.193   67.684 59.717 1.00 26.66 ? 199  GLU A OE2 1 
ATOM   1537 N N   . SER A 1 200 ? 7.506   65.033 56.854 1.00 25.32 ? 200  SER A N   1 
ATOM   1538 C CA  . SER A 1 200 ? 7.219   63.922 57.787 1.00 25.43 ? 200  SER A CA  1 
ATOM   1539 C C   . SER A 1 200 ? 6.224   62.931 57.096 1.00 25.10 ? 200  SER A C   1 
ATOM   1540 O O   . SER A 1 200 ? 6.553   62.440 56.012 1.00 25.31 ? 200  SER A O   1 
ATOM   1541 C CB  . SER A 1 200 ? 6.688   64.532 59.087 1.00 25.77 ? 200  SER A CB  1 
ATOM   1542 O OG  . SER A 1 200 ? 6.575   63.616 60.173 1.00 25.74 ? 200  SER A OG  1 
ATOM   1543 N N   . ALA A 1 201 ? 5.060   62.622 57.673 1.00 24.30 ? 201  ALA A N   1 
ATOM   1544 C CA  . ALA A 1 201 ? 4.131   61.734 56.976 1.00 24.22 ? 201  ALA A CA  1 
ATOM   1545 C C   . ALA A 1 201 ? 3.857   62.223 55.520 1.00 24.20 ? 201  ALA A C   1 
ATOM   1546 O O   . ALA A 1 201 ? 3.580   61.403 54.632 1.00 24.39 ? 201  ALA A O   1 
ATOM   1547 C CB  . ALA A 1 201 ? 2.774   61.584 57.775 1.00 23.29 ? 201  ALA A CB  1 
ATOM   1548 N N   . GLY A 1 202 ? 3.922   63.545 55.291 1.00 24.25 ? 202  GLY A N   1 
ATOM   1549 C CA  . GLY A 1 202 ? 3.711   64.107 53.971 1.00 24.17 ? 202  GLY A CA  1 
ATOM   1550 C C   . GLY A 1 202 ? 4.903   63.754 53.095 1.00 24.95 ? 202  GLY A C   1 
ATOM   1551 O O   . GLY A 1 202 ? 4.738   63.498 51.886 1.00 25.00 ? 202  GLY A O   1 
ATOM   1552 N N   . GLY A 1 203 ? 6.102   63.727 53.684 1.00 24.79 ? 203  GLY A N   1 
ATOM   1553 C CA  . GLY A 1 203 ? 7.267   63.325 52.920 1.00 25.19 ? 203  GLY A CA  1 
ATOM   1554 C C   . GLY A 1 203 ? 7.226   61.806 52.657 1.00 25.68 ? 203  GLY A C   1 
ATOM   1555 O O   . GLY A 1 203 ? 7.614   61.349 51.584 1.00 26.15 ? 203  GLY A O   1 
ATOM   1556 N N   . ALA A 1 204 ? 6.782   61.015 53.632 1.00 25.85 ? 204  ALA A N   1 
ATOM   1557 C CA  . ALA A 1 204 ? 6.652   59.555 53.449 1.00 26.14 ? 204  ALA A CA  1 
ATOM   1558 C C   . ALA A 1 204 ? 5.580   59.319 52.314 1.00 26.13 ? 204  ALA A C   1 
ATOM   1559 O O   . ALA A 1 204 ? 5.792   58.477 51.401 1.00 26.17 ? 204  ALA A O   1 
ATOM   1560 C CB  . ALA A 1 204 ? 6.195   58.873 54.796 1.00 25.69 ? 204  ALA A CB  1 
ATOM   1561 N N   . SER A 1 205 ? 4.469   60.071 52.376 1.00 25.47 ? 205  SER A N   1 
ATOM   1562 C CA  . SER A 1 205 ? 3.429   59.986 51.345 1.00 25.54 ? 205  SER A CA  1 
ATOM   1563 C C   . SER A 1 205 ? 4.053   60.256 49.960 1.00 25.27 ? 205  SER A C   1 
ATOM   1564 O O   . SER A 1 205 ? 3.774   59.520 48.998 1.00 25.59 ? 205  SER A O   1 
ATOM   1565 C CB  . SER A 1 205 ? 2.297   61.019 51.581 1.00 25.04 ? 205  SER A CB  1 
ATOM   1566 O OG  . SER A 1 205 ? 1.472   60.671 52.674 1.00 24.83 ? 205  SER A OG  1 
ATOM   1567 N N   . VAL A 1 206 ? 4.865   61.320 49.858 1.00 24.78 ? 206  VAL A N   1 
ATOM   1568 C CA  . VAL A 1 206 ? 5.517   61.628 48.599 1.00 24.28 ? 206  VAL A CA  1 
ATOM   1569 C C   . VAL A 1 206 ? 6.277   60.381 48.085 1.00 24.63 ? 206  VAL A C   1 
ATOM   1570 O O   . VAL A 1 206 ? 6.140   60.004 46.921 1.00 25.27 ? 206  VAL A O   1 
ATOM   1571 C CB  . VAL A 1 206 ? 6.492   62.861 48.713 1.00 23.92 ? 206  VAL A CB  1 
ATOM   1572 C CG1 . VAL A 1 206 ? 7.417   62.930 47.490 1.00 23.19 ? 206  VAL A CG1 1 
ATOM   1573 C CG2 . VAL A 1 206 ? 5.656   64.222 48.755 1.00 23.35 ? 206  VAL A CG2 1 
ATOM   1574 N N   . GLY A 1 207 ? 7.059   59.754 48.941 1.00 24.13 ? 207  GLY A N   1 
ATOM   1575 C CA  . GLY A 1 207 ? 7.814   58.579 48.547 1.00 24.32 ? 207  GLY A CA  1 
ATOM   1576 C C   . GLY A 1 207 ? 6.899   57.417 48.182 1.00 24.45 ? 207  GLY A C   1 
ATOM   1577 O O   . GLY A 1 207 ? 7.230   56.603 47.295 1.00 24.29 ? 207  GLY A O   1 
ATOM   1578 N N   . MET A 1 208 ? 5.744   57.352 48.848 1.00 24.39 ? 208  MET A N   1 
ATOM   1579 C CA  . MET A 1 208 ? 4.782   56.316 48.538 1.00 24.83 ? 208  MET A CA  1 
ATOM   1580 C C   . MET A 1 208 ? 4.194   56.500 47.119 1.00 25.53 ? 208  MET A C   1 
ATOM   1581 O O   . MET A 1 208 ? 3.912   55.525 46.419 1.00 25.61 ? 208  MET A O   1 
ATOM   1582 C CB  . MET A 1 208 ? 3.691   56.275 49.610 1.00 24.26 ? 208  MET A CB  1 
ATOM   1583 C CG  . MET A 1 208 ? 4.211   55.628 50.913 1.00 24.21 ? 208  MET A CG  1 
ATOM   1584 S SD  . MET A 1 208 ? 3.165   55.928 52.324 1.00 25.04 ? 208  MET A SD  1 
ATOM   1585 C CE  . MET A 1 208 ? 3.880   54.870 53.591 1.00 23.94 ? 208  MET A CE  1 
ATOM   1586 N N   . HIS A 1 209 ? 4.040   57.737 46.675 1.00 26.20 ? 209  HIS A N   1 
ATOM   1587 C CA  . HIS A 1 209 ? 3.485   57.960 45.349 1.00 26.95 ? 209  HIS A CA  1 
ATOM   1588 C C   . HIS A 1 209 ? 4.545   57.683 44.328 1.00 27.58 ? 209  HIS A C   1 
ATOM   1589 O O   . HIS A 1 209 ? 4.230   57.343 43.162 1.00 27.97 ? 209  HIS A O   1 
ATOM   1590 C CB  . HIS A 1 209 ? 2.970   59.392 45.205 1.00 27.14 ? 209  HIS A CB  1 
ATOM   1591 C CG  . HIS A 1 209 ? 1.717   59.640 45.983 1.00 28.30 ? 209  HIS A CG  1 
ATOM   1592 N ND1 . HIS A 1 209 ? 0.554   58.935 45.753 1.00 28.20 ? 209  HIS A ND1 1 
ATOM   1593 C CD2 . HIS A 1 209 ? 1.457   60.478 47.021 1.00 28.08 ? 209  HIS A CD2 1 
ATOM   1594 C CE1 . HIS A 1 209 ? -0.372  59.329 46.607 1.00 28.29 ? 209  HIS A CE1 1 
ATOM   1595 N NE2 . HIS A 1 209 ? 0.151   60.263 47.387 1.00 28.52 ? 209  HIS A NE2 1 
ATOM   1596 N N   . ILE A 1 210 ? 5.811   57.832 44.748 1.00 27.66 ? 210  ILE A N   1 
ATOM   1597 C CA  . ILE A 1 210 ? 6.926   57.530 43.834 1.00 27.87 ? 210  ILE A CA  1 
ATOM   1598 C C   . ILE A 1 210 ? 6.964   56.004 43.626 1.00 27.97 ? 210  ILE A C   1 
ATOM   1599 O O   . ILE A 1 210 ? 7.273   55.520 42.543 1.00 27.79 ? 210  ILE A O   1 
ATOM   1600 C CB  . ILE A 1 210 ? 8.246   57.948 44.462 1.00 28.00 ? 210  ILE A CB  1 
ATOM   1601 C CG1 . ILE A 1 210 ? 8.406   59.457 44.323 1.00 27.36 ? 210  ILE A CG1 1 
ATOM   1602 C CG2 . ILE A 1 210 ? 9.444   57.101 43.842 1.00 27.51 ? 210  ILE A CG2 1 
ATOM   1603 C CD1 . ILE A 1 210 ? 9.580   59.919 45.080 1.00 27.55 ? 210  ILE A CD1 1 
ATOM   1604 N N   . LEU A 1 211 ? 6.638   55.266 44.688 1.00 27.85 ? 211  LEU A N   1 
ATOM   1605 C CA  . LEU A 1 211 ? 6.663   53.822 44.631 1.00 28.54 ? 211  LEU A CA  1 
ATOM   1606 C C   . LEU A 1 211 ? 5.460   53.227 43.936 1.00 28.52 ? 211  LEU A C   1 
ATOM   1607 O O   . LEU A 1 211 ? 5.602   52.416 43.047 1.00 28.62 ? 211  LEU A O   1 
ATOM   1608 C CB  . LEU A 1 211 ? 6.749   53.204 46.031 1.00 28.28 ? 211  LEU A CB  1 
ATOM   1609 C CG  . LEU A 1 211 ? 8.102   53.401 46.722 1.00 29.33 ? 211  LEU A CG  1 
ATOM   1610 C CD1 . LEU A 1 211 ? 7.930   53.238 48.219 1.00 29.11 ? 211  LEU A CD1 1 
ATOM   1611 C CD2 . LEU A 1 211 ? 9.069   52.390 46.246 1.00 29.93 ? 211  LEU A CD2 1 
ATOM   1612 N N   . SER A 1 212 ? 4.285   53.655 44.340 1.00 28.89 ? 212  SER A N   1 
ATOM   1613 C CA  . SER A 1 212 ? 3.041   53.115 43.825 1.00 29.20 ? 212  SER A CA  1 
ATOM   1614 C C   . SER A 1 212 ? 2.775   53.336 42.365 1.00 29.19 ? 212  SER A C   1 
ATOM   1615 O O   . SER A 1 212 ? 2.587   54.474 41.941 1.00 29.74 ? 212  SER A O   1 
ATOM   1616 C CB  . SER A 1 212 ? 1.877   53.681 44.632 1.00 29.53 ? 212  SER A CB  1 
ATOM   1617 O OG  . SER A 1 212 ? 0.660   53.098 44.232 1.00 29.44 ? 212  SER A OG  1 
ATOM   1618 N N   . PRO A 1 213 ? 2.740   52.245 41.580 1.00 29.12 ? 213  PRO A N   1 
ATOM   1619 C CA  . PRO A 1 213 ? 2.484   52.285 40.126 1.00 29.49 ? 213  PRO A CA  1 
ATOM   1620 C C   . PRO A 1 213 ? 1.285   53.174 39.758 1.00 29.25 ? 213  PRO A C   1 
ATOM   1621 O O   . PRO A 1 213 ? 1.335   53.895 38.776 1.00 29.33 ? 213  PRO A O   1 
ATOM   1622 C CB  . PRO A 1 213 ? 2.196   50.814 39.765 1.00 29.54 ? 213  PRO A CB  1 
ATOM   1623 C CG  . PRO A 1 213 ? 3.026   50.046 40.825 1.00 30.09 ? 213  PRO A CG  1 
ATOM   1624 C CD  . PRO A 1 213 ? 2.852   50.865 42.086 1.00 28.86 ? 213  PRO A CD  1 
ATOM   1625 N N   . GLY A 1 214 ? 0.219   53.114 40.552 1.00 29.28 ? 214  GLY A N   1 
ATOM   1626 C CA  . GLY A 1 214 ? -0.974  53.895 40.247 1.00 29.31 ? 214  GLY A CA  1 
ATOM   1627 C C   . GLY A 1 214 ? -0.850  55.384 40.476 1.00 29.98 ? 214  GLY A C   1 
ATOM   1628 O O   . GLY A 1 214 ? -1.746  56.128 40.095 1.00 29.93 ? 214  GLY A O   1 
ATOM   1629 N N   . SER A 1 215 ? 0.253   55.850 41.075 1.00 29.63 ? 215  SER A N   1 
ATOM   1630 C CA  . SER A 1 215 ? 0.389   57.275 41.313 1.00 29.51 ? 215  SER A CA  1 
ATOM   1631 C C   . SER A 1 215 ? 1.469   57.916 40.458 1.00 29.71 ? 215  SER A C   1 
ATOM   1632 O O   . SER A 1 215 ? 1.421   59.111 40.198 1.00 29.18 ? 215  SER A O   1 
ATOM   1633 C CB  . SER A 1 215 ? 0.750   57.535 42.800 1.00 29.53 ? 215  SER A CB  1 
ATOM   1634 O OG  . SER A 1 215 ? -0.310  57.230 43.675 1.00 29.60 ? 215  SER A OG  1 
ATOM   1635 N N   . ARG A 1 216 ? 2.449   57.117 40.032 1.00 29.99 ? 216  ARG A N   1 
ATOM   1636 C CA  . ARG A 1 216 ? 3.602   57.634 39.302 1.00 30.72 ? 216  ARG A CA  1 
ATOM   1637 C C   . ARG A 1 216 ? 3.374   58.612 38.180 1.00 30.94 ? 216  ARG A C   1 
ATOM   1638 O O   . ARG A 1 216 ? 4.086   59.626 38.067 1.00 31.01 ? 216  ARG A O   1 
ATOM   1639 C CB  . ARG A 1 216 ? 4.439   56.489 38.725 1.00 31.38 ? 216  ARG A CB  1 
ATOM   1640 C CG  . ARG A 1 216 ? 4.830   55.446 39.752 1.00 32.29 ? 216  ARG A CG  1 
ATOM   1641 C CD  . ARG A 1 216 ? 5.674   54.355 39.141 1.00 32.13 ? 216  ARG A CD  1 
ATOM   1642 N NE  . ARG A 1 216 ? 5.906   53.290 40.109 1.00 31.98 ? 216  ARG A NE  1 
ATOM   1643 C CZ  . ARG A 1 216 ? 6.426   52.103 39.800 1.00 31.78 ? 216  ARG A CZ  1 
ATOM   1644 N NH1 . ARG A 1 216 ? 6.764   51.825 38.535 1.00 31.54 ? 216  ARG A NH1 1 
ATOM   1645 N NH2 . ARG A 1 216 ? 6.608   51.199 40.750 1.00 31.11 ? 216  ARG A NH2 1 
ATOM   1646 N N   . ASP A 1 217 ? 2.370   58.328 37.366 1.00 30.96 ? 217  ASP A N   1 
ATOM   1647 C CA  . ASP A 1 217 ? 2.147   59.153 36.184 1.00 31.03 ? 217  ASP A CA  1 
ATOM   1648 C C   . ASP A 1 217 ? 1.557   60.504 36.500 1.00 31.00 ? 217  ASP A C   1 
ATOM   1649 O O   . ASP A 1 217 ? 1.562   61.342 35.648 1.00 31.35 ? 217  ASP A O   1 
ATOM   1650 C CB  . ASP A 1 217 ? 1.242   58.434 35.164 1.00 30.16 ? 217  ASP A CB  1 
ATOM   1651 C CG  . ASP A 1 217 ? 1.749   57.013 34.792 1.00 30.61 ? 217  ASP A CG  1 
ATOM   1652 O OD1 . ASP A 1 217 ? 2.794   56.545 35.299 1.00 30.74 ? 217  ASP A OD1 1 
ATOM   1653 O OD2 . ASP A 1 217 ? 1.078   56.339 33.996 1.00 30.97 ? 217  ASP A OD2 1 
ATOM   1654 N N   . LEU A 1 218 ? 1.092   60.728 37.723 1.00 30.87 ? 218  LEU A N   1 
ATOM   1655 C CA  . LEU A 1 218 ? 0.463   61.993 38.027 1.00 30.74 ? 218  LEU A CA  1 
ATOM   1656 C C   . LEU A 1 218 ? 1.366   63.148 38.461 1.00 30.93 ? 218  LEU A C   1 
ATOM   1657 O O   . LEU A 1 218 ? 0.846   64.219 38.841 1.00 31.27 ? 218  LEU A O   1 
ATOM   1658 C CB  . LEU A 1 218 ? -0.606  61.796 39.080 1.00 30.91 ? 218  LEU A CB  1 
ATOM   1659 C CG  . LEU A 1 218 ? -1.638  60.737 38.699 1.00 31.67 ? 218  LEU A CG  1 
ATOM   1660 C CD1 . LEU A 1 218 ? -2.531  60.515 39.916 1.00 31.98 ? 218  LEU A CD1 1 
ATOM   1661 C CD2 . LEU A 1 218 ? -2.467  61.144 37.476 1.00 31.87 ? 218  LEU A CD2 1 
ATOM   1662 N N   . PHE A 1 219 ? 2.691   62.983 38.428 1.00 29.83 ? 219  PHE A N   1 
ATOM   1663 C CA  . PHE A 1 219 ? 3.533   64.092 38.843 1.00 29.05 ? 219  PHE A CA  1 
ATOM   1664 C C   . PHE A 1 219 ? 4.914   63.967 38.197 1.00 29.09 ? 219  PHE A C   1 
ATOM   1665 O O   . PHE A 1 219 ? 5.297   62.906 37.709 1.00 27.92 ? 219  PHE A O   1 
ATOM   1666 C CB  . PHE A 1 219 ? 3.592   64.165 40.388 1.00 28.68 ? 219  PHE A CB  1 
ATOM   1667 C CG  . PHE A 1 219 ? 4.342   63.018 41.035 1.00 28.12 ? 219  PHE A CG  1 
ATOM   1668 C CD1 . PHE A 1 219 ? 3.698   61.792 41.301 1.00 28.23 ? 219  PHE A CD1 1 
ATOM   1669 C CD2 . PHE A 1 219 ? 5.707   63.125 41.295 1.00 27.33 ? 219  PHE A CD2 1 
ATOM   1670 C CE1 . PHE A 1 219 ? 4.421   60.686 41.809 1.00 28.01 ? 219  PHE A CE1 1 
ATOM   1671 C CE2 . PHE A 1 219 ? 6.436   62.011 41.802 1.00 27.59 ? 219  PHE A CE2 1 
ATOM   1672 C CZ  . PHE A 1 219 ? 5.786   60.799 42.051 1.00 27.54 ? 219  PHE A CZ  1 
ATOM   1673 N N   . ARG A 1 220 ? 5.658   65.056 38.183 1.00 29.15 ? 220  ARG A N   1 
ATOM   1674 C CA  . ARG A 1 220 ? 6.944   65.050 37.517 1.00 29.59 ? 220  ARG A CA  1 
ATOM   1675 C C   . ARG A 1 220 ? 8.133   64.751 38.444 1.00 29.78 ? 220  ARG A C   1 
ATOM   1676 O O   . ARG A 1 220 ? 8.999   63.937 38.115 1.00 29.37 ? 220  ARG A O   1 
ATOM   1677 C CB  . ARG A 1 220 ? 7.125   66.418 36.847 1.00 30.19 ? 220  ARG A CB  1 
ATOM   1678 C CG  . ARG A 1 220 ? 8.440   66.667 36.186 1.00 31.56 ? 220  ARG A CG  1 
ATOM   1679 C CD  . ARG A 1 220 ? 8.535   65.881 34.936 1.00 34.11 ? 220  ARG A CD  1 
ATOM   1680 N NE  . ARG A 1 220 ? 9.620   66.347 34.053 1.00 36.10 ? 220  ARG A NE  1 
ATOM   1681 C CZ  . ARG A 1 220 ? 9.487   67.240 33.068 1.00 36.76 ? 220  ARG A CZ  1 
ATOM   1682 N NH1 . ARG A 1 220 ? 8.306   67.830 32.801 1.00 36.94 ? 220  ARG A NH1 1 
ATOM   1683 N NH2 . ARG A 1 220 ? 10.532  67.466 32.277 1.00 37.30 ? 220  ARG A NH2 1 
ATOM   1684 N N   . ARG A 1 221 ? 8.201   65.462 39.569 1.00 29.32 ? 221  ARG A N   1 
ATOM   1685 C CA  . ARG A 1 221 ? 9.268   65.259 40.521 1.00 29.24 ? 221  ARG A CA  1 
ATOM   1686 C C   . ARG A 1 221 ? 8.843   65.438 41.935 1.00 28.73 ? 221  ARG A C   1 
ATOM   1687 O O   . ARG A 1 221 ? 7.698   65.799 42.205 1.00 27.98 ? 221  ARG A O   1 
ATOM   1688 C CB  . ARG A 1 221 ? 10.512  66.085 40.234 1.00 30.38 ? 221  ARG A CB  1 
ATOM   1689 C CG  . ARG A 1 221 ? 10.394  67.451 39.675 1.00 31.62 ? 221  ARG A CG  1 
ATOM   1690 C CD  . ARG A 1 221 ? 11.745  67.718 38.914 1.00 32.87 ? 221  ARG A CD  1 
ATOM   1691 N NE  . ARG A 1 221 ? 11.544  68.836 38.043 1.00 34.84 ? 221  ARG A NE  1 
ATOM   1692 C CZ  . ARG A 1 221 ? 11.772  68.864 36.740 1.00 35.43 ? 221  ARG A CZ  1 
ATOM   1693 N NH1 . ARG A 1 221 ? 12.264  67.833 36.076 1.00 35.50 ? 221  ARG A NH1 1 
ATOM   1694 N NH2 . ARG A 1 221 ? 11.362  69.920 36.077 1.00 36.09 ? 221  ARG A NH2 1 
ATOM   1695 N N   . ALA A 1 222 ? 9.787   65.210 42.845 1.00 28.38 ? 222  ALA A N   1 
ATOM   1696 C CA  . ALA A 1 222 ? 9.429   65.162 44.257 1.00 28.13 ? 222  ALA A CA  1 
ATOM   1697 C C   . ALA A 1 222 ? 10.441  65.672 45.240 1.00 28.08 ? 222  ALA A C   1 
ATOM   1698 O O   . ALA A 1 222 ? 11.658  65.580 45.026 1.00 28.13 ? 222  ALA A O   1 
ATOM   1699 C CB  . ALA A 1 222 ? 9.067   63.703 44.615 1.00 27.50 ? 222  ALA A CB  1 
ATOM   1700 N N   . ILE A 1 223 ? 9.889   66.204 46.322 1.00 27.66 ? 223  ILE A N   1 
ATOM   1701 C CA  . ILE A 1 223 ? 10.645  66.761 47.436 1.00 27.23 ? 223  ILE A CA  1 
ATOM   1702 C C   . ILE A 1 223 ? 10.086  66.122 48.705 1.00 26.52 ? 223  ILE A C   1 
ATOM   1703 O O   . ILE A 1 223 ? 8.868   66.130 48.931 1.00 26.37 ? 223  ILE A O   1 
ATOM   1704 C CB  . ILE A 1 223 ? 10.453  68.288 47.507 1.00 27.24 ? 223  ILE A CB  1 
ATOM   1705 C CG1 . ILE A 1 223 ? 11.146  68.969 46.310 1.00 27.63 ? 223  ILE A CG1 1 
ATOM   1706 C CG2 . ILE A 1 223 ? 11.011  68.846 48.827 1.00 27.57 ? 223  ILE A CG2 1 
ATOM   1707 C CD1 . ILE A 1 223 ? 10.708  70.503 46.224 1.00 27.35 ? 223  ILE A CD1 1 
ATOM   1708 N N   . LEU A 1 224 ? 10.978  65.559 49.508 1.00 26.16 ? 224  LEU A N   1 
ATOM   1709 C CA  . LEU A 1 224 ? 10.615  64.913 50.752 1.00 26.09 ? 224  LEU A CA  1 
ATOM   1710 C C   . LEU A 1 224 ? 11.390  65.567 51.896 1.00 26.36 ? 224  LEU A C   1 
ATOM   1711 O O   . LEU A 1 224 ? 12.640  65.564 51.908 1.00 26.59 ? 224  LEU A O   1 
ATOM   1712 C CB  . LEU A 1 224 ? 10.960  63.409 50.695 1.00 26.09 ? 224  LEU A CB  1 
ATOM   1713 C CG  . LEU A 1 224 ? 10.385  62.500 49.565 1.00 25.80 ? 224  LEU A CG  1 
ATOM   1714 C CD1 . LEU A 1 224 ? 11.134  62.702 48.251 1.00 25.03 ? 224  LEU A CD1 1 
ATOM   1715 C CD2 . LEU A 1 224 ? 10.482  61.041 50.002 1.00 25.46 ? 224  LEU A CD2 1 
ATOM   1716 N N   . GLN A 1 225 ? 10.657  66.133 52.853 1.00 26.29 ? 225  GLN A N   1 
ATOM   1717 C CA  . GLN A 1 225 ? 11.251  66.791 54.039 1.00 25.90 ? 225  GLN A CA  1 
ATOM   1718 C C   . GLN A 1 225 ? 10.958  65.947 55.306 1.00 25.72 ? 225  GLN A C   1 
ATOM   1719 O O   . GLN A 1 225 ? 9.794   65.708 55.684 1.00 24.93 ? 225  GLN A O   1 
ATOM   1720 C CB  . GLN A 1 225 ? 10.650  68.201 54.221 1.00 25.83 ? 225  GLN A CB  1 
ATOM   1721 C CG  . GLN A 1 225 ? 10.903  69.123 52.989 1.00 26.98 ? 225  GLN A CG  1 
ATOM   1722 C CD  . GLN A 1 225 ? 10.021  70.380 52.940 1.00 27.90 ? 225  GLN A CD  1 
ATOM   1723 O OE1 . GLN A 1 225 ? 9.658   70.853 51.863 1.00 28.47 ? 225  GLN A OE1 1 
ATOM   1724 N NE2 . GLN A 1 225 ? 9.684   70.925 54.103 1.00 28.20 ? 225  GLN A NE2 1 
ATOM   1725 N N   . SER A 1 226 ? 12.041  65.441 55.898 1.00 25.64 ? 226  SER A N   1 
ATOM   1726 C CA  . SER A 1 226 ? 11.989  64.719 57.155 1.00 24.84 ? 226  SER A CA  1 
ATOM   1727 C C   . SER A 1 226 ? 11.060  63.540 57.119 1.00 24.48 ? 226  SER A C   1 
ATOM   1728 O O   . SER A 1 226 ? 10.321  63.303 58.056 1.00 23.96 ? 226  SER A O   1 
ATOM   1729 C CB  . SER A 1 226 ? 11.571  65.717 58.285 1.00 25.24 ? 226  SER A CB  1 
ATOM   1730 O OG  . SER A 1 226 ? 12.489  66.828 58.420 1.00 23.66 ? 226  SER A OG  1 
ATOM   1731 N N   . GLY A 1 227 ? 11.045  62.821 56.014 1.00 24.25 ? 227  GLY A N   1 
ATOM   1732 C CA  . GLY A 1 227 ? 10.186  61.658 55.970 1.00 24.20 ? 227  GLY A CA  1 
ATOM   1733 C C   . GLY A 1 227 ? 10.505  60.885 54.737 1.00 24.43 ? 227  GLY A C   1 
ATOM   1734 O O   . GLY A 1 227 ? 10.963  61.470 53.775 1.00 24.89 ? 227  GLY A O   1 
ATOM   1735 N N   . SER A 1 228 ? 10.306  59.576 54.769 1.00 24.71 ? 228  SER A N   1 
ATOM   1736 C CA  . SER A 1 228 ? 10.554  58.749 53.618 1.00 24.85 ? 228  SER A CA  1 
ATOM   1737 C C   . SER A 1 228 ? 9.601   57.572 53.769 1.00 25.01 ? 228  SER A C   1 
ATOM   1738 O O   . SER A 1 228 ? 9.189   57.225 54.870 1.00 24.92 ? 228  SER A O   1 
ATOM   1739 C CB  . SER A 1 228 ? 12.029  58.349 53.456 1.00 24.35 ? 228  SER A CB  1 
ATOM   1740 O OG  . SER A 1 228 ? 12.475  57.584 54.510 1.00 25.39 ? 228  SER A OG  1 
ATOM   1741 N N   . PRO A 1 229 ? 9.253   56.941 52.645 1.00 25.17 ? 229  PRO A N   1 
ATOM   1742 C CA  . PRO A 1 229 ? 8.300   55.836 52.679 1.00 25.59 ? 229  PRO A CA  1 
ATOM   1743 C C   . PRO A 1 229 ? 8.566   54.627 53.540 1.00 25.88 ? 229  PRO A C   1 
ATOM   1744 O O   . PRO A 1 229 ? 7.633   54.060 54.083 1.00 25.99 ? 229  PRO A O   1 
ATOM   1745 C CB  . PRO A 1 229 ? 8.069   55.526 51.185 1.00 25.48 ? 229  PRO A CB  1 
ATOM   1746 C CG  . PRO A 1 229 ? 9.460   55.838 50.559 1.00 25.23 ? 229  PRO A CG  1 
ATOM   1747 C CD  . PRO A 1 229 ? 9.965   57.049 51.351 1.00 24.50 ? 229  PRO A CD  1 
ATOM   1748 N N   . ASN A 1 230 ? 9.833   54.290 53.705 1.00 26.49 ? 230  ASN A N   1 
ATOM   1749 C CA  . ASN A 1 230 ? 10.276  53.150 54.479 1.00 26.68 ? 230  ASN A CA  1 
ATOM   1750 C C   . ASN A 1 230 ? 10.423  53.457 55.948 1.00 27.01 ? 230  ASN A C   1 
ATOM   1751 O O   . ASN A 1 230 ? 10.969  52.627 56.662 1.00 26.72 ? 230  ASN A O   1 
ATOM   1752 C CB  . ASN A 1 230 ? 11.650  52.670 53.951 1.00 27.61 ? 230  ASN A CB  1 
ATOM   1753 C CG  . ASN A 1 230 ? 12.686  53.815 53.929 1.00 28.42 ? 230  ASN A CG  1 
ATOM   1754 O OD1 . ASN A 1 230 ? 12.376  54.944 53.498 1.00 29.10 ? 230  ASN A OD1 1 
ATOM   1755 N ND2 . ASN A 1 230 ? 13.893  53.543 54.400 1.00 28.57 ? 230  ASN A ND2 1 
ATOM   1756 N N   . CYS A 1 231 ? 9.989   54.636 56.416 1.00 26.72 ? 231  CYS A N   1 
ATOM   1757 C CA  . CYS A 1 231 ? 10.105  54.921 57.845 1.00 26.87 ? 231  CYS A CA  1 
ATOM   1758 C C   . CYS A 1 231 ? 9.344   53.829 58.649 1.00 27.24 ? 231  CYS A C   1 
ATOM   1759 O O   . CYS A 1 231 ? 8.269   53.385 58.222 1.00 27.39 ? 231  CYS A O   1 
ATOM   1760 C CB  . CYS A 1 231 ? 9.529   56.308 58.180 1.00 26.56 ? 231  CYS A CB  1 
ATOM   1761 S SG  . CYS A 1 231 ? 10.601  57.680 57.683 1.00 25.85 ? 231  CYS A SG  1 
ATOM   1762 N N   . PRO A 1 232 ? 9.900   53.393 59.804 1.00 27.02 ? 232  PRO A N   1 
ATOM   1763 C CA  . PRO A 1 232 ? 9.313   52.352 60.678 1.00 26.60 ? 232  PRO A CA  1 
ATOM   1764 C C   . PRO A 1 232 ? 7.939   52.644 61.207 1.00 26.82 ? 232  PRO A C   1 
ATOM   1765 O O   . PRO A 1 232 ? 7.217   51.726 61.581 1.00 26.97 ? 232  PRO A O   1 
ATOM   1766 C CB  . PRO A 1 232 ? 10.352  52.183 61.801 1.00 26.07 ? 232  PRO A CB  1 
ATOM   1767 C CG  . PRO A 1 232 ? 10.980  53.601 61.936 1.00 26.32 ? 232  PRO A CG  1 
ATOM   1768 C CD  . PRO A 1 232 ? 11.104  54.010 60.425 1.00 26.81 ? 232  PRO A CD  1 
ATOM   1769 N N   . TRP A 1 233 ? 7.565   53.921 61.252 1.00 26.62 ? 233  TRP A N   1 
ATOM   1770 C CA  . TRP A 1 233 ? 6.237   54.326 61.721 1.00 26.37 ? 233  TRP A CA  1 
ATOM   1771 C C   . TRP A 1 233 ? 5.240   54.593 60.563 1.00 27.14 ? 233  TRP A C   1 
ATOM   1772 O O   . TRP A 1 233 ? 4.046   54.843 60.829 1.00 27.86 ? 233  TRP A O   1 
ATOM   1773 C CB  . TRP A 1 233 ? 6.335   55.637 62.487 1.00 25.24 ? 233  TRP A CB  1 
ATOM   1774 C CG  . TRP A 1 233 ? 7.143   56.667 61.725 1.00 24.42 ? 233  TRP A CG  1 
ATOM   1775 C CD1 . TRP A 1 233 ? 8.515   56.895 61.830 1.00 23.89 ? 233  TRP A CD1 1 
ATOM   1776 C CD2 . TRP A 1 233 ? 6.665   57.591 60.741 1.00 23.84 ? 233  TRP A CD2 1 
ATOM   1777 N NE1 . TRP A 1 233 ? 8.888   57.913 60.984 1.00 24.13 ? 233  TRP A NE1 1 
ATOM   1778 C CE2 . TRP A 1 233 ? 7.790   58.359 60.301 1.00 23.43 ? 233  TRP A CE2 1 
ATOM   1779 C CE3 . TRP A 1 233 ? 5.398   57.858 60.189 1.00 24.07 ? 233  TRP A CE3 1 
ATOM   1780 C CZ2 . TRP A 1 233 ? 7.686   59.378 59.334 1.00 23.77 ? 233  TRP A CZ2 1 
ATOM   1781 C CZ3 . TRP A 1 233 ? 5.283   58.902 59.210 1.00 23.75 ? 233  TRP A CZ3 1 
ATOM   1782 C CH2 . TRP A 1 233 ? 6.427   59.644 58.797 1.00 24.12 ? 233  TRP A CH2 1 
ATOM   1783 N N   . ALA A 1 234 ? 5.716   54.584 59.316 1.00 26.75 ? 234  ALA A N   1 
ATOM   1784 C CA  . ALA A 1 234 ? 4.881   54.905 58.159 1.00 27.28 ? 234  ALA A CA  1 
ATOM   1785 C C   . ALA A 1 234 ? 3.985   53.814 57.543 1.00 27.68 ? 234  ALA A C   1 
ATOM   1786 O O   . ALA A 1 234 ? 3.158   54.108 56.686 1.00 27.61 ? 234  ALA A O   1 
ATOM   1787 C CB  . ALA A 1 234 ? 5.767   55.519 57.045 1.00 26.30 ? 234  ALA A CB  1 
ATOM   1788 N N   . SER A 1 235 ? 4.176   52.555 57.921 1.00 28.05 ? 235  SER A N   1 
ATOM   1789 C CA  . SER A 1 235 ? 3.333   51.505 57.365 1.00 28.15 ? 235  SER A CA  1 
ATOM   1790 C C   . SER A 1 235 ? 3.272   50.323 58.303 1.00 28.59 ? 235  SER A C   1 
ATOM   1791 O O   . SER A 1 235 ? 4.032   50.257 59.265 1.00 28.68 ? 235  SER A O   1 
ATOM   1792 C CB  . SER A 1 235 ? 3.823   51.059 55.978 1.00 27.51 ? 235  SER A CB  1 
ATOM   1793 O OG  . SER A 1 235 ? 5.060   50.391 56.025 1.00 26.78 ? 235  SER A OG  1 
ATOM   1794 N N   . VAL A 1 236 ? 2.331   49.421 58.052 1.00 28.71 ? 236  VAL A N   1 
ATOM   1795 C CA  . VAL A 1 236 ? 2.190   48.220 58.866 1.00 28.83 ? 236  VAL A CA  1 
ATOM   1796 C C   . VAL A 1 236 ? 1.771   47.078 57.916 1.00 29.51 ? 236  VAL A C   1 
ATOM   1797 O O   . VAL A 1 236 ? 1.366   47.330 56.766 1.00 29.85 ? 236  VAL A O   1 
ATOM   1798 C CB  . VAL A 1 236 ? 1.088   48.387 59.991 1.00 28.79 ? 236  VAL A CB  1 
ATOM   1799 C CG1 . VAL A 1 236 ? 1.537   49.383 61.064 1.00 27.61 ? 236  VAL A CG1 1 
ATOM   1800 C CG2 . VAL A 1 236 ? -0.259  48.796 59.361 1.00 27.76 ? 236  VAL A CG2 1 
ATOM   1801 N N   . SER A 1 237 ? 1.896   45.835 58.364 1.00 29.34 ? 237  SER A N   1 
ATOM   1802 C CA  . SER A 1 237 ? 1.475   44.691 57.538 1.00 29.79 ? 237  SER A CA  1 
ATOM   1803 C C   . SER A 1 237 ? -0.074  44.658 57.546 1.00 29.83 ? 237  SER A C   1 
ATOM   1804 O O   . SER A 1 237 ? -0.712  45.285 58.399 1.00 29.51 ? 237  SER A O   1 
ATOM   1805 C CB  . SER A 1 237 ? 1.963   43.365 58.171 1.00 29.45 ? 237  SER A CB  1 
ATOM   1806 O OG  . SER A 1 237 ? 1.283   43.164 59.411 1.00 29.07 ? 237  SER A OG  1 
ATOM   1807 N N   . VAL A 1 238 ? -0.664  43.901 56.619 1.00 30.34 ? 238  VAL A N   1 
ATOM   1808 C CA  . VAL A 1 238 ? -2.119  43.803 56.592 1.00 30.56 ? 238  VAL A CA  1 
ATOM   1809 C C   . VAL A 1 238 ? -2.550  43.105 57.869 1.00 30.35 ? 238  VAL A C   1 
ATOM   1810 O O   . VAL A 1 238 ? -3.612  43.406 58.416 1.00 30.42 ? 238  VAL A O   1 
ATOM   1811 C CB  . VAL A 1 238 ? -2.649  43.037 55.341 1.00 31.05 ? 238  VAL A CB  1 
ATOM   1812 C CG1 . VAL A 1 238 ? -2.329  43.820 54.138 1.00 31.53 ? 238  VAL A CG1 1 
ATOM   1813 C CG2 . VAL A 1 238 ? -2.057  41.643 55.235 1.00 31.13 ? 238  VAL A CG2 1 
ATOM   1814 N N   . ALA A 1 239 ? -1.716  42.198 58.369 1.00 29.82 ? 239  ALA A N   1 
ATOM   1815 C CA  . ALA A 1 239 ? -2.061  41.539 59.625 1.00 30.22 ? 239  ALA A CA  1 
ATOM   1816 C C   . ALA A 1 239 ? -2.059  42.520 60.805 1.00 29.98 ? 239  ALA A C   1 
ATOM   1817 O O   . ALA A 1 239 ? -2.983  42.517 61.625 1.00 30.12 ? 239  ALA A O   1 
ATOM   1818 C CB  . ALA A 1 239 ? -1.087  40.342 59.908 1.00 30.35 ? 239  ALA A CB  1 
ATOM   1819 N N   . GLU A 1 240 ? -1.048  43.383 60.914 1.00 30.51 ? 240  GLU A N   1 
ATOM   1820 C CA  . GLU A 1 240 ? -1.069  44.330 62.051 1.00 30.60 ? 240  GLU A CA  1 
ATOM   1821 C C   . GLU A 1 240 ? -2.242  45.325 61.902 1.00 30.28 ? 240  GLU A C   1 
ATOM   1822 O O   . GLU A 1 240 ? -2.896  45.688 62.887 1.00 29.86 ? 240  GLU A O   1 
ATOM   1823 C CB  . GLU A 1 240 ? 0.281   45.063 62.209 1.00 30.93 ? 240  GLU A CB  1 
ATOM   1824 C CG  . GLU A 1 240 ? 0.285   46.208 63.302 1.00 31.21 ? 240  GLU A CG  1 
ATOM   1825 C CD  . GLU A 1 240 ? -0.017  45.702 64.722 1.00 31.89 ? 240  GLU A CD  1 
ATOM   1826 O OE1 . GLU A 1 240 ? -0.046  44.461 64.915 1.00 31.37 ? 240  GLU A OE1 1 
ATOM   1827 O OE2 . GLU A 1 240 ? -0.214  46.546 65.639 1.00 31.83 ? 240  GLU A OE2 1 
ATOM   1828 N N   . GLY A 1 241 ? -2.506  45.727 60.654 1.00 30.93 ? 241  GLY A N   1 
ATOM   1829 C CA  . GLY A 1 241 ? -3.606  46.633 60.364 1.00 30.88 ? 241  GLY A CA  1 
ATOM   1830 C C   . GLY A 1 241 ? -4.920  46.008 60.791 1.00 31.22 ? 241  GLY A C   1 
ATOM   1831 O O   . GLY A 1 241 ? -5.777  46.653 61.423 1.00 30.56 ? 241  GLY A O   1 
ATOM   1832 N N   . ARG A 1 242 ? -5.075  44.727 60.452 1.00 31.58 ? 242  ARG A N   1 
ATOM   1833 C CA  . ARG A 1 242 ? -6.287  44.011 60.804 1.00 31.89 ? 242  ARG A CA  1 
ATOM   1834 C C   . ARG A 1 242 ? -6.419  43.940 62.324 1.00 31.58 ? 242  ARG A C   1 
ATOM   1835 O O   . ARG A 1 242 ? -7.461  44.313 62.893 1.00 31.29 ? 242  ARG A O   1 
ATOM   1836 C CB  . ARG A 1 242 ? -6.272  42.617 60.152 1.00 32.54 ? 242  ARG A CB  1 
ATOM   1837 C CG  . ARG A 1 242 ? -7.382  41.676 60.616 1.00 32.90 ? 242  ARG A CG  1 
ATOM   1838 C CD  . ARG A 1 242 ? -7.548  40.486 59.619 1.00 33.52 ? 242  ARG A CD  1 
ATOM   1839 N NE  . ARG A 1 242 ? -8.172  40.915 58.361 1.00 33.22 ? 242  ARG A NE  1 
ATOM   1840 C CZ  . ARG A 1 242 ? -9.478  41.108 58.198 1.00 33.26 ? 242  ARG A CZ  1 
ATOM   1841 N NH1 . ARG A 1 242 ? -10.332 40.850 59.178 1.00 32.82 ? 242  ARG A NH1 1 
ATOM   1842 N NH2 . ARG A 1 242 ? -9.934  41.528 57.023 1.00 33.92 ? 242  ARG A NH2 1 
ATOM   1843 N N   . ARG A 1 243 ? -5.354  43.503 62.990 1.00 31.35 ? 243  ARG A N   1 
ATOM   1844 C CA  . ARG A 1 243 ? -5.388  43.438 64.439 1.00 31.31 ? 243  ARG A CA  1 
ATOM   1845 C C   . ARG A 1 243 ? -5.743  44.798 65.090 1.00 31.19 ? 243  ARG A C   1 
ATOM   1846 O O   . ARG A 1 243 ? -6.516  44.841 66.058 1.00 31.19 ? 243  ARG A O   1 
ATOM   1847 C CB  . ARG A 1 243 ? -4.044  42.955 64.990 1.00 31.86 ? 243  ARG A CB  1 
ATOM   1848 C CG  . ARG A 1 243 ? -4.044  42.824 66.502 1.00 32.66 ? 243  ARG A CG  1 
ATOM   1849 C CD  . ARG A 1 243 ? -2.609  42.778 67.091 1.00 32.91 ? 243  ARG A CD  1 
ATOM   1850 N NE  . ARG A 1 243 ? -1.950  44.076 67.039 1.00 32.90 ? 243  ARG A NE  1 
ATOM   1851 C CZ  . ARG A 1 243 ? -2.260  45.115 67.812 1.00 33.07 ? 243  ARG A CZ  1 
ATOM   1852 N NH1 . ARG A 1 243 ? -3.214  45.007 68.738 1.00 32.44 ? 243  ARG A NH1 1 
ATOM   1853 N NH2 . ARG A 1 243 ? -1.594  46.261 67.669 1.00 32.90 ? 243  ARG A NH2 1 
ATOM   1854 N N   . ARG A 1 244 ? -5.198  45.909 64.587 1.00 30.95 ? 244  ARG A N   1 
ATOM   1855 C CA  . ARG A 1 244 ? -5.539  47.210 65.192 1.00 30.71 ? 244  ARG A CA  1 
ATOM   1856 C C   . ARG A 1 244 ? -6.978  47.636 64.909 1.00 30.61 ? 244  ARG A C   1 
ATOM   1857 O O   . ARG A 1 244 ? -7.587  48.294 65.757 1.00 30.67 ? 244  ARG A O   1 
ATOM   1858 C CB  . ARG A 1 244 ? -4.573  48.331 64.741 1.00 30.29 ? 244  ARG A CB  1 
ATOM   1859 C CG  . ARG A 1 244 ? -3.156  48.163 65.210 1.00 29.36 ? 244  ARG A CG  1 
ATOM   1860 C CD  . ARG A 1 244 ? -2.233  49.135 64.468 1.00 29.88 ? 244  ARG A CD  1 
ATOM   1861 N NE  . ARG A 1 244 ? -0.810  48.881 64.703 1.00 29.01 ? 244  ARG A NE  1 
ATOM   1862 C CZ  . ARG A 1 244 ? 0.167   49.772 64.529 1.00 28.89 ? 244  ARG A CZ  1 
ATOM   1863 N NH1 . ARG A 1 244 ? -0.079  51.026 64.106 1.00 27.71 ? 244  ARG A NH1 1 
ATOM   1864 N NH2 . ARG A 1 244 ? 1.407   49.414 64.809 1.00 27.68 ? 244  ARG A NH2 1 
ATOM   1865 N N   . ALA A 1 245 ? -7.501  47.279 63.732 1.00 30.91 ? 245  ALA A N   1 
ATOM   1866 C CA  . ALA A 1 245 ? -8.877  47.612 63.351 1.00 32.00 ? 245  ALA A CA  1 
ATOM   1867 C C   . ALA A 1 245 ? -9.822  46.913 64.314 1.00 32.54 ? 245  ALA A C   1 
ATOM   1868 O O   . ALA A 1 245 ? -10.752 47.532 64.839 1.00 32.95 ? 245  ALA A O   1 
ATOM   1869 C CB  . ALA A 1 245 ? -9.200  47.151 61.877 1.00 32.35 ? 245  ALA A CB  1 
ATOM   1870 N N   . VAL A 1 246 ? -9.551  45.631 64.553 1.00 32.87 ? 246  VAL A N   1 
ATOM   1871 C CA  . VAL A 1 246 ? -10.336 44.820 65.471 1.00 33.31 ? 246  VAL A CA  1 
ATOM   1872 C C   . VAL A 1 246 ? -10.224 45.327 66.917 1.00 33.94 ? 246  VAL A C   1 
ATOM   1873 O O   . VAL A 1 246 ? -11.219 45.357 67.692 1.00 34.35 ? 246  VAL A O   1 
ATOM   1874 C CB  . VAL A 1 246 ? -9.865  43.341 65.452 1.00 33.47 ? 246  VAL A CB  1 
ATOM   1875 C CG1 . VAL A 1 246 ? -10.570 42.541 66.641 1.00 32.73 ? 246  VAL A CG1 1 
ATOM   1876 C CG2 . VAL A 1 246 ? -10.153 42.702 64.050 1.00 32.36 ? 246  VAL A CG2 1 
ATOM   1877 N N   . GLU A 1 247 ? -9.011  45.704 67.307 1.00 33.86 ? 247  GLU A N   1 
ATOM   1878 C CA  . GLU A 1 247 ? -8.828  46.206 68.652 1.00 33.60 ? 247  GLU A CA  1 
ATOM   1879 C C   . GLU A 1 247 ? -9.599  47.528 68.789 1.00 33.19 ? 247  GLU A C   1 
ATOM   1880 O O   . GLU A 1 247 ? -10.154 47.822 69.872 1.00 32.98 ? 247  GLU A O   1 
ATOM   1881 C CB  . GLU A 1 247 ? -7.329  46.383 68.947 1.00 34.45 ? 247  GLU A CB  1 
ATOM   1882 C CG  . GLU A 1 247 ? -7.041  46.786 70.379 1.00 35.98 ? 247  GLU A CG  1 
ATOM   1883 C CD  . GLU A 1 247 ? -7.575  45.750 71.417 1.00 37.05 ? 247  GLU A CD  1 
ATOM   1884 O OE1 . GLU A 1 247 ? -7.942  44.584 71.057 1.00 36.96 ? 247  GLU A OE1 1 
ATOM   1885 O OE2 . GLU A 1 247 ? -7.622  46.155 72.601 1.00 37.57 ? 247  GLU A OE2 1 
ATOM   1886 N N   . LEU A 1 248 ? -9.682  48.312 67.704 1.00 32.66 ? 248  LEU A N   1 
ATOM   1887 C CA  . LEU A 1 248 ? -10.419 49.578 67.809 1.00 32.89 ? 248  LEU A CA  1 
ATOM   1888 C C   . LEU A 1 248 ? -11.877 49.228 68.085 1.00 33.44 ? 248  LEU A C   1 
ATOM   1889 O O   . LEU A 1 248 ? -12.529 49.836 68.940 1.00 33.65 ? 248  LEU A O   1 
ATOM   1890 C CB  . LEU A 1 248 ? -10.345 50.409 66.517 1.00 32.16 ? 248  LEU A CB  1 
ATOM   1891 C CG  . LEU A 1 248 ? -10.999 51.808 66.575 1.00 31.51 ? 248  LEU A CG  1 
ATOM   1892 C CD1 . LEU A 1 248 ? -10.138 52.767 67.442 1.00 32.02 ? 248  LEU A CD1 1 
ATOM   1893 C CD2 . LEU A 1 248 ? -11.153 52.396 65.193 1.00 31.31 ? 248  LEU A CD2 1 
ATOM   1894 N N   . GLY A 1 249 ? -12.382 48.253 67.329 1.00 33.58 ? 249  GLY A N   1 
ATOM   1895 C CA  . GLY A 1 249 ? -13.747 47.818 67.524 1.00 34.30 ? 249  GLY A CA  1 
ATOM   1896 C C   . GLY A 1 249 ? -13.982 47.307 68.932 1.00 34.46 ? 249  GLY A C   1 
ATOM   1897 O O   . GLY A 1 249 ? -15.017 47.585 69.525 1.00 34.10 ? 249  GLY A O   1 
ATOM   1898 N N   . ARG A 1 250 ? -13.008 46.575 69.466 1.00 34.77 ? 250  ARG A N   1 
ATOM   1899 C CA  . ARG A 1 250 ? -13.139 46.040 70.802 1.00 35.35 ? 250  ARG A CA  1 
ATOM   1900 C C   . ARG A 1 250 ? -13.232 47.187 71.839 1.00 35.96 ? 250  ARG A C   1 
ATOM   1901 O O   . ARG A 1 250 ? -13.909 47.059 72.865 1.00 35.92 ? 250  ARG A O   1 
ATOM   1902 C CB  . ARG A 1 250 ? -11.965 45.066 71.051 1.00 35.35 ? 250  ARG A CB  1 
ATOM   1903 C CG  . ARG A 1 250 ? -12.008 44.288 72.378 1.00 35.93 ? 250  ARG A CG  1 
ATOM   1904 C CD  . ARG A 1 250 ? -10.777 43.369 72.539 1.00 35.70 ? 250  ARG A CD  1 
ATOM   1905 N NE  . ARG A 1 250 ? -10.717 42.367 71.466 1.00 37.05 ? 250  ARG A NE  1 
ATOM   1906 N N   . ASN A 1 251 ? -12.592 48.334 71.550 1.00 36.57 ? 251  ASN A N   1 
ATOM   1907 C CA  . ASN A 1 251 ? -12.618 49.513 72.455 1.00 36.21 ? 251  ASN A CA  1 
ATOM   1908 C C   . ASN A 1 251 ? -13.977 50.208 72.422 1.00 36.85 ? 251  ASN A C   1 
ATOM   1909 O O   . ASN A 1 251 ? -14.343 50.937 73.339 1.00 36.56 ? 251  ASN A O   1 
ATOM   1910 C CB  . ASN A 1 251 ? -11.532 50.532 72.037 1.00 35.34 ? 251  ASN A CB  1 
ATOM   1911 C CG  . ASN A 1 251 ? -10.183 50.318 72.767 1.00 34.77 ? 251  ASN A CG  1 
ATOM   1912 O OD1 . ASN A 1 251 ? -9.893  51.024 73.724 1.00 34.36 ? 251  ASN A OD1 1 
ATOM   1913 N ND2 . ASN A 1 251 ? -9.375  49.344 72.317 1.00 33.57 ? 251  ASN A ND2 1 
ATOM   1914 N N   . LEU A 1 252 ? -14.708 50.014 71.332 1.00 38.24 ? 252  LEU A N   1 
