data_1SOT
# 
_entry.id   1SOT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SOT         
RCSB  RCSB021882   
WWPDB D_1000021882 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SOT 
_pdbx_database_status.recvd_initial_deposition_date   2004-03-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wilken, C.'    1 
'Kitzing, K.'   2 
'Kurzbauer, R.' 3 
'Ehrmann, M.'   4 
'Clausen, T.'   5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structure of the DegS stress sensor: How a PDZ domain recognizes misfolded protein and activates a protease' 
'Cell(Cambridge,Mass.)' 117 483 494 2004 CELLB5 US 0092-8674 0998 ? 15137941 '10.1016/S0092-8674(04)00454-4' 
1       
;OMP peptide signals initiate the envelope stress response by activating DegS protease via relief of inhibition mediated by its PDZ domain
;
'Cell(Cambridge,Mass.)' 113 61  71  2003 CELLB5 US 0092-8674 0998 ? ?        '10.1016/S0092-8674(03)00203-4' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wilken, C.'    1  
primary 'Kitzing, K.'   2  
primary 'Kurzbauer, R.' 3  
primary 'Ehrmann, M.'   4  
primary 'Clausen, T.'   5  
1       'Walsh, N.P.'   6  
1       'Alba, B.M.'    7  
1       'Bose, B.'      8  
1       'Gross, C.A.'   9  
1       'Sauer, R.T.'   10 
# 
_cell.entry_id           1SOT 
_cell.length_a           207.681 
_cell.length_b           143.062 
_cell.length_c           41.529 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.07 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SOT 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Protease degS' 34353.898 3   3.4.21.- ? 'protease plus PDZ domain' ? 
2 water   nat water           18.015    330 ?        ? ?                          ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(MSE)TPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVI(MSE)DQRGYIITNKHVINDADQIIVALQDGRV
FEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTD
ASINHGNSGGALVNSLGEL(MSE)GINTLSFDKSNDGETPEGIGFAIPFQLATKI(MSE)DKLIRDGRVIRGYIGIGGRE
IAPLHAQGGGIDQLQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALET(MSE)DQVAEIRPGSVIPVVV(MSE)R
DDKQLTLQVTIQEYPATNHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGS
DSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNS
GGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQG
IVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPATNHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   THR n 
1 3   PRO n 
1 4   ALA n 
1 5   SER n 
1 6   TYR n 
1 7   ASN n 
1 8   LEU n 
1 9   ALA n 
1 10  VAL n 
1 11  ARG n 
1 12  ARG n 
1 13  ALA n 
1 14  ALA n 
1 15  PRO n 
1 16  ALA n 
1 17  VAL n 
1 18  VAL n 
1 19  ASN n 
1 20  VAL n 
1 21  TYR n 
1 22  ASN n 
1 23  ARG n 
1 24  GLY n 
1 25  LEU n 
1 26  ASN n 
1 27  THR n 
1 28  ASN n 
1 29  SER n 
1 30  HIS n 
1 31  ASN n 
1 32  GLN n 
1 33  LEU n 
1 34  GLU n 
1 35  ILE n 
1 36  ARG n 
1 37  THR n 
1 38  LEU n 
1 39  GLY n 
1 40  SER n 
1 41  GLY n 
1 42  VAL n 
1 43  ILE n 
1 44  MSE n 
1 45  ASP n 
1 46  GLN n 
1 47  ARG n 
1 48  GLY n 
1 49  TYR n 
1 50  ILE n 
1 51  ILE n 
1 52  THR n 
1 53  ASN n 
1 54  LYS n 
1 55  HIS n 
1 56  VAL n 
1 57  ILE n 
1 58  ASN n 
1 59  ASP n 
1 60  ALA n 
1 61  ASP n 
1 62  GLN n 
1 63  ILE n 
1 64  ILE n 
1 65  VAL n 
1 66  ALA n 
1 67  LEU n 
1 68  GLN n 
1 69  ASP n 
1 70  GLY n 
1 71  ARG n 
1 72  VAL n 
1 73  PHE n 
1 74  GLU n 
1 75  ALA n 
1 76  LEU n 
1 77  LEU n 
1 78  VAL n 
1 79  GLY n 
1 80  SER n 
1 81  ASP n 
1 82  SER n 
1 83  LEU n 
1 84  THR n 
1 85  ASP n 
1 86  LEU n 
1 87  ALA n 
1 88  VAL n 
1 89  LEU n 
1 90  LYS n 
1 91  ILE n 
1 92  ASN n 
1 93  ALA n 
1 94  THR n 
1 95  GLY n 
1 96  GLY n 
1 97  LEU n 
1 98  PRO n 
1 99  THR n 
1 100 ILE n 
1 101 PRO n 
1 102 ILE n 
1 103 ASN n 
1 104 ALA n 
1 105 ARG n 
1 106 ARG n 
1 107 VAL n 
1 108 PRO n 
1 109 HIS n 
1 110 ILE n 
1 111 GLY n 
1 112 ASP n 
1 113 VAL n 
1 114 VAL n 
1 115 LEU n 
1 116 ALA n 
1 117 ILE n 
1 118 GLY n 
1 119 ASN n 
1 120 PRO n 
1 121 TYR n 
1 122 ASN n 
1 123 LEU n 
1 124 GLY n 
1 125 GLN n 
1 126 THR n 
1 127 ILE n 
1 128 THR n 
1 129 GLN n 
1 130 GLY n 
1 131 ILE n 
1 132 ILE n 
1 133 SER n 
1 134 ALA n 
1 135 THR n 
1 136 GLY n 
1 137 ARG n 
1 138 ILE n 
1 139 GLY n 
1 140 LEU n 
1 141 ASN n 
1 142 PRO n 
1 143 THR n 
1 144 GLY n 
1 145 ARG n 
1 146 GLN n 
1 147 ASN n 
1 148 PHE n 
1 149 LEU n 
1 150 GLN n 
1 151 THR n 
1 152 ASP n 
1 153 ALA n 
1 154 SER n 
1 155 ILE n 
1 156 ASN n 
1 157 HIS n 
1 158 GLY n 
1 159 ASN n 
1 160 SER n 
1 161 GLY n 
1 162 GLY n 
1 163 ALA n 
1 164 LEU n 
1 165 VAL n 
1 166 ASN n 
1 167 SER n 
1 168 LEU n 
1 169 GLY n 
1 170 GLU n 
1 171 LEU n 
1 172 MSE n 
1 173 GLY n 
1 174 ILE n 
1 175 ASN n 
1 176 THR n 
1 177 LEU n 
1 178 SER n 
1 179 PHE n 
1 180 ASP n 
1 181 LYS n 
1 182 SER n 
1 183 ASN n 
1 184 ASP n 
1 185 GLY n 
1 186 GLU n 
1 187 THR n 
1 188 PRO n 
1 189 GLU n 
1 190 GLY n 
1 191 ILE n 
1 192 GLY n 
1 193 PHE n 
1 194 ALA n 
1 195 ILE n 
1 196 PRO n 
1 197 PHE n 
1 198 GLN n 
1 199 LEU n 
1 200 ALA n 
1 201 THR n 
1 202 LYS n 
1 203 ILE n 
1 204 MSE n 
1 205 ASP n 
1 206 LYS n 
1 207 LEU n 
1 208 ILE n 
1 209 ARG n 
1 210 ASP n 
1 211 GLY n 
1 212 ARG n 
1 213 VAL n 
1 214 ILE n 
1 215 ARG n 
1 216 GLY n 
1 217 TYR n 
1 218 ILE n 
1 219 GLY n 
1 220 ILE n 
1 221 GLY n 
1 222 GLY n 
1 223 ARG n 
1 224 GLU n 
1 225 ILE n 
1 226 ALA n 
1 227 PRO n 
1 228 LEU n 
1 229 HIS n 
1 230 ALA n 
1 231 GLN n 
1 232 GLY n 
1 233 GLY n 
1 234 GLY n 
1 235 ILE n 
1 236 ASP n 
1 237 GLN n 
1 238 LEU n 
1 239 GLN n 
1 240 GLY n 
1 241 ILE n 
1 242 VAL n 
1 243 VAL n 
1 244 ASN n 
1 245 GLU n 
1 246 VAL n 
1 247 SER n 
1 248 PRO n 
1 249 ASP n 
1 250 GLY n 
1 251 PRO n 
1 252 ALA n 
1 253 ALA n 
1 254 ASN n 
1 255 ALA n 
1 256 GLY n 
1 257 ILE n 
1 258 GLN n 
1 259 VAL n 
1 260 ASN n 
1 261 ASP n 
1 262 LEU n 
1 263 ILE n 
1 264 ILE n 
1 265 SER n 
1 266 VAL n 
1 267 ASP n 
1 268 ASN n 
1 269 LYS n 
1 270 PRO n 
1 271 ALA n 
1 272 ILE n 
1 273 SER n 
1 274 ALA n 
1 275 LEU n 
1 276 GLU n 
1 277 THR n 
1 278 MSE n 
1 279 ASP n 
1 280 GLN n 
1 281 VAL n 
1 282 ALA n 
1 283 GLU n 
1 284 ILE n 
1 285 ARG n 
1 286 PRO n 
1 287 GLY n 
1 288 SER n 
1 289 VAL n 
1 290 ILE n 
1 291 PRO n 
1 292 VAL n 
1 293 VAL n 
1 294 VAL n 
1 295 MSE n 
1 296 ARG n 
1 297 ASP n 
1 298 ASP n 
1 299 LYS n 
1 300 GLN n 
1 301 LEU n 
1 302 THR n 
1 303 LEU n 
1 304 GLN n 
1 305 VAL n 
1 306 THR n 
1 307 ILE n 
1 308 GLN n 
1 309 GLU n 
1 310 TYR n 
1 311 PRO n 
1 312 ALA n 
1 313 THR n 
1 314 ASN n 
1 315 HIS n 
1 316 HIS n 
1 317 HIS n 
1 318 HIS n 
1 319 HIS n 
1 320 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 'DEGS, HHOB, HTRH, B3235, Z4594, ECS4108' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET21b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DEGS_ECOLI 
_struct_ref.pdbx_db_accession          P31137 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSD
SLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSG
GALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQGI
VVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPATN
;
_struct_ref.pdbx_align_begin           43 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1SOT A 2 ? 314 ? P31137 43 ? 355 ? 43 355 
2 1 1SOT B 2 ? 314 ? P31137 43 ? 355 ? 43 355 
3 1 1SOT C 2 ? 314 ? P31137 43 ? 355 ? 43 355 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1SOT MSE A 1   ? UNP P31137 ?   ?   'MODIFIED RESIDUE' 42  1  
1 1SOT MSE A 44  ? UNP P31137 MET 85  'MODIFIED RESIDUE' 85  2  
1 1SOT MSE A 172 ? UNP P31137 MET 213 'MODIFIED RESIDUE' 213 3  
1 1SOT MSE A 204 ? UNP P31137 MET 245 'MODIFIED RESIDUE' 245 4  
1 1SOT MSE A 278 ? UNP P31137 MET 319 'MODIFIED RESIDUE' 319 5  
1 1SOT MSE A 295 ? UNP P31137 MET 336 'MODIFIED RESIDUE' 336 6  
1 1SOT HIS A 315 ? UNP P31137 ?   ?   'EXPRESSION TAG'   356 7  
1 1SOT HIS A 316 ? UNP P31137 ?   ?   'EXPRESSION TAG'   357 8  
1 1SOT HIS A 317 ? UNP P31137 ?   ?   'EXPRESSION TAG'   358 9  
1 1SOT HIS A 318 ? UNP P31137 ?   ?   'EXPRESSION TAG'   359 10 
1 1SOT HIS A 319 ? UNP P31137 ?   ?   'EXPRESSION TAG'   360 11 
1 1SOT HIS A 320 ? UNP P31137 ?   ?   'EXPRESSION TAG'   361 12 
2 1SOT MSE B 1   ? UNP P31137 ?   ?   'MODIFIED RESIDUE' 42  13 
2 1SOT MSE B 44  ? UNP P31137 MET 85  'MODIFIED RESIDUE' 85  14 
2 1SOT MSE B 172 ? UNP P31137 MET 213 'MODIFIED RESIDUE' 213 15 
2 1SOT MSE B 204 ? UNP P31137 MET 245 'MODIFIED RESIDUE' 245 16 
2 1SOT MSE B 278 ? UNP P31137 MET 319 'MODIFIED RESIDUE' 319 17 
2 1SOT MSE B 295 ? UNP P31137 MET 336 'MODIFIED RESIDUE' 336 18 
2 1SOT HIS B 315 ? UNP P31137 ?   ?   'EXPRESSION TAG'   356 19 
2 1SOT HIS B 316 ? UNP P31137 ?   ?   'EXPRESSION TAG'   357 20 
2 1SOT HIS B 317 ? UNP P31137 ?   ?   'EXPRESSION TAG'   358 21 
2 1SOT HIS B 318 ? UNP P31137 ?   ?   'EXPRESSION TAG'   359 22 
2 1SOT HIS B 319 ? UNP P31137 ?   ?   'EXPRESSION TAG'   360 23 
2 1SOT HIS B 320 ? UNP P31137 ?   ?   'EXPRESSION TAG'   361 24 
3 1SOT MSE C 1   ? UNP P31137 ?   ?   'MODIFIED RESIDUE' 42  25 
3 1SOT MSE C 44  ? UNP P31137 MET 85  'MODIFIED RESIDUE' 85  26 
3 1SOT MSE C 172 ? UNP P31137 MET 213 'MODIFIED RESIDUE' 213 27 
3 1SOT MSE C 204 ? UNP P31137 MET 245 'MODIFIED RESIDUE' 245 28 
3 1SOT MSE C 278 ? UNP P31137 MET 319 'MODIFIED RESIDUE' 319 29 
3 1SOT MSE C 295 ? UNP P31137 MET 336 'MODIFIED RESIDUE' 336 30 
3 1SOT HIS C 315 ? UNP P31137 ?   ?   'EXPRESSION TAG'   356 31 
3 1SOT HIS C 316 ? UNP P31137 ?   ?   'EXPRESSION TAG'   357 32 
3 1SOT HIS C 317 ? UNP P31137 ?   ?   'EXPRESSION TAG'   358 33 
3 1SOT HIS C 318 ? UNP P31137 ?   ?   'EXPRESSION TAG'   359 34 
3 1SOT HIS C 319 ? UNP P31137 ?   ?   'EXPRESSION TAG'   360 35 
3 1SOT HIS C 320 ? UNP P31137 ?   ?   'EXPRESSION TAG'   361 36 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ? 'C5 H11 N O2 S'  149.211 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1SOT 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   64.63 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      3.51 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292. 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'PEG 6000, MPD, magnesium chloride, HEPES, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 292.K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2003-06-12 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9393 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9393 
# 
_reflns.entry_id                     1SOT 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.3 
_reflns.d_resolution_low             15 
_reflns.number_all                   51588 
_reflns.number_obs                   51588 
_reflns.percent_possible_obs         96.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.049 
_reflns.pdbx_netI_over_sigmaI        24.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.3 
_reflns_shell.d_res_low              2.34 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.205 
_reflns_shell.meanI_over_sigI_obs    2.4 
_reflns_shell.pdbx_redundancy        1.93 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1SOT 
_refine.ls_d_res_high                            2.3 
_refine.ls_d_res_low                             15 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_number_reflns_all                     51588 
_refine.ls_number_reflns_obs                     51588 
_refine.ls_number_reflns_R_free                  2510 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          0.201 
_refine.ls_R_factor_obs                          0.201 
_refine.ls_R_factor_R_work                       0.198 
_refine.ls_R_factor_R_free                       0.248 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 1KY9' 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6287 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             330 
_refine_hist.number_atoms_total               6617 
_refine_hist.d_res_high                       2.3 
_refine_hist.d_res_low                        15 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg 1.59  ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d    0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1SOT 
_struct.title                     'Crystal Structure of the DegS stress sensor' 
_struct.pdbx_descriptor           'Protease degS (E.C.3.4.21.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SOT 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'stress response, protein quality control, PDZ, UPR, HtrA, hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 6   ? ALA A 14  ? TYR A 47  ALA A 55  1 ? 9  
HELX_P HELX_P2  2  LYS A 54  ? ASN A 58  ? LYS A 95  ASN A 99  1 ? 5  
HELX_P HELX_P3  3  GLY A 144 ? PHE A 148 ? GLY A 185 PHE A 189 5 ? 5  
HELX_P HELX_P4  4  PHE A 197 ? ASP A 210 ? PHE A 238 ASP A 251 1 ? 14 
HELX_P HELX_P5  5  ALA A 274 ? ILE A 284 ? ALA A 315 ILE A 325 1 ? 11 
HELX_P HELX_P6  6  TYR B 6   ? ALA B 14  ? TYR B 47  ALA B 55  1 ? 9  
HELX_P HELX_P7  7  LYS B 54  ? ASN B 58  ? LYS B 95  ASN B 99  1 ? 5  
HELX_P HELX_P8  8  GLY B 144 ? PHE B 148 ? GLY B 185 PHE B 189 5 ? 5  
HELX_P HELX_P9  9  PHE B 197 ? GLY B 211 ? PHE B 238 GLY B 252 1 ? 15 
HELX_P HELX_P10 10 SER B 273 ? GLU B 283 ? SER B 314 GLU B 324 1 ? 11 
HELX_P HELX_P11 11 TYR C 6   ? ALA C 14  ? TYR C 47  ALA C 55  1 ? 9  
HELX_P HELX_P12 12 LYS C 54  ? ASN C 58  ? LYS C 95  ASN C 99  1 ? 5  
HELX_P HELX_P13 13 GLY C 144 ? PHE C 148 ? GLY C 185 PHE C 189 5 ? 5  
HELX_P HELX_P14 14 PHE C 197 ? GLY C 211 ? PHE C 238 GLY C 252 1 ? 15 
HELX_P HELX_P15 15 ALA C 274 ? ALA C 282 ? ALA C 315 ALA C 323 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A MSE 1   C ? ? ? 1_555 A THR 2   N ? ? A MSE 42  A THR 43  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale2  covale ? ? A ILE 43  C ? ? ? 1_555 A MSE 44  N ? ? A ILE 84  A MSE 85  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale3  covale ? ? A MSE 44  C ? ? ? 1_555 A ASP 45  N ? ? A MSE 85  A ASP 86  1_555 ? ? ? ? ? ? ? 1.337 ? 
covale4  covale ? ? A LEU 171 C ? ? ? 1_555 A MSE 172 N ? ? A LEU 212 A MSE 213 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale5  covale ? ? A MSE 172 C ? ? ? 1_555 A GLY 173 N ? ? A MSE 213 A GLY 214 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale6  covale ? ? A ILE 203 C ? ? ? 1_555 A MSE 204 N ? ? A ILE 244 A MSE 245 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale7  covale ? ? A MSE 204 C ? ? ? 1_555 A ASP 205 N ? ? A MSE 245 A ASP 246 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale8  covale ? ? A THR 277 C ? ? ? 1_555 A MSE 278 N ? ? A THR 318 A MSE 319 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale9  covale ? ? A MSE 278 C ? ? ? 1_555 A ASP 279 N ? ? A MSE 319 A ASP 320 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale10 covale ? ? B MSE 1   C ? ? ? 1_555 B THR 2   N ? ? B MSE 42  B THR 43  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale11 covale ? ? B ILE 43  C ? ? ? 1_555 B MSE 44  N ? ? B ILE 84  B MSE 85  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale12 covale ? ? B MSE 44  C ? ? ? 1_555 B ASP 45  N ? ? B MSE 85  B ASP 86  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale13 covale ? ? B LEU 171 C ? ? ? 1_555 B MSE 172 N ? ? B LEU 212 B MSE 213 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale14 covale ? ? B MSE 172 C ? ? ? 1_555 B GLY 173 N ? ? B MSE 213 B GLY 214 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale15 covale ? ? B ILE 203 C ? ? ? 1_555 B MSE 204 N ? ? B ILE 244 B MSE 245 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale16 covale ? ? B MSE 204 C ? ? ? 1_555 B ASP 205 N ? ? B MSE 245 B ASP 246 1_555 ? ? ? ? ? ? ? 1.339 ? 
covale17 covale ? ? B THR 277 C ? ? ? 1_555 B MSE 278 N ? ? B THR 318 B MSE 319 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale18 covale ? ? B MSE 278 C ? ? ? 1_555 B ASP 279 N ? ? B MSE 319 B ASP 320 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale19 covale ? ? B VAL 294 C ? ? ? 1_555 B MSE 295 N ? ? B VAL 335 B MSE 336 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale20 covale ? ? C MSE 1   C ? ? ? 1_555 C THR 2   N ? ? C MSE 42  C THR 43  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale21 covale ? ? C ILE 43  C ? ? ? 1_555 C MSE 44  N ? ? C ILE 84  C MSE 85  1_555 ? ? ? ? ? ? ? 1.341 ? 
covale22 covale ? ? C MSE 44  C ? ? ? 1_555 C ASP 45  N ? ? C MSE 85  C ASP 86  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale23 covale ? ? C LEU 171 C ? ? ? 1_555 C MSE 172 N ? ? C LEU 212 C MSE 213 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale24 covale ? ? C MSE 172 C ? ? ? 1_555 C GLY 173 N ? ? C MSE 213 C GLY 214 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale25 covale ? ? C ILE 203 C ? ? ? 1_555 C MSE 204 N ? ? C ILE 244 C MSE 245 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale26 covale ? ? C MSE 204 C ? ? ? 1_555 C ASP 205 N ? ? C MSE 245 C ASP 246 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale27 covale ? ? C THR 277 C ? ? ? 1_555 C MSE 278 N ? ? C THR 318 C MSE 319 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale28 covale ? ? C MSE 278 C ? ? ? 1_555 C ASP 279 N ? ? C MSE 319 C ASP 320 1_555 ? ? ? ? ? ? ? 1.333 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 7 ? 
G ? 7 ? 
H ? 2 ? 
I ? 4 ? 
J ? 7 ? 
K ? 7 ? 
L ? 2 ? 
M ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
F 5 6 ? anti-parallel 
F 6 7 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
G 6 7 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
J 4 5 ? anti-parallel 
J 5 6 ? anti-parallel 
J 6 7 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
K 4 5 ? anti-parallel 
K 5 6 ? anti-parallel 
K 6 7 ? anti-parallel 
L 1 2 ? anti-parallel 
M 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 17  ? GLY A 24  ? VAL A 58  GLY A 65  
A 2 GLU A 34  ? ILE A 43  ? GLU A 75  ILE A 84  
A 3 TYR A 49  ? ASN A 53  ? TYR A 90  ASN A 94  
A 4 LEU A 86  ? ILE A 91  ? LEU A 127 ILE A 132 
A 5 VAL A 72  ? ASP A 81  ? VAL A 113 ASP A 122 
A 6 GLN A 62  ? ALA A 66  ? GLN A 103 ALA A 107 
A 7 VAL A 17  ? GLY A 24  ? VAL A 58  GLY A 65  
B 1 VAL A 113 ? GLY A 118 ? VAL A 154 GLY A 159 
B 2 THR A 126 ? ALA A 134 ? THR A 167 ALA A 175 
B 3 LEU A 149 ? THR A 151 ? LEU A 190 THR A 192 
B 4 GLY A 192 ? PRO A 196 ? GLY A 233 PRO A 237 
B 5 LEU A 171 ? THR A 176 ? LEU A 212 THR A 217 
B 6 ALA A 163 ? ASN A 166 ? ALA A 204 ASN A 207 
B 7 VAL A 113 ? GLY A 118 ? VAL A 154 GLY A 159 
C 1 GLY A 216 ? TYR A 217 ? GLY A 257 TYR A 258 
C 2 GLN A 308 ? GLU A 309 ? GLN A 349 GLU A 350 
D 1 ILE A 241 ? VAL A 242 ? ILE A 282 VAL A 283 
D 2 LEU A 262 ? ILE A 263 ? LEU A 303 ILE A 304 
E 1 VAL A 289 ? VAL A 292 ? VAL A 330 VAL A 333 
E 2 LEU A 303 ? THR A 306 ? LEU A 344 THR A 347 
F 1 VAL B 17  ? GLY B 24  ? VAL B 58  GLY B 65  
F 2 GLU B 34  ? ILE B 43  ? GLU B 75  ILE B 84  
F 3 TYR B 49  ? ASN B 53  ? TYR B 90  ASN B 94  
F 4 LEU B 86  ? LYS B 90  ? LEU B 127 LYS B 131 
F 5 VAL B 72  ? ASP B 81  ? VAL B 113 ASP B 122 
F 6 GLN B 62  ? ALA B 66  ? GLN B 103 ALA B 107 
F 7 VAL B 17  ? GLY B 24  ? VAL B 58  GLY B 65  
G 1 VAL B 113 ? GLY B 118 ? VAL B 154 GLY B 159 
G 2 THR B 126 ? ALA B 134 ? THR B 167 ALA B 175 
G 3 LEU B 149 ? THR B 151 ? LEU B 190 THR B 192 
G 4 GLY B 192 ? PRO B 196 ? GLY B 233 PRO B 237 
G 5 LEU B 171 ? THR B 176 ? LEU B 212 THR B 217 
G 6 ALA B 163 ? ASN B 166 ? ALA B 204 ASN B 207 
G 7 VAL B 113 ? GLY B 118 ? VAL B 154 GLY B 159 
H 1 GLY B 216 ? TYR B 217 ? GLY B 257 TYR B 258 
H 2 GLN B 308 ? GLU B 309 ? GLN B 349 GLU B 350 
I 1 ILE B 241 ? VAL B 242 ? ILE B 282 VAL B 283 
I 2 LEU B 262 ? VAL B 266 ? LEU B 303 VAL B 307 
I 3 VAL B 289 ? VAL B 294 ? VAL B 330 VAL B 335 
I 4 LEU B 301 ? THR B 306 ? LEU B 342 THR B 347 
J 1 VAL C 17  ? ASN C 22  ? VAL C 58  ASN C 63  
J 2 THR C 37  ? ILE C 43  ? THR C 78  ILE C 84  
J 3 TYR C 49  ? ASN C 53  ? TYR C 90  ASN C 94  
J 4 LEU C 86  ? LYS C 90  ? LEU C 127 LYS C 131 
J 5 VAL C 72  ? ASP C 81  ? VAL C 113 ASP C 122 
J 6 ILE C 63  ? ALA C 66  ? ILE C 104 ALA C 107 
J 7 VAL C 17  ? ASN C 22  ? VAL C 58  ASN C 63  
K 1 VAL C 113 ? GLY C 118 ? VAL C 154 GLY C 159 
K 2 THR C 126 ? ALA C 134 ? THR C 167 ALA C 175 
K 3 LEU C 149 ? THR C 151 ? LEU C 190 THR C 192 
K 4 GLY C 192 ? PRO C 196 ? GLY C 233 PRO C 237 
K 5 LEU C 171 ? THR C 176 ? LEU C 212 THR C 217 
K 6 ALA C 163 ? ASN C 166 ? ALA C 204 ASN C 207 
K 7 VAL C 113 ? GLY C 118 ? VAL C 154 GLY C 159 
L 1 SER C 265 ? VAL C 266 ? SER C 306 VAL C 307 
L 2 LYS C 269 ? PRO C 270 ? LYS C 310 PRO C 311 
M 1 VAL C 289 ? ILE C 290 ? VAL C 330 ILE C 331 
M 2 VAL C 305 ? THR C 306 ? VAL C 346 THR C 347 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASN A 22  ? N ASN A 63  O THR A 37  ? O THR A 78  
A 2 3 N VAL A 42  ? N VAL A 83  O ILE A 51  ? O ILE A 92  
A 3 4 N ILE A 50  ? N ILE A 91  O LEU A 89  ? O LEU A 130 
A 4 5 O VAL A 88  ? O VAL A 129 N VAL A 78  ? N VAL A 119 
A 5 6 O PHE A 73  ? O PHE A 114 N VAL A 65  ? N VAL A 106 
A 6 7 O ILE A 64  ? O ILE A 105 N TYR A 21  ? N TYR A 62  
B 1 2 N GLY A 118 ? N GLY A 159 O THR A 126 ? O THR A 167 
B 2 3 N SER A 133 ? N SER A 174 O GLN A 150 ? O GLN A 191 
B 3 4 N THR A 151 ? N THR A 192 O GLY A 192 ? O GLY A 233 
B 4 5 O PHE A 193 ? O PHE A 234 N THR A 176 ? N THR A 217 
B 5 6 O MSE A 172 ? O MSE A 213 N LEU A 164 ? N LEU A 205 
B 6 7 O ALA A 163 ? O ALA A 204 N ILE A 117 ? N ILE A 158 
C 1 2 N TYR A 217 ? N TYR A 258 O GLN A 308 ? O GLN A 349 
D 1 2 N ILE A 241 ? N ILE A 282 O ILE A 263 ? O ILE A 304 
E 1 2 N ILE A 290 ? N ILE A 331 O VAL A 305 ? O VAL A 346 
F 1 2 N VAL B 20  ? N VAL B 61  O GLY B 39  ? O GLY B 80  
F 2 3 N VAL B 42  ? N VAL B 83  O ILE B 51  ? O ILE B 92  
F 3 4 N ILE B 50  ? N ILE B 91  O LEU B 89  ? O LEU B 130 
F 4 5 O LEU B 86  ? O LEU B 127 N ASP B 81  ? N ASP B 122 
F 5 6 O PHE B 73  ? O PHE B 114 N VAL B 65  ? N VAL B 106 
F 6 7 O ILE B 64  ? O ILE B 105 N TYR B 21  ? N TYR B 62  
G 1 2 N GLY B 118 ? N GLY B 159 O THR B 126 ? O THR B 167 
G 2 3 N SER B 133 ? N SER B 174 O GLN B 150 ? O GLN B 191 
G 3 4 N THR B 151 ? N THR B 192 O GLY B 192 ? O GLY B 233 
G 4 5 O ILE B 195 ? O ILE B 236 N ILE B 174 ? N ILE B 215 
G 5 6 O MSE B 172 ? O MSE B 213 N LEU B 164 ? N LEU B 205 
G 6 7 O ALA B 163 ? O ALA B 204 N ILE B 117 ? N ILE B 158 
H 1 2 N TYR B 217 ? N TYR B 258 O GLN B 308 ? O GLN B 349 
I 1 2 N ILE B 241 ? N ILE B 282 O ILE B 263 ? O ILE B 304 
I 2 3 N ILE B 264 ? N ILE B 305 O VAL B 293 ? O VAL B 334 
I 3 4 N ILE B 290 ? N ILE B 331 O VAL B 305 ? O VAL B 346 
J 1 2 N ASN C 22  ? N ASN C 63  O THR C 37  ? O THR C 78  
J 2 3 N VAL C 42  ? N VAL C 83  O ILE C 51  ? O ILE C 92  
J 3 4 N ILE C 50  ? N ILE C 91  O LEU C 89  ? O LEU C 130 
J 4 5 O LEU C 86  ? O LEU C 127 N ASP C 81  ? N ASP C 122 
J 5 6 O PHE C 73  ? O PHE C 114 N VAL C 65  ? N VAL C 106 
J 6 7 O ILE C 64  ? O ILE C 105 N TYR C 21  ? N TYR C 62  
K 1 2 N GLY C 118 ? N GLY C 159 O THR C 126 ? O THR C 167 
K 2 3 N SER C 133 ? N SER C 174 O GLN C 150 ? O GLN C 191 
K 3 4 N THR C 151 ? N THR C 192 O GLY C 192 ? O GLY C 233 
K 4 5 O ILE C 195 ? O ILE C 236 N ILE C 174 ? N ILE C 215 
K 5 6 O MSE C 172 ? O MSE C 213 N LEU C 164 ? N LEU C 205 
K 6 7 O ALA C 163 ? O ALA C 204 N ILE C 117 ? N ILE C 158 
L 1 2 N VAL C 266 ? N VAL C 307 O LYS C 269 ? O LYS C 310 
M 1 2 N ILE C 290 ? N ILE C 331 O VAL C 305 ? O VAL C 346 
# 
_database_PDB_matrix.entry_id          1SOT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SOT 
_atom_sites.fract_transf_matrix[1][1]   0.004815 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000006 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006990 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.024080 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1    N  N   . MSE A 1 1   ? 35.704 35.956  -17.001 1.00 85.53  ? 42  MSE A N   1 
HETATM 2    C  CA  . MSE A 1 1   ? 35.232 34.554  -16.774 1.00 85.47  ? 42  MSE A CA  1 
HETATM 3    C  C   . MSE A 1 1   ? 34.193 34.471  -15.651 1.00 77.00  ? 42  MSE A C   1 
HETATM 4    O  O   . MSE A 1 1   ? 33.852 35.471  -15.012 1.00 76.99  ? 42  MSE A O   1 
HETATM 5    C  CB  . MSE A 1 1   ? 36.419 33.648  -16.422 1.00 97.11  ? 42  MSE A CB  1 
HETATM 6    C  CG  . MSE A 1 1   ? 37.560 33.638  -17.438 1.00 110.62 ? 42  MSE A CG  1 
HETATM 7    SE SE  . MSE A 1 1   ? 39.167 32.757  -16.742 1.00 134.09 ? 42  MSE A SE  1 
HETATM 8    C  CE  . MSE A 1 1   ? 40.013 34.307  -15.925 1.00 123.71 ? 42  MSE A CE  1 
ATOM   9    N  N   . THR A 1 2   ? 33.699 33.264  -15.410 1.00 65.82  ? 43  THR A N   1 
ATOM   10   C  CA  . THR A 1 2   ? 32.706 33.041  -14.368 1.00 60.26  ? 43  THR A CA  1 
ATOM   11   C  C   . THR A 1 2   ? 33.343 32.259  -13.226 1.00 47.02  ? 43  THR A C   1 
ATOM   12   O  O   . THR A 1 2   ? 33.888 31.179  -13.423 1.00 47.67  ? 43  THR A O   1 
ATOM   13   C  CB  . THR A 1 2   ? 31.508 32.258  -14.936 1.00 66.33  ? 43  THR A CB  1 
ATOM   14   O  OG1 . THR A 1 2   ? 30.895 33.044  -15.969 1.00 75.70  ? 43  THR A OG1 1 
ATOM   15   C  CG2 . THR A 1 2   ? 30.478 31.952  -13.857 1.00 58.36  ? 43  THR A CG2 1 
ATOM   16   N  N   . PRO A 1 3   ? 33.319 32.815  -12.014 1.00 43.99  ? 44  PRO A N   1 
ATOM   17   C  CA  . PRO A 1 3   ? 33.932 32.060  -10.908 1.00 34.88  ? 44  PRO A CA  1 
ATOM   18   C  C   . PRO A 1 3   ? 33.113 30.782  -10.719 1.00 30.79  ? 44  PRO A C   1 
ATOM   19   O  O   . PRO A 1 3   ? 31.889 30.795  -10.872 1.00 26.81  ? 44  PRO A O   1 
ATOM   20   C  CB  . PRO A 1 3   ? 33.783 33.006  -9.715  1.00 36.34  ? 44  PRO A CB  1 
ATOM   21   C  CG  . PRO A 1 3   ? 33.688 34.391  -10.348 1.00 39.85  ? 44  PRO A CG  1 
ATOM   22   C  CD  . PRO A 1 3   ? 32.846 34.142  -11.578 1.00 40.21  ? 44  PRO A CD  1 
ATOM   23   N  N   . ALA A 1 4   ? 33.778 29.681  -10.426 1.00 24.06  ? 45  ALA A N   1 
ATOM   24   C  CA  . ALA A 1 4   ? 33.065 28.435  -10.188 1.00 27.86  ? 45  ALA A CA  1 
ATOM   25   C  C   . ALA A 1 4   ? 32.188 28.667  -8.921  1.00 29.47  ? 45  ALA A C   1 
ATOM   26   O  O   . ALA A 1 4   ? 32.639 29.271  -7.913  1.00 23.92  ? 45  ALA A O   1 
ATOM   27   C  CB  . ALA A 1 4   ? 34.078 27.309  -9.942  1.00 20.49  ? 45  ALA A CB  1 
ATOM   28   N  N   . SER A 1 5   ? 30.953 28.179  -8.959  1.00 26.63  ? 46  SER A N   1 
ATOM   29   C  CA  . SER A 1 5   ? 30.052 28.414  -7.851  1.00 26.66  ? 46  SER A CA  1 
ATOM   30   C  C   . SER A 1 5   ? 28.863 27.491  -7.834  1.00 28.74  ? 46  SER A C   1 
ATOM   31   O  O   . SER A 1 5   ? 28.389 27.056  -8.892  1.00 30.07  ? 46  SER A O   1 
ATOM   32   C  CB  . SER A 1 5   ? 29.577 29.879  -7.934  1.00 32.23  ? 46  SER A CB  1 
ATOM   33   O  OG  . SER A 1 5   ? 28.444 30.173  -7.115  1.00 30.16  ? 46  SER A OG  1 
ATOM   34   N  N   . TYR A 1 6   ? 28.363 27.218  -6.628  1.00 23.07  ? 47  TYR A N   1 
ATOM   35   C  CA  . TYR A 1 6   ? 27.179 26.391  -6.426  1.00 16.07  ? 47  TYR A CA  1 
ATOM   36   C  C   . TYR A 1 6   ? 26.031 27.286  -5.954  1.00 23.47  ? 47  TYR A C   1 
ATOM   37   O  O   . TYR A 1 6   ? 25.048 26.832  -5.315  1.00 25.68  ? 47  TYR A O   1 
ATOM   38   C  CB  . TYR A 1 6   ? 27.494 25.299  -5.388  1.00 26.50  ? 47  TYR A CB  1 
ATOM   39   C  CG  . TYR A 1 6   ? 28.582 24.375  -5.879  1.00 25.68  ? 47  TYR A CG  1 
ATOM   40   C  CD1 . TYR A 1 6   ? 29.848 24.385  -5.315  1.00 27.29  ? 47  TYR A CD1 1 
ATOM   41   C  CD2 . TYR A 1 6   ? 28.343 23.514  -6.958  1.00 30.15  ? 47  TYR A CD2 1 
ATOM   42   C  CE1 . TYR A 1 6   ? 30.867 23.564  -5.800  1.00 29.35  ? 47  TYR A CE1 1 
ATOM   43   C  CE2 . TYR A 1 6   ? 29.336 22.698  -7.453  1.00 28.25  ? 47  TYR A CE2 1 
ATOM   44   C  CZ  . TYR A 1 6   ? 30.589 22.719  -6.884  1.00 29.26  ? 47  TYR A CZ  1 
ATOM   45   O  OH  . TYR A 1 6   ? 31.562 21.907  -7.400  1.00 36.35  ? 47  TYR A OH  1 
ATOM   46   N  N   . ASN A 1 7   ? 26.136 28.574  -6.266  1.00 25.77  ? 48  ASN A N   1 
ATOM   47   C  CA  . ASN A 1 7   ? 25.080 29.515  -5.833  1.00 23.69  ? 48  ASN A CA  1 
ATOM   48   C  C   . ASN A 1 7   ? 23.686 29.180  -6.360  1.00 26.77  ? 48  ASN A C   1 
ATOM   49   O  O   . ASN A 1 7   ? 22.675 29.505  -5.737  1.00 26.20  ? 48  ASN A O   1 
ATOM   50   C  CB  . ASN A 1 7   ? 25.453 30.974  -6.223  1.00 17.35  ? 48  ASN A CB  1 
ATOM   51   C  CG  . ASN A 1 7   ? 24.367 31.978  -5.803  1.00 31.34  ? 48  ASN A CG  1 
ATOM   52   O  OD1 . ASN A 1 7   ? 23.675 32.532  -6.633  1.00 35.21  ? 48  ASN A OD1 1 
ATOM   53   N  ND2 . ASN A 1 7   ? 24.203 32.176  -4.504  1.00 25.97  ? 48  ASN A ND2 1 
ATOM   54   N  N   . LEU A 1 8   ? 23.611 28.538  -7.522  1.00 25.43  ? 49  LEU A N   1 
ATOM   55   C  CA  . LEU A 1 8   ? 22.304 28.218  -8.086  1.00 26.16  ? 49  LEU A CA  1 
ATOM   56   C  C   . LEU A 1 8   ? 21.568 27.201  -7.168  1.00 20.40  ? 49  LEU A C   1 
ATOM   57   O  O   . LEU A 1 8   ? 20.373 27.280  -6.953  1.00 23.73  ? 49  LEU A O   1 
ATOM   58   C  CB  . LEU A 1 8   ? 22.506 27.619  -9.493  1.00 30.57  ? 49  LEU A CB  1 
ATOM   59   C  CG  . LEU A 1 8   ? 21.252 27.127  -10.221 1.00 41.46  ? 49  LEU A CG  1 
ATOM   60   C  CD1 . LEU A 1 8   ? 20.374 28.316  -10.609 1.00 37.07  ? 49  LEU A CD1 1 
ATOM   61   C  CD2 . LEU A 1 8   ? 21.656 26.376  -11.480 1.00 47.61  ? 49  LEU A CD2 1 
ATOM   62   N  N   . ALA A 1 9   ? 22.296 26.202  -6.691  1.00 24.45  ? 50  ALA A N   1 
ATOM   63   C  CA  . ALA A 1 9   ? 21.730 25.205  -5.782  1.00 24.12  ? 50  ALA A CA  1 
ATOM   64   C  C   . ALA A 1 9   ? 21.230 25.933  -4.523  1.00 18.45  ? 50  ALA A C   1 
ATOM   65   O  O   . ALA A 1 9   ? 20.134 25.701  -4.062  1.00 24.48  ? 50  ALA A O   1 
ATOM   66   C  CB  . ALA A 1 9   ? 22.795 24.222  -5.403  1.00 26.45  ? 50  ALA A CB  1 
ATOM   67   N  N   . VAL A 1 10  ? 22.040 26.852  -3.998  1.00 22.98  ? 51  VAL A N   1 
ATOM   68   C  CA  . VAL A 1 10  ? 21.658 27.592  -2.790  1.00 25.46  ? 51  VAL A CA  1 
ATOM   69   C  C   . VAL A 1 10  ? 20.371 28.409  -3.004  1.00 24.64  ? 51  VAL A C   1 
ATOM   70   O  O   . VAL A 1 10  ? 19.356 28.270  -2.263  1.00 19.31  ? 51  VAL A O   1 
ATOM   71   C  CB  . VAL A 1 10  ? 22.833 28.561  -2.336  1.00 22.67  ? 51  VAL A CB  1 
ATOM   72   C  CG1 . VAL A 1 10  ? 22.405 29.414  -1.159  1.00 21.87  ? 51  VAL A CG1 1 
ATOM   73   C  CG2 . VAL A 1 10  ? 24.032 27.744  -1.980  1.00 15.60  ? 51  VAL A CG2 1 
ATOM   74   N  N   . ARG A 1 11  ? 20.392 29.250  -4.028  1.00 23.72  ? 52  ARG A N   1 
ATOM   75   C  CA  . ARG A 1 11  ? 19.208 30.084  -4.283  1.00 22.50  ? 52  ARG A CA  1 
ATOM   76   C  C   . ARG A 1 11  ? 17.951 29.265  -4.464  1.00 23.08  ? 52  ARG A C   1 
ATOM   77   O  O   . ARG A 1 11  ? 16.857 29.666  -4.030  1.00 22.41  ? 52  ARG A O   1 
ATOM   78   C  CB  . ARG A 1 11  ? 19.435 30.988  -5.518  1.00 30.00  ? 52  ARG A CB  1 
ATOM   79   C  CG  . ARG A 1 11  ? 20.684 31.853  -5.382  1.00 39.48  ? 52  ARG A CG  1 
ATOM   80   C  CD  . ARG A 1 11  ? 20.809 32.990  -6.437  1.00 55.56  ? 52  ARG A CD  1 
ATOM   81   N  NE  . ARG A 1 11  ? 20.292 32.650  -7.776  1.00 65.85  ? 52  ARG A NE  1 
ATOM   82   C  CZ  . ARG A 1 11  ? 20.995 32.116  -8.777  1.00 66.77  ? 52  ARG A CZ  1 
ATOM   83   N  NH1 . ARG A 1 11  ? 22.284 31.833  -8.641  1.00 67.47  ? 52  ARG A NH1 1 
ATOM   84   N  NH2 . ARG A 1 11  ? 20.401 31.866  -9.937  1.00 71.59  ? 52  ARG A NH2 1 
ATOM   85   N  N   . ARG A 1 12  ? 18.092 28.093  -5.077  1.00 18.91  ? 53  ARG A N   1 
ATOM   86   C  CA  . ARG A 1 12  ? 16.912 27.277  -5.348  1.00 20.07  ? 53  ARG A CA  1 
ATOM   87   C  C   . ARG A 1 12  ? 16.368 26.513  -4.142  1.00 27.05  ? 53  ARG A C   1 
ATOM   88   O  O   . ARG A 1 12  ? 15.171 26.370  -3.980  1.00 25.48  ? 53  ARG A O   1 
ATOM   89   C  CB  . ARG A 1 12  ? 17.236 26.231  -6.457  1.00 21.08  ? 53  ARG A CB  1 
ATOM   90   C  CG  . ARG A 1 12  ? 17.257 26.783  -7.961  1.00 30.49  ? 53  ARG A CG  1 
ATOM   91   C  CD  . ARG A 1 12  ? 17.631 25.651  -8.943  1.00 32.80  ? 53  ARG A CD  1 
ATOM   92   N  NE  . ARG A 1 12  ? 17.592 26.023  -10.356 1.00 35.78  ? 53  ARG A NE  1 
ATOM   93   C  CZ  . ARG A 1 12  ? 18.038 25.258  -11.352 1.00 38.88  ? 53  ARG A CZ  1 
ATOM   94   N  NH1 . ARG A 1 12  ? 18.578 24.050  -11.092 1.00 24.66  ? 53  ARG A NH1 1 
ATOM   95   N  NH2 . ARG A 1 12  ? 17.944 25.699  -12.617 1.00 32.52  ? 53  ARG A NH2 1 
ATOM   96   N  N   . ALA A 1 13  ? 17.272 25.963  -3.339  1.00 20.58  ? 54  ALA A N   1 
ATOM   97   C  CA  . ALA A 1 13  ? 16.873 25.147  -2.208  1.00 25.97  ? 54  ALA A CA  1 
ATOM   98   C  C   . ALA A 1 13  ? 16.877 25.835  -0.812  1.00 18.77  ? 54  ALA A C   1 
ATOM   99   O  O   . ALA A 1 13  ? 16.018 25.544  -0.004  1.00 23.94  ? 54  ALA A O   1 
ATOM   100  C  CB  . ALA A 1 13  ? 17.785 23.904  -2.160  1.00 16.58  ? 54  ALA A CB  1 
ATOM   101  N  N   . ALA A 1 14  ? 17.802 26.767  -0.575  1.00 22.57  ? 55  ALA A N   1 
ATOM   102  C  CA  . ALA A 1 14  ? 17.948 27.359  0.763   1.00 22.92  ? 55  ALA A CA  1 
ATOM   103  C  C   . ALA A 1 14  ? 16.707 27.954  1.418   1.00 27.29  ? 55  ALA A C   1 
ATOM   104  O  O   . ALA A 1 14  ? 16.560 27.783  2.610   1.00 25.39  ? 55  ALA A O   1 
ATOM   105  C  CB  . ALA A 1 14  ? 19.168 28.343  0.804   1.00 20.69  ? 55  ALA A CB  1 
ATOM   106  N  N   . PRO A 1 15  ? 15.756 28.581  0.644   1.00 25.49  ? 56  PRO A N   1 
ATOM   107  C  CA  . PRO A 1 15  ? 14.548 29.146  1.287   1.00 18.94  ? 56  PRO A CA  1 