ATOM   1915 C CA  . LEU A 1 252 ? -16.026 50.635 71.177 1.00 39.81 ? 252  LEU A CA  1 
ATOM   1916 C C   . LEU A 1 252 ? -17.171 49.618 71.398 1.00 40.98 ? 252  LEU A C   1 
ATOM   1917 O O   . LEU A 1 252 ? -18.324 49.881 71.073 1.00 41.18 ? 252  LEU A O   1 
ATOM   1918 C CB  . LEU A 1 252 ? -16.115 51.316 69.797 1.00 38.92 ? 252  LEU A CB  1 
ATOM   1919 C CG  . LEU A 1 252 ? -15.119 52.517 69.735 1.00 38.91 ? 252  LEU A CG  1 
ATOM   1920 C CD1 . LEU A 1 252 ? -14.906 52.953 68.314 1.00 38.58 ? 252  LEU A CD1 1 
ATOM   1921 C CD2 . LEU A 1 252 ? -15.588 53.682 70.536 1.00 37.77 ? 252  LEU A CD2 1 
ATOM   1922 N N   . ASN A 1 253 ? -16.826 48.461 71.966 1.00 42.48 ? 253  ASN A N   1 
ATOM   1923 C CA  . ASN A 1 253 ? -17.800 47.406 72.263 1.00 43.85 ? 253  ASN A CA  1 
ATOM   1924 C C   . ASN A 1 253 ? -18.537 46.998 70.998 1.00 43.93 ? 253  ASN A C   1 
ATOM   1925 O O   . ASN A 1 253 ? -19.766 46.862 71.001 1.00 44.53 ? 253  ASN A O   1 
ATOM   1926 C CB  . ASN A 1 253 ? -18.800 47.920 73.302 1.00 44.99 ? 253  ASN A CB  1 
ATOM   1927 C CG  . ASN A 1 253 ? -18.101 48.612 74.509 1.00 46.89 ? 253  ASN A CG  1 
ATOM   1928 O OD1 . ASN A 1 253 ? -17.453 47.949 75.350 1.00 47.75 ? 253  ASN A OD1 1 
ATOM   1929 N ND2 . ASN A 1 253 ? -18.217 49.954 74.579 1.00 47.21 ? 253  ASN A ND2 1 
ATOM   1930 N N   . CYS A 1 254 ? -17.797 46.842 69.910 1.00 43.55 ? 254  CYS A N   1 
ATOM   1931 C CA  . CYS A 1 254 ? -18.400 46.455 68.647 1.00 43.23 ? 254  CYS A CA  1 
ATOM   1932 C C   . CYS A 1 254 ? -18.562 44.940 68.568 1.00 43.53 ? 254  CYS A C   1 
ATOM   1933 O O   . CYS A 1 254 ? -17.817 44.173 69.187 1.00 43.12 ? 254  CYS A O   1 
ATOM   1934 C CB  . CYS A 1 254 ? -17.517 46.892 67.461 1.00 43.03 ? 254  CYS A CB  1 
ATOM   1935 S SG  . CYS A 1 254 ? -17.585 48.656 66.985 1.00 42.44 ? 254  CYS A SG  1 
ATOM   1936 N N   . ASN A 1 255 ? -19.530 44.518 67.765 1.00 43.73 ? 255  ASN A N   1 
ATOM   1937 C CA  . ASN A 1 255 ? -19.753 43.106 67.514 1.00 43.98 ? 255  ASN A CA  1 
ATOM   1938 C C   . ASN A 1 255 ? -18.535 42.799 66.653 1.00 44.14 ? 255  ASN A C   1 
ATOM   1939 O O   . ASN A 1 255 ? -18.327 43.493 65.643 1.00 44.07 ? 255  ASN A O   1 
ATOM   1940 C CB  . ASN A 1 255 ? -21.031 42.959 66.682 1.00 44.39 ? 255  ASN A CB  1 
ATOM   1941 C CG  . ASN A 1 255 ? -21.300 41.533 66.236 1.00 44.61 ? 255  ASN A CG  1 
ATOM   1942 O OD1 . ASN A 1 255 ? -20.427 40.829 65.703 1.00 44.50 ? 255  ASN A OD1 1 
ATOM   1943 N ND2 . ASN A 1 255 ? -22.536 41.107 66.435 1.00 45.14 ? 255  ASN A ND2 1 
ATOM   1944 N N   . LEU A 1 256 ? -17.746 41.784 67.015 1.00 44.18 ? 256  LEU A N   1 
ATOM   1945 C CA  . LEU A 1 256 ? -16.548 41.450 66.247 1.00 44.55 ? 256  LEU A CA  1 
ATOM   1946 C C   . LEU A 1 256 ? -16.588 40.159 65.422 1.00 45.37 ? 256  LEU A C   1 
ATOM   1947 O O   . LEU A 1 256 ? -15.535 39.678 64.971 1.00 45.60 ? 256  LEU A O   1 
ATOM   1948 C CB  . LEU A 1 256 ? -15.335 41.401 67.180 1.00 44.18 ? 256  LEU A CB  1 
ATOM   1949 C CG  . LEU A 1 256 ? -15.143 42.629 68.088 1.00 43.94 ? 256  LEU A CG  1 
ATOM   1950 C CD1 . LEU A 1 256 ? -13.932 42.417 69.012 1.00 43.27 ? 256  LEU A CD1 1 
ATOM   1951 C CD2 . LEU A 1 256 ? -14.989 43.902 67.202 1.00 43.44 ? 256  LEU A CD2 1 
ATOM   1952 N N   . ASN A 1 257 ? -17.784 39.622 65.183 1.00 45.76 ? 257  ASN A N   1 
ATOM   1953 C CA  . ASN A 1 257 ? -17.940 38.361 64.434 1.00 46.10 ? 257  ASN A CA  1 
ATOM   1954 C C   . ASN A 1 257 ? -17.487 38.356 62.966 1.00 46.15 ? 257  ASN A C   1 
ATOM   1955 O O   . ASN A 1 257 ? -16.989 37.345 62.465 1.00 46.54 ? 257  ASN A O   1 
ATOM   1956 C CB  . ASN A 1 257 ? -19.409 37.920 64.512 1.00 46.13 ? 257  ASN A CB  1 
ATOM   1957 N N   . SER A 1 258 ? -17.690 39.477 62.272 1.00 45.88 ? 258  SER A N   1 
ATOM   1958 C CA  . SER A 1 258 ? -17.308 39.617 60.861 1.00 45.22 ? 258  SER A CA  1 
ATOM   1959 C C   . SER A 1 258 ? -16.855 41.038 60.541 1.00 45.17 ? 258  SER A C   1 
ATOM   1960 O O   . SER A 1 258 ? -17.207 42.003 61.247 1.00 44.87 ? 258  SER A O   1 
ATOM   1961 C CB  . SER A 1 258 ? -18.492 39.325 59.944 1.00 44.69 ? 258  SER A CB  1 
ATOM   1962 O OG  . SER A 1 258 ? -19.486 40.317 60.113 1.00 44.55 ? 258  SER A OG  1 
ATOM   1963 N N   . ASP A 1 259 ? -16.088 41.166 59.462 1.00 45.10 ? 259  ASP A N   1 
ATOM   1964 C CA  . ASP A 1 259 ? -15.648 42.479 59.040 1.00 45.21 ? 259  ASP A CA  1 
ATOM   1965 C C   . ASP A 1 259 ? -16.891 43.346 58.850 1.00 45.18 ? 259  ASP A C   1 
ATOM   1966 O O   . ASP A 1 259 ? -16.890 44.506 59.257 1.00 45.58 ? 259  ASP A O   1 
ATOM   1967 C CB  . ASP A 1 259 ? -14.867 42.406 57.726 1.00 45.17 ? 259  ASP A CB  1 
ATOM   1968 C CG  . ASP A 1 259 ? -13.471 41.812 57.900 1.00 45.62 ? 259  ASP A CG  1 
ATOM   1969 O OD1 . ASP A 1 259 ? -13.088 41.454 59.041 1.00 45.89 ? 259  ASP A OD1 1 
ATOM   1970 O OD2 . ASP A 1 259 ? -12.744 41.704 56.882 1.00 45.82 ? 259  ASP A OD2 1 
ATOM   1971 N N   . GLU A 1 260 ? -17.955 42.786 58.254 1.00 44.92 ? 260  GLU A N   1 
ATOM   1972 C CA  . GLU A 1 260 ? -19.192 43.538 58.006 1.00 44.42 ? 260  GLU A CA  1 
ATOM   1973 C C   . GLU A 1 260 ? -19.761 44.036 59.305 1.00 43.96 ? 260  GLU A C   1 
ATOM   1974 O O   . GLU A 1 260 ? -20.172 45.199 59.412 1.00 43.92 ? 260  GLU A O   1 
ATOM   1975 C CB  . GLU A 1 260 ? -20.223 42.672 57.274 1.00 44.87 ? 260  GLU A CB  1 
ATOM   1976 C CG  . GLU A 1 260 ? -19.622 41.871 56.072 1.00 45.55 ? 260  GLU A CG  1 
ATOM   1977 C CD  . GLU A 1 260 ? -18.485 40.871 56.477 1.00 45.61 ? 260  GLU A CD  1 
ATOM   1978 N N   . GLU A 1 261 ? -19.784 43.159 60.304 1.00 43.68 ? 261  GLU A N   1 
ATOM   1979 C CA  . GLU A 1 261 ? -20.277 43.531 61.633 1.00 43.61 ? 261  GLU A CA  1 
ATOM   1980 C C   . GLU A 1 261 ? -19.427 44.687 62.216 1.00 42.63 ? 261  GLU A C   1 
ATOM   1981 O O   . GLU A 1 261 ? -19.974 45.686 62.723 1.00 42.09 ? 261  GLU A O   1 
ATOM   1982 C CB  . GLU A 1 261 ? -20.224 42.319 62.595 1.00 45.10 ? 261  GLU A CB  1 
ATOM   1983 C CG  . GLU A 1 261 ? -21.346 41.268 62.432 1.00 47.55 ? 261  GLU A CG  1 
ATOM   1984 C CD  . GLU A 1 261 ? -22.709 41.786 62.943 1.00 49.32 ? 261  GLU A CD  1 
ATOM   1985 O OE1 . GLU A 1 261 ? -22.770 42.944 63.440 1.00 50.05 ? 261  GLU A OE1 1 
ATOM   1986 O OE2 . GLU A 1 261 ? -23.718 41.038 62.867 1.00 50.09 ? 261  GLU A OE2 1 
ATOM   1987 N N   . LEU A 1 262 ? -18.095 44.540 62.112 1.00 41.46 ? 262  LEU A N   1 
ATOM   1988 C CA  . LEU A 1 262 ? -17.133 45.509 62.640 1.00 40.34 ? 262  LEU A CA  1 
ATOM   1989 C C   . LEU A 1 262 ? -17.251 46.870 61.976 1.00 40.05 ? 262  LEU A C   1 
ATOM   1990 O O   . LEU A 1 262 ? -17.442 47.889 62.633 1.00 39.49 ? 262  LEU A O   1 
ATOM   1991 C CB  . LEU A 1 262 ? -15.703 44.975 62.476 1.00 39.47 ? 262  LEU A CB  1 
ATOM   1992 C CG  . LEU A 1 262 ? -14.564 45.902 62.952 1.00 38.97 ? 262  LEU A CG  1 
ATOM   1993 C CD1 . LEU A 1 262 ? -14.866 46.419 64.365 1.00 37.76 ? 262  LEU A CD1 1 
ATOM   1994 C CD2 . LEU A 1 262 ? -13.212 45.134 62.906 1.00 38.39 ? 262  LEU A CD2 1 
ATOM   1995 N N   . ILE A 1 263 ? -17.174 46.863 60.656 1.00 40.14 ? 263  ILE A N   1 
ATOM   1996 C CA  . ILE A 1 263 ? -17.251 48.098 59.894 1.00 40.38 ? 263  ILE A CA  1 
ATOM   1997 C C   . ILE A 1 263 ? -18.569 48.817 60.097 1.00 40.97 ? 263  ILE A C   1 
ATOM   1998 O O   . ILE A 1 263 ? -18.601 50.039 60.204 1.00 41.14 ? 263  ILE A O   1 
ATOM   1999 C CB  . ILE A 1 263 ? -17.043 47.838 58.393 1.00 39.82 ? 263  ILE A CB  1 
ATOM   2000 C CG1 . ILE A 1 263 ? -15.617 47.318 58.153 1.00 38.79 ? 263  ILE A CG1 1 
ATOM   2001 C CG2 . ILE A 1 263 ? -17.376 49.107 57.602 1.00 39.75 ? 263  ILE A CG2 1 
ATOM   2002 C CD1 . ILE A 1 263 ? -15.373 46.865 56.756 1.00 37.95 ? 263  ILE A CD1 1 
ATOM   2003 N N   . HIS A 1 264 ? -19.657 48.056 60.150 1.00 41.69 ? 264  HIS A N   1 
ATOM   2004 C CA  . HIS A 1 264 ? -20.979 48.629 60.346 1.00 42.27 ? 264  HIS A CA  1 
ATOM   2005 C C   . HIS A 1 264 ? -21.018 49.365 61.675 1.00 42.09 ? 264  HIS A C   1 
ATOM   2006 O O   . HIS A 1 264 ? -21.519 50.497 61.762 1.00 42.36 ? 264  HIS A O   1 
ATOM   2007 C CB  . HIS A 1 264 ? -22.071 47.540 60.328 1.00 43.59 ? 264  HIS A CB  1 
ATOM   2008 C CG  . HIS A 1 264 ? -23.444 48.080 60.584 1.00 44.69 ? 264  HIS A CG  1 
ATOM   2009 N ND1 . HIS A 1 264 ? -23.924 48.329 61.857 1.00 45.46 ? 264  HIS A ND1 1 
ATOM   2010 C CD2 . HIS A 1 264 ? -24.376 48.577 59.732 1.00 45.76 ? 264  HIS A CD2 1 
ATOM   2011 C CE1 . HIS A 1 264 ? -25.081 48.964 61.780 1.00 45.91 ? 264  HIS A CE1 1 
ATOM   2012 N NE2 . HIS A 1 264 ? -25.379 49.130 60.499 1.00 46.19 ? 264  HIS A NE2 1 
ATOM   2013 N N   . CYS A 1 265 ? -20.492 48.715 62.713 1.00 41.85 ? 265  CYS A N   1 
ATOM   2014 C CA  . CYS A 1 265 ? -20.448 49.321 64.048 1.00 41.60 ? 265  CYS A CA  1 
ATOM   2015 C C   . CYS A 1 265 ? -19.594 50.602 64.050 1.00 41.15 ? 265  CYS A C   1 
ATOM   2016 O O   . CYS A 1 265 ? -20.010 51.635 64.582 1.00 40.36 ? 265  CYS A O   1 
ATOM   2017 C CB  . CYS A 1 265 ? -19.886 48.313 65.059 1.00 41.82 ? 265  CYS A CB  1 
ATOM   2018 S SG  . CYS A 1 265 ? -19.587 48.956 66.748 1.00 42.61 ? 265  CYS A SG  1 
ATOM   2019 N N   . LEU A 1 266 ? -18.411 50.519 63.438 1.00 41.06 ? 266  LEU A N   1 
ATOM   2020 C CA  . LEU A 1 266 ? -17.511 51.687 63.387 1.00 41.22 ? 266  LEU A CA  1 
ATOM   2021 C C   . LEU A 1 266 ? -18.140 52.842 62.595 1.00 41.31 ? 266  LEU A C   1 
ATOM   2022 O O   . LEU A 1 266 ? -17.920 54.007 62.907 1.00 41.10 ? 266  LEU A O   1 
ATOM   2023 C CB  . LEU A 1 266 ? -16.123 51.287 62.812 1.00 40.69 ? 266  LEU A CB  1 
ATOM   2024 C CG  . LEU A 1 266 ? -15.309 50.315 63.681 1.00 40.05 ? 266  LEU A CG  1 
ATOM   2025 C CD1 . LEU A 1 266 ? -14.097 49.871 62.954 1.00 40.13 ? 266  LEU A CD1 1 
ATOM   2026 C CD2 . LEU A 1 266 ? -14.930 50.951 65.006 1.00 40.31 ? 266  LEU A CD2 1 
ATOM   2027 N N   . ARG A 1 267 ? -18.958 52.518 61.598 1.00 41.54 ? 267  ARG A N   1 
ATOM   2028 C CA  . ARG A 1 267 ? -19.597 53.565 60.815 1.00 42.06 ? 267  ARG A CA  1 
ATOM   2029 C C   . ARG A 1 267 ? -20.707 54.302 61.540 1.00 42.23 ? 267  ARG A C   1 
ATOM   2030 O O   . ARG A 1 267 ? -21.051 55.418 61.151 1.00 42.50 ? 267  ARG A O   1 
ATOM   2031 C CB  . ARG A 1 267 ? -20.143 53.015 59.501 1.00 41.94 ? 267  ARG A CB  1 
ATOM   2032 C CG  . ARG A 1 267 ? -19.073 52.702 58.493 1.00 42.31 ? 267  ARG A CG  1 
ATOM   2033 C CD  . ARG A 1 267 ? -19.652 52.479 57.144 1.00 42.23 ? 267  ARG A CD  1 
ATOM   2034 N NE  . ARG A 1 267 ? -18.601 52.284 56.177 1.00 43.08 ? 267  ARG A NE  1 
ATOM   2035 C CZ  . ARG A 1 267 ? -18.646 51.390 55.189 1.00 43.67 ? 267  ARG A CZ  1 
ATOM   2036 N NH1 . ARG A 1 267 ? -19.714 50.602 55.048 1.00 43.71 ? 267  ARG A NH1 1 
ATOM   2037 N NH2 . ARG A 1 267 ? -17.622 51.277 54.349 1.00 43.52 ? 267  ARG A NH2 1 
ATOM   2038 N N   . GLU A 1 268 ? -21.270 53.697 62.583 1.00 42.44 ? 268  GLU A N   1 
ATOM   2039 C CA  . GLU A 1 268 ? -22.336 54.362 63.344 1.00 42.50 ? 268  GLU A CA  1 
ATOM   2040 C C   . GLU A 1 268 ? -21.789 55.253 64.453 1.00 42.56 ? 268  GLU A C   1 
ATOM   2041 O O   . GLU A 1 268 ? -22.508 56.133 64.942 1.00 42.74 ? 268  GLU A O   1 
ATOM   2042 C CB  . GLU A 1 268 ? -23.314 53.340 63.957 1.00 42.81 ? 268  GLU A CB  1 
ATOM   2043 C CG  . GLU A 1 268 ? -24.203 52.590 62.903 1.00 43.33 ? 268  GLU A CG  1 
ATOM   2044 C CD  . GLU A 1 268 ? -24.734 53.520 61.792 1.00 42.77 ? 268  GLU A CD  1 
ATOM   2045 N N   . LYS A 1 269 ? -20.530 55.036 64.850 1.00 41.96 ? 269  LYS A N   1 
ATOM   2046 C CA  . LYS A 1 269 ? -19.910 55.849 65.899 1.00 41.79 ? 269  LYS A CA  1 
ATOM   2047 C C   . LYS A 1 269 ? -19.641 57.268 65.386 1.00 41.59 ? 269  LYS A C   1 
ATOM   2048 O O   . LYS A 1 269 ? -19.315 57.481 64.222 1.00 41.58 ? 269  LYS A O   1 
ATOM   2049 C CB  . LYS A 1 269 ? -18.589 55.218 66.349 1.00 42.12 ? 269  LYS A CB  1 
ATOM   2050 C CG  . LYS A 1 269 ? -18.716 53.801 66.829 1.00 42.54 ? 269  LYS A CG  1 
ATOM   2051 C CD  . LYS A 1 269 ? -19.629 53.789 68.041 1.00 43.12 ? 269  LYS A CD  1 
ATOM   2052 C CE  . LYS A 1 269 ? -19.711 52.431 68.693 1.00 43.71 ? 269  LYS A CE  1 
ATOM   2053 N NZ  . LYS A 1 269 ? -20.543 52.552 69.926 1.00 44.31 ? 269  LYS A NZ  1 
ATOM   2054 N N   . LYS A 1 270 ? -19.821 58.243 66.257 1.00 41.62 ? 270  LYS A N   1 
ATOM   2055 C CA  . LYS A 1 270 ? -19.573 59.631 65.886 1.00 41.66 ? 270  LYS A CA  1 
ATOM   2056 C C   . LYS A 1 270 ? -18.048 59.741 65.710 1.00 40.32 ? 270  LYS A C   1 
ATOM   2057 O O   . LYS A 1 270 ? -17.304 58.904 66.209 1.00 39.81 ? 270  LYS A O   1 
ATOM   2058 C CB  . LYS A 1 270 ? -20.070 60.570 66.992 1.00 42.51 ? 270  LYS A CB  1 
ATOM   2059 C CG  . LYS A 1 270 ? -21.608 60.718 67.077 1.00 44.78 ? 270  LYS A CG  1 
ATOM   2060 C CD  . LYS A 1 270 ? -22.211 61.536 65.868 1.00 46.69 ? 270  LYS A CD  1 
ATOM   2061 C CE  . LYS A 1 270 ? -22.359 60.739 64.506 1.00 47.93 ? 270  LYS A CE  1 
ATOM   2062 N NZ  . LYS A 1 270 ? -23.639 59.881 64.277 1.00 48.70 ? 270  LYS A NZ  1 
ATOM   2063 N N   . PRO A 1 271 ? -17.575 60.764 64.994 1.00 39.51 ? 271  PRO A N   1 
ATOM   2064 C CA  . PRO A 1 271 ? -16.117 60.872 64.813 1.00 39.03 ? 271  PRO A CA  1 
ATOM   2065 C C   . PRO A 1 271 ? -15.288 60.849 66.109 1.00 38.53 ? 271  PRO A C   1 
ATOM   2066 O O   . PRO A 1 271 ? -14.343 60.060 66.243 1.00 37.94 ? 271  PRO A O   1 
ATOM   2067 C CB  . PRO A 1 271 ? -15.954 62.191 64.028 1.00 39.05 ? 271  PRO A CB  1 
ATOM   2068 C CG  . PRO A 1 271 ? -17.217 62.243 63.220 1.00 39.19 ? 271  PRO A CG  1 
ATOM   2069 C CD  . PRO A 1 271 ? -18.295 61.772 64.195 1.00 38.74 ? 271  PRO A CD  1 
ATOM   2070 N N   . GLN A 1 272 ? -15.652 61.692 67.066 1.00 38.33 ? 272  GLN A N   1 
ATOM   2071 C CA  . GLN A 1 272 ? -14.883 61.761 68.313 1.00 38.38 ? 272  GLN A CA  1 
ATOM   2072 C C   . GLN A 1 272 ? -14.815 60.443 69.109 1.00 38.15 ? 272  GLN A C   1 
ATOM   2073 O O   . GLN A 1 272 ? -13.915 60.261 69.930 1.00 38.01 ? 272  GLN A O   1 
ATOM   2074 C CB  . GLN A 1 272 ? -15.392 62.936 69.190 1.00 38.31 ? 272  GLN A CB  1 
ATOM   2075 C CG  . GLN A 1 272 ? -14.373 63.453 70.274 1.00 38.81 ? 272  GLN A CG  1 
ATOM   2076 C CD  . GLN A 1 272 ? -12.942 63.662 69.729 1.00 39.12 ? 272  GLN A CD  1 
ATOM   2077 O OE1 . GLN A 1 272 ? -12.760 64.211 68.637 1.00 38.82 ? 272  GLN A OE1 1 
ATOM   2078 N NE2 . GLN A 1 272 ? -11.922 63.214 70.502 1.00 39.08 ? 272  GLN A NE2 1 
ATOM   2079 N N   . GLU A 1 273 ? -15.752 59.519 68.882 1.00 37.94 ? 273  GLU A N   1 
ATOM   2080 C CA  . GLU A 1 273 ? -15.686 58.222 69.594 1.00 37.88 ? 273  GLU A CA  1 
ATOM   2081 C C   . GLU A 1 273 ? -14.472 57.409 69.101 1.00 36.83 ? 273  GLU A C   1 
ATOM   2082 O O   . GLU A 1 273 ? -13.815 56.731 69.867 1.00 36.76 ? 273  GLU A O   1 
ATOM   2083 C CB  . GLU A 1 273 ? -16.984 57.414 69.393 1.00 38.53 ? 273  GLU A CB  1 
ATOM   2084 C CG  . GLU A 1 273 ? -18.175 58.071 70.095 1.00 40.52 ? 273  GLU A CG  1 
ATOM   2085 C CD  . GLU A 1 273 ? -19.503 57.374 69.777 1.00 41.77 ? 273  GLU A CD  1 
ATOM   2086 O OE1 . GLU A 1 273 ? -19.705 56.217 70.222 1.00 42.34 ? 273  GLU A OE1 1 
ATOM   2087 O OE2 . GLU A 1 273 ? -20.329 57.975 69.064 1.00 42.19 ? 273  GLU A OE2 1 
ATOM   2088 N N   . LEU A 1 274 ? -14.211 57.466 67.808 1.00 35.97 ? 274  LEU A N   1 
ATOM   2089 C CA  . LEU A 1 274 ? -13.067 56.781 67.253 1.00 35.50 ? 274  LEU A CA  1 
ATOM   2090 C C   . LEU A 1 274 ? -11.778 57.485 67.713 1.00 34.75 ? 274  LEU A C   1 
ATOM   2091 O O   . LEU A 1 274 ? -10.811 56.842 68.131 1.00 34.38 ? 274  LEU A O   1 
ATOM   2092 C CB  . LEU A 1 274 ? -13.143 56.780 65.720 1.00 36.00 ? 274  LEU A CB  1 
ATOM   2093 C CG  . LEU A 1 274 ? -13.873 55.626 64.995 1.00 36.74 ? 274  LEU A CG  1 
ATOM   2094 C CD1 . LEU A 1 274 ? -15.133 55.234 65.691 1.00 36.45 ? 274  LEU A CD1 1 
ATOM   2095 C CD2 . LEU A 1 274 ? -14.196 56.070 63.566 1.00 36.64 ? 274  LEU A CD2 1 
ATOM   2096 N N   . ILE A 1 275 ? -11.760 58.803 67.639 1.00 33.96 ? 275  ILE A N   1 
ATOM   2097 C CA  . ILE A 1 275 ? -10.582 59.539 68.036 1.00 33.40 ? 275  ILE A CA  1 
ATOM   2098 C C   . ILE A 1 275 ? -10.254 59.308 69.522 1.00 33.23 ? 275  ILE A C   1 
ATOM   2099 O O   . ILE A 1 275 ? -9.088  59.138 69.884 1.00 32.79 ? 275  ILE A O   1 
ATOM   2100 C CB  . ILE A 1 275 ? -10.756 61.047 67.722 1.00 33.05 ? 275  ILE A CB  1 
ATOM   2101 C CG1 . ILE A 1 275 ? -10.771 61.222 66.213 1.00 32.47 ? 275  ILE A CG1 1 
ATOM   2102 C CG2 . ILE A 1 275 ? -9.606  61.907 68.360 1.00 32.65 ? 275  ILE A CG2 1 
ATOM   2103 C CD1 . ILE A 1 275 ? -11.379 62.515 65.760 1.00 32.05 ? 275  ILE A CD1 1 
ATOM   2104 N N   . ASP A 1 276 ? -11.269 59.224 70.364 1.00 32.90 ? 276  ASP A N   1 
ATOM   2105 C CA  . ASP A 1 276 ? -11.022 59.013 71.779 1.00 33.12 ? 276  ASP A CA  1 
ATOM   2106 C C   . ASP A 1 276 ? -10.291 57.740 72.182 1.00 32.91 ? 276  ASP A C   1 
ATOM   2107 O O   . ASP A 1 276 ? -9.658  57.727 73.227 1.00 33.32 ? 276  ASP A O   1 
ATOM   2108 C CB  . ASP A 1 276 ? -12.333 59.052 72.581 1.00 34.07 ? 276  ASP A CB  1 
ATOM   2109 C CG  . ASP A 1 276 ? -12.883 60.479 72.773 1.00 35.45 ? 276  ASP A CG  1 
ATOM   2110 O OD1 . ASP A 1 276 ? -12.150 61.500 72.564 1.00 35.14 ? 276  ASP A OD1 1 
ATOM   2111 O OD2 . ASP A 1 276 ? -14.073 60.553 73.145 1.00 35.81 ? 276  ASP A OD2 1 
ATOM   2112 N N   . VAL A 1 277 ? -10.378 56.674 71.392 1.00 32.18 ? 277  VAL A N   1 
ATOM   2113 C CA  . VAL A 1 277 ? -9.728  55.414 71.759 1.00 31.34 ? 277  VAL A CA  1 
ATOM   2114 C C   . VAL A 1 277 ? -8.650  54.991 70.781 1.00 31.05 ? 277  VAL A C   1 
ATOM   2115 O O   . VAL A 1 277 ? -8.017  53.941 70.964 1.00 31.14 ? 277  VAL A O   1 
ATOM   2116 C CB  . VAL A 1 277 ? -10.779 54.244 71.847 1.00 31.43 ? 277  VAL A CB  1 
ATOM   2117 C CG1 . VAL A 1 277 ? -11.826 54.536 72.941 1.00 30.25 ? 277  VAL A CG1 1 
ATOM   2118 C CG2 . VAL A 1 277 ? -11.496 54.071 70.471 1.00 30.80 ? 277  VAL A CG2 1 
ATOM   2119 N N   . GLU A 1 278 ? -8.453  55.813 69.748 1.00 30.62 ? 278  GLU A N   1 
ATOM   2120 C CA  . GLU A 1 278 ? -7.481  55.574 68.686 1.00 30.74 ? 278  GLU A CA  1 
ATOM   2121 C C   . GLU A 1 278 ? -6.107  55.088 69.166 1.00 31.12 ? 278  GLU A C   1 
ATOM   2122 O O   . GLU A 1 278 ? -5.578  54.132 68.629 1.00 31.33 ? 278  GLU A O   1 
ATOM   2123 C CB  . GLU A 1 278 ? -7.306  56.868 67.863 1.00 31.05 ? 278  GLU A CB  1 
ATOM   2124 C CG  . GLU A 1 278 ? -6.074  56.914 66.950 1.00 31.31 ? 278  GLU A CG  1 
ATOM   2125 C CD  . GLU A 1 278 ? -5.944  58.199 66.112 1.00 31.94 ? 278  GLU A CD  1 
ATOM   2126 O OE1 . GLU A 1 278 ? -6.919  58.981 66.013 1.00 32.22 ? 278  GLU A OE1 1 
ATOM   2127 O OE2 . GLU A 1 278 ? -4.841  58.438 65.529 1.00 32.84 ? 278  GLU A OE2 1 
ATOM   2128 N N   . TRP A 1 279 ? -5.550  55.760 70.178 1.00 31.16 ? 279  TRP A N   1 
ATOM   2129 C CA  . TRP A 1 279 ? -4.238  55.466 70.720 1.00 31.44 ? 279  TRP A CA  1 
ATOM   2130 C C   . TRP A 1 279 ? -4.166  54.163 71.488 1.00 31.55 ? 279  TRP A C   1 
ATOM   2131 O O   . TRP A 1 279 ? -3.080  53.624 71.630 1.00 31.87 ? 279  TRP A O   1 
ATOM   2132 C CB  . TRP A 1 279 ? -3.738  56.635 71.594 1.00 31.59 ? 279  TRP A CB  1 
ATOM   2133 C CG  . TRP A 1 279 ? -3.569  57.859 70.804 1.00 32.73 ? 279  TRP A CG  1 
ATOM   2134 C CD1 . TRP A 1 279 ? -4.478  58.863 70.645 1.00 32.94 ? 279  TRP A CD1 1 
ATOM   2135 C CD2 . TRP A 1 279 ? -2.458  58.185 69.963 1.00 33.18 ? 279  TRP A CD2 1 
ATOM   2136 N NE1 . TRP A 1 279 ? -4.003  59.800 69.757 1.00 33.46 ? 279  TRP A NE1 1 
ATOM   2137 C CE2 . TRP A 1 279 ? -2.765  59.401 69.318 1.00 33.82 ? 279  TRP A CE2 1 
ATOM   2138 C CE3 . TRP A 1 279 ? -1.232  57.564 69.695 1.00 34.10 ? 279  TRP A CE3 1 
ATOM   2139 C CZ2 . TRP A 1 279 ? -1.886  60.020 68.408 1.00 33.94 ? 279  TRP A CZ2 1 
ATOM   2140 C CZ3 . TRP A 1 279 ? -0.345  58.185 68.793 1.00 34.57 ? 279  TRP A CZ3 1 
ATOM   2141 C CH2 . TRP A 1 279 ? -0.686  59.403 68.163 1.00 34.31 ? 279  TRP A CH2 1 
ATOM   2142 N N   . ASN A 1 280 ? -5.309  53.630 71.921 1.00 31.34 ? 280  ASN A N   1 
ATOM   2143 C CA  . ASN A 1 280 ? -5.334  52.368 72.661 1.00 31.15 ? 280  ASN A CA  1 
ATOM   2144 C C   . ASN A 1 280 ? -4.972  51.115 71.838 1.00 30.93 ? 280  ASN A C   1 
ATOM   2145 O O   . ASN A 1 280 ? -4.829  50.033 72.397 1.00 31.00 ? 280  ASN A O   1 
ATOM   2146 C CB  . ASN A 1 280 ? -6.731  52.177 73.294 1.00 31.72 ? 280  ASN A CB  1 
ATOM   2147 C CG  . ASN A 1 280 ? -7.099  53.308 74.279 1.00 32.10 ? 280  ASN A CG  1 
ATOM   2148 O OD1 . ASN A 1 280 ? -6.242  54.119 74.668 1.00 33.47 ? 280  ASN A OD1 1 
ATOM   2149 N ND2 . ASN A 1 280 ? -8.359  53.367 74.682 1.00 31.62 ? 280  ASN A ND2 1 
ATOM   2150 N N   . VAL A 1 281 ? -4.776  51.238 70.527 1.00 30.76 ? 281  VAL A N   1 
ATOM   2151 C CA  . VAL A 1 281 ? -4.520  50.036 69.730 1.00 30.63 ? 281  VAL A CA  1 
ATOM   2152 C C   . VAL A 1 281 ? -3.075  49.748 69.406 1.00 30.31 ? 281  VAL A C   1 
ATOM   2153 O O   . VAL A 1 281 ? -2.777  48.731 68.759 1.00 29.96 ? 281  VAL A O   1 
ATOM   2154 C CB  . VAL A 1 281 ? -5.331  50.054 68.360 1.00 31.04 ? 281  VAL A CB  1 
ATOM   2155 C CG1 . VAL A 1 281 ? -6.852  50.267 68.651 1.00 31.15 ? 281  VAL A CG1 1 
ATOM   2156 C CG2 . VAL A 1 281 ? -4.801  51.188 67.414 1.00 31.05 ? 281  VAL A CG2 1 
ATOM   2157 N N   . LEU A 1 282 ? -2.190  50.648 69.804 1.00 29.50 ? 282  LEU A N   1 
ATOM   2158 C CA  . LEU A 1 282 ? -0.762  50.451 69.535 1.00 29.61 ? 282  LEU A CA  1 
ATOM   2159 C C   . LEU A 1 282 ? -0.309  49.130 70.148 1.00 30.03 ? 282  LEU A C   1 
ATOM   2160 O O   . LEU A 1 282 ? -0.732  48.767 71.252 1.00 29.50 ? 282  LEU A O   1 
ATOM   2161 C CB  . LEU A 1 282 ? 0.074   51.605 70.117 1.00 29.20 ? 282  LEU A CB  1 
ATOM   2162 C CG  . LEU A 1 282 ? -0.072  52.924 69.313 1.00 28.91 ? 282  LEU A CG  1 
ATOM   2163 C CD1 . LEU A 1 282 ? 0.812   54.003 69.925 1.00 28.71 ? 282  LEU A CD1 1 
ATOM   2164 C CD2 . LEU A 1 282 ? 0.303   52.677 67.857 1.00 28.28 ? 282  LEU A CD2 1 
ATOM   2165 N N   . PRO A 1 283 ? 0.551   48.388 69.451 1.00 30.03 ? 283  PRO A N   1 
ATOM   2166 C CA  . PRO A 1 283 ? 0.937   47.133 70.101 1.00 30.58 ? 283  PRO A CA  1 
ATOM   2167 C C   . PRO A 1 283 ? 1.926   47.315 71.263 1.00 31.21 ? 283  PRO A C   1 
ATOM   2168 O O   . PRO A 1 283 ? 1.950   46.507 72.183 1.00 31.72 ? 283  PRO A O   1 
ATOM   2169 C CB  . PRO A 1 283 ? 1.528   46.318 68.950 1.00 30.21 ? 283  PRO A CB  1 
ATOM   2170 C CG  . PRO A 1 283 ? 2.226   47.438 68.128 1.00 30.09 ? 283  PRO A CG  1 
ATOM   2171 C CD  . PRO A 1 283 ? 1.140   48.510 68.107 1.00 30.25 ? 283  PRO A CD  1 
ATOM   2172 N N   . PHE A 1 284 ? 2.731   48.370 71.257 1.00 31.22 ? 284  PHE A N   1 
ATOM   2173 C CA  . PHE A 1 284 ? 3.688   48.511 72.350 1.00 31.00 ? 284  PHE A CA  1 
ATOM   2174 C C   . PHE A 1 284 ? 3.611   49.859 73.020 1.00 30.21 ? 284  PHE A C   1 
ATOM   2175 O O   . PHE A 1 284 ? 2.965   50.775 72.527 1.00 29.88 ? 284  PHE A O   1 
ATOM   2176 C CB  . PHE A 1 284 ? 5.126   48.337 71.848 1.00 32.19 ? 284  PHE A CB  1 
ATOM   2177 C CG  . PHE A 1 284 ? 5.304   47.196 70.899 1.00 33.65 ? 284  PHE A CG  1 
ATOM   2178 C CD1 . PHE A 1 284 ? 5.296   45.877 71.367 1.00 34.67 ? 284  PHE A CD1 1 
ATOM   2179 C CD2 . PHE A 1 284 ? 5.447   47.437 69.535 1.00 34.24 ? 284  PHE A CD2 1 
ATOM   2180 C CE1 . PHE A 1 284 ? 5.425   44.798 70.482 1.00 35.11 ? 284  PHE A CE1 1 
ATOM   2181 C CE2 . PHE A 1 284 ? 5.579   46.396 68.623 1.00 35.21 ? 284  PHE A CE2 1 
ATOM   2182 C CZ  . PHE A 1 284 ? 5.568   45.051 69.102 1.00 35.60 ? 284  PHE A CZ  1 
ATOM   2183 N N   . ASP A 1 285 ? 4.295   49.965 74.152 1.00 29.50 ? 285  ASP A N   1 
ATOM   2184 C CA  . ASP A 1 285 ? 4.406   51.224 74.867 1.00 29.05 ? 285  ASP A CA  1 
ATOM   2185 C C   . ASP A 1 285 ? 5.465   51.875 73.978 1.00 29.00 ? 285  ASP A C   1 
ATOM   2186 O O   . ASP A 1 285 ? 6.607   51.422 73.878 1.00 29.04 ? 285  ASP A O   1 
ATOM   2187 C CB  . ASP A 1 285 ? 4.957   50.959 76.241 1.00 29.20 ? 285  ASP A CB  1 
ATOM   2188 C CG  . ASP A 1 285 ? 4.988   52.203 77.091 1.00 29.25 ? 285  ASP A CG  1 
ATOM   2189 O OD1 . ASP A 1 285 ? 4.556   53.282 76.619 1.00 28.08 ? 285  ASP A OD1 1 
ATOM   2190 O OD2 . ASP A 1 285 ? 5.462   52.058 78.228 1.00 30.11 ? 285  ASP A OD2 1 
ATOM   2191 N N   . SER A 1 286 ? 5.108   52.933 73.294 1.00 28.92 ? 286  SER A N   1 
ATOM   2192 C CA  . SER A 1 286 ? 6.082   53.452 72.384 1.00 29.17 ? 286  SER A CA  1 
ATOM   2193 C C   . SER A 1 286 ? 6.041   54.937 72.152 1.00 28.80 ? 286  SER A C   1 
ATOM   2194 O O   . SER A 1 286 ? 5.124   55.616 72.534 1.00 28.65 ? 286  SER A O   1 
ATOM   2195 C CB  . SER A 1 286 ? 5.890   52.742 71.032 1.00 29.38 ? 286  SER A CB  1 
ATOM   2196 O OG  . SER A 1 286 ? 4.579   53.058 70.519 1.00 30.58 ? 286  SER A OG  1 
ATOM   2197 N N   . ILE A 1 287 ? 7.048   55.401 71.452 1.00 28.64 ? 287  ILE A N   1 
ATOM   2198 C CA  . ILE A 1 287 ? 7.142   56.770 71.085 1.00 28.31 ? 287  ILE A CA  1 
ATOM   2199 C C   . ILE A 1 287 ? 7.308   56.783 69.563 1.00 27.95 ? 287  ILE A C   1 
ATOM   2200 O O   . ILE A 1 287 ? 7.903   55.841 68.990 1.00 27.03 ? 287  ILE A O   1 
ATOM   2201 C CB  . ILE A 1 287 ? 8.316   57.381 71.900 1.00 29.43 ? 287  ILE A CB  1 
ATOM   2202 C CG1 . ILE A 1 287 ? 7.810   58.643 72.467 1.00 29.93 ? 287  ILE A CG1 1 
ATOM   2203 C CG2 . ILE A 1 287 ? 9.618   57.510 71.193 1.00 29.09 ? 287  ILE A CG2 1 
ATOM   2204 C CD1 . ILE A 1 287 ? 6.880   58.274 73.466 1.00 31.30 ? 287  ILE A CD1 1 
ATOM   2205 N N   . PHE A 1 288 ? 6.749   57.794 68.902 1.00 26.73 ? 288  PHE A N   1 
ATOM   2206 C CA  . PHE A 1 288 ? 6.908   57.906 67.437 1.00 26.80 ? 288  PHE A CA  1 
ATOM   2207 C C   . PHE A 1 288 ? 6.277   56.726 66.662 1.00 26.83 ? 288  PHE A C   1 
ATOM   2208 O O   . PHE A 1 288 ? 6.871   56.203 65.703 1.00 27.15 ? 288  PHE A O   1 
ATOM   2209 C CB  . PHE A 1 288 ? 8.405   58.006 67.059 1.00 25.61 ? 288  PHE A CB  1 
ATOM   2210 C CG  . PHE A 1 288 ? 8.702   58.963 65.901 1.00 25.46 ? 288  PHE A CG  1 
ATOM   2211 C CD1 . PHE A 1 288 ? 7.989   58.871 64.668 1.00 25.04 ? 288  PHE A CD1 1 
ATOM   2212 C CD2 . PHE A 1 288 ? 9.689   59.947 66.035 1.00 24.09 ? 288  PHE A CD2 1 
ATOM   2213 C CE1 . PHE A 1 288 ? 8.250   59.732 63.598 1.00 24.36 ? 288  PHE A CE1 1 
ATOM   2214 C CE2 . PHE A 1 288 ? 9.965   60.813 64.991 1.00 24.64 ? 288  PHE A CE2 1 
ATOM   2215 C CZ  . PHE A 1 288 ? 9.251   60.722 63.758 1.00 25.08 ? 288  PHE A CZ  1 
ATOM   2216 N N   . ARG A 1 289 ? 5.095   56.302 67.103 1.00 26.77 ? 289  ARG A N   1 
ATOM   2217 C CA  . ARG A 1 289 ? 4.324   55.223 66.460 1.00 26.69 ? 289  ARG A CA  1 
ATOM   2218 C C   . ARG A 1 289 ? 2.856   55.728 66.489 1.00 26.92 ? 289  ARG A C   1 
ATOM   2219 O O   . ARG A 1 289 ? 2.402   56.334 67.487 1.00 26.76 ? 289  ARG A O   1 
ATOM   2220 C CB  . ARG A 1 289 ? 4.460   53.894 67.223 1.00 26.09 ? 289  ARG A CB  1 
ATOM   2221 C CG  . ARG A 1 289 ? 5.813   53.267 67.160 1.00 25.90 ? 289  ARG A CG  1 
ATOM   2222 C CD  . ARG A 1 289 ? 6.220   52.898 65.718 1.00 26.89 ? 289  ARG A CD  1 
ATOM   2223 N NE  . ARG A 1 289 ? 7.499   52.172 65.688 1.00 26.82 ? 289  ARG A NE  1 
ATOM   2224 C CZ  . ARG A 1 289 ? 8.702   52.738 65.574 1.00 26.86 ? 289  ARG A CZ  1 
ATOM   2225 N NH1 . ARG A 1 289 ? 8.821   54.046 65.481 1.00 26.74 ? 289  ARG A NH1 1 
ATOM   2226 N NH2 . ARG A 1 289 ? 9.790   51.999 65.527 1.00 26.27 ? 289  ARG A NH2 1 
ATOM   2227 N N   . PHE A 1 290 ? 2.141   55.475 65.393 1.00 26.86 ? 290  PHE A N   1 
ATOM   2228 C CA  . PHE A 1 290 ? 0.787   55.964 65.216 1.00 27.12 ? 290  PHE A CA  1 
ATOM   2229 C C   . PHE A 1 290 ? -0.102  54.808 64.831 1.00 27.33 ? 290  PHE A C   1 
ATOM   2230 O O   . PHE A 1 290 ? 0.298   53.909 64.126 1.00 27.79 ? 290  PHE A O   1 
ATOM   2231 C CB  . PHE A 1 290 ? 0.809   57.043 64.129 1.00 27.08 ? 290  PHE A CB  1 
ATOM   2232 C CG  . PHE A 1 290 ? 1.942   58.025 64.300 1.00 26.90 ? 290  PHE A CG  1 
ATOM   2233 C CD1 . PHE A 1 290 ? 1.981   58.857 65.398 1.00 26.82 ? 290  PHE A CD1 1 
ATOM   2234 C CD2 . PHE A 1 290 ? 3.020   58.031 63.410 1.00 26.81 ? 290  PHE A CD2 1 
ATOM   2235 C CE1 . PHE A 1 290 ? 3.074   59.692 65.631 1.00 26.77 ? 290  PHE A CE1 1 
ATOM   2236 C CE2 . PHE A 1 290 ? 4.121   58.850 63.618 1.00 26.92 ? 290  PHE A CE2 1 
ATOM   2237 C CZ  . PHE A 1 290 ? 4.154   59.689 64.737 1.00 27.23 ? 290  PHE A CZ  1 
ATOM   2238 N N   . SER A 1 291 ? -1.334  54.854 65.273 1.00 27.54 ? 291  SER A N   1 
ATOM   2239 C CA  . SER A 1 291 ? -2.238  53.742 65.054 1.00 27.71 ? 291  SER A CA  1 
ATOM   2240 C C   . SER A 1 291 ? -2.610  53.327 63.637 1.00 27.58 ? 291  SER A C   1 
ATOM   2241 O O   . SER A 1 291 ? -2.386  52.190 63.242 1.00 27.21 ? 291  SER A O   1 
ATOM   2242 C CB  . SER A 1 291 ? -3.502  53.973 65.869 1.00 27.56 ? 291  SER A CB  1 
ATOM   2243 O OG  . SER A 1 291 ? -3.119  54.008 67.213 1.00 28.01 ? 291  SER A OG  1 
ATOM   2244 N N   . PHE A 1 292 ? -3.155  54.254 62.873 1.00 27.41 ? 292  PHE A N   1 
ATOM   2245 C CA  . PHE A 1 292 ? -3.609  53.921 61.533 1.00 27.30 ? 292  PHE A CA  1 
ATOM   2246 C C   . PHE A 1 292 ? -2.784  54.587 60.504 1.00 27.28 ? 292  PHE A C   1 
ATOM   2247 O O   . PHE A 1 292 ? -2.841  55.814 60.324 1.00 27.47 ? 292  PHE A O   1 
ATOM   2248 C CB  . PHE A 1 292 ? -5.066  54.336 61.414 1.00 27.31 ? 292  PHE A CB  1 
ATOM   2249 C CG  . PHE A 1 292 ? -5.924  53.677 62.433 1.00 27.71 ? 292  PHE A CG  1 
ATOM   2250 C CD1 . PHE A 1 292 ? -6.359  52.359 62.239 1.00 28.32 ? 292  PHE A CD1 1 
ATOM   2251 C CD2 . PHE A 1 292 ? -6.241  54.325 63.621 1.00 27.95 ? 292  PHE A CD2 1 
ATOM   2252 C CE1 . PHE A 1 292 ? -7.123  51.678 63.257 1.00 28.44 ? 292  PHE A CE1 1 
ATOM   2253 C CE2 . PHE A 1 292 ? -6.976  53.680 64.626 1.00 28.02 ? 292  PHE A CE2 1 
ATOM   2254 C CZ  . PHE A 1 292 ? -7.421  52.345 64.442 1.00 28.11 ? 292  PHE A CZ  1 
ATOM   2255 N N   . VAL A 1 293 ? -2.038  53.770 59.803 1.00 26.68 ? 293  VAL A N   1 
ATOM   2256 C CA  . VAL A 1 293 ? -1.154  54.264 58.823 1.00 26.82 ? 293  VAL A CA  1 
ATOM   2257 C C   . VAL A 1 293 ? -1.272  53.364 57.593 1.00 27.83 ? 293  VAL A C   1 
ATOM   2258 O O   . VAL A 1 293 ? -1.995  52.360 57.619 1.00 28.04 ? 293  VAL A O   1 
ATOM   2259 C CB  . VAL A 1 293 ? 0.327   54.208 59.387 1.00 26.79 ? 293  VAL A CB  1 
ATOM   2260 C CG1 . VAL A 1 293 ? 0.527   55.216 60.575 1.00 25.82 ? 293  VAL A CG1 1 
ATOM   2261 C CG2 . VAL A 1 293 ? 0.681   52.765 59.802 1.00 25.47 ? 293  VAL A CG2 1 
ATOM   2262 N N   . PRO A 1 294 ? -0.582  53.723 56.501 1.00 27.89 ? 294  PRO A N   1 
ATOM   2263 C CA  . PRO A 1 294 ? -0.595  52.943 55.271 1.00 28.58 ? 294  PRO A CA  1 
ATOM   2264 C C   . PRO A 1 294 ? -0.280  51.429 55.526 1.00 29.47 ? 294  PRO A C   1 
ATOM   2265 O O   . PRO A 1 294 ? 0.502   51.078 56.451 1.00 28.78 ? 294  PRO A O   1 
ATOM   2266 C CB  . PRO A 1 294 ? 0.493   53.624 54.444 1.00 27.95 ? 294  PRO A CB  1 
ATOM   2267 C CG  . PRO A 1 294 ? 0.278   55.076 54.753 1.00 28.06 ? 294  PRO A CG  1 
ATOM   2268 C CD  . PRO A 1 294 ? 0.047   55.046 56.278 1.00 28.37 ? 294  PRO A CD  1 
ATOM   2269 N N   . VAL A 1 295 ? -0.906  50.559 54.724 1.00 29.95 ? 295  VAL A N   1 
ATOM   2270 C CA  . VAL A 1 295 ? -0.685  49.101 54.800 1.00 30.95 ? 295  VAL A CA  1 
ATOM   2271 C C   . VAL A 1 295 ? -0.056  48.543 53.529 1.00 30.92 ? 295  VAL A C   1 
ATOM   2272 O O   . VAL A 1 295 ? -0.433  48.909 52.428 1.00 29.98 ? 295  VAL A O   1 
ATOM   2273 C CB  . VAL A 1 295 ? -1.990  48.280 55.003 1.00 31.57 ? 295  VAL A CB  1 
ATOM   2274 C CG1 . VAL A 1 295 ? -2.356  48.297 56.407 1.00 32.64 ? 295  VAL A CG1 1 
ATOM   2275 C CG2 . VAL A 1 295 ? -3.136  48.856 54.185 1.00 31.75 ? 295  VAL A CG2 1 
ATOM   2276 N N   . ILE A 1 296 ? 0.910   47.653 53.712 1.00 31.45 ? 296  ILE A N   1 
ATOM   2277 C CA  . ILE A 1 296 ? 1.575   46.996 52.597 1.00 32.44 ? 296  ILE A CA  1 
ATOM   2278 C C   . ILE A 1 296 ? 0.513   45.957 52.154 1.00 33.42 ? 296  ILE A C   1 
ATOM   2279 O O   . ILE A 1 296 ? 0.422   44.834 52.657 1.00 33.40 ? 296  ILE A O   1 
ATOM   2280 C CB  . ILE A 1 296 ? 2.908   46.377 53.093 1.00 32.53 ? 296  ILE A CB  1 
ATOM   2281 C CG1 . ILE A 1 296 ? 3.739   47.506 53.768 1.00 32.00 ? 296  ILE A CG1 1 
ATOM   2282 C CG2 . ILE A 1 296 ? 3.684   45.773 51.896 1.00 31.77 ? 296  ILE A CG2 1 
ATOM   2283 C CD1 . ILE A 1 296 ? 3.980   48.741 52.810 1.00 31.38 ? 296  ILE A CD1 1 
ATOM   2284 N N   . ASP A 1 297 ? -0.323  46.386 51.219 1.00 33.86 ? 297  ASP A N   1 
ATOM   2285 C CA  . ASP A 1 297 ? -1.447  45.584 50.817 1.00 35.00 ? 297  ASP A CA  1 
ATOM   2286 C C   . ASP A 1 297 ? -1.339  44.763 49.535 1.00 35.39 ? 297  ASP A C   1 
ATOM   2287 O O   . ASP A 1 297 ? -2.256  44.034 49.234 1.00 35.90 ? 297  ASP A O   1 
ATOM   2288 C CB  . ASP A 1 297 ? -2.645  46.519 50.692 1.00 34.52 ? 297  ASP A CB  1 
ATOM   2289 C CG  . ASP A 1 297 ? -2.434  47.555 49.587 1.00 35.29 ? 297  ASP A CG  1 
ATOM   2290 O OD1 . ASP A 1 297 ? -1.281  47.717 49.093 1.00 34.97 ? 297  ASP A OD1 1 
ATOM   2291 O OD2 . ASP A 1 297 ? -3.415  48.224 49.212 1.00 36.19 ? 297  ASP A OD2 1 
ATOM   2292 N N   . GLY A 1 298 ? -0.275  44.891 48.761 1.00 35.77 ? 298  GLY A N   1 
ATOM   2293 C CA  . GLY A 1 298 ? -0.248  44.143 47.514 1.00 36.69 ? 298  GLY A CA  1 