ATOM   108  C  C   . PRO A 1 15  ? 13.634 28.111  1.962   1.00 23.71  ? 56  PRO A C   1 
ATOM   109  O  O   . PRO A 1 15  ? 12.767 28.476  2.772   1.00 17.93  ? 56  PRO A O   1 
ATOM   110  C  CB  . PRO A 1 15  ? 13.807 29.852  0.122   1.00 17.37  ? 56  PRO A CB  1 
ATOM   111  C  CG  . PRO A 1 15  ? 15.055 30.379  -0.736  1.00 16.00  ? 56  PRO A CG  1 
ATOM   112  C  CD  . PRO A 1 15  ? 15.907 29.091  -0.744  1.00 23.67  ? 56  PRO A CD  1 
ATOM   113  N  N   . ALA A 1 16  ? 13.755 26.839  1.580   1.00 17.62  ? 57  ALA A N   1 
ATOM   114  C  CA  . ALA A 1 16  ? 12.898 25.807  2.202   1.00 21.64  ? 57  ALA A CA  1 
ATOM   115  C  C   . ALA A 1 16  ? 13.555 25.113  3.467   1.00 17.74  ? 57  ALA A C   1 
ATOM   116  O  O   . ALA A 1 16  ? 12.964 24.166  4.022   1.00 19.72  ? 57  ALA A O   1 
ATOM   117  C  CB  . ALA A 1 16  ? 12.499 24.699  1.121   1.00 14.87  ? 57  ALA A CB  1 
ATOM   118  N  N   . VAL A 1 17  ? 14.772 25.530  3.859   1.00 17.58  ? 58  VAL A N   1 
ATOM   119  C  CA  . VAL A 1 17  ? 15.430 24.957  5.070   1.00 22.17  ? 58  VAL A CA  1 
ATOM   120  C  C   . VAL A 1 17  ? 15.111 25.877  6.257   1.00 21.77  ? 58  VAL A C   1 
ATOM   121  O  O   . VAL A 1 17  ? 15.431 27.060  6.262   1.00 22.65  ? 58  VAL A O   1 
ATOM   122  C  CB  . VAL A 1 17  ? 16.903 24.808  4.852   1.00 23.56  ? 58  VAL A CB  1 
ATOM   123  C  CG1 . VAL A 1 17  ? 17.607 24.226  6.111   1.00 20.90  ? 58  VAL A CG1 1 
ATOM   124  C  CG2 . VAL A 1 17  ? 17.094 23.849  3.657   1.00 16.18  ? 58  VAL A CG2 1 
ATOM   125  N  N   . VAL A 1 18  ? 14.395 25.341  7.230   1.00 20.02  ? 59  VAL A N   1 
ATOM   126  C  CA  . VAL A 1 18  ? 13.950 26.152  8.363   1.00 16.84  ? 59  VAL A CA  1 
ATOM   127  C  C   . VAL A 1 18  ? 14.727 25.895  9.679   1.00 24.90  ? 59  VAL A C   1 
ATOM   128  O  O   . VAL A 1 18  ? 15.487 24.914  9.791   1.00 20.41  ? 59  VAL A O   1 
ATOM   129  C  CB  . VAL A 1 18  ? 12.430 25.878  8.675   1.00 17.01  ? 59  VAL A CB  1 
ATOM   130  C  CG1 . VAL A 1 18  ? 11.509 26.238  7.462   1.00 23.29  ? 59  VAL A CG1 1 
ATOM   131  C  CG2 . VAL A 1 18  ? 12.239 24.403  9.039   1.00 14.38  ? 59  VAL A CG2 1 
ATOM   132  N  N   . ASN A 1 19  ? 14.533 26.798  10.647  1.00 28.66  ? 60  ASN A N   1 
ATOM   133  C  CA  . ASN A 1 19  ? 15.085 26.638  12.024  1.00 28.64  ? 60  ASN A CA  1 
ATOM   134  C  C   . ASN A 1 19  ? 13.962 25.928  12.783  1.00 31.69  ? 60  ASN A C   1 
ATOM   135  O  O   . ASN A 1 19  ? 12.784 26.341  12.661  1.00 21.88  ? 60  ASN A O   1 
ATOM   136  C  CB  . ASN A 1 19  ? 15.263 27.972  12.707  1.00 30.63  ? 60  ASN A CB  1 
ATOM   137  C  CG  . ASN A 1 19  ? 16.358 28.769  12.109  1.00 36.20  ? 60  ASN A CG  1 
ATOM   138  O  OD1 . ASN A 1 19  ? 17.515 28.383  12.182  1.00 46.59  ? 60  ASN A OD1 1 
ATOM   139  N  ND2 . ASN A 1 19  ? 16.015 29.882  11.505  1.00 46.98  ? 60  ASN A ND2 1 
ATOM   140  N  N   . VAL A 1 20  ? 14.298 24.853  13.506  1.00 26.92  ? 61  VAL A N   1 
ATOM   141  C  CA  . VAL A 1 20  ? 13.308 24.120  14.318  1.00 25.97  ? 61  VAL A CA  1 
ATOM   142  C  C   . VAL A 1 20  ? 13.699 24.289  15.815  1.00 35.58  ? 61  VAL A C   1 
ATOM   143  O  O   . VAL A 1 20  ? 14.846 24.040  16.201  1.00 29.50  ? 61  VAL A O   1 
ATOM   144  C  CB  . VAL A 1 20  ? 13.293 22.630  13.935  1.00 30.35  ? 61  VAL A CB  1 
ATOM   145  C  CG1 . VAL A 1 20  ? 12.363 21.859  14.827  1.00 19.49  ? 61  VAL A CG1 1 
ATOM   146  C  CG2 . VAL A 1 20  ? 12.837 22.467  12.436  1.00 19.10  ? 61  VAL A CG2 1 
ATOM   147  N  N   . TYR A 1 21  ? 12.767 24.754  16.641  1.00 37.24  ? 62  TYR A N   1 
ATOM   148  C  CA  . TYR A 1 21  ? 13.054 24.952  18.068  1.00 36.82  ? 62  TYR A CA  1 
ATOM   149  C  C   . TYR A 1 21  ? 12.185 24.071  18.955  1.00 35.91  ? 62  TYR A C   1 
ATOM   150  O  O   . TYR A 1 21  ? 10.960 24.126  18.869  1.00 35.38  ? 62  TYR A O   1 
ATOM   151  C  CB  . TYR A 1 21  ? 12.799 26.389  18.535  1.00 38.35  ? 62  TYR A CB  1 
ATOM   152  C  CG  . TYR A 1 21  ? 13.520 27.466  17.773  1.00 38.56  ? 62  TYR A CG  1 
ATOM   153  C  CD1 . TYR A 1 21  ? 12.932 28.042  16.649  1.00 44.84  ? 62  TYR A CD1 1 
ATOM   154  C  CD2 . TYR A 1 21  ? 14.802 27.861  18.117  1.00 40.93  ? 62  TYR A CD2 1 
ATOM   155  C  CE1 . TYR A 1 21  ? 13.597 28.975  15.870  1.00 42.87  ? 62  TYR A CE1 1 
ATOM   156  C  CE2 . TYR A 1 21  ? 15.495 28.813  17.339  1.00 52.97  ? 62  TYR A CE2 1 
ATOM   157  C  CZ  . TYR A 1 21  ? 14.869 29.356  16.202  1.00 49.21  ? 62  TYR A CZ  1 
ATOM   158  O  OH  . TYR A 1 21  ? 15.510 30.226  15.359  1.00 51.42  ? 62  TYR A OH  1 
ATOM   159  N  N   . ASN A 1 22  ? 12.827 23.284  19.812  1.00 36.08  ? 63  ASN A N   1 
ATOM   160  C  CA  . ASN A 1 22  ? 12.142 22.412  20.782  1.00 38.23  ? 63  ASN A CA  1 
ATOM   161  C  C   . ASN A 1 22  ? 12.107 23.254  22.085  1.00 41.38  ? 63  ASN A C   1 
ATOM   162  O  O   . ASN A 1 22  ? 13.146 23.668  22.589  1.00 39.36  ? 63  ASN A O   1 
ATOM   163  C  CB  . ASN A 1 22  ? 12.967 21.125  20.981  1.00 39.08  ? 63  ASN A CB  1 
ATOM   164  C  CG  . ASN A 1 22  ? 12.413 20.208  22.076  1.00 42.35  ? 63  ASN A CG  1 
ATOM   165  O  OD1 . ASN A 1 22  ? 12.647 19.009  22.048  1.00 49.16  ? 63  ASN A OD1 1 
ATOM   166  N  ND2 . ASN A 1 22  ? 11.703 20.764  23.030  1.00 41.85  ? 63  ASN A ND2 1 
ATOM   167  N  N   . ARG A 1 23  ? 10.913 23.545  22.587  1.00 36.17  ? 64  ARG A N   1 
ATOM   168  C  CA  . ARG A 1 23  ? 10.776 24.323  23.802  1.00 36.50  ? 64  ARG A CA  1 
ATOM   169  C  C   . ARG A 1 23  ? 10.027 23.553  24.882  1.00 44.64  ? 64  ARG A C   1 
ATOM   170  O  O   . ARG A 1 23  ? 9.103  22.733  24.580  1.00 37.24  ? 64  ARG A O   1 
ATOM   171  C  CB  . ARG A 1 23  ? 10.095 25.660  23.519  1.00 39.45  ? 64  ARG A CB  1 
ATOM   172  C  CG  . ARG A 1 23  ? 10.919 26.525  22.549  1.00 42.30  ? 64  ARG A CG  1 
ATOM   173  C  CD  . ARG A 1 23  ? 10.729 28.006  22.757  1.00 40.81  ? 64  ARG A CD  1 
ATOM   174  N  NE  . ARG A 1 23  ? 9.325  28.442  22.703  1.00 36.79  ? 64  ARG A NE  1 
ATOM   175  C  CZ  . ARG A 1 23  ? 8.921  29.667  23.044  1.00 37.04  ? 64  ARG A CZ  1 
ATOM   176  N  NH1 . ARG A 1 23  ? 9.803  30.573  23.458  1.00 42.58  ? 64  ARG A NH1 1 
ATOM   177  N  NH2 . ARG A 1 23  ? 7.640  29.991  22.987  1.00 39.69  ? 64  ARG A NH2 1 
ATOM   178  N  N   . GLY A 1 24  ? 10.453 23.783  26.138  1.00 36.48  ? 65  GLY A N   1 
ATOM   179  C  CA  . GLY A 1 24  ? 9.834  23.083  27.263  1.00 35.36  ? 65  GLY A CA  1 
ATOM   180  C  C   . GLY A 1 24  ? 9.199  23.976  28.314  1.00 34.76  ? 65  GLY A C   1 
ATOM   181  O  O   . GLY A 1 24  ? 9.561  25.162  28.470  1.00 34.11  ? 65  GLY A O   1 
ATOM   182  N  N   . LEU A 1 25  ? 8.232  23.404  29.024  1.00 41.94  ? 66  LEU A N   1 
ATOM   183  C  CA  . LEU A 1 25  ? 7.534  24.092  30.118  1.00 48.48  ? 66  LEU A CA  1 
ATOM   184  C  C   . LEU A 1 25  ? 8.140  23.763  31.499  1.00 52.33  ? 66  LEU A C   1 
ATOM   185  O  O   . LEU A 1 25  ? 8.019  24.563  32.426  1.00 60.97  ? 66  LEU A O   1 
ATOM   186  C  CB  . LEU A 1 25  ? 6.053  23.715  30.115  1.00 51.59  ? 66  LEU A CB  1 
ATOM   187  C  CG  . LEU A 1 25  ? 5.195  24.429  29.072  1.00 53.54  ? 66  LEU A CG  1 
ATOM   188  C  CD1 . LEU A 1 25  ? 3.857  23.757  29.016  1.00 57.14  ? 66  LEU A CD1 1 
ATOM   189  C  CD2 . LEU A 1 25  ? 5.058  25.905  29.407  1.00 51.68  ? 66  LEU A CD2 1 
ATOM   190  N  N   . ASN A 1 26  ? 8.780  22.599  31.655  1.00 46.55  ? 67  ASN A N   1 
ATOM   191  C  CA  . ASN A 1 26  ? 9.398  22.266  32.957  1.00 45.52  ? 67  ASN A CA  1 
ATOM   192  C  C   . ASN A 1 26  ? 10.912 22.277  32.837  1.00 39.76  ? 67  ASN A C   1 
ATOM   193  O  O   . ASN A 1 26  ? 11.594 21.430  33.401  1.00 33.74  ? 67  ASN A O   1 
ATOM   194  C  CB  . ASN A 1 26  ? 8.955  20.885  33.486  1.00 46.47  ? 67  ASN A CB  1 
ATOM   195  C  CG  . ASN A 1 26  ? 9.698  20.477  34.812  1.00 61.94  ? 67  ASN A CG  1 
ATOM   196  O  OD1 . ASN A 1 26  ? 9.599  21.143  35.879  1.00 46.59  ? 67  ASN A OD1 1 
ATOM   197  N  ND2 . ASN A 1 26  ? 10.443 19.382  34.730  1.00 51.59  ? 67  ASN A ND2 1 
ATOM   198  N  N   . THR A 1 27  ? 11.428 23.240  32.082  1.00 40.22  ? 68  THR A N   1 
ATOM   199  C  CA  . THR A 1 27  ? 12.866 23.362  31.855  1.00 37.41  ? 68  THR A CA  1 
ATOM   200  C  C   . THR A 1 27  ? 13.513 24.293  32.879  1.00 27.69  ? 68  THR A C   1 
ATOM   201  O  O   . THR A 1 27  ? 14.708 24.183  33.160  1.00 25.35  ? 68  THR A O   1 
ATOM   202  C  CB  . THR A 1 27  ? 13.134 23.883  30.403  1.00 38.93  ? 68  THR A CB  1 
ATOM   203  O  OG1 . THR A 1 27  ? 12.708 22.878  29.453  1.00 46.60  ? 68  THR A OG1 1 
ATOM   204  C  CG2 . THR A 1 27  ? 14.598 24.187  30.199  1.00 32.19  ? 68  THR A CG2 1 
ATOM   205  N  N   . ASN A 1 28  ? 12.728 25.251  33.368  1.00 27.23  ? 69  ASN A N   1 
ATOM   206  C  CA  . ASN A 1 28  ? 13.180 26.199  34.365  1.00 29.78  ? 69  ASN A CA  1 
ATOM   207  C  C   . ASN A 1 28  ? 12.150 26.154  35.481  1.00 34.50  ? 69  ASN A C   1 
ATOM   208  O  O   . ASN A 1 28  ? 11.052 25.580  35.331  1.00 30.77  ? 69  ASN A O   1 
ATOM   209  C  CB  . ASN A 1 28  ? 13.359 27.620  33.810  1.00 28.50  ? 69  ASN A CB  1 
ATOM   210  C  CG  . ASN A 1 28  ? 12.131 28.142  33.025  1.00 34.57  ? 69  ASN A CG  1 
ATOM   211  O  OD1 . ASN A 1 28  ? 11.030 28.344  33.565  1.00 28.37  ? 69  ASN A OD1 1 
ATOM   212  N  ND2 . ASN A 1 28  ? 12.347 28.386  31.744  1.00 35.41  ? 69  ASN A ND2 1 
ATOM   213  N  N   . SER A 1 29  ? 12.502 26.764  36.594  1.00 30.94  ? 70  SER A N   1 
ATOM   214  C  CA  . SER A 1 29  ? 11.649 26.724  37.795  1.00 36.30  ? 70  SER A CA  1 
ATOM   215  C  C   . SER A 1 29  ? 10.343 27.513  37.702  1.00 30.87  ? 70  SER A C   1 
ATOM   216  O  O   . SER A 1 29  ? 9.376  27.219  38.424  1.00 23.51  ? 70  SER A O   1 
ATOM   217  C  CB  . SER A 1 29  ? 12.439 27.254  38.996  1.00 29.99  ? 70  SER A CB  1 
ATOM   218  O  OG  . SER A 1 29  ? 12.436 28.674  38.872  1.00 34.69  ? 70  SER A OG  1 
ATOM   219  N  N   . HIS A 1 30  ? 10.292 28.502  36.815  1.00 27.06  ? 71  HIS A N   1 
ATOM   220  C  CA  . HIS A 1 30  ? 9.072  29.304  36.732  1.00 26.58  ? 71  HIS A CA  1 
ATOM   221  C  C   . HIS A 1 30  ? 8.124  28.771  35.685  1.00 28.32  ? 71  HIS A C   1 
ATOM   222  O  O   . HIS A 1 30  ? 7.165  29.434  35.340  1.00 31.02  ? 71  HIS A O   1 
ATOM   223  C  CB  . HIS A 1 30  ? 9.418  30.777  36.483  1.00 33.39  ? 71  HIS A CB  1 
ATOM   224  C  CG  . HIS A 1 30  ? 10.392 31.332  37.482  1.00 51.31  ? 71  HIS A CG  1 
ATOM   225  N  ND1 . HIS A 1 30  ? 10.234 31.164  38.852  1.00 54.55  ? 71  HIS A ND1 1 
ATOM   226  C  CD2 . HIS A 1 30  ? 11.577 31.972  37.317  1.00 48.05  ? 71  HIS A CD2 1 
ATOM   227  C  CE1 . HIS A 1 30  ? 11.280 31.672  39.480  1.00 53.77  ? 71  HIS A CE1 1 
ATOM   228  N  NE2 . HIS A 1 30  ? 12.109 32.170  38.574  1.00 58.61  ? 71  HIS A NE2 1 
ATOM   229  N  N   . ASN A 1 31  ? 8.415  27.583  35.163  1.00 26.11  ? 72  ASN A N   1 
ATOM   230  C  CA  . ASN A 1 31  ? 7.540  26.966  34.167  1.00 38.11  ? 72  ASN A CA  1 
ATOM   231  C  C   . ASN A 1 31  ? 7.261  27.898  32.966  1.00 38.11  ? 72  ASN A C   1 
ATOM   232  O  O   . ASN A 1 31  ? 6.133  28.080  32.532  1.00 38.10  ? 72  ASN A O   1 
ATOM   233  C  CB  . ASN A 1 31  ? 6.237  26.551  34.863  1.00 43.84  ? 72  ASN A CB  1 
ATOM   234  C  CG  . ASN A 1 31  ? 6.476  25.560  35.998  1.00 60.39  ? 72  ASN A CG  1 
ATOM   235  O  OD1 . ASN A 1 31  ? 6.725  24.384  35.745  1.00 66.82  ? 72  ASN A OD1 1 
ATOM   236  N  ND2 . ASN A 1 31  ? 6.425  26.039  37.259  1.00 63.78  ? 72  ASN A ND2 1 
ATOM   237  N  N   . GLN A 1 32  ? 8.311  28.519  32.459  1.00 41.27  ? 73  GLN A N   1 
ATOM   238  C  CA  . GLN A 1 32  ? 8.199  29.401  31.313  1.00 44.36  ? 73  GLN A CA  1 
ATOM   239  C  C   . GLN A 1 32  ? 8.877  28.705  30.138  1.00 39.90  ? 73  GLN A C   1 
ATOM   240  O  O   . GLN A 1 32  ? 9.977  28.140  30.290  1.00 31.91  ? 73  GLN A O   1 
ATOM   241  C  CB  . GLN A 1 32  ? 8.872  30.734  31.607  1.00 46.07  ? 73  GLN A CB  1 
ATOM   242  C  CG  . GLN A 1 32  ? 7.989  31.694  32.388  1.00 54.01  ? 73  GLN A CG  1 
ATOM   243  C  CD  . GLN A 1 32  ? 8.785  32.812  33.040  1.00 62.53  ? 73  GLN A CD  1 
ATOM   244  O  OE1 . GLN A 1 32  ? 8.217  33.776  33.556  1.00 70.96  ? 73  GLN A OE1 1 
ATOM   245  N  NE2 . GLN A 1 32  ? 10.111 32.682  33.030  1.00 70.15  ? 73  GLN A NE2 1 
ATOM   246  N  N   . LEU A 1 33  ? 8.196  28.733  28.986  1.00 41.01  ? 74  LEU A N   1 
ATOM   247  C  CA  . LEU A 1 33  ? 8.665  28.108  27.739  1.00 32.40  ? 74  LEU A CA  1 
ATOM   248  C  C   . LEU A 1 33  ? 10.069 28.563  27.446  1.00 29.27  ? 74  LEU A C   1 
ATOM   249  O  O   . LEU A 1 33  ? 10.349 29.755  27.403  1.00 29.54  ? 74  LEU A O   1 
ATOM   250  C  CB  . LEU A 1 33  ? 7.735  28.458  26.579  1.00 36.79  ? 74  LEU A CB  1 
ATOM   251  C  CG  . LEU A 1 33  ? 6.444  27.637  26.496  1.00 42.61  ? 74  LEU A CG  1 
ATOM   252  C  CD1 . LEU A 1 33  ? 5.479  28.267  25.452  1.00 44.48  ? 74  LEU A CD1 1 
ATOM   253  C  CD2 . LEU A 1 33  ? 6.791  26.178  26.125  1.00 35.15  ? 74  LEU A CD2 1 
ATOM   254  N  N   . GLU A 1 34  ? 10.962 27.596  27.271  1.00 31.45  ? 75  GLU A N   1 
ATOM   255  C  CA  . GLU A 1 34  ? 12.380 27.911  27.062  1.00 38.89  ? 75  GLU A CA  1 
ATOM   256  C  C   . GLU A 1 34  ? 12.935 26.914  26.062  1.00 25.06  ? 75  GLU A C   1 
ATOM   257  O  O   . GLU A 1 34  ? 12.508 25.750  26.002  1.00 29.94  ? 75  GLU A O   1 
ATOM   258  C  CB  . GLU A 1 34  ? 13.187 27.781  28.412  1.00 33.07  ? 75  GLU A CB  1 
ATOM   259  C  CG  . GLU A 1 34  ? 14.612 28.430  28.418  1.00 41.17  ? 75  GLU A CG  1 
ATOM   260  C  CD  . GLU A 1 34  ? 15.429 28.251  29.754  1.00 50.92  ? 75  GLU A CD  1 
ATOM   261  O  OE1 . GLU A 1 34  ? 14.841 28.095  30.855  1.00 35.83  ? 75  GLU A OE1 1 
ATOM   262  O  OE2 . GLU A 1 34  ? 16.684 28.287  29.698  1.00 46.63  ? 75  GLU A OE2 1 
ATOM   263  N  N   . ILE A 1 35  ? 13.918 27.365  25.310  1.00 30.56  ? 76  ILE A N   1 
ATOM   264  C  CA  . ILE A 1 35  ? 14.549 26.504  24.312  1.00 36.77  ? 76  ILE A CA  1 
ATOM   265  C  C   . ILE A 1 35  ? 15.361 25.369  24.982  1.00 38.64  ? 76  ILE A C   1 
ATOM   266  O  O   . ILE A 1 35  ? 16.227 25.630  25.807  1.00 46.77  ? 76  ILE A O   1 
ATOM   267  C  CB  . ILE A 1 35  ? 15.451 27.388  23.385  1.00 33.88  ? 76  ILE A CB  1 
ATOM   268  C  CG1 . ILE A 1 35  ? 14.555 28.265  22.488  1.00 41.45  ? 76  ILE A CG1 1 
ATOM   269  C  CG2 . ILE A 1 35  ? 16.377 26.507  22.567  1.00 37.37  ? 76  ILE A CG2 1 
ATOM   270  C  CD1 . ILE A 1 35  ? 15.289 29.424  21.754  1.00 36.33  ? 76  ILE A CD1 1 
ATOM   271  N  N   . ARG A 1 36  ? 15.064 24.119  24.645  1.00 40.38  ? 77  ARG A N   1 
ATOM   272  C  CA  . ARG A 1 36  ? 15.795 22.975  25.185  1.00 41.92  ? 77  ARG A CA  1 
ATOM   273  C  C   . ARG A 1 36  ? 16.722 22.431  24.110  1.00 50.96  ? 77  ARG A C   1 
ATOM   274  O  O   . ARG A 1 36  ? 17.784 21.885  24.417  1.00 56.21  ? 77  ARG A O   1 
ATOM   275  C  CB  . ARG A 1 36  ? 14.860 21.826  25.566  1.00 42.59  ? 77  ARG A CB  1 
ATOM   276  C  CG  . ARG A 1 36  ? 13.659 22.200  26.403  1.00 45.26  ? 77  ARG A CG  1 
ATOM   277  C  CD  . ARG A 1 36  ? 12.772 20.991  26.641  1.00 41.93  ? 77  ARG A CD  1 
ATOM   278  N  NE  . ARG A 1 36  ? 13.574 19.772  26.631  1.00 57.02  ? 77  ARG A NE  1 
ATOM   279  C  CZ  . ARG A 1 36  ? 13.215 18.617  27.186  1.00 67.30  ? 77  ARG A CZ  1 
ATOM   280  N  NH1 . ARG A 1 36  ? 12.048 18.506  27.825  1.00 69.18  ? 77  ARG A NH1 1 
ATOM   281  N  NH2 . ARG A 1 36  ? 14.015 17.557  27.073  1.00 66.35  ? 77  ARG A NH2 1 
ATOM   282  N  N   . THR A 1 37  ? 16.298 22.552  22.850  1.00 49.77  ? 78  THR A N   1 
ATOM   283  C  CA  . THR A 1 37  ? 17.074 22.049  21.709  1.00 54.17  ? 78  THR A CA  1 
ATOM   284  C  C   . THR A 1 37  ? 16.742 22.823  20.425  1.00 52.66  ? 78  THR A C   1 
ATOM   285  O  O   . THR A 1 37  ? 15.629 23.334  20.250  1.00 47.24  ? 78  THR A O   1 