ATOM   2294 C C   . GLY A 1 298 ? -0.976  44.881 46.367 1.00 37.27 ? 298  GLY A C   1 
ATOM   2295 O O   . GLY A 1 298 ? -1.071  44.355 45.258 1.00 37.32 ? 298  GLY A O   1 
ATOM   2296 N N   . GLU A 1 299 ? -1.497  46.083 46.620 1.00 37.14 ? 299  GLU A N   1 
ATOM   2297 C CA  . GLU A 1 299 ? -2.209  46.842 45.593 1.00 36.81 ? 299  GLU A CA  1 
ATOM   2298 C C   . GLU A 1 299 ? -1.563  48.210 45.433 1.00 35.52 ? 299  GLU A C   1 
ATOM   2299 O O   . GLU A 1 299 ? -0.859  48.429 44.460 1.00 35.51 ? 299  GLU A O   1 
ATOM   2300 C CB  . GLU A 1 299 ? -3.669  46.981 45.979 1.00 38.81 ? 299  GLU A CB  1 
ATOM   2301 C CG  . GLU A 1 299 ? -4.351  45.644 45.950 1.00 42.81 ? 299  GLU A CG  1 
ATOM   2302 C CD  . GLU A 1 299 ? -5.716  45.657 46.619 1.00 44.81 ? 299  GLU A CD  1 
ATOM   2303 O OE1 . GLU A 1 299 ? -6.642  46.344 46.077 1.00 45.88 ? 299  GLU A OE1 1 
ATOM   2304 O OE2 . GLU A 1 299 ? -5.840  44.981 47.688 1.00 45.74 ? 299  GLU A OE2 1 
ATOM   2305 N N   . PHE A 1 300 ? -1.818  49.130 46.361 1.00 33.79 ? 300  PHE A N   1 
ATOM   2306 C CA  . PHE A 1 300 ? -1.161  50.418 46.302 1.00 32.62 ? 300  PHE A CA  1 
ATOM   2307 C C   . PHE A 1 300 ? 0.356   50.111 46.288 1.00 32.29 ? 300  PHE A C   1 
ATOM   2308 O O   . PHE A 1 300 ? 1.108   50.698 45.515 1.00 32.22 ? 300  PHE A O   1 
ATOM   2309 C CB  . PHE A 1 300 ? -1.552  51.260 47.518 1.00 32.27 ? 300  PHE A CB  1 
ATOM   2310 C CG  . PHE A 1 300 ? -1.151  52.710 47.402 1.00 32.73 ? 300  PHE A CG  1 
ATOM   2311 C CD1 . PHE A 1 300 ? 0.193   53.113 47.652 1.00 32.37 ? 300  PHE A CD1 1 
ATOM   2312 C CD2 . PHE A 1 300 ? -2.095  53.679 47.028 1.00 31.88 ? 300  PHE A CD2 1 
ATOM   2313 C CE1 . PHE A 1 300 ? 0.570   54.462 47.537 1.00 31.95 ? 300  PHE A CE1 1 
ATOM   2314 C CE2 . PHE A 1 300 ? -1.741  55.011 46.903 1.00 31.95 ? 300  PHE A CE2 1 
ATOM   2315 C CZ  . PHE A 1 300 ? -0.393  55.414 47.164 1.00 31.83 ? 300  PHE A CZ  1 
ATOM   2316 N N   . PHE A 1 301 ? 0.805   49.183 47.137 1.00 32.04 ? 301  PHE A N   1 
ATOM   2317 C CA  . PHE A 1 301 ? 2.220   48.773 47.174 1.00 31.67 ? 301  PHE A CA  1 
ATOM   2318 C C   . PHE A 1 301 ? 2.170   47.329 46.648 1.00 32.31 ? 301  PHE A C   1 
ATOM   2319 O O   . PHE A 1 301 ? 1.645   46.434 47.311 1.00 33.17 ? 301  PHE A O   1 
ATOM   2320 C CB  . PHE A 1 301 ? 2.759   48.845 48.613 1.00 30.38 ? 301  PHE A CB  1 
ATOM   2321 C CG  . PHE A 1 301 ? 2.631   50.227 49.233 1.00 29.16 ? 301  PHE A CG  1 
ATOM   2322 C CD1 . PHE A 1 301 ? 3.426   51.286 48.790 1.00 28.52 ? 301  PHE A CD1 1 
ATOM   2323 C CD2 . PHE A 1 301 ? 1.695   50.478 50.233 1.00 28.34 ? 301  PHE A CD2 1 
ATOM   2324 C CE1 . PHE A 1 301 ? 3.285   52.572 49.342 1.00 28.31 ? 301  PHE A CE1 1 
ATOM   2325 C CE2 . PHE A 1 301 ? 1.554   51.767 50.787 1.00 28.17 ? 301  PHE A CE2 1 
ATOM   2326 C CZ  . PHE A 1 301 ? 2.364   52.821 50.331 1.00 27.04 ? 301  PHE A CZ  1 
ATOM   2327 N N   . PRO A 1 302 ? 2.680   47.083 45.436 1.00 32.51 ? 302  PRO A N   1 
ATOM   2328 C CA  . PRO A 1 302 ? 2.595   45.695 44.948 1.00 32.66 ? 302  PRO A CA  1 
ATOM   2329 C C   . PRO A 1 302 ? 3.330   44.667 45.801 1.00 32.64 ? 302  PRO A C   1 
ATOM   2330 O O   . PRO A 1 302 ? 2.851   43.559 45.948 1.00 32.76 ? 302  PRO A O   1 
ATOM   2331 C CB  . PRO A 1 302 ? 3.156   45.782 43.505 1.00 32.77 ? 302  PRO A CB  1 
ATOM   2332 C CG  . PRO A 1 302 ? 3.096   47.299 43.170 1.00 32.85 ? 302  PRO A CG  1 
ATOM   2333 C CD  . PRO A 1 302 ? 3.369   47.964 44.470 1.00 32.26 ? 302  PRO A CD  1 
ATOM   2334 N N   . THR A 1 303 ? 4.499   45.017 46.342 1.00 32.35 ? 303  THR A N   1 
ATOM   2335 C CA  . THR A 1 303 ? 5.245   44.098 47.190 1.00 32.31 ? 303  THR A CA  1 
ATOM   2336 C C   . THR A 1 303 ? 5.847   44.900 48.356 1.00 31.95 ? 303  THR A C   1 
ATOM   2337 O O   . THR A 1 303 ? 5.514   46.092 48.529 1.00 32.14 ? 303  THR A O   1 
ATOM   2338 C CB  . THR A 1 303 ? 6.389   43.407 46.408 1.00 33.07 ? 303  THR A CB  1 
ATOM   2339 O OG1 . THR A 1 303 ? 7.386   44.369 46.033 1.00 34.08 ? 303  THR A OG1 1 
ATOM   2340 C CG2 . THR A 1 303 ? 5.863   42.769 45.134 1.00 33.32 ? 303  THR A CG2 1 
ATOM   2341 N N   . SER A 1 304 ? 6.717   44.268 49.142 1.00 30.84 ? 304  SER A N   1 
ATOM   2342 C CA  . SER A 1 304 ? 7.340   44.946 50.274 1.00 30.60 ? 304  SER A CA  1 
ATOM   2343 C C   . SER A 1 304 ? 8.067   46.205 49.782 1.00 30.42 ? 304  SER A C   1 
ATOM   2344 O O   . SER A 1 304 ? 8.547   46.234 48.650 1.00 30.16 ? 304  SER A O   1 
ATOM   2345 C CB  . SER A 1 304 ? 8.358   44.048 50.982 1.00 29.98 ? 304  SER A CB  1 
ATOM   2346 O OG  . SER A 1 304 ? 9.501   43.892 50.164 1.00 30.01 ? 304  SER A OG  1 
ATOM   2347 N N   . LEU A 1 305 ? 8.155   47.234 50.631 1.00 30.45 ? 305  LEU A N   1 
ATOM   2348 C CA  . LEU A 1 305 ? 8.817   48.446 50.198 1.00 31.00 ? 305  LEU A CA  1 
ATOM   2349 C C   . LEU A 1 305 ? 10.309  48.190 49.893 1.00 31.27 ? 305  LEU A C   1 
ATOM   2350 O O   . LEU A 1 305 ? 10.867  48.725 48.923 1.00 31.04 ? 305  LEU A O   1 
ATOM   2351 C CB  . LEU A 1 305 ? 8.650   49.540 51.245 1.00 30.39 ? 305  LEU A CB  1 
ATOM   2352 C CG  . LEU A 1 305 ? 7.206   49.892 51.640 1.00 30.54 ? 305  LEU A CG  1 
ATOM   2353 C CD1 . LEU A 1 305 ? 7.228   51.025 52.708 1.00 29.77 ? 305  LEU A CD1 1 
ATOM   2354 C CD2 . LEU A 1 305 ? 6.395   50.311 50.387 1.00 30.27 ? 305  LEU A CD2 1 
ATOM   2355 N N   . GLU A 1 306 ? 10.951  47.371 50.713 1.00 31.97 ? 306  GLU A N   1 
ATOM   2356 C CA  . GLU A 1 306 ? 12.363  47.083 50.480 1.00 32.77 ? 306  GLU A CA  1 
ATOM   2357 C C   . GLU A 1 306 ? 12.587  46.356 49.154 1.00 32.73 ? 306  GLU A C   1 
ATOM   2358 O O   . GLU A 1 306 ? 13.545  46.679 48.422 1.00 32.75 ? 306  GLU A O   1 
ATOM   2359 C CB  . GLU A 1 306 ? 12.958  46.239 51.622 1.00 33.59 ? 306  GLU A CB  1 
ATOM   2360 C CG  . GLU A 1 306 ? 14.462  45.935 51.423 1.00 35.41 ? 306  GLU A CG  1 
ATOM   2361 C CD  . GLU A 1 306 ? 15.352  47.182 51.578 1.00 36.92 ? 306  GLU A CD  1 
ATOM   2362 O OE1 . GLU A 1 306 ? 14.855  48.252 52.042 1.00 37.94 ? 306  GLU A OE1 1 
ATOM   2363 O OE2 . GLU A 1 306 ? 16.554  47.103 51.253 1.00 37.12 ? 306  GLU A OE2 1 
ATOM   2364 N N   . SER A 1 307 ? 11.742  45.379 48.817 1.00 32.38 ? 307  SER A N   1 
ATOM   2365 C CA  . SER A 1 307 ? 11.997  44.716 47.539 1.00 32.83 ? 307  SER A CA  1 
ATOM   2366 C C   . SER A 1 307 ? 11.733  45.688 46.365 1.00 32.71 ? 307  SER A C   1 
ATOM   2367 O O   . SER A 1 307 ? 12.421  45.625 45.347 1.00 32.26 ? 307  SER A O   1 
ATOM   2368 C CB  . SER A 1 307 ? 11.194  43.423 47.403 1.00 32.88 ? 307  SER A CB  1 
ATOM   2369 O OG  . SER A 1 307 ? 9.818   43.668 47.469 1.00 34.31 ? 307  SER A OG  1 
ATOM   2370 N N   . MET A 1 308 ? 10.767  46.604 46.520 1.00 32.59 ? 308  MET A N   1 
ATOM   2371 C CA  . MET A 1 308 ? 10.530  47.595 45.472 1.00 32.72 ? 308  MET A CA  1 
ATOM   2372 C C   . MET A 1 308 ? 11.774  48.515 45.366 1.00 32.59 ? 308  MET A C   1 
ATOM   2373 O O   . MET A 1 308 ? 12.243  48.801 44.303 1.00 32.01 ? 308  MET A O   1 
ATOM   2374 C CB  . MET A 1 308 ? 9.264   48.421 45.793 1.00 32.69 ? 308  MET A CB  1 
ATOM   2375 C CG  . MET A 1 308 ? 7.981   47.638 45.743 1.00 32.29 ? 308  MET A CG  1 
ATOM   2376 S SD  . MET A 1 308 ? 6.479   48.641 46.002 1.00 34.18 ? 308  MET A SD  1 
ATOM   2377 C CE  . MET A 1 308 ? 6.550   49.692 44.373 1.00 32.84 ? 308  MET A CE  1 
ATOM   2378 N N   . LEU A 1 309 ? 12.305  48.971 46.483 1.00 33.33 ? 309  LEU A N   1 
ATOM   2379 C CA  . LEU A 1 309 ? 13.487  49.834 46.444 1.00 34.57 ? 309  LEU A CA  1 
ATOM   2380 C C   . LEU A 1 309 ? 14.682  49.080 45.848 1.00 35.61 ? 309  LEU A C   1 
ATOM   2381 O O   . LEU A 1 309 ? 15.456  49.614 45.029 1.00 35.58 ? 309  LEU A O   1 
ATOM   2382 C CB  . LEU A 1 309 ? 13.833  50.297 47.854 1.00 33.96 ? 309  LEU A CB  1 
ATOM   2383 C CG  . LEU A 1 309 ? 12.841  51.290 48.468 1.00 34.25 ? 309  LEU A CG  1 
ATOM   2384 C CD1 . LEU A 1 309 ? 13.193  51.528 49.919 1.00 33.56 ? 309  LEU A CD1 1 
ATOM   2385 C CD2 . LEU A 1 309 ? 12.856  52.618 47.686 1.00 33.59 ? 309  LEU A CD2 1 
ATOM   2386 N N   . ASN A 1 310 ? 14.839  47.828 46.272 1.00 36.57 ? 310  ASN A N   1 
ATOM   2387 C CA  . ASN A 1 310 ? 15.923  47.014 45.768 1.00 37.23 ? 310  ASN A CA  1 
ATOM   2388 C C   . ASN A 1 310 ? 15.833  46.725 44.278 1.00 36.92 ? 310  ASN A C   1 
ATOM   2389 O O   . ASN A 1 310 ? 16.857  46.723 43.575 1.00 36.71 ? 310  ASN A O   1 
ATOM   2390 C CB  . ASN A 1 310 ? 15.996  45.698 46.532 1.00 38.84 ? 310  ASN A CB  1 
ATOM   2391 C CG  . ASN A 1 310 ? 16.894  45.796 47.732 1.00 40.09 ? 310  ASN A CG  1 
ATOM   2392 O OD1 . ASN A 1 310 ? 17.976  46.414 47.658 1.00 40.89 ? 310  ASN A OD1 1 
ATOM   2393 N ND2 . ASN A 1 310 ? 16.469  45.195 48.856 1.00 41.05 ? 310  ASN A ND2 1 
ATOM   2394 N N   . SER A 1 311 ? 14.617  46.515 43.784 1.00 36.36 ? 311  SER A N   1 
ATOM   2395 C CA  . SER A 1 311 ? 14.469  46.212 42.375 1.00 36.05 ? 311  SER A CA  1 
ATOM   2396 C C   . SER A 1 311 ? 14.279  47.423 41.451 1.00 35.43 ? 311  SER A C   1 
ATOM   2397 O O   . SER A 1 311 ? 14.200  47.255 40.244 1.00 35.26 ? 311  SER A O   1 
ATOM   2398 C CB  . SER A 1 311 ? 13.309  45.205 42.168 1.00 36.60 ? 311  SER A CB  1 
ATOM   2399 O OG  . SER A 1 311 ? 12.031  45.792 42.451 1.00 37.90 ? 311  SER A OG  1 
ATOM   2400 N N   . GLY A 1 312 ? 14.235  48.645 41.974 1.00 34.79 ? 312  GLY A N   1 
ATOM   2401 C CA  . GLY A 1 312 ? 14.031  49.766 41.071 1.00 33.12 ? 312  GLY A CA  1 
ATOM   2402 C C   . GLY A 1 312 ? 12.563  49.837 40.638 1.00 32.53 ? 312  GLY A C   1 
ATOM   2403 O O   . GLY A 1 312 ? 12.179  50.459 39.640 1.00 32.05 ? 312  GLY A O   1 
ATOM   2404 N N   . ASN A 1 313 ? 11.708  49.182 41.394 1.00 32.18 ? 313  ASN A N   1 
ATOM   2405 C CA  . ASN A 1 313 ? 10.323  49.228 41.052 1.00 31.74 ? 313  ASN A CA  1 
ATOM   2406 C C   . ASN A 1 313 ? 9.745   50.534 41.622 1.00 31.60 ? 313  ASN A C   1 
ATOM   2407 O O   . ASN A 1 313 ? 9.086   50.553 42.674 1.00 31.59 ? 313  ASN A O   1 
ATOM   2408 C CB  . ASN A 1 313 ? 9.591   48.024 41.615 1.00 31.64 ? 313  ASN A CB  1 
ATOM   2409 C CG  . ASN A 1 313 ? 8.191   47.932 41.083 1.00 32.30 ? 313  ASN A CG  1 
ATOM   2410 O OD1 . ASN A 1 313 ? 7.798   48.746 40.217 1.00 32.47 ? 313  ASN A OD1 1 
ATOM   2411 N ND2 . ASN A 1 313 ? 7.428   46.963 41.563 1.00 31.33 ? 313  ASN A ND2 1 
ATOM   2412 N N   . PHE A 1 314 ? 10.008  51.627 40.917 1.00 31.06 ? 314  PHE A N   1 
ATOM   2413 C CA  . PHE A 1 314 ? 9.525   52.939 41.341 1.00 30.44 ? 314  PHE A CA  1 
ATOM   2414 C C   . PHE A 1 314 ? 9.723   54.019 40.271 1.00 30.39 ? 314  PHE A C   1 
ATOM   2415 O O   . PHE A 1 314 ? 10.433  53.812 39.294 1.00 29.71 ? 314  PHE A O   1 
ATOM   2416 C CB  . PHE A 1 314 ? 10.178  53.346 42.672 1.00 29.01 ? 314  PHE A CB  1 
ATOM   2417 C CG  . PHE A 1 314 ? 11.676  53.315 42.669 1.00 28.10 ? 314  PHE A CG  1 
ATOM   2418 C CD1 . PHE A 1 314 ? 12.415  54.326 42.027 1.00 27.61 ? 314  PHE A CD1 1 
ATOM   2419 C CD2 . PHE A 1 314 ? 12.367  52.289 43.360 1.00 27.53 ? 314  PHE A CD2 1 
ATOM   2420 C CE1 . PHE A 1 314 ? 13.851  54.326 42.076 1.00 26.85 ? 314  PHE A CE1 1 
ATOM   2421 C CE2 . PHE A 1 314 ? 13.756  52.277 43.419 1.00 26.46 ? 314  PHE A CE2 1 
ATOM   2422 C CZ  . PHE A 1 314 ? 14.510  53.299 42.778 1.00 26.14 ? 314  PHE A CZ  1 
ATOM   2423 N N   . LYS A 1 315 ? 9.103   55.173 40.463 1.00 30.46 ? 315  LYS A N   1 
ATOM   2424 C CA  . LYS A 1 315 ? 9.235   56.204 39.455 1.00 30.96 ? 315  LYS A CA  1 
ATOM   2425 C C   . LYS A 1 315 ? 10.649  56.778 39.412 1.00 31.47 ? 315  LYS A C   1 
ATOM   2426 O O   . LYS A 1 315 ? 11.191  57.172 40.449 1.00 31.07 ? 315  LYS A O   1 
ATOM   2427 C CB  . LYS A 1 315 ? 8.245   57.339 39.723 1.00 30.86 ? 315  LYS A CB  1 
ATOM   2428 C CG  . LYS A 1 315 ? 8.293   58.444 38.674 1.00 29.88 ? 315  LYS A CG  1 
ATOM   2429 C CD  . LYS A 1 315 ? 7.471   59.617 39.183 1.00 29.71 ? 315  LYS A CD  1 
ATOM   2430 C CE  . LYS A 1 315 ? 7.390   60.741 38.168 1.00 28.80 ? 315  LYS A CE  1 
ATOM   2431 N NZ  . LYS A 1 315 ? 6.407   60.374 37.107 1.00 27.45 ? 315  LYS A NZ  1 
ATOM   2432 N N   . LYS A 1 316 ? 11.249  56.809 38.225 1.00 31.77 ? 316  LYS A N   1 
ATOM   2433 C CA  . LYS A 1 316 ? 12.581  57.367 38.076 1.00 32.53 ? 316  LYS A CA  1 
ATOM   2434 C C   . LYS A 1 316 ? 12.504  58.867 37.701 1.00 32.32 ? 316  LYS A C   1 
ATOM   2435 O O   . LYS A 1 316 ? 11.967  59.221 36.672 1.00 32.22 ? 316  LYS A O   1 
ATOM   2436 C CB  . LYS A 1 316 ? 13.354  56.622 36.989 1.00 33.96 ? 316  LYS A CB  1 
ATOM   2437 C CG  . LYS A 1 316 ? 13.980  55.282 37.440 1.00 36.17 ? 316  LYS A CG  1 
ATOM   2438 C CD  . LYS A 1 316 ? 12.937  54.283 37.768 1.00 37.18 ? 316  LYS A CD  1 
ATOM   2439 C CE  . LYS A 1 316 ? 13.431  52.852 37.494 1.00 38.47 ? 316  LYS A CE  1 
ATOM   2440 N NZ  . LYS A 1 316 ? 12.202  51.949 37.296 1.00 39.11 ? 316  LYS A NZ  1 
ATOM   2441 N N   . THR A 1 317 ? 13.028  59.755 38.533 1.00 31.70 ? 317  THR A N   1 
ATOM   2442 C CA  . THR A 1 317 ? 12.971  61.161 38.183 1.00 30.85 ? 317  THR A CA  1 
ATOM   2443 C C   . THR A 1 317 ? 13.985  61.774 39.138 1.00 30.99 ? 317  THR A C   1 
ATOM   2444 O O   . THR A 1 317 ? 14.855  61.034 39.683 1.00 30.43 ? 317  THR A O   1 
ATOM   2445 C CB  . THR A 1 317 ? 11.535  61.659 38.430 1.00 30.67 ? 317  THR A CB  1 
ATOM   2446 O OG1 . THR A 1 317 ? 11.424  63.034 38.068 1.00 29.76 ? 317  THR A OG1 1 
ATOM   2447 C CG2 . THR A 1 317 ? 11.153  61.446 39.938 1.00 29.93 ? 317  THR A CG2 1 
ATOM   2448 N N   . GLN A 1 318 ? 13.901  63.095 39.330 1.00 30.58 ? 318  GLN A N   1 
ATOM   2449 C CA  . GLN A 1 318 ? 14.783  63.798 40.266 1.00 30.43 ? 318  GLN A CA  1 
ATOM   2450 C C   . GLN A 1 318 ? 14.058  63.971 41.610 1.00 29.72 ? 318  GLN A C   1 
ATOM   2451 O O   . GLN A 1 318 ? 12.836  64.166 41.665 1.00 29.10 ? 318  GLN A O   1 
ATOM   2452 C CB  . GLN A 1 318 ? 15.162  65.228 39.782 1.00 31.49 ? 318  GLN A CB  1 
ATOM   2453 C CG  . GLN A 1 318 ? 15.770  65.332 38.406 1.00 33.39 ? 318  GLN A CG  1 
ATOM   2454 C CD  . GLN A 1 318 ? 14.711  65.268 37.310 1.00 34.31 ? 318  GLN A CD  1 
ATOM   2455 O OE1 . GLN A 1 318 ? 13.606  65.765 37.479 1.00 34.47 ? 318  GLN A OE1 1 
ATOM   2456 N NE2 . GLN A 1 318 ? 15.051  64.633 36.179 1.00 35.59 ? 318  GLN A NE2 1 
ATOM   2457 N N   . ILE A 1 319 ? 14.821  63.943 42.694 1.00 28.97 ? 319  ILE A N   1 
ATOM   2458 C CA  . ILE A 1 319 ? 14.222  64.137 43.985 1.00 28.18 ? 319  ILE A CA  1 
ATOM   2459 C C   . ILE A 1 319 ? 15.134  65.069 44.751 1.00 27.97 ? 319  ILE A C   1 
ATOM   2460 O O   . ILE A 1 319 ? 16.365  65.125 44.480 1.00 27.66 ? 319  ILE A O   1 
ATOM   2461 C CB  . ILE A 1 319 ? 14.048  62.782 44.773 1.00 27.91 ? 319  ILE A CB  1 
ATOM   2462 C CG1 . ILE A 1 319 ? 15.405  62.095 44.994 1.00 27.96 ? 319  ILE A CG1 1 
ATOM   2463 C CG2 . ILE A 1 319 ? 13.088  61.868 44.038 1.00 28.08 ? 319  ILE A CG2 1 
ATOM   2464 C CD1 . ILE A 1 319 ? 15.407  60.900 46.047 1.00 26.96 ? 319  ILE A CD1 1 
ATOM   2465 N N   . LEU A 1 320 ? 14.535  65.838 45.659 1.00 27.28 ? 320  LEU A N   1 
ATOM   2466 C CA  . LEU A 1 320 ? 15.300  66.724 46.545 1.00 27.67 ? 320  LEU A CA  1 
ATOM   2467 C C   . LEU A 1 320 ? 14.720  66.397 47.937 1.00 27.91 ? 320  LEU A C   1 
ATOM   2468 O O   . LEU A 1 320 ? 13.483  66.302 48.125 1.00 27.96 ? 320  LEU A O   1 
ATOM   2469 C CB  . LEU A 1 320 ? 15.138  68.191 46.143 1.00 27.75 ? 320  LEU A CB  1 
ATOM   2470 C CG  . LEU A 1 320 ? 15.890  69.242 46.974 1.00 28.59 ? 320  LEU A CG  1 
ATOM   2471 C CD1 . LEU A 1 320 ? 16.131  70.509 46.102 1.00 28.60 ? 320  LEU A CD1 1 
ATOM   2472 C CD2 . LEU A 1 320 ? 15.059  69.635 48.219 1.00 28.33 ? 320  LEU A CD2 1 
ATOM   2473 N N   . LEU A 1 321 ? 15.600  66.178 48.913 1.00 27.40 ? 321  LEU A N   1 
ATOM   2474 C CA  . LEU A 1 321 ? 15.109  65.769 50.196 1.00 26.47 ? 321  LEU A CA  1 
ATOM   2475 C C   . LEU A 1 321 ? 16.157  65.987 51.275 1.00 26.53 ? 321  LEU A C   1 
ATOM   2476 O O   . LEU A 1 321 ? 17.345  66.217 50.997 1.00 26.05 ? 321  LEU A O   1 
ATOM   2477 C CB  . LEU A 1 321 ? 14.733  64.274 50.114 1.00 26.47 ? 321  LEU A CB  1 
ATOM   2478 C CG  . LEU A 1 321 ? 15.870  63.192 50.063 1.00 26.23 ? 321  LEU A CG  1 
ATOM   2479 C CD1 . LEU A 1 321 ? 15.268  61.751 50.043 1.00 25.68 ? 321  LEU A CD1 1 
ATOM   2480 C CD2 . LEU A 1 321 ? 16.687  63.395 48.796 1.00 25.50 ? 321  LEU A CD2 1 
ATOM   2481 N N   . GLY A 1 322 ? 15.714  65.864 52.516 1.00 26.26 ? 322  GLY A N   1 
ATOM   2482 C CA  . GLY A 1 322 ? 16.625  66.070 53.608 1.00 26.93 ? 322  GLY A CA  1 
ATOM   2483 C C   . GLY A 1 322 ? 15.952  65.990 54.941 1.00 27.41 ? 322  GLY A C   1 
ATOM   2484 O O   . GLY A 1 322 ? 14.740  65.677 55.049 1.00 26.97 ? 322  GLY A O   1 
ATOM   2485 N N   . VAL A 1 323 ? 16.757  66.268 55.977 1.00 27.76 ? 323  VAL A N   1 
ATOM   2486 C CA  . VAL A 1 323 ? 16.297  66.181 57.346 1.00 27.28 ? 323  VAL A CA  1 
ATOM   2487 C C   . VAL A 1 323 ? 16.750  67.376 58.182 1.00 28.02 ? 323  VAL A C   1 
ATOM   2488 O O   . VAL A 1 323 ? 17.576  68.176 57.746 1.00 28.56 ? 323  VAL A O   1 
ATOM   2489 C CB  . VAL A 1 323 ? 16.855  64.910 57.976 1.00 27.11 ? 323  VAL A CB  1 
ATOM   2490 C CG1 . VAL A 1 323 ? 16.555  63.717 57.088 1.00 27.33 ? 323  VAL A CG1 1 
ATOM   2491 C CG2 . VAL A 1 323 ? 18.378  65.031 58.159 1.00 26.52 ? 323  VAL A CG2 1 
ATOM   2492 N N   . ASN A 1 324 ? 16.192  67.498 59.377 1.00 27.55 ? 324  ASN A N   1 
ATOM   2493 C CA  . ASN A 1 324 ? 16.593  68.532 60.313 1.00 27.77 ? 324  ASN A CA  1 
ATOM   2494 C C   . ASN A 1 324 ? 17.518  67.917 61.349 1.00 27.83 ? 324  ASN A C   1 
ATOM   2495 O O   . ASN A 1 324 ? 17.527  66.715 61.581 1.00 27.86 ? 324  ASN A O   1 
ATOM   2496 C CB  . ASN A 1 324 ? 15.402  69.109 61.020 1.00 26.99 ? 324  ASN A CB  1 
ATOM   2497 C CG  . ASN A 1 324 ? 14.468  69.846 60.079 1.00 27.22 ? 324  ASN A CG  1 
ATOM   2498 O OD1 . ASN A 1 324 ? 14.742  70.001 58.854 1.00 26.70 ? 324  ASN A OD1 1 
ATOM   2499 N ND2 . ASN A 1 324 ? 13.348  70.312 60.642 1.00 26.77 ? 324  ASN A ND2 1 
ATOM   2500 N N   . LYS A 1 325 ? 18.305  68.752 61.986 1.00 28.20 ? 325  LYS A N   1 
ATOM   2501 C CA  . LYS A 1 325 ? 19.259  68.259 62.974 1.00 28.37 ? 325  LYS A CA  1 
ATOM   2502 C C   . LYS A 1 325 ? 18.735  67.511 64.195 1.00 27.85 ? 325  LYS A C   1 
ATOM   2503 O O   . LYS A 1 325 ? 19.329  66.515 64.607 1.00 27.08 ? 325  LYS A O   1 
ATOM   2504 C CB  . LYS A 1 325 ? 20.133  69.410 63.458 1.00 28.75 ? 325  LYS A CB  1 
ATOM   2505 C CG  . LYS A 1 325 ? 21.290  68.964 64.351 1.00 30.27 ? 325  LYS A CG  1 
ATOM   2506 C CD  . LYS A 1 325 ? 22.010  70.191 64.871 1.00 31.62 ? 325  LYS A CD  1 
ATOM   2507 C CE  . LYS A 1 325 ? 23.346  69.811 65.430 1.00 32.25 ? 325  LYS A CE  1 
ATOM   2508 N NZ  . LYS A 1 325 ? 23.191  69.251 66.762 1.00 33.53 ? 325  LYS A NZ  1 
ATOM   2509 N N   . ASP A 1 326 ? 17.642  67.994 64.784 1.00 28.00 ? 326  ASP A N   1 
ATOM   2510 C CA  . ASP A 1 326 ? 17.113  67.376 66.022 1.00 27.86 ? 326  ASP A CA  1 
ATOM   2511 C C   . ASP A 1 326 ? 15.678  66.891 65.842 1.00 28.59 ? 326  ASP A C   1 
ATOM   2512 O O   . ASP A 1 326 ? 14.700  67.390 66.497 1.00 29.19 ? 326  ASP A O   1 
ATOM   2513 C CB  . ASP A 1 326 ? 17.211  68.406 67.178 1.00 27.54 ? 326  ASP A CB  1 
ATOM   2514 C CG  . ASP A 1 326 ? 18.638  68.983 67.347 1.00 27.19 ? 326  ASP A CG  1 
ATOM   2515 O OD1 . ASP A 1 326 ? 19.545  68.235 67.764 1.00 26.33 ? 326  ASP A OD1 1 
ATOM   2516 O OD2 . ASP A 1 326 ? 18.843  70.186 67.055 1.00 27.00 ? 326  ASP A OD2 1 
ATOM   2517 N N   . GLU A 1 327 ? 15.535  65.925 64.936 1.00 28.48 ? 327  GLU A N   1 
ATOM   2518 C CA  . GLU A 1 327 ? 14.246  65.367 64.613 1.00 28.13 ? 327  GLU A CA  1 
ATOM   2519 C C   . GLU A 1 327 ? 13.539  64.750 65.830 1.00 28.14 ? 327  GLU A C   1 
ATOM   2520 O O   . GLU A 1 327 ? 12.331  64.875 65.929 1.00 28.80 ? 327  GLU A O   1 
ATOM   2521 C CB  . GLU A 1 327 ? 14.374  64.296 63.493 1.00 27.93 ? 327  GLU A CB  1 
ATOM   2522 C CG  . GLU A 1 327 ? 14.859  64.783 62.132 1.00 28.08 ? 327  GLU A CG  1 
ATOM   2523 C CD  . GLU A 1 327 ? 13.755  65.435 61.309 1.00 29.03 ? 327  GLU A CD  1 
ATOM   2524 O OE1 . GLU A 1 327 ? 12.547  65.409 61.738 1.00 28.97 ? 327  GLU A OE1 1 
ATOM   2525 O OE2 . GLU A 1 327 ? 14.089  65.965 60.216 1.00 28.83 ? 327  GLU A OE2 1 
ATOM   2526 N N   . GLY A 1 328 ? 14.248  64.121 66.763 1.00 27.91 ? 328  GLY A N   1 
ATOM   2527 C CA  . GLY A 1 328 ? 13.550  63.480 67.865 1.00 28.08 ? 328  GLY A CA  1 
ATOM   2528 C C   . GLY A 1 328 ? 13.024  64.240 69.077 1.00 28.53 ? 328  GLY A C   1 
ATOM   2529 O O   . GLY A 1 328 ? 12.147  63.716 69.800 1.00 28.20 ? 328  GLY A O   1 
ATOM   2530 N N   . SER A 1 329 ? 13.510  65.464 69.324 1.00 29.12 ? 329  SER A N   1 
ATOM   2531 C CA  . SER A 1 329 ? 13.106  66.189 70.546 1.00 29.47 ? 329  SER A CA  1 
ATOM   2532 C C   . SER A 1 329 ? 11.590  66.276 70.846 1.00 30.26 ? 329  SER A C   1 
ATOM   2533 O O   . SER A 1 329 ? 11.162  66.114 71.995 1.00 30.02 ? 329  SER A O   1 
ATOM   2534 C CB  . SER A 1 329 ? 13.763  67.582 70.593 1.00 29.10 ? 329  SER A CB  1 
ATOM   2535 O OG  . SER A 1 329 ? 13.411  68.372 69.466 1.00 28.50 ? 329  SER A OG  1 
ATOM   2536 N N   . PHE A 1 330 ? 10.777  66.498 69.825 1.00 31.20 ? 330  PHE A N   1 
ATOM   2537 C CA  . PHE A 1 330 ? 9.334   66.581 69.995 1.00 32.13 ? 330  PHE A CA  1 
ATOM   2538 C C   . PHE A 1 330 ? 8.699   65.360 70.656 1.00 31.81 ? 330  PHE A C   1 
ATOM   2539 O O   . PHE A 1 330 ? 7.834   65.451 71.555 1.00 31.68 ? 330  PHE A O   1 
ATOM   2540 C CB  . PHE A 1 330 ? 8.665   66.682 68.637 1.00 34.42 ? 330  PHE A CB  1 
ATOM   2541 C CG  . PHE A 1 330 ? 7.811   67.859 68.494 1.00 36.85 ? 330  PHE A CG  1 
ATOM   2542 C CD1 . PHE A 1 330 ? 6.759   68.057 69.376 1.00 37.83 ? 330  PHE A CD1 1 
ATOM   2543 C CD2 . PHE A 1 330 ? 8.137   68.851 67.564 1.00 38.02 ? 330  PHE A CD2 1 
ATOM   2544 C CE1 . PHE A 1 330 ? 6.042   69.234 69.375 1.00 38.92 ? 330  PHE A CE1 1 
ATOM   2545 C CE2 . PHE A 1 330 ? 7.425   70.061 67.535 1.00 39.42 ? 330  PHE A CE2 1 
ATOM   2546 C CZ  . PHE A 1 330 ? 6.365   70.255 68.462 1.00 39.56 ? 330  PHE A CZ  1 
ATOM   2547 N N   . PHE A 1 331 ? 9.112   64.206 70.155 1.00 31.14 ? 331  PHE A N   1 
ATOM   2548 C CA  . PHE A 1 331 ? 8.549   62.955 70.581 1.00 30.63 ? 331  PHE A CA  1 
ATOM   2549 C C   . PHE A 1 331 ? 8.967   62.603 71.967 1.00 30.50 ? 331  PHE A C   1 
ATOM   2550 O O   . PHE A 1 331 ? 8.180   62.005 72.695 1.00 30.98 ? 331  PHE A O   1 
ATOM   2551 C CB  . PHE A 1 331 ? 8.888   61.871 69.536 1.00 30.22 ? 331  PHE A CB  1 
ATOM   2552 C CG  . PHE A 1 331 ? 8.435   62.244 68.136 1.00 29.23 ? 331  PHE A CG  1 
ATOM   2553 C CD1 . PHE A 1 331 ? 9.199   63.089 67.343 1.00 29.64 ? 331  PHE A CD1 1 
ATOM   2554 C CD2 . PHE A 1 331 ? 7.184   61.852 67.676 1.00 28.96 ? 331  PHE A CD2 1 
ATOM   2555 C CE1 . PHE A 1 331 ? 8.709   63.557 66.077 1.00 29.54 ? 331  PHE A CE1 1 
ATOM   2556 C CE2 . PHE A 1 331 ? 6.694   62.297 66.465 1.00 28.92 ? 331  PHE A CE2 1 
ATOM   2557 C CZ  . PHE A 1 331 ? 7.441   63.148 65.649 1.00 29.02 ? 331  PHE A CZ  1 
ATOM   2558 N N   . LEU A 1 332 ? 10.181  62.983 72.356 1.00 29.83 ? 332  LEU A N   1 
ATOM   2559 C CA  . LEU A 1 332 ? 10.630  62.717 73.716 1.00 29.49 ? 332  LEU A CA  1 
ATOM   2560 C C   . LEU A 1 332 ? 9.891   63.672 74.667 1.00 29.83 ? 332  LEU A C   1 
ATOM   2561 O O   . LEU A 1 332 ? 9.399   63.266 75.714 1.00 30.05 ? 332  LEU A O   1 
ATOM   2562 C CB  . LEU A 1 332 ? 12.163  62.882 73.838 1.00 28.78 ? 332  LEU A CB  1 
ATOM   2563 C CG  . LEU A 1 332 ? 12.956  61.861 73.011 1.00 27.75 ? 332  LEU A CG  1 
ATOM   2564 C CD1 . LEU A 1 332 ? 14.383  62.383 72.700 1.00 27.22 ? 332  LEU A CD1 1 
ATOM   2565 C CD2 . LEU A 1 332 ? 12.969  60.545 73.796 1.00 27.29 ? 332  LEU A CD2 1 
ATOM   2566 N N   . LEU A 1 333 ? 9.805   64.944 74.306 1.00 30.43 ? 333  LEU A N   1 
ATOM   2567 C CA  . LEU A 1 333 ? 9.079   65.905 75.146 1.00 30.79 ? 333  LEU A CA  1 
ATOM   2568 C C   . LEU A 1 333 ? 7.685   65.356 75.460 1.00 31.16 ? 333  LEU A C   1 
ATOM   2569 O O   . LEU A 1 333 ? 7.239   65.340 76.610 1.00 31.37 ? 333  LEU A O   1 
ATOM   2570 C CB  . LEU A 1 333 ? 8.895   67.240 74.413 1.00 30.38 ? 333  LEU A CB  1 
ATOM   2571 C CG  . LEU A 1 333 ? 7.923   68.215 75.120 1.00 31.30 ? 333  LEU A CG  1 
ATOM   2572 C CD1 . LEU A 1 333 ? 8.410   68.496 76.588 1.00 30.69 ? 333  LEU A CD1 1 
ATOM   2573 C CD2 . LEU A 1 333 ? 7.820   69.544 74.295 1.00 30.90 ? 333  LEU A CD2 1 
ATOM   2574 N N   . TYR A 1 334 ? 6.992   64.921 74.419 1.00 31.34 ? 334  TYR A N   1 
ATOM   2575 C CA  . TYR A 1 334 ? 5.645   64.436 74.596 1.00 32.26 ? 334  TYR A CA  1 
ATOM   2576 C C   . TYR A 1 334 ? 5.528   63.082 75.227 1.00 33.02 ? 334  TYR A C   1 
ATOM   2577 O O   . TYR A 1 334 ? 4.543   62.818 75.854 1.00 34.29 ? 334  TYR A O   1 
ATOM   2578 C CB  . TYR A 1 334 ? 4.851   64.449 73.273 1.00 31.64 ? 334  TYR A CB  1 
ATOM   2579 C CG  . TYR A 1 334 ? 4.291   65.810 72.931 1.00 31.05 ? 334  TYR A CG  1 
ATOM   2580 C CD1 . TYR A 1 334 ? 5.135   66.913 72.757 1.00 30.56 ? 334  TYR A CD1 1 
ATOM   2581 C CD2 . TYR A 1 334 ? 2.910   66.004 72.788 1.00 30.37 ? 334  TYR A CD2 1 
ATOM   2582 C CE1 . TYR A 1 334 ? 4.619   68.173 72.444 1.00 30.23 ? 334  TYR A CE1 1 
ATOM   2583 C CE2 . TYR A 1 334 ? 2.390   67.247 72.475 1.00 30.01 ? 334  TYR A CE2 1 
ATOM   2584 C CZ  . TYR A 1 334 ? 3.235   68.325 72.299 1.00 29.97 ? 334  TYR A CZ  1 
ATOM   2585 O OH  . TYR A 1 334 ? 2.707   69.525 71.915 1.00 29.74 ? 334  TYR A OH  1 
ATOM   2586 N N   . GLY A 1 335 ? 6.502   62.210 75.141 1.00 33.66 ? 335  GLY A N   1 
ATOM   2587 C CA  . GLY A 1 335 ? 6.234   60.951 75.795 1.00 34.35 ? 335  GLY A CA  1 
ATOM   2588 C C   . GLY A 1 335 ? 7.324   60.205 76.536 1.00 34.54 ? 335  GLY A C   1 
ATOM   2589 O O   . GLY A 1 335 ? 7.116   59.053 76.897 1.00 35.60 ? 335  GLY A O   1 
ATOM   2590 N N   . ALA A 1 336 ? 8.476   60.794 76.761 1.00 33.66 ? 336  ALA A N   1 
ATOM   2591 C CA  . ALA A 1 336 ? 9.493   60.032 77.451 1.00 33.34 ? 336  ALA A CA  1 
ATOM   2592 C C   . ALA A 1 336 ? 9.743   60.624 78.836 1.00 33.11 ? 336  ALA A C   1 
ATOM   2593 O O   . ALA A 1 336 ? 9.782   61.834 79.013 1.00 32.86 ? 336  ALA A O   1 
ATOM   2594 C CB  . ALA A 1 336 ? 10.772  59.990 76.618 1.00 32.90 ? 336  ALA A CB  1 
ATOM   2595 N N   . PRO A 1 337 ? 9.887   59.768 79.851 1.00 33.61 ? 337  PRO A N   1 
ATOM   2596 C CA  . PRO A 1 337 ? 10.122  60.294 81.211 1.00 33.60 ? 337  PRO A CA  1 
ATOM   2597 C C   . PRO A 1 337 ? 11.390  61.142 81.345 1.00 33.59 ? 337  PRO A C   1 
ATOM   2598 O O   . PRO A 1 337 ? 12.451  60.809 80.782 1.00 33.48 ? 337  PRO A O   1 
ATOM   2599 C CB  . PRO A 1 337 ? 10.203  59.034 82.050 1.00 34.14 ? 337  PRO A CB  1 
ATOM   2600 C CG  . PRO A 1 337 ? 10.916  58.037 81.042 1.00 33.69 ? 337  PRO A CG  1 
ATOM   2601 C CD  . PRO A 1 337 ? 10.088  58.308 79.784 1.00 33.59 ? 337  PRO A CD  1 
ATOM   2602 N N   . GLY A 1 338 ? 11.249  62.252 82.074 1.00 33.41 ? 338  GLY A N   1 
ATOM   2603 C CA  . GLY A 1 338 ? 12.362  63.152 82.322 1.00 32.69 ? 338  GLY A CA  1 
ATOM   2604 C C   . GLY A 1 338 ? 12.407  64.412 81.472 1.00 32.28 ? 338  GLY A C   1 
ATOM   2605 O O   . GLY A 1 338 ? 13.115  65.370 81.811 1.00 32.02 ? 338  GLY A O   1 
ATOM   2606 N N   . PHE A 1 339 ? 11.643  64.412 80.383 1.00 31.74 ? 339  PHE A N   1 
ATOM   2607 C CA  . PHE A 1 339 ? 11.603  65.545 79.457 1.00 31.82 ? 339  PHE A CA  1 
ATOM   2608 C C   . PHE A 1 339 ? 10.452  66.466 79.794 1.00 31.98 ? 339  PHE A C   1 
ATOM   2609 O O   . PHE A 1 339 ? 9.342   65.987 79.973 1.00 32.87 ? 339  PHE A O   1 
ATOM   2610 C CB  . PHE A 1 339 ? 11.442  65.035 78.018 1.00 30.43 ? 339  PHE A CB  1 
ATOM   2611 C CG  . PHE A 1 339 ? 12.623  64.262 77.533 1.00 29.84 ? 339  PHE A CG  1 
ATOM   2612 C CD1 . PHE A 1 339 ? 12.735  62.866 77.808 1.00 29.26 ? 339  PHE A CD1 1 
ATOM   2613 C CD2 . PHE A 1 339 ? 13.630  64.911 76.787 1.00 29.37 ? 339  PHE A CD2 1 
ATOM   2614 C CE1 . PHE A 1 339 ? 13.838  62.117 77.337 1.00 29.12 ? 339  PHE A CE1 1 
ATOM   2615 C CE2 . PHE A 1 339 ? 14.748  64.194 76.300 1.00 28.71 ? 339  PHE A CE2 1 
ATOM   2616 C CZ  . PHE A 1 339 ? 14.858  62.785 76.574 1.00 29.12 ? 339  PHE A CZ  1 
ATOM   2617 N N   . SER A 1 340 ? 10.687  67.768 79.862 1.00 31.91 ? 340  SER A N   1 
ATOM   2618 C CA  . SER A 1 340 ? 9.597   68.709 80.189 1.00 32.27 ? 340  SER A CA  1 
ATOM   2619 C C   . SER A 1 340 ? 9.835   69.932 79.349 1.00 32.42 ? 340  SER A C   1 
ATOM   2620 O O   . SER A 1 340 ? 11.001  70.250 79.027 1.00 31.83 ? 340  SER A O   1 
ATOM   2621 C CB  . SER A 1 340 ? 9.645   69.189 81.639 1.00 32.26 ? 340  SER A CB  1 
ATOM   2622 O OG  . SER A 1 340 ? 9.944   68.170 82.549 1.00 33.66 ? 340  SER A OG  1 
ATOM   2623 N N   . LYS A 1 341 ? 8.737   70.637 79.056 1.00 32.33 ? 341  LYS A N   1 
ATOM   2624 C CA  . LYS A 1 341 ? 8.800   71.813 78.232 1.00 32.69 ? 341  LYS A CA  1 
ATOM   2625 C C   . LYS A 1 341 ? 9.583   72.947 78.861 1.00 32.81 ? 341  LYS A C   1 
ATOM   2626 O O   . LYS A 1 341 ? 10.288  73.678 78.157 1.00 32.54 ? 341  LYS A O   1 
ATOM   2627 C CB  . LYS A 1 341 ? 7.393   72.323 77.868 1.00 32.68 ? 341  LYS A CB  1 
ATOM   2628 C CG  . LYS A 1 341 ? 7.487   73.410 76.798 1.00 33.24 ? 341  LYS A CG  1 
ATOM   2629 C CD  . LYS A 1 341 ? 6.148   73.811 76.130 1.00 33.49 ? 341  LYS A CD  1 
ATOM   2630 C CE  . LYS A 1 341 ? 5.413   74.822 77.019 1.00 33.85 ? 341  LYS A CE  1 
ATOM   2631 N NZ  . LYS A 1 341 ? 6.363   75.916 77.517 1.00 34.56 ? 341  LYS A NZ  1 
ATOM   2632 N N   . ASP A 1 342 ? 9.484   73.069 80.180 1.00 32.83 ? 342  ASP A N   1 
ATOM   2633 C CA  . ASP A 1 342 ? 10.121  74.179 80.883 1.00 33.08 ? 342  ASP A CA  1 
ATOM   2634 C C   . ASP A 1 342 ? 11.410  73.933 81.669 1.00 33.22 ? 342  ASP A C   1 
ATOM   2635 O O   . ASP A 1 342 ? 11.784  74.757 82.504 1.00 32.83 ? 342  ASP A O   1 
ATOM   2636 C CB  . ASP A 1 342 ? 9.103   74.861 81.815 1.00 33.42 ? 342  ASP A CB  1 
ATOM   2637 C CG  . ASP A 1 342 ? 7.839   75.324 81.089 1.00 33.97 ? 342  ASP A CG  1 
ATOM   2638 O OD1 . ASP A 1 342 ? 7.837   75.419 79.822 1.00 33.98 ? 342  ASP A OD1 1 
ATOM   2639 O OD2 . ASP A 1 342 ? 6.841   75.593 81.805 1.00 33.94 ? 342  ASP A OD2 1 
ATOM   2640 N N   . SER A 1 343 ? 12.053  72.791 81.475 1.00 33.49 ? 343  SER A N   1 
ATOM   2641 C CA  . SER A 1 343 ? 13.338  72.578 82.114 1.00 34.18 ? 343  SER A CA  1 
ATOM   2642 C C   . SER A 1 343 ? 14.287  72.216 80.968 1.00 34.68 ? 343  SER A C   1 
ATOM   2643 O O   . SER A 1 343 ? 13.846  72.045 79.832 1.00 34.36 ? 343  SER A O   1 
ATOM   2644 C CB  . SER A 1 343 ? 13.305  71.451 83.140 1.00 34.15 ? 343  SER A CB  1 
ATOM   2645 O OG  . SER A 1 343 ? 13.240  70.195 82.521 1.00 35.68 ? 343  SER A OG  1 
ATOM   2646 N N   . GLU A 1 344 ? 15.574  72.117 81.278 1.00 34.85 ? 344  GLU A N   1 
ATOM   2647 C CA  . GLU A 1 344 ? 16.617  71.787 80.326 1.00 35.11 ? 344  GLU A CA  1 
ATOM   2648 C C   . GLU A 1 344 ? 16.535  70.290 79.997 1.00 35.26 ? 344  GLU A C   1 
ATOM   2649 O O   . GLU A 1 344 ? 17.250  69.800 79.125 1.00 34.79 ? 344  GLU A O   1 
ATOM   2650 C CB  . GLU A 1 344 ? 18.000  72.091 80.950 1.00 35.71 ? 344  GLU A CB  1 
ATOM   2651 C CG  . GLU A 1 344 ? 18.667  73.442 80.557 1.00 36.83 ? 344  GLU A CG  1 
ATOM   2652 C CD  . GLU A 1 344 ? 20.122  73.559 81.107 1.00 36.84 ? 344  GLU A CD  1 
ATOM   2653 N N   . SER A 1 345 ? 15.696  69.564 80.744 1.00 35.64 ? 345  SER A N   1 
ATOM   2654 C CA  . SER A 1 345 ? 15.491  68.121 80.541 1.00 36.06 ? 345  SER A CA  1 
ATOM   2655 C C   . SER A 1 345 ? 16.762  67.255 80.531 1.00 36.84 ? 345  SER A C   1 
ATOM   2656 O O   . SER A 1 345 ? 16.948  66.411 79.643 1.00 36.73 ? 345  SER A O   1 
ATOM   2657 C CB  . SER A 1 345 ? 14.739  67.864 79.228 1.00 35.65 ? 345  SER A CB  1 
ATOM   2658 O OG  . SER A 1 345 ? 13.465  68.444 79.230 1.00 35.72 ? 345  SER A OG  1 
ATOM   2659 N N   . LYS A 1 346 ? 17.638  67.481 81.493 1.00 37.78 ? 346  LYS A N   1 
ATOM   2660 C CA  . LYS A 1 346 ? 18.841  66.693 81.625 1.00 39.02 ? 346  LYS A CA  1 
ATOM   2661 C C   . LYS A 1 346 ? 18.332  65.321 82.053 1.00 39.25 ? 346  LYS A C   1 
ATOM   2662 O O   . LYS A 1 346 ? 17.539  65.192 82.971 1.00 39.32 ? 346  LYS A O   1 
ATOM   2663 C CB  . LYS A 1 346 ? 19.743  67.317 82.677 1.00 39.97 ? 346  LYS A CB  1 
ATOM   2664 C CG  . LYS A 1 346 ? 20.361  68.627 82.209 1.00 41.50 ? 346  LYS A CG  1 
ATOM   2665 C CD  . LYS A 1 346 ? 21.199  69.234 83.333 1.00 42.87 ? 346  LYS A CD  1 
ATOM   2666 C CE  . LYS A 1 346 ? 21.512  70.721 83.115 1.00 44.01 ? 346  LYS A CE  1 
ATOM   2667 N NZ  . LYS A 1 346 ? 22.060  71.280 84.411 1.00 44.79 ? 346  LYS A NZ  1 
ATOM   2668 N N   . ILE A 1 347 ? 18.792  64.287 81.379 1.00 39.52 ? 347  ILE A N   1 
ATOM   2669 C CA  . ILE A 1 347 ? 18.280  62.950 81.617 1.00 39.85 ? 347  ILE A CA  1 
ATOM   2670 C C   . ILE A 1 347 ? 19.180  62.055 82.484 1.00 40.28 ? 347  ILE A C   1 
ATOM   2671 O O   . ILE A 1 347 ? 20.380  61.930 82.230 1.00 40.10 ? 347  ILE A O   1 
ATOM   2672 C CB  . ILE A 1 347 ? 18.015  62.291 80.194 1.00 39.90 ? 347  ILE A CB  1 