ATOM   286  C  CB  . THR A 1 37  ? 16.800 20.528  21.417  1.00 57.66  ? 78  THR A CB  1 
ATOM   287  O  OG1 . THR A 1 37  ? 16.766 19.775  22.639  1.00 67.27  ? 78  THR A OG1 1 
ATOM   288  C  CG2 . THR A 1 37  ? 17.904 19.958  20.524  1.00 64.45  ? 78  THR A CG2 1 
ATOM   289  N  N   . LEU A 1 38  ? 17.724 22.885  19.533  1.00 49.72  ? 79  LEU A N   1 
ATOM   290  C  CA  . LEU A 1 38  ? 17.609 23.573  18.252  1.00 49.51  ? 79  LEU A CA  1 
ATOM   291  C  C   . LEU A 1 38  ? 18.042 22.629  17.157  1.00 49.13  ? 79  LEU A C   1 
ATOM   292  O  O   . LEU A 1 38  ? 18.801 21.677  17.399  1.00 42.93  ? 79  LEU A O   1 
ATOM   293  C  CB  . LEU A 1 38  ? 18.522 24.786  18.193  1.00 54.36  ? 79  LEU A CB  1 
ATOM   294  C  CG  . LEU A 1 38  ? 17.819 26.109  18.396  1.00 62.50  ? 79  LEU A CG  1 
ATOM   295  C  CD1 . LEU A 1 38  ? 16.833 26.006  19.540  1.00 69.90  ? 79  LEU A CD1 1 
ATOM   296  C  CD2 . LEU A 1 38  ? 18.849 27.150  18.667  1.00 60.43  ? 79  LEU A CD2 1 
ATOM   297  N  N   . GLY A 1 39  ? 17.562 22.923  15.953  1.00 36.63  ? 80  GLY A N   1 
ATOM   298  C  CA  . GLY A 1 39  ? 17.882 22.113  14.801  1.00 33.23  ? 80  GLY A CA  1 
ATOM   299  C  C   . GLY A 1 39  ? 17.396 22.776  13.527  1.00 28.30  ? 80  GLY A C   1 
ATOM   300  O  O   . GLY A 1 39  ? 16.999 23.942  13.475  1.00 27.52  ? 80  GLY A O   1 
ATOM   301  N  N   . SER A 1 40  ? 17.422 21.991  12.485  1.00 23.13  ? 81  SER A N   1 
ATOM   302  C  CA  . SER A 1 40  ? 17.014 22.437  11.166  1.00 30.21  ? 81  SER A CA  1 
ATOM   303  C  C   . SER A 1 40  ? 15.937 21.512  10.694  1.00 28.22  ? 81  SER A C   1 
ATOM   304  O  O   . SER A 1 40  ? 15.748 20.428  11.252  1.00 22.89  ? 81  SER A O   1 
ATOM   305  C  CB  . SER A 1 40  ? 18.202 22.363  10.197  1.00 25.15  ? 81  SER A CB  1 
ATOM   306  O  OG  . SER A 1 40  ? 19.061 23.446  10.478  1.00 28.64  ? 81  SER A OG  1 
ATOM   307  N  N   . GLY A 1 41  ? 15.223 21.961  9.669   1.00 25.74  ? 82  GLY A N   1 
ATOM   308  C  CA  . GLY A 1 41  ? 14.193 21.146  9.066   1.00 14.69  ? 82  GLY A CA  1 
ATOM   309  C  C   . GLY A 1 41  ? 14.038 21.541  7.580   1.00 26.28  ? 82  GLY A C   1 
ATOM   310  O  O   . GLY A 1 41  ? 14.552 22.573  7.135   1.00 20.89  ? 82  GLY A O   1 
ATOM   311  N  N   . VAL A 1 42  ? 13.244 20.756  6.847   1.00 18.41  ? 83  VAL A N   1 
ATOM   312  C  CA  . VAL A 1 42  ? 13.027 20.957  5.429   1.00 25.96  ? 83  VAL A CA  1 
ATOM   313  C  C   . VAL A 1 42  ? 11.529 20.961  5.084   1.00 21.35  ? 83  VAL A C   1 
ATOM   314  O  O   . VAL A 1 42  ? 10.835 19.980  5.370   1.00 21.12  ? 83  VAL A O   1 
ATOM   315  C  CB  . VAL A 1 42  ? 13.739 19.828  4.664   1.00 26.15  ? 83  VAL A CB  1 
ATOM   316  C  CG1 . VAL A 1 42  ? 13.547 19.997  3.136   1.00 29.13  ? 83  VAL A CG1 1 
ATOM   317  C  CG2 . VAL A 1 42  ? 15.215 19.818  5.041   1.00 21.65  ? 83  VAL A CG2 1 
ATOM   318  N  N   . ILE A 1 43  ? 11.031 22.046  4.491   1.00 16.08  ? 84  ILE A N   1 
ATOM   319  C  CA  . ILE A 1 43  ? 9.621  22.067  4.099   1.00 12.08  ? 84  ILE A CA  1 
ATOM   320  C  C   . ILE A 1 43  ? 9.511  21.230  2.850   1.00 18.07  ? 84  ILE A C   1 
ATOM   321  O  O   . ILE A 1 43  ? 10.191 21.506  1.885   1.00 22.39  ? 84  ILE A O   1 
ATOM   322  C  CB  . ILE A 1 43  ? 9.095  23.503  3.792   1.00 19.42  ? 84  ILE A CB  1 
ATOM   323  C  CG1 . ILE A 1 43  ? 9.325  24.412  5.008   1.00 14.28  ? 84  ILE A CG1 1 
ATOM   324  C  CG2 . ILE A 1 43  ? 7.581  23.452  3.524   1.00 16.78  ? 84  ILE A CG2 1 
ATOM   325  C  CD1 . ILE A 1 43  ? 9.134  25.930  4.789   1.00 12.10  ? 84  ILE A CD1 1 
HETATM 326  N  N   . MSE A 1 44  ? 8.718  20.162  2.937   1.00 19.67  ? 85  MSE A N   1 
HETATM 327  C  CA  . MSE A 1 44  ? 8.515  19.188  1.882   1.00 22.96  ? 85  MSE A CA  1 
HETATM 328  C  C   . MSE A 1 44  ? 7.431  19.603  0.889   1.00 27.00  ? 85  MSE A C   1 
HETATM 329  O  O   . MSE A 1 44  ? 7.589  19.361  -0.308  1.00 29.49  ? 85  MSE A O   1 
HETATM 330  C  CB  . MSE A 1 44  ? 8.166  17.810  2.508   1.00 29.36  ? 85  MSE A CB  1 
HETATM 331  C  CG  . MSE A 1 44  ? 9.271  17.284  3.490   1.00 26.72  ? 85  MSE A CG  1 
HETATM 332  SE SE  . MSE A 1 44  ? 11.046 17.295  2.649   1.00 39.69  ? 85  MSE A SE  1 
HETATM 333  C  CE  . MSE A 1 44  ? 10.731 15.931  1.324   1.00 27.64  ? 85  MSE A CE  1 
ATOM   334  N  N   . ASP A 1 45  ? 6.345  20.227  1.356   1.00 21.13  ? 86  ASP A N   1 
ATOM   335  C  CA  . ASP A 1 45  ? 5.305  20.658  0.400   1.00 29.47  ? 86  ASP A CA  1 
ATOM   336  C  C   . ASP A 1 45  ? 4.441  21.717  0.985   1.00 32.03  ? 86  ASP A C   1 
ATOM   337  O  O   . ASP A 1 45  ? 4.541  22.011  2.189   1.00 30.55  ? 86  ASP A O   1 
ATOM   338  C  CB  . ASP A 1 45  ? 4.418  19.490  -0.085  1.00 28.28  ? 86  ASP A CB  1 
ATOM   339  C  CG  . ASP A 1 45  ? 3.540  18.893  1.033   1.00 31.08  ? 86  ASP A CG  1 
ATOM   340  O  OD1 . ASP A 1 45  ? 3.648  17.666  1.268   1.00 39.74  ? 86  ASP A OD1 1 
ATOM   341  O  OD2 . ASP A 1 45  ? 2.734  19.628  1.656   1.00 39.09  ? 86  ASP A OD2 1 
ATOM   342  N  N   . GLN A 1 46  ? 3.551  22.262  0.158   1.00 28.59  ? 87  GLN A N   1 
ATOM   343  C  CA  . GLN A 1 46  ? 2.720  23.360  0.622   1.00 28.22  ? 87  GLN A CA  1 
ATOM   344  C  C   . GLN A 1 46  ? 1.655  23.115  1.655   1.00 26.51  ? 87  GLN A C   1 
ATOM   345  O  O   . GLN A 1 46  ? 1.055  24.049  2.149   1.00 25.99  ? 87  GLN A O   1 
ATOM   346  C  CB  . GLN A 1 46  ? 2.191  24.154  -0.580  1.00 31.88  ? 87  GLN A CB  1 
ATOM   347  C  CG  . GLN A 1 46  ? 3.377  24.948  -1.160  1.00 45.24  ? 87  GLN A CG  1 
ATOM   348  C  CD  . GLN A 1 46  ? 2.990  26.025  -2.100  1.00 55.78  ? 87  GLN A CD  1 
ATOM   349  O  OE1 . GLN A 1 46  ? 2.702  25.761  -3.290  1.00 53.10  ? 87  GLN A OE1 1 
ATOM   350  N  NE2 . GLN A 1 46  ? 2.958  27.268  -1.591  1.00 46.00  ? 87  GLN A NE2 1 
ATOM   351  N  N   . ARG A 1 47  ? 1.443  21.867  2.028   1.00 25.16  ? 88  ARG A N   1 
ATOM   352  C  CA  . ARG A 1 47  ? 0.461  21.610  3.066   1.00 27.26  ? 88  ARG A CA  1 
ATOM   353  C  C   . ARG A 1 47  ? 1.098  21.945  4.454   1.00 28.03  ? 88  ARG A C   1 
ATOM   354  O  O   . ARG A 1 47  ? 0.414  21.886  5.453   1.00 29.05  ? 88  ARG A O   1 
ATOM   355  C  CB  . ARG A 1 47  ? 0.048  20.128  3.050   1.00 26.43  ? 88  ARG A CB  1 
ATOM   356  C  CG  . ARG A 1 47  ? -0.581 19.665  1.765   1.00 30.53  ? 88  ARG A CG  1 
ATOM   357  C  CD  . ARG A 1 47  ? -0.829 18.176  1.788   1.00 21.55  ? 88  ARG A CD  1 
ATOM   358  N  NE  . ARG A 1 47  ? 0.424  17.436  1.654   1.00 30.34  ? 88  ARG A NE  1 
ATOM   359  C  CZ  . ARG A 1 47  ? 0.509  16.110  1.549   1.00 30.63  ? 88  ARG A CZ  1 
ATOM   360  N  NH1 . ARG A 1 47  ? -0.584 15.368  1.538   1.00 28.44  ? 88  ARG A NH1 1 
ATOM   361  N  NH2 . ARG A 1 47  ? 1.701  15.525  1.528   1.00 30.53  ? 88  ARG A NH2 1 
ATOM   362  N  N   . GLY A 1 48  ? 2.398  22.250  4.510   1.00 22.83  ? 89  GLY A N   1 
ATOM   363  C  CA  . GLY A 1 48  ? 3.013  22.570  5.785   1.00 28.55  ? 89  GLY A CA  1 
ATOM   364  C  C   . GLY A 1 48  ? 3.801  21.442  6.428   1.00 25.35  ? 89  GLY A C   1 
ATOM   365  O  O   . GLY A 1 48  ? 4.202  21.555  7.577   1.00 29.27  ? 89  GLY A O   1 
ATOM   366  N  N   . TYR A 1 49  ? 4.010  20.341  5.705   1.00 26.38  ? 90  TYR A N   1 
ATOM   367  C  CA  . TYR A 1 49  ? 4.788  19.230  6.240   1.00 23.43  ? 90  TYR A CA  1 
ATOM   368  C  C   . TYR A 1 49  ? 6.281  19.502  6.113   1.00 29.01  ? 90  TYR A C   1 
ATOM   369  O  O   . TYR A 1 49  ? 6.820  19.844  5.018   1.00 27.15  ? 90  TYR A O   1 
ATOM   370  C  CB  . TYR A 1 49  ? 4.450  17.932  5.538   1.00 24.90  ? 90  TYR A CB  1 
ATOM   371  C  CG  . TYR A 1 49  ? 3.071  17.463  5.840   1.00 33.49  ? 90  TYR A CG  1 
ATOM   372  C  CD1 . TYR A 1 49  ? 2.052  17.508  4.855   1.00 29.46  ? 90  TYR A CD1 1 
ATOM   373  C  CD2 . TYR A 1 49  ? 2.764  16.953  7.102   1.00 26.89  ? 90  TYR A CD2 1 
ATOM   374  C  CE1 . TYR A 1 49  ? 0.755  17.037  5.147   1.00 30.10  ? 90  TYR A CE1 1 
ATOM   375  C  CE2 . TYR A 1 49  ? 1.473  16.484  7.408   1.00 28.01  ? 90  TYR A CE2 1 
ATOM   376  C  CZ  . TYR A 1 49  ? 0.478  16.528  6.422   1.00 35.91  ? 90  TYR A CZ  1 
ATOM   377  O  OH  . TYR A 1 49  ? -0.782 16.065  6.726   1.00 38.43  ? 90  TYR A OH  1 
ATOM   378  N  N   . ILE A 1 50  ? 6.933  19.327  7.254   1.00 24.79  ? 91  ILE A N   1 
ATOM   379  C  CA  . ILE A 1 50  ? 8.357  19.591  7.427   1.00 17.99  ? 91  ILE A CA  1 
ATOM   380  C  C   . ILE A 1 50  ? 9.033  18.333  7.964   1.00 20.17  ? 91  ILE A C   1 
ATOM   381  O  O   . ILE A 1 50  ? 8.477  17.642  8.831   1.00 28.12  ? 91  ILE A O   1 
ATOM   382  C  CB  . ILE A 1 50  ? 8.543  20.755  8.440   1.00 25.35  ? 91  ILE A CB  1 
ATOM   383  C  CG1 . ILE A 1 50  ? 7.813  22.010  7.926   1.00 23.68  ? 91  ILE A CG1 1 
ATOM   384  C  CG2 . ILE A 1 50  ? 10.016 21.023  8.682   1.00 21.34  ? 91  ILE A CG2 1 
ATOM   385  C  CD1 . ILE A 1 50  ? 7.791  23.245  8.875   1.00 22.23  ? 91  ILE A CD1 1 
ATOM   386  N  N   . ILE A 1 51  ? 10.179 17.974  7.400   1.00 17.59  ? 92  ILE A N   1 
ATOM   387  C  CA  . ILE A 1 51  ? 10.917 16.807  7.911   1.00 21.35  ? 92  ILE A CA  1 
ATOM   388  C  C   . ILE A 1 51  ? 12.075 17.384  8.721   1.00 27.02  ? 92  ILE A C   1 
ATOM   389  O  O   . ILE A 1 51  ? 12.647 18.415  8.332   1.00 23.78  ? 92  ILE A O   1 
ATOM   390  C  CB  . ILE A 1 51  ? 11.529 15.901  6.815   1.00 30.59  ? 92  ILE A CB  1 
ATOM   391  C  CG1 . ILE A 1 51  ? 10.419 15.227  5.984   1.00 29.17  ? 92  ILE A CG1 1 
ATOM   392  C  CG2 . ILE A 1 51  ? 12.388 14.766  7.501   1.00 22.70  ? 92  ILE A CG2 1 
ATOM   393  C  CD1 . ILE A 1 51  ? 10.943 14.245  4.936   1.00 31.93  ? 92  ILE A CD1 1 
ATOM   394  N  N   . THR A 1 52  ? 12.338 16.781  9.885   1.00 26.22  ? 93  THR A N   1 
ATOM   395  C  CA  . THR A 1 52  ? 13.470 17.152  10.758  1.00 22.97  ? 93  THR A CA  1 
ATOM   396  C  C   . THR A 1 52  ? 13.993 15.863  11.452  1.00 29.22  ? 93  THR A C   1 
ATOM   397  O  O   . THR A 1 52  ? 13.653 14.743  11.036  1.00 27.93  ? 93  THR A O   1 
ATOM   398  C  CB  . THR A 1 52  ? 13.077 18.216  11.834  1.00 28.90  ? 93  THR A CB  1 
ATOM   399  O  OG1 . THR A 1 52  ? 14.258 18.658  12.499  1.00 31.04  ? 93  THR A OG1 1 
ATOM   400  C  CG2 . THR A 1 52  ? 12.109 17.661  12.863  1.00 20.17  ? 93  THR A CG2 1 
ATOM   401  N  N   . ASN A 1 53  ? 14.856 16.002  12.455  1.00 24.56  ? 94  ASN A N   1 
ATOM   402  C  CA  . ASN A 1 53  ? 15.410 14.807  13.132  1.00 31.55  ? 94  ASN A CA  1 
ATOM   403  C  C   . ASN A 1 53  ? 14.573 14.535  14.358  1.00 23.48  ? 94  ASN A C   1 
ATOM   404  O  O   . ASN A 1 53  ? 14.112 15.479  15.021  1.00 22.90  ? 94  ASN A O   1 
ATOM   405  C  CB  . ASN A 1 53  ? 16.865 15.024  13.602  1.00 28.61  ? 94  ASN A CB  1 
ATOM   406  C  CG  . ASN A 1 53  ? 17.888 14.997  12.462  1.00 33.47  ? 94  ASN A CG  1 
ATOM   407  O  OD1 . ASN A 1 53  ? 18.806 15.815  12.437  1.00 39.21  ? 94  ASN A OD1 1 
ATOM   408  N  ND2 . ASN A 1 53  ? 17.750 14.053  11.543  1.00 27.60  ? 94  ASN A ND2 1 
ATOM   409  N  N   . LYS A 1 54  ? 14.336 13.264  14.641  1.00 29.56  ? 95  LYS A N   1 
ATOM   410  C  CA  . LYS A 1 54  ? 13.590 12.935  15.855  1.00 33.99  ? 95  LYS A CA  1 
ATOM   411  C  C   . LYS A 1 54  ? 14.323 13.478  17.090  1.00 34.49  ? 95  LYS A C   1 
ATOM   412  O  O   . LYS A 1 54  ? 13.706 14.096  17.955  1.00 34.88  ? 95  LYS A O   1 
ATOM   413  C  CB  . LYS A 1 54  ? 13.432 11.435  16.027  1.00 39.85  ? 95  LYS A CB  1 
ATOM   414  C  CG  . LYS A 1 54  ? 12.642 11.061  17.290  1.00 43.25  ? 95  LYS A CG  1 
ATOM   415  C  CD  . LYS A 1 54  ? 12.375 9.565   17.289  1.00 43.97  ? 95  LYS A CD  1 
ATOM   416  C  CE  . LYS A 1 54  ? 11.425 9.158   18.410  1.00 49.44  ? 95  LYS A CE  1 
ATOM   417  N  NZ  . LYS A 1 54  ? 12.066 9.331   19.727  1.00 52.64  ? 95  LYS A NZ  1 
ATOM   418  N  N   . HIS A 1 55  ? 15.638 13.307  17.162  1.00 38.69  ? 96  HIS A N   1 
ATOM   419  C  CA  . HIS A 1 55  ? 16.352 13.793  18.358  1.00 42.54  ? 96  HIS A CA  1 
ATOM   420  C  C   . HIS A 1 55  ? 16.245 15.297  18.548  1.00 46.46  ? 96  HIS A C   1 
ATOM   421  O  O   . HIS A 1 55  ? 16.597 15.814  19.606  1.00 42.89  ? 96  HIS A O   1 
ATOM   422  C  CB  . HIS A 1 55  ? 17.843 13.388  18.345  1.00 38.24  ? 96  HIS A CB  1 
ATOM   423  C  CG  . HIS A 1 55  ? 18.715 14.266  17.500  1.00 39.73  ? 96  HIS A CG  1 
ATOM   424  N  ND1 . HIS A 1 55  ? 19.107 13.923  16.221  1.00 45.17  ? 96  HIS A ND1 1 
ATOM   425  C  CD2 . HIS A 1 55  ? 19.265 15.478  17.749  1.00 40.16  ? 96  HIS A CD2 1 
ATOM   426  C  CE1 . HIS A 1 55  ? 19.861 14.887  15.720  1.00 44.44  ? 96  HIS A CE1 1 
ATOM   427  N  NE2 . HIS A 1 55  ? 19.973 15.842  16.626  1.00 40.79  ? 96  HIS A NE2 1 
ATOM   428  N  N   . VAL A 1 56  ? 15.757 16.012  17.531  1.00 43.41  ? 97  VAL A N   1 
ATOM   429  C  CA  . VAL A 1 56  ? 15.633 17.457  17.663  1.00 33.40  ? 97  VAL A CA  1 
ATOM   430  C  C   . VAL A 1 56  ? 14.315 17.848  18.346  1.00 33.06  ? 97  VAL A C   1 
ATOM   431  O  O   . VAL A 1 56  ? 14.244 18.853  19.043  1.00 31.58  ? 97  VAL A O   1 
ATOM   432  C  CB  . VAL A 1 56  ? 15.746 18.163  16.264  1.00 40.98  ? 97  VAL A CB  1 
ATOM   433  C  CG1 . VAL A 1 56  ? 15.174 19.591  16.323  1.00 27.70  ? 97  VAL A CG1 1 
ATOM   434  C  CG2 . VAL A 1 56  ? 17.219 18.193  15.818  1.00 32.03  ? 97  VAL A CG2 1 
ATOM   435  N  N   . ILE A 1 57  ? 13.275 17.039  18.182  1.00 32.03  ? 98  ILE A N   1 
ATOM   436  C  CA  . ILE A 1 57  ? 11.976 17.405  18.761  1.00 36.94  ? 98  ILE A CA  1 
ATOM   437  C  C   . ILE A 1 57  ? 11.500 16.542  19.939  1.00 37.73  ? 98  ILE A C   1 
ATOM   438  O  O   . ILE A 1 57  ? 10.393 16.722  20.458  1.00 30.30  ? 98  ILE A O   1 
ATOM   439  C  CB  . ILE A 1 57  ? 10.883 17.414  17.659  1.00 30.73  ? 98  ILE A CB  1 
ATOM   440  C  CG1 . ILE A 1 57  ? 10.794 16.048  16.973  1.00 34.30  ? 98  ILE A CG1 1 
ATOM   441  C  CG2 . ILE A 1 57  ? 11.219 18.530  16.627  1.00 26.66  ? 98  ILE A CG2 1 
ATOM   442  C  CD1 . ILE A 1 57  ? 10.062 14.946  17.716  1.00 33.52  ? 98  ILE A CD1 1 
ATOM   443  N  N   . ASN A 1 58  ? 12.339 15.593  20.320  1.00 35.52  ? 99  ASN A N   1 
ATOM   444  C  CA  . ASN A 1 58  ? 12.050 14.695  21.430  1.00 46.72  ? 99  ASN A CA  1 
ATOM   445  C  C   . ASN A 1 58  ? 11.626 15.415  22.691  1.00 41.14  ? 99  ASN A C   1 
ATOM   446  O  O   . ASN A 1 58  ? 12.309 16.339  23.154  1.00 39.64  ? 99  ASN A O   1 
ATOM   447  C  CB  . ASN A 1 58  ? 13.259 13.800  21.732  1.00 39.93  ? 99  ASN A CB  1 
ATOM   448  C  CG  . ASN A 1 58  ? 13.119 12.455  21.086  1.00 56.16  ? 99  ASN A CG  1 
ATOM   449  O  OD1 . ASN A 1 58  ? 12.014 11.883  21.070  1.00 50.08  ? 99  ASN A OD1 1 
ATOM   450  N  ND2 . ASN A 1 58  ? 14.219 11.928  20.540  1.00 58.46  ? 99  ASN A ND2 1 
ATOM   451  N  N   . ASP A 1 59  ? 10.469 14.986  23.192  1.00 45.80  ? 100 ASP A N   1 
ATOM   452  C  CA  . ASP A 1 59  ? 9.856  15.492  24.412  1.00 57.59  ? 100 ASP A CA  1 
ATOM   453  C  C   . ASP A 1 59  ? 9.573  16.987  24.458  1.00 54.87  ? 100 ASP A C   1 
ATOM   454  O  O   . ASP A 1 59  ? 9.501  17.578  25.540  1.00 59.07  ? 100 ASP A O   1 
ATOM   455  C  CB  . ASP A 1 59  ? 10.708 15.084  25.630  1.00 61.28  ? 100 ASP A CB  1 
ATOM   456  C  CG  . ASP A 1 59  ? 10.720 13.580  25.852  1.00 67.04  ? 100 ASP A CG  1 
ATOM   457  O  OD1 . ASP A 1 59  ? 9.622  13.000  25.973  1.00 73.78  ? 100 ASP A OD1 1 
ATOM   458  O  OD2 . ASP A 1 59  ? 11.817 12.972  25.907  1.00 76.76  ? 100 ASP A OD2 1 
ATOM   459  N  N   . ALA A 1 60  ? 9.394  17.608  23.301  1.00 51.89  ? 101 ALA A N   1 
ATOM   460  C  CA  . ALA A 1 60  ? 9.098  19.043  23.292  1.00 48.25  ? 101 ALA A CA  1 
ATOM   461  C  C   . ALA A 1 60  ? 7.669  19.304  23.737  1.00 45.14  ? 101 ALA A C   1 
ATOM   462  O  O   . ALA A 1 60  ? 6.778  18.464  23.557  1.00 50.71  ? 101 ALA A O   1 
ATOM   463  C  CB  . ALA A 1 60  ? 9.320  19.611  21.913  1.00 49.90  ? 101 ALA A CB  1 