ATOM   2673 C CG1 . ILE A 1 347 ? 16.974  63.140 79.429 1.00 39.78 ? 347  ILE A CG1 1 
ATOM   2674 C CG2 . ILE A 1 347 ? 17.544  60.846 80.296 1.00 39.58 ? 347  ILE A CG2 1 
ATOM   2675 C CD1 . ILE A 1 347 ? 15.646  63.295 80.133 1.00 39.47 ? 347  ILE A CD1 1 
ATOM   2676 N N   . SER A 1 348 ? 18.590  61.425 83.489 1.00 40.75 ? 348  SER A N   1 
ATOM   2677 C CA  . SER A 1 348 ? 19.336  60.520 84.345 1.00 42.04 ? 348  SER A CA  1 
ATOM   2678 C C   . SER A 1 348 ? 19.590  59.289 83.499 1.00 42.77 ? 348  SER A C   1 
ATOM   2679 O O   . SER A 1 348 ? 19.035  59.143 82.415 1.00 43.20 ? 348  SER A O   1 
ATOM   2680 C CB  . SER A 1 348 ? 18.527  60.132 85.583 1.00 41.94 ? 348  SER A CB  1 
ATOM   2681 O OG  . SER A 1 348 ? 17.411  59.325 85.240 1.00 42.48 ? 348  SER A OG  1 
ATOM   2682 N N   . ARG A 1 349 ? 20.441  58.408 83.988 1.00 43.17 ? 349  ARG A N   1 
ATOM   2683 C CA  . ARG A 1 349 ? 20.778  57.197 83.270 1.00 43.38 ? 349  ARG A CA  1 
ATOM   2684 C C   . ARG A 1 349 ? 19.568  56.262 83.238 1.00 43.33 ? 349  ARG A C   1 
ATOM   2685 O O   . ARG A 1 349 ? 19.374  55.531 82.293 1.00 43.39 ? 349  ARG A O   1 
ATOM   2686 C CB  . ARG A 1 349 ? 21.926  56.505 83.992 1.00 44.26 ? 349  ARG A CB  1 
ATOM   2687 C CG  . ARG A 1 349 ? 22.535  55.356 83.263 1.00 45.11 ? 349  ARG A CG  1 
ATOM   2688 C CD  . ARG A 1 349 ? 23.453  55.927 82.276 1.00 46.16 ? 349  ARG A CD  1 
ATOM   2689 N NE  . ARG A 1 349 ? 23.626  54.990 81.205 1.00 46.75 ? 349  ARG A NE  1 
ATOM   2690 C CZ  . ARG A 1 349 ? 23.707  55.338 79.932 1.00 46.67 ? 349  ARG A CZ  1 
ATOM   2691 N NH1 . ARG A 1 349 ? 23.640  56.621 79.577 1.00 46.47 ? 349  ARG A NH1 1 
ATOM   2692 N NH2 . ARG A 1 349 ? 23.831  54.381 79.019 1.00 47.07 ? 349  ARG A NH2 1 
ATOM   2693 N N   . GLU A 1 350 ? 18.750  56.275 84.275 1.00 43.30 ? 350  GLU A N   1 
ATOM   2694 C CA  . GLU A 1 350 ? 17.609  55.394 84.283 1.00 43.33 ? 350  GLU A CA  1 
ATOM   2695 C C   . GLU A 1 350 ? 16.548  55.844 83.259 1.00 43.06 ? 350  GLU A C   1 
ATOM   2696 O O   . GLU A 1 350 ? 15.929  55.014 82.582 1.00 42.67 ? 350  GLU A O   1 
ATOM   2697 C CB  . GLU A 1 350 ? 17.025  55.293 85.700 1.00 44.00 ? 350  GLU A CB  1 
ATOM   2698 C CG  . GLU A 1 350 ? 15.722  54.476 85.761 1.00 45.06 ? 350  GLU A CG  1 
ATOM   2699 C CD  . GLU A 1 350 ? 15.349  54.024 87.172 1.00 45.95 ? 350  GLU A CD  1 
ATOM   2700 N N   . ASP A 1 351 ? 16.357  57.160 83.132 1.00 42.67 ? 351  ASP A N   1 
ATOM   2701 C CA  . ASP A 1 351 ? 15.393  57.692 82.167 1.00 42.15 ? 351  ASP A CA  1 
ATOM   2702 C C   . ASP A 1 351 ? 15.892  57.499 80.737 1.00 41.61 ? 351  ASP A C   1 
ATOM   2703 O O   . ASP A 1 351 ? 15.095  57.325 79.812 1.00 41.64 ? 351  ASP A O   1 
ATOM   2704 C CB  . ASP A 1 351 ? 15.085  59.170 82.455 1.00 42.33 ? 351  ASP A CB  1 
ATOM   2705 C CG  . ASP A 1 351 ? 14.068  59.341 83.593 1.00 42.26 ? 351  ASP A CG  1 
ATOM   2706 O OD1 . ASP A 1 351 ? 13.498  58.329 84.038 1.00 42.32 ? 351  ASP A OD1 1 
ATOM   2707 O OD2 . ASP A 1 351 ? 13.834  60.478 84.047 1.00 42.65 ? 351  ASP A OD2 1 
ATOM   2708 N N   . PHE A 1 352 ? 17.210  57.498 80.570 1.00 40.80 ? 352  PHE A N   1 
ATOM   2709 C CA  . PHE A 1 352 ? 17.807  57.286 79.266 1.00 40.30 ? 352  PHE A CA  1 
ATOM   2710 C C   . PHE A 1 352 ? 17.412  55.917 78.839 1.00 40.80 ? 352  PHE A C   1 
ATOM   2711 O O   . PHE A 1 352 ? 17.002  55.681 77.714 1.00 40.90 ? 352  PHE A O   1 
ATOM   2712 C CB  . PHE A 1 352 ? 19.323  57.302 79.365 1.00 39.27 ? 352  PHE A CB  1 
ATOM   2713 C CG  . PHE A 1 352 ? 20.013  57.038 78.083 1.00 38.03 ? 352  PHE A CG  1 
ATOM   2714 C CD1 . PHE A 1 352 ? 20.130  58.031 77.133 1.00 37.35 ? 352  PHE A CD1 1 
ATOM   2715 C CD2 . PHE A 1 352 ? 20.546  55.793 77.827 1.00 37.80 ? 352  PHE A CD2 1 
ATOM   2716 C CE1 . PHE A 1 352 ? 20.778  57.787 75.945 1.00 37.34 ? 352  PHE A CE1 1 
ATOM   2717 C CE2 . PHE A 1 352 ? 21.195  55.526 76.655 1.00 37.46 ? 352  PHE A CE2 1 
ATOM   2718 C CZ  . PHE A 1 352 ? 21.319  56.525 75.699 1.00 37.50 ? 352  PHE A CZ  1 
ATOM   2719 N N   . MET A 1 353 ? 17.572  54.983 79.755 1.00 41.61 ? 353  MET A N   1 
ATOM   2720 C CA  . MET A 1 353 ? 17.255  53.609 79.433 1.00 42.27 ? 353  MET A CA  1 
ATOM   2721 C C   . MET A 1 353 ? 15.770  53.394 79.226 1.00 41.31 ? 353  MET A C   1 
ATOM   2722 O O   . MET A 1 353 ? 15.383  52.655 78.318 1.00 40.82 ? 353  MET A O   1 
ATOM   2723 C CB  . MET A 1 353 ? 17.850  52.670 80.484 1.00 44.46 ? 353  MET A CB  1 
ATOM   2724 C CG  . MET A 1 353 ? 19.381  52.475 80.253 1.00 46.87 ? 353  MET A CG  1 
ATOM   2725 S SD  . MET A 1 353 ? 19.965  51.051 81.210 1.00 52.02 ? 353  MET A SD  1 
ATOM   2726 C CE  . MET A 1 353 ? 19.709  51.681 82.945 1.00 48.78 ? 353  MET A CE  1 
ATOM   2727 N N   . SER A 1 354 ? 14.926  54.050 80.018 1.00 40.00 ? 354  SER A N   1 
ATOM   2728 C CA  . SER A 1 354 ? 13.523  53.845 79.750 1.00 39.39 ? 354  SER A CA  1 
ATOM   2729 C C   . SER A 1 354 ? 13.178  54.558 78.389 1.00 38.36 ? 354  SER A C   1 
ATOM   2730 O O   . SER A 1 354 ? 12.264  54.123 77.646 1.00 37.83 ? 354  SER A O   1 
ATOM   2731 C CB  . SER A 1 354 ? 12.681  54.301 80.941 1.00 39.87 ? 354  SER A CB  1 
ATOM   2732 O OG  . SER A 1 354 ? 12.499  55.698 80.943 1.00 42.78 ? 354  SER A OG  1 
ATOM   2733 N N   . GLY A 1 355 ? 13.974  55.586 78.039 1.00 36.98 ? 355  GLY A N   1 
ATOM   2734 C CA  . GLY A 1 355 ? 13.801  56.284 76.775 1.00 35.06 ? 355  GLY A CA  1 
ATOM   2735 C C   . GLY A 1 355 ? 14.096  55.380 75.568 1.00 34.18 ? 355  GLY A C   1 
ATOM   2736 O O   . GLY A 1 355 ? 13.320  55.334 74.572 1.00 33.02 ? 355  GLY A O   1 
ATOM   2737 N N   . VAL A 1 356 ? 15.173  54.606 75.648 1.00 33.53 ? 356  VAL A N   1 
ATOM   2738 C CA  . VAL A 1 356 ? 15.484  53.768 74.496 1.00 33.98 ? 356  VAL A CA  1 
ATOM   2739 C C   . VAL A 1 356 ? 14.488  52.644 74.296 1.00 33.98 ? 356  VAL A C   1 
ATOM   2740 O O   . VAL A 1 356 ? 14.185  52.285 73.165 1.00 33.56 ? 356  VAL A O   1 
ATOM   2741 C CB  . VAL A 1 356 ? 16.993  53.223 74.463 1.00 34.16 ? 356  VAL A CB  1 
ATOM   2742 C CG1 . VAL A 1 356 ? 17.858  53.949 75.455 1.00 33.43 ? 356  VAL A CG1 1 
ATOM   2743 C CG2 . VAL A 1 356 ? 17.033  51.752 74.588 1.00 34.08 ? 356  VAL A CG2 1 
ATOM   2744 N N   . LYS A 1 357 ? 13.962  52.107 75.393 1.00 34.62 ? 357  LYS A N   1 
ATOM   2745 C CA  . LYS A 1 357 ? 12.937  51.051 75.322 1.00 34.89 ? 357  LYS A CA  1 
ATOM   2746 C C   . LYS A 1 357 ? 11.689  51.607 74.563 1.00 34.34 ? 357  LYS A C   1 
ATOM   2747 O O   . LYS A 1 357 ? 11.135  50.948 73.684 1.00 34.30 ? 357  LYS A O   1 
ATOM   2748 C CB  . LYS A 1 357 ? 12.579  50.604 76.750 1.00 35.75 ? 357  LYS A CB  1 
ATOM   2749 C CG  . LYS A 1 357 ? 11.466  49.575 76.846 1.00 37.63 ? 357  LYS A CG  1 
ATOM   2750 C CD  . LYS A 1 357 ? 11.748  48.306 76.028 1.00 38.65 ? 357  LYS A CD  1 
ATOM   2751 C CE  . LYS A 1 357 ? 10.806  47.139 76.438 1.00 39.87 ? 357  LYS A CE  1 
ATOM   2752 N N   . LEU A 1 358 ? 11.280  52.826 74.897 1.00 33.58 ? 358  LEU A N   1 
ATOM   2753 C CA  . LEU A 1 358 ? 10.165  53.498 74.226 1.00 33.15 ? 358  LEU A CA  1 
ATOM   2754 C C   . LEU A 1 358 ? 10.479  53.768 72.720 1.00 32.90 ? 358  LEU A C   1 
ATOM   2755 O O   . LEU A 1 358 ? 9.585   53.691 71.843 1.00 32.20 ? 358  LEU A O   1 
ATOM   2756 C CB  . LEU A 1 358 ? 9.927   54.832 74.925 1.00 33.22 ? 358  LEU A CB  1 
ATOM   2757 C CG  . LEU A 1 358 ? 8.740   55.111 75.839 1.00 34.28 ? 358  LEU A CG  1 
ATOM   2758 C CD1 . LEU A 1 358 ? 8.038   53.844 76.320 1.00 33.92 ? 358  LEU A CD1 1 
ATOM   2759 C CD2 . LEU A 1 358 ? 9.221   56.037 76.947 1.00 33.30 ? 358  LEU A CD2 1 
ATOM   2760 N N   . SER A 1 359 ? 11.749  54.081 72.433 1.00 32.45 ? 359  SER A N   1 
ATOM   2761 C CA  . SER A 1 359 ? 12.183  54.408 71.073 1.00 32.35 ? 359  SER A CA  1 
ATOM   2762 C C   . SER A 1 359 ? 12.324  53.276 70.092 1.00 32.82 ? 359  SER A C   1 
ATOM   2763 O O   . SER A 1 359 ? 12.200  53.477 68.889 1.00 32.56 ? 359  SER A O   1 
ATOM   2764 C CB  . SER A 1 359 ? 13.494  55.159 71.123 1.00 32.32 ? 359  SER A CB  1 
ATOM   2765 O OG  . SER A 1 359 ? 13.328  56.327 71.879 1.00 31.90 ? 359  SER A OG  1 
ATOM   2766 N N   . VAL A 1 360 ? 12.558  52.080 70.589 1.00 33.30 ? 360  VAL A N   1 
ATOM   2767 C CA  . VAL A 1 360 ? 12.756  50.948 69.719 1.00 34.56 ? 360  VAL A CA  1 
ATOM   2768 C C   . VAL A 1 360 ? 11.849  49.866 70.301 1.00 35.84 ? 360  VAL A C   1 
ATOM   2769 O O   . VAL A 1 360 ? 12.314  48.800 70.723 1.00 34.92 ? 360  VAL A O   1 
ATOM   2770 C CB  . VAL A 1 360 ? 14.238  50.531 69.792 1.00 34.59 ? 360  VAL A CB  1 
ATOM   2771 C CG1 . VAL A 1 360 ? 14.562  49.537 68.701 1.00 34.16 ? 360  VAL A CG1 1 
ATOM   2772 C CG2 . VAL A 1 360 ? 15.133  51.797 69.723 1.00 34.28 ? 360  VAL A CG2 1 
ATOM   2773 N N   . PRO A 1 361 ? 10.524  50.112 70.249 1.00 37.24 ? 361  PRO A N   1 
ATOM   2774 C CA  . PRO A 1 361 ? 9.517   49.199 70.794 1.00 38.64 ? 361  PRO A CA  1 
ATOM   2775 C C   . PRO A 1 361 ? 9.622   47.769 70.354 1.00 40.26 ? 361  PRO A C   1 
ATOM   2776 O O   . PRO A 1 361 ? 9.403   46.856 71.134 1.00 40.85 ? 361  PRO A O   1 
ATOM   2777 C CB  . PRO A 1 361 ? 8.204   49.883 70.418 1.00 38.45 ? 361  PRO A CB  1 
ATOM   2778 C CG  . PRO A 1 361 ? 8.512   50.560 69.119 1.00 37.15 ? 361  PRO A CG  1 
ATOM   2779 C CD  . PRO A 1 361 ? 9.912   51.086 69.323 1.00 36.97 ? 361  PRO A CD  1 
ATOM   2780 N N   . HIS A 1 362 ? 10.017  47.567 69.112 1.00 42.04 ? 362  HIS A N   1 
ATOM   2781 C CA  . HIS A 1 362 ? 10.153  46.227 68.551 1.00 43.68 ? 362  HIS A CA  1 
ATOM   2782 C C   . HIS A 1 362 ? 11.466  45.468 68.903 1.00 43.91 ? 362  HIS A C   1 
ATOM   2783 O O   . HIS A 1 362 ? 11.752  44.405 68.306 1.00 44.18 ? 362  HIS A O   1 
ATOM   2784 C CB  . HIS A 1 362 ? 10.057  46.345 67.033 1.00 45.04 ? 362  HIS A CB  1 
ATOM   2785 C CG  . HIS A 1 362 ? 11.043  47.323 66.461 1.00 46.97 ? 362  HIS A CG  1 
ATOM   2786 N ND1 . HIS A 1 362 ? 11.007  48.677 66.748 1.00 47.29 ? 362  HIS A ND1 1 
ATOM   2787 C CD2 . HIS A 1 362 ? 12.102  47.142 65.624 1.00 47.48 ? 362  HIS A CD2 1 
ATOM   2788 C CE1 . HIS A 1 362 ? 11.995  49.285 66.112 1.00 47.72 ? 362  HIS A CE1 1 
ATOM   2789 N NE2 . HIS A 1 362 ? 12.672  48.376 65.421 1.00 48.07 ? 362  HIS A NE2 1 
ATOM   2790 N N   . ALA A 1 363 ? 12.254  45.974 69.853 1.00 43.44 ? 363  ALA A N   1 
ATOM   2791 C CA  . ALA A 1 363 ? 13.539  45.335 70.151 1.00 42.52 ? 363  ALA A CA  1 
ATOM   2792 C C   . ALA A 1 363 ? 13.644  44.416 71.331 1.00 41.96 ? 363  ALA A C   1 
ATOM   2793 O O   . ALA A 1 363 ? 13.139  44.738 72.392 1.00 42.01 ? 363  ALA A O   1 
ATOM   2794 C CB  . ALA A 1 363 ? 14.602  46.406 70.312 1.00 42.44 ? 363  ALA A CB  1 
ATOM   2795 N N   . ASN A 1 364 ? 14.309  43.269 71.152 1.00 41.28 ? 364  ASN A N   1 
ATOM   2796 C CA  . ASN A 1 364 ? 14.562  42.400 72.296 1.00 40.78 ? 364  ASN A CA  1 
ATOM   2797 C C   . ASN A 1 364 ? 15.653  43.087 73.150 1.00 40.34 ? 364  ASN A C   1 
ATOM   2798 O O   . ASN A 1 364 ? 16.215  44.130 72.765 1.00 39.85 ? 364  ASN A O   1 
ATOM   2799 C CB  . ASN A 1 364 ? 15.043  40.999 71.880 1.00 41.12 ? 364  ASN A CB  1 
ATOM   2800 C CG  . ASN A 1 364 ? 16.291  41.021 71.010 1.00 41.80 ? 364  ASN A CG  1 
ATOM   2801 O OD1 . ASN A 1 364 ? 17.058  41.989 71.005 1.00 42.03 ? 364  ASN A OD1 1 
ATOM   2802 N ND2 . ASN A 1 364 ? 16.500  39.944 70.264 1.00 41.79 ? 364  ASN A ND2 1 
ATOM   2803 N N   . ASP A 1 365 ? 15.947  42.504 74.309 1.00 40.08 ? 365  ASP A N   1 
ATOM   2804 C CA  . ASP A 1 365 ? 16.949  43.049 75.218 1.00 39.89 ? 365  ASP A CA  1 
ATOM   2805 C C   . ASP A 1 365 ? 18.365  43.198 74.660 1.00 39.17 ? 365  ASP A C   1 
ATOM   2806 O O   . ASP A 1 365 ? 19.064  44.152 75.002 1.00 38.92 ? 365  ASP A O   1 
ATOM   2807 C CB  . ASP A 1 365 ? 16.987  42.229 76.495 1.00 41.74 ? 365  ASP A CB  1 
ATOM   2808 C CG  . ASP A 1 365 ? 15.712  42.373 77.306 1.00 43.18 ? 365  ASP A CG  1 
ATOM   2809 O OD1 . ASP A 1 365 ? 14.737  43.023 76.816 1.00 44.28 ? 365  ASP A OD1 1 
ATOM   2810 O OD2 . ASP A 1 365 ? 15.689  41.839 78.437 1.00 44.77 ? 365  ASP A OD2 1 
ATOM   2811 N N   . LEU A 1 366 ? 18.790  42.271 73.804 1.00 37.91 ? 366  LEU A N   1 
ATOM   2812 C CA  . LEU A 1 366 ? 20.106  42.373 73.196 1.00 36.92 ? 366  LEU A CA  1 
ATOM   2813 C C   . LEU A 1 366 ? 20.111  43.651 72.296 1.00 36.21 ? 366  LEU A C   1 
ATOM   2814 O O   . LEU A 1 366 ? 21.056  44.463 72.293 1.00 35.66 ? 366  LEU A O   1 
ATOM   2815 C CB  . LEU A 1 366 ? 20.368  41.132 72.348 1.00 36.88 ? 366  LEU A CB  1 
ATOM   2816 C CG  . LEU A 1 366 ? 21.786  41.140 71.777 1.00 37.48 ? 366  LEU A CG  1 
ATOM   2817 C CD1 . LEU A 1 366 ? 22.803  40.932 72.919 1.00 37.06 ? 366  LEU A CD1 1 
ATOM   2818 C CD2 . LEU A 1 366 ? 21.926  40.042 70.729 1.00 37.48 ? 366  LEU A CD2 1 
ATOM   2819 N N   . GLY A 1 367 ? 19.031  43.802 71.526 1.00 35.25 ? 367  GLY A N   1 
ATOM   2820 C CA  . GLY A 1 367 ? 18.876  44.952 70.659 1.00 33.93 ? 367  GLY A CA  1 
ATOM   2821 C C   . GLY A 1 367 ? 18.875  46.231 71.466 1.00 33.10 ? 367  GLY A C   1 
ATOM   2822 O O   . GLY A 1 367 ? 19.528  47.196 71.097 1.00 32.68 ? 367  GLY A O   1 
ATOM   2823 N N   . LEU A 1 368 ? 18.142  46.247 72.570 1.00 32.97 ? 368  LEU A N   1 
ATOM   2824 C CA  . LEU A 1 368 ? 18.117  47.433 73.410 1.00 33.05 ? 368  LEU A CA  1 
ATOM   2825 C C   . LEU A 1 368 ? 19.535  47.744 73.914 1.00 33.39 ? 368  LEU A C   1 
ATOM   2826 O O   . LEU A 1 368 ? 19.928  48.923 73.983 1.00 33.00 ? 368  LEU A O   1 
ATOM   2827 C CB  . LEU A 1 368 ? 17.178  47.236 74.600 1.00 32.91 ? 368  LEU A CB  1 
ATOM   2828 C CG  . LEU A 1 368 ? 15.667  47.125 74.293 1.00 33.34 ? 368  LEU A CG  1 
ATOM   2829 C CD1 . LEU A 1 368 ? 14.917  46.828 75.565 1.00 32.20 ? 368  LEU A CD1 1 
ATOM   2830 C CD2 . LEU A 1 368 ? 15.152  48.460 73.676 1.00 33.46 ? 368  LEU A CD2 1 
ATOM   2831 N N   . ASP A 1 369 ? 20.295  46.691 74.267 1.00 33.49 ? 369  ASP A N   1 
ATOM   2832 C CA  . ASP A 1 369 ? 21.667  46.869 74.738 1.00 33.65 ? 369  ASP A CA  1 
ATOM   2833 C C   . ASP A 1 369 ? 22.534  47.400 73.591 1.00 33.09 ? 369  ASP A C   1 
ATOM   2834 O O   . ASP A 1 369 ? 23.411  48.249 73.795 1.00 32.52 ? 369  ASP A O   1 
ATOM   2835 C CB  . ASP A 1 369 ? 22.282  45.558 75.238 1.00 34.72 ? 369  ASP A CB  1 
ATOM   2836 C CG  . ASP A 1 369 ? 21.745  45.148 76.577 1.00 36.20 ? 369  ASP A CG  1 
ATOM   2837 O OD1 . ASP A 1 369 ? 21.291  46.040 77.325 1.00 36.39 ? 369  ASP A OD1 1 
ATOM   2838 O OD2 . ASP A 1 369 ? 21.800  43.934 76.889 1.00 37.15 ? 369  ASP A OD2 1 
ATOM   2839 N N   . ALA A 1 370 ? 22.289  46.918 72.388 1.00 32.54 ? 370  ALA A N   1 
ATOM   2840 C CA  . ALA A 1 370 ? 23.095  47.413 71.286 1.00 32.41 ? 370  ALA A CA  1 
ATOM   2841 C C   . ALA A 1 370 ? 22.852  48.908 71.115 1.00 32.41 ? 370  ALA A C   1 
ATOM   2842 O O   . ALA A 1 370 ? 23.816  49.669 70.951 1.00 32.70 ? 370  ALA A O   1 
ATOM   2843 C CB  . ALA A 1 370 ? 22.796  46.643 69.979 1.00 31.95 ? 370  ALA A CB  1 
ATOM   2844 N N   . VAL A 1 371 ? 21.599  49.358 71.184 1.00 32.40 ? 371  VAL A N   1 
ATOM   2845 C CA  . VAL A 1 371 ? 21.322  50.789 71.011 1.00 32.24 ? 371  VAL A CA  1 
ATOM   2846 C C   . VAL A 1 371 ? 21.997  51.617 72.105 1.00 32.91 ? 371  VAL A C   1 
ATOM   2847 O O   . VAL A 1 371 ? 22.702  52.584 71.815 1.00 32.83 ? 371  VAL A O   1 
ATOM   2848 C CB  . VAL A 1 371 ? 19.774  51.077 70.987 1.00 32.02 ? 371  VAL A CB  1 
ATOM   2849 C CG1 . VAL A 1 371 ? 19.491  52.604 71.000 1.00 30.57 ? 371  VAL A CG1 1 
ATOM   2850 C CG2 . VAL A 1 371 ? 19.149  50.411 69.725 1.00 31.23 ? 371  VAL A CG2 1 
ATOM   2851 N N   . THR A 1 372 ? 21.787  51.218 73.353 1.00 33.63 ? 372  THR A N   1 
ATOM   2852 C CA  . THR A 1 372 ? 22.358  51.898 74.505 1.00 34.72 ? 372  THR A CA  1 
ATOM   2853 C C   . THR A 1 372 ? 23.885  52.021 74.395 1.00 35.23 ? 372  THR A C   1 
ATOM   2854 O O   . THR A 1 372 ? 24.450  53.116 74.559 1.00 35.40 ? 372  THR A O   1 
ATOM   2855 C CB  . THR A 1 372 ? 21.972  51.144 75.808 1.00 35.31 ? 372  THR A CB  1 
ATOM   2856 O OG1 . THR A 1 372 ? 20.549  51.193 75.954 1.00 35.96 ? 372  THR A OG1 1 
ATOM   2857 C CG2 . THR A 1 372 ? 22.622  51.764 77.040 1.00 34.34 ? 372  THR A CG2 1 
ATOM   2858 N N   . LEU A 1 373 ? 24.560  50.927 74.073 1.00 35.46 ? 373  LEU A N   1 
ATOM   2859 C CA  . LEU A 1 373 ? 26.004  51.016 73.931 1.00 35.95 ? 373  LEU A CA  1 
ATOM   2860 C C   . LEU A 1 373 ? 26.420  51.961 72.793 1.00 36.07 ? 373  LEU A C   1 
ATOM   2861 O O   . LEU A 1 373 ? 27.416  52.687 72.918 1.00 36.35 ? 373  LEU A O   1 
ATOM   2862 C CB  . LEU A 1 373 ? 26.621  49.634 73.677 1.00 36.69 ? 373  LEU A CB  1 
ATOM   2863 C CG  . LEU A 1 373 ? 28.100  49.680 73.279 1.00 37.43 ? 373  LEU A CG  1 
ATOM   2864 C CD1 . LEU A 1 373 ? 28.918  50.286 74.435 1.00 38.33 ? 373  LEU A CD1 1 
ATOM   2865 C CD2 . LEU A 1 373 ? 28.598  48.311 72.978 1.00 38.45 ? 373  LEU A CD2 1 
ATOM   2866 N N   . GLN A 1 374 ? 25.679  51.935 71.683 1.00 35.67 ? 374  GLN A N   1 
ATOM   2867 C CA  . GLN A 1 374 ? 25.989  52.764 70.525 1.00 35.24 ? 374  GLN A CA  1 
ATOM   2868 C C   . GLN A 1 374 ? 25.896  54.274 70.803 1.00 34.73 ? 374  GLN A C   1 
ATOM   2869 O O   . GLN A 1 374 ? 26.595  55.057 70.188 1.00 34.54 ? 374  GLN A O   1 
ATOM   2870 C CB  . GLN A 1 374 ? 25.022  52.427 69.387 1.00 35.85 ? 374  GLN A CB  1 
ATOM   2871 C CG  . GLN A 1 374 ? 25.363  53.019 68.064 1.00 36.26 ? 374  GLN A CG  1 
ATOM   2872 C CD  . GLN A 1 374 ? 26.532  52.296 67.404 1.00 37.34 ? 374  GLN A CD  1 
ATOM   2873 O OE1 . GLN A 1 374 ? 27.024  52.742 66.384 1.00 38.35 ? 374  GLN A OE1 1 
ATOM   2874 N NE2 . GLN A 1 374 ? 26.978  51.171 67.988 1.00 37.92 ? 374  GLN A NE2 1 
ATOM   2875 N N   . TYR A 1 375 ? 25.037  54.662 71.735 1.00 33.95 ? 375  TYR A N   1 
ATOM   2876 C CA  . TYR A 1 375 ? 24.819  56.071 72.027 1.00 33.81 ? 375  TYR A CA  1 
ATOM   2877 C C   . TYR A 1 375 ? 25.311  56.566 73.410 1.00 34.35 ? 375  TYR A C   1 
ATOM   2878 O O   . TYR A 1 375 ? 25.104  57.717 73.781 1.00 34.62 ? 375  TYR A O   1 
ATOM   2879 C CB  . TYR A 1 375 ? 23.317  56.349 71.846 1.00 32.47 ? 375  TYR A CB  1 
ATOM   2880 C CG  . TYR A 1 375 ? 22.923  56.468 70.380 1.00 31.08 ? 375  TYR A CG  1 
ATOM   2881 C CD1 . TYR A 1 375 ? 22.559  55.333 69.634 1.00 30.35 ? 375  TYR A CD1 1 
ATOM   2882 C CD2 . TYR A 1 375 ? 22.917  57.709 69.741 1.00 30.36 ? 375  TYR A CD2 1 
ATOM   2883 C CE1 . TYR A 1 375 ? 22.202  55.424 68.284 1.00 29.67 ? 375  TYR A CE1 1 
ATOM   2884 C CE2 . TYR A 1 375 ? 22.549  57.818 68.371 1.00 30.55 ? 375  TYR A CE2 1 
ATOM   2885 C CZ  . TYR A 1 375 ? 22.194  56.662 67.663 1.00 29.83 ? 375  TYR A CZ  1 
ATOM   2886 O OH  . TYR A 1 375 ? 21.811  56.763 66.357 1.00 29.54 ? 375  TYR A OH  1 
ATOM   2887 N N   . THR A 1 376 ? 25.964  55.703 74.170 1.00 34.73 ? 376  THR A N   1 
ATOM   2888 C CA  . THR A 1 376 ? 26.451  56.088 75.486 1.00 34.91 ? 376  THR A CA  1 
ATOM   2889 C C   . THR A 1 376 ? 27.934  56.387 75.459 1.00 35.58 ? 376  THR A C   1 
ATOM   2890 O O   . THR A 1 376 ? 28.746  55.636 74.892 1.00 35.07 ? 376  THR A O   1 
ATOM   2891 C CB  . THR A 1 376 ? 26.236  54.957 76.529 1.00 34.75 ? 376  THR A CB  1 
ATOM   2892 O OG1 . THR A 1 376 ? 24.843  54.698 76.678 1.00 34.04 ? 376  THR A OG1 1 
ATOM   2893 C CG2 . THR A 1 376 ? 26.807  55.333 77.885 1.00 34.12 ? 376  THR A CG2 1 
ATOM   2894 N N   . ASP A 1 377 ? 28.284  57.502 76.070 1.00 36.67 ? 377  ASP A N   1 
ATOM   2895 C CA  . ASP A 1 377 ? 29.687  57.890 76.227 1.00 38.00 ? 377  ASP A CA  1 
ATOM   2896 C C   . ASP A 1 377 ? 30.035  57.249 77.595 1.00 38.71 ? 377  ASP A C   1 
ATOM   2897 O O   . ASP A 1 377 ? 29.621  57.792 78.643 1.00 37.78 ? 377  ASP A O   1 
ATOM   2898 C CB  . ASP A 1 377 ? 29.789  59.411 76.336 1.00 38.79 ? 377  ASP A CB  1 
ATOM   2899 C CG  . ASP A 1 377 ? 31.204  59.890 76.596 1.00 39.81 ? 377  ASP A CG  1 
ATOM   2900 O OD1 . ASP A 1 377 ? 32.073  59.032 76.911 1.00 40.50 ? 377  ASP A OD1 1 
ATOM   2901 O OD2 . ASP A 1 377 ? 31.439  61.126 76.493 1.00 39.94 ? 377  ASP A OD2 1 
ATOM   2902 N N   . TRP A 1 378 ? 30.732  56.099 77.592 1.00 39.58 ? 378  TRP A N   1 
ATOM   2903 C CA  . TRP A 1 378 ? 31.089  55.429 78.859 1.00 41.30 ? 378  TRP A CA  1 
ATOM   2904 C C   . TRP A 1 378 ? 32.153  56.105 79.727 1.00 41.84 ? 378  TRP A C   1 
ATOM   2905 O O   . TRP A 1 378 ? 32.483  55.615 80.794 1.00 41.80 ? 378  TRP A O   1 
ATOM   2906 C CB  . TRP A 1 378 ? 31.457  53.939 78.644 1.00 41.67 ? 378  TRP A CB  1 
ATOM   2907 C CG  . TRP A 1 378 ? 30.268  53.163 78.149 1.00 43.06 ? 378  TRP A CG  1 
ATOM   2908 C CD1 . TRP A 1 378 ? 30.022  52.805 76.859 1.00 43.32 ? 378  TRP A CD1 1 
ATOM   2909 C CD2 . TRP A 1 378 ? 29.074  52.833 78.887 1.00 43.36 ? 378  TRP A CD2 1 
ATOM   2910 N NE1 . TRP A 1 378 ? 28.763  52.292 76.743 1.00 44.02 ? 378  TRP A NE1 1 
ATOM   2911 C CE2 . TRP A 1 378 ? 28.155  52.297 77.968 1.00 43.57 ? 378  TRP A CE2 1 
ATOM   2912 C CE3 . TRP A 1 378 ? 28.698  52.950 80.229 1.00 43.90 ? 378  TRP A CE3 1 
ATOM   2913 C CZ2 . TRP A 1 378 ? 26.864  51.874 78.336 1.00 44.26 ? 378  TRP A CZ2 1 
ATOM   2914 C CZ3 . TRP A 1 378 ? 27.412  52.529 80.610 1.00 44.30 ? 378  TRP A CZ3 1 
ATOM   2915 C CH2 . TRP A 1 378 ? 26.513  52.001 79.665 1.00 44.12 ? 378  TRP A CH2 1 
ATOM   2916 N N   . MET A 1 379 ? 32.680  57.231 79.272 1.00 43.26 ? 379  MET A N   1 
ATOM   2917 C CA  . MET A 1 379 ? 33.662  57.985 80.053 1.00 44.48 ? 379  MET A CA  1 
ATOM   2918 C C   . MET A 1 379 ? 32.855  59.017 80.838 1.00 44.51 ? 379  MET A C   1 
ATOM   2919 O O   . MET A 1 379 ? 33.380  59.683 81.745 1.00 44.77 ? 379  MET A O   1 
ATOM   2920 C CB  . MET A 1 379 ? 34.623  58.781 79.151 1.00 45.80 ? 379  MET A CB  1 
ATOM   2921 C CG  . MET A 1 379 ? 35.860  58.070 78.596 1.00 48.32 ? 379  MET A CG  1 
ATOM   2922 S SD  . MET A 1 379 ? 37.298  58.003 79.775 1.00 51.99 ? 379  MET A SD  1 
ATOM   2923 C CE  . MET A 1 379 ? 36.505  58.424 81.373 1.00 50.55 ? 379  MET A CE  1 
ATOM   2924 N N   . ASP A 1 380 ? 31.575  59.160 80.509 1.00 44.16 ? 380  ASP A N   1 
ATOM   2925 C CA  . ASP A 1 380 ? 30.775  60.203 81.155 1.00 43.94 ? 380  ASP A CA  1 
ATOM   2926 C C   . ASP A 1 380 ? 29.275  59.837 81.109 1.00 43.88 ? 380  ASP A C   1 
ATOM   2927 O O   . ASP A 1 380 ? 28.439  60.653 80.750 1.00 43.78 ? 380  ASP A O   1 
ATOM   2928 C CB  . ASP A 1 380 ? 31.105  61.495 80.381 1.00 43.79 ? 380  ASP A CB  1 
ATOM   2929 C CG  . ASP A 1 380 ? 30.633  62.762 81.073 1.00 44.28 ? 380  ASP A CG  1 
ATOM   2930 O OD1 . ASP A 1 380 ? 30.380  62.737 82.291 1.00 44.41 ? 380  ASP A OD1 1 
ATOM   2931 O OD2 . ASP A 1 380 ? 30.520  63.796 80.375 1.00 44.26 ? 380  ASP A OD2 1 
ATOM   2932 N N   . ASP A 1 381 ? 28.947  58.611 81.520 1.00 44.21 ? 381  ASP A N   1 
ATOM   2933 C CA  . ASP A 1 381 ? 27.574  58.077 81.447 1.00 44.32 ? 381  ASP A CA  1 
ATOM   2934 C C   . ASP A 1 381 ? 26.476  58.719 82.286 1.00 44.25 ? 381  ASP A C   1 
ATOM   2935 O O   . ASP A 1 381 ? 25.280  58.421 82.102 1.00 44.27 ? 381  ASP A O   1 
ATOM   2936 C CB  . ASP A 1 381 ? 27.578  56.560 81.695 1.00 44.61 ? 381  ASP A CB  1 
ATOM   2937 C CG  . ASP A 1 381 ? 28.046  56.202 83.089 1.00 45.10 ? 381  ASP A CG  1 
ATOM   2938 O OD1 . ASP A 1 381 ? 29.186  56.587 83.484 1.00 45.50 ? 381  ASP A OD1 1 
ATOM   2939 O OD2 . ASP A 1 381 ? 27.269  55.532 83.786 1.00 45.18 ? 381  ASP A OD2 1 
ATOM   2940 N N   . ASN A 1 382 ? 26.867  59.600 83.193 1.00 44.14 ? 382  ASN A N   1 
ATOM   2941 C CA  . ASN A 1 382 ? 25.899  60.308 84.024 1.00 43.77 ? 382  ASN A CA  1 
ATOM   2942 C C   . ASN A 1 382 ? 25.731  61.745 83.619 1.00 42.94 ? 382  ASN A C   1 
ATOM   2943 O O   . ASN A 1 382 ? 25.140  62.537 84.349 1.00 43.05 ? 382  ASN A O   1 
ATOM   2944 C CB  . ASN A 1 382 ? 26.317  60.249 85.477 1.00 44.88 ? 382  ASN A CB  1 
ATOM   2945 C CG  . ASN A 1 382 ? 26.148  58.901 86.011 1.00 45.64 ? 382  ASN A CG  1 
ATOM   2946 O OD1 . ASN A 1 382 ? 25.067  58.332 85.888 1.00 46.27 ? 382  ASN A OD1 1 
ATOM   2947 N ND2 . ASN A 1 382 ? 27.210  58.335 86.569 1.00 46.48 ? 382  ASN A ND2 1 
ATOM   2948 N N   . ASN A 1 383 ? 26.271  62.094 82.460 1.00 41.62 ? 383  ASN A N   1 
ATOM   2949 C CA  . ASN A 1 383 ? 26.146  63.443 81.991 1.00 40.14 ? 383  ASN A CA  1 
ATOM   2950 C C   . ASN A 1 383 ? 24.706  63.601 81.473 1.00 39.37 ? 383  ASN A C   1 
ATOM   2951 O O   . ASN A 1 383 ? 24.302  62.953 80.495 1.00 38.71 ? 383  ASN A O   1 
ATOM   2952 C CB  . ASN A 1 383 ? 27.145  63.658 80.885 1.00 40.74 ? 383  ASN A CB  1 
ATOM   2953 C CG  . ASN A 1 383 ? 27.115  65.040 80.374 1.00 40.97 ? 383  ASN A CG  1 
ATOM   2954 O OD1 . ASN A 1 383 ? 26.045  65.651 80.280 1.00 41.58 ? 383  ASN A OD1 1 
ATOM   2955 N ND2 . ASN A 1 383 ? 28.274  65.561 80.011 1.00 41.15 ? 383  ASN A ND2 1 
ATOM   2956 N N   . GLY A 1 384 ? 23.938  64.442 82.168 1.00 38.38 ? 384  GLY A N   1 
ATOM   2957 C CA  . GLY A 1 384 ? 22.553  64.704 81.831 1.00 37.06 ? 384  GLY A CA  1 
ATOM   2958 C C   . GLY A 1 384 ? 22.325  65.299 80.459 1.00 36.63 ? 384  GLY A C   1 
ATOM   2959 O O   . GLY A 1 384 ? 21.367  64.912 79.800 1.00 36.58 ? 384  GLY A O   1 
ATOM   2960 N N   . ILE A 1 385 ? 23.169  66.236 80.037 1.00 36.13 ? 385  ILE A N   1 
ATOM   2961 C CA  . ILE A 1 385 ? 23.044  66.848 78.743 1.00 36.12 ? 385  ILE A CA  1 
ATOM   2962 C C   . ILE A 1 385 ? 23.305  65.766 77.689 1.00 36.28 ? 385  ILE A C   1 
ATOM   2963 O O   . ILE A 1 385 ? 22.565  65.645 76.704 1.00 36.37 ? 385  ILE A O   1 
ATOM   2964 C CB  . ILE A 1 385 ? 24.085  67.961 78.528 1.00 36.72 ? 385  ILE A CB  1 
ATOM   2965 C CG1 . ILE A 1 385 ? 23.909  69.068 79.565 1.00 37.49 ? 385  ILE A CG1 1 
ATOM   2966 C CG2 . ILE A 1 385 ? 23.946  68.553 77.176 1.00 35.84 ? 385  ILE A CG2 1 
ATOM   2967 C CD1 . ILE A 1 385 ? 22.511  69.496 79.732 1.00 38.16 ? 385  ILE A CD1 1 
ATOM   2968 N N   . LYS A 1 386 ? 24.349  64.968 77.909 1.00 36.02 ? 386  LYS A N   1 
ATOM   2969 C CA  . LYS A 1 386 ? 24.707  63.923 76.965 1.00 36.09 ? 386  LYS A CA  1 
ATOM   2970 C C   . LYS A 1 386 ? 23.637  62.857 76.822 1.00 35.68 ? 386  LYS A C   1 
ATOM   2971 O O   . LYS A 1 386 ? 23.406  62.362 75.716 1.00 35.60 ? 386  LYS A O   1 
ATOM   2972 C CB  . LYS A 1 386 ? 26.036  63.267 77.340 1.00 36.47 ? 386  LYS A CB  1 
ATOM   2973 C CG  . LYS A 1 386 ? 27.245  63.949 76.756 1.00 37.56 ? 386  LYS A CG  1 
ATOM   2974 C CD  . LYS A 1 386 ? 28.518  63.388 77.380 1.00 38.47 ? 386  LYS A CD  1 
ATOM   2975 C CE  . LYS A 1 386 ? 29.774  64.012 76.757 1.00 38.72 ? 386  LYS A CE  1 
ATOM   2976 N NZ  . LYS A 1 386 ? 30.982  63.637 77.574 1.00 39.79 ? 386  LYS A NZ  1 
ATOM   2977 N N   . ASN A 1 387 ? 23.001  62.508 77.937 1.00 35.14 ? 387  ASN A N   1 
ATOM   2978 C CA  . ASN A 1 387 ? 21.954  61.512 77.918 1.00 34.65 ? 387  ASN A CA  1 
ATOM   2979 C C   . ASN A 1 387 ? 20.744  62.048 77.135 1.00 33.82 ? 387  ASN A C   1 
ATOM   2980 O O   . ASN A 1 387 ? 20.179  61.333 76.313 1.00 33.35 ? 387  ASN A O   1 
ATOM   2981 C CB  . ASN A 1 387 ? 21.563  61.141 79.343 1.00 35.29 ? 387  ASN A CB  1 
ATOM   2982 C CG  . ASN A 1 387 ? 22.616  60.263 80.018 1.00 36.75 ? 387  ASN A CG  1 
ATOM   2983 O OD1 . ASN A 1 387 ? 23.481  59.684 79.338 1.00 37.49 ? 387  ASN A OD1 1 
ATOM   2984 N ND2 . ASN A 1 387 ? 22.557  60.160 81.358 1.00 36.66 ? 387  ASN A ND2 1 
ATOM   2985 N N   . ARG A 1 388 ? 20.379  63.308 77.379 1.00 33.16 ? 388  ARG A N   1 
ATOM   2986 C CA  . ARG A 1 388 ? 19.257  63.960 76.686 1.00 32.61 ? 388  ARG A CA  1 
ATOM   2987 C C   . ARG A 1 388 ? 19.549  63.985 75.177 1.00 32.32 ? 388  ARG A C   1 
ATOM   2988 O O   . ARG A 1 388 ? 18.774  63.481 74.354 1.00 32.32 ? 388  ARG A O   1 
ATOM   2989 C CB  . ARG A 1 388 ? 19.076  65.405 77.193 1.00 32.60 ? 388  ARG A CB  1 
ATOM   2990 C CG  . ARG A 1 388 ? 17.842  66.185 76.639 1.00 32.21 ? 388  ARG A CG  1 
ATOM   2991 C CD  . ARG A 1 388 ? 17.952  67.666 76.909 1.00 31.92 ? 388  ARG A CD  1 
ATOM   2992 N NE  . ARG A 1 388 ? 19.126  68.226 76.234 1.00 31.57 ? 388  ARG A NE  1 
ATOM   2993 C CZ  . ARG A 1 388 ? 19.816  69.290 76.646 1.00 30.73 ? 388  ARG A CZ  1 
ATOM   2994 N NH1 . ARG A 1 388 ? 19.480  69.933 77.752 1.00 30.78 ? 388  ARG A NH1 1 
ATOM   2995 N NH2 . ARG A 1 388 ? 20.856  69.692 75.952 1.00 30.33 ? 388  ARG A NH2 1 
ATOM   2996 N N   . ASP A 1 389 ? 20.694  64.546 74.818 1.00 31.73 ? 389  ASP A N   1 
ATOM   2997 C CA  . ASP A 1 389 ? 21.045  64.625 73.421 1.00 31.44 ? 389  ASP A CA  1 
ATOM   2998 C C   . ASP A 1 389 ? 21.198  63.254 72.745 1.00 31.26 ? 389  ASP A C   1 
ATOM   2999 O O   . ASP A 1 389 ? 20.822  63.093 71.561 1.00 30.61 ? 389  ASP A O   1 
ATOM   3000 C CB  . ASP A 1 389 ? 22.313  65.459 73.263 1.00 30.99 ? 389  ASP A CB  1 
ATOM   3001 C CG  . ASP A 1 389 ? 22.086  66.896 73.652 1.00 30.92 ? 389  ASP A CG  1 
ATOM   3002 O OD1 . ASP A 1 389 ? 20.911  67.287 73.810 1.00 29.56 ? 389  ASP A OD1 1 
ATOM   3003 O OD2 . ASP A 1 389 ? 23.084  67.614 73.787 1.00 31.03 ? 389  ASP A OD2 1 
ATOM   3004 N N   . GLY A 1 390 ? 21.721  62.282 73.499 1.00 30.83 ? 390  GLY A N   1 
ATOM   3005 C CA  . GLY A 1 390 ? 21.909  60.954 72.942 1.00 31.03 ? 390  GLY A CA  1 
ATOM   3006 C C   . GLY A 1 390 ? 20.559  60.350 72.560 1.00 31.19 ? 390  GLY A C   1 
ATOM   3007 O O   . GLY A 1 390 ? 20.416  59.766 71.489 1.00 31.41 ? 390  GLY A O   1 
ATOM   3008 N N   . LEU A 1 391 ? 19.588  60.501 73.461 1.00 31.08 ? 391  LEU A N   1 
ATOM   3009 C CA  . LEU A 1 391 ? 18.219  60.042 73.275 1.00 30.94 ? 391  LEU A CA  1 
ATOM   3010 C C   . LEU A 1 391 ? 17.598  60.800 72.076 1.00 30.61 ? 391  LEU A C   1 
ATOM   3011 O O   . LEU A 1 391 ? 16.992  60.197 71.198 1.00 30.23 ? 391  LEU A O   1 
ATOM   3012 C CB  . LEU A 1 391 ? 17.460  60.285 74.593 1.00 31.42 ? 391  LEU A CB  1 
ATOM   3013 C CG  . LEU A 1 391 ? 16.315  59.378 75.055 1.00 32.20 ? 391  LEU A CG  1 
ATOM   3014 C CD1 . LEU A 1 391 ? 16.532  57.955 74.542 1.00 32.73 ? 391  LEU A CD1 1 
ATOM   3015 C CD2 . LEU A 1 391 ? 16.188  59.385 76.582 1.00 32.17 ? 391  LEU A CD2 1 
ATOM   3016 N N   . ASP A 1 392 ? 17.800  62.110 72.010 1.00 30.65 ? 392  ASP A N   1 
ATOM   3017 C CA  . ASP A 1 392 ? 17.289  62.907 70.895 1.00 30.89 ? 392  ASP A CA  1 
ATOM   3018 C C   . ASP A 1 392 ? 17.795  62.271 69.569 1.00 30.16 ? 392  ASP A C   1 
ATOM   3019 O O   . ASP A 1 392 ? 17.014  61.983 68.641 1.00 30.32 ? 392  ASP A O   1 
ATOM   3020 C CB  . ASP A 1 392 ? 17.764  64.363 71.055 1.00 32.24 ? 392  ASP A CB  1 
ATOM   3021 C CG  . ASP A 1 392 ? 16.951  65.376 70.221 1.00 33.85 ? 392  ASP A CG  1 
ATOM   3022 O OD1 . ASP A 1 392 ? 16.175  65.018 69.298 1.00 34.35 ? 392  ASP A OD1 1 
ATOM   3023 O OD2 . ASP A 1 392 ? 17.106  66.584 70.500 1.00 35.24 ? 392  ASP A OD2 1 
ATOM   3024 N N   . ASP A 1 393 ? 19.092  62.034 69.467 1.00 29.39 ? 393  ASP A N   1 
ATOM   3025 C CA  . ASP A 1 393 ? 19.638  61.386 68.261 1.00 28.36 ? 393  ASP A CA  1 
ATOM   3026 C C   . ASP A 1 393 ? 19.096  59.974 67.997 1.00 27.69 ? 393  ASP A C   1 
ATOM   3027 O O   . ASP A 1 393 ? 18.903  59.584 66.837 1.00 27.07 ? 393  ASP A O   1 
ATOM   3028 C CB  . ASP A 1 393 ? 21.156  61.285 68.355 1.00 28.96 ? 393  ASP A CB  1 
ATOM   3029 C CG  . ASP A 1 393 ? 21.820  62.623 68.187 1.00 30.28 ? 393  ASP A CG  1 
ATOM   3030 O OD1 . ASP A 1 393 ? 21.213  63.480 67.502 1.00 30.74 ? 393  ASP A OD1 1 
ATOM   3031 O OD2 . ASP A 1 393 ? 22.936  62.820 68.710 1.00 30.50 ? 393  ASP A OD2 1 
ATOM   3032 N N   . ILE A 1 394 ? 18.890  59.180 69.052 1.00 26.79 ? 394  ILE A N   1 
ATOM   3033 C CA  . ILE A 1 394 ? 18.354  57.834 68.818 1.00 26.28 ? 394  ILE A CA  1 
ATOM   3034 C C   . ILE A 1 394 ? 16.965  57.940 68.137 1.00 25.96 ? 394  ILE A C   1 
ATOM   3035 O O   . ILE A 1 394 ? 16.697  57.276 67.142 1.00 26.36 ? 394  ILE A O   1 
ATOM   3036 C CB  . ILE A 1 394 ? 18.242  57.008 70.157 1.00 25.93 ? 394  ILE A CB  1 
ATOM   3037 C CG1 . ILE A 1 394 ? 19.636  56.506 70.586 1.00 24.86 ? 394  ILE A CG1 1 
ATOM   3038 C CG2 . ILE A 1 394 ? 17.267  55.817 69.975 1.00 24.85 ? 394  ILE A CG2 1 
ATOM   3039 C CD1 . ILE A 1 394 ? 19.678  56.167 72.042 1.00 25.70 ? 394  ILE A CD1 1 
ATOM   3040 N N   . VAL A 1 395 ? 16.121  58.819 68.634 1.00 25.47 ? 395  VAL A N   1 
ATOM   3041 C CA  . VAL A 1 395 ? 14.806  58.965 68.071 1.00 25.27 ? 395  VAL A CA  1 
ATOM   3042 C C   . VAL A 1 395 ? 14.839  59.479 66.644 1.00 25.33 ? 395  VAL A C   1 
ATOM   3043 O O   . VAL A 1 395 ? 14.184  58.900 65.761 1.00 25.42 ? 395  VAL A O   1 
ATOM   3044 C CB  . VAL A 1 395 ? 13.954  59.860 68.990 1.00 25.08 ? 395  VAL A CB  1 
ATOM   3045 C CG1 . VAL A 1 395 ? 12.596  60.124 68.377 1.00 24.89 ? 395  VAL A CG1 1 
ATOM   3046 C CG2 . VAL A 1 395 ? 13.813  59.184 70.349 1.00 24.31 ? 395  VAL A CG2 1 
ATOM   3047 N N   . GLY A 1 396 ? 15.627  60.538 66.411 1.00 25.77 ? 396  GLY A N   1 
ATOM   3048 C CA  . GLY A 1 396 ? 15.750  61.111 65.082 1.00 25.55 ? 396  GLY A CA  1 
ATOM   3049 C C   . GLY A 1 396 ? 16.450  60.169 64.077 1.00 26.18 ? 396  GLY A C   1 
ATOM   3050 O O   . GLY A 1 396 ? 16.023  60.021 62.912 1.00 26.56 ? 396  GLY A O   1 
ATOM   3051 N N   . ASP A 1 397 ? 17.539  59.540 64.500 1.00 25.91 ? 397  ASP A N   1 