ATOM   464  N  N   . ASP A 1 61  ? 7.453  20.465  24.338  1.00 44.67  ? 102 ASP A N   1 
ATOM   465  C  CA  . ASP A 1 61  ? 6.124  20.861  24.771  1.00 43.84  ? 102 ASP A CA  1 
ATOM   466  C  C   . ASP A 1 61  ? 5.600  21.891  23.750  1.00 47.09  ? 102 ASP A C   1 
ATOM   467  O  O   . ASP A 1 61  ? 4.407  22.196  23.709  1.00 47.52  ? 102 ASP A O   1 
ATOM   468  C  CB  . ASP A 1 61  ? 6.164  21.487  26.179  1.00 49.13  ? 102 ASP A CB  1 
ATOM   469  C  CG  . ASP A 1 61  ? 6.478  20.448  27.289  1.00 60.33  ? 102 ASP A CG  1 
ATOM   470  O  OD1 . ASP A 1 61  ? 5.718  19.455  27.414  1.00 56.76  ? 102 ASP A OD1 1 
ATOM   471  O  OD2 . ASP A 1 61  ? 7.482  20.629  28.029  1.00 55.46  ? 102 ASP A OD2 1 
ATOM   472  N  N   . GLN A 1 62  ? 6.516  22.450  22.963  1.00 43.52  ? 103 GLN A N   1 
ATOM   473  C  CA  . GLN A 1 62  ? 6.167  23.410  21.921  1.00 43.31  ? 103 GLN A CA  1 
ATOM   474  C  C   . GLN A 1 62  ? 7.263  23.373  20.849  1.00 39.41  ? 103 GLN A C   1 
ATOM   475  O  O   . GLN A 1 62  ? 8.459  23.422  21.161  1.00 32.75  ? 103 GLN A O   1 
ATOM   476  C  CB  . GLN A 1 62  ? 6.058  24.826  22.470  1.00 44.77  ? 103 GLN A CB  1 
ATOM   477  C  CG  . GLN A 1 62  ? 5.355  25.730  21.487  1.00 32.97  ? 103 GLN A CG  1 
ATOM   478  C  CD  . GLN A 1 62  ? 5.504  27.189  21.765  1.00 34.17  ? 103 GLN A CD  1 
ATOM   479  O  OE1 . GLN A 1 62  ? 6.625  27.701  21.927  1.00 37.49  ? 103 GLN A OE1 1 
ATOM   480  N  NE2 . GLN A 1 62  ? 4.369  27.906  21.791  1.00 33.98  ? 103 GLN A NE2 1 
ATOM   481  N  N   . ILE A 1 63  ? 6.862  23.251  19.589  1.00 35.87  ? 104 ILE A N   1 
ATOM   482  C  CA  . ILE A 1 63  ? 7.842  23.228  18.488  1.00 27.03  ? 104 ILE A CA  1 
ATOM   483  C  C   . ILE A 1 63  ? 7.596  24.489  17.678  1.00 29.29  ? 104 ILE A C   1 
ATOM   484  O  O   . ILE A 1 63  ? 6.486  24.761  17.248  1.00 31.72  ? 104 ILE A O   1 
ATOM   485  C  CB  . ILE A 1 63  ? 7.666  21.961  17.607  1.00 35.03  ? 104 ILE A CB  1 
ATOM   486  C  CG1 . ILE A 1 63  ? 7.897  20.735  18.484  1.00 27.55  ? 104 ILE A CG1 1 
ATOM   487  C  CG2 . ILE A 1 63  ? 8.665  21.992  16.365  1.00 24.65  ? 104 ILE A CG2 1 
ATOM   488  C  CD1 . ILE A 1 63  ? 7.316  19.402  17.941  1.00 24.83  ? 104 ILE A CD1 1 
ATOM   489  N  N   . ILE A 1 64  ? 8.620  25.294  17.511  1.00 26.40  ? 105 ILE A N   1 
ATOM   490  C  CA  . ILE A 1 64  ? 8.488  26.506  16.740  1.00 24.83  ? 105 ILE A CA  1 
ATOM   491  C  C   . ILE A 1 64  ? 9.355  26.341  15.480  1.00 34.67  ? 105 ILE A C   1 
ATOM   492  O  O   . ILE A 1 64  ? 10.477 25.782  15.551  1.00 23.78  ? 105 ILE A O   1 
ATOM   493  C  CB  . ILE A 1 64  ? 8.996  27.712  17.506  1.00 33.67  ? 105 ILE A CB  1 
ATOM   494  C  CG1 . ILE A 1 64  ? 8.181  27.857  18.807  1.00 40.20  ? 105 ILE A CG1 1 
ATOM   495  C  CG2 . ILE A 1 64  ? 8.803  28.995  16.668  1.00 31.68  ? 105 ILE A CG2 1 
ATOM   496  C  CD1 . ILE A 1 64  ? 6.694  28.245  18.558  1.00 43.24  ? 105 ILE A CD1 1 
ATOM   497  N  N   . VAL A 1 65  ? 8.828  26.815  14.338  1.00 27.27  ? 106 VAL A N   1 
ATOM   498  C  CA  . VAL A 1 65  ? 9.548  26.742  13.070  1.00 22.24  ? 106 VAL A CA  1 
ATOM   499  C  C   . VAL A 1 65  ? 9.737  28.174  12.575  1.00 19.31  ? 106 VAL A C   1 
ATOM   500  O  O   . VAL A 1 65  ? 8.786  28.953  12.529  1.00 21.20  ? 106 VAL A O   1 
ATOM   501  C  CB  . VAL A 1 65  ? 8.703  25.895  12.041  1.00 30.55  ? 106 VAL A CB  1 
ATOM   502  C  CG1 . VAL A 1 65  ? 9.071  26.232  10.654  1.00 31.63  ? 106 VAL A CG1 1 
ATOM   503  C  CG2 . VAL A 1 65  ? 8.869  24.405  12.321  1.00 19.10  ? 106 VAL A CG2 1 
ATOM   504  N  N   . ALA A 1 66  ? 10.959 28.537  12.197  1.00 20.64  ? 107 ALA A N   1 
ATOM   505  C  CA  . ALA A 1 66  ? 11.202 29.884  11.703  1.00 21.19  ? 107 ALA A CA  1 
ATOM   506  C  C   . ALA A 1 66  ? 11.782 29.754  10.276  1.00 25.21  ? 107 ALA A C   1 
ATOM   507  O  O   . ALA A 1 66  ? 12.708 28.983  10.058  1.00 22.18  ? 107 ALA A O   1 
ATOM   508  C  CB  . ALA A 1 66  ? 12.234 30.626  12.601  1.00 23.11  ? 107 ALA A CB  1 
ATOM   509  N  N   . LEU A 1 67  ? 11.246 30.520  9.335   1.00 21.06  ? 108 LEU A N   1 
ATOM   510  C  CA  . LEU A 1 67  ? 11.739 30.470  7.951   1.00 27.13  ? 108 LEU A CA  1 
ATOM   511  C  C   . LEU A 1 67  ? 12.723 31.596  7.666   1.00 24.94  ? 108 LEU A C   1 
ATOM   512  O  O   . LEU A 1 67  ? 12.704 32.636  8.320   1.00 20.75  ? 108 LEU A O   1 
ATOM   513  C  CB  . LEU A 1 67  ? 10.596 30.659  6.931   1.00 20.24  ? 108 LEU A CB  1 
ATOM   514  C  CG  . LEU A 1 67  ? 9.248  29.964  6.940   1.00 27.42  ? 108 LEU A CG  1 
ATOM   515  C  CD1 . LEU A 1 67  ? 8.781  29.840  5.467   1.00 26.22  ? 108 LEU A CD1 1 
ATOM   516  C  CD2 . LEU A 1 67  ? 9.264  28.661  7.607   1.00 22.52  ? 108 LEU A CD2 1 
ATOM   517  N  N   . GLN A 1 68  ? 13.519 31.424  6.621   1.00 27.74  ? 109 GLN A N   1 
ATOM   518  C  CA  . GLN A 1 68  ? 14.450 32.480  6.210   1.00 34.96  ? 109 GLN A CA  1 
ATOM   519  C  C   . GLN A 1 68  ? 13.743 33.782  5.814   1.00 29.72  ? 109 GLN A C   1 
ATOM   520  O  O   . GLN A 1 68  ? 14.325 34.868  5.916   1.00 38.66  ? 109 GLN A O   1 
ATOM   521  C  CB  . GLN A 1 68  ? 15.310 32.023  5.025   1.00 33.39  ? 109 GLN A CB  1 
ATOM   522  C  CG  . GLN A 1 68  ? 16.352 30.999  5.400   1.00 39.86  ? 109 GLN A CG  1 
ATOM   523  C  CD  . GLN A 1 68  ? 17.373 31.568  6.380   1.00 49.16  ? 109 GLN A CD  1 
ATOM   524  O  OE1 . GLN A 1 68  ? 18.109 32.505  6.054   1.00 55.29  ? 109 GLN A OE1 1 
ATOM   525  N  NE2 . GLN A 1 68  ? 17.419 31.009  7.579   1.00 40.22  ? 109 GLN A NE2 1 
ATOM   526  N  N   . ASP A 1 69  ? 12.513 33.705  5.329   1.00 27.57  ? 110 ASP A N   1 
ATOM   527  C  CA  . ASP A 1 69  ? 11.832 34.957  4.954   1.00 30.00  ? 110 ASP A CA  1 
ATOM   528  C  C   . ASP A 1 69  ? 11.244 35.680  6.178   1.00 32.61  ? 110 ASP A C   1 
ATOM   529  O  O   . ASP A 1 69  ? 10.521 36.651  6.022   1.00 38.31  ? 110 ASP A O   1 
ATOM   530  C  CB  . ASP A 1 69  ? 10.734 34.739  3.880   1.00 34.88  ? 110 ASP A CB  1 
ATOM   531  C  CG  . ASP A 1 69  ? 9.578  33.832  4.365   1.00 46.64  ? 110 ASP A CG  1 
ATOM   532  O  OD1 . ASP A 1 69  ? 9.302  33.849  5.584   1.00 33.11  ? 110 ASP A OD1 1 
ATOM   533  O  OD2 . ASP A 1 69  ? 8.937  33.117  3.527   1.00 50.91  ? 110 ASP A OD2 1 
ATOM   534  N  N   . GLY A 1 70  ? 11.552 35.200  7.390   1.00 34.94  ? 111 GLY A N   1 
ATOM   535  C  CA  . GLY A 1 70  ? 11.099 35.877  8.604   1.00 34.20  ? 111 GLY A CA  1 
ATOM   536  C  C   . GLY A 1 70  ? 9.857  35.334  9.290   1.00 37.93  ? 111 GLY A C   1 
ATOM   537  O  O   . GLY A 1 70  ? 9.588  35.660  10.436  1.00 35.92  ? 111 GLY A O   1 
ATOM   538  N  N   . ARG A 1 71  ? 9.079  34.518  8.596   1.00 28.29  ? 112 ARG A N   1 
ATOM   539  C  CA  . ARG A 1 71  ? 7.887  34.001  9.202   1.00 27.02  ? 112 ARG A CA  1 
ATOM   540  C  C   . ARG A 1 71  ? 8.191  32.957  10.267  1.00 27.66  ? 112 ARG A C   1 
ATOM   541  O  O   . ARG A 1 71  ? 9.171  32.184  10.167  1.00 25.80  ? 112 ARG A O   1 
ATOM   542  C  CB  . ARG A 1 71  ? 6.940  33.438  8.135   1.00 28.28  ? 112 ARG A CB  1 
ATOM   543  C  CG  . ARG A 1 71  ? 6.204  34.533  7.299   1.00 29.68  ? 112 ARG A CG  1 
ATOM   544  C  CD  . ARG A 1 71  ? 5.203  33.856  6.342   1.00 29.08  ? 112 ARG A CD  1 
ATOM   545  N  NE  . ARG A 1 71  ? 5.913  33.202  5.243   1.00 24.98  ? 112 ARG A NE  1 
ATOM   546  C  CZ  . ARG A 1 71  ? 5.359  32.364  4.366   1.00 26.34  ? 112 ARG A CZ  1 
ATOM   547  N  NH1 . ARG A 1 71  ? 4.080  32.034  4.467   1.00 31.37  ? 112 ARG A NH1 1 
ATOM   548  N  NH2 . ARG A 1 71  ? 6.064  31.950  3.323   1.00 18.29  ? 112 ARG A NH2 1 
ATOM   549  N  N   . VAL A 1 72  ? 7.316  32.926  11.270  1.00 22.94  ? 113 VAL A N   1 
ATOM   550  C  CA  . VAL A 1 72  ? 7.457  32.000  12.399  1.00 33.85  ? 113 VAL A CA  1 
ATOM   551  C  C   . VAL A 1 72  ? 6.133  31.299  12.664  1.00 30.18  ? 113 VAL A C   1 
ATOM   552  O  O   . VAL A 1 72  ? 5.106  31.931  12.777  1.00 29.53  ? 113 VAL A O   1 
ATOM   553  C  CB  . VAL A 1 72  ? 7.911  32.770  13.678  1.00 39.39  ? 113 VAL A CB  1 
ATOM   554  C  CG1 . VAL A 1 72  ? 7.893  31.844  14.860  1.00 35.16  ? 113 VAL A CG1 1 
ATOM   555  C  CG2 . VAL A 1 72  ? 9.322  33.379  13.452  1.00 27.14  ? 113 VAL A CG2 1 
ATOM   556  N  N   . PHE A 1 73  ? 6.178  29.988  12.799  1.00 26.59  ? 114 PHE A N   1 
ATOM   557  C  CA  . PHE A 1 73  ? 4.969  29.194  12.985  1.00 27.89  ? 114 PHE A CA  1 
ATOM   558  C  C   . PHE A 1 73  ? 5.149  28.175  14.130  1.00 35.70  ? 114 PHE A C   1 
ATOM   559  O  O   . PHE A 1 73  ? 6.256  27.714  14.414  1.00 31.84  ? 114 PHE A O   1 
ATOM   560  C  CB  . PHE A 1 73  ? 4.702  28.304  11.743  1.00 21.46  ? 114 PHE A CB  1 
ATOM   561  C  CG  . PHE A 1 73  ? 4.479  29.047  10.463  1.00 26.78  ? 114 PHE A CG  1 
ATOM   562  C  CD1 . PHE A 1 73  ? 5.550  29.399  9.665   1.00 19.77  ? 114 PHE A CD1 1 
ATOM   563  C  CD2 . PHE A 1 73  ? 3.180  29.383  10.047  1.00 31.73  ? 114 PHE A CD2 1 
ATOM   564  C  CE1 . PHE A 1 73  ? 5.349  30.090  8.431   1.00 31.53  ? 114 PHE A CE1 1 
ATOM   565  C  CE2 . PHE A 1 73  ? 2.959  30.063  8.838   1.00 30.74  ? 114 PHE A CE2 1 
ATOM   566  C  CZ  . PHE A 1 73  ? 4.062  30.418  8.021   1.00 26.13  ? 114 PHE A CZ  1 
ATOM   567  N  N   . GLU A 1 74  ? 4.038  27.786  14.727  1.00 30.45  ? 115 GLU A N   1 
ATOM   568  C  CA  . GLU A 1 74  ? 4.085  26.734  15.703  1.00 36.35  ? 115 GLU A CA  1 
ATOM   569  C  C   . GLU A 1 74  ? 3.753  25.505  14.867  1.00 33.85  ? 115 GLU A C   1 
ATOM   570  O  O   . GLU A 1 74  ? 2.871  25.532  14.014  1.00 39.26  ? 115 GLU A O   1 
ATOM   571  C  CB  . GLU A 1 74  ? 3.034  26.914  16.809  1.00 39.99  ? 115 GLU A CB  1 
ATOM   572  C  CG  . GLU A 1 74  ? 2.847  25.644  17.622  1.00 55.48  ? 115 GLU A CG  1 
ATOM   573  C  CD  . GLU A 1 74  ? 2.065  25.851  18.915  1.00 70.32  ? 115 GLU A CD  1 
ATOM   574  O  OE1 . GLU A 1 74  ? 1.853  24.841  19.636  1.00 68.23  ? 115 GLU A OE1 1 
ATOM   575  O  OE2 . GLU A 1 74  ? 1.673  27.013  19.207  1.00 74.83  ? 115 GLU A OE2 1 
ATOM   576  N  N   . ALA A 1 75  ? 4.455  24.426  15.133  1.00 28.82  ? 116 ALA A N   1 
ATOM   577  C  CA  . ALA A 1 75  ? 4.300  23.192  14.435  1.00 28.93  ? 116 ALA A CA  1 
ATOM   578  C  C   . ALA A 1 75  ? 3.731  22.097  15.314  1.00 36.31  ? 116 ALA A C   1 
ATOM   579  O  O   . ALA A 1 75  ? 3.957  22.078  16.526  1.00 39.62  ? 116 ALA A O   1 
ATOM   580  C  CB  . ALA A 1 75  ? 5.630  22.764  13.955  1.00 25.37  ? 116 ALA A CB  1 
ATOM   581  N  N   . LEU A 1 76  ? 3.021  21.166  14.682  1.00 38.81  ? 117 LEU A N   1 
ATOM   582  C  CA  . LEU A 1 76  ? 2.455  20.017  15.362  1.00 36.41  ? 117 LEU A CA  1 
ATOM   583  C  C   . LEU A 1 76  ? 3.268  18.813  14.929  1.00 36.71  ? 117 LEU A C   1 
ATOM   584  O  O   . LEU A 1 76  ? 3.692  18.750  13.777  1.00 33.61  ? 117 LEU A O   1 
ATOM   585  C  CB  . LEU A 1 76  ? 0.996  19.826  14.985  1.00 39.96  ? 117 LEU A CB  1 
ATOM   586  C  CG  . LEU A 1 76  ? 0.005  20.838  15.595  1.00 57.67  ? 117 LEU A CG  1 
ATOM   587  C  CD1 . LEU A 1 76  ? 0.330  21.072  17.107  1.00 52.85  ? 117 LEU A CD1 1 
ATOM   588  C  CD2 . LEU A 1 76  ? 0.094  22.159  14.842  1.00 61.87  ? 117 LEU A CD2 1 
ATOM   589  N  N   . LEU A 1 77  ? 3.505  17.873  15.847  1.00 29.01  ? 118 LEU A N   1 
ATOM   590  C  CA  . LEU A 1 77  ? 4.270  16.667  15.561  1.00 33.01  ? 118 LEU A CA  1 
ATOM   591  C  C   . LEU A 1 77  ? 3.342  15.674  14.916  1.00 35.27  ? 118 LEU A C   1 
ATOM   592  O  O   . LEU A 1 77  ? 2.309  15.352  15.494  1.00 33.25  ? 118 LEU A O   1 
ATOM   593  C  CB  . LEU A 1 77  ? 4.779  16.026  16.857  1.00 40.22  ? 118 LEU A CB  1 
ATOM   594  C  CG  . LEU A 1 77  ? 6.193  15.472  17.079  1.00 48.86  ? 118 LEU A CG  1 
ATOM   595  C  CD1 . LEU A 1 77  ? 6.114  14.363  18.145  1.00 47.18  ? 118 LEU A CD1 1 
ATOM   596  C  CD2 . LEU A 1 77  ? 6.786  14.915  15.849  1.00 33.62  ? 118 LEU A CD2 1 
ATOM   597  N  N   . VAL A 1 78  ? 3.671  15.148  13.742  1.00 32.53  ? 119 VAL A N   1 
ATOM   598  C  CA  . VAL A 1 78  ? 2.723  14.178  13.233  1.00 36.78  ? 119 VAL A CA  1 
ATOM   599  C  C   . VAL A 1 78  ? 3.243  12.789  13.533  1.00 37.86  ? 119 VAL A C   1 
ATOM   600  O  O   . VAL A 1 78  ? 2.465  11.847  13.612  1.00 37.57  ? 119 VAL A O   1 
ATOM   601  C  CB  . VAL A 1 78  ? 2.323  14.377  11.686  1.00 38.96  ? 119 VAL A CB  1 
ATOM   602  C  CG1 . VAL A 1 78  ? 2.818  15.693  11.147  1.00 29.74  ? 119 VAL A CG1 1 
ATOM   603  C  CG2 . VAL A 1 78  ? 2.759  13.221  10.843  1.00 33.96  ? 119 VAL A CG2 1 
ATOM   604  N  N   . GLY A 1 79  ? 4.549  12.666  13.761  1.00 37.85  ? 120 GLY A N   1 
ATOM   605  C  CA  . GLY A 1 79  ? 5.101  11.352  14.062  1.00 37.22  ? 120 GLY A CA  1 
ATOM   606  C  C   . GLY A 1 79  ? 6.612  11.328  13.960  1.00 39.03  ? 120 GLY A C   1 
ATOM   607  O  O   . GLY A 1 79  ? 7.203  12.278  13.430  1.00 36.63  ? 120 GLY A O   1 
ATOM   608  N  N   . SER A 1 80  ? 7.230  10.256  14.463  1.00 32.56  ? 121 SER A N   1 
ATOM   609  C  CA  . SER A 1 80  ? 8.675  10.106  14.434  1.00 33.50  ? 121 SER A CA  1 
ATOM   610  C  C   . SER A 1 80  ? 9.095  8.647   14.230  1.00 37.06  ? 121 SER A C   1 
ATOM   611  O  O   . SER A 1 80  ? 8.279  7.728   14.331  1.00 36.66  ? 121 SER A O   1 
ATOM   612  C  CB  . SER A 1 80  ? 9.302  10.687  15.710  1.00 39.07  ? 121 SER A CB  1 
ATOM   613  O  OG  . SER A 1 80  ? 8.703  10.168  16.879  1.00 54.32  ? 121 SER A OG  1 
ATOM   614  N  N   . ASP A 1 81  ? 10.367 8.450   13.905  1.00 36.51  ? 122 ASP A N   1 
ATOM   615  C  CA  . ASP A 1 81  ? 10.920 7.125   13.640  1.00 39.97  ? 122 ASP A CA  1 
ATOM   616  C  C   . ASP A 1 81  ? 12.337 7.008   14.179  1.00 40.84  ? 122 ASP A C   1 
ATOM   617  O  O   . ASP A 1 81  ? 13.281 7.585   13.616  1.00 47.37  ? 122 ASP A O   1 
ATOM   618  C  CB  . ASP A 1 81  ? 10.942 6.838   12.138  1.00 38.73  ? 122 ASP A CB  1 
ATOM   619  C  CG  . ASP A 1 81  ? 11.378 5.394   11.815  1.00 50.08  ? 122 ASP A CG  1 
ATOM   620  O  OD1 . ASP A 1 81  ? 10.839 4.462   12.453  1.00 54.42  ? 122 ASP A OD1 1 
ATOM   621  O  OD2 . ASP A 1 81  ? 12.239 5.180   10.914  1.00 48.77  ? 122 ASP A OD2 1 
ATOM   622  N  N   . SER A 1 82  ? 12.488 6.269   15.274  1.00 40.56  ? 123 SER A N   1 
ATOM   623  C  CA  . SER A 1 82  ? 13.802 6.066   15.899  1.00 41.36  ? 123 SER A CA  1 
ATOM   624  C  C   . SER A 1 82  ? 14.794 5.442   14.958  1.00 35.77  ? 123 SER A C   1 
ATOM   625  O  O   . SER A 1 82  ? 15.942 5.855   14.910  1.00 36.88  ? 123 SER A O   1 
ATOM   626  C  CB  . SER A 1 82  ? 13.675 5.177   17.130  1.00 44.12  ? 123 SER A CB  1 
ATOM   627  O  OG  . SER A 1 82  ? 12.836 5.804   18.074  1.00 54.95  ? 123 SER A OG  1 
ATOM   628  N  N   . LEU A 1 83  ? 14.366 4.459   14.179  1.00 38.86  ? 124 LEU A N   1 
ATOM   629  C  CA  . LEU A 1 83  ? 15.313 3.828   13.261  1.00 39.72  ? 124 LEU A CA  1 
ATOM   630  C  C   . LEU A 1 83  ? 15.957 4.756   12.221  1.00 45.19  ? 124 LEU A C   1 
ATOM   631  O  O   . LEU A 1 83  ? 17.052 4.470   11.719  1.00 44.34  ? 124 LEU A O   1 
ATOM   632  C  CB  . LEU A 1 83  ? 14.641 2.668   12.547  1.00 47.12  ? 124 LEU A CB  1 
ATOM   633  C  CG  . LEU A 1 83  ? 14.090 1.581   13.467  1.00 55.43  ? 124 LEU A CG  1 
ATOM   634  C  CD1 . LEU A 1 83  ? 13.469 0.467   12.597  1.00 54.81  ? 124 LEU A CD1 1 
ATOM   635  C  CD2 . LEU A 1 83  ? 15.217 1.035   14.354  1.00 56.13  ? 124 LEU A CD2 1 
ATOM   636  N  N   . THR A 1 84  ? 15.300 5.865   11.876  1.00 42.16  ? 125 THR A N   1 
ATOM   637  C  CA  . THR A 1 84  ? 15.895 6.765   10.893  1.00 39.13  ? 125 THR A CA  1 
ATOM   638  C  C   . THR A 1 84  ? 16.215 8.110   11.501  1.00 38.67  ? 125 THR A C   1 
ATOM   639  O  O   . THR A 1 84  ? 16.794 8.971   10.856  1.00 41.02  ? 125 THR A O   1 
ATOM   640  C  CB  . THR A 1 84  ? 14.958 6.955   9.646   1.00 40.24  ? 125 THR A CB  1 
ATOM   641  O  OG1 . THR A 1 84  ? 13.632 7.316   10.062  1.00 36.43  ? 125 THR A OG1 1 