ATOM   3052 C CA  . ASP A 1 397 ? 18.237  58.633 63.599 1.00 25.98 ? 397  ASP A CA  1 
ATOM   3053 C C   . ASP A 1 397 ? 17.359  57.441 63.194 1.00 25.93 ? 397  ASP A C   1 
ATOM   3054 O O   . ASP A 1 397 ? 17.224  57.149 62.020 1.00 26.28 ? 397  ASP A O   1 
ATOM   3055 C CB  . ASP A 1 397 ? 19.532  58.111 64.237 1.00 25.92 ? 397  ASP A CB  1 
ATOM   3056 C CG  . ASP A 1 397 ? 20.585  59.202 64.436 1.00 26.38 ? 397  ASP A CG  1 
ATOM   3057 O OD1 . ASP A 1 397 ? 20.512  60.294 63.815 1.00 26.73 ? 397  ASP A OD1 1 
ATOM   3058 O OD2 . ASP A 1 397 ? 21.518  58.971 65.212 1.00 25.86 ? 397  ASP A OD2 1 
ATOM   3059 N N   . HIS A 1 398 ? 16.755  56.769 64.159 1.00 26.04 ? 398  HIS A N   1 
ATOM   3060 C CA  . HIS A 1 398 ? 15.927  55.603 63.880 1.00 25.99 ? 398  HIS A CA  1 
ATOM   3061 C C   . HIS A 1 398 ? 14.658  55.886 63.087 1.00 26.29 ? 398  HIS A C   1 
ATOM   3062 O O   . HIS A 1 398 ? 14.333  55.162 62.150 1.00 26.00 ? 398  HIS A O   1 
ATOM   3063 C CB  . HIS A 1 398 ? 15.573  54.901 65.191 1.00 25.98 ? 398  HIS A CB  1 
ATOM   3064 C CG  . HIS A 1 398 ? 14.519  53.852 65.058 1.00 26.34 ? 398  HIS A CG  1 
ATOM   3065 N ND1 . HIS A 1 398 ? 14.678  52.719 64.281 1.00 26.49 ? 398  HIS A ND1 1 
ATOM   3066 C CD2 . HIS A 1 398 ? 13.286  53.760 65.615 1.00 26.81 ? 398  HIS A CD2 1 
ATOM   3067 C CE1 . HIS A 1 398 ? 13.591  51.975 64.366 1.00 26.64 ? 398  HIS A CE1 1 
ATOM   3068 N NE2 . HIS A 1 398 ? 12.731  52.584 65.173 1.00 27.63 ? 398  HIS A NE2 1 
ATOM   3069 N N   . ASN A 1 399 ? 13.986  56.974 63.429 1.00 26.90 ? 399  ASN A N   1 
ATOM   3070 C CA  . ASN A 1 399 ? 12.730  57.313 62.806 1.00 27.15 ? 399  ASN A CA  1 
ATOM   3071 C C   . ASN A 1 399 ? 12.751  58.181 61.564 1.00 27.44 ? 399  ASN A C   1 
ATOM   3072 O O   . ASN A 1 399 ? 11.852  58.106 60.728 1.00 27.51 ? 399  ASN A O   1 
ATOM   3073 C CB  . ASN A 1 399 ? 11.869  57.963 63.865 1.00 27.22 ? 399  ASN A CB  1 
ATOM   3074 C CG  . ASN A 1 399 ? 11.421  56.967 64.922 1.00 27.84 ? 399  ASN A CG  1 
ATOM   3075 O OD1 . ASN A 1 399 ? 10.697  56.034 64.603 1.00 28.08 ? 399  ASN A OD1 1 
ATOM   3076 N ND2 . ASN A 1 399 ? 11.846  57.159 66.185 1.00 27.05 ? 399  ASN A ND2 1 
ATOM   3077 N N   . VAL A 1 400 ? 13.776  59.009 61.409 1.00 27.66 ? 400  VAL A N   1 
ATOM   3078 C CA  . VAL A 1 400 ? 13.755  59.905 60.257 1.00 27.34 ? 400  VAL A CA  1 
ATOM   3079 C C   . VAL A 1 400 ? 15.014  59.838 59.404 1.00 27.59 ? 400  VAL A C   1 
ATOM   3080 O O   . VAL A 1 400 ? 14.988  59.427 58.229 1.00 27.74 ? 400  VAL A O   1 
ATOM   3081 C CB  . VAL A 1 400 ? 13.553  61.373 60.724 1.00 27.29 ? 400  VAL A CB  1 
ATOM   3082 C CG1 . VAL A 1 400 ? 13.573  62.274 59.561 1.00 26.79 ? 400  VAL A CG1 1 
ATOM   3083 C CG2 . VAL A 1 400 ? 12.193  61.519 61.491 1.00 26.62 ? 400  VAL A CG2 1 
ATOM   3084 N N   . ILE A 1 401 ? 16.138  60.153 60.029 1.00 27.67 ? 401  ILE A N   1 
ATOM   3085 C CA  . ILE A 1 401 ? 17.367  60.226 59.289 1.00 27.39 ? 401  ILE A CA  1 
ATOM   3086 C C   . ILE A 1 401 ? 17.849  58.947 58.642 1.00 27.50 ? 401  ILE A C   1 
ATOM   3087 O O   . ILE A 1 401 ? 18.045  58.918 57.430 1.00 27.58 ? 401  ILE A O   1 
ATOM   3088 C CB  . ILE A 1 401 ? 18.480  60.860 60.154 1.00 27.30 ? 401  ILE A CB  1 
ATOM   3089 C CG1 . ILE A 1 401 ? 17.986  62.217 60.661 1.00 27.09 ? 401  ILE A CG1 1 
ATOM   3090 C CG2 . ILE A 1 401 ? 19.770  61.034 59.307 1.00 26.88 ? 401  ILE A CG2 1 
ATOM   3091 C CD1 . ILE A 1 401 ? 18.969  62.969 61.559 1.00 28.01 ? 401  ILE A CD1 1 
ATOM   3092 N N   . CYS A 1 402 ? 18.023  57.882 59.408 1.00 27.30 ? 402  CYS A N   1 
ATOM   3093 C CA  . CYS A 1 402 ? 18.551  56.675 58.785 1.00 27.22 ? 402  CYS A CA  1 
ATOM   3094 C C   . CYS A 1 402 ? 17.601  56.075 57.770 1.00 26.81 ? 402  CYS A C   1 
ATOM   3095 O O   . CYS A 1 402 ? 18.053  55.550 56.782 1.00 26.40 ? 402  CYS A O   1 
ATOM   3096 C CB  . CYS A 1 402 ? 19.014  55.689 59.869 1.00 27.34 ? 402  CYS A CB  1 
ATOM   3097 S SG  . CYS A 1 402 ? 20.423  56.401 60.788 1.00 29.52 ? 402  CYS A SG  1 
ATOM   3098 N N   . PRO A 1 403 ? 16.257  56.129 58.010 1.00 27.45 ? 403  PRO A N   1 
ATOM   3099 C CA  . PRO A 1 403 ? 15.353  55.564 56.975 1.00 27.38 ? 403  PRO A CA  1 
ATOM   3100 C C   . PRO A 1 403 ? 15.491  56.449 55.707 1.00 27.48 ? 403  PRO A C   1 
ATOM   3101 O O   . PRO A 1 403 ? 15.512  55.940 54.587 1.00 27.45 ? 403  PRO A O   1 
ATOM   3102 C CB  . PRO A 1 403 ? 13.947  55.713 57.585 1.00 26.98 ? 403  PRO A CB  1 
ATOM   3103 C CG  . PRO A 1 403 ? 14.220  55.585 59.048 1.00 27.88 ? 403  PRO A CG  1 
ATOM   3104 C CD  . PRO A 1 403 ? 15.517  56.381 59.273 1.00 27.20 ? 403  PRO A CD  1 
ATOM   3105 N N   . LEU A 1 404 ? 15.590  57.773 55.878 1.00 27.25 ? 404  LEU A N   1 
ATOM   3106 C CA  . LEU A 1 404 ? 15.715  58.607 54.694 1.00 27.83 ? 404  LEU A CA  1 
ATOM   3107 C C   . LEU A 1 404 ? 17.064  58.306 53.997 1.00 28.08 ? 404  LEU A C   1 
ATOM   3108 O O   . LEU A 1 404 ? 17.151  58.288 52.772 1.00 28.04 ? 404  LEU A O   1 
ATOM   3109 C CB  . LEU A 1 404 ? 15.627  60.110 55.043 1.00 27.74 ? 404  LEU A CB  1 
ATOM   3110 C CG  . LEU A 1 404 ? 15.740  61.057 53.831 1.00 28.10 ? 404  LEU A CG  1 
ATOM   3111 C CD1 . LEU A 1 404 ? 14.789  62.255 53.922 1.00 27.48 ? 404  LEU A CD1 1 
ATOM   3112 C CD2 . LEU A 1 404 ? 17.188  61.515 53.713 1.00 28.03 ? 404  LEU A CD2 1 
ATOM   3113 N N   . MET A 1 405 ? 18.115  58.078 54.767 1.00 28.33 ? 405  MET A N   1 
ATOM   3114 C CA  . MET A 1 405 ? 19.397  57.790 54.137 1.00 29.09 ? 405  MET A CA  1 
ATOM   3115 C C   . MET A 1 405 ? 19.344  56.448 53.418 1.00 29.23 ? 405  MET A C   1 
ATOM   3116 O O   . MET A 1 405 ? 19.962  56.275 52.380 1.00 29.26 ? 405  MET A O   1 
ATOM   3117 C CB  . MET A 1 405 ? 20.533  57.811 55.150 1.00 28.86 ? 405  MET A CB  1 
ATOM   3118 C CG  . MET A 1 405 ? 20.819  59.213 55.658 1.00 28.99 ? 405  MET A CG  1 
ATOM   3119 S SD  . MET A 1 405 ? 21.030  60.402 54.334 1.00 29.44 ? 405  MET A SD  1 
ATOM   3120 C CE  . MET A 1 405 ? 22.545  59.633 53.458 1.00 27.89 ? 405  MET A CE  1 
ATOM   3121 N N   . HIS A 1 406 ? 18.571  55.506 53.941 1.00 29.87 ? 406  HIS A N   1 
ATOM   3122 C CA  . HIS A 1 406 ? 18.457  54.216 53.258 1.00 30.47 ? 406  HIS A CA  1 
ATOM   3123 C C   . HIS A 1 406 ? 17.673  54.454 51.947 1.00 30.62 ? 406  HIS A C   1 
ATOM   3124 O O   . HIS A 1 406 ? 18.059  53.961 50.871 1.00 30.76 ? 406  HIS A O   1 
ATOM   3125 C CB  . HIS A 1 406 ? 17.739  53.195 54.145 1.00 30.99 ? 406  HIS A CB  1 
ATOM   3126 C CG  . HIS A 1 406 ? 17.497  51.880 53.473 1.00 32.23 ? 406  HIS A CG  1 
ATOM   3127 N ND1 . HIS A 1 406 ? 18.513  50.977 53.204 1.00 32.53 ? 406  HIS A ND1 1 
ATOM   3128 C CD2 . HIS A 1 406 ? 16.350  51.305 53.028 1.00 31.91 ? 406  HIS A CD2 1 
ATOM   3129 C CE1 . HIS A 1 406 ? 17.998  49.907 52.625 1.00 32.02 ? 406  HIS A CE1 1 
ATOM   3130 N NE2 . HIS A 1 406 ? 16.691  50.080 52.512 1.00 32.33 ? 406  HIS A NE2 1 
ATOM   3131 N N   . PHE A 1 407 ? 16.588  55.223 52.024 1.00 30.49 ? 407  PHE A N   1 
ATOM   3132 C CA  . PHE A 1 407 ? 15.829  55.492 50.812 1.00 30.39 ? 407  PHE A CA  1 
ATOM   3133 C C   . PHE A 1 407 ? 16.703  56.208 49.770 1.00 30.63 ? 407  PHE A C   1 
ATOM   3134 O O   . PHE A 1 407 ? 16.670  55.845 48.572 1.00 30.23 ? 407  PHE A O   1 
ATOM   3135 C CB  . PHE A 1 407 ? 14.612  56.372 51.124 1.00 29.69 ? 407  PHE A CB  1 
ATOM   3136 C CG  . PHE A 1 407 ? 13.830  56.811 49.910 1.00 29.09 ? 407  PHE A CG  1 
ATOM   3137 C CD1 . PHE A 1 407 ? 12.955  55.945 49.275 1.00 29.28 ? 407  PHE A CD1 1 
ATOM   3138 C CD2 . PHE A 1 407 ? 13.960  58.106 49.411 1.00 29.01 ? 407  PHE A CD2 1 
ATOM   3139 C CE1 . PHE A 1 407 ? 12.203  56.372 48.139 1.00 28.72 ? 407  PHE A CE1 1 
ATOM   3140 C CE2 . PHE A 1 407 ? 13.227  58.535 48.287 1.00 28.61 ? 407  PHE A CE2 1 
ATOM   3141 C CZ  . PHE A 1 407 ? 12.346  57.657 47.660 1.00 28.50 ? 407  PHE A CZ  1 
ATOM   3142 N N   . VAL A 1 408 ? 17.498  57.193 50.207 1.00 30.90 ? 408  VAL A N   1 
ATOM   3143 C CA  . VAL A 1 408 ? 18.229  57.950 49.218 1.00 31.89 ? 408  VAL A CA  1 
ATOM   3144 C C   . VAL A 1 408 ? 19.290  57.142 48.507 1.00 32.39 ? 408  VAL A C   1 
ATOM   3145 O O   . VAL A 1 408 ? 19.484  57.267 47.297 1.00 31.91 ? 408  VAL A O   1 
ATOM   3146 C CB  . VAL A 1 408 ? 18.814  59.261 49.798 1.00 32.65 ? 408  VAL A CB  1 
ATOM   3147 C CG1 . VAL A 1 408 ? 19.906  58.990 50.773 1.00 32.75 ? 408  VAL A CG1 1 
ATOM   3148 C CG2 . VAL A 1 408 ? 19.354  60.133 48.637 1.00 34.32 ? 408  VAL A CG2 1 
ATOM   3149 N N   . ASN A 1 409 ? 19.958  56.277 49.259 1.00 33.06 ? 409  ASN A N   1 
ATOM   3150 C CA  . ASN A 1 409 ? 20.970  55.440 48.667 1.00 33.36 ? 409  ASN A CA  1 
ATOM   3151 C C   . ASN A 1 409 ? 20.324  54.422 47.739 1.00 33.48 ? 409  ASN A C   1 
ATOM   3152 O O   . ASN A 1 409 ? 20.877  54.124 46.679 1.00 33.72 ? 409  ASN A O   1 
ATOM   3153 C CB  . ASN A 1 409 ? 21.827  54.807 49.771 1.00 33.72 ? 409  ASN A CB  1 
ATOM   3154 C CG  . ASN A 1 409 ? 22.948  55.771 50.231 1.00 34.70 ? 409  ASN A CG  1 
ATOM   3155 O OD1 . ASN A 1 409 ? 23.874  56.076 49.451 1.00 36.03 ? 409  ASN A OD1 1 
ATOM   3156 N ND2 . ASN A 1 409 ? 22.854  56.274 51.455 1.00 34.57 ? 409  ASN A ND2 1 
ATOM   3157 N N   . LYS A 1 410 ? 19.150  53.901 48.081 1.00 33.06 ? 410  LYS A N   1 
ATOM   3158 C CA  . LYS A 1 410 ? 18.518  52.948 47.163 1.00 33.09 ? 410  LYS A CA  1 
ATOM   3159 C C   . LYS A 1 410 ? 17.964  53.646 45.900 1.00 33.12 ? 410  LYS A C   1 
ATOM   3160 O O   . LYS A 1 410 ? 18.035  53.115 44.777 1.00 32.79 ? 410  LYS A O   1 
ATOM   3161 C CB  . LYS A 1 410 ? 17.369  52.223 47.860 1.00 33.72 ? 410  LYS A CB  1 
ATOM   3162 C CG  . LYS A 1 410 ? 17.841  51.193 48.877 1.00 34.18 ? 410  LYS A CG  1 
ATOM   3163 C CD  . LYS A 1 410 ? 18.477  50.012 48.178 1.00 34.81 ? 410  LYS A CD  1 
ATOM   3164 C CE  . LYS A 1 410 ? 18.971  48.993 49.191 1.00 36.04 ? 410  LYS A CE  1 
ATOM   3165 N NZ  . LYS A 1 410 ? 19.743  47.875 48.519 1.00 36.28 ? 410  LYS A NZ  1 
ATOM   3166 N N   . TYR A 1 411 ? 17.415  54.846 46.100 1.00 32.69 ? 411  TYR A N   1 
ATOM   3167 C CA  . TYR A 1 411 ? 16.799  55.592 45.020 1.00 32.07 ? 411  TYR A CA  1 
ATOM   3168 C C   . TYR A 1 411 ? 17.796  56.032 43.998 1.00 32.02 ? 411  TYR A C   1 
ATOM   3169 O O   . TYR A 1 411 ? 17.597  55.858 42.793 1.00 32.36 ? 411  TYR A O   1 
ATOM   3170 C CB  . TYR A 1 411 ? 16.066  56.847 45.530 1.00 31.10 ? 411  TYR A CB  1 
ATOM   3171 C CG  . TYR A 1 411 ? 15.221  57.446 44.440 1.00 29.88 ? 411  TYR A CG  1 
ATOM   3172 C CD1 . TYR A 1 411 ? 13.946  56.930 44.171 1.00 29.26 ? 411  TYR A CD1 1 
ATOM   3173 C CD2 . TYR A 1 411 ? 15.716  58.483 43.633 1.00 29.20 ? 411  TYR A CD2 1 
ATOM   3174 C CE1 . TYR A 1 411 ? 13.170  57.422 43.128 1.00 28.97 ? 411  TYR A CE1 1 
ATOM   3175 C CE2 . TYR A 1 411 ? 14.961  58.995 42.568 1.00 28.86 ? 411  TYR A CE2 1 
ATOM   3176 C CZ  . TYR A 1 411 ? 13.674  58.457 42.315 1.00 29.55 ? 411  TYR A CZ  1 
ATOM   3177 O OH  . TYR A 1 411 ? 12.915  58.903 41.243 1.00 29.28 ? 411  TYR A OH  1 
ATOM   3178 N N   . THR A 1 412 ? 18.863  56.616 44.494 1.00 32.33 ? 412  THR A N   1 
ATOM   3179 C CA  . THR A 1 412 ? 19.927  57.126 43.667 1.00 32.91 ? 412  THR A CA  1 
ATOM   3180 C C   . THR A 1 412 ? 20.506  56.084 42.699 1.00 33.82 ? 412  THR A C   1 
ATOM   3181 O O   . THR A 1 412 ? 20.951  56.455 41.630 1.00 34.10 ? 412  THR A O   1 
ATOM   3182 C CB  . THR A 1 412 ? 21.014  57.773 44.576 1.00 32.45 ? 412  THR A CB  1 
ATOM   3183 O OG1 . THR A 1 412 ? 20.429  58.916 45.219 1.00 32.80 ? 412  THR A OG1 1 
ATOM   3184 C CG2 . THR A 1 412 ? 22.267  58.219 43.778 1.00 31.27 ? 412  THR A CG2 1 
ATOM   3185 N N   . LYS A 1 413 ? 20.505  54.801 43.053 1.00 34.60 ? 413  LYS A N   1 
ATOM   3186 C CA  . LYS A 1 413 ? 20.997  53.788 42.104 1.00 35.59 ? 413  LYS A CA  1 
ATOM   3187 C C   . LYS A 1 413 ? 20.153  53.829 40.799 1.00 35.95 ? 413  LYS A C   1 
ATOM   3188 O O   . LYS A 1 413 ? 20.683  53.609 39.712 1.00 36.04 ? 413  LYS A O   1 
ATOM   3189 C CB  . LYS A 1 413 ? 20.894  52.358 42.671 1.00 35.61 ? 413  LYS A CB  1 
ATOM   3190 C CG  . LYS A 1 413 ? 21.754  52.044 43.950 1.00 36.85 ? 413  LYS A CG  1 
ATOM   3191 N N   . PHE A 1 414 ? 18.852  54.109 40.888 1.00 35.43 ? 414  PHE A N   1 
ATOM   3192 C CA  . PHE A 1 414 ? 18.034  54.119 39.672 1.00 35.18 ? 414  PHE A CA  1 
ATOM   3193 C C   . PHE A 1 414 ? 17.498  55.459 39.209 1.00 35.19 ? 414  PHE A C   1 
ATOM   3194 O O   . PHE A 1 414 ? 17.032  55.579 38.082 1.00 35.12 ? 414  PHE A O   1 
ATOM   3195 C CB  . PHE A 1 414 ? 16.849  53.210 39.861 1.00 34.91 ? 414  PHE A CB  1 
ATOM   3196 C CG  . PHE A 1 414 ? 17.220  51.784 40.054 1.00 35.38 ? 414  PHE A CG  1 
ATOM   3197 C CD1 . PHE A 1 414 ? 17.503  51.303 41.307 1.00 34.97 ? 414  PHE A CD1 1 
ATOM   3198 C CD2 . PHE A 1 414 ? 17.299  50.915 38.959 1.00 35.49 ? 414  PHE A CD2 1 
ATOM   3199 C CE1 . PHE A 1 414 ? 17.865  49.970 41.510 1.00 35.64 ? 414  PHE A CE1 1 
ATOM   3200 C CE2 . PHE A 1 414 ? 17.655  49.580 39.141 1.00 35.43 ? 414  PHE A CE2 1 
ATOM   3201 C CZ  . PHE A 1 414 ? 17.940  49.107 40.435 1.00 35.75 ? 414  PHE A CZ  1 
ATOM   3202 N N   . GLY A 1 415 ? 17.537  56.462 40.082 1.00 35.10 ? 415  GLY A N   1 
ATOM   3203 C CA  . GLY A 1 415 ? 16.996  57.765 39.730 1.00 34.77 ? 415  GLY A CA  1 
ATOM   3204 C C   . GLY A 1 415 ? 17.769  58.592 38.718 1.00 34.66 ? 415  GLY A C   1 
ATOM   3205 O O   . GLY A 1 415 ? 18.799  58.196 38.204 1.00 33.86 ? 415  GLY A O   1 
ATOM   3206 N N   . ASN A 1 416 ? 17.253  59.779 38.470 1.00 34.98 ? 416  ASN A N   1 
ATOM   3207 C CA  . ASN A 1 416 ? 17.832  60.668 37.508 1.00 35.27 ? 416  ASN A CA  1 
ATOM   3208 C C   . ASN A 1 416 ? 18.421  61.914 38.142 1.00 35.00 ? 416  ASN A C   1 
ATOM   3209 O O   . ASN A 1 416 ? 18.762  62.851 37.449 1.00 34.73 ? 416  ASN A O   1 
ATOM   3210 C CB  . ASN A 1 416 ? 16.736  61.036 36.504 1.00 37.57 ? 416  ASN A CB  1 
ATOM   3211 C CG  . ASN A 1 416 ? 17.264  61.841 35.339 1.00 39.54 ? 416  ASN A CG  1 
ATOM   3212 O OD1 . ASN A 1 416 ? 16.721  62.918 35.027 1.00 39.05 ? 416  ASN A OD1 1 
ATOM   3213 N ND2 . ASN A 1 416 ? 18.322  61.321 34.715 1.00 40.59 ? 416  ASN A ND2 1 
ATOM   3214 N N   . GLY A 1 417 ? 18.554  61.924 39.469 1.00 34.66 ? 417  GLY A N   1 
ATOM   3215 C CA  . GLY A 1 417 ? 19.127  63.079 40.143 1.00 34.34 ? 417  GLY A CA  1 
ATOM   3216 C C   . GLY A 1 417 ? 18.656  63.280 41.572 1.00 33.60 ? 417  GLY A C   1 
ATOM   3217 O O   . GLY A 1 417 ? 17.474  63.329 41.824 1.00 33.77 ? 417  GLY A O   1 
ATOM   3218 N N   . THR A 1 418 ? 19.589  63.425 42.502 1.00 33.30 ? 418  THR A N   1 
ATOM   3219 C CA  . THR A 1 418 ? 19.227  63.561 43.910 1.00 32.45 ? 418  THR A CA  1 
ATOM   3220 C C   . THR A 1 418 ? 19.961  64.744 44.535 1.00 32.32 ? 418  THR A C   1 
ATOM   3221 O O   . THR A 1 418 ? 21.167  64.902 44.292 1.00 32.34 ? 418  THR A O   1 
ATOM   3222 C CB  . THR A 1 418 ? 19.686  62.286 44.723 1.00 32.52 ? 418  THR A CB  1 
ATOM   3223 O OG1 . THR A 1 418 ? 19.237  61.082 44.075 1.00 31.06 ? 418  THR A OG1 1 
ATOM   3224 C CG2 . THR A 1 418 ? 19.176  62.363 46.188 1.00 31.15 ? 418  THR A CG2 1 
ATOM   3225 N N   . TYR A 1 419 ? 19.256  65.565 45.314 1.00 31.37 ? 419  TYR A N   1 
ATOM   3226 C CA  . TYR A 1 419 ? 19.905  66.661 46.032 1.00 31.26 ? 419  TYR A CA  1 
ATOM   3227 C C   . TYR A 1 419 ? 19.507  66.493 47.513 1.00 30.90 ? 419  TYR A C   1 
ATOM   3228 O O   . TYR A 1 419 ? 18.302  66.429 47.856 1.00 31.03 ? 419  TYR A O   1 
ATOM   3229 C CB  . TYR A 1 419 ? 19.509  68.044 45.487 1.00 31.73 ? 419  TYR A CB  1 
ATOM   3230 C CG  . TYR A 1 419 ? 19.913  68.245 44.025 1.00 32.31 ? 419  TYR A CG  1 
ATOM   3231 C CD1 . TYR A 1 419 ? 19.097  67.779 42.988 1.00 31.97 ? 419  TYR A CD1 1 
ATOM   3232 C CD2 . TYR A 1 419 ? 21.125  68.858 43.680 1.00 32.52 ? 419  TYR A CD2 1 
ATOM   3233 C CE1 . TYR A 1 419 ? 19.449  67.911 41.676 1.00 32.28 ? 419  TYR A CE1 1 
ATOM   3234 C CE2 . TYR A 1 419 ? 21.494  68.992 42.327 1.00 32.92 ? 419  TYR A CE2 1 
ATOM   3235 C CZ  . TYR A 1 419 ? 20.640  68.512 41.338 1.00 32.99 ? 419  TYR A CZ  1 
ATOM   3236 O OH  . TYR A 1 419 ? 20.966  68.605 39.984 1.00 33.65 ? 419  TYR A OH  1 
ATOM   3237 N N   . LEU A 1 420 ? 20.524  66.381 48.372 1.00 30.08 ? 420  LEU A N   1 
ATOM   3238 C CA  . LEU A 1 420 ? 20.340  66.158 49.794 1.00 29.27 ? 420  LEU A CA  1 
ATOM   3239 C C   . LEU A 1 420 ? 20.760  67.309 50.713 1.00 29.57 ? 420  LEU A C   1 
ATOM   3240 O O   . LEU A 1 420 ? 21.828  67.915 50.561 1.00 29.84 ? 420  LEU A O   1 
ATOM   3241 C CB  . LEU A 1 420 ? 21.063  64.865 50.176 1.00 28.53 ? 420  LEU A CB  1 
ATOM   3242 C CG  . LEU A 1 420 ? 21.034  64.399 51.638 1.00 28.76 ? 420  LEU A CG  1 
ATOM   3243 C CD1 . LEU A 1 420 ? 19.630  64.005 51.997 1.00 27.82 ? 420  LEU A CD1 1 
ATOM   3244 C CD2 . LEU A 1 420 ? 22.004  63.206 51.845 1.00 27.92 ? 420  LEU A CD2 1 
ATOM   3245 N N   . TYR A 1 421 ? 19.905  67.630 51.683 1.00 29.33 ? 421  TYR A N   1 
ATOM   3246 C CA  . TYR A 1 421 ? 20.239  68.708 52.603 1.00 29.10 ? 421  TYR A CA  1 
ATOM   3247 C C   . TYR A 1 421 ? 20.149  68.267 54.059 1.00 29.31 ? 421  TYR A C   1 
ATOM   3248 O O   . TYR A 1 421 ? 19.468  67.270 54.385 1.00 29.20 ? 421  TYR A O   1 
ATOM   3249 C CB  . TYR A 1 421 ? 19.303  69.904 52.395 1.00 28.18 ? 421  TYR A CB  1 
ATOM   3250 C CG  . TYR A 1 421 ? 17.869  69.681 52.854 1.00 27.97 ? 421  TYR A CG  1 
ATOM   3251 C CD1 . TYR A 1 421 ? 17.536  69.725 54.209 1.00 27.46 ? 421  TYR A CD1 1 
ATOM   3252 C CD2 . TYR A 1 421 ? 16.844  69.385 51.923 1.00 27.90 ? 421  TYR A CD2 1 
ATOM   3253 C CE1 . TYR A 1 421 ? 16.197  69.470 54.637 1.00 27.62 ? 421  TYR A CE1 1 
ATOM   3254 C CE2 . TYR A 1 421 ? 15.525  69.137 52.333 1.00 27.02 ? 421  TYR A CE2 1 
ATOM   3255 C CZ  . TYR A 1 421 ? 15.206  69.179 53.687 1.00 27.40 ? 421  TYR A CZ  1 
ATOM   3256 O OH  . TYR A 1 421 ? 13.911  68.943 54.106 1.00 27.25 ? 421  TYR A OH  1 
ATOM   3257 N N   . PHE A 1 422 ? 20.837  69.013 54.917 1.00 29.46 ? 422  PHE A N   1 
ATOM   3258 C CA  . PHE A 1 422 ? 20.795  68.789 56.349 1.00 30.06 ? 422  PHE A CA  1 
ATOM   3259 C C   . PHE A 1 422 ? 20.456  70.189 56.862 1.00 30.71 ? 422  PHE A C   1 
ATOM   3260 O O   . PHE A 1 422 ? 21.313  71.092 56.794 1.00 30.74 ? 422  PHE A O   1 
ATOM   3261 C CB  . PHE A 1 422 ? 22.161  68.341 56.852 1.00 30.34 ? 422  PHE A CB  1 
ATOM   3262 C CG  . PHE A 1 422 ? 22.198  68.019 58.328 1.00 30.86 ? 422  PHE A CG  1 
ATOM   3263 C CD1 . PHE A 1 422 ? 21.586  66.855 58.826 1.00 31.40 ? 422  PHE A CD1 1 
ATOM   3264 C CD2 . PHE A 1 422 ? 22.842  68.866 59.210 1.00 30.71 ? 422  PHE A CD2 1 
ATOM   3265 C CE1 . PHE A 1 422 ? 21.625  66.552 60.201 1.00 31.04 ? 422  PHE A CE1 1 
ATOM   3266 C CE2 . PHE A 1 422 ? 22.894  68.588 60.584 1.00 31.28 ? 422  PHE A CE2 1 
ATOM   3267 C CZ  . PHE A 1 422 ? 22.292  67.440 61.082 1.00 31.18 ? 422  PHE A CZ  1 
ATOM   3268 N N   . PHE A 1 423 ? 19.222  70.383 57.342 1.00 30.94 ? 423  PHE A N   1 
ATOM   3269 C CA  . PHE A 1 423 ? 18.777  71.690 57.820 1.00 31.27 ? 423  PHE A CA  1 
ATOM   3270 C C   . PHE A 1 423 ? 19.108  71.845 59.313 1.00 32.23 ? 423  PHE A C   1 
ATOM   3271 O O   . PHE A 1 423 ? 18.561  71.099 60.190 1.00 32.18 ? 423  PHE A O   1 
ATOM   3272 C CB  . PHE A 1 423 ? 17.281  71.851 57.552 1.00 30.85 ? 423  PHE A CB  1 
ATOM   3273 C CG  . PHE A 1 423 ? 16.696  73.147 58.061 1.00 31.39 ? 423  PHE A CG  1 
ATOM   3274 C CD1 . PHE A 1 423 ? 16.670  74.285 57.249 1.00 30.27 ? 423  PHE A CD1 1 
ATOM   3275 C CD2 . PHE A 1 423 ? 16.139  73.215 59.350 1.00 31.01 ? 423  PHE A CD2 1 
ATOM   3276 C CE1 . PHE A 1 423 ? 16.112  75.438 57.689 1.00 30.72 ? 423  PHE A CE1 1 
ATOM   3277 C CE2 . PHE A 1 423 ? 15.558  74.404 59.822 1.00 30.96 ? 423  PHE A CE2 1 
ATOM   3278 C CZ  . PHE A 1 423 ? 15.545  75.526 58.985 1.00 30.84 ? 423  PHE A CZ  1 
ATOM   3279 N N   . ASN A 1 424 ? 20.002  72.799 59.615 1.00 32.30 ? 424  ASN A N   1 
ATOM   3280 C CA  . ASN A 1 424 ? 20.410  72.968 60.985 1.00 33.41 ? 424  ASN A CA  1 
ATOM   3281 C C   . ASN A 1 424 ? 20.451  74.400 61.519 1.00 34.14 ? 424  ASN A C   1 
ATOM   3282 O O   . ASN A 1 424 ? 21.296  74.755 62.351 1.00 34.10 ? 424  ASN A O   1 
ATOM   3283 C CB  . ASN A 1 424 ? 21.750  72.219 61.250 1.00 33.31 ? 424  ASN A CB  1 
ATOM   3284 C CG  . ASN A 1 424 ? 22.924  72.792 60.449 1.00 34.13 ? 424  ASN A CG  1 
ATOM   3285 O OD1 . ASN A 1 424 ? 22.726  73.549 59.491 1.00 33.82 ? 424  ASN A OD1 1 
ATOM   3286 N ND2 . ASN A 1 424 ? 24.143  72.426 60.829 1.00 33.85 ? 424  ASN A ND2 1 
ATOM   3287 N N   . HIS A 1 425 ? 19.519  75.219 61.073 1.00 34.53 ? 425  HIS A N   1 
ATOM   3288 C CA  . HIS A 1 425 ? 19.463  76.552 61.627 1.00 35.35 ? 425  HIS A CA  1 
ATOM   3289 C C   . HIS A 1 425 ? 18.278  76.541 62.572 1.00 35.98 ? 425  HIS A C   1 
ATOM   3290 O O   . HIS A 1 425 ? 17.183  76.159 62.163 1.00 36.51 ? 425  HIS A O   1 
ATOM   3291 C CB  . HIS A 1 425 ? 19.170  77.615 60.566 1.00 34.89 ? 425  HIS A CB  1 
ATOM   3292 C CG  . HIS A 1 425 ? 18.913  78.972 61.153 1.00 34.71 ? 425  HIS A CG  1 
ATOM   3293 N ND1 . HIS A 1 425 ? 19.918  79.738 61.709 1.00 34.76 ? 425  HIS A ND1 1 
ATOM   3294 C CD2 . HIS A 1 425 ? 17.762  79.656 61.363 1.00 34.65 ? 425  HIS A CD2 1 
ATOM   3295 C CE1 . HIS A 1 425 ? 19.395  80.832 62.243 1.00 34.68 ? 425  HIS A CE1 1 
ATOM   3296 N NE2 . HIS A 1 425 ? 18.089  80.808 62.051 1.00 34.40 ? 425  HIS A NE2 1 
ATOM   3297 N N   . ARG A 1 426 ? 18.460  76.942 63.817 1.00 36.47 ? 426  ARG A N   1 
ATOM   3298 C CA  . ARG A 1 426 ? 17.308  77.001 64.710 1.00 37.18 ? 426  ARG A CA  1 
ATOM   3299 C C   . ARG A 1 426 ? 16.784  78.453 64.620 1.00 37.27 ? 426  ARG A C   1 
ATOM   3300 O O   . ARG A 1 426 ? 17.556  79.400 64.781 1.00 37.14 ? 426  ARG A O   1 
ATOM   3301 C CB  . ARG A 1 426 ? 17.702  76.671 66.175 1.00 37.30 ? 426  ARG A CB  1 
ATOM   3302 C CG  . ARG A 1 426 ? 16.541  76.897 67.213 1.00 37.66 ? 426  ARG A CG  1 
ATOM   3303 C CD  . ARG A 1 426 ? 17.061  76.795 68.644 1.00 37.03 ? 426  ARG A CD  1 
ATOM   3304 N NE  . ARG A 1 426 ? 16.182  77.372 69.658 1.00 37.21 ? 426  ARG A NE  1 
ATOM   3305 C CZ  . ARG A 1 426 ? 15.308  76.688 70.395 1.00 37.44 ? 426  ARG A CZ  1 
ATOM   3306 N NH1 . ARG A 1 426 ? 15.157  75.362 70.218 1.00 37.28 ? 426  ARG A NH1 1 
ATOM   3307 N NH2 . ARG A 1 426 ? 14.568  77.333 71.305 1.00 36.87 ? 426  ARG A NH2 1 
ATOM   3308 N N   . ALA A 1 427 ? 15.490  78.611 64.355 1.00 37.45 ? 427  ALA A N   1 
ATOM   3309 C CA  . ALA A 1 427 ? 14.872  79.926 64.252 1.00 37.77 ? 427  ALA A CA  1 
ATOM   3310 C C   . ALA A 1 427 ? 15.130  80.771 65.508 1.00 38.28 ? 427  ALA A C   1 
ATOM   3311 O O   . ALA A 1 427 ? 14.988  80.311 66.665 1.00 38.94 ? 427  ALA A O   1 
ATOM   3312 C CB  . ALA A 1 427 ? 13.369  79.786 64.016 1.00 37.28 ? 427  ALA A CB  1 
ATOM   3313 N N   . SER A 1 428 ? 15.490  82.022 65.285 1.00 38.69 ? 428  SER A N   1 
ATOM   3314 C CA  . SER A 1 428 ? 15.799  82.934 66.391 1.00 39.19 ? 428  SER A CA  1 
ATOM   3315 C C   . SER A 1 428 ? 14.565  83.206 67.236 1.00 39.40 ? 428  SER A C   1 
ATOM   3316 O O   . SER A 1 428 ? 14.688  83.505 68.422 1.00 39.86 ? 428  SER A O   1 
ATOM   3317 C CB  . SER A 1 428 ? 16.364  84.259 65.858 1.00 38.80 ? 428  SER A CB  1 
ATOM   3318 O OG  . SER A 1 428 ? 15.422  84.855 64.965 1.00 39.20 ? 428  SER A OG  1 
ATOM   3319 N N   . ASN A 1 429 ? 13.380  83.073 66.643 1.00 39.45 ? 429  ASN A N   1 
ATOM   3320 C CA  . ASN A 1 429 ? 12.131  83.334 67.376 1.00 38.94 ? 429  ASN A CA  1 
ATOM   3321 C C   . ASN A 1 429 ? 11.372  82.096 67.871 1.00 38.89 ? 429  ASN A C   1 
ATOM   3322 O O   . ASN A 1 429 ? 10.150  82.189 68.183 1.00 38.68 ? 429  ASN A O   1 
ATOM   3323 C CB  . ASN A 1 429 ? 11.181  84.144 66.490 1.00 39.08 ? 429  ASN A CB  1 
ATOM   3324 C CG  . ASN A 1 429 ? 10.892  83.464 65.137 1.00 39.56 ? 429  ASN A CG  1 
ATOM   3325 O OD1 . ASN A 1 429 ? 11.243  82.285 64.913 1.00 39.10 ? 429  ASN A OD1 1 
ATOM   3326 N ND2 . ASN A 1 429 ? 10.242  84.214 64.228 1.00 38.92 ? 429  ASN A ND2 1 
ATOM   3327 N N   . LEU A 1 430 ? 12.052  80.948 67.938 1.00 38.34 ? 430  LEU A N   1 
ATOM   3328 C CA  . LEU A 1 430 ? 11.382  79.717 68.370 1.00 38.00 ? 430  LEU A CA  1 
ATOM   3329 C C   . LEU A 1 430 ? 10.842  79.822 69.790 1.00 37.59 ? 430  LEU A C   1 
ATOM   3330 O O   . LEU A 1 430 ? 11.567  80.231 70.693 1.00 37.25 ? 430  LEU A O   1 
ATOM   3331 C CB  . LEU A 1 430 ? 12.355  78.531 68.296 1.00 38.84 ? 430  LEU A CB  1 
ATOM   3332 C CG  . LEU A 1 430 ? 12.107  77.475 67.202 1.00 39.88 ? 430  LEU A CG  1 
ATOM   3333 C CD1 . LEU A 1 430 ? 13.214  76.416 67.339 1.00 40.23 ? 430  LEU A CD1 1 
ATOM   3334 C CD2 . LEU A 1 430 ? 10.713  76.794 67.353 1.00 39.47 ? 430  LEU A CD2 1 
ATOM   3335 N N   . VAL A 1 431 ? 9.590   79.433 70.014 1.00 36.72 ? 431  VAL A N   1 
ATOM   3336 C CA  . VAL A 1 431 ? 9.066   79.531 71.368 1.00 36.11 ? 431  VAL A CA  1 
ATOM   3337 C C   . VAL A 1 431 ? 9.315   78.266 72.178 1.00 35.54 ? 431  VAL A C   1 
ATOM   3338 O O   . VAL A 1 431 ? 9.123   78.254 73.389 1.00 35.45 ? 431  VAL A O   1 
ATOM   3339 C CB  . VAL A 1 431 ? 7.555   79.836 71.374 1.00 36.58 ? 431  VAL A CB  1 
ATOM   3340 C CG1 . VAL A 1 431 ? 7.308   81.151 70.657 1.00 36.25 ? 431  VAL A CG1 1 
ATOM   3341 C CG2 . VAL A 1 431 ? 6.747   78.667 70.673 1.00 36.38 ? 431  VAL A CG2 1 
ATOM   3342 N N   . TRP A 1 432 ? 9.733   77.198 71.504 1.00 34.75 ? 432  TRP A N   1 
ATOM   3343 C CA  . TRP A 1 432 ? 10.052  75.912 72.163 1.00 33.76 ? 432  TRP A CA  1 
ATOM   3344 C C   . TRP A 1 432 ? 11.381  76.058 72.922 1.00 33.57 ? 432  TRP A C   1 
ATOM   3345 O O   . TRP A 1 432 ? 12.220  76.878 72.542 1.00 33.83 ? 432  TRP A O   1 
ATOM   3346 C CB  . TRP A 1 432 ? 10.164  74.787 71.097 1.00 32.22 ? 432  TRP A CB  1 
ATOM   3347 C CG  . TRP A 1 432 ? 8.820   74.352 70.531 1.00 31.17 ? 432  TRP A CG  1 
ATOM   3348 C CD1 . TRP A 1 432 ? 8.289   74.675 69.313 1.00 31.23 ? 432  TRP A CD1 1 
ATOM   3349 C CD2 . TRP A 1 432 ? 7.821   73.586 71.206 1.00 30.34 ? 432  TRP A CD2 1 
ATOM   3350 N NE1 . TRP A 1 432 ? 7.010   74.157 69.192 1.00 30.71 ? 432  TRP A NE1 1 
ATOM   3351 C CE2 . TRP A 1 432 ? 6.701   73.488 70.341 1.00 30.35 ? 432  TRP A CE2 1 
ATOM   3352 C CE3 . TRP A 1 432 ? 7.763   72.972 72.461 1.00 29.98 ? 432  TRP A CE3 1 
ATOM   3353 C CZ2 . TRP A 1 432 ? 5.524   72.801 70.699 1.00 29.94 ? 432  TRP A CZ2 1 
ATOM   3354 C CZ3 . TRP A 1 432 ? 6.598   72.282 72.817 1.00 29.89 ? 432  TRP A CZ3 1 
ATOM   3355 C CH2 . TRP A 1 432 ? 5.494   72.207 71.931 1.00 29.94 ? 432  TRP A CH2 1 
ATOM   3356 N N   . PRO A 1 433 ? 11.607  75.260 73.979 1.00 33.86 ? 433  PRO A N   1 
ATOM   3357 C CA  . PRO A 1 433 ? 12.882  75.425 74.688 1.00 34.03 ? 433  PRO A CA  1 
ATOM   3358 C C   . PRO A 1 433 ? 14.119  75.088 73.877 1.00 34.70 ? 433  PRO A C   1 
ATOM   3359 O O   . PRO A 1 433 ? 14.083  74.333 72.904 1.00 35.33 ? 433  PRO A O   1 
ATOM   3360 C CB  . PRO A 1 433 ? 12.740  74.520 75.890 1.00 33.93 ? 433  PRO A CB  1 
ATOM   3361 C CG  . PRO A 1 433 ? 11.862  73.350 75.315 1.00 33.97 ? 433  PRO A CG  1 
ATOM   3362 C CD  . PRO A 1 433 ? 10.806  74.159 74.563 1.00 33.48 ? 433  PRO A CD  1 
ATOM   3363 N N   . GLU A 1 434 ? 15.219  75.683 74.301 1.00 35.20 ? 434  GLU A N   1 
ATOM   3364 C CA  . GLU A 1 434 ? 16.540  75.522 73.717 1.00 35.42 ? 434  GLU A CA  1 
ATOM   3365 C C   . GLU A 1 434 ? 16.983  74.062 73.559 1.00 33.96 ? 434  GLU A C   1 
ATOM   3366 O O   . GLU A 1 434 ? 17.599  73.692 72.548 1.00 33.13 ? 434  GLU A O   1 
ATOM   3367 C CB  . GLU A 1 434 ? 17.538  76.223 74.634 1.00 37.46 ? 434  GLU A CB  1 
ATOM   3368 C CG  . GLU A 1 434 ? 18.592  76.975 73.912 1.00 41.72 ? 434  GLU A CG  1 
ATOM   3369 C CD  . GLU A 1 434 ? 17.976  78.009 72.974 1.00 44.18 ? 434  GLU A CD  1 
ATOM   3370 O OE1 . GLU A 1 434 ? 16.977  78.643 73.435 1.00 45.67 ? 434  GLU A OE1 1 
ATOM   3371 O OE2 . GLU A 1 434 ? 18.480  78.185 71.805 1.00 45.43 ? 434  GLU A OE2 1 
ATOM   3372 N N   . TRP A 1 435 ? 16.690  73.237 74.563 1.00 32.56 ? 435  TRP A N   1 
ATOM   3373 C CA  . TRP A 1 435 ? 17.158  71.852 74.488 1.00 32.10 ? 435  TRP A CA  1 
ATOM   3374 C C   . TRP A 1 435 ? 16.615  71.040 73.275 1.00 31.53 ? 435  TRP A C   1 
ATOM   3375 O O   . TRP A 1 435 ? 17.212  70.035 72.890 1.00 31.62 ? 435  TRP A O   1 
ATOM   3376 C CB  . TRP A 1 435 ? 16.886  71.092 75.814 1.00 31.81 ? 435  TRP A CB  1 
ATOM   3377 C CG  . TRP A 1 435 ? 15.426  70.703 76.075 1.00 32.00 ? 435  TRP A CG  1 
ATOM   3378 C CD1 . TRP A 1 435 ? 14.560  71.324 76.917 1.00 31.58 ? 435  TRP A CD1 1 
ATOM   3379 C CD2 . TRP A 1 435 ? 14.701  69.563 75.525 1.00 32.02 ? 435  TRP A CD2 1 
ATOM   3380 N NE1 . TRP A 1 435 ? 13.355  70.659 76.944 1.00 32.04 ? 435  TRP A NE1 1 
ATOM   3381 C CE2 . TRP A 1 435 ? 13.403  69.583 76.098 1.00 31.61 ? 435  TRP A CE2 1 
ATOM   3382 C CE3 . TRP A 1 435 ? 15.027  68.540 74.610 1.00 31.85 ? 435  TRP A CE3 1 
ATOM   3383 C CZ2 . TRP A 1 435 ? 12.421  68.634 75.789 1.00 31.80 ? 435  TRP A CZ2 1 
ATOM   3384 C CZ3 . TRP A 1 435 ? 14.051  67.584 74.294 1.00 31.92 ? 435  TRP A CZ3 1 
ATOM   3385 C CH2 . TRP A 1 435 ? 12.753  67.644 74.887 1.00 32.15 ? 435  TRP A CH2 1 
ATOM   3386 N N   . MET A 1 436 ? 15.520  71.486 72.664 1.00 30.48 ? 436  MET A N   1 
ATOM   3387 C CA  . MET A 1 436 ? 14.943  70.757 71.544 1.00 29.85 ? 436  MET A CA  1 
ATOM   3388 C C   . MET A 1 436 ? 15.683  70.979 70.232 1.00 29.12 ? 436  MET A C   1 
ATOM   3389 O O   . MET A 1 436 ? 15.515  70.197 69.295 1.00 28.30 ? 436  MET A O   1 
ATOM   3390 C CB  . MET A 1 436 ? 13.454  71.084 71.411 1.00 30.14 ? 436  MET A CB  1 
ATOM   3391 C CG  . MET A 1 436 ? 12.685  70.591 72.630 1.00 30.16 ? 436  MET A CG  1 
ATOM   3392 S SD  . MET A 1 436 ? 10.992  71.107 72.707 1.00 31.59 ? 436  MET A SD  1 
ATOM   3393 C CE  . MET A 1 436 ? 10.206  69.883 71.386 1.00 29.48 ? 436  MET A CE  1 
ATOM   3394 N N   . GLY A 1 437 ? 16.553  72.004 70.198 1.00 28.83 ? 437  GLY A N   1 
ATOM   3395 C CA  . GLY A 1 437 ? 17.382  72.276 69.007 1.00 27.66 ? 437  GLY A CA  1 
ATOM   3396 C C   . GLY A 1 437 ? 16.642  72.733 67.749 1.00 27.26 ? 437  GLY A C   1 
ATOM   3397 O O   . GLY A 1 437 ? 15.747  73.565 67.825 1.00 27.28 ? 437  GLY A O   1 
ATOM   3398 N N   . VAL A 1 438 ? 17.037  72.180 66.610 1.00 27.00 ? 438  VAL A N   1 
ATOM   3399 C CA  . VAL A 1 438 ? 16.427  72.441 65.309 1.00 27.25 ? 438  VAL A CA  1 
ATOM   3400 C C   . VAL A 1 438 ? 15.367  71.316 65.155 1.00 27.42 ? 438  VAL A C   1 
ATOM   3401 O O   . VAL A 1 438 ? 15.592  70.204 64.613 1.00 27.44 ? 438  VAL A O   1 
ATOM   3402 C CB  . VAL A 1 438 ? 17.471  72.349 64.218 1.00 27.57 ? 438  VAL A CB  1 
ATOM   3403 C CG1 . VAL A 1 438 ? 16.907  72.855 62.904 1.00 27.12 ? 438  VAL A CG1 1 
ATOM   3404 C CG2 . VAL A 1 438 ? 18.705  73.143 64.620 1.00 27.20 ? 438  VAL A CG2 1 
ATOM   3405 N N   . ILE A 1 439 ? 14.226  71.636 65.721 1.00 27.33 ? 439  ILE A N   1 
ATOM   3406 C CA  . ILE A 1 439 ? 13.062  70.781 65.838 1.00 27.45 ? 439  ILE A CA  1 
ATOM   3407 C C   . ILE A 1 439 ? 12.390  70.314 64.553 1.00 27.16 ? 439  ILE A C   1 
ATOM   3408 O O   . ILE A 1 439 ? 12.353  71.009 63.530 1.00 27.27 ? 439  ILE A O   1 
ATOM   3409 C CB  . ILE A 1 439 ? 12.014  71.496 66.681 1.00 27.60 ? 439  ILE A CB  1 
ATOM   3410 C CG1 . ILE A 1 439 ? 12.709  72.030 67.953 1.00 27.89 ? 439  ILE A CG1 1 
ATOM   3411 C CG2 . ILE A 1 439 ? 10.807  70.595 66.934 1.00 27.19 ? 439  ILE A CG2 1 
ATOM   3412 C CD1 . ILE A 1 439 ? 11.790  72.865 68.845 1.00 27.91 ? 439  ILE A CD1 1 
ATOM   3413 N N   . HIS A 1 440 ? 11.893  69.086 64.652 1.00 26.70 ? 440  HIS A N   1 
ATOM   3414 C CA  . HIS A 1 440 ? 11.145  68.446 63.613 1.00 26.22 ? 440  HIS A CA  1 
ATOM   3415 C C   . HIS A 1 440 ? 10.052  69.436 63.211 1.00 26.66 ? 440  HIS A C   1 
ATOM   3416 O O   . HIS A 1 440 ? 9.352   69.936 64.065 1.00 26.77 ? 440  HIS A O   1 
ATOM   3417 C CB  . HIS A 1 440 ? 10.527  67.219 64.207 1.00 25.03 ? 440  HIS A CB  1 
ATOM   3418 C CG  . HIS A 1 440 ? 9.584   66.509 63.294 1.00 24.98 ? 440  HIS A CG  1 
ATOM   3419 N ND1 . HIS A 1 440 ? 10.014  65.816 62.174 1.00 23.49 ? 440  HIS A ND1 1 
ATOM   3420 C CD2 . HIS A 1 440 ? 8.247   66.286 63.406 1.00 24.20 ? 440  HIS A CD2 1 
ATOM   3421 C CE1 . HIS A 1 440 ? 8.973   65.176 61.653 1.00 24.86 ? 440  HIS A CE1 1 
ATOM   3422 N NE2 . HIS A 1 440 ? 7.890   65.441 62.379 1.00 24.74 ? 440  HIS A NE2 1 
ATOM   3423 N N   . GLY A 1 441 ? 9.940   69.708 61.915 1.00 27.01 ? 441  GLY A N   1 
ATOM   3424 C CA  . GLY A 1 441 ? 8.937   70.611 61.392 1.00 27.95 ? 441  GLY A CA  1 
ATOM   3425 C C   . GLY A 1 441 ? 9.278   72.107 61.274 1.00 28.69 ? 441  GLY A C   1 
ATOM   3426 O O   . GLY A 1 441 ? 8.537   72.871 60.656 1.00 28.65 ? 441  GLY A O   1 
ATOM   3427 N N   . TYR A 1 442 ? 10.404  72.528 61.834 1.00 28.75 ? 442  TYR A N   1 
ATOM   3428 C CA  . TYR A 1 442 ? 10.694  73.936 61.822 1.00 28.51 ? 442  TYR A CA  1 
ATOM   3429 C C   . TYR A 1 442 ? 11.520  74.427 60.660 1.00 29.14 ? 442  TYR A C   1 
ATOM   3430 O O   . TYR A 1 442 ? 12.113  75.499 60.727 1.00 29.30 ? 442  TYR A O   1 
ATOM   3431 C CB  . TYR A 1 442 ? 11.256  74.346 63.199 1.00 28.90 ? 442  TYR A CB  1 
ATOM   3432 C CG  . TYR A 1 442 ? 10.120  74.487 64.197 1.00 29.15 ? 442  TYR A CG  1 
ATOM   3433 C CD1 . TYR A 1 442 ? 9.555   73.354 64.818 1.00 29.35 ? 442  TYR A CD1 1 
ATOM   3434 C CD2 . TYR A 1 442 ? 9.477   75.714 64.364 1.00 29.17 ? 442  TYR A CD2 1 
ATOM   3435 C CE1 . TYR A 1 442 ? 8.361   73.446 65.566 1.00 29.18 ? 442  TYR A CE1 1 
ATOM   3436 C CE2 . TYR A 1 442 ? 8.285   75.822 65.109 1.00 29.03 ? 442  TYR A CE2 1 
ATOM   3437 C CZ  . TYR A 1 442 ? 7.729   74.688 65.700 1.00 29.56 ? 442  TYR A CZ  1 
ATOM   3438 O OH  . TYR A 1 442 ? 6.533   74.801 66.370 1.00 28.90 ? 442  TYR A OH  1 
ATOM   3439 N N   . GLU A 1 443 ? 11.594  73.615 59.595 1.00 28.80 ? 443  GLU A N   1 
ATOM   3440 C CA  . GLU A 1 443 ? 12.217  74.075 58.360 1.00 28.27 ? 443  GLU A CA  1 
ATOM   3441 C C   . GLU A 1 443 ? 10.999  74.479 57.467 1.00 28.32 ? 443  GLU A C   1 
ATOM   3442 O O   . GLU A 1 443 ? 11.142  75.213 56.504 1.00 28.59 ? 443  GLU A O   1 
ATOM   3443 C CB  . GLU A 1 443 ? 13.011  72.972 57.662 1.00 27.79 ? 443  GLU A CB  1 
ATOM   3444 C CG  . GLU A 1 443 ? 12.170  72.078 56.727 1.00 27.25 ? 443  GLU A CG  1 
ATOM   3445 C CD  . GLU A 1 443 ? 11.210  71.131 57.484 1.00 28.01 ? 443  GLU A CD  1 
ATOM   3446 O OE1 . GLU A 1 443 ? 11.245  71.075 58.745 1.00 27.51 ? 443  GLU A OE1 1 
ATOM   3447 O OE2 . GLU A 1 443 ? 10.429  70.428 56.806 1.00 28.18 ? 443  GLU A OE2 1 
ATOM   3448 N N   . ILE A 1 444 ? 9.799   74.034 57.809 1.00 28.24 ? 444  ILE A N   1 
ATOM   3449 C CA  . ILE A 1 444 ? 8.626   74.346 56.999 1.00 29.03 ? 444  ILE A CA  1 
ATOM   3450 C C   . ILE A 1 444 ? 8.431   75.891 56.848 1.00 29.66 ? 444  ILE A C   1 
ATOM   3451 O O   . ILE A 1 444 ? 8.263   76.402 55.723 1.00 29.45 ? 444  ILE A O   1 
ATOM   3452 C CB  . ILE A 1 444 ? 7.350   73.692 57.641 1.00 29.10 ? 444  ILE A CB  1 
ATOM   3453 C CG1 . ILE A 1 444 ? 7.486   72.166 57.609 1.00 28.05 ? 444  ILE A CG1 1 
ATOM   3454 C CG2 . ILE A 1 444 ? 6.047   74.230 56.943 1.00 28.36 ? 444  ILE A CG2 1 
ATOM   3455 C CD1 . ILE A 1 444 ? 6.329   71.434 58.223 1.00 28.19 ? 444  ILE A CD1 1 
ATOM   3456 N N   . GLU A 1 445 ? 8.485   76.610 57.976 1.00 30.02 ? 445  GLU A N   1 
ATOM   3457 C CA  . GLU A 1 445 ? 8.335   78.051 57.942 1.00 31.05 ? 445  GLU A CA  1 
ATOM   3458 C C   . GLU A 1 445 ? 9.310   78.705 56.965 1.00 31.11 ? 445  GLU A C   1 
ATOM   3459 O O   . GLU A 1 445 ? 8.950   79.692 56.325 1.00 31.61 ? 445  GLU A O   1 
ATOM   3460 C CB  . GLU A 1 445 ? 8.434   78.678 59.367 1.00 31.58 ? 445  GLU A CB  1 
ATOM   3461 C CG  . GLU A 1 445 ? 9.669   78.327 60.148 1.00 32.14 ? 445  GLU A CG  1 
ATOM   3462 C CD  . GLU A 1 445 ? 9.446   78.481 61.653 1.00 32.81 ? 445  GLU A CD  1 
ATOM   3463 O OE1 . GLU A 1 445 ? 8.441   77.911 62.165 1.00 32.58 ? 445  GLU A OE1 1 
ATOM   3464 O OE2 . GLU A 1 445 ? 10.286  79.154 62.317 1.00 32.67 ? 445  GLU A OE2 1 
ATOM   3465 N N   . PHE A 1 446 ? 10.516  78.158 56.804 1.00 31.32 ? 446  PHE A N   1 
ATOM   3466 C CA  . PHE A 1 446 ? 11.435  78.730 55.828 1.00 31.40 ? 446  PHE A CA  1 
ATOM   3467 C C   . PHE A 1 446 ? 11.068  78.348 54.385 1.00 31.80 ? 446  PHE A C   1 
ATOM   3468 O O   . PHE A 1 446 ? 11.277  79.141 53.428 1.00 31.96 ? 446  PHE A O   1 
ATOM   3469 C CB  . PHE A 1 446 ? 12.857  78.278 56.111 1.00 31.50 ? 446  PHE A CB  1 
ATOM   3470 C CG  . PHE A 1 446 ? 13.436  78.908 57.345 1.00 31.86 ? 446  PHE A CG  1 
ATOM   3471 C CD1 . PHE A 1 446 ? 13.218  78.331 58.615 1.00 30.99 ? 446  PHE A CD1 1 
ATOM   3472 C CD2 . PHE A 1 446 ? 14.143  80.129 57.241 1.00 31.63 ? 446  PHE A CD2 1 
ATOM   3473 C CE1 . PHE A 1 446 ? 13.691  78.957 59.768 1.00 31.42 ? 446  PHE A CE1 1 
ATOM   3474 C CE2 . PHE A 1 446 ? 14.628  80.771 58.391 1.00 31.59 ? 446  PHE A CE2 1 
ATOM   3475 C CZ  . PHE A 1 446 ? 14.404  80.191 59.656 1.00 31.77 ? 446  PHE A CZ  1 
ATOM   3476 N N   . VAL A 1 447 ? 10.549  77.129 54.207 1.00 31.40 ? 447  VAL A N   1 
ATOM   3477 C CA  . VAL A 1 447 ? 10.144  76.690 52.879 1.00 30.95 ? 447  VAL A CA  1 
ATOM   3478 C C   . VAL A 1 447 ? 8.929   77.518 52.420 1.00 31.14 ? 447  VAL A C   1 
ATOM   3479 O O   . VAL A 1 447 ? 8.794   77.845 51.234 1.00 30.36 ? 447  VAL A O   1 
ATOM   3480 C CB  . VAL A 1 447 ? 9.785   75.180 52.883 1.00 30.44 ? 447  VAL A CB  1 
ATOM   3481 C CG1 . VAL A 1 447 ? 8.981   74.799 51.624 1.00 29.78 ? 447  VAL A CG1 1 
ATOM   3482 C CG2 . VAL A 1 447 ? 11.072  74.359 52.961 1.00 29.69 ? 447  VAL A CG2 1 
ATOM   3483 N N   . PHE A 1 448 ? 8.051   77.856 53.362 1.00 31.77 ? 448  PHE A N   1 
ATOM   3484 C CA  . PHE A 1 448 ? 6.881   78.636 52.987 1.00 32.54 ? 448  PHE A CA  1 
ATOM   3485 C C   . PHE A 1 448 ? 7.094   80.161 53.082 1.00 33.26 ? 448  PHE A C   1 
ATOM   3486 O O   . PHE A 1 448 ? 6.170   80.940 52.882 1.00 32.92 ? 448  PHE A O   1 
ATOM   3487 C CB  . PHE A 1 448 ? 5.653   78.179 53.777 1.00 32.03 ? 448  PHE A CB  1 
ATOM   3488 C CG  . PHE A 1 448 ? 5.026   76.943 53.216 1.00 32.03 ? 448  PHE A CG  1 
ATOM   3489 C CD1 . PHE A 1 448 ? 5.557   75.672 53.507 1.00 31.72 ? 448  PHE A CD1 1 
ATOM   3490 C CD2 . PHE A 1 448 ? 3.930   77.035 52.339 1.00 31.99 ? 448  PHE A CD2 1 
ATOM   3491 C CE1 . PHE A 1 448 ? 5.005   74.491 52.924 1.00 31.35 ? 448  PHE A CE1 1 
ATOM   3492 C CE2 . PHE A 1 448 ? 3.373   75.862 51.754 1.00 31.37 ? 448  PHE A CE2 1 
ATOM   3493 C CZ  . PHE A 1 448 ? 3.918   74.595 52.049 1.00 31.18 ? 448  PHE A CZ  1 
ATOM   3494 N N   . GLY A 1 449 ? 8.335   80.552 53.368 1.00 34.23 ? 449  GLY A N   1 
ATOM   3495 C CA  . GLY A 1 449 ? 8.716   81.949 53.421 1.00 35.89 ? 449  GLY A CA  1 
ATOM   3496 C C   . GLY A 1 449 ? 8.198   82.861 54.525 1.00 36.90 ? 449  GLY A C   1 
ATOM   3497 O O   . GLY A 1 449 ? 8.145   84.064 54.322 1.00 36.87 ? 449  GLY A O   1 
ATOM   3498 N N   . LEU A 1 450 ? 7.831   82.320 55.680 1.00 37.93 ? 450  LEU A N   1 
ATOM   3499 C CA  . LEU A 1 450 ? 7.349   83.167 56.784 1.00 39.00 ? 450  LEU A CA  1 
ATOM   3500 C C   . LEU A 1 450 ? 8.389   84.254 57.183 1.00 39.75 ? 450  LEU A C   1 
ATOM   3501 O O   . LEU A 1 450 ? 8.031   85.348 57.602 1.00 39.83 ? 450  LEU A O   1 
ATOM   3502 C CB  . LEU A 1 450 ? 6.963   82.313 57.992 1.00 38.31 ? 450  LEU A CB  1 
ATOM   3503 C CG  . LEU A 1 450 ? 5.679   81.462 57.899 1.00 38.97 ? 450  LEU A CG  1 
ATOM   3504 C CD1 . LEU A 1 450 ? 4.479   82.308 57.840 1.00 38.88 ? 450  LEU A CD1 1 
ATOM   3505 C CD2 . LEU A 1 450 ? 5.705   80.592 56.643 1.00 38.46 ? 450  LEU A CD2 1 
ATOM   3506 N N   . PRO A 1 451 ? 9.687   83.961 57.054 1.00 40.50 ? 451  PRO A N   1 
ATOM   3507 C CA  . PRO A 1 451 ? 10.660  84.990 57.418 1.00 41.59 ? 451  PRO A CA  1 
ATOM   3508 C C   . PRO A 1 451 ? 10.599  86.283 56.567 1.00 42.59 ? 451  PRO A C   1 
ATOM   3509 O O   . PRO A 1 451 ? 11.251  87.263 56.898 1.00 42.67 ? 451  PRO A O   1 
ATOM   3510 C CB  . PRO A 1 451 ? 11.992  84.266 57.265 1.00 41.02 ? 451  PRO A CB  1 
ATOM   3511 C CG  . PRO A 1 451 ? 11.627  82.892 57.680 1.00 41.03 ? 451  PRO A CG  1 
ATOM   3512 C CD  . PRO A 1 451 ? 10.355  82.662 56.909 1.00 40.81 ? 451  PRO A CD  1 
ATOM   3513 N N   . LEU A 1 452 ? 9.852   86.290 55.467 1.00 43.68 ? 452  LEU A N   1 
ATOM   3514 C CA  . LEU A 1 452 ? 9.785   87.509 54.689 1.00 45.00 ? 452  LEU A CA  1 
ATOM   3515 C C   . LEU A 1 452 ? 8.757   88.490 55.270 1.00 45.77 ? 452  LEU A C   1 
ATOM   3516 O O   . LEU A 1 452 ? 8.694   89.625 54.806 1.00 46.24 ? 452  LEU A O   1 
ATOM   3517 C CB  . LEU A 1 452 ? 9.418   87.264 53.223 1.00 44.87 ? 452  LEU A CB  1 
ATOM   3518 C CG  . LEU A 1 452 ? 9.937   86.157 52.317 1.00 45.67 ? 452  LEU A CG  1 
ATOM   3519 C CD1 . LEU A 1 452 ? 9.904   86.716 50.878 1.00 45.56 ? 452  LEU A CD1 1 
ATOM   3520 C CD2 . LEU A 1 452 ? 11.349  85.631 52.714 1.00 45.33 ? 452  LEU A CD2 1 
ATOM   3521 N N   . VAL A 1 453 ? 7.935   88.067 56.232 1.00 46.23 ? 453  VAL A N   1 
ATOM   3522 C CA  . VAL A 1 453 ? 6.965   88.989 56.807 1.00 47.13 ? 453  VAL A CA  1 
ATOM   3523 C C   . VAL A 1 453 ? 7.457   89.545 58.145 1.00 47.92 ? 453  VAL A C   1 
ATOM   3524 O O   . VAL A 1 453 ? 7.486   88.868 59.197 1.00 47.58 ? 453  VAL A O   1 
ATOM   3525 C CB  . VAL A 1 453 ? 5.530   88.358 56.905 1.00 47.31 ? 453  VAL A CB  1 
ATOM   3526 C CG1 . VAL A 1 453 ? 5.563   86.900 56.471 1.00 47.47 ? 453  VAL A CG1 1 
ATOM   3527 C CG2 . VAL A 1 453 ? 4.935   88.559 58.280 1.00 46.91 ? 453  VAL A CG2 1 
ATOM   3528 N N   . LYS A 1 454 ? 7.871   90.806 58.055 1.00 48.74 ? 454  LYS A N   1 
ATOM   3529 C CA  . LYS A 1 454 ? 8.447   91.562 59.161 1.00 49.58 ? 454  LYS A CA  1 
ATOM   3530 C C   . LYS A 1 454 ? 7.825   91.355 60.522 1.00 49.48 ? 454  LYS A C   1 
ATOM   3531 O O   . LYS A 1 454 ? 8.549   91.161 61.489 1.00 49.31 ? 454  LYS A O   1 
ATOM   3532 C CB  . LYS A 1 454 ? 8.481   93.057 58.799 1.00 50.78 ? 454  LYS A CB  1 
ATOM   3533 C CG  . LYS A 1 454 ? 9.163   93.329 57.435 1.00 52.08 ? 454  LYS A CG  1 
ATOM   3534 C CD  . LYS A 1 454 ? 10.548  92.616 57.317 1.00 53.51 ? 454  LYS A CD  1 
ATOM   3535 C CE  . LYS A 1 454 ? 11.020  92.572 55.864 1.00 53.96 ? 454  LYS A CE  1 
ATOM   3536 N NZ  . LYS A 1 454 ? 10.658  93.880 55.215 1.00 54.63 ? 454  LYS A NZ  1 
ATOM   3537 N N   . GLU A 1 455 ? 6.500   91.381 60.609 1.00 49.57 ? 455  GLU A N   1 
ATOM   3538 C CA  . GLU A 1 455 ? 5.866   91.171 61.892 1.00 50.05 ? 455  GLU A CA  1 
ATOM   3539 C C   . GLU A 1 455 ? 6.235   89.831 62.526 1.00 49.90 ? 455  GLU A C   1 
ATOM   3540 O O   . GLU A 1 455 ? 6.172   89.691 63.744 1.00 50.00 ? 455  GLU A O   1 
ATOM   3541 C CB  . GLU A 1 455 ? 4.344   91.246 61.777 1.00 51.05 ? 455  GLU A CB  1 
ATOM   3542 C CG  . GLU A 1 455 ? 3.855   92.391 60.930 1.00 52.97 ? 455  GLU A CG  1 
ATOM   3543 C CD  . GLU A 1 455 ? 3.856   92.050 59.441 1.00 54.13 ? 455  GLU A CD  1 
ATOM   3544 O OE1 . GLU A 1 455 ? 2.954   91.264 59.014 1.00 54.78 ? 455  GLU A OE1 1 
ATOM   3545 O OE2 . GLU A 1 455 ? 4.747   92.557 58.709 1.00 54.50 ? 455  GLU A OE2 1 
ATOM   3546 N N   . LEU A 1 456 ? 6.608   88.830 61.733 1.00 49.33 ? 456  LEU A N   1 
ATOM   3547 C CA  . LEU A 1 456 ? 6.927   87.557 62.359 1.00 48.92 ? 456  LEU A CA  1 
ATOM   3548 C C   . LEU A 1 456 ? 8.263   87.550 63.095 1.00 49.03 ? 456  LEU A C   1 
ATOM   3549 O O   . LEU A 1 456 ? 8.669   86.548 63.666 1.00 49.48 ? 456  LEU A O   1 
ATOM   3550 C CB  . LEU A 1 456 ? 6.840   86.426 61.344 1.00 48.06 ? 456  LEU A CB  1 
ATOM   3551 C CG  . LEU A 1 456 ? 5.404   86.215 60.873 1.00 47.35 ? 456  LEU A CG  1 
ATOM   3552 C CD1 . LEU A 1 456 ? 5.391   85.023 59.924 1.00 46.64 ? 456  LEU A CD1 1 
ATOM   3553 C CD2 . LEU A 1 456 ? 4.461   86.014 62.068 1.00 46.29 ? 456  LEU A CD2 1 
ATOM   3554 N N   . ASN A 1 457 ? 8.976   88.661 63.057 1.00 48.96 ? 457  ASN A N   1 
ATOM   3555 C CA  . ASN A 1 457 ? 10.185  88.749 63.847 1.00 48.67 ? 457  ASN A CA  1 
ATOM   3556 C C   . ASN A 1 457 ? 11.349  87.850 63.565 1.00 47.84 ? 457  ASN A C   1 
ATOM   3557 O O   . ASN A 1 457 ? 11.955  87.382 64.512 1.00 48.12 ? 457  ASN A O   1 
ATOM   3558 C CB  . ASN A 1 457 ? 9.837   88.540 65.332 1.00 49.66 ? 457  ASN A CB  1 
ATOM   3559 C CG  . ASN A 1 457 ? 8.880   89.604 65.881 1.00 50.82 ? 457  ASN A CG  1 
ATOM   3560 O OD1 . ASN A 1 457 ? 8.278   89.426 66.957 1.00 51.66 ? 457  ASN A OD1 1 
ATOM   3561 N ND2 . ASN A 1 457 ? 8.746   90.716 65.157 1.00 51.00 ? 457  ASN A ND2 1 
ATOM   3562 N N   . TYR A 1 458 ? 11.683  87.574 62.322 1.00 46.61 ? 458  TYR A N   1 
ATOM   3563 C CA  . TYR A 1 458 ? 12.862  86.752 62.088 1.00 45.23 ? 458  TYR A CA  1 
ATOM   3564 C C   . TYR A 1 458 ? 13.997  87.751 61.851 1.00 45.22 ? 458  TYR A C   1 
ATOM   3565 O O   . TYR A 1 458 ? 13.784  88.947 61.772 1.00 45.03 ? 458  TYR A O   1 
ATOM   3566 C CB  . TYR A 1 458 ? 12.695  85.860 60.843 1.00 44.02 ? 458  TYR A CB  1 
ATOM   3567 C CG  . TYR A 1 458 ? 11.700  84.725 60.976 1.00 42.68 ? 458  TYR A CG  1 
ATOM   3568 C CD1 . TYR A 1 458 ? 10.338  84.928 60.772 1.00 41.75 ? 458  TYR A CD1 1 
ATOM   3569 C CD2 . TYR A 1 458 ? 12.132  83.437 61.318 1.00 42.20 ? 458  TYR A CD2 1 
ATOM   3570 C CE1 . TYR A 1 458 ? 9.418   83.890 60.907 1.00 41.14 ? 458  TYR A CE1 1 
ATOM   3571 C CE2 . TYR A 1 458 ? 11.230  82.386 61.453 1.00 41.57 ? 458  TYR A CE2 1 
ATOM   3572 C CZ  . TYR A 1 458 ? 9.863   82.608 61.251 1.00 41.22 ? 458  TYR A CZ  1 
ATOM   3573 O OH  . TYR A 1 458 ? 8.957   81.551 61.398 1.00 40.39 ? 458  TYR A OH  1 
ATOM   3574 N N   . THR A 1 459 ? 15.216  87.269 61.743 1.00 45.37 ? 459  THR A N   1 
ATOM   3575 C CA  . THR A 1 459 ? 16.317  88.162 61.475 1.00 45.27 ? 459  THR A CA  1 
ATOM   3576 C C   . THR A 1 459 ? 16.483  88.293 59.974 1.00 45.26 ? 459  THR A C   1 
ATOM   3577 O O   . THR A 1 459 ? 16.001  87.464 59.202 1.00 45.29 ? 459  THR A O   1 
ATOM   3578 C CB  . THR A 1 459 ? 17.616  87.611 62.026 1.00 45.38 ? 459  THR A CB  1 
ATOM   3579 O OG1 . THR A 1 459 ? 17.906  86.363 61.380 1.00 45.27 ? 459  THR A OG1 1 
ATOM   3580 C CG2 . THR A 1 459 ? 17.504  87.411 63.542 1.00 45.21 ? 459  THR A CG2 1 
ATOM   3581 N N   . ALA A 1 460 ? 17.184  89.342 59.562 1.00 45.01 ? 460  ALA A N   1 
ATOM   3582 C CA  . ALA A 1 460 ? 17.456  89.575 58.159 1.00 44.40 ? 460  ALA A CA  1 
ATOM   3583 C C   . ALA A 1 460 ? 18.150  88.355 57.567 1.00 43.99 ? 460  ALA A C   1 
ATOM   3584 O O   . ALA A 1 460 ? 17.839  87.955 56.450 1.00 44.17 ? 460  ALA A O   1 
ATOM   3585 C CB  . ALA A 1 460 ? 18.336  90.803 57.994 1.00 43.96 ? 460  ALA A CB  1 
ATOM   3586 N N   . GLU A 1 461 ? 19.089  87.749 58.284 1.00 43.56 ? 461  GLU A N   1 
ATOM   3587 C CA  . GLU A 1 461 ? 19.753  86.587 57.682 1.00 43.39 ? 461  GLU A CA  1 
ATOM   3588 C C   . GLU A 1 461 ? 18.792  85.391 57.547 1.00 42.69 ? 461  GLU A C   1 
ATOM   3589 O O   . GLU A 1 461 ? 18.944  84.556 56.642 1.00 42.47 ? 461  GLU A O   1 
ATOM   3590 C CB  . GLU A 1 461 ? 21.033  86.198 58.443 1.00 43.83 ? 461  GLU A CB  1 
ATOM   3591 C CG  . GLU A 1 461 ? 21.019  86.610 59.873 1.00 45.93 ? 461  GLU A CG  1 
ATOM   3592 C CD  . GLU A 1 461 ? 21.244  88.106 60.046 1.00 46.42 ? 461  GLU A CD  1 
ATOM   3593 O OE1 . GLU A 1 461 ? 22.315  88.562 59.610 1.00 47.68 ? 461  GLU A OE1 1 
ATOM   3594 O OE2 . GLU A 1 461 ? 20.378  88.821 60.605 1.00 46.81 ? 461  GLU A OE2 1 
ATOM   3595 N N   . GLU A 1 462 ? 17.797  85.337 58.431 1.00 41.93 ? 462  GLU A N   1 
ATOM   3596 C CA  . GLU A 1 462 ? 16.806  84.288 58.367 1.00 41.34 ? 462  GLU A CA  1 
ATOM   3597 C C   . GLU A 1 462 ? 15.928  84.501 57.131 1.00 41.18 ? 462  GLU A C   1 
ATOM   3598 O O   . GLU A 1 462 ? 15.553  83.531 56.462 1.00 41.14 ? 462  GLU A O   1 
ATOM   3599 C CB  . GLU A 1 462 ? 15.994  84.239 59.660 1.00 40.93 ? 462  GLU A CB  1 
ATOM   3600 C CG  . GLU A 1 462 ? 16.729  83.429 60.713 1.00 40.60 ? 462  GLU A CG  1 
ATOM   3601 C CD  . GLU A 1 462 ? 16.069  83.420 62.071 1.00 40.85 ? 462  GLU A CD  1 
ATOM   3602 O OE1 . GLU A 1 462 ? 15.260  84.334 62.365 1.00 40.99 ? 462  GLU A OE1 1 
ATOM   3603 O OE2 . GLU A 1 462 ? 16.394  82.511 62.867 1.00 40.69 ? 462  GLU A OE2 1 
ATOM   3604 N N   . GLU A 1 463 ? 15.641  85.762 56.803 1.00 40.55 ? 463  GLU A N   1 
ATOM   3605 C CA  . GLU A 1 463 ? 14.848  86.068 55.623 1.00 40.01 ? 463  GLU A CA  1 
ATOM   3606 C C   . GLU A 1 463 ? 15.656  85.648 54.413 1.00 39.52 ? 463  GLU A C   1 
ATOM   3607 O O   . GLU A 1 463 ? 15.128  85.044 53.460 1.00 39.34 ? 463  GLU A O   1 
ATOM   3608 C CB  . GLU A 1 463 ? 14.527  87.567 55.492 1.00 40.50 ? 463  GLU A CB  1 
ATOM   3609 C CG  . GLU A 1 463 ? 14.046  87.899 54.040 1.00 41.56 ? 463  GLU A CG  1 
ATOM   3610 C CD  . GLU A 1 463 ? 13.555  89.329 53.833 1.00 42.06 ? 463  GLU A CD  1 
ATOM   3611 O OE1 . GLU A 1 463 ? 13.750  90.170 54.733 1.00 42.65 ? 463  GLU A OE1 1 
ATOM   3612 O OE2 . GLU A 1 463 ? 12.973  89.613 52.759 1.00 42.29 ? 463  GLU A OE2 1 
ATOM   3613 N N   . ALA A 1 464 ? 16.947  85.967 54.435 1.00 38.48 ? 464  ALA A N   1 
ATOM   3614 C CA  . ALA A 1 464 ? 17.779  85.581 53.305 1.00 37.72 ? 464  ALA A CA  1 
ATOM   3615 C C   . ALA A 1 464 ? 17.800  84.050 53.112 1.00 36.92 ? 464  ALA A C   1 
ATOM   3616 O O   . ALA A 1 464 ? 17.762  83.554 51.977 1.00 36.90 ? 464  ALA A O   1 
ATOM   3617 C CB  . ALA A 1 464 ? 19.233  86.149 53.457 1.00 37.29 ? 464  ALA A CB  1 
ATOM   3618 N N   . LEU A 1 465 ? 17.859  83.306 54.214 1.00 36.22 ? 465  LEU A N   1 
ATOM   3619 C CA  . LEU A 1 465 ? 17.872  81.833 54.153 1.00 35.03 ? 465  LEU A CA  1 
ATOM   3620 C C   . LEU A 1 465 ? 16.552  81.326 53.581 1.00 34.35 ? 465  LEU A C   1 
ATOM   3621 O O   . LEU A 1 465 ? 16.530  80.476 52.705 1.00 34.30 ? 465  LEU A O   1 
ATOM   3622 C CB  . LEU A 1 465 ? 18.080  81.264 55.551 1.00 35.02 ? 465  LEU A CB  1 
ATOM   3623 C CG  . LEU A 1 465 ? 17.877  79.754 55.718 1.00 34.40 ? 465  LEU A CG  1 
ATOM   3624 C CD1 . LEU A 1 465 ? 18.764  78.956 54.723 1.00 34.40 ? 465  LEU A CD1 1 
ATOM   3625 C CD2 . LEU A 1 465 ? 18.199  79.405 57.139 1.00 34.21 ? 465  LEU A CD2 1 
ATOM   3626 N N   . SER A 1 466 ? 15.448  81.869 54.071 1.00 33.80 ? 466  SER A N   1 
ATOM   3627 C CA  . SER A 1 466 ? 14.158  81.482 53.549 1.00 34.05 ? 466  SER A CA  1 
ATOM   3628 C C   . SER A 1 466 ? 14.127  81.736 52.036 1.00 34.56 ? 466  SER A C   1 
ATOM   3629 O O   . SER A 1 466 ? 13.672  80.875 51.245 1.00 34.39 ? 466  SER A O   1 
ATOM   3630 C CB  . SER A 1 466 ? 13.040  82.256 54.264 1.00 33.88 ? 466  SER A CB  1 
ATOM   3631 O OG  . SER A 1 466 ? 11.743  81.999 53.747 1.00 33.56 ? 466  SER A OG  1 
ATOM   3632 N N   . ARG A 1 467 ? 14.628  82.899 51.607 1.00 34.71 ? 467  ARG A N   1 
ATOM   3633 C CA  . ARG A 1 467 ? 14.616  83.195 50.171 1.00 34.90 ? 467  ARG A CA  1 
ATOM   3634 C C   . ARG A 1 467 ? 15.422  82.202 49.370 1.00 34.89 ? 467  ARG A C   1 
ATOM   3635 O O   . ARG A 1 467 ? 14.954  81.761 48.305 1.00 34.83 ? 467  ARG A O   1 
ATOM   3636 C CB  . ARG A 1 467 ? 15.081  84.638 49.856 1.00 35.25 ? 467  ARG A CB  1 
ATOM   3637 C CG  . ARG A 1 467 ? 13.967  85.704 50.111 1.00 35.62 ? 467  ARG A CG  1 
ATOM   3638 C CD  . ARG A 1 467 ? 14.469  87.172 49.915 1.00 35.53 ? 467  ARG A CD  1 
ATOM   3639 N NE  . ARG A 1 467 ? 13.425  88.126 50.290 1.00 35.39 ? 467  ARG A NE  1 
ATOM   3640 C CZ  . ARG A 1 467 ? 12.332  88.355 49.570 1.00 35.68 ? 467  ARG A CZ  1 
ATOM   3641 N NH1 . ARG A 1 467 ? 12.130  87.713 48.414 1.00 34.59 ? 467  ARG A NH1 1 
ATOM   3642 N NH2 . ARG A 1 467 ? 11.420  89.195 50.037 1.00 35.85 ? 467  ARG A NH2 1 
ATOM   3643 N N   . ARG A 1 468 ? 16.615  81.823 49.838 1.00 34.81 ? 468  ARG A N   1 
ATOM   3644 C CA  . ARG A 1 468 ? 17.337  80.835 49.039 1.00 35.00 ? 468  ARG A CA  1 
ATOM   3645 C C   . ARG A 1 468 ? 16.683  79.444 49.089 1.00 33.78 ? 468  ARG A C   1 
ATOM   3646 O O   . ARG A 1 468 ? 16.744  78.723 48.113 1.00 33.27 ? 468  ARG A O   1 
ATOM   3647 C CB  . ARG A 1 468 ? 18.841  80.691 49.402 1.00 36.56 ? 468  ARG A CB  1 
ATOM   3648 C CG  . ARG A 1 468 ? 19.291  81.331 50.655 1.00 39.46 ? 468  ARG A CG  1 
ATOM   3649 C CD  . ARG A 1 468 ? 20.847  81.439 50.628 1.00 41.39 ? 468  ARG A CD  1 
ATOM   3650 N NE  . ARG A 1 468 ? 21.470  80.131 50.446 1.00 42.79 ? 468  ARG A NE  1 
ATOM   3651 C CZ  . ARG A 1 468 ? 21.810  79.326 51.447 1.00 43.28 ? 468  ARG A CZ  1 
ATOM   3652 N NH1 . ARG A 1 468 ? 21.597  79.713 52.686 1.00 43.87 ? 468  ARG A NH1 1 
ATOM   3653 N NH2 . ARG A 1 468 ? 22.354  78.133 51.206 1.00 43.59 ? 468  ARG A NH2 1 
ATOM   3654 N N   . ILE A 1 469 ? 16.084  79.055 50.215 1.00 33.03 ? 469  ILE A N   1 
ATOM   3655 C CA  . ILE A 1 469 ? 15.430  77.735 50.253 1.00 31.96 ? 469  ILE A CA  1 
ATOM   3656 C C   . ILE A 1 469 ? 14.249  77.746 49.267 1.00 32.32 ? 469  ILE A C   1 
ATOM   3657 O O   . ILE A 1 469 ? 14.107  76.859 48.403 1.00 31.90 ? 469  ILE A O   1 
ATOM   3658 C CB  . ILE A 1 469 ? 15.003  77.380 51.728 1.00 31.21 ? 469  ILE A CB  1 
ATOM   3659 C CG1 . ILE A 1 469 ? 16.272  77.011 52.515 1.00 29.39 ? 469  ILE A CG1 1 
ATOM   3660 C CG2 . ILE A 1 469 ? 13.939  76.239 51.758 1.00 30.03 ? 469  ILE A CG2 1 
ATOM   3661 C CD1 . ILE A 1 469 ? 16.098  76.860 54.001 1.00 28.20 ? 469  ILE A CD1 1 
ATOM   3662 N N   . MET A 1 470 ? 13.437  78.795 49.330 1.00 33.04 ? 470  MET A N   1 
ATOM   3663 C CA  . MET A 1 470 ? 12.297  78.892 48.403 1.00 33.75 ? 470  MET A CA  1 
ATOM   3664 C C   . MET A 1 470 ? 12.741  78.834 46.936 1.00 33.83 ? 470  MET A C   1 
ATOM   3665 O O   . MET A 1 470 ? 12.098  78.177 46.086 1.00 33.51 ? 470  MET A O   1 
ATOM   3666 C CB  . MET A 1 470 ? 11.495  80.188 48.630 1.00 34.15 ? 470  MET A CB  1 
ATOM   3667 C CG  . MET A 1 470 ? 10.642  80.180 49.889 1.00 35.11 ? 470  MET A CG  1 
ATOM   3668 S SD  . MET A 1 470 ? 9.401   81.481 49.802 1.00 37.73 ? 470  MET A SD  1 
ATOM   3669 C CE  . MET A 1 470 ? 10.443  82.921 50.069 1.00 36.17 ? 470  MET A CE  1 
ATOM   3670 N N   . HIS A 1 471 ? 13.837  79.533 46.636 1.00 33.86 ? 471  HIS A N   1 
ATOM   3671 C CA  . HIS A 1 471 ? 14.321  79.548 45.278 1.00 33.42 ? 471  HIS A CA  1 
ATOM   3672 C C   . HIS A 1 471 ? 14.974  78.199 44.944 1.00 33.25 ? 471  HIS A C   1 
ATOM   3673 O O   . HIS A 1 471 ? 14.913  77.750 43.785 1.00 33.45 ? 471  HIS A O   1 
ATOM   3674 C CB  . HIS A 1 471 ? 15.285  80.724 45.042 1.00 33.80 ? 471  HIS A CB  1 
ATOM   3675 C CG  . HIS A 1 471 ? 15.582  80.961 43.591 1.00 33.72 ? 471  HIS A CG  1 
ATOM   3676 N ND1 . HIS A 1 471 ? 14.598  81.297 42.677 1.00 33.84 ? 471  HIS A ND1 1 
ATOM   3677 C CD2 . HIS A 1 471 ? 16.739  80.894 42.891 1.00 33.32 ? 471  HIS A CD2 1 
ATOM   3678 C CE1 . HIS A 1 471 ? 15.138  81.433 41.479 1.00 32.96 ? 471  HIS A CE1 1 
ATOM   3679 N NE2 . HIS A 1 471 ? 16.435  81.195 41.581 1.00 33.40 ? 471  HIS A NE2 1 
ATOM   3680 N N   . TYR A 1 472 ? 15.612  77.545 45.913 1.00 32.64 ? 472  TYR A N   1 
ATOM   3681 C CA  . TYR A 1 472 ? 16.155  76.201 45.618 1.00 32.39 ? 472  TYR A CA  1 
ATOM   3682 C C   . TYR A 1 472 ? 14.951  75.268 45.349 1.00 31.48 ? 472  TYR A C   1 
ATOM   3683 O O   . TYR A 1 472 ? 14.943  74.500 44.402 1.00 31.07 ? 472  TYR A O   1 
ATOM   3684 C CB  . TYR A 1 472 ? 16.856  75.570 46.811 1.00 33.26 ? 472  TYR A CB  1 
ATOM   3685 C CG  . TYR A 1 472 ? 18.189  76.108 47.200 1.00 34.68 ? 472  TYR A CG  1 
ATOM   3686 C CD1 . TYR A 1 472 ? 19.153  76.463 46.239 1.00 35.43 ? 472  TYR A CD1 1 
ATOM   3687 C CD2 . TYR A 1 472 ? 18.549  76.125 48.549 1.00 35.03 ? 472  TYR A CD2 1 
ATOM   3688 C CE1 . TYR A 1 472 ? 20.456  76.814 46.634 1.00 36.07 ? 472  TYR A CE1 1 
ATOM   3689 C CE2 . TYR A 1 472 ? 19.803  76.455 48.951 1.00 35.87 ? 472  TYR A CE2 1 
ATOM   3690 C CZ  . TYR A 1 472 ? 20.762  76.806 48.007 1.00 36.50 ? 472  TYR A CZ  1 
ATOM   3691 O OH  . TYR A 1 472 ? 21.991  77.203 48.497 1.00 37.97 ? 472  TYR A OH  1 
ATOM   3692 N N   . TRP A 1 473 ? 13.945  75.313 46.221 1.00 30.69 ? 473  TRP A N   1 
ATOM   3693 C CA  . TRP A 1 473 ? 12.799  74.440 46.008 1.00 30.28 ? 473  TRP A CA  1 
ATOM   3694 C C   . TRP A 1 473 ? 12.068  74.714 44.665 1.00 30.63 ? 473  TRP A C   1 
ATOM   3695 O O   . TRP A 1 473 ? 11.718  73.800 43.918 1.00 30.92 ? 473  TRP A O   1 
ATOM   3696 C CB  . TRP A 1 473 ? 11.804  74.589 47.141 1.00 28.80 ? 473  TRP A CB  1 
ATOM   3697 C CG  . TRP A 1 473 ? 11.870  73.560 48.297 1.00 27.85 ? 473  TRP A CG  1 
ATOM   3698 C CD1 . TRP A 1 473 ? 10.795  72.969 48.908 1.00 26.34 ? 473  TRP A CD1 1 
ATOM   3699 C CD2 . TRP A 1 473 ? 13.018  73.214 49.102 1.00 26.92 ? 473  TRP A CD2 1 
ATOM   3700 N NE1 . TRP A 1 473 ? 11.192  72.312 50.033 1.00 26.01 ? 473  TRP A NE1 1 
ATOM   3701 C CE2 . TRP A 1 473 ? 12.545  72.437 50.185 1.00 26.58 ? 473  TRP A CE2 1 
ATOM   3702 C CE3 . TRP A 1 473 ? 14.394  73.495 49.017 1.00 26.81 ? 473  TRP A CE3 1 
ATOM   3703 C CZ2 . TRP A 1 473 ? 13.399  71.931 51.186 1.00 26.33 ? 473  TRP A CZ2 1 
ATOM   3704 C CZ3 . TRP A 1 473 ? 15.249  72.991 50.023 1.00 26.80 ? 473  TRP A CZ3 1 
ATOM   3705 C CH2 . TRP A 1 473 ? 14.738  72.217 51.088 1.00 25.92 ? 473  TRP A CH2 1 
ATOM   3706 N N   . ALA A 1 474 ? 11.817  75.980 44.369 1.00 30.90 ? 474  ALA A N   1 
ATOM   3707 C CA  . ALA A 1 474 ? 11.101  76.332 43.136 1.00 30.60 ? 474  ALA A CA  1 
ATOM   3708 C C   . ALA A 1 474 ? 11.913  76.078 41.896 1.00 30.39 ? 474  ALA A C   1 
ATOM   3709 O O   . ALA A 1 474 ? 11.382  75.672 40.890 1.00 30.65 ? 474  ALA A O   1 
ATOM   3710 C CB  . ALA A 1 474 ? 10.681  77.764 43.183 1.00 30.29 ? 474  ALA A CB  1 
ATOM   3711 N N   . THR A 1 475 ? 13.205  76.324 41.949 1.00 30.65 ? 475  THR A N   1 
ATOM   3712 C CA  . THR A 1 475 ? 14.027  76.082 40.783 1.00 30.49 ? 475  THR A CA  1 
ATOM   3713 C C   . THR A 1 475 ? 14.151  74.565 40.543 1.00 30.67 ? 475  THR A C   1 
ATOM   3714 O O   . THR A 1 475 ? 14.242  74.100 39.382 1.00 30.52 ? 475  THR A O   1 
ATOM   3715 C CB  . THR A 1 475 ? 15.423  76.665 40.966 1.00 30.77 ? 475  THR A CB  1 
ATOM   3716 O OG1 . THR A 1 475 ? 15.327  78.076 41.291 1.00 30.69 ? 475  THR A OG1 1 
ATOM   3717 C CG2 . THR A 1 475 ? 16.225  76.437 39.719 1.00 29.84 ? 475  THR A CG2 1 
ATOM   3718 N N   . PHE A 1 476 ? 14.180  73.790 41.625 1.00 30.32 ? 476  PHE A N   1 
ATOM   3719 C CA  . PHE A 1 476 ? 14.250  72.351 41.442 1.00 30.24 ? 476  PHE A CA  1 
ATOM   3720 C C   . PHE A 1 476 ? 12.924  71.896 40.821 1.00 30.46 ? 476  PHE A C   1 
ATOM   3721 O O   . PHE A 1 476 ? 12.912  71.065 39.895 1.00 29.74 ? 476  PHE A O   1 
ATOM   3722 C CB  . PHE A 1 476 ? 14.449  71.626 42.768 1.00 30.26 ? 476  PHE A CB  1 
ATOM   3723 C CG  . PHE A 1 476 ? 14.248  70.144 42.668 1.00 29.99 ? 476  PHE A CG  1 
ATOM   3724 C CD1 . PHE A 1 476 ? 15.267  69.319 42.157 1.00 30.28 ? 476  PHE A CD1 1 
ATOM   3725 C CD2 . PHE A 1 476 ? 13.049  69.568 43.063 1.00 29.50 ? 476  PHE A CD2 1 
ATOM   3726 C CE1 . PHE A 1 476 ? 15.076  67.923 42.058 1.00 29.64 ? 476  PHE A CE1 1 
ATOM   3727 C CE2 . PHE A 1 476 ? 12.851  68.176 42.966 1.00 29.35 ? 476  PHE A CE2 1 
ATOM   3728 C CZ  . PHE A 1 476 ? 13.869  67.360 42.468 1.00 29.51 ? 476  PHE A CZ  1 
ATOM   3729 N N   . ALA A 1 477 ? 11.806  72.450 41.308 1.00 30.59 ? 477  ALA A N   1 
ATOM   3730 C CA  . ALA A 1 477 ? 10.527  72.044 40.756 1.00 31.52 ? 477  ALA A CA  1 
ATOM   3731 C C   . ALA A 1 477 ? 10.462  72.348 39.269 1.00 32.65 ? 477  ALA A C   1 
ATOM   3732 O O   . ALA A 1 477 ? 9.976   71.526 38.468 1.00 33.09 ? 477  ALA A O   1 
ATOM   3733 C CB  . ALA A 1 477 ? 9.406   72.713 41.468 1.00 30.95 ? 477  ALA A CB  1 
ATOM   3734 N N   . LYS A 1 478 ? 10.982  73.517 38.887 1.00 33.50 ? 478  LYS A N   1 
ATOM   3735 C CA  . LYS A 1 478 ? 10.959  73.919 37.505 1.00 34.49 ? 478  LYS A CA  1 
ATOM   3736 C C   . LYS A 1 478 ? 11.897  73.135 36.590 1.00 34.57 ? 478  LYS A C   1 
ATOM   3737 O O   . LYS A 1 478 ? 11.533  72.750 35.456 1.00 35.02 ? 478  LYS A O   1 
ATOM   3738 C CB  . LYS A 1 478 ? 11.301  75.411 37.396 1.00 35.64 ? 478  LYS A CB  1 
ATOM   3739 C CG  . LYS A 1 478 ? 11.180  75.929 35.933 1.00 37.64 ? 478  LYS A CG  1 
ATOM   3740 C CD  . LYS A 1 478 ? 11.104  77.461 35.863 1.00 38.91 ? 478  LYS A CD  1 
ATOM   3741 C CE  . LYS A 1 478 ? 12.454  78.121 35.521 1.00 39.75 ? 478  LYS A CE  1 
ATOM   3742 N NZ  . LYS A 1 478 ? 12.239  79.301 34.557 1.00 40.70 ? 478  LYS A NZ  1 
ATOM   3743 N N   . THR A 1 479 ? 13.089  72.859 37.091 1.00 34.22 ? 479  THR A N   1 
ATOM   3744 C CA  . THR A 1 479 ? 14.085  72.232 36.260 1.00 34.12 ? 479  THR A CA  1 
ATOM   3745 C C   . THR A 1 479 ? 14.582  70.874 36.624 1.00 34.55 ? 479  THR A C   1 
ATOM   3746 O O   . THR A 1 479 ? 15.164  70.221 35.779 1.00 34.21 ? 479  THR A O   1 
ATOM   3747 C CB  . THR A 1 479 ? 15.352  73.110 36.179 1.00 34.09 ? 479  THR A CB  1 
ATOM   3748 O OG1 . THR A 1 479 ? 16.029  73.076 37.444 1.00 33.29 ? 479  THR A OG1 1 
ATOM   3749 C CG2 . THR A 1 479 ? 14.982  74.570 35.818 1.00 33.25 ? 479  THR A CG2 1 
ATOM   3750 N N   . GLY A 1 480 ? 14.374  70.442 37.866 1.00 34.61 ? 480  GLY A N   1 
ATOM   3751 C CA  . GLY A 1 480 ? 14.913  69.159 38.277 1.00 34.68 ? 480  GLY A CA  1 
ATOM   3752 C C   . GLY A 1 480 ? 16.309  69.384 38.844 1.00 35.12 ? 480  GLY A C   1 
ATOM   3753 O O   . GLY A 1 480 ? 17.022  68.416 39.076 1.00 35.11 ? 480  GLY A O   1 
ATOM   3754 N N   . ASN A 1 481 ? 16.686  70.657 39.068 1.00 35.58 ? 481  ASN A N   1 
ATOM   3755 C CA  . ASN A 1 481 ? 17.993  71.064 39.620 1.00 36.34 ? 481  ASN A CA  1 
ATOM   3756 C C   . ASN A 1 481 ? 17.787  72.339 40.478 1.00 37.18 ? 481  ASN A C   1 
ATOM   3757 O O   . ASN A 1 481 ? 17.308  73.350 39.972 1.00 37.26 ? 481  ASN A O   1 
ATOM   3758 C CB  . ASN A 1 481 ? 18.967  71.378 38.466 1.00 36.30 ? 481  ASN A CB  1 
ATOM   3759 C CG  . ASN A 1 481 ? 20.404  71.727 38.950 1.00 35.75 ? 481  ASN A CG  1 
ATOM   3760 O OD1 . ASN A 1 481 ? 20.620  72.129 40.094 1.00 36.08 ? 481  ASN A OD1 1 
ATOM   3761 N ND2 . ASN A 1 481 ? 21.373  71.582 38.060 1.00 34.87 ? 481  ASN A ND2 1 
ATOM   3762 N N   . PRO A 1 482 ? 18.138  72.314 41.786 1.00 37.93 ? 482  PRO A N   1 
ATOM   3763 C CA  . PRO A 1 482 ? 17.928  73.531 42.582 1.00 39.14 ? 482  PRO A CA  1 
ATOM   3764 C C   . PRO A 1 482 ? 18.827  74.728 42.231 1.00 40.28 ? 482  PRO A C   1 
ATOM   3765 O O   . PRO A 1 482 ? 18.543  75.859 42.632 1.00 40.18 ? 482  PRO A O   1 
ATOM   3766 C CB  . PRO A 1 482 ? 18.181  73.055 44.017 1.00 38.46 ? 482  PRO A CB  1 
ATOM   3767 C CG  . PRO A 1 482 ? 19.298  72.087 43.817 1.00 37.87 ? 482  PRO A CG  1 
ATOM   3768 C CD  . PRO A 1 482 ? 18.814  71.286 42.600 1.00 37.81 ? 482  PRO A CD  1 
ATOM   3769 N N   . ASN A 1 483 ? 19.922  74.474 41.527 1.00 41.88 ? 483  ASN A N   1 
ATOM   3770 C CA  . ASN A 1 483 ? 20.828  75.540 41.158 1.00 43.98 ? 483  ASN A CA  1 
ATOM   3771 C C   . ASN A 1 483 ? 20.449  76.326 39.934 1.00 45.79 ? 483  ASN A C   1 
ATOM   3772 O O   . ASN A 1 483 ? 19.889  75.815 38.959 1.00 45.66 ? 483  ASN A O   1 
ATOM   3773 C CB  . ASN A 1 483 ? 22.204  74.994 40.946 1.00 43.52 ? 483  ASN A CB  1 
ATOM   3774 C CG  . ASN A 1 483 ? 22.692  74.272 42.139 1.00 43.79 ? 483  ASN A CG  1 
ATOM   3775 O OD1 . ASN A 1 483 ? 22.929  74.879 43.194 1.00 43.38 ? 483  ASN A OD1 1 
ATOM   3776 N ND2 . ASN A 1 483 ? 22.824  72.958 42.010 1.00 43.34 ? 483  ASN A ND2 1 
ATOM   3777 N N   . GLU A 1 484 ? 20.779  77.599 40.017 1.00 48.36 ? 484  GLU A N   1 
ATOM   3778 C CA  . GLU A 1 484 ? 20.548  78.559 38.946 1.00 50.84 ? 484  GLU A CA  1 
ATOM   3779 C C   . GLU A 1 484 ? 21.658  78.238 37.921 1.00 52.03 ? 484  GLU A C   1 
ATOM   3780 O O   . GLU A 1 484 ? 22.854  78.232 38.235 1.00 51.76 ? 484  GLU A O   1 
ATOM   3781 C CB  . GLU A 1 484 ? 20.690  79.962 39.549 1.00 51.78 ? 484  GLU A CB  1 
ATOM   3782 C CG  . GLU A 1 484 ? 20.024  81.086 38.805 1.00 53.19 ? 484  GLU A CG  1 
ATOM   3783 C CD  . GLU A 1 484 ? 18.574  80.827 38.575 1.00 53.58 ? 484  GLU A CD  1 
ATOM   3784 O OE1 . GLU A 1 484 ? 18.300  79.994 37.680 1.00 54.50 ? 484  GLU A OE1 1 
ATOM   3785 O OE2 . GLU A 1 484 ? 17.734  81.437 39.281 1.00 53.65 ? 484  GLU A OE2 1 
ATOM   3786 N N   . PRO A 1 485 ? 21.263  77.912 36.686 1.00 53.54 ? 485  PRO A N   1 
ATOM   3787 C CA  . PRO A 1 485 ? 22.235  77.579 35.627 1.00 54.33 ? 485  PRO A CA  1 
ATOM   3788 C C   . PRO A 1 485 ? 23.465  78.529 35.478 1.00 54.84 ? 485  PRO A C   1 
ATOM   3789 O O   . PRO A 1 485 ? 23.359  79.765 35.569 1.00 55.54 ? 485  PRO A O   1 
ATOM   3790 C CB  . PRO A 1 485 ? 21.357  77.534 34.365 1.00 54.47 ? 485  PRO A CB  1 
ATOM   3791 C CG  . PRO A 1 485 ? 20.213  78.524 34.695 1.00 54.36 ? 485  PRO A CG  1 
ATOM   3792 C CD  . PRO A 1 485 ? 19.907  78.125 36.125 1.00 54.07 ? 485  PRO A CD  1 
ATOM   3793 N N   . SER A 1 490 ? 27.161  79.793 44.373 1.00 46.95 ? 490  SER A N   1 
ATOM   3794 C CA  . SER A 1 490 ? 27.755  78.607 45.061 1.00 47.19 ? 490  SER A CA  1 
ATOM   3795 C C   . SER A 1 490 ? 26.795  77.382 44.952 1.00 46.31 ? 490  SER A C   1 
ATOM   3796 O O   . SER A 1 490 ? 25.661  77.416 45.461 1.00 46.15 ? 490  SER A O   1 
ATOM   3797 C CB  . SER A 1 490 ? 28.036  78.920 46.537 1.00 47.70 ? 490  SER A CB  1 
ATOM   3798 O OG  . SER A 1 490 ? 28.767  77.851 47.114 1.00 49.18 ? 490  SER A OG  1 
ATOM   3799 N N   . LYS A 1 491 ? 27.278  76.327 44.298 1.00 45.17 ? 491  LYS A N   1 
ATOM   3800 C CA  . LYS A 1 491 ? 26.494  75.138 43.974 1.00 44.50 ? 491  LYS A CA  1 
ATOM   3801 C C   . LYS A 1 491 ? 26.229  73.989 44.932 1.00 43.16 ? 491  LYS A C   1 
ATOM   3802 O O   . LYS A 1 491 ? 27.149  73.486 45.571 1.00 43.26 ? 491  LYS A O   1 
ATOM   3803 C CB  . LYS A 1 491 ? 27.051  74.529 42.695 1.00 45.57 ? 491  LYS A CB  1 
ATOM   3804 C CG  . LYS A 1 491 ? 27.158  75.563 41.579 1.00 47.42 ? 491  LYS A CG  1 
ATOM   3805 C CD  . LYS A 1 491 ? 25.898  76.414 41.560 1.00 48.80 ? 491  LYS A CD  1 
ATOM   3806 C CE  . LYS A 1 491 ? 25.877  77.417 40.417 1.00 49.95 ? 491  LYS A CE  1 
ATOM   3807 N NZ  . LYS A 1 491 ? 24.455  77.948 40.276 1.00 51.11 ? 491  LYS A NZ  1 
ATOM   3808 N N   . TRP A 1 492 ? 24.953  73.580 44.978 1.00 41.14 ? 492  TRP A N   1 
ATOM   3809 C CA  . TRP A 1 492 ? 24.474  72.455 45.773 1.00 38.89 ? 492  TRP A CA  1 