ATOM   642  C  CG2 . THR A 1 84  ? 14.873 5.644   8.853   1.00 42.77  ? 125 THR A CG2 1 
ATOM   643  N  N   . ASP A 1 85  ? 15.914 8.253   12.782  1.00 36.07  ? 126 ASP A N   1 
ATOM   644  C  CA  . ASP A 1 85  ? 16.066 9.545   13.453  1.00 38.93  ? 126 ASP A CA  1 
ATOM   645  C  C   . ASP A 1 85  ? 15.348 10.641  12.619  1.00 32.64  ? 126 ASP A C   1 
ATOM   646  O  O   . ASP A 1 85  ? 15.868 11.732  12.435  1.00 34.19  ? 126 ASP A O   1 
ATOM   647  C  CB  . ASP A 1 85  ? 17.539 9.938   13.701  1.00 28.73  ? 126 ASP A CB  1 
ATOM   648  C  CG  . ASP A 1 85  ? 17.669 11.248  14.535  1.00 38.23  ? 126 ASP A CG  1 
ATOM   649  O  OD1 . ASP A 1 85  ? 16.835 11.485  15.440  1.00 41.50  ? 126 ASP A OD1 1 
ATOM   650  O  OD2 . ASP A 1 85  ? 18.600 12.051  14.299  1.00 43.61  ? 126 ASP A OD2 1 
ATOM   651  N  N   . LEU A 1 86  ? 14.162 10.319  12.096  1.00 33.59  ? 127 LEU A N   1 
ATOM   652  C  CA  . LEU A 1 86  ? 13.379 11.308  11.378  1.00 35.87  ? 127 LEU A CA  1 
ATOM   653  C  C   . LEU A 1 86  ? 12.061 11.569  12.098  1.00 34.79  ? 127 LEU A C   1 
ATOM   654  O  O   . LEU A 1 86  ? 11.511 10.677  12.734  1.00 35.42  ? 127 LEU A O   1 
ATOM   655  C  CB  . LEU A 1 86  ? 13.053 10.874  9.936   1.00 38.08  ? 127 LEU A CB  1 
ATOM   656  C  CG  . LEU A 1 86  ? 14.164 10.711  8.902   1.00 38.53  ? 127 LEU A CG  1 
ATOM   657  C  CD1 . LEU A 1 86  ? 13.501 10.549  7.529   1.00 33.41  ? 127 LEU A CD1 1 
ATOM   658  C  CD2 . LEU A 1 86  ? 15.111 11.922  8.914   1.00 32.68  ? 127 LEU A CD2 1 
ATOM   659  N  N   . ALA A 1 87  ? 11.594 12.817  12.025  1.00 25.22  ? 128 ALA A N   1 
ATOM   660  C  CA  . ALA A 1 87  ? 10.288 13.200  12.538  1.00 24.63  ? 128 ALA A CA  1 
ATOM   661  C  C   . ALA A 1 87  ? 9.612  14.114  11.452  1.00 26.89  ? 128 ALA A C   1 
ATOM   662  O  O   . ALA A 1 87  ? 10.304 14.768  10.656  1.00 31.87  ? 128 ALA A O   1 
ATOM   663  C  CB  . ALA A 1 87  ? 10.422 13.980  13.847  1.00 18.06  ? 128 ALA A CB  1 
ATOM   664  N  N   . VAL A 1 88  ? 8.281  14.164  11.457  1.00 24.23  ? 129 VAL A N   1 
ATOM   665  C  CA  . VAL A 1 88  ? 7.503  14.996  10.568  1.00 25.40  ? 129 VAL A CA  1 
ATOM   666  C  C   . VAL A 1 88  ? 6.668  15.984  11.381  1.00 27.63  ? 129 VAL A C   1 
ATOM   667  O  O   . VAL A 1 88  ? 6.002  15.603  12.356  1.00 28.70  ? 129 VAL A O   1 
ATOM   668  C  CB  . VAL A 1 88  ? 6.517  14.165  9.648   1.00 28.38  ? 129 VAL A CB  1 
ATOM   669  C  CG1 . VAL A 1 88  ? 5.586  15.156  8.829   1.00 23.65  ? 129 VAL A CG1 1 
ATOM   670  C  CG2 . VAL A 1 88  ? 7.337  13.320  8.644   1.00 26.82  ? 129 VAL A CG2 1 
ATOM   671  N  N   . LEU A 1 89  ? 6.733  17.257  10.988  1.00 21.61  ? 130 LEU A N   1 
ATOM   672  C  CA  . LEU A 1 89  ? 5.968  18.326  11.633  1.00 22.75  ? 130 LEU A CA  1 
ATOM   673  C  C   . LEU A 1 89  ? 4.962  18.871  10.622  1.00 28.67  ? 130 LEU A C   1 
ATOM   674  O  O   . LEU A 1 89  ? 5.087  18.683  9.396   1.00 28.09  ? 130 LEU A O   1 
ATOM   675  C  CB  . LEU A 1 89  ? 6.881  19.478  12.067  1.00 17.96  ? 130 LEU A CB  1 
ATOM   676  C  CG  . LEU A 1 89  ? 8.163  19.059  12.806  1.00 27.20  ? 130 LEU A CG  1 
ATOM   677  C  CD1 . LEU A 1 89  ? 8.991  20.293  13.004  1.00 13.26  ? 130 LEU A CD1 1 
ATOM   678  C  CD2 . LEU A 1 89  ? 7.817  18.418  14.172  1.00 29.42  ? 130 LEU A CD2 1 
ATOM   679  N  N   . LYS A 1 90  ? 4.005  19.606  11.148  1.00 29.45  ? 131 LYS A N   1 
ATOM   680  C  CA  . LYS A 1 90  ? 2.961  20.165  10.362  1.00 29.17  ? 131 LYS A CA  1 
ATOM   681  C  C   . LYS A 1 90  ? 2.724  21.577  10.813  1.00 29.25  ? 131 LYS A C   1 
ATOM   682  O  O   . LYS A 1 90  ? 2.416  21.796  11.979  1.00 27.30  ? 131 LYS A O   1 
ATOM   683  C  CB  . LYS A 1 90  ? 1.696  19.314  10.561  1.00 36.68  ? 131 LYS A CB  1 
ATOM   684  C  CG  . LYS A 1 90  ? 0.466  19.702  9.699   1.00 36.99  ? 131 LYS A CG  1 
ATOM   685  C  CD  . LYS A 1 90  ? 0.797  19.691  8.228   1.00 44.83  ? 131 LYS A CD  1 
ATOM   686  C  CE  . LYS A 1 90  ? -0.487 19.606  7.355   1.00 39.91  ? 131 LYS A CE  1 
ATOM   687  N  NZ  . LYS A 1 90  ? -1.262 20.879  7.347   1.00 34.60  ? 131 LYS A NZ  1 
ATOM   688  N  N   . ILE A 1 91  ? 2.954  22.547  9.926   1.00 17.79  ? 132 ILE A N   1 
ATOM   689  C  CA  . ILE A 1 91  ? 2.648  23.917  10.264  1.00 23.36  ? 132 ILE A CA  1 
ATOM   690  C  C   . ILE A 1 91  ? 1.356  24.283  9.490   1.00 31.51  ? 132 ILE A C   1 
ATOM   691  O  O   . ILE A 1 91  ? 0.984  23.599  8.515   1.00 27.86  ? 132 ILE A O   1 
ATOM   692  C  CB  . ILE A 1 91  ? 3.833  24.898  9.947   1.00 24.02  ? 132 ILE A CB  1 
ATOM   693  C  CG1 . ILE A 1 91  ? 4.239  24.850  8.456   1.00 19.73  ? 132 ILE A CG1 1 
ATOM   694  C  CG2 . ILE A 1 91  ? 5.005  24.576  10.924  1.00 22.01  ? 132 ILE A CG2 1 
ATOM   695  C  CD1 . ILE A 1 91  ? 5.194  26.009  8.049   1.00 17.05  ? 132 ILE A CD1 1 
ATOM   696  N  N   . ASN A 1 92  ? 0.648  25.304  9.958   1.00 35.77  ? 133 ASN A N   1 
ATOM   697  C  CA  . ASN A 1 92  ? -0.612 25.732  9.332   1.00 41.17  ? 133 ASN A CA  1 
ATOM   698  C  C   . ASN A 1 92  ? -0.193 26.836  8.399   1.00 41.82  ? 133 ASN A C   1 
ATOM   699  O  O   . ASN A 1 92  ? -0.147 27.995  8.777   1.00 39.82  ? 133 ASN A O   1 
ATOM   700  C  CB  . ASN A 1 92  ? -1.604 26.304  10.359  1.00 43.36  ? 133 ASN A CB  1 
ATOM   701  C  CG  . ASN A 1 92  ? -2.993 26.634  9.741   1.00 55.05  ? 133 ASN A CG  1 
ATOM   702  O  OD1 . ASN A 1 92  ? -3.659 27.599  10.151  1.00 51.63  ? 133 ASN A OD1 1 
ATOM   703  N  ND2 . ASN A 1 92  ? -3.434 25.815  8.778   1.00 47.24  ? 133 ASN A ND2 1 
ATOM   704  N  N   . ALA A 1 93  ? 0.124  26.446  7.176   1.00 45.97  ? 134 ALA A N   1 
ATOM   705  C  CA  . ALA A 1 93  ? 0.589  27.374  6.158   1.00 52.86  ? 134 ALA A CA  1 
ATOM   706  C  C   . ALA A 1 93  ? -0.471 28.372  5.705   1.00 47.78  ? 134 ALA A C   1 
ATOM   707  O  O   . ALA A 1 93  ? -1.533 27.988  5.296   1.00 36.42  ? 134 ALA A O   1 
ATOM   708  C  CB  . ALA A 1 93  ? 1.073  26.564  4.938   1.00 53.40  ? 134 ALA A CB  1 
ATOM   709  N  N   . THR A 1 94  ? -0.175 29.652  5.789   1.00 51.93  ? 135 THR A N   1 
ATOM   710  C  CA  . THR A 1 94  ? -1.102 30.660  5.304   1.00 50.50  ? 135 THR A CA  1 
ATOM   711  C  C   . THR A 1 94  ? -0.271 31.466  4.293   1.00 47.03  ? 135 THR A C   1 
ATOM   712  O  O   . THR A 1 94  ? 0.895  31.783  4.539   1.00 56.12  ? 135 THR A O   1 
ATOM   713  C  CB  . THR A 1 94  ? -1.597 31.567  6.456   1.00 58.88  ? 135 THR A CB  1 
ATOM   714  O  OG1 . THR A 1 94  ? -2.525 32.538  5.948   1.00 48.03  ? 135 THR A OG1 1 
ATOM   715  C  CG2 . THR A 1 94  ? -0.414 32.276  7.127   1.00 54.57  ? 135 THR A CG2 1 
ATOM   716  N  N   . GLY A 1 95  ? -0.828 31.737  3.129   1.00 36.86  ? 136 GLY A N   1 
ATOM   717  C  CA  . GLY A 1 95  ? -0.082 32.505  2.147   1.00 34.00  ? 136 GLY A CA  1 
ATOM   718  C  C   . GLY A 1 95  ? 0.997  31.808  1.333   1.00 23.69  ? 136 GLY A C   1 
ATOM   719  O  O   . GLY A 1 95  ? 1.833  32.462  0.720   1.00 30.60  ? 136 GLY A O   1 
ATOM   720  N  N   . GLY A 1 96  ? 1.002  30.493  1.290   1.00 25.03  ? 137 GLY A N   1 
ATOM   721  C  CA  . GLY A 1 96  ? 2.045  29.846  0.500   1.00 22.17  ? 137 GLY A CA  1 
ATOM   722  C  C   . GLY A 1 96  ? 3.353  29.653  1.268   1.00 29.63  ? 137 GLY A C   1 
ATOM   723  O  O   . GLY A 1 96  ? 3.697  30.435  2.123   1.00 26.59  ? 137 GLY A O   1 
ATOM   724  N  N   . LEU A 1 97  ? 4.100  28.622  0.907   1.00 24.80  ? 138 LEU A N   1 
ATOM   725  C  CA  . LEU A 1 97  ? 5.355  28.307  1.521   1.00 21.02  ? 138 LEU A CA  1 
ATOM   726  C  C   . LEU A 1 97  ? 6.382  27.910  0.485   1.00 23.05  ? 138 LEU A C   1 
ATOM   727  O  O   . LEU A 1 97  ? 6.033  27.406  -0.552  1.00 24.74  ? 138 LEU A O   1 
ATOM   728  C  CB  . LEU A 1 97  ? 5.215  27.085  2.441   1.00 18.53  ? 138 LEU A CB  1 
ATOM   729  C  CG  . LEU A 1 97  ? 4.364  27.216  3.721   1.00 25.37  ? 138 LEU A CG  1 
ATOM   730  C  CD1 . LEU A 1 97  ? 4.033  25.832  4.257   1.00 25.51  ? 138 LEU A CD1 1 
ATOM   731  C  CD2 . LEU A 1 97  ? 5.119  28.070  4.760   1.00 21.12  ? 138 LEU A CD2 1 
ATOM   732  N  N   . PRO A 1 98  ? 7.672  28.126  0.793   1.00 25.18  ? 139 PRO A N   1 
ATOM   733  C  CA  . PRO A 1 98  ? 8.805  27.757  -0.066  1.00 22.85  ? 139 PRO A CA  1 
ATOM   734  C  C   . PRO A 1 98  ? 8.914  26.233  0.173   1.00 25.99  ? 139 PRO A C   1 
ATOM   735  O  O   . PRO A 1 98  ? 8.703  25.747  1.321   1.00 27.08  ? 139 PRO A O   1 
ATOM   736  C  CB  . PRO A 1 98  ? 10.001 28.523  0.541   1.00 22.33  ? 139 PRO A CB  1 
ATOM   737  C  CG  . PRO A 1 98  ? 9.593  28.702  2.039   1.00 24.44  ? 139 PRO A CG  1 
ATOM   738  C  CD  . PRO A 1 98  ? 8.088  28.910  1.990   1.00 26.71  ? 139 PRO A CD  1 
ATOM   739  N  N   . THR A 1 99  ? 9.218  25.466  -0.872  1.00 20.22  ? 140 THR A N   1 
ATOM   740  C  CA  . THR A 1 99  ? 9.313  24.022  -0.712  1.00 20.50  ? 140 THR A CA  1 
ATOM   741  C  C   . THR A 1 99  ? 10.569 23.520  -1.336  1.00 19.96  ? 140 THR A C   1 
ATOM   742  O  O   . THR A 1 99  ? 11.014 24.080  -2.320  1.00 26.27  ? 140 THR A O   1 
ATOM   743  C  CB  . THR A 1 99  ? 8.078  23.303  -1.287  1.00 34.24  ? 140 THR A CB  1 
ATOM   744  O  OG1 . THR A 1 99  ? 7.980  23.569  -2.688  1.00 27.87  ? 140 THR A OG1 1 
ATOM   745  C  CG2 . THR A 1 99  ? 6.785  23.788  -0.553  1.00 28.55  ? 140 THR A CG2 1 
ATOM   746  N  N   . ILE A 1 100 ? 11.126 22.433  -0.796  1.00 13.64  ? 141 ILE A N   1 
ATOM   747  C  CA  . ILE A 1 100 ? 12.406 21.947  -1.284  1.00 16.67  ? 141 ILE A CA  1 
ATOM   748  C  C   . ILE A 1 100 ? 12.312 21.314  -2.685  1.00 18.81  ? 141 ILE A C   1 
ATOM   749  O  O   . ILE A 1 100 ? 11.392 20.575  -2.957  1.00 15.95  ? 141 ILE A O   1 
ATOM   750  C  CB  . ILE A 1 100 ? 13.018 20.892  -0.265  1.00 9.95   ? 141 ILE A CB  1 
ATOM   751  C  CG1 . ILE A 1 100 ? 14.463 20.618  -0.578  1.00 9.96   ? 141 ILE A CG1 1 
ATOM   752  C  CG2 . ILE A 1 100 ? 12.232 19.565  -0.272  1.00 13.98  ? 141 ILE A CG2 1 
ATOM   753  C  CD1 . ILE A 1 100 ? 15.406 21.790  -0.140  1.00 16.16  ? 141 ILE A CD1 1 
ATOM   754  N  N   . PRO A 1 101 ? 13.254 21.617  -3.571  1.00 18.51  ? 142 PRO A N   1 
ATOM   755  C  CA  . PRO A 1 101 ? 13.190 20.996  -4.923  1.00 22.45  ? 142 PRO A CA  1 
ATOM   756  C  C   . PRO A 1 101 ? 13.477 19.509  -4.773  1.00 25.71  ? 142 PRO A C   1 
ATOM   757  O  O   . PRO A 1 101 ? 14.401 19.074  -4.046  1.00 26.87  ? 142 PRO A O   1 
ATOM   758  C  CB  . PRO A 1 101 ? 14.299 21.691  -5.722  1.00 17.78  ? 142 PRO A CB  1 
ATOM   759  C  CG  . PRO A 1 101 ? 14.412 23.059  -5.018  1.00 28.49  ? 142 PRO A CG  1 
ATOM   760  C  CD  . PRO A 1 101 ? 14.259 22.692  -3.509  1.00 15.59  ? 142 PRO A CD  1 
ATOM   761  N  N   . ILE A 1 102 ? 12.640 18.714  -5.399  1.00 24.12  ? 143 ILE A N   1 
ATOM   762  C  CA  . ILE A 1 102 ? 12.800 17.277  -5.350  1.00 32.43  ? 143 ILE A CA  1 
ATOM   763  C  C   . ILE A 1 102 ? 12.693 16.717  -6.783  1.00 41.82  ? 143 ILE A C   1 
ATOM   764  O  O   . ILE A 1 102 ? 11.923 17.216  -7.618  1.00 33.67  ? 143 ILE A O   1 
ATOM   765  C  CB  . ILE A 1 102 ? 11.695 16.631  -4.484  1.00 36.56  ? 143 ILE A CB  1 
ATOM   766  C  CG1 . ILE A 1 102 ? 12.070 16.668  -3.003  1.00 46.32  ? 143 ILE A CG1 1 
ATOM   767  C  CG2 . ILE A 1 102 ? 11.521 15.187  -4.848  1.00 47.66  ? 143 ILE A CG2 1 
ATOM   768  C  CD1 . ILE A 1 102 ? 11.063 15.935  -2.095  1.00 44.00  ? 143 ILE A CD1 1 
ATOM   769  N  N   . ASN A 1 103 ? 13.485 15.698  -7.076  1.00 39.08  ? 144 ASN A N   1 
ATOM   770  C  CA  . ASN A 1 103 ? 13.403 15.059  -8.380  1.00 35.32  ? 144 ASN A CA  1 
ATOM   771  C  C   . ASN A 1 103 ? 13.388 13.578  -8.070  1.00 35.48  ? 144 ASN A C   1 
ATOM   772  O  O   . ASN A 1 103 ? 14.433 12.955  -7.932  1.00 34.32  ? 144 ASN A O   1 
ATOM   773  C  CB  . ASN A 1 103 ? 14.605 15.394  -9.252  1.00 38.87  ? 144 ASN A CB  1 
ATOM   774  C  CG  . ASN A 1 103 ? 14.404 14.930  -10.703 1.00 47.62  ? 144 ASN A CG  1 
ATOM   775  O  OD1 . ASN A 1 103 ? 13.630 13.992  -10.965 1.00 43.15  ? 144 ASN A OD1 1 
ATOM   776  N  ND2 . ASN A 1 103 ? 15.098 15.575  -11.638 1.00 44.65  ? 144 ASN A ND2 1 
ATOM   777  N  N   . ALA A 1 104 ? 12.194 13.021  -7.935  1.00 34.57  ? 145 ALA A N   1 
ATOM   778  C  CA  . ALA A 1 104 ? 12.039 11.618  -7.599  1.00 37.35  ? 145 ALA A CA  1 
ATOM   779  C  C   . ALA A 1 104 ? 12.642 10.621  -8.598  1.00 39.46  ? 145 ALA A C   1 
ATOM   780  O  O   . ALA A 1 104 ? 12.853 9.458   -8.266  1.00 42.43  ? 145 ALA A O   1 
ATOM   781  C  CB  . ALA A 1 104 ? 10.568 11.316  -7.373  1.00 39.96  ? 145 ALA A CB  1 
ATOM   782  N  N   . ARG A 1 105 ? 12.927 11.056  -9.814  1.00 37.16  ? 146 ARG A N   1 
ATOM   783  C  CA  . ARG A 1 105 ? 13.520 10.140  -10.775 1.00 47.52  ? 146 ARG A CA  1 
ATOM   784  C  C   . ARG A 1 105 ? 15.035 10.251  -10.767 1.00 48.04  ? 146 ARG A C   1 
ATOM   785  O  O   . ARG A 1 105 ? 15.721 9.415   -11.350 1.00 50.88  ? 146 ARG A O   1 
ATOM   786  C  CB  . ARG A 1 105 ? 13.015 10.421  -12.195 1.00 50.89  ? 146 ARG A CB  1 
ATOM   787  C  CG  . ARG A 1 105 ? 11.537 10.110  -12.421 1.00 59.38  ? 146 ARG A CG  1 
ATOM   788  C  CD  . ARG A 1 105 ? 11.204 10.444  -13.860 1.00 71.61  ? 146 ARG A CD  1 
ATOM   789  N  NE  . ARG A 1 105 ? 9.826  10.147  -14.218 1.00 82.24  ? 146 ARG A NE  1 
ATOM   790  C  CZ  . ARG A 1 105 ? 9.334  10.300  -15.442 1.00 85.40  ? 146 ARG A CZ  1 
ATOM   791  N  NH1 . ARG A 1 105 ? 10.109 10.748  -16.427 1.00 86.28  ? 146 ARG A NH1 1 
ATOM   792  N  NH2 . ARG A 1 105 ? 8.069  9.998   -15.686 1.00 89.45  ? 146 ARG A NH2 1 
ATOM   793  N  N   . ARG A 1 106 ? 15.571 11.282  -10.128 1.00 43.68  ? 147 ARG A N   1 
ATOM   794  C  CA  . ARG A 1 106 ? 17.022 11.417  -10.093 1.00 45.60  ? 147 ARG A CA  1 
ATOM   795  C  C   . ARG A 1 106 ? 17.697 10.266  -9.304  1.00 43.90  ? 147 ARG A C   1 
ATOM   796  O  O   . ARG A 1 106 ? 17.266 9.904   -8.208  1.00 40.23  ? 147 ARG A O   1 
ATOM   797  C  CB  . ARG A 1 106 ? 17.402 12.763  -9.490  1.00 42.21  ? 147 ARG A CB  1 
ATOM   798  C  CG  . ARG A 1 106 ? 18.882 13.006  -9.453  1.00 48.95  ? 147 ARG A CG  1 
ATOM   799  C  CD  . ARG A 1 106 ? 19.201 14.252  -10.218 1.00 46.82  ? 147 ARG A CD  1 
ATOM   800  N  NE  . ARG A 1 106 ? 19.523 13.957  -11.587 1.00 52.93  ? 147 ARG A NE  1 
ATOM   801  C  CZ  . ARG A 1 106 ? 19.272 14.762  -12.615 1.00 47.91  ? 147 ARG A CZ  1 
ATOM   802  N  NH1 . ARG A 1 106 ? 18.677 15.931  -12.443 1.00 39.42  ? 147 ARG A NH1 1 
ATOM   803  N  NH2 . ARG A 1 106 ? 19.642 14.391  -13.825 1.00 49.91  ? 147 ARG A NH2 1 
ATOM   804  N  N   . VAL A 1 107 ? 18.733 9.663   -9.879  1.00 37.82  ? 148 VAL A N   1 
ATOM   805  C  CA  . VAL A 1 107 ? 19.413 8.584   -9.172  1.00 40.41  ? 148 VAL A CA  1 
ATOM   806  C  C   . VAL A 1 107 ? 20.719 9.171   -8.661  1.00 41.66  ? 148 VAL A C   1 
ATOM   807  O  O   . VAL A 1 107 ? 21.546 9.646   -9.444  1.00 37.54  ? 148 VAL A O   1 
ATOM   808  C  CB  . VAL A 1 107 ? 19.660 7.336   -10.083 1.00 50.78  ? 148 VAL A CB  1 
ATOM   809  C  CG1 . VAL A 1 107 ? 20.346 7.755   -11.360 1.00 59.33  ? 148 VAL A CG1 1 
ATOM   810  C  CG2 . VAL A 1 107 ? 20.508 6.262   -9.337  1.00 41.78  ? 148 VAL A CG2 1 
ATOM   811  N  N   . PRO A 1 108 ? 20.880 9.215   -7.322  1.00 35.56  ? 149 PRO A N   1 
ATOM   812  C  CA  . PRO A 1 108 ? 22.097 9.758   -6.702  1.00 37.08  ? 149 PRO A CA  1 
ATOM   813  C  C   . PRO A 1 108 ? 23.297 8.846   -7.048  1.00 38.79  ? 149 PRO A C   1 
ATOM   814  O  O   . PRO A 1 108 ? 23.166 7.630   -7.063  1.00 37.92  ? 149 PRO A O   1 
ATOM   815  C  CB  . PRO A 1 108 ? 21.792 9.721   -5.197  1.00 37.66  ? 149 PRO A CB  1 
ATOM   816  C  CG  . PRO A 1 108 ? 20.260 9.556   -5.094  1.00 38.57  ? 149 PRO A CG  1 
ATOM   817  C  CD  . PRO A 1 108 ? 19.916 8.728   -6.313  1.00 37.80  ? 149 PRO A CD  1 
ATOM   818  N  N   . HIS A 1 109 ? 24.449 9.449   -7.336  1.00 36.80  ? 150 HIS A N   1 
ATOM   819  C  CA  . HIS A 1 109 ? 25.657 8.708   -7.646  1.00 35.97  ? 150 HIS A CA  1 
ATOM   820  C  C   . HIS A 1 109 ? 26.787 9.117   -6.710  1.00 39.02  ? 150 HIS A C   1 