ATOM   3810 C C   . TRP A 1 492 ? 24.808  71.302 44.869 1.00 38.28 ? 492  TRP A C   1 
ATOM   3811 O O   . TRP A 1 492 ? 24.210  71.156 43.810 1.00 38.18 ? 492  TRP A O   1 
ATOM   3812 C CB  . TRP A 1 492 ? 22.958  72.530 45.914 1.00 37.69 ? 492  TRP A CB  1 
ATOM   3813 C CG  . TRP A 1 492 ? 22.276  71.479 46.794 1.00 36.23 ? 492  TRP A CG  1 
ATOM   3814 C CD1 . TRP A 1 492 ? 22.723  70.199 47.093 1.00 35.66 ? 492  TRP A CD1 1 
ATOM   3815 C CD2 . TRP A 1 492 ? 20.987  71.605 47.400 1.00 35.33 ? 492  TRP A CD2 1 
ATOM   3816 N NE1 . TRP A 1 492 ? 21.778  69.535 47.841 1.00 35.60 ? 492  TRP A NE1 1 
ATOM   3817 C CE2 . TRP A 1 492 ? 20.702  70.369 48.045 1.00 35.25 ? 492  TRP A CE2 1 
ATOM   3818 C CE3 . TRP A 1 492 ? 20.044  72.642 47.466 1.00 35.21 ? 492  TRP A CE3 1 
ATOM   3819 C CZ2 . TRP A 1 492 ? 19.508  70.145 48.748 1.00 34.40 ? 492  TRP A CZ2 1 
ATOM   3820 C CZ3 . TRP A 1 492 ? 18.855  72.422 48.168 1.00 35.00 ? 492  TRP A CZ3 1 
ATOM   3821 C CH2 . TRP A 1 492 ? 18.604  71.169 48.803 1.00 34.59 ? 492  TRP A CH2 1 
ATOM   3822 N N   . PRO A 1 493 ? 25.770  70.458 45.257 1.00 37.64 ? 493  PRO A N   1 
ATOM   3823 C CA  . PRO A 1 493 ? 26.072  69.349 44.347 1.00 36.91 ? 493  PRO A CA  1 
ATOM   3824 C C   . PRO A 1 493 ? 25.087  68.189 44.371 1.00 36.71 ? 493  PRO A C   1 
ATOM   3825 O O   . PRO A 1 493 ? 24.368  67.949 45.339 1.00 36.27 ? 493  PRO A O   1 
ATOM   3826 C CB  . PRO A 1 493 ? 27.468  68.902 44.806 1.00 36.94 ? 493  PRO A CB  1 
ATOM   3827 C CG  . PRO A 1 493 ? 27.422  69.132 46.227 1.00 36.96 ? 493  PRO A CG  1 
ATOM   3828 C CD  . PRO A 1 493 ? 26.731  70.490 46.371 1.00 37.24 ? 493  PRO A CD  1 
ATOM   3829 N N   . LEU A 1 494 ? 25.080  67.448 43.284 1.00 36.26 ? 494  LEU A N   1 
ATOM   3830 C CA  . LEU A 1 494 ? 24.232  66.291 43.186 1.00 36.25 ? 494  LEU A CA  1 
ATOM   3831 C C   . LEU A 1 494 ? 24.753  65.222 44.189 1.00 36.36 ? 494  LEU A C   1 
ATOM   3832 O O   . LEU A 1 494 ? 25.958  65.142 44.475 1.00 36.15 ? 494  LEU A O   1 
ATOM   3833 C CB  . LEU A 1 494 ? 24.309  65.789 41.746 1.00 36.19 ? 494  LEU A CB  1 
ATOM   3834 C CG  . LEU A 1 494 ? 23.233  65.101 40.899 1.00 36.53 ? 494  LEU A CG  1 
ATOM   3835 C CD1 . LEU A 1 494 ? 21.908  65.771 40.952 1.00 35.80 ? 494  LEU A CD1 1 
ATOM   3836 C CD2 . LEU A 1 494 ? 23.747  65.144 39.463 1.00 36.62 ? 494  LEU A CD2 1 
ATOM   3837 N N   . PHE A 1 495 ? 23.833  64.450 44.767 1.00 35.88 ? 495  PHE A N   1 
ATOM   3838 C CA  . PHE A 1 495 ? 24.210  63.370 45.649 1.00 35.61 ? 495  PHE A CA  1 
ATOM   3839 C C   . PHE A 1 495 ? 24.454  62.198 44.677 1.00 35.88 ? 495  PHE A C   1 
ATOM   3840 O O   . PHE A 1 495 ? 23.661  61.966 43.774 1.00 35.71 ? 495  PHE A O   1 
ATOM   3841 C CB  . PHE A 1 495 ? 23.055  63.051 46.631 1.00 35.10 ? 495  PHE A CB  1 
ATOM   3842 C CG  . PHE A 1 495 ? 23.209  61.716 47.373 1.00 34.24 ? 495  PHE A CG  1 
ATOM   3843 C CD1 . PHE A 1 495 ? 22.864  60.514 46.755 1.00 33.58 ? 495  PHE A CD1 1 
ATOM   3844 C CD2 . PHE A 1 495 ? 23.693  61.677 48.694 1.00 33.73 ? 495  PHE A CD2 1 
ATOM   3845 C CE1 . PHE A 1 495 ? 22.993  59.297 47.449 1.00 33.44 ? 495  PHE A CE1 1 
ATOM   3846 C CE2 . PHE A 1 495 ? 23.825  60.477 49.384 1.00 33.42 ? 495  PHE A CE2 1 
ATOM   3847 C CZ  . PHE A 1 495 ? 23.472  59.280 48.757 1.00 33.28 ? 495  PHE A CZ  1 
ATOM   3848 N N   . THR A 1 496 ? 25.559  61.482 44.829 1.00 36.36 ? 496  THR A N   1 
ATOM   3849 C CA  . THR A 1 496 ? 25.833  60.350 43.955 1.00 37.02 ? 496  THR A CA  1 
ATOM   3850 C C   . THR A 1 496 ? 26.135  59.135 44.804 1.00 37.61 ? 496  THR A C   1 
ATOM   3851 O O   . THR A 1 496 ? 26.496  59.254 45.965 1.00 37.62 ? 496  THR A O   1 
ATOM   3852 C CB  . THR A 1 496 ? 27.043  60.623 43.016 1.00 37.22 ? 496  THR A CB  1 
ATOM   3853 O OG1 . THR A 1 496 ? 28.208  60.928 43.808 1.00 37.55 ? 496  THR A OG1 1 
ATOM   3854 C CG2 . THR A 1 496 ? 26.728  61.796 42.065 1.00 36.40 ? 496  THR A CG2 1 
ATOM   3855 N N   . THR A 1 497 ? 25.959  57.965 44.218 1.00 38.52 ? 497  THR A N   1 
ATOM   3856 C CA  . THR A 1 497 ? 26.214  56.712 44.911 1.00 39.67 ? 497  THR A CA  1 
ATOM   3857 C C   . THR A 1 497 ? 27.623  56.680 45.479 1.00 39.71 ? 497  THR A C   1 
ATOM   3858 O O   . THR A 1 497 ? 27.828  56.232 46.609 1.00 40.12 ? 497  THR A O   1 
ATOM   3859 C CB  . THR A 1 497 ? 26.088  55.492 43.953 1.00 40.05 ? 497  THR A CB  1 
ATOM   3860 O OG1 . THR A 1 497 ? 24.800  55.481 43.338 1.00 41.16 ? 497  THR A OG1 1 
ATOM   3861 C CG2 . THR A 1 497 ? 26.263  54.211 44.717 1.00 40.42 ? 497  THR A CG2 1 
ATOM   3862 N N   . LYS A 1 498 ? 28.580  57.157 44.673 1.00 39.63 ? 498  LYS A N   1 
ATOM   3863 C CA  . LYS A 1 498 ? 29.983  57.184 45.029 1.00 39.54 ? 498  LYS A CA  1 
ATOM   3864 C C   . LYS A 1 498 ? 30.339  58.221 46.088 1.00 39.68 ? 498  LYS A C   1 
ATOM   3865 O O   . LYS A 1 498 ? 30.840  57.885 47.158 1.00 39.15 ? 498  LYS A O   1 
ATOM   3866 C CB  . LYS A 1 498 ? 30.830  57.446 43.779 1.00 39.24 ? 498  LYS A CB  1 
ATOM   3867 N N   . GLU A 1 499 ? 30.073  59.482 45.765 1.00 40.10 ? 499  GLU A N   1 
ATOM   3868 C CA  . GLU A 1 499 ? 30.395  60.600 46.634 1.00 40.46 ? 499  GLU A CA  1 
ATOM   3869 C C   . GLU A 1 499 ? 29.455  60.894 47.792 1.00 39.38 ? 499  GLU A C   1 
ATOM   3870 O O   . GLU A 1 499 ? 29.894  61.414 48.809 1.00 38.78 ? 499  GLU A O   1 
ATOM   3871 C CB  . GLU A 1 499 ? 30.502  61.870 45.800 1.00 42.72 ? 499  GLU A CB  1 
ATOM   3872 C CG  . GLU A 1 499 ? 31.894  62.324 45.504 1.00 45.75 ? 499  GLU A CG  1 
ATOM   3873 C CD  . GLU A 1 499 ? 32.639  61.313 44.714 1.00 47.34 ? 499  GLU A CD  1 
ATOM   3874 O OE1 . GLU A 1 499 ? 32.050  60.797 43.733 1.00 48.90 ? 499  GLU A OE1 1 
ATOM   3875 O OE2 . GLU A 1 499 ? 33.809  61.037 45.075 1.00 48.85 ? 499  GLU A OE2 1 
ATOM   3876 N N   . GLN A 1 500 ? 28.159  60.628 47.616 1.00 38.67 ? 500  GLN A N   1 
ATOM   3877 C CA  . GLN A 1 500 ? 27.161  60.864 48.693 1.00 37.63 ? 500  GLN A CA  1 
ATOM   3878 C C   . GLN A 1 500 ? 27.174  62.269 49.323 1.00 36.39 ? 500  GLN A C   1 
ATOM   3879 O O   . GLN A 1 500 ? 26.961  62.447 50.514 1.00 35.73 ? 500  GLN A O   1 
ATOM   3880 C CB  . GLN A 1 500 ? 27.364  59.803 49.756 1.00 38.23 ? 500  GLN A CB  1 
ATOM   3881 C CG  . GLN A 1 500 ? 27.057  58.432 49.174 1.00 39.74 ? 500  GLN A CG  1 
ATOM   3882 C CD  . GLN A 1 500 ? 27.520  57.298 50.060 1.00 40.41 ? 500  GLN A CD  1 
ATOM   3883 O OE1 . GLN A 1 500 ? 27.168  57.230 51.227 1.00 40.21 ? 500  GLN A OE1 1 
ATOM   3884 N NE2 . GLN A 1 500 ? 28.328  56.407 49.500 1.00 40.68 ? 500  GLN A NE2 1 
ATOM   3885 N N   . LYS A 1 501 ? 27.399  63.263 48.488 1.00 35.49 ? 501  LYS A N   1 
ATOM   3886 C CA  . LYS A 1 501 ? 27.481  64.631 48.934 1.00 35.12 ? 501  LYS A CA  1 
ATOM   3887 C C   . LYS A 1 501 ? 26.150  65.276 49.332 1.00 34.41 ? 501  LYS A C   1 
ATOM   3888 O O   . LYS A 1 501 ? 25.080  64.956 48.776 1.00 33.99 ? 501  LYS A O   1 
ATOM   3889 C CB  . LYS A 1 501 ? 28.133  65.485 47.848 1.00 35.77 ? 501  LYS A CB  1 
ATOM   3890 C CG  . LYS A 1 501 ? 29.601  65.113 47.539 1.00 37.25 ? 501  LYS A CG  1 
ATOM   3891 C CD  . LYS A 1 501 ? 30.171  66.123 46.515 1.00 38.74 ? 501  LYS A CD  1 
ATOM   3892 C CE  . LYS A 1 501 ? 31.532  65.662 45.960 1.00 39.80 ? 501  LYS A CE  1 
ATOM   3893 N NZ  . LYS A 1 501 ? 32.198  66.750 45.193 1.00 40.18 ? 501  LYS A NZ  1 
ATOM   3894 N N   . PHE A 1 502 ? 26.233  66.174 50.304 1.00 33.03 ? 502  PHE A N   1 
ATOM   3895 C CA  . PHE A 1 502 ? 25.068  66.893 50.736 1.00 32.96 ? 502  PHE A CA  1 
ATOM   3896 C C   . PHE A 1 502 ? 25.520  68.250 51.250 1.00 33.22 ? 502  PHE A C   1 
ATOM   3897 O O   . PHE A 1 502 ? 26.721  68.478 51.461 1.00 33.00 ? 502  PHE A O   1 
ATOM   3898 C CB  . PHE A 1 502 ? 24.305  66.098 51.818 1.00 31.76 ? 502  PHE A CB  1 
ATOM   3899 C CG  . PHE A 1 502 ? 25.003  66.031 53.163 1.00 31.04 ? 502  PHE A CG  1 
ATOM   3900 C CD1 . PHE A 1 502 ? 25.926  65.016 53.433 1.00 30.24 ? 502  PHE A CD1 1 
ATOM   3901 C CD2 . PHE A 1 502 ? 24.691  66.953 54.168 1.00 30.55 ? 502  PHE A CD2 1 
ATOM   3902 C CE1 . PHE A 1 502 ? 26.524  64.901 54.674 1.00 30.30 ? 502  PHE A CE1 1 
ATOM   3903 C CE2 . PHE A 1 502 ? 25.282  66.860 55.437 1.00 30.64 ? 502  PHE A CE2 1 
ATOM   3904 C CZ  . PHE A 1 502 ? 26.202  65.830 55.700 1.00 30.23 ? 502  PHE A CZ  1 
ATOM   3905 N N   . ILE A 1 503 ? 24.559  69.159 51.384 1.00 33.84 ? 503  ILE A N   1 
ATOM   3906 C CA  . ILE A 1 503 ? 24.817  70.489 51.928 1.00 34.37 ? 503  ILE A CA  1 
ATOM   3907 C C   . ILE A 1 503 ? 24.055  70.747 53.229 1.00 34.71 ? 503  ILE A C   1 
ATOM   3908 O O   . ILE A 1 503 ? 23.023  70.147 53.487 1.00 34.40 ? 503  ILE A O   1 
ATOM   3909 C CB  . ILE A 1 503 ? 24.401  71.627 50.938 1.00 34.68 ? 503  ILE A CB  1 
ATOM   3910 C CG1 . ILE A 1 503 ? 22.862  71.625 50.731 1.00 34.42 ? 503  ILE A CG1 1 
ATOM   3911 C CG2 . ILE A 1 503 ? 25.141  71.474 49.625 1.00 33.75 ? 503  ILE A CG2 1 
ATOM   3912 C CD1 . ILE A 1 503 ? 22.298  72.988 50.312 1.00 34.34 ? 503  ILE A CD1 1 
ATOM   3913 N N   . ASP A 1 504 ? 24.592  71.639 54.052 1.00 35.71 ? 504  ASP A N   1 
ATOM   3914 C CA  . ASP A 1 504 ? 23.916  72.041 55.272 1.00 36.84 ? 504  ASP A CA  1 
ATOM   3915 C C   . ASP A 1 504 ? 23.061  73.200 54.768 1.00 37.13 ? 504  ASP A C   1 
ATOM   3916 O O   . ASP A 1 504 ? 23.409  73.871 53.794 1.00 36.74 ? 504  ASP A O   1 
ATOM   3917 C CB  . ASP A 1 504 ? 24.865  72.600 56.349 1.00 38.01 ? 504  ASP A CB  1 
ATOM   3918 C CG  . ASP A 1 504 ? 25.891  71.581 56.862 1.00 39.52 ? 504  ASP A CG  1 
ATOM   3919 O OD1 . ASP A 1 504 ? 25.545  70.410 57.150 1.00 40.56 ? 504  ASP A OD1 1 
ATOM   3920 O OD2 . ASP A 1 504 ? 27.073  71.961 57.008 1.00 40.55 ? 504  ASP A OD2 1 
ATOM   3921 N N   . LEU A 1 505 ? 21.948  73.440 55.438 1.00 37.54 ? 505  LEU A N   1 
ATOM   3922 C CA  . LEU A 1 505 ? 21.058  74.521 55.062 1.00 38.44 ? 505  LEU A CA  1 
ATOM   3923 C C   . LEU A 1 505 ? 20.926  75.414 56.281 1.00 38.92 ? 505  LEU A C   1 
ATOM   3924 O O   . LEU A 1 505 ? 20.246  75.060 57.263 1.00 38.51 ? 505  LEU A O   1 
ATOM   3925 C CB  . LEU A 1 505 ? 19.711  73.944 54.670 1.00 38.29 ? 505  LEU A CB  1 
ATOM   3926 C CG  . LEU A 1 505 ? 18.971  74.410 53.447 1.00 38.85 ? 505  LEU A CG  1 
ATOM   3927 C CD1 . LEU A 1 505 ? 19.899  74.789 52.262 1.00 38.39 ? 505  LEU A CD1 1 
ATOM   3928 C CD2 . LEU A 1 505 ? 18.034  73.251 53.096 1.00 38.62 ? 505  LEU A CD2 1 
ATOM   3929 N N   . ASN A 1 506 ? 21.620  76.550 56.238 1.00 39.48 ? 506  ASN A N   1 
ATOM   3930 C CA  . ASN A 1 506 ? 21.573  77.498 57.353 1.00 40.16 ? 506  ASN A CA  1 
ATOM   3931 C C   . ASN A 1 506 ? 21.983  78.900 56.900 1.00 40.89 ? 506  ASN A C   1 
ATOM   3932 O O   . ASN A 1 506 ? 22.019  79.189 55.703 1.00 41.28 ? 506  ASN A O   1 
ATOM   3933 C CB  . ASN A 1 506 ? 22.468  77.012 58.506 1.00 39.67 ? 506  ASN A CB  1 
ATOM   3934 C CG  . ASN A 1 506 ? 23.894  76.797 58.072 1.00 39.25 ? 506  ASN A CG  1 
ATOM   3935 O OD1 . ASN A 1 506 ? 24.464  77.652 57.389 1.00 39.38 ? 506  ASN A OD1 1 
ATOM   3936 N ND2 . ASN A 1 506 ? 24.486  75.671 58.462 1.00 38.12 ? 506  ASN A ND2 1 
ATOM   3937 N N   . THR A 1 507 ? 22.300  79.771 57.846 1.00 41.68 ? 507  THR A N   1 
ATOM   3938 C CA  . THR A 1 507 ? 22.636  81.143 57.506 1.00 42.36 ? 507  THR A CA  1 
ATOM   3939 C C   . THR A 1 507 ? 24.121  81.380 57.228 1.00 43.23 ? 507  THR A C   1 
ATOM   3940 O O   . THR A 1 507 ? 24.518  82.491 56.878 1.00 43.71 ? 507  THR A O   1 
ATOM   3941 C CB  . THR A 1 507 ? 22.141  82.091 58.609 1.00 41.88 ? 507  THR A CB  1 
ATOM   3942 O OG1 . THR A 1 507 ? 22.685  81.674 59.861 1.00 42.25 ? 507  THR A OG1 1 
ATOM   3943 C CG2 . THR A 1 507 ? 20.653  82.044 58.718 1.00 41.06 ? 507  THR A CG2 1 
ATOM   3944 N N   . GLU A 1 508 ? 24.931  80.339 57.360 1.00 43.84 ? 508  GLU A N   1 
ATOM   3945 C CA  . GLU A 1 508 ? 26.367  80.439 57.114 1.00 44.47 ? 508  GLU A CA  1 
ATOM   3946 C C   . GLU A 1 508 ? 26.620  80.089 55.656 1.00 44.98 ? 508  GLU A C   1 
ATOM   3947 O O   . GLU A 1 508 ? 25.751  79.534 55.006 1.00 45.04 ? 508  GLU A O   1 
ATOM   3948 C CB  . GLU A 1 508 ? 27.143  79.463 58.014 1.00 44.28 ? 508  GLU A CB  1 
ATOM   3949 C CG  . GLU A 1 508 ? 27.080  79.760 59.522 1.00 44.70 ? 508  GLU A CG  1 
ATOM   3950 N N   . PRO A 1 509 ? 27.792  80.453 55.112 1.00 45.62 ? 509  PRO A N   1 
ATOM   3951 C CA  . PRO A 1 509 ? 28.111  80.139 53.709 1.00 46.15 ? 509  PRO A CA  1 
ATOM   3952 C C   . PRO A 1 509 ? 27.938  78.631 53.508 1.00 46.59 ? 509  PRO A C   1 
ATOM   3953 O O   . PRO A 1 509 ? 28.387  77.844 54.342 1.00 46.55 ? 509  PRO A O   1 
ATOM   3954 C CB  . PRO A 1 509 ? 29.577  80.537 53.575 1.00 45.83 ? 509  PRO A CB  1 
ATOM   3955 C CG  . PRO A 1 509 ? 29.709  81.684 54.552 1.00 46.04 ? 509  PRO A CG  1 
ATOM   3956 C CD  . PRO A 1 509 ? 28.866  81.238 55.749 1.00 45.85 ? 509  PRO A CD  1 
ATOM   3957 N N   . MET A 1 510 ? 27.286  78.235 52.417 1.00 47.06 ? 510  MET A N   1 
ATOM   3958 C CA  . MET A 1 510 ? 27.060  76.834 52.129 1.00 47.35 ? 510  MET A CA  1 
ATOM   3959 C C   . MET A 1 510 ? 28.337  76.071 52.381 1.00 47.42 ? 510  MET A C   1 
ATOM   3960 O O   . MET A 1 510 ? 29.428  76.582 52.133 1.00 48.13 ? 510  MET A O   1 
ATOM   3961 C CB  . MET A 1 510 ? 26.660  76.661 50.677 1.00 48.14 ? 510  MET A CB  1 
ATOM   3962 C CG  . MET A 1 510 ? 26.243  75.239 50.274 1.00 48.43 ? 510  MET A CG  1 
ATOM   3963 S SD  . MET A 1 510 ? 26.227  75.040 48.469 1.00 49.66 ? 510  MET A SD  1 
ATOM   3964 C CE  . MET A 1 510 ? 24.702  75.844 48.005 1.00 49.11 ? 510  MET A CE  1 
ATOM   3965 N N   . LYS A 1 511 ? 28.195  74.849 52.880 1.00 46.89 ? 511  LYS A N   1 
ATOM   3966 C CA  . LYS A 1 511 ? 29.301  73.951 53.176 1.00 46.10 ? 511  LYS A CA  1 
ATOM   3967 C C   . LYS A 1 511 ? 28.845  72.549 52.687 1.00 45.30 ? 511  LYS A C   1 
ATOM   3968 O O   . LYS A 1 511 ? 27.713  72.117 52.960 1.00 45.31 ? 511  LYS A O   1 
ATOM   3969 C CB  . LYS A 1 511 ? 29.536  73.945 54.674 1.00 46.92 ? 511  LYS A CB  1 
ATOM   3970 C CG  . LYS A 1 511 ? 30.982  73.897 55.112 1.00 48.71 ? 511  LYS A CG  1 
ATOM   3971 C CD  . LYS A 1 511 ? 31.100  74.535 56.515 1.00 50.05 ? 511  LYS A CD  1 
ATOM   3972 C CE  . LYS A 1 511 ? 32.534  74.595 57.071 1.00 51.12 ? 511  LYS A CE  1 
ATOM   3973 N NZ  . LYS A 1 511 ? 32.491  75.116 58.506 1.00 52.05 ? 511  LYS A NZ  1 
ATOM   3974 N N   . VAL A 1 512 ? 29.709  71.866 51.948 1.00 43.72 ? 512  VAL A N   1 
ATOM   3975 C CA  . VAL A 1 512 ? 29.417  70.553 51.413 1.00 42.50 ? 512  VAL A CA  1 
ATOM   3976 C C   . VAL A 1 512 ? 30.058  69.481 52.267 1.00 41.56 ? 512  VAL A C   1 
ATOM   3977 O O   . VAL A 1 512 ? 31.199  69.619 52.667 1.00 41.44 ? 512  VAL A O   1 
ATOM   3978 C CB  . VAL A 1 512 ? 29.959  70.405 49.967 1.00 42.34 ? 512  VAL A CB  1 
ATOM   3979 C CG1 . VAL A 1 512 ? 29.630  69.017 49.414 1.00 41.91 ? 512  VAL A CG1 1 
ATOM   3980 C CG2 . VAL A 1 512 ? 29.366  71.497 49.092 1.00 42.32 ? 512  VAL A CG2 1 
ATOM   3981 N N   . HIS A 1 513 ? 29.316  68.412 52.531 1.00 40.64 ? 513  HIS A N   1 
ATOM   3982 C CA  . HIS A 1 513 ? 29.809  67.290 53.328 1.00 39.67 ? 513  HIS A CA  1 
ATOM   3983 C C   . HIS A 1 513 ? 29.472  66.000 52.629 1.00 38.87 ? 513  HIS A C   1 
ATOM   3984 O O   . HIS A 1 513 ? 28.877  65.999 51.563 1.00 38.84 ? 513  HIS A O   1 
ATOM   3985 C CB  . HIS A 1 513 ? 29.151  67.239 54.689 1.00 39.66 ? 513  HIS A CB  1 
ATOM   3986 C CG  . HIS A 1 513 ? 29.174  68.527 55.429 1.00 40.17 ? 513  HIS A CG  1 
ATOM   3987 N ND1 . HIS A 1 513 ? 30.316  69.018 56.028 1.00 40.37 ? 513  HIS A ND1 1 
ATOM   3988 C CD2 . HIS A 1 513 ? 28.177  69.388 55.750 1.00 40.64 ? 513  HIS A CD2 1 
ATOM   3989 C CE1 . HIS A 1 513 ? 30.019  70.119 56.697 1.00 40.42 ? 513  HIS A CE1 1 
ATOM   3990 N NE2 . HIS A 1 513 ? 28.729  70.365 56.545 1.00 40.81 ? 513  HIS A NE2 1 
ATOM   3991 N N   . GLN A 1 514 ? 29.827  64.885 53.252 1.00 38.13 ? 514  GLN A N   1 
ATOM   3992 C CA  . GLN A 1 514 ? 29.548  63.591 52.657 1.00 37.23 ? 514  GLN A CA  1 
ATOM   3993 C C   . GLN A 1 514 ? 29.143  62.555 53.685 1.00 35.98 ? 514  GLN A C   1 
ATOM   3994 O O   . GLN A 1 514 ? 29.552  62.621 54.820 1.00 34.90 ? 514  GLN A O   1 
ATOM   3995 C CB  . GLN A 1 514 ? 30.780  63.077 51.928 1.00 38.36 ? 514  GLN A CB  1 
ATOM   3996 C CG  . GLN A 1 514 ? 31.303  63.996 50.849 1.00 40.10 ? 514  GLN A CG  1 
ATOM   3997 C CD  . GLN A 1 514 ? 32.521  63.400 50.155 1.00 40.84 ? 514  GLN A CD  1 
ATOM   3998 O OE1 . GLN A 1 514 ? 33.659  63.736 50.473 1.00 41.85 ? 514  GLN A OE1 1 
ATOM   3999 N NE2 . GLN A 1 514 ? 32.281  62.487 49.234 1.00 41.23 ? 514  GLN A NE2 1 
ATOM   4000 N N   . ARG A 1 515 ? 28.358  61.579 53.246 1.00 35.22 ? 515  ARG A N   1 
ATOM   4001 C CA  . ARG A 1 515 ? 27.936  60.465 54.100 1.00 34.67 ? 515  ARG A CA  1 
ATOM   4002 C C   . ARG A 1 515 ? 27.217  60.889 55.384 1.00 33.53 ? 515  ARG A C   1 
ATOM   4003 O O   . ARG A 1 515 ? 27.676  60.624 56.476 1.00 32.21 ? 515  ARG A O   1 
ATOM   4004 C CB  . ARG A 1 515 ? 29.166  59.597 54.432 1.00 35.41 ? 515  ARG A CB  1 
ATOM   4005 C CG  . ARG A 1 515 ? 29.833  58.999 53.166 1.00 36.78 ? 515  ARG A CG  1 
ATOM   4006 C CD  . ARG A 1 515 ? 30.895  57.935 53.514 1.00 37.79 ? 515  ARG A CD  1 
ATOM   4007 N NE  . ARG A 1 515 ? 31.417  57.249 52.330 1.00 38.56 ? 515  ARG A NE  1 
ATOM   4008 N N   . LEU A 1 516 ? 26.089  61.564 55.199 1.00 32.93 ? 516  LEU A N   1 
ATOM   4009 C CA  . LEU A 1 516 ? 25.237  62.060 56.282 1.00 33.00 ? 516  LEU A CA  1 
ATOM   4010 C C   . LEU A 1 516 ? 24.935  60.942 57.305 1.00 32.72 ? 516  LEU A C   1 
ATOM   4011 O O   . LEU A 1 516 ? 24.352  59.906 56.980 1.00 31.85 ? 516  LEU A O   1 
ATOM   4012 C CB  . LEU A 1 516 ? 23.956  62.624 55.654 1.00 32.91 ? 516  LEU A CB  1 
ATOM   4013 C CG  . LEU A 1 516 ? 22.727  63.052 56.435 1.00 33.28 ? 516  LEU A CG  1 
ATOM   4014 C CD1 . LEU A 1 516 ? 23.028  63.570 57.806 1.00 33.51 ? 516  LEU A CD1 1 
ATOM   4015 C CD2 . LEU A 1 516 ? 22.061  64.117 55.573 1.00 33.52 ? 516  LEU A CD2 1 
ATOM   4016 N N   . ARG A 1 517 ? 25.374  61.190 58.536 1.00 32.98 ? 517  ARG A N   1 
ATOM   4017 C CA  . ARG A 1 517 ? 25.275  60.258 59.670 1.00 33.40 ? 517  ARG A CA  1 
ATOM   4018 C C   . ARG A 1 517 ? 25.562  58.791 59.339 1.00 32.97 ? 517  ARG A C   1 
ATOM   4019 O O   . ARG A 1 517 ? 24.877  57.896 59.858 1.00 32.49 ? 517  ARG A O   1 
ATOM   4020 C CB  . ARG A 1 517 ? 23.924  60.433 60.412 1.00 34.12 ? 517  ARG A CB  1 
ATOM   4021 C CG  . ARG A 1 517 ? 24.091  61.604 61.426 1.00 36.60 ? 517  ARG A CG  1 
ATOM   4022 C CD  . ARG A 1 517 ? 22.899  62.095 62.199 1.00 37.58 ? 517  ARG A CD  1 
ATOM   4023 N NE  . ARG A 1 517 ? 22.810  61.376 63.459 1.00 39.33 ? 517  ARG A NE  1 
ATOM   4024 C CZ  . ARG A 1 517 ? 23.649  61.517 64.483 1.00 39.53 ? 517  ARG A CZ  1 
ATOM   4025 N NH1 . ARG A 1 517 ? 24.644  62.389 64.377 1.00 40.25 ? 517  ARG A NH1 1 
ATOM   4026 N NH2 . ARG A 1 517 ? 23.525  60.764 65.583 1.00 38.20 ? 517  ARG A NH2 1 
ATOM   4027 N N   . VAL A 1 518 ? 26.587  58.539 58.506 1.00 32.50 ? 518  VAL A N   1 
ATOM   4028 C CA  . VAL A 1 518 ? 26.906  57.145 58.124 1.00 32.62 ? 518  VAL A CA  1 
ATOM   4029 C C   . VAL A 1 518 ? 27.077  56.167 59.292 1.00 32.70 ? 518  VAL A C   1 
ATOM   4030 O O   . VAL A 1 518 ? 26.545  55.083 59.279 1.00 33.13 ? 518  VAL A O   1 
ATOM   4031 C CB  . VAL A 1 518 ? 28.254  56.913 57.397 1.00 32.53 ? 518  VAL A CB  1 
ATOM   4032 C CG1 . VAL A 1 518 ? 28.002  56.272 56.061 1.00 31.46 ? 518  VAL A CG1 1 
ATOM   4033 C CG2 . VAL A 1 518 ? 29.127  58.119 57.467 1.00 31.71 ? 518  VAL A CG2 1 
ATOM   4034 N N   . GLN A 1 519 ? 27.913  56.552 60.237 1.00 32.86 ? 519  GLN A N   1 
ATOM   4035 C CA  . GLN A 1 519 ? 28.240  55.744 61.391 1.00 33.23 ? 519  GLN A CA  1 
ATOM   4036 C C   . GLN A 1 519 ? 26.974  55.225 62.080 1.00 33.13 ? 519  GLN A C   1 
ATOM   4037 O O   . GLN A 1 519 ? 26.797  54.015 62.225 1.00 32.91 ? 519  GLN A O   1 
ATOM   4038 C CB  . GLN A 1 519 ? 29.088  56.591 62.336 1.00 33.38 ? 519  GLN A CB  1 
ATOM   4039 C CG  . GLN A 1 519 ? 29.898  55.764 63.293 1.00 35.08 ? 519  GLN A CG  1 
ATOM   4040 C CD  . GLN A 1 519 ? 30.943  54.896 62.578 1.00 35.96 ? 519  GLN A CD  1 
ATOM   4041 O OE1 . GLN A 1 519 ? 31.519  55.295 61.557 1.00 36.55 ? 519  GLN A OE1 1 
ATOM   4042 N NE2 . GLN A 1 519 ? 31.191  53.708 63.118 1.00 36.14 ? 519  GLN A NE2 1 
ATOM   4043 N N   . MET A 1 520 ? 26.092  56.141 62.481 1.00 32.69 ? 520  MET A N   1 
ATOM   4044 C CA  . MET A 1 520 ? 24.854  55.744 63.123 1.00 32.80 ? 520  MET A CA  1 
ATOM   4045 C C   . MET A 1 520 ? 23.919  55.017 62.158 1.00 32.32 ? 520  MET A C   1 
ATOM   4046 O O   . MET A 1 520 ? 23.274  54.044 62.555 1.00 32.58 ? 520  MET A O   1 
ATOM   4047 C CB  . MET A 1 520 ? 24.122  56.942 63.730 1.00 33.41 ? 520  MET A CB  1 
ATOM   4048 C CG  . MET A 1 520 ? 24.832  57.568 64.932 1.00 34.54 ? 520  MET A CG  1 
ATOM   4049 S SD  . MET A 1 520 ? 25.251  56.323 66.231 1.00 36.79 ? 520  MET A SD  1 
ATOM   4050 C CE  . MET A 1 520 ? 26.956  56.071 65.795 1.00 36.26 ? 520  MET A CE  1 
ATOM   4051 N N   . CYS A 1 521 ? 23.853  55.439 60.895 1.00 31.20 ? 521  CYS A N   1 
ATOM   4052 C CA  . CYS A 1 521 ? 22.947  54.760 59.991 1.00 30.29 ? 521  CYS A CA  1 
ATOM   4053 C C   . CYS A 1 521 ? 23.400  53.357 59.568 1.00 30.12 ? 521  CYS A C   1 
ATOM   4054 O O   . CYS A 1 521 ? 22.541  52.530 59.234 1.00 29.65 ? 521  CYS A O   1 
ATOM   4055 C CB  . CYS A 1 521 ? 22.585  55.650 58.796 1.00 30.05 ? 521  CYS A CB  1 
ATOM   4056 S SG  . CYS A 1 521 ? 21.630  57.114 59.326 1.00 29.28 ? 521  CYS A SG  1 
ATOM   4057 N N   . VAL A 1 522 ? 24.708  53.045 59.606 1.00 29.84 ? 522  VAL A N   1 
ATOM   4058 C CA  . VAL A 1 522 ? 25.092  51.642 59.304 1.00 29.98 ? 522  VAL A CA  1 
ATOM   4059 C C   . VAL A 1 522 ? 24.547  50.804 60.491 1.00 30.13 ? 522  VAL A C   1 
ATOM   4060 O O   . VAL A 1 522 ? 24.074  49.664 60.333 1.00 30.33 ? 522  VAL A O   1 
ATOM   4061 C CB  . VAL A 1 522 ? 26.628  51.433 59.183 1.00 30.78 ? 522  VAL A CB  1 
ATOM   4062 C CG1 . VAL A 1 522 ? 26.967  49.898 59.166 1.00 30.58 ? 522  VAL A CG1 1 
ATOM   4063 C CG2 . VAL A 1 522 ? 27.121  52.078 57.884 1.00 30.46 ? 522  VAL A CG2 1 
ATOM   4064 N N   . PHE A 1 523 ? 24.565  51.388 61.685 1.00 29.57 ? 523  PHE A N   1 
ATOM   4065 C CA  . PHE A 1 523 ? 24.014  50.694 62.837 1.00 29.47 ? 523  PHE A CA  1 
ATOM   4066 C C   . PHE A 1 523 ? 22.505  50.398 62.674 1.00 29.30 ? 523  PHE A C   1 
ATOM   4067 O O   . PHE A 1 523 ? 22.081  49.268 62.801 1.00 29.08 ? 523  PHE A O   1 
ATOM   4068 C CB  . PHE A 1 523 ? 24.231  51.499 64.115 1.00 29.03 ? 523  PHE A CB  1 
ATOM   4069 C CG  . PHE A 1 523 ? 23.504  50.941 65.284 1.00 29.44 ? 523  PHE A CG  1 
ATOM   4070 C CD1 . PHE A 1 523 ? 24.058  49.911 66.029 1.00 30.23 ? 523  PHE A CD1 1 
ATOM   4071 C CD2 . PHE A 1 523 ? 22.233  51.414 65.622 1.00 29.83 ? 523  PHE A CD2 1 
ATOM   4072 C CE1 . PHE A 1 523 ? 23.355  49.342 67.109 1.00 30.59 ? 523  PHE A CE1 1 
ATOM   4073 C CE2 . PHE A 1 523 ? 21.512  50.862 66.690 1.00 30.20 ? 523  PHE A CE2 1 
ATOM   4074 C CZ  . PHE A 1 523 ? 22.084  49.811 67.443 1.00 30.79 ? 523  PHE A CZ  1 
ATOM   4075 N N   . TRP A 1 524 ? 21.714  51.426 62.394 1.00 29.43 ? 524  TRP A N   1 
ATOM   4076 C CA  . TRP A 1 524 ? 20.264  51.283 62.207 1.00 29.80 ? 524  TRP A CA  1 
ATOM   4077 C C   . TRP A 1 524 ? 19.816  50.577 60.941 1.00 30.22 ? 524  TRP A C   1 
ATOM   4078 O O   . TRP A 1 524 ? 18.807  49.906 60.948 1.00 30.59 ? 524  TRP A O   1 
ATOM   4079 C CB  . TRP A 1 524 ? 19.562  52.664 62.246 1.00 28.60 ? 524  TRP A CB  1 
ATOM   4080 C CG  . TRP A 1 524 ? 19.653  53.334 63.590 1.00 27.75 ? 524  TRP A CG  1 
ATOM   4081 C CD1 . TRP A 1 524 ? 20.486  54.365 63.938 1.00 27.12 ? 524  TRP A CD1 1 
ATOM   4082 C CD2 . TRP A 1 524 ? 18.917  52.994 64.769 1.00 27.10 ? 524  TRP A CD2 1 
ATOM   4083 N NE1 . TRP A 1 524 ? 20.312  54.688 65.244 1.00 26.67 ? 524  TRP A NE1 1 
ATOM   4084 C CE2 . TRP A 1 524 ? 19.359  53.860 65.790 1.00 27.04 ? 524  TRP A CE2 1 
ATOM   4085 C CE3 . TRP A 1 524 ? 17.932  52.041 65.068 1.00 26.81 ? 524  TRP A CE3 1 
ATOM   4086 C CZ2 . TRP A 1 524 ? 18.846  53.796 67.099 1.00 26.27 ? 524  TRP A CZ2 1 
ATOM   4087 C CZ3 . TRP A 1 524 ? 17.422  51.979 66.356 1.00 26.23 ? 524  TRP A CZ3 1 
ATOM   4088 C CH2 . TRP A 1 524 ? 17.883  52.851 67.361 1.00 26.14 ? 524  TRP A CH2 1 
ATOM   4089 N N   . ASN A 1 525 ? 20.561  50.702 59.856 1.00 31.24 ? 525  ASN A N   1 
ATOM   4090 C CA  . ASN A 1 525 ? 20.115  50.083 58.610 1.00 32.16 ? 525  ASN A CA  1 
ATOM   4091 C C   . ASN A 1 525 ? 20.732  48.739 58.283 1.00 32.95 ? 525  ASN A C   1 
ATOM   4092 O O   . ASN A 1 525 ? 20.201  48.010 57.465 1.00 32.55 ? 525  ASN A O   1 
ATOM   4093 C CB  . ASN A 1 525 ? 20.355  51.010 57.420 1.00 31.82 ? 525  ASN A CB  1 
ATOM   4094 C CG  . ASN A 1 525 ? 19.654  52.355 57.567 1.00 32.34 ? 525  ASN A CG  1 
ATOM   4095 O OD1 . ASN A 1 525 ? 18.632  52.470 58.263 1.00 32.70 ? 525  ASN A OD1 1 
ATOM   4096 N ND2 . ASN A 1 525 ? 20.193  53.376 56.910 1.00 31.95 ? 525  ASN A ND2 1 
ATOM   4097 N N   . GLN A 1 526 ? 21.858  48.420 58.899 1.00 33.55 ? 526  GLN A N   1 
ATOM   4098 C CA  . GLN A 1 526 ? 22.509  47.159 58.609 1.00 34.12 ? 526  GLN A CA  1 
ATOM   4099 C C   . GLN A 1 526 ? 22.666  46.275 59.838 1.00 34.25 ? 526  GLN A C   1 
ATOM   4100 O O   . GLN A 1 526 ? 22.090  45.199 59.880 1.00 34.79 ? 526  GLN A O   1 
ATOM   4101 C CB  . GLN A 1 526 ? 23.864  47.402 57.952 1.00 34.27 ? 526  GLN A CB  1 
ATOM   4102 C CG  . GLN A 1 526 ? 23.745  47.976 56.524 1.00 36.24 ? 526  GLN A CG  1 
ATOM   4103 C CD  . GLN A 1 526 ? 25.136  48.292 55.873 1.00 37.07 ? 526  GLN A CD  1 
ATOM   4104 N N   . PHE A 1 527 ? 23.385  46.729 60.867 1.00 34.09 ? 527  PHE A N   1 
ATOM   4105 C CA  . PHE A 1 527 ? 23.594  45.878 62.023 1.00 33.80 ? 527  PHE A CA  1 
ATOM   4106 C C   . PHE A 1 527 ? 22.384  45.539 62.888 1.00 34.26 ? 527  PHE A C   1 
ATOM   4107 O O   . PHE A 1 527 ? 22.101  44.362 63.122 1.00 34.39 ? 527  PHE A O   1 
ATOM   4108 C CB  . PHE A 1 527 ? 24.692  46.446 62.916 1.00 32.71 ? 527  PHE A CB  1 
ATOM   4109 C CG  . PHE A 1 527 ? 25.018  45.560 64.089 1.00 32.14 ? 527  PHE A CG  1 
ATOM   4110 C CD1 . PHE A 1 527 ? 25.780  44.396 63.907 1.00 32.03 ? 527  PHE A CD1 1 
ATOM   4111 C CD2 . PHE A 1 527 ? 24.552  45.873 65.365 1.00 32.24 ? 527  PHE A CD2 1 
ATOM   4112 C CE1 . PHE A 1 527 ? 26.078  43.560 64.944 1.00 31.44 ? 527  PHE A CE1 1 
ATOM   4113 C CE2 . PHE A 1 527 ? 24.837  45.042 66.442 1.00 32.32 ? 527  PHE A CE2 1 
ATOM   4114 C CZ  . PHE A 1 527 ? 25.613  43.865 66.228 1.00 32.36 ? 527  PHE A CZ  1 
ATOM   4115 N N   . LEU A 1 528 ? 21.663  46.541 63.374 1.00 34.64 ? 528  LEU A N   1 
ATOM   4116 C CA  . LEU A 1 528 ? 20.537  46.238 64.248 1.00 35.38 ? 528  LEU A CA  1 
ATOM   4117 C C   . LEU A 1 528 ? 19.480  45.285 63.644 1.00 36.48 ? 528  LEU A C   1 
ATOM   4118 O O   . LEU A 1 528 ? 18.995  44.373 64.326 1.00 36.80 ? 528  LEU A O   1 
ATOM   4119 C CB  . LEU A 1 528 ? 19.875  47.531 64.751 1.00 34.19 ? 528  LEU A CB  1 
ATOM   4120 C CG  . LEU A 1 528 ? 18.741  47.277 65.742 1.00 34.30 ? 528  LEU A CG  1 
ATOM   4121 C CD1 . LEU A 1 528 ? 19.271  46.378 66.903 1.00 34.31 ? 528  LEU A CD1 1 
ATOM   4122 C CD2 . LEU A 1 528 ? 18.154  48.614 66.277 1.00 33.71 ? 528  LEU A CD2 1 
ATOM   4123 N N   . PRO A 1 529 ? 19.068  45.514 62.391 1.00 37.40 ? 529  PRO A N   1 
ATOM   4124 C CA  . PRO A 1 529 ? 18.069  44.608 61.803 1.00 38.74 ? 529  PRO A CA  1 
ATOM   4125 C C   . PRO A 1 529 ? 18.661  43.187 61.709 1.00 39.75 ? 529  PRO A C   1 
ATOM   4126 O O   . PRO A 1 529 ? 17.974  42.200 61.980 1.00 40.32 ? 529  PRO A O   1 
ATOM   4127 C CB  . PRO A 1 529 ? 17.795  45.218 60.412 1.00 38.27 ? 529  PRO A CB  1 
ATOM   4128 C CG  . PRO A 1 529 ? 18.191  46.660 60.565 1.00 38.09 ? 529  PRO A CG  1 
ATOM   4129 C CD  . PRO A 1 529 ? 19.411  46.607 61.468 1.00 37.53 ? 529  PRO A CD  1 
ATOM   4130 N N   . LYS A 1 530 ? 19.928  43.069 61.323 1.00 41.00 ? 530  LYS A N   1 
ATOM   4131 C CA  . LYS A 1 530 ? 20.563  41.739 61.274 1.00 42.48 ? 530  LYS A CA  1 
ATOM   4132 C C   . LYS A 1 530 ? 20.537  41.133 62.714 1.00 42.90 ? 530  LYS A C   1 
ATOM   4133 O O   . LYS A 1 530 ? 20.198  39.966 62.924 1.00 42.58 ? 530  LYS A O   1 
ATOM   4134 C CB  . LYS A 1 530 ? 22.000  41.858 60.747 1.00 43.39 ? 530  LYS A CB  1 
ATOM   4135 C CG  . LYS A 1 530 ? 22.697  40.528 60.606 1.00 44.97 ? 530  LYS A CG  1 
ATOM   4136 C CD  . LYS A 1 530 ? 23.993  40.559 59.760 1.00 45.97 ? 530  LYS A CD  1 
ATOM   4137 C CE  . LYS A 1 530 ? 24.614  39.135 59.718 1.00 46.76 ? 530  LYS A CE  1 
ATOM   4138 N NZ  . LYS A 1 530 ? 25.884  38.993 58.911 1.00 47.52 ? 530  LYS A NZ  1 
ATOM   4139 N N   . LEU A 1 531 ? 20.834  41.956 63.709 1.00 43.25 ? 531  LEU A N   1 
ATOM   4140 C CA  . LEU A 1 531 ? 20.813  41.479 65.064 1.00 44.16 ? 531  LEU A CA  1 
ATOM   4141 C C   . LEU A 1 531 ? 19.417  41.015 65.527 1.00 45.11 ? 531  LEU A C   1 
ATOM   4142 O O   . LEU A 1 531 ? 19.277  39.945 66.104 1.00 44.54 ? 531  LEU A O   1 
ATOM   4143 C CB  . LEU A 1 531 ? 21.362  42.574 65.984 1.00 43.86 ? 531  LEU A CB  1 
ATOM   4144 C CG  . LEU A 1 531 ? 21.174  42.382 67.481 1.00 43.76 ? 531  LEU A CG  1 
ATOM   4145 C CD1 . LEU A 1 531 ? 21.355  40.924 67.772 1.00 44.89 ? 531  LEU A CD1 1 
ATOM   4146 C CD2 . LEU A 1 531 ? 22.176  43.183 68.271 1.00 43.95 ? 531  LEU A CD2 1 
ATOM   4147 N N   . LEU A 1 532 ? 18.383  41.810 65.284 1.00 46.57 ? 532  LEU A N   1 
ATOM   4148 C CA  . LEU A 1 532 ? 17.038  41.427 65.735 1.00 48.22 ? 532  LEU A CA  1 
ATOM   4149 C C   . LEU A 1 532 ? 16.522  40.196 64.993 1.00 49.58 ? 532  LEU A C   1 
ATOM   4150 O O   . LEU A 1 532 ? 15.764  39.429 65.551 1.00 49.64 ? 532  LEU A O   1 
ATOM   4151 C CB  . LEU A 1 532 ? 16.050  42.587 65.578 1.00 47.77 ? 532  LEU A CB  1 
ATOM   4152 C CG  . LEU A 1 532 ? 16.335  43.837 66.422 1.00 47.62 ? 532  LEU A CG  1 
ATOM   4153 C CD1 . LEU A 1 532 ? 15.491  44.993 65.916 1.00 47.34 ? 532  LEU A CD1 1 
ATOM   4154 C CD2 . LEU A 1 532 ? 16.091  43.553 67.886 1.00 47.08 ? 532  LEU A CD2 1 
ATOM   4155 N N   . ASN A 1 533 ? 16.948  40.002 63.749 1.00 51.35 ? 533  ASN A N   1 
ATOM   4156 C CA  . ASN A 1 533 ? 16.531  38.830 62.991 1.00 53.31 ? 533  ASN A CA  1 
ATOM   4157 C C   . ASN A 1 533 ? 17.215  37.532 63.460 1.00 54.55 ? 533  ASN A C   1 
ATOM   4158 O O   . ASN A 1 533 ? 16.674  36.438 63.280 1.00 54.61 ? 533  ASN A O   1 
ATOM   4159 C CB  . ASN A 1 533 ? 16.827  38.986 61.493 1.00 53.55 ? 533  ASN A CB  1 
ATOM   4160 C CG  . ASN A 1 533 ? 16.243  37.822 60.660 1.00 54.28 ? 533  ASN A CG  1 
ATOM   4161 O OD1 . ASN A 1 533 ? 15.021  37.620 60.627 1.00 54.83 ? 533  ASN A OD1 1 
ATOM   4162 N ND2 . ASN A 1 533 ? 17.107  37.054 60.008 1.00 54.36 ? 533  ASN A ND2 1 
ATOM   4163 N N   . ALA A 1 534 ? 18.406  37.630 64.036 1.00 55.79 ? 534  ALA A N   1 
ATOM   4164 C CA  . ALA A 1 534 ? 19.083  36.420 64.451 1.00 57.17 ? 534  ALA A CA  1 
ATOM   4165 C C   . ALA A 1 534 ? 18.669  36.035 65.855 1.00 58.35 ? 534  ALA A C   1 
ATOM   4166 O O   . ALA A 1 534 ? 18.689  34.864 66.219 1.00 58.83 ? 534  ALA A O   1 
ATOM   4167 C CB  . ALA A 1 534 ? 20.578  36.608 64.380 1.00 57.07 ? 534  ALA A CB  1 
ATOM   4168 N N   . THR A 1 535 ? 18.276  37.022 66.646 1.00 59.47 ? 535  THR A N   1 
ATOM   4169 C CA  . THR A 1 535 ? 17.878  36.763 68.024 1.00 60.38 ? 535  THR A CA  1 
ATOM   4170 C C   . THR A 1 535 ? 16.380  36.823 68.162 1.00 60.70 ? 535  THR A C   1 
ATOM   4171 O O   . THR A 1 535 ? 15.780  36.169 67.284 1.00 61.41 ? 535  THR A O   1 
ATOM   4172 C CB  . THR A 1 535 ? 18.519  37.784 68.975 1.00 60.82 ? 535  THR A CB  1 
ATOM   4173 O OG1 . THR A 1 535 ? 18.446  39.086 68.383 1.00 61.03 ? 535  THR A OG1 1 
ATOM   4174 C CG2 . THR A 1 535 ? 19.994  37.426 69.228 1.00 61.29 ? 535  THR A CG2 1 
HETATM 4175 C C1  . NAG B 2 .   ? 18.866  61.990 33.562 1.00 42.66 ? 544  NAG A C1  1 
HETATM 4176 C C2  . NAG B 2 .   ? 20.365  61.799 33.561 1.00 43.59 ? 544  NAG A C2  1 
HETATM 4177 C C3  . NAG B 2 .   ? 21.016  62.281 32.259 1.00 44.81 ? 544  NAG A C3  1 
HETATM 4178 C C4  . NAG B 2 .   ? 20.232  61.812 31.006 1.00 45.28 ? 544  NAG A C4  1 
HETATM 4179 C C5  . NAG B 2 .   ? 18.754  62.114 31.181 1.00 45.07 ? 544  NAG A C5  1 
HETATM 4180 C C6  . NAG B 2 .   ? 17.890  61.644 29.987 1.00 45.40 ? 544  NAG A C6  1 
HETATM 4181 C C7  . NAG B 2 .   ? 21.318  61.944 35.764 1.00 43.18 ? 544  NAG A C7  1 
HETATM 4182 C C8  . NAG B 2 .   ? 21.887  62.805 36.883 1.00 43.01 ? 544  NAG A C8  1 
HETATM 4183 N N2  . NAG B 2 .   ? 20.918  62.559 34.661 1.00 43.51 ? 544  NAG A N2  1 
HETATM 4184 O O3  . NAG B 2 .   ? 22.342  61.769 32.213 1.00 45.33 ? 544  NAG A O3  1 
HETATM 4185 O O4  . NAG B 2 .   ? 20.719  62.481 29.849 1.00 46.75 ? 544  NAG A O4  1 
HETATM 4186 O O5  . NAG B 2 .   ? 18.284  61.451 32.377 1.00 43.89 ? 544  NAG A O5  1 
HETATM 4187 O O6  . NAG B 2 .   ? 17.741  60.226 29.929 1.00 45.40 ? 544  NAG A O6  1 