ATOM   821  O  O   . HIS A 1 109 ? 26.967 10.319  -6.359  1.00 27.83  ? 150 HIS A O   1 
ATOM   822  C  CB  . HIS A 1 109 ? 26.135 8.971   -9.087  1.00 39.96  ? 150 HIS A CB  1 
ATOM   823  C  CG  . HIS A 1 109 ? 25.169 8.543   -10.147 1.00 49.39  ? 150 HIS A CG  1 
ATOM   824  N  ND1 . HIS A 1 109 ? 24.691 7.252   -10.246 1.00 55.51  ? 150 HIS A ND1 1 
ATOM   825  C  CD2 . HIS A 1 109 ? 24.640 9.219   -11.196 1.00 49.51  ? 150 HIS A CD2 1 
ATOM   826  C  CE1 . HIS A 1 109 ? 23.915 7.150   -11.311 1.00 52.75  ? 150 HIS A CE1 1 
ATOM   827  N  NE2 . HIS A 1 109 ? 23.870 8.328   -11.906 1.00 51.77  ? 150 HIS A NE2 1 
ATOM   828  N  N   . ILE A 1 110 ? 27.559 8.104   -6.329  1.00 34.51  ? 151 ILE A N   1 
ATOM   829  C  CA  . ILE A 1 110 ? 28.726 8.292   -5.502  1.00 30.14  ? 151 ILE A CA  1 
ATOM   830  C  C   . ILE A 1 110 ? 29.592 9.260   -6.294  1.00 29.71  ? 151 ILE A C   1 
ATOM   831  O  O   . ILE A 1 110 ? 29.777 9.099   -7.512  1.00 32.14  ? 151 ILE A O   1 
ATOM   832  C  CB  . ILE A 1 110 ? 29.443 6.962   -5.312  1.00 32.40  ? 151 ILE A CB  1 
ATOM   833  C  CG1 . ILE A 1 110 ? 28.543 6.021   -4.519  1.00 28.77  ? 151 ILE A CG1 1 
ATOM   834  C  CG2 . ILE A 1 110 ? 30.747 7.171   -4.544  1.00 33.01  ? 151 ILE A CG2 1 
ATOM   835  C  CD1 . ILE A 1 110 ? 29.056 4.555   -4.466  1.00 39.47  ? 151 ILE A CD1 1 
ATOM   836  N  N   . GLY A 1 111 ? 30.090 10.285  -5.622  1.00 31.97  ? 152 GLY A N   1 
ATOM   837  C  CA  . GLY A 1 111 ? 30.880 11.297  -6.301  1.00 26.64  ? 152 GLY A CA  1 
ATOM   838  C  C   . GLY A 1 111 ? 30.068 12.545  -6.679  1.00 30.41  ? 152 GLY A C   1 
ATOM   839  O  O   . GLY A 1 111 ? 30.658 13.548  -7.106  1.00 28.15  ? 152 GLY A O   1 
ATOM   840  N  N   . ASP A 1 112 ? 28.734 12.509  -6.568  1.00 28.36  ? 153 ASP A N   1 
ATOM   841  C  CA  . ASP A 1 112 ? 27.942 13.727  -6.898  1.00 26.63  ? 153 ASP A CA  1 
ATOM   842  C  C   . ASP A 1 112 ? 28.282 14.784  -5.872  1.00 28.87  ? 153 ASP A C   1 
ATOM   843  O  O   . ASP A 1 112 ? 28.395 14.480  -4.675  1.00 23.83  ? 153 ASP A O   1 
ATOM   844  C  CB  . ASP A 1 112 ? 26.416 13.488  -6.824  1.00 23.84  ? 153 ASP A CB  1 
ATOM   845  C  CG  . ASP A 1 112 ? 25.885 12.614  -7.993  1.00 37.47  ? 153 ASP A CG  1 
ATOM   846  O  OD1 . ASP A 1 112 ? 26.565 12.554  -9.048  1.00 39.92  ? 153 ASP A OD1 1 
ATOM   847  O  OD2 . ASP A 1 112 ? 24.801 11.987  -7.865  1.00 33.18  ? 153 ASP A OD2 1 
ATOM   848  N  N   . VAL A 1 113 ? 28.457 16.014  -6.337  1.00 28.81  ? 154 VAL A N   1 
ATOM   849  C  CA  . VAL A 1 113 ? 28.723 17.122  -5.444  1.00 26.56  ? 154 VAL A CA  1 
ATOM   850  C  C   . VAL A 1 113 ? 27.436 17.346  -4.648  1.00 28.93  ? 154 VAL A C   1 
ATOM   851  O  O   . VAL A 1 113 ? 26.331 17.221  -5.173  1.00 25.51  ? 154 VAL A O   1 
ATOM   852  C  CB  . VAL A 1 113 ? 29.100 18.360  -6.237  1.00 31.83  ? 154 VAL A CB  1 
ATOM   853  C  CG1 . VAL A 1 113 ? 29.129 19.595  -5.331  1.00 24.61  ? 154 VAL A CG1 1 
ATOM   854  C  CG2 . VAL A 1 113 ? 30.443 18.101  -6.906  1.00 27.93  ? 154 VAL A CG2 1 
ATOM   855  N  N   . VAL A 1 114 ? 27.587 17.685  -3.376  1.00 25.98  ? 155 VAL A N   1 
ATOM   856  C  CA  . VAL A 1 114 ? 26.443 17.865  -2.492  1.00 23.15  ? 155 VAL A CA  1 
ATOM   857  C  C   . VAL A 1 114 ? 26.660 19.116  -1.591  1.00 28.22  ? 155 VAL A C   1 
ATOM   858  O  O   . VAL A 1 114 ? 27.796 19.511  -1.289  1.00 26.38  ? 155 VAL A O   1 
ATOM   859  C  CB  . VAL A 1 114 ? 26.294 16.482  -1.764  1.00 30.31  ? 155 VAL A CB  1 
ATOM   860  C  CG1 . VAL A 1 114 ? 26.644 16.547  -0.333  1.00 32.94  ? 155 VAL A CG1 1 
ATOM   861  C  CG2 . VAL A 1 114 ? 24.975 15.838  -2.100  1.00 24.26  ? 155 VAL A CG2 1 
ATOM   862  N  N   . LEU A 1 115 ? 25.576 19.808  -1.268  1.00 22.70  ? 156 LEU A N   1 
ATOM   863  C  CA  . LEU A 1 115 ? 25.656 20.942  -0.393  1.00 23.66  ? 156 LEU A CA  1 
ATOM   864  C  C   . LEU A 1 115 ? 24.777 20.571  0.803   1.00 28.14  ? 156 LEU A C   1 
ATOM   865  O  O   . LEU A 1 115 ? 23.677 20.057  0.610   1.00 19.74  ? 156 LEU A O   1 
ATOM   866  C  CB  . LEU A 1 115 ? 25.093 22.212  -1.034  1.00 25.88  ? 156 LEU A CB  1 
ATOM   867  C  CG  . LEU A 1 115 ? 25.771 22.766  -2.291  1.00 34.90  ? 156 LEU A CG  1 
ATOM   868  C  CD1 . LEU A 1 115 ? 25.184 24.141  -2.520  1.00 36.72  ? 156 LEU A CD1 1 
ATOM   869  C  CD2 . LEU A 1 115 ? 27.310 22.838  -2.139  1.00 28.08  ? 156 LEU A CD2 1 
ATOM   870  N  N   . ALA A 1 116 ? 25.282 20.836  2.010   1.00 21.73  ? 157 ALA A N   1 
ATOM   871  C  CA  . ALA A 1 116 ? 24.550 20.600  3.272   1.00 23.86  ? 157 ALA A CA  1 
ATOM   872  C  C   . ALA A 1 116 ? 24.085 21.972  3.698   1.00 19.78  ? 157 ALA A C   1 
ATOM   873  O  O   . ALA A 1 116 ? 24.872 22.910  3.793   1.00 23.80  ? 157 ALA A O   1 
ATOM   874  C  CB  . ALA A 1 116 ? 25.501 19.968  4.383   1.00 20.01  ? 157 ALA A CB  1 
ATOM   875  N  N   . ILE A 1 117 ? 22.789 22.114  3.905   1.00 21.93  ? 158 ILE A N   1 
ATOM   876  C  CA  . ILE A 1 117 ? 22.238 23.404  4.266   1.00 22.07  ? 158 ILE A CA  1 
ATOM   877  C  C   . ILE A 1 117 ? 21.675 23.327  5.685   1.00 26.37  ? 158 ILE A C   1 
ATOM   878  O  O   . ILE A 1 117 ? 20.767 22.543  5.980   1.00 22.90  ? 158 ILE A O   1 
ATOM   879  C  CB  . ILE A 1 117 ? 21.110 23.774  3.293   1.00 19.97  ? 158 ILE A CB  1 
ATOM   880  C  CG1 . ILE A 1 117 ? 21.653 23.753  1.850   1.00 26.73  ? 158 ILE A CG1 1 
ATOM   881  C  CG2 . ILE A 1 117 ? 20.516 25.158  3.672   1.00 17.01  ? 158 ILE A CG2 1 
ATOM   882  C  CD1 . ILE A 1 117 ? 20.557 23.980  0.802   1.00 19.61  ? 158 ILE A CD1 1 
ATOM   883  N  N   . GLY A 1 118 ? 22.207 24.138  6.571   1.00 30.43  ? 159 GLY A N   1 
ATOM   884  C  CA  . GLY A 1 118 ? 21.716 24.091  7.927   1.00 33.02  ? 159 GLY A CA  1 
ATOM   885  C  C   . GLY A 1 118 ? 21.547 25.493  8.412   1.00 44.12  ? 159 GLY A C   1 
ATOM   886  O  O   . GLY A 1 118 ? 22.281 26.383  7.999   1.00 47.78  ? 159 GLY A O   1 
ATOM   887  N  N   . ASN A 1 119 ? 20.556 25.718  9.266   1.00 61.53  ? 160 ASN A N   1 
ATOM   888  C  CA  . ASN A 1 119 ? 20.336 27.062  9.809   1.00 64.62  ? 160 ASN A CA  1 
ATOM   889  C  C   . ASN A 1 119 ? 20.756 27.104  11.271  1.00 71.04  ? 160 ASN A C   1 
ATOM   890  O  O   . ASN A 1 119 ? 19.918 27.292  12.149  1.00 68.71  ? 160 ASN A O   1 
ATOM   891  C  CB  . ASN A 1 119 ? 18.875 27.472  9.705   1.00 47.20  ? 160 ASN A CB  1 
ATOM   892  C  CG  . ASN A 1 119 ? 18.352 27.454  8.267   1.00 63.56  ? 160 ASN A CG  1 
ATOM   893  O  OD1 . ASN A 1 119 ? 17.327 28.084  7.957   1.00 48.97  ? 160 ASN A OD1 1 
ATOM   894  N  ND2 . ASN A 1 119 ? 19.048 26.725  7.381   1.00 64.63  ? 160 ASN A ND2 1 
ATOM   895  N  N   . PRO A 1 120 ? 22.058 26.905  11.554  1.00 76.12  ? 161 PRO A N   1 
ATOM   896  C  CA  . PRO A 1 120 ? 22.466 26.950  12.958  1.00 84.23  ? 161 PRO A CA  1 
ATOM   897  C  C   . PRO A 1 120 ? 22.055 28.293  13.581  1.00 89.88  ? 161 PRO A C   1 
ATOM   898  O  O   . PRO A 1 120 ? 22.214 29.355  12.964  1.00 88.13  ? 161 PRO A O   1 
ATOM   899  C  CB  . PRO A 1 120 ? 23.985 26.762  12.884  1.00 87.41  ? 161 PRO A CB  1 
ATOM   900  C  CG  . PRO A 1 120 ? 24.343 27.326  11.538  1.00 85.65  ? 161 PRO A CG  1 
ATOM   901  C  CD  . PRO A 1 120 ? 23.230 26.771  10.675  1.00 81.05  ? 161 PRO A CD  1 
ATOM   902  N  N   . TYR A 1 121 ? 21.505 28.227  14.793  1.00 93.14  ? 162 TYR A N   1 
ATOM   903  C  CA  . TYR A 1 121 ? 21.056 29.409  15.524  1.00 95.47  ? 162 TYR A CA  1 
ATOM   904  C  C   . TYR A 1 121 ? 22.264 30.168  16.091  1.00 94.83  ? 162 TYR A C   1 
ATOM   905  O  O   . TYR A 1 121 ? 22.138 31.274  16.627  1.00 94.41  ? 162 TYR A O   1 
ATOM   906  C  CB  . TYR A 1 121 ? 20.131 28.964  16.650  1.00 99.78  ? 162 TYR A CB  1 
ATOM   907  C  CG  . TYR A 1 121 ? 19.397 30.068  17.375  1.00 104.54 ? 162 TYR A CG  1 
ATOM   908  C  CD1 . TYR A 1 121 ? 18.400 30.804  16.738  1.00 104.47 ? 162 TYR A CD1 1 
ATOM   909  C  CD2 . TYR A 1 121 ? 19.661 30.336  18.723  1.00 104.76 ? 162 TYR A CD2 1 
ATOM   910  C  CE1 . TYR A 1 121 ? 17.677 31.774  17.427  1.00 107.79 ? 162 TYR A CE1 1 
ATOM   911  C  CE2 . TYR A 1 121 ? 18.948 31.301  19.418  1.00 105.78 ? 162 TYR A CE2 1 
ATOM   912  C  CZ  . TYR A 1 121 ? 17.955 32.015  18.768  1.00 108.04 ? 162 TYR A CZ  1 
ATOM   913  O  OH  . TYR A 1 121 ? 17.225 32.953  19.462  1.00 110.67 ? 162 TYR A OH  1 
ATOM   914  N  N   . ASN A 1 122 ? 23.437 29.562  15.954  1.00 93.35  ? 163 ASN A N   1 
ATOM   915  C  CA  . ASN A 1 122 ? 24.675 30.162  16.427  1.00 91.58  ? 163 ASN A CA  1 
ATOM   916  C  C   . ASN A 1 122 ? 25.394 31.003  15.346  1.00 90.22  ? 163 ASN A C   1 
ATOM   917  O  O   . ASN A 1 122 ? 26.304 31.780  15.667  1.00 92.49  ? 163 ASN A O   1 
ATOM   918  C  CB  . ASN A 1 122 ? 25.613 29.059  16.976  1.00 89.86  ? 163 ASN A CB  1 
ATOM   919  C  CG  . ASN A 1 122 ? 25.961 27.982  15.934  1.00 88.78  ? 163 ASN A CG  1 
ATOM   920  O  OD1 . ASN A 1 122 ? 25.085 27.287  15.407  1.00 80.19  ? 163 ASN A OD1 1 
ATOM   921  N  ND2 . ASN A 1 122 ? 27.253 27.840  15.646  1.00 86.45  ? 163 ASN A ND2 1 
ATOM   922  N  N   . LEU A 1 123 ? 24.979 30.874  14.081  1.00 81.69  ? 164 LEU A N   1 
ATOM   923  C  CA  . LEU A 1 123 ? 25.630 31.615  12.995  1.00 74.65  ? 164 LEU A CA  1 
ATOM   924  C  C   . LEU A 1 123 ? 24.817 31.861  11.709  1.00 66.55  ? 164 LEU A C   1 
ATOM   925  O  O   . LEU A 1 123 ? 25.399 32.126  10.658  1.00 64.07  ? 164 LEU A O   1 
ATOM   926  C  CB  . LEU A 1 123 ? 26.952 30.911  12.618  1.00 76.58  ? 164 LEU A CB  1 
ATOM   927  C  CG  . LEU A 1 123 ? 28.112 30.944  13.630  1.00 77.11  ? 164 LEU A CG  1 
ATOM   928  C  CD1 . LEU A 1 123 ? 29.237 30.028  13.171  1.00 75.68  ? 164 LEU A CD1 1 
ATOM   929  C  CD2 . LEU A 1 123 ? 28.618 32.377  13.792  1.00 75.44  ? 164 LEU A CD2 1 
ATOM   930  N  N   . GLY A 1 124 ? 23.490 31.777  11.779  1.00 60.89  ? 165 GLY A N   1 
ATOM   931  C  CA  . GLY A 1 124 ? 22.667 31.994  10.589  1.00 54.81  ? 165 GLY A CA  1 
ATOM   932  C  C   . GLY A 1 124 ? 22.668 30.787  9.656   1.00 46.98  ? 165 GLY A C   1 
ATOM   933  O  O   . GLY A 1 124 ? 23.305 29.771  9.966   1.00 46.75  ? 165 GLY A O   1 
ATOM   934  N  N   . GLN A 1 125 ? 21.980 30.867  8.517   1.00 40.21  ? 166 GLN A N   1 
ATOM   935  C  CA  . GLN A 1 125 ? 21.970 29.716  7.602   1.00 39.26  ? 166 GLN A CA  1 
ATOM   936  C  C   . GLN A 1 125 ? 23.380 29.453  7.042   1.00 31.24  ? 166 GLN A C   1 
ATOM   937  O  O   . GLN A 1 125 ? 24.049 30.348  6.557   1.00 33.99  ? 166 GLN A O   1 
ATOM   938  C  CB  . GLN A 1 125 ? 20.953 29.934  6.448   1.00 47.08  ? 166 GLN A CB  1 
ATOM   939  C  CG  . GLN A 1 125 ? 20.572 28.651  5.695   1.00 38.41  ? 166 GLN A CG  1 
ATOM   940  C  CD  . GLN A 1 125 ? 19.519 28.852  4.601   1.00 39.67  ? 166 GLN A CD  1 
ATOM   941  O  OE1 . GLN A 1 125 ? 18.388 28.345  4.675   1.00 38.28  ? 166 GLN A OE1 1 
ATOM   942  N  NE2 . GLN A 1 125 ? 19.893 29.578  3.584   1.00 32.06  ? 166 GLN A NE2 1 
ATOM   943  N  N   . THR A 1 126 ? 23.844 28.222  7.138   1.00 25.93  ? 167 THR A N   1 
ATOM   944  C  CA  . THR A 1 126 ? 25.163 27.875  6.624   1.00 29.85  ? 167 THR A CA  1 
ATOM   945  C  C   . THR A 1 126 ? 25.051 26.789  5.541   1.00 23.99  ? 167 THR A C   1 
ATOM   946  O  O   . THR A 1 126 ? 24.096 25.985  5.511   1.00 23.60  ? 167 THR A O   1 
ATOM   947  C  CB  . THR A 1 126 ? 26.079 27.302  7.729   1.00 31.88  ? 167 THR A CB  1 
ATOM   948  O  OG1 . THR A 1 126 ? 25.462 26.128  8.271   1.00 56.27  ? 167 THR A OG1 1 
ATOM   949  C  CG2 . THR A 1 126 ? 26.267 28.304  8.854   1.00 48.77  ? 167 THR A CG2 1 
ATOM   950  N  N   . ILE A 1 127 ? 26.080 26.741  4.713   1.00 22.96  ? 168 ILE A N   1 
ATOM   951  C  CA  . ILE A 1 127 ? 26.171 25.822  3.603   1.00 30.00  ? 168 ILE A CA  1 
ATOM   952  C  C   . ILE A 1 127 ? 27.568 25.297  3.544   1.00 27.72  ? 168 ILE A C   1 
ATOM   953  O  O   . ILE A 1 127 ? 28.525 26.065  3.612   1.00 27.14  ? 168 ILE A O   1 
ATOM   954  C  CB  . ILE A 1 127 ? 25.951 26.537  2.220   1.00 29.04  ? 168 ILE A CB  1 
ATOM   955  C  CG1 . ILE A 1 127 ? 24.874 27.628  2.330   1.00 34.37  ? 168 ILE A CG1 1 
ATOM   956  C  CG2 . ILE A 1 127 ? 25.571 25.492  1.134   1.00 27.82  ? 168 ILE A CG2 1 
ATOM   957  C  CD1 . ILE A 1 127 ? 23.451 27.155  2.231   1.00 22.39  ? 168 ILE A CD1 1 
ATOM   958  N  N   . THR A 1 128 ? 27.713 23.992  3.373   1.00 29.13  ? 169 THR A N   1 
ATOM   959  C  CA  . THR A 1 128 ? 29.061 23.438  3.219   1.00 25.89  ? 169 THR A CA  1 
ATOM   960  C  C   . THR A 1 128 ? 28.983 22.432  2.087   1.00 23.40  ? 169 THR A C   1 
ATOM   961  O  O   . THR A 1 128 ? 27.893 21.988  1.743   1.00 26.28  ? 169 THR A O   1 
ATOM   962  C  CB  . THR A 1 128 ? 29.515 22.737  4.486   1.00 29.48  ? 169 THR A CB  1 
ATOM   963  O  OG1 . THR A 1 128 ? 28.622 21.653  4.764   1.00 27.12  ? 169 THR A OG1 1 
ATOM   964  C  CG2 . THR A 1 128 ? 29.511 23.745  5.688   1.00 36.39  ? 169 THR A CG2 1 
ATOM   965  N  N   . GLN A 1 129 ? 30.110 22.102  1.463   1.00 27.15  ? 170 GLN A N   1 
ATOM   966  C  CA  . GLN A 1 129 ? 30.047 21.126  0.403   1.00 30.21  ? 170 GLN A CA  1 
ATOM   967  C  C   . GLN A 1 129 ? 31.022 19.999  0.487   1.00 28.76  ? 170 GLN A C   1 
ATOM   968  O  O   . GLN A 1 129 ? 32.079 20.104  1.096   1.00 26.81  ? 170 GLN A O   1 
ATOM   969  C  CB  . GLN A 1 129 ? 30.153 21.751  -0.990  1.00 30.67  ? 170 GLN A CB  1 
ATOM   970  C  CG  . GLN A 1 129 ? 31.418 22.334  -1.356  1.00 37.55  ? 170 GLN A CG  1 
ATOM   971  C  CD  . GLN A 1 129 ? 32.376 21.396  -2.072  1.00 41.37  ? 170 GLN A CD  1 
ATOM   972  O  OE1 . GLN A 1 129 ? 32.029 20.297  -2.557  1.00 42.64  ? 170 GLN A OE1 1 
ATOM   973  N  NE2 . GLN A 1 129 ? 33.610 21.845  -2.152  1.00 32.87  ? 170 GLN A NE2 1 
ATOM   974  N  N   . GLY A 1 130 ? 30.601 18.907  -0.129  1.00 24.25  ? 171 GLY A N   1 
ATOM   975  C  CA  . GLY A 1 130 ? 31.394 17.702  -0.210  1.00 26.58  ? 171 GLY A CA  1 
ATOM   976  C  C   . GLY A 1 130 ? 30.820 16.913  -1.377  1.00 26.48  ? 171 GLY A C   1 
ATOM   977  O  O   . GLY A 1 130 ? 30.308 17.467  -2.361  1.00 24.79  ? 171 GLY A O   1 
ATOM   978  N  N   . ILE A 1 131 ? 30.896 15.608  -1.276  1.00 20.14  ? 172 ILE A N   1 
ATOM   979  C  CA  . ILE A 1 131 ? 30.346 14.783  -2.320  1.00 23.03  ? 172 ILE A CA  1 
ATOM   980  C  C   . ILE A 1 131 ? 29.668 13.673  -1.589  1.00 26.54  ? 172 ILE A C   1 
ATOM   981  O  O   . ILE A 1 131 ? 29.819 13.541  -0.340  1.00 24.19  ? 172 ILE A O   1 
ATOM   982  C  CB  . ILE A 1 131 ? 31.467 14.164  -3.241  1.00 25.73  ? 172 ILE A CB  1 
ATOM   983  C  CG1 . ILE A 1 131 ? 32.428 13.313  -2.405  1.00 27.28  ? 172 ILE A CG1 1 
ATOM   984  C  CG2 . ILE A 1 131 ? 32.204 15.284  -3.989  1.00 19.97  ? 172 ILE A CG2 1 
ATOM   985  C  CD1 . ILE A 1 131 ? 33.342 12.373  -3.245  1.00 26.37  ? 172 ILE A CD1 1 
ATOM   986  N  N   . ILE A 1 132 ? 28.911 12.892  -2.350  1.00 25.97  ? 173 ILE A N   1 
ATOM   987  C  CA  . ILE A 1 132 ? 28.260 11.701  -1.809  1.00 28.36  ? 173 ILE A CA  1 
ATOM   988  C  C   . ILE A 1 132 ? 29.406 10.636  -1.732  1.00 32.01  ? 173 ILE A C   1 
ATOM   989  O  O   . ILE A 1 132 ? 30.067 10.331  -2.739  1.00 26.10  ? 173 ILE A O   1 
ATOM   990  C  CB  . ILE A 1 132 ? 27.112 11.210  -2.766  1.00 26.93  ? 173 ILE A CB  1 
ATOM   991  C  CG1 . ILE A 1 132 ? 25.930 12.210  -2.706  1.00 19.30  ? 173 ILE A CG1 1 
ATOM   992  C  CG2 . ILE A 1 132 ? 26.620 9.784   -2.331  1.00 24.81  ? 173 ILE A CG2 1 
ATOM   993  C  CD1 . ILE A 1 132 ? 24.661 11.800  -3.508  1.00 24.52  ? 173 ILE A CD1 1 
ATOM   994  N  N   . SER A 1 133 ? 29.678 10.135  -0.530  1.00 30.94  ? 174 SER A N   1 
ATOM   995  C  CA  . SER A 1 133 ? 30.720 9.112   -0.332  1.00 35.42  ? 174 SER A CA  1 
ATOM   996  C  C   . SER A 1 133 ? 30.169 7.701   -0.509  1.00 35.03  ? 174 SER A C   1 
ATOM   997  O  O   . SER A 1 133 ? 30.873 6.850   -0.982  1.00 38.35  ? 174 SER A O   1 
ATOM   998  C  CB  . SER A 1 133 ? 31.365 9.257   1.045   1.00 36.02  ? 174 SER A CB  1 