HETATM 4188 O O7  . NAG B 2 .   ? 21.229  60.728 35.906 1.00 43.63 ? 544  NAG A O7  1 
HETATM 4189 C C1  . NAG C 2 .   ? -18.367 83.372 49.499 1.00 53.83 ? 545  NAG A C1  1 
HETATM 4190 C C2  . NAG C 2 .   ? -19.297 84.588 49.533 1.00 55.59 ? 545  NAG A C2  1 
HETATM 4191 C C3  . NAG C 2 .   ? -18.857 85.519 50.677 1.00 56.58 ? 545  NAG A C3  1 
HETATM 4192 C C4  . NAG C 2 .   ? -18.985 84.738 51.991 1.00 57.03 ? 545  NAG A C4  1 
HETATM 4193 C C5  . NAG C 2 .   ? -18.055 83.524 51.920 1.00 56.65 ? 545  NAG A C5  1 
HETATM 4194 C C6  . NAG C 2 .   ? -18.070 82.654 53.195 1.00 56.79 ? 545  NAG A C6  1 
HETATM 4195 C C7  . NAG C 2 .   ? -20.214 84.964 47.326 1.00 56.90 ? 545  NAG A C7  1 
HETATM 4196 C C8  . NAG C 2 .   ? -20.164 85.759 46.026 1.00 56.51 ? 545  NAG A C8  1 
HETATM 4197 N N2  . NAG C 2 .   ? -19.308 85.289 48.256 1.00 56.30 ? 545  NAG A N2  1 
HETATM 4198 O O3  . NAG C 2 .   ? -19.678 86.679 50.702 1.00 57.11 ? 545  NAG A O3  1 
HETATM 4199 O O4  . NAG C 2 .   ? -18.652 85.551 53.114 1.00 58.70 ? 545  NAG A O4  1 
HETATM 4200 O O5  . NAG C 2 .   ? -18.426 82.681 50.775 1.00 55.53 ? 545  NAG A O5  1 
HETATM 4201 O O6  . NAG C 2 .   ? -19.270 82.796 53.954 1.00 56.87 ? 545  NAG A O6  1 
HETATM 4202 O O7  . NAG C 2 .   ? -21.070 84.054 47.477 1.00 57.32 ? 545  NAG A O7  1 
HETATM 4203 X UNK . UNX D 3 .   ? -0.095  61.163 71.959 0.00 15.00 ? 1000 UNX A UNK 1 
HETATM 4204 X UNK . UNX E 3 .   ? -2.980  59.951 73.956 0.00 15.00 ? 1001 UNX A UNK 1 
HETATM 4205 X UNK . UNX F 3 .   ? 3.253   67.233 61.190 0.00 50.64 ? 1002 UNX A UNK 1 
HETATM 4206 X UNK . UNX G 3 .   ? 3.160   66.844 62.611 0.00 51.03 ? 1003 UNX A UNK 1 
HETATM 4207 X UNK . UNX H 3 .   ? 4.130   68.425 61.178 0.00 51.00 ? 1004 UNX A UNK 1 
HETATM 4208 X UNK . UNX I 3 .   ? 4.246   68.905 62.606 0.00 51.21 ? 1005 UNX A UNK 1 
HETATM 4209 X UNK . UNX J 3 .   ? 5.411   69.681 62.909 0.00 50.94 ? 1006 UNX A UNK 1 
HETATM 4210 X UNK . UNX K 3 .   ? 5.661   69.356 64.361 0.00 51.40 ? 1007 UNX A UNK 1 
HETATM 4211 X UNK . UNX L 3 .   ? 4.582   68.478 64.910 0.00 51.38 ? 1008 UNX A UNK 1 
HETATM 4212 X UNK . UNX M 3 .   ? 5.181   67.254 65.458 0.00 51.50 ? 1009 UNX A UNK 1 
HETATM 4213 P P1  . VXA N 4 .   ? 5.405   63.461 61.144 1.00 26.46 ? 1010 VXA A P1  1 
HETATM 4214 O O1  . VXA N 4 .   ? 4.103   63.469 60.421 1.00 25.39 ? 1010 VXA A O1  1 
HETATM 4215 O O2  . VXA N 4 .   ? 5.439   64.499 62.131 1.00 25.69 ? 1010 VXA A O2  1 
HETATM 4216 C C1  . VXA N 4 .   ? 5.697   61.888 61.905 1.00 24.90 ? 1010 VXA A C1  1 
HETATM 4217 O O   . HOH O 5 .   ? 3.787   68.887 57.456 1.00 22.41 ? 600  HOH A O   1 
HETATM 4218 O O   . HOH O 5 .   ? -6.740  61.375 64.822 1.00 25.68 ? 601  HOH A O   1 
HETATM 4219 O O   . HOH O 5 .   ? -4.015  69.931 61.952 1.00 23.65 ? 602  HOH A O   1 
HETATM 4220 O O   . HOH O 5 .   ? -0.684  66.452 39.602 1.00 30.79 ? 603  HOH A O   1 
HETATM 4221 O O   . HOH O 5 .   ? 3.183   54.041 63.232 1.00 25.72 ? 604  HOH A O   1 
HETATM 4222 O O   . HOH O 5 .   ? -14.710 59.669 56.710 1.00 26.92 ? 605  HOH A O   1 
HETATM 4223 O O   . HOH O 5 .   ? 23.241  66.785 47.642 1.00 27.56 ? 606  HOH A O   1 
HETATM 4224 O O   . HOH O 5 .   ? -3.933  56.936 63.492 1.00 29.00 ? 607  HOH A O   1 
HETATM 4225 O O   . HOH O 5 .   ? 4.179   80.491 50.959 1.00 29.54 ? 608  HOH A O   1 
HETATM 4226 O O   . HOH O 5 .   ? 8.003   75.684 60.526 1.00 24.32 ? 609  HOH A O   1 
HETATM 4227 O O   . HOH O 5 .   ? 7.680   63.603 78.703 1.00 30.50 ? 610  HOH A O   1 
HETATM 4228 O O   . HOH O 5 .   ? -0.281  69.302 62.000 1.00 25.17 ? 611  HOH A O   1 
HETATM 4229 O O   . HOH O 5 .   ? -3.550  50.793 59.249 1.00 25.84 ? 612  HOH A O   1 
HETATM 4230 O O   . HOH O 5 .   ? 0.444   77.221 61.740 1.00 28.63 ? 613  HOH A O   1 
HETATM 4231 O O   . HOH O 5 .   ? -4.223  51.773 55.890 1.00 24.69 ? 614  HOH A O   1 
HETATM 4232 O O   . HOH O 5 .   ? 10.618  55.496 68.214 1.00 22.98 ? 615  HOH A O   1 
HETATM 4233 O O   . HOH O 5 .   ? 1.408   43.281 54.614 1.00 34.44 ? 616  HOH A O   1 
HETATM 4234 O O   . HOH O 5 .   ? -7.082  67.774 57.324 1.00 23.92 ? 617  HOH A O   1 
HETATM 4235 O O   . HOH O 5 .   ? 17.921  50.429 44.764 1.00 32.41 ? 618  HOH A O   1 
HETATM 4236 O O   . HOH O 5 .   ? 7.692   70.405 38.904 1.00 34.03 ? 619  HOH A O   1 
HETATM 4237 O O   . HOH O 5 .   ? -3.046  77.070 30.697 1.00 36.68 ? 620  HOH A O   1 
HETATM 4238 O O   . HOH O 5 .   ? -6.424  49.295 60.867 1.00 29.61 ? 621  HOH A O   1 
HETATM 4239 O O   . HOH O 5 .   ? 7.294   52.229 56.188 1.00 23.99 ? 622  HOH A O   1 
HETATM 4240 O O   . HOH O 5 .   ? 18.449  59.988 41.629 1.00 28.80 ? 623  HOH A O   1 
HETATM 4241 O O   . HOH O 5 .   ? 13.542  68.593 56.822 1.00 30.97 ? 624  HOH A O   1 
HETATM 4242 O O   . HOH O 5 .   ? 4.454   66.196 68.996 1.00 54.50 ? 625  HOH A O   1 
HETATM 4243 O O   . HOH O 5 .   ? 21.381  52.040 53.773 1.00 33.76 ? 626  HOH A O   1 
HETATM 4244 O O   . HOH O 5 .   ? 14.247  51.001 55.765 1.00 37.33 ? 627  HOH A O   1 
HETATM 4245 O O   . HOH O 5 .   ? 25.186  61.455 52.471 1.00 23.95 ? 628  HOH A O   1 
HETATM 4246 O O   . HOH O 5 .   ? 19.652  84.328 62.114 1.00 37.32 ? 629  HOH A O   1 
HETATM 4247 O O   . HOH O 5 .   ? 4.235   55.568 77.815 1.00 33.32 ? 630  HOH A O   1 
HETATM 4248 O O   . HOH O 5 .   ? -1.002  50.888 41.940 1.00 39.49 ? 631  HOH A O   1 
HETATM 4249 O O   . HOH O 5 .   ? -4.162  70.520 33.594 1.00 25.51 ? 632  HOH A O   1 
HETATM 4250 O O   . HOH O 5 .   ? -15.234 66.256 51.332 1.00 29.24 ? 633  HOH A O   1 
HETATM 4251 O O   . HOH O 5 .   ? -20.083 59.354 58.816 1.00 37.16 ? 634  HOH A O   1 
HETATM 4252 O O   . HOH O 5 .   ? -12.006 66.974 36.803 1.00 36.30 ? 635  HOH A O   1 
HETATM 4253 O O   . HOH O 5 .   ? 5.517   47.674 75.180 1.00 37.82 ? 636  HOH A O   1 
HETATM 4254 O O   . HOH O 5 .   ? 12.100  67.471 67.117 1.00 28.57 ? 637  HOH A O   1 
HETATM 4255 O O   . HOH O 5 .   ? 3.505   50.429 69.223 1.00 27.85 ? 638  HOH A O   1 
HETATM 4256 O O   . HOH O 5 .   ? -9.024  58.221 64.117 1.00 28.45 ? 639  HOH A O   1 
HETATM 4257 O O   . HOH O 5 .   ? -5.699  44.938 57.004 1.00 33.99 ? 640  HOH A O   1 
HETATM 4258 O O   . HOH O 5 .   ? 27.603  63.054 45.601 1.00 35.85 ? 641  HOH A O   1 
HETATM 4259 O O   . HOH O 5 .   ? 4.074   56.146 70.015 1.00 37.46 ? 642  HOH A O   1 
HETATM 4260 O O   . HOH O 5 .   ? 7.346   46.740 53.494 1.00 31.83 ? 643  HOH A O   1 
HETATM 4261 O O   . HOH O 5 .   ? 22.601  79.158 61.236 1.00 34.36 ? 644  HOH A O   1 
HETATM 4262 O O   . HOH O 5 .   ? 15.989  80.108 69.270 1.00 32.33 ? 645  HOH A O   1 
HETATM 4263 O O   . HOH O 5 .   ? -1.794  57.544 62.122 1.00 23.02 ? 646  HOH A O   1 
HETATM 4264 O O   . HOH O 5 .   ? -7.437  70.325 55.942 1.00 28.70 ? 647  HOH A O   1 
HETATM 4265 O O   . HOH O 5 .   ? -13.536 62.300 56.448 1.00 32.03 ? 648  HOH A O   1 
HETATM 4266 O O   . HOH O 5 .   ? 25.322  58.717 52.147 1.00 34.05 ? 649  HOH A O   1 
HETATM 4267 O O   . HOH O 5 .   ? -2.385  57.421 66.300 1.00 33.47 ? 650  HOH A O   1 
HETATM 4268 O O   . HOH O 5 .   ? -13.341 57.706 55.905 1.00 32.13 ? 651  HOH A O   1 
HETATM 4269 O O   . HOH O 5 .   ? -15.198 67.367 48.801 1.00 26.27 ? 652  HOH A O   1 
HETATM 4270 O O   . HOH O 5 .   ? -1.366  69.496 52.218 1.00 23.83 ? 653  HOH A O   1 
HETATM 4271 O O   . HOH O 5 .   ? 25.428  66.483 74.040 1.00 37.79 ? 654  HOH A O   1 
HETATM 4272 O O   . HOH O 5 .   ? 5.073   59.631 69.535 1.00 29.39 ? 655  HOH A O   1 
HETATM 4273 O O   . HOH O 5 .   ? 26.713  59.001 62.579 1.00 26.93 ? 656  HOH A O   1 
HETATM 4274 O O   . HOH O 5 .   ? 3.483   45.874 60.898 1.00 26.73 ? 657  HOH A O   1 
HETATM 4275 O O   . HOH O 5 .   ? 9.701   56.121 35.843 1.00 30.25 ? 658  HOH A O   1 
HETATM 4276 O O   . HOH O 5 .   ? -6.261  83.637 38.453 1.00 33.77 ? 659  HOH A O   1 
HETATM 4277 O O   . HOH O 5 .   ? -20.249 74.900 37.136 1.00 36.13 ? 660  HOH A O   1 
HETATM 4278 O O   . HOH O 5 .   ? 0.324   70.187 67.845 1.00 30.43 ? 661  HOH A O   1 
HETATM 4279 O O   . HOH O 5 .   ? 15.806  52.950 61.203 1.00 29.91 ? 662  HOH A O   1 
HETATM 4280 O O   . HOH O 5 .   ? 21.320  82.142 53.319 1.00 43.21 ? 663  HOH A O   1 
HETATM 4281 O O   . HOH O 5 .   ? -9.667  62.108 59.342 1.00 31.30 ? 664  HOH A O   1 
HETATM 4282 O O   . HOH O 5 .   ? 10.000  79.922 64.687 1.00 31.90 ? 665  HOH A O   1 
HETATM 4283 O O   . HOH O 5 .   ? -6.005  58.425 39.616 1.00 34.76 ? 666  HOH A O   1 
HETATM 4284 O O   . HOH O 5 .   ? 3.452   51.315 64.017 1.00 32.52 ? 667  HOH A O   1 
HETATM 4285 O O   . HOH O 5 .   ? -15.476 60.176 48.377 1.00 37.20 ? 668  HOH A O   1 
HETATM 4286 O O   . HOH O 5 .   ? -3.958  83.057 51.519 1.00 43.66 ? 669  HOH A O   1 
HETATM 4287 O O   . HOH O 5 .   ? 12.902  83.388 47.153 1.00 36.06 ? 670  HOH A O   1 
HETATM 4288 O O   . HOH O 5 .   ? 3.143   62.820 69.633 1.00 47.10 ? 671  HOH A O   1 
HETATM 4289 O O   . HOH O 5 .   ? 4.514   49.883 66.588 1.00 31.68 ? 672  HOH A O   1 
HETATM 4290 O O   . HOH O 5 .   ? 3.844   80.817 32.025 1.00 46.74 ? 673  HOH A O   1 
HETATM 4291 O O   . HOH O 5 .   ? -13.449 40.593 61.888 1.00 44.65 ? 674  HOH A O   1 
HETATM 4292 O O   . HOH O 5 .   ? 2.798   54.067 36.285 1.00 32.62 ? 675  HOH A O   1 
HETATM 4293 O O   . HOH O 5 .   ? 23.144  54.745 55.030 1.00 46.03 ? 676  HOH A O   1 
HETATM 4294 O O   . HOH O 5 .   ? -20.087 56.776 59.078 1.00 34.30 ? 677  HOH A O   1 
HETATM 4295 O O   . HOH O 5 .   ? -21.950 46.421 66.821 1.00 39.41 ? 678  HOH A O   1 
HETATM 4296 O O   . HOH O 5 .   ? 23.183  77.051 53.888 1.00 50.39 ? 679  HOH A O   1 
HETATM 4297 O O   . HOH O 5 .   ? 13.353  59.132 78.690 1.00 36.09 ? 680  HOH A O   1 
HETATM 4298 O O   . HOH O 5 .   ? -3.564  51.523 43.767 1.00 37.29 ? 681  HOH A O   1 
HETATM 4299 O O   . HOH O 5 .   ? 9.830   74.169 33.310 1.00 53.73 ? 682  HOH A O   1 
HETATM 4300 O O   . HOH O 5 .   ? -10.058 51.763 54.250 1.00 36.80 ? 683  HOH A O   1 
HETATM 4301 O O   . HOH O 5 .   ? 11.850  61.761 85.899 1.00 51.73 ? 684  HOH A O   1 
HETATM 4302 O O   . HOH O 5 .   ? 5.743   57.512 35.662 1.00 44.50 ? 685  HOH A O   1 
HETATM 4303 O O   . HOH O 5 .   ? 11.272  77.369 83.720 1.00 48.21 ? 686  HOH A O   1 
HETATM 4304 O O   . HOH O 5 .   ? -17.966 65.326 60.873 1.00 34.63 ? 687  HOH A O   1 
HETATM 4305 O O   . HOH O 5 .   ? -0.083  67.504 63.896 1.00 34.04 ? 688  HOH A O   1 
HETATM 4306 O O   . HOH O 5 .   ? -17.975 68.419 48.449 1.00 33.89 ? 689  HOH A O   1 
HETATM 4307 O O   . HOH O 5 .   ? -2.430  77.787 61.968 1.00 36.07 ? 690  HOH A O   1 
HETATM 4308 O O   . HOH O 5 .   ? 8.542   79.883 37.548 1.00 46.86 ? 691  HOH A O   1 
HETATM 4309 O O   . HOH O 5 .   ? 6.470   48.122 55.577 1.00 32.71 ? 692  HOH A O   1 
HETATM 4310 O O   . HOH O 5 .   ? 17.072  63.938 66.630 1.00 32.11 ? 693  HOH A O   1 
HETATM 4311 O O   . HOH O 5 .   ? 24.611  73.035 38.870 1.00 47.86 ? 694  HOH A O   1 
HETATM 4312 O O   . HOH O 5 .   ? -10.518 65.607 68.254 1.00 30.29 ? 695  HOH A O   1 
HETATM 4313 O O   . HOH O 5 .   ? -8.826  60.909 63.103 1.00 28.86 ? 696  HOH A O   1 
HETATM 4314 O O   . HOH O 5 .   ? 20.003  62.664 65.042 1.00 31.32 ? 697  HOH A O   1 
HETATM 4315 O O   . HOH O 5 .   ? -3.714  50.030 61.756 1.00 36.76 ? 698  HOH A O   1 
HETATM 4316 O O   . HOH O 5 .   ? 3.571   47.454 64.921 1.00 32.74 ? 699  HOH A O   1 
HETATM 4317 O O   . HOH O 5 .   ? 7.304   49.121 66.046 1.00 37.04 ? 700  HOH A O   1 
HETATM 4318 O O   . HOH O 5 .   ? -9.332  44.803 50.855 1.00 43.39 ? 701  HOH A O   1 
HETATM 4319 O O   . HOH O 5 .   ? -1.290  71.906 72.922 1.00 42.48 ? 702  HOH A O   1 
HETATM 4320 O O   . HOH O 5 .   ? -21.743 58.963 62.050 1.00 54.53 ? 703  HOH A O   1 
HETATM 4321 O O   . HOH O 5 .   ? 18.490  54.207 35.794 1.00 43.29 ? 704  HOH A O   1 
HETATM 4322 O O   . HOH O 5 .   ? 8.078   49.565 37.372 1.00 51.12 ? 705  HOH A O   1 
HETATM 4323 O O   . HOH O 5 .   ? -12.258 64.578 41.224 1.00 33.48 ? 706  HOH A O   1 
HETATM 4324 O O   . HOH O 5 .   ? 4.687   57.513 75.721 1.00 41.36 ? 707  HOH A O   1 
HETATM 4325 O O   . HOH O 5 .   ? -0.747  65.232 72.460 1.00 36.51 ? 708  HOH A O   1 
HETATM 4326 O O   . HOH O 5 .   ? -4.407  40.306 62.479 1.00 40.81 ? 709  HOH A O   1 
HETATM 4327 O O   . HOH O 5 .   ? 21.240  71.173 67.903 1.00 38.05 ? 710  HOH A O   1 
HETATM 4328 O O   . HOH O 5 .   ? 18.512  67.311 72.679 1.00 35.06 ? 711  HOH A O   1 
HETATM 4329 O O   . HOH O 5 .   ? 14.986  77.444 76.510 1.00 36.17 ? 712  HOH A O   1 
HETATM 4330 O O   . HOH O 5 .   ? -0.652  63.143 58.641 1.00 24.49 ? 713  HOH A O   1 
HETATM 4331 O O   . HOH O 5 .   ? -4.114  85.232 39.028 1.00 30.75 ? 714  HOH A O   1 
HETATM 4332 O O   . HOH O 5 .   ? 0.006   69.220 59.124 1.00 27.86 ? 715  HOH A O   1 
HETATM 4333 O O   . HOH O 5 .   ? 10.647  68.459 59.495 1.00 30.70 ? 716  HOH A O   1 
HETATM 4334 O O   . HOH O 5 .   ? 4.782   50.435 61.816 1.00 26.21 ? 717  HOH A O   1 
HETATM 4335 O O   . HOH O 5 .   ? 3.328   64.244 64.994 1.00 43.96 ? 718  HOH A O   1 
HETATM 4336 O O   . HOH O 5 .   ? -1.727  75.291 52.344 1.00 30.67 ? 719  HOH A O   1 
HETATM 4337 O O   . HOH O 5 .   ? -12.309 62.974 58.763 1.00 28.90 ? 720  HOH A O   1 
HETATM 4338 O O   . HOH O 5 .   ? -10.007 65.118 37.873 1.00 28.63 ? 721  HOH A O   1 
HETATM 4339 O O   . HOH O 5 .   ? -10.310 81.207 54.805 1.00 41.02 ? 722  HOH A O   1 
HETATM 4340 O O   . HOH O 5 .   ? -9.584  69.987 54.155 1.00 35.08 ? 723  HOH A O   1 
HETATM 4341 O O   . HOH O 5 .   ? -1.177  68.383 66.268 1.00 37.54 ? 724  HOH A O   1 
HETATM 4342 O O   . HOH O 5 .   ? 0.460   40.515 56.922 1.00 38.18 ? 725  HOH A O   1 
HETATM 4343 O O   . HOH O 5 .   ? 13.658  86.069 46.879 1.00 44.93 ? 726  HOH A O   1 
HETATM 4344 O O   . HOH O 5 .   ? -7.714  59.038 41.652 1.00 29.56 ? 727  HOH A O   1 
HETATM 4345 O O   . HOH O 5 .   ? 3.190   68.494 66.554 1.00 43.39 ? 728  HOH A O   1 
HETATM 4346 O O   . HOH O 5 .   ? -6.819  48.573 73.601 1.00 38.52 ? 729  HOH A O   1 
HETATM 4347 O O   . HOH O 5 .   ? 4.876   47.673 62.762 1.00 37.35 ? 730  HOH A O   1 
HETATM 4348 O O   . HOH O 5 .   ? 11.419  64.629 35.164 1.00 42.71 ? 731  HOH A O   1 
HETATM 4349 O O   . HOH O 5 .   ? 19.159  84.809 49.877 1.00 33.35 ? 732  HOH A O   1 
HETATM 4350 O O   . HOH O 5 .   ? 11.650  70.203 33.633 1.00 41.55 ? 733  HOH A O   1 
HETATM 4351 O O   . HOH O 5 .   ? -3.251  75.937 63.983 1.00 36.92 ? 734  HOH A O   1 
HETATM 4352 O O   . HOH O 5 .   ? 9.746   46.429 53.202 1.00 31.08 ? 735  HOH A O   1 
HETATM 4353 O O   . HOH O 5 .   ? 4.039   43.543 55.417 1.00 28.88 ? 736  HOH A O   1 
HETATM 4354 O O   . HOH O 5 .   ? -7.085  50.394 49.294 1.00 37.14 ? 737  HOH A O   1 
HETATM 4355 O O   . HOH O 5 .   ? 18.052  74.788 37.230 1.00 34.73 ? 738  HOH A O   1 
HETATM 4356 O O   . HOH O 5 .   ? 8.310   76.651 75.682 1.00 36.19 ? 739  HOH A O   1 
HETATM 4357 O O   . HOH O 5 .   ? 22.158  61.664 41.816 1.00 30.02 ? 740  HOH A O   1 
HETATM 4358 O O   . HOH O 5 .   ? -3.148  66.634 73.921 1.00 43.65 ? 741  HOH A O   1 
HETATM 4359 O O   . HOH O 5 .   ? 4.998   46.500 40.201 1.00 38.28 ? 742  HOH A O   1 
HETATM 4360 O O   . HOH O 5 .   ? -4.793  87.722 34.579 1.00 44.23 ? 743  HOH A O   1 
HETATM 4361 O O   . HOH O 5 .   ? 3.723   66.662 36.256 1.00 25.21 ? 744  HOH A O   1 
HETATM 4362 O O   . HOH O 5 .   ? 25.194  58.070 55.092 1.00 39.77 ? 745  HOH A O   1 
HETATM 4363 O O   . HOH O 5 .   ? 17.774  39.529 74.013 1.00 46.83 ? 746  HOH A O   1 
HETATM 4364 O O   . HOH O 5 .   ? -15.385 74.613 50.193 1.00 43.05 ? 747  HOH A O   1 
HETATM 4365 O O   . HOH O 5 .   ? 14.219  76.461 63.041 1.00 37.64 ? 748  HOH A O   1 
HETATM 4366 O O   . HOH O 5 .   ? -7.922  71.335 52.176 1.00 33.24 ? 749  HOH A O   1 
HETATM 4367 O O   . HOH O 5 .   ? 14.024  39.740 75.150 1.00 39.95 ? 750  HOH A O   1 
HETATM 4368 O O   . HOH O 5 .   ? 9.329   88.149 47.719 1.00 44.79 ? 751  HOH A O   1 
HETATM 4369 O O   . HOH O 5 .   ? 16.557  74.005 77.267 1.00 36.04 ? 752  HOH A O   1 
HETATM 4370 O O   . HOH O 5 .   ? 23.673  70.153 73.537 1.00 40.13 ? 753  HOH A O   1 
HETATM 4371 O O   . HOH O 5 .   ? -14.411 71.511 65.282 1.00 43.32 ? 754  HOH A O   1 
HETATM 4372 O O   . HOH O 5 .   ? -14.430 76.520 60.089 1.00 40.05 ? 755  HOH A O   1 
HETATM 4373 O O   . HOH O 5 .   ? 11.627  86.622 44.062 1.00 47.27 ? 756  HOH A O   1 
HETATM 4374 O O   . HOH O 5 .   ? 9.249   44.741 43.301 1.00 44.89 ? 757  HOH A O   1 
HETATM 4375 O O   . HOH O 5 .   ? 24.317  66.305 84.248 1.00 46.37 ? 758  HOH A O   1 
HETATM 4376 O O   . HOH O 5 .   ? 13.205  49.635 53.510 1.00 42.47 ? 759  HOH A O   1 
HETATM 4377 O O   . HOH O 5 .   ? -10.110 55.898 44.656 1.00 40.49 ? 760  HOH A O   1 
HETATM 4378 O O   . HOH O 5 .   ? 26.852  68.765 59.063 1.00 46.27 ? 761  HOH A O   1 
HETATM 4379 O O   . HOH O 5 .   ? -4.825  50.779 45.791 1.00 48.20 ? 762  HOH A O   1 
HETATM 4380 O O   . HOH O 5 .   ? 22.447  59.401 85.807 1.00 46.71 ? 763  HOH A O   1 
HETATM 4381 O O   . HOH O 5 .   ? 21.413  77.639 64.428 1.00 41.80 ? 764  HOH A O   1 
HETATM 4382 O O   . HOH O 5 .   ? -19.343 63.011 60.578 1.00 44.62 ? 765  HOH A O   1 
HETATM 4383 O O   . HOH O 5 .   ? 20.792  72.445 78.381 1.00 43.89 ? 766  HOH A O   1 
HETATM 4384 O O   . HOH O 5 .   ? 7.335   65.115 80.891 1.00 47.80 ? 767  HOH A O   1 
HETATM 4385 O O   . HOH O 5 .   ? -6.823  56.539 73.301 1.00 49.67 ? 768  HOH A O   1 
HETATM 4386 O O   . HOH O 5 .   ? 14.564  48.406 63.808 1.00 46.77 ? 769  HOH A O   1 
HETATM 4387 O O   . HOH O 5 .   ? 24.884  80.291 50.521 1.00 47.08 ? 770  HOH A O   1 
HETATM 4388 O O   . HOH O 5 .   ? 13.527  84.595 43.378 1.00 44.08 ? 771  HOH A O   1 
HETATM 4389 O O   . HOH O 5 .   ? -6.486  88.361 41.931 1.00 42.55 ? 772  HOH A O   1 
HETATM 4390 O O   . HOH O 5 .   ? -0.769  57.903 32.885 1.00 38.64 ? 773  HOH A O   1 
HETATM 4391 O O   . HOH O 5 .   ? 5.627   61.066 71.722 1.00 39.40 ? 774  HOH A O   1 
HETATM 4392 O O   . HOH O 5 .   ? 19.544  67.518 38.303 1.00 41.27 ? 775  HOH A O   1 
HETATM 4393 O O   . HOH O 5 .   ? -8.647  65.102 70.244 1.00 38.57 ? 776  HOH A O   1 
HETATM 4394 O O   . HOH O 5 .   ? 29.985  52.285 65.210 1.00 52.13 ? 777  HOH A O   1 
HETATM 4395 O O   . HOH O 5 .   ? -15.270 72.596 53.811 1.00 42.43 ? 778  HOH A O   1 
HETATM 4396 O O   . HOH O 5 .   ? -19.248 82.582 33.749 1.00 56.14 ? 779  HOH A O   1 
HETATM 4397 O O   . HOH O 5 .   ? 16.069  86.340 46.533 1.00 38.58 ? 780  HOH A O   1 
HETATM 4398 O O   . HOH O 5 .   ? 16.164  62.043 84.329 1.00 40.03 ? 781  HOH A O   1 
HETATM 4399 O O   . HOH O 5 .   ? 12.056  67.435 82.935 1.00 30.01 ? 782  HOH A O   1 
HETATM 4400 O O   . HOH O 5 .   ? 16.232  52.825 58.968 1.00 32.64 ? 783  HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 ?   ?   ?   A . n 
A 1 487 SER 487 487 ?   ?   ?   A . n 
A 1 488 GLN 488 488 ?   ?   ?   A . n 
A 1 489 GLU 489 489 ?   ?   ?   A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
A 1 538 ASP 538 538 ?   ?   ?   A . n 
A 1 539 GLY 539 539 ?   ?   ?   A . n 
A 1 540 GLU 540 540 ?   ?   ?   A . n 
A 1 541 LEU 541 541 ?   ?   ?   A . n 
A 1 542 SER 542 542 ?   ?   ?   A . n 
A 1 543 SER 543 543 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAG 1   544  416  NAG NAG A . 
C 2 NAG 1   545  59   NAG NAG A . 
D 3 UNX 1   1000 1000 UNX DEN A . 
E 3 UNX 1   1001 1001 UNX DEN A . 
F 3 UNX 1   1002 1002 UNX DEN A . 
G 3 UNX 1   1003 1002 UNX DEN A . 
H 3 UNX 1   1004 1002 UNX DEN A . 
I 3 UNX 1   1005 1002 UNX DEN A . 
J 3 UNX 1   1006 1002 UNX DEN A . 
K 3 UNX 1   1007 1002 UNX DEN A . 
L 3 UNX 1   1008 1002 UNX DEN A . 
M 3 UNX 1   1009 1002 UNX DEN A . 
N 4 VXA 1   1010 200  VXA SOM A . 
O 5 HOH 1   600  600  HOH HOH A . 
O 5 HOH 2   601  601  HOH HOH A . 
O 5 HOH 3   602  602  HOH HOH A . 
O 5 HOH 4   603  603  HOH HOH A . 
O 5 HOH 5   604  604  HOH HOH A . 
O 5 HOH 6   605  605  HOH HOH A . 
O 5 HOH 7   606  606  HOH HOH A . 
O 5 HOH 8   607  607  HOH HOH A . 
O 5 HOH 9   608  608  HOH HOH A . 
O 5 HOH 10  609  609  HOH HOH A . 
O 5 HOH 11  610  610  HOH HOH A . 
O 5 HOH 12  611  611  HOH HOH A . 
O 5 HOH 13  612  612  HOH HOH A . 
O 5 HOH 14  613  613  HOH HOH A . 
O 5 HOH 15  614  614  HOH HOH A . 
O 5 HOH 16  615  615  HOH HOH A . 
O 5 HOH 17  616  616  HOH HOH A . 
O 5 HOH 18  617  617  HOH HOH A . 
O 5 HOH 19  618  618  HOH HOH A . 
O 5 HOH 20  619  619  HOH HOH A . 
O 5 HOH 21  620  620  HOH HOH A . 
O 5 HOH 22  621  621  HOH HOH A . 
O 5 HOH 23  622  622  HOH HOH A . 
O 5 HOH 24  623  623  HOH HOH A . 
O 5 HOH 25  624  624  HOH HOH A . 
O 5 HOH 26  625  625  HOH HOH A . 
O 5 HOH 27  626  626  HOH HOH A . 
O 5 HOH 28  627  627  HOH HOH A . 
O 5 HOH 29  628  628  HOH HOH A . 
O 5 HOH 30  629  629  HOH HOH A . 
O 5 HOH 31  630  630  HOH HOH A . 
O 5 HOH 32  631  631  HOH HOH A . 
O 5 HOH 33  632  632  HOH HOH A . 
O 5 HOH 34  633  633  HOH HOH A . 
O 5 HOH 35  634  634  HOH HOH A . 
O 5 HOH 36  635  635  HOH HOH A . 
O 5 HOH 37  636  636  HOH HOH A . 
O 5 HOH 38  637  637  HOH HOH A . 
O 5 HOH 39  638  638  HOH HOH A . 
O 5 HOH 40  639  639  HOH HOH A . 
O 5 HOH 41  640  640  HOH HOH A . 
O 5 HOH 42  641  641  HOH HOH A . 
O 5 HOH 43  642  642  HOH HOH A . 
O 5 HOH 44  643  643  HOH HOH A . 
O 5 HOH 45  644  644  HOH HOH A . 
O 5 HOH 46  645  645  HOH HOH A . 
O 5 HOH 47  646  646  HOH HOH A . 
O 5 HOH 48  647  647  HOH HOH A . 
O 5 HOH 49  648  648  HOH HOH A . 
O 5 HOH 50  649  649  HOH HOH A . 
O 5 HOH 51  650  650  HOH HOH A . 
O 5 HOH 52  651  651  HOH HOH A . 
O 5 HOH 53  652  652  HOH HOH A . 
O 5 HOH 54  653  653  HOH HOH A . 
O 5 HOH 55  654  654  HOH HOH A . 
O 5 HOH 56  655  655  HOH HOH A . 
O 5 HOH 57  656  656  HOH HOH A . 
O 5 HOH 58  657  657  HOH HOH A . 
O 5 HOH 59  658  658  HOH HOH A . 
O 5 HOH 60  659  659  HOH HOH A . 
O 5 HOH 61  660  660  HOH HOH A . 
O 5 HOH 62  661  661  HOH HOH A . 
O 5 HOH 63  662  662  HOH HOH A . 
O 5 HOH 64  663  663  HOH HOH A . 
O 5 HOH 65  664  664  HOH HOH A . 
O 5 HOH 66  665  665  HOH HOH A . 
O 5 HOH 67  666  666  HOH HOH A . 
O 5 HOH 68  667  667  HOH HOH A . 
O 5 HOH 69  668  668  HOH HOH A . 
O 5 HOH 70  669  669  HOH HOH A . 
O 5 HOH 71  670  670  HOH HOH A . 
O 5 HOH 72  671  671  HOH HOH A . 
O 5 HOH 73  672  672  HOH HOH A . 
O 5 HOH 74  673  673  HOH HOH A . 
O 5 HOH 75  674  674  HOH HOH A . 
O 5 HOH 76  675  675  HOH HOH A . 
O 5 HOH 77  676  676  HOH HOH A . 
O 5 HOH 78  677  677  HOH HOH A . 
O 5 HOH 79  678  678  HOH HOH A . 
O 5 HOH 80  679  679  HOH HOH A . 
O 5 HOH 81  680  680  HOH HOH A . 
O 5 HOH 82  681  681  HOH HOH A . 
O 5 HOH 83  682  682  HOH HOH A . 
O 5 HOH 84  683  683  HOH HOH A . 
O 5 HOH 85  684  684  HOH HOH A . 
O 5 HOH 86  685  685  HOH HOH A . 
O 5 HOH 87  686  686  HOH HOH A . 
O 5 HOH 88  687  687  HOH HOH A . 
O 5 HOH 89  688  688  HOH HOH A . 
O 5 HOH 90  689  689  HOH HOH A . 
O 5 HOH 91  690  690  HOH HOH A . 
O 5 HOH 92  691  691  HOH HOH A . 
O 5 HOH 93  692  692  HOH HOH A . 
O 5 HOH 94  693  693  HOH HOH A . 
O 5 HOH 95  694  694  HOH HOH A . 
O 5 HOH 96  695  695  HOH HOH A . 
O 5 HOH 97  696  696  HOH HOH A . 
O 5 HOH 98  697  697  HOH HOH A . 
O 5 HOH 99  698  698  HOH HOH A . 
O 5 HOH 100 699  699  HOH HOH A . 
O 5 HOH 101 700  700  HOH HOH A . 
O 5 HOH 102 701  701  HOH HOH A . 
O 5 HOH 103 702  702  HOH HOH A . 
O 5 HOH 104 703  703  HOH HOH A . 
O 5 HOH 105 704  704  HOH HOH A . 
O 5 HOH 106 705  705  HOH HOH A . 
O 5 HOH 107 706  706  HOH HOH A . 
O 5 HOH 108 707  707  HOH HOH A . 
O 5 HOH 109 708  708  HOH HOH A . 
O 5 HOH 110 709  709  HOH HOH A . 
O 5 HOH 111 710  710  HOH HOH A . 
O 5 HOH 112 711  711  HOH HOH A . 
O 5 HOH 113 712  712  HOH HOH A . 
O 5 HOH 114 713  713  HOH HOH A . 
O 5 HOH 115 714  714  HOH HOH A . 
O 5 HOH 116 715  715  HOH HOH A . 
O 5 HOH 117 716  716  HOH HOH A . 
O 5 HOH 118 717  717  HOH HOH A . 
O 5 HOH 119 718  718  HOH HOH A . 
O 5 HOH 120 719  719  HOH HOH A . 
O 5 HOH 121 720  720  HOH HOH A . 
O 5 HOH 122 721  721  HOH HOH A . 
O 5 HOH 123 722  722  HOH HOH A . 
O 5 HOH 124 723  723  HOH HOH A . 
O 5 HOH 125 724  724  HOH HOH A . 
O 5 HOH 126 725  725  HOH HOH A . 
O 5 HOH 127 726  726  HOH HOH A . 
O 5 HOH 128 727  727  HOH HOH A . 
O 5 HOH 129 728  728  HOH HOH A . 
O 5 HOH 130 729  729  HOH HOH A . 
O 5 HOH 131 730  730  HOH HOH A . 
O 5 HOH 132 731  731  HOH HOH A . 
O 5 HOH 133 732  732  HOH HOH A . 
O 5 HOH 134 733  733  HOH HOH A . 
O 5 HOH 135 734  734  HOH HOH A . 
O 5 HOH 136 735  735  HOH HOH A . 
O 5 HOH 137 736  736  HOH HOH A . 
O 5 HOH 138 737  737  HOH HOH A . 
O 5 HOH 139 738  738  HOH HOH A . 
O 5 HOH 140 739  739  HOH HOH A . 
O 5 HOH 141 740  740  HOH HOH A . 
O 5 HOH 142 741  741  HOH HOH A . 
O 5 HOH 143 742  742  HOH HOH A . 
O 5 HOH 144 743  743  HOH HOH A . 
O 5 HOH 145 744  744  HOH HOH A . 
O 5 HOH 146 745  745  HOH HOH A . 
O 5 HOH 147 746  746  HOH HOH A . 
O 5 HOH 148 747  747  HOH HOH A . 
O 5 HOH 149 748  748  HOH HOH A . 
O 5 HOH 150 749  749  HOH HOH A . 
O 5 HOH 151 750  750  HOH HOH A . 
O 5 HOH 152 751  751  HOH HOH A . 
O 5 HOH 153 752  752  HOH HOH A . 
O 5 HOH 154 753  753  HOH HOH A . 
O 5 HOH 155 754  754  HOH HOH A . 
O 5 HOH 156 755  755  HOH HOH A . 
O 5 HOH 157 756  756  HOH HOH A . 
O 5 HOH 158 757  757  HOH HOH A . 
O 5 HOH 159 758  758  HOH HOH A . 
O 5 HOH 160 759  759  HOH HOH A . 
O 5 HOH 161 760  760  HOH HOH A . 
O 5 HOH 162 761  761  HOH HOH A . 
O 5 HOH 163 762  762  HOH HOH A . 
O 5 HOH 164 763  763  HOH HOH A . 
O 5 HOH 165 764  764  HOH HOH A . 
O 5 HOH 166 765  765  HOH HOH A . 
O 5 HOH 167 766  766  HOH HOH A . 
O 5 HOH 168 767  767  HOH HOH A . 
O 5 HOH 169 768  768  HOH HOH A . 
O 5 HOH 170 769  769  HOH HOH A . 
O 5 HOH 171 770  770  HOH HOH A . 
O 5 HOH 172 771  771  HOH HOH A . 
O 5 HOH 173 772  772  HOH HOH A . 
O 5 HOH 174 773  773  HOH HOH A . 
O 5 HOH 175 774  774  HOH HOH A . 
O 5 HOH 176 775  775  HOH HOH A . 
O 5 HOH 177 776  776  HOH HOH A . 
O 5 HOH 178 777  777  HOH HOH A . 
O 5 HOH 179 778  778  HOH HOH A . 
O 5 HOH 180 779  779  HOH HOH A . 
O 5 HOH 181 780  780  HOH HOH A . 
O 5 HOH 182 781  781  HOH HOH A . 
O 5 HOH 183 782  782  HOH HOH A . 
O 5 HOH 184 783  783  HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 59  A ASN 59  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 416 A ASN 416 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3080  ? 
1 MORE         2     ? 
1 'SSA (A^2)'  37560 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 137.0020000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-06-25 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2020-07-29 
5 'Structure model' 1 4 2021-06-02 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' Advisory                    
5 4 'Structure model' 'Data collection'           
6 4 'Structure model' 'Derived calculations'      
7 4 'Structure model' 'Structure summary'         
8 5 'Structure model' 'Derived calculations'      
9 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' chem_comp                       
2  4 'Structure model' entity                          
3  4 'Structure model' pdbx_chem_comp_identifier       
4  4 'Structure model' pdbx_entity_nonpoly             
5  4 'Structure model' pdbx_unobs_or_zero_occ_residues 
6  4 'Structure model' struct_conn                     
7  4 'Structure model' struct_site                     
8  4 'Structure model' struct_site_gen                 
9  5 'Structure model' chem_comp                       
10 5 'Structure model' pdbx_struct_assembly            
11 5 'Structure model' pdbx_struct_assembly_prop       
12 5 'Structure model' pdbx_struct_oper_list           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_chem_comp.name'                           
2  4 'Structure model' '_chem_comp.type'                           
3  4 'Structure model' '_entity.pdbx_description'                  
4  4 'Structure model' '_pdbx_entity_nonpoly.name'                 
5  4 'Structure model' '_struct_conn.pdbx_dist_value'              
6  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'       
7  4 'Structure model' '_struct_conn.pdbx_role'                    
8  4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'           
9  4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'            
10 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'          
11 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'          
12 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'           
13 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'           
14 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'            
15 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'          
16 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'          
17 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'          
18 5 'Structure model' '_chem_comp.pdbx_synonyms'                  
19 5 'Structure model' '_pdbx_struct_assembly.details'             
20 5 'Structure model' '_pdbx_struct_assembly.method_details'      
21 5 'Structure model' '_pdbx_struct_oper_list.matrix[2][1]'       
22 5 'Structure model' '_pdbx_struct_oper_list.matrix[2][2]'       
23 5 'Structure model' '_pdbx_struct_oper_list.matrix[3][3]'       
24 5 'Structure model' '_pdbx_struct_oper_list.name'               
25 5 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
26 5 'Structure model' '_pdbx_struct_oper_list.vector[1]'          
27 5 'Structure model' '_pdbx_struct_oper_list.vector[2]'          
28 5 'Structure model' '_pdbx_struct_oper_list.vector[3]'          
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
_pdbx_entry_details.entry_id                 1SOM 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       
;GD (SOMAN) HAS UNDERGONE DEALKYLATION
AND THE PINACOLYL GROUP IS NOT VISIBLE
IN THE ELECTRON DENSITY MAPS.

DUMMY ATOMS NOT USED IN REFINEMENT TO SHOW
LOCATION OF TWO DENSITY FEATURES NEAR THE
INDOLE RINGS OF TRP84 AND TRP279
;
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   UNK 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   UNX 
_pdbx_validate_close_contact.auth_seq_id_1    1008 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    728 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.15 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA A LEU 494 ? ? CB A LEU 494 ? ? CG A LEU 494 ? ? 129.30 115.30 14.00  2.30 N 
2 1 CB A VAL 518 ? ? CA A VAL 518 ? ? C  A VAL 518 ? ? 99.50  111.40 -11.90 1.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 45  ? ? 83.52   -17.27  
2 1 PRO A 76  ? ? -38.60  126.49  
3 1 SER A 108 ? ? -158.71 76.42   
4 1 SER A 200 ? ? 56.28   -123.70 
5 1 GLU A 299 ? ? -124.04 -76.58  
6 1 THR A 317 ? ? -164.56 -161.75 
7 1 ASP A 380 ? ? -156.03 49.88   
8 1 VAL A 400 ? ? -127.17 -60.21  
9 1 GLN A 526 ? ? -120.86 -60.64  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    TYR 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     442 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.073 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASN 42  ? CG  ? A ASN 42  CG  
2  1 Y 1 A ASN 42  ? OD1 ? A ASN 42  OD1 
3  1 Y 1 A ASN 42  ? ND2 ? A ASN 42  ND2 
4  1 Y 1 A ARG 46  ? CZ  ? A ARG 46  CZ  
5  1 Y 1 A ARG 46  ? NH1 ? A ARG 46  NH1 
6  1 Y 1 A ARG 46  ? NH2 ? A ARG 46  NH2 
7  1 Y 1 A ARG 250 ? CZ  ? A ARG 250 CZ  
8  1 Y 1 A ARG 250 ? NH1 ? A ARG 250 NH1 
9  1 Y 1 A ARG 250 ? NH2 ? A ARG 250 NH2 
10 1 Y 1 A ASN 257 ? CG  ? A ASN 257 CG  
11 1 Y 1 A ASN 257 ? OD1 ? A ASN 257 OD1 
12 1 Y 1 A ASN 257 ? ND2 ? A ASN 257 ND2 
13 1 Y 1 A GLU 260 ? OE1 ? A GLU 260 OE1 
14 1 Y 1 A GLU 260 ? OE2 ? A GLU 260 OE2 
15 1 Y 1 A GLU 268 ? OE1 ? A GLU 268 OE1 
16 1 Y 1 A GLU 268 ? OE2 ? A GLU 268 OE2 
17 1 Y 1 A GLU 344 ? OE1 ? A GLU 344 OE1 
18 1 Y 1 A GLU 344 ? OE2 ? A GLU 344 OE2 
19 1 Y 1 A GLU 350 ? OE1 ? A GLU 350 OE1 
20 1 Y 1 A GLU 350 ? OE2 ? A GLU 350 OE2 
21 1 Y 1 A LYS 357 ? NZ  ? A LYS 357 NZ  
22 1 Y 1 A LYS 413 ? CD  ? A LYS 413 CD  
23 1 Y 1 A LYS 413 ? CE  ? A LYS 413 CE  
24 1 Y 1 A LYS 413 ? NZ  ? A LYS 413 NZ  
25 1 Y 1 A LYS 498 ? CG  ? A LYS 498 CG  
26 1 Y 1 A LYS 498 ? CD  ? A LYS 498 CD  
27 1 Y 1 A LYS 498 ? CE  ? A LYS 498 CE  
28 1 Y 1 A LYS 498 ? NZ  ? A LYS 498 NZ  
29 1 Y 1 A GLU 508 ? CD  ? A GLU 508 CD  
30 1 Y 1 A GLU 508 ? OE1 ? A GLU 508 OE1 
31 1 Y 1 A GLU 508 ? OE2 ? A GLU 508 OE2 
32 1 Y 1 A ARG 515 ? CZ  ? A ARG 515 CZ  
33 1 Y 1 A ARG 515 ? NH1 ? A ARG 515 NH1 
34 1 Y 1 A ARG 515 ? NH2 ? A ARG 515 NH2 
35 1 Y 1 A GLN 526 ? OE1 ? A GLN 526 OE1 
36 1 Y 1 A GLN 526 ? NE2 ? A GLN 526 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 1   ? A ASP 1   
2  1 Y 1 A ASP 2   ? A ASP 2   
3  1 Y 1 A HIS 3   ? A HIS 3   
4  1 Y 1 A HIS 486 ? A HIS 486 
5  1 Y 1 A SER 487 ? A SER 487 
6  1 Y 1 A GLN 488 ? A GLN 488 
7  1 Y 1 A GLU 489 ? A GLU 489 
8  1 Y 1 A ALA 536 ? A ALA 536 
9  1 Y 1 A CYS 537 ? A CYS 537 
10 1 Y 1 A ASP 538 ? A ASP 538 
11 1 Y 1 A GLY 539 ? A GLY 539 
12 1 Y 1 A GLU 540 ? A GLU 540 
13 1 Y 1 A LEU 541 ? A LEU 541 
14 1 Y 1 A SER 542 ? A SER 542 
15 1 Y 1 A SER 543 ? A SER 543 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
3 'UNKNOWN ATOM OR ION'                    UNX 
4 'METHYLPHOSPHONIC ACID ESTER GROUP'      VXA 
5 water                                    HOH 
#