ATOM   999  O  OG  . SER A 1 133 ? 31.767 10.611  1.220   1.00 46.12  ? 174 SER A OG  1 
ATOM   1000 N  N   . ALA A 1 134 ? 28.912 7.469   -0.126  1.00 33.79  ? 175 ALA A N   1 
ATOM   1001 C  CA  . ALA A 1 134 ? 28.232 6.171   -0.312  1.00 35.37  ? 175 ALA A CA  1 
ATOM   1002 C  C   . ALA A 1 134 ? 26.762 6.533   -0.424  1.00 35.82  ? 175 ALA A C   1 
ATOM   1003 O  O   . ALA A 1 134 ? 26.275 7.384   0.321   1.00 35.73  ? 175 ALA A O   1 
ATOM   1004 C  CB  . ALA A 1 134 ? 28.438 5.250   0.882   1.00 30.14  ? 175 ALA A CB  1 
ATOM   1005 N  N   . THR A 1 135 ? 26.054 5.890   -1.346  1.00 38.40  ? 176 THR A N   1 
ATOM   1006 C  CA  . THR A 1 135 ? 24.651 6.184   -1.576  1.00 40.07  ? 176 THR A CA  1 
ATOM   1007 C  C   . THR A 1 135 ? 23.658 5.683   -0.547  1.00 46.04  ? 176 THR A C   1 
ATOM   1008 O  O   . THR A 1 135 ? 22.581 6.266   -0.409  1.00 52.41  ? 176 THR A O   1 
ATOM   1009 C  CB  . THR A 1 135 ? 24.205 5.695   -2.987  1.00 44.42  ? 176 THR A CB  1 
ATOM   1010 O  OG1 . THR A 1 135 ? 24.831 4.437   -3.286  1.00 44.56  ? 176 THR A OG1 1 
ATOM   1011 C  CG2 . THR A 1 135 ? 24.607 6.707   -4.052  1.00 37.94  ? 176 THR A CG2 1 
ATOM   1012 N  N   . GLY A 1 136 ? 23.985 4.626   0.188   1.00 46.09  ? 177 GLY A N   1 
ATOM   1013 C  CA  . GLY A 1 136 ? 23.024 4.145   1.179   1.00 48.26  ? 177 GLY A CA  1 
ATOM   1014 C  C   . GLY A 1 136 ? 21.852 3.382   0.553   1.00 50.30  ? 177 GLY A C   1 
ATOM   1015 O  O   . GLY A 1 136 ? 21.700 3.362   -0.671  1.00 55.77  ? 177 GLY A O   1 
ATOM   1016 N  N   . ARG A 1 137 ? 21.017 2.756   1.382   1.00 51.06  ? 178 ARG A N   1 
ATOM   1017 C  CA  . ARG A 1 137 ? 19.869 1.983   0.892   1.00 50.91  ? 178 ARG A CA  1 
ATOM   1018 C  C   . ARG A 1 137 ? 18.564 2.716   1.143   1.00 48.26  ? 178 ARG A C   1 
ATOM   1019 O  O   . ARG A 1 137 ? 18.426 3.449   2.119   1.00 44.91  ? 178 ARG A O   1 
ATOM   1020 C  CB  . ARG A 1 137 ? 19.781 0.626   1.602   1.00 59.28  ? 178 ARG A CB  1 
ATOM   1021 C  CG  . ARG A 1 137 ? 20.991 -0.295  1.470   1.00 66.40  ? 178 ARG A CG  1 
ATOM   1022 C  CD  . ARG A 1 137 ? 20.683 -1.674  2.090   1.00 73.02  ? 178 ARG A CD  1 
ATOM   1023 N  NE  . ARG A 1 137 ? 20.340 -2.705  1.100   1.00 79.37  ? 178 ARG A NE  1 
ATOM   1024 C  CZ  . ARG A 1 137 ? 19.273 -2.688  0.298   1.00 80.52  ? 178 ARG A CZ  1 
ATOM   1025 N  NH1 . ARG A 1 137 ? 18.395 -1.687  0.338   1.00 87.27  ? 178 ARG A NH1 1 
ATOM   1026 N  NH2 . ARG A 1 137 ? 19.081 -3.683  -0.554  1.00 77.86  ? 178 ARG A NH2 1 
ATOM   1027 N  N   . ILE A 1 138 ? 17.582 2.478   0.292   1.00 51.44  ? 179 ILE A N   1 
ATOM   1028 C  CA  . ILE A 1 138 ? 16.295 3.148   0.452   1.00 54.98  ? 179 ILE A CA  1 
ATOM   1029 C  C   . ILE A 1 138 ? 15.157 2.273   0.971   1.00 55.19  ? 179 ILE A C   1 
ATOM   1030 O  O   . ILE A 1 138 ? 14.047 2.762   1.187   1.00 52.83  ? 179 ILE A O   1 
ATOM   1031 C  CB  . ILE A 1 138 ? 15.863 3.803   -0.863  1.00 53.31  ? 179 ILE A CB  1 
ATOM   1032 C  CG1 . ILE A 1 138 ? 15.633 2.744   -1.946  1.00 52.71  ? 179 ILE A CG1 1 
ATOM   1033 C  CG2 . ILE A 1 138 ? 16.944 4.780   -1.296  1.00 51.45  ? 179 ILE A CG2 1 
ATOM   1034 C  CD1 . ILE A 1 138 ? 15.298 3.333   -3.327  1.00 45.03  ? 179 ILE A CD1 1 
ATOM   1035 N  N   . GLY A 1 139 ? 15.437 0.990   1.179   1.00 53.37  ? 180 GLY A N   1 
ATOM   1036 C  CA  . GLY A 1 139 ? 14.424 0.091   1.689   1.00 50.74  ? 180 GLY A CA  1 
ATOM   1037 C  C   . GLY A 1 139 ? 14.068 0.385   3.142   1.00 53.86  ? 180 GLY A C   1 
ATOM   1038 O  O   . GLY A 1 139 ? 14.781 1.086   3.865   1.00 54.64  ? 180 GLY A O   1 
ATOM   1039 N  N   . LEU A 1 140 ? 12.964 -0.199  3.582   1.00 57.77  ? 181 LEU A N   1 
ATOM   1040 C  CA  . LEU A 1 140 ? 12.452 0.006   4.922   1.00 57.97  ? 181 LEU A CA  1 
ATOM   1041 C  C   . LEU A 1 140 ? 13.089 -0.820  6.032   1.00 58.11  ? 181 LEU A C   1 
ATOM   1042 O  O   . LEU A 1 140 ? 12.869 -0.547  7.208   1.00 62.97  ? 181 LEU A O   1 
ATOM   1043 C  CB  . LEU A 1 140 ? 10.953 -0.243  4.896   1.00 63.30  ? 181 LEU A CB  1 
ATOM   1044 C  CG  . LEU A 1 140 ? 10.118 0.601   5.838   1.00 65.17  ? 181 LEU A CG  1 
ATOM   1045 C  CD1 . LEU A 1 140 ? 10.284 2.075   5.491   1.00 60.14  ? 181 LEU A CD1 1 
ATOM   1046 C  CD2 . LEU A 1 140 ? 8.669  0.159   5.704   1.00 67.25  ? 181 LEU A CD2 1 
ATOM   1047 N  N   . ASN A 1 141 ? 13.876 -1.828  5.679   1.00 60.92  ? 182 ASN A N   1 
ATOM   1048 C  CA  . ASN A 1 141 ? 14.518 -2.657  6.695   1.00 58.88  ? 182 ASN A CA  1 
ATOM   1049 C  C   . ASN A 1 141 ? 15.669 -1.905  7.335   1.00 57.98  ? 182 ASN A C   1 
ATOM   1050 O  O   . ASN A 1 141 ? 16.582 -1.465  6.651   1.00 61.98  ? 182 ASN A O   1 
ATOM   1051 C  CB  . ASN A 1 141 ? 15.055 -3.954  6.084   1.00 61.99  ? 182 ASN A CB  1 
ATOM   1052 C  CG  . ASN A 1 141 ? 15.727 -4.850  7.119   1.00 64.90  ? 182 ASN A CG  1 
ATOM   1053 O  OD1 . ASN A 1 141 ? 16.847 -5.321  6.924   1.00 65.15  ? 182 ASN A OD1 1 
ATOM   1054 N  ND2 . ASN A 1 141 ? 15.040 -5.082  8.231   1.00 66.25  ? 182 ASN A ND2 1 
ATOM   1055 N  N   . PRO A 1 142 ? 15.642 -1.754  8.661   1.00 61.38  ? 183 PRO A N   1 
ATOM   1056 C  CA  . PRO A 1 142 ? 16.690 -1.048  9.416   1.00 68.15  ? 183 PRO A CA  1 
ATOM   1057 C  C   . PRO A 1 142 ? 18.010 -1.826  9.492   1.00 71.47  ? 183 PRO A C   1 
ATOM   1058 O  O   . PRO A 1 142 ? 18.029 -2.980  9.924   1.00 73.98  ? 183 PRO A O   1 
ATOM   1059 C  CB  . PRO A 1 142 ? 16.052 -0.861  10.785  1.00 69.12  ? 183 PRO A CB  1 
ATOM   1060 C  CG  . PRO A 1 142 ? 15.191 -2.097  10.906  1.00 68.79  ? 183 PRO A CG  1 
ATOM   1061 C  CD  . PRO A 1 142 ? 14.552 -2.193  9.548   1.00 60.76  ? 183 PRO A CD  1 
ATOM   1062 N  N   . THR A 1 143 ? 19.110 -1.195  9.082   1.00 71.82  ? 184 THR A N   1 
ATOM   1063 C  CA  . THR A 1 143 ? 20.404 -1.870  9.096   1.00 73.31  ? 184 THR A CA  1 
ATOM   1064 C  C   . THR A 1 143 ? 21.547 -1.066  9.724   1.00 72.19  ? 184 THR A C   1 
ATOM   1065 O  O   . THR A 1 143 ? 22.677 -1.533  9.773   1.00 75.87  ? 184 THR A O   1 
ATOM   1066 C  CB  . THR A 1 143 ? 20.820 -2.306  7.654   1.00 72.92  ? 184 THR A CB  1 
ATOM   1067 O  OG1 . THR A 1 143 ? 20.922 -1.151  6.807   1.00 72.17  ? 184 THR A OG1 1 
ATOM   1068 C  CG2 . THR A 1 143 ? 19.788 -3.271  7.060   1.00 70.38  ? 184 THR A CG2 1 
ATOM   1069 N  N   . GLY A 1 144 ? 21.263 0.138   10.200  1.00 70.26  ? 185 GLY A N   1 
ATOM   1070 C  CA  . GLY A 1 144 ? 22.310 0.932   10.816  1.00 74.72  ? 185 GLY A CA  1 
ATOM   1071 C  C   . GLY A 1 144 ? 22.926 2.016   9.950   1.00 77.89  ? 185 GLY A C   1 
ATOM   1072 O  O   . GLY A 1 144 ? 22.623 2.134   8.759   1.00 79.89  ? 185 GLY A O   1 
ATOM   1073 N  N   . ARG A 1 145 ? 23.811 2.802   10.558  1.00 79.69  ? 186 ARG A N   1 
ATOM   1074 C  CA  . ARG A 1 145 ? 24.484 3.907   9.881   1.00 80.86  ? 186 ARG A CA  1 
ATOM   1075 C  C   . ARG A 1 145 ? 25.161 3.572   8.546   1.00 80.95  ? 186 ARG A C   1 
ATOM   1076 O  O   . ARG A 1 145 ? 25.104 4.372   7.613   1.00 82.46  ? 186 ARG A O   1 
ATOM   1077 C  CB  . ARG A 1 145 ? 25.498 4.545   10.823  1.00 80.70  ? 186 ARG A CB  1 
ATOM   1078 N  N   . GLN A 1 146 ? 25.794 2.407   8.434   1.00 79.62  ? 187 GLN A N   1 
ATOM   1079 C  CA  . GLN A 1 146 ? 26.476 2.067   7.183   1.00 78.09  ? 187 GLN A CA  1 
ATOM   1080 C  C   . GLN A 1 146 ? 25.579 2.080   5.959   1.00 73.93  ? 187 GLN A C   1 
ATOM   1081 O  O   . GLN A 1 146 ? 26.069 2.119   4.834   1.00 79.01  ? 187 GLN A O   1 
ATOM   1082 C  CB  . GLN A 1 146 ? 27.175 0.705   7.267   1.00 81.99  ? 187 GLN A CB  1 
ATOM   1083 C  CG  . GLN A 1 146 ? 26.284 -0.465  7.652   1.00 88.56  ? 187 GLN A CG  1 
ATOM   1084 C  CD  . GLN A 1 146 ? 26.323 -0.753  9.144   1.00 91.76  ? 187 GLN A CD  1 
ATOM   1085 O  OE1 . GLN A 1 146 ? 25.868 0.055   9.961   1.00 91.78  ? 187 GLN A OE1 1 
ATOM   1086 N  NE2 . GLN A 1 146 ? 26.880 -1.906  9.507   1.00 91.78  ? 187 GLN A NE2 1 
ATOM   1087 N  N   . ASN A 1 147 ? 24.269 2.051   6.146   1.00 66.86  ? 188 ASN A N   1 
ATOM   1088 C  CA  . ASN A 1 147 ? 23.413 2.072   4.976   1.00 62.96  ? 188 ASN A CA  1 
ATOM   1089 C  C   . ASN A 1 147 ? 22.671 3.393   4.755   1.00 60.42  ? 188 ASN A C   1 
ATOM   1090 O  O   . ASN A 1 147 ? 21.778 3.491   3.917   1.00 55.17  ? 188 ASN A O   1 
ATOM   1091 C  CB  . ASN A 1 147 ? 22.479 0.870   5.002   1.00 67.49  ? 188 ASN A CB  1 
ATOM   1092 C  CG  . ASN A 1 147 ? 23.227 -0.430  4.751   1.00 69.03  ? 188 ASN A CG  1 
ATOM   1093 O  OD1 . ASN A 1 147 ? 23.914 -0.574  3.743   1.00 67.84  ? 188 ASN A OD1 1 
ATOM   1094 N  ND2 . ASN A 1 147 ? 23.110 -1.372  5.669   1.00 73.24  ? 188 ASN A ND2 1 
ATOM   1095 N  N   . PHE A 1 148 ? 23.058 4.412   5.519   1.00 52.15  ? 189 PHE A N   1 
ATOM   1096 C  CA  . PHE A 1 148 ? 22.510 5.745   5.342   1.00 45.18  ? 189 PHE A CA  1 
ATOM   1097 C  C   . PHE A 1 148 ? 23.452 6.311   4.280   1.00 45.16  ? 189 PHE A C   1 
ATOM   1098 O  O   . PHE A 1 148 ? 24.490 5.711   3.977   1.00 37.26  ? 189 PHE A O   1 
ATOM   1099 C  CB  . PHE A 1 148 ? 22.676 6.598   6.605   1.00 42.71  ? 189 PHE A CB  1 
ATOM   1100 C  CG  . PHE A 1 148 ? 21.697 6.288   7.691   1.00 53.44  ? 189 PHE A CG  1 
ATOM   1101 C  CD1 . PHE A 1 148 ? 21.817 6.898   8.932   1.00 58.86  ? 189 PHE A CD1 1 
ATOM   1102 C  CD2 . PHE A 1 148 ? 20.625 5.431   7.466   1.00 60.36  ? 189 PHE A CD2 1 
ATOM   1103 C  CE1 . PHE A 1 148 ? 20.885 6.664   9.926   1.00 62.92  ? 189 PHE A CE1 1 
ATOM   1104 C  CE2 . PHE A 1 148 ? 19.689 5.190   8.459   1.00 60.89  ? 189 PHE A CE2 1 
ATOM   1105 C  CZ  . PHE A 1 148 ? 19.819 5.808   9.690   1.00 60.06  ? 189 PHE A CZ  1 
ATOM   1106 N  N   . LEU A 1 149 ? 23.100 7.468   3.734   1.00 40.60  ? 190 LEU A N   1 
ATOM   1107 C  CA  . LEU A 1 149 ? 23.936 8.123   2.753   1.00 34.09  ? 190 LEU A CA  1 
ATOM   1108 C  C   . LEU A 1 149 ? 25.127 8.748   3.497   1.00 32.16  ? 190 LEU A C   1 
ATOM   1109 O  O   . LEU A 1 149 ? 24.968 9.322   4.588   1.00 28.29  ? 190 LEU A O   1 
ATOM   1110 C  CB  . LEU A 1 149 ? 23.100 9.189   2.044   1.00 35.96  ? 190 LEU A CB  1 
ATOM   1111 C  CG  . LEU A 1 149 ? 23.750 9.976   0.915   1.00 38.50  ? 190 LEU A CG  1 
ATOM   1112 C  CD1 . LEU A 1 149 ? 22.668 10.684  0.138   1.00 33.45  ? 190 LEU A CD1 1 
ATOM   1113 C  CD2 . LEU A 1 149 ? 24.759 10.983  1.493   1.00 23.98  ? 190 LEU A CD2 1 
ATOM   1114 N  N   . GLN A 1 150 ? 26.333 8.637   2.938   1.00 25.54  ? 191 GLN A N   1 
ATOM   1115 C  CA  . GLN A 1 150 ? 27.477 9.220   3.624   1.00 29.40  ? 191 GLN A CA  1 
ATOM   1116 C  C   . GLN A 1 150 ? 28.038 10.354  2.817   1.00 30.04  ? 191 GLN A C   1 
ATOM   1117 O  O   . GLN A 1 150 ? 28.046 10.283  1.594   1.00 24.76  ? 191 GLN A O   1 
ATOM   1118 C  CB  . GLN A 1 150 ? 28.590 8.167   3.864   1.00 30.70  ? 191 GLN A CB  1 
ATOM   1119 C  CG  . GLN A 1 150 ? 28.101 6.932   4.618   1.00 35.54  ? 191 GLN A CG  1 
ATOM   1120 C  CD  . GLN A 1 150 ? 29.176 5.829   4.744   1.00 45.01  ? 191 GLN A CD  1 
ATOM   1121 O  OE1 . GLN A 1 150 ? 28.853 4.647   4.681   1.00 40.98  ? 191 GLN A OE1 1 
ATOM   1122 N  NE2 . GLN A 1 150 ? 30.447 6.222   4.910   1.00 41.38  ? 191 GLN A NE2 1 
ATOM   1123 N  N   . THR A 1 151 ? 28.559 11.378  3.497   1.00 26.30  ? 192 THR A N   1 
ATOM   1124 C  CA  . THR A 1 151 ? 29.115 12.490  2.765   1.00 24.93  ? 192 THR A CA  1 
ATOM   1125 C  C   . THR A 1 151 ? 30.230 13.126  3.553   1.00 30.05  ? 192 THR A C   1 
ATOM   1126 O  O   . THR A 1 151 ? 30.277 12.973  4.766   1.00 29.14  ? 192 THR A O   1 
ATOM   1127 C  CB  . THR A 1 151 ? 28.004 13.590  2.472   1.00 32.69  ? 192 THR A CB  1 
ATOM   1128 O  OG1 . THR A 1 151 ? 28.609 14.700  1.822   1.00 32.20  ? 192 THR A OG1 1 
ATOM   1129 C  CG2 . THR A 1 151 ? 27.381 14.129  3.771   1.00 28.72  ? 192 THR A CG2 1 
ATOM   1130 N  N   . ASP A 1 152 ? 31.135 13.829  2.868   1.00 30.13  ? 193 ASP A N   1 
ATOM   1131 C  CA  . ASP A 1 152 ? 32.219 14.515  3.562   1.00 31.41  ? 193 ASP A CA  1 
ATOM   1132 C  C   . ASP A 1 152 ? 31.854 15.991  3.705   1.00 33.45  ? 193 ASP A C   1 
ATOM   1133 O  O   . ASP A 1 152 ? 32.689 16.809  4.047   1.00 40.45  ? 193 ASP A O   1 
ATOM   1134 C  CB  . ASP A 1 152 ? 33.555 14.344  2.817   1.00 38.72  ? 193 ASP A CB  1 
ATOM   1135 C  CG  . ASP A 1 152 ? 33.510 14.868  1.373   1.00 43.03  ? 193 ASP A CG  1 
ATOM   1136 O  OD1 . ASP A 1 152 ? 32.406 14.964  0.809   1.00 38.36  ? 193 ASP A OD1 1 
ATOM   1137 O  OD2 . ASP A 1 152 ? 34.581 15.176  0.801   1.00 37.46  ? 193 ASP A OD2 1 
ATOM   1138 N  N   . ALA A 1 153 ? 30.620 16.367  3.404   1.00 27.72  ? 194 ALA A N   1 
ATOM   1139 C  CA  . ALA A 1 153 ? 30.278 17.778  3.652   1.00 42.51  ? 194 ALA A CA  1 
ATOM   1140 C  C   . ALA A 1 153 ? 30.206 17.912  5.201   1.00 44.12  ? 194 ALA A C   1 
ATOM   1141 O  O   . ALA A 1 153 ? 29.778 16.983  5.889   1.00 48.88  ? 194 ALA A O   1 
ATOM   1142 C  CB  . ALA A 1 153 ? 28.955 18.108  3.042   1.00 36.36  ? 194 ALA A CB  1 
ATOM   1143 N  N   . SER A 1 154 ? 30.664 19.014  5.771   1.00 46.40  ? 195 SER A N   1 
ATOM   1144 C  CA  . SER A 1 154 ? 30.572 19.137  7.234   1.00 54.85  ? 195 SER A CA  1 
ATOM   1145 C  C   . SER A 1 154 ? 29.108 19.060  7.731   1.00 55.79  ? 195 SER A C   1 
ATOM   1146 O  O   . SER A 1 154 ? 28.279 19.898  7.383   1.00 50.14  ? 195 SER A O   1 
ATOM   1147 C  CB  . SER A 1 154 ? 31.191 20.462  7.708   1.00 57.27  ? 195 SER A CB  1 
ATOM   1148 O  OG  . SER A 1 154 ? 32.537 20.588  7.260   1.00 59.59  ? 195 SER A OG  1 
ATOM   1149 N  N   . ILE A 1 155 ? 28.799 18.020  8.500   1.00 55.63  ? 196 ILE A N   1 
ATOM   1150 C  CA  . ILE A 1 155 ? 27.478 17.823  9.088   1.00 55.66  ? 196 ILE A CA  1 
ATOM   1151 C  C   . ILE A 1 155 ? 27.676 17.956  10.596  1.00 56.70  ? 196 ILE A C   1 
ATOM   1152 O  O   . ILE A 1 155 ? 28.456 17.218  11.189  1.00 52.52  ? 196 ILE A O   1 
ATOM   1153 C  CB  . ILE A 1 155 ? 26.910 16.404  8.808   1.00 57.75  ? 196 ILE A CB  1 
ATOM   1154 C  CG1 . ILE A 1 155 ? 26.705 16.201  7.296   1.00 61.74  ? 196 ILE A CG1 1 
ATOM   1155 C  CG2 . ILE A 1 155 ? 25.576 16.218  9.560   1.00 52.53  ? 196 ILE A CG2 1 
ATOM   1156 C  CD1 . ILE A 1 155 ? 25.792 17.228  6.654   1.00 51.35  ? 196 ILE A CD1 1 
ATOM   1157 N  N   . ASN A 1 156 ? 26.979 18.901  11.205  1.00 57.71  ? 197 ASN A N   1 
ATOM   1158 C  CA  . ASN A 1 156 ? 27.100 19.131  12.632  1.00 59.90  ? 197 ASN A CA  1 
ATOM   1159 C  C   . ASN A 1 156 ? 25.755 19.573  13.215  1.00 61.96  ? 197 ASN A C   1 
ATOM   1160 O  O   . ASN A 1 156 ? 24.723 19.491  12.540  1.00 56.71  ? 197 ASN A O   1 
ATOM   1161 C  CB  . ASN A 1 156 ? 28.160 20.200  12.881  1.00 67.36  ? 197 ASN A CB  1 
ATOM   1162 C  CG  . ASN A 1 156 ? 27.701 21.587  12.461  1.00 78.07  ? 197 ASN A CG  1 
ATOM   1163 O  OD1 . ASN A 1 156 ? 27.240 21.790  11.334  1.00 82.63  ? 197 ASN A OD1 1 
ATOM   1164 N  ND2 . ASN A 1 156 ? 27.830 22.555  13.370  1.00 81.65  ? 197 ASN A ND2 1 
ATOM   1165 N  N   . HIS A 1 157 ? 25.764 20.067  14.455  1.00 59.31  ? 198 HIS A N   1 
ATOM   1166 C  CA  . HIS A 1 157 ? 24.519 20.489  15.105  1.00 59.95  ? 198 HIS A CA  1 
ATOM   1167 C  C   . HIS A 1 157 ? 23.684 21.580  14.433  1.00 51.33  ? 198 HIS A C   1 
ATOM   1168 O  O   . HIS A 1 157 ? 22.476 21.555  14.576  1.00 47.92  ? 198 HIS A O   1 
ATOM   1169 C  CB  . HIS A 1 157 ? 24.781 20.858  16.569  1.00 65.23  ? 198 HIS A CB  1 
ATOM   1170 C  CG  . HIS A 1 157 ? 24.861 19.667  17.475  1.00 82.87  ? 198 HIS A CG  1 
ATOM   1171 N  ND1 . HIS A 1 157 ? 23.743 18.984  17.908  1.00 87.48  ? 198 HIS A ND1 1 
ATOM   1172 C  CD2 . HIS A 1 157 ? 25.928 19.006  17.990  1.00 86.15  ? 198 HIS A CD2 1 
ATOM   1173 C  CE1 . HIS A 1 157 ? 24.117 17.956  18.651  1.00 91.24  ? 198 HIS A CE1 1 
ATOM   1174 N  NE2 . HIS A 1 157 ? 25.437 17.946  18.715  1.00 90.11  ? 198 HIS A NE2 1 
ATOM   1175 N  N   . GLY A 1 158 ? 24.294 22.543  13.738  1.00 44.66  ? 199 GLY A N   1 
ATOM   1176 C  CA  . GLY A 1 158 ? 23.489 23.560  13.052  1.00 49.36  ? 199 GLY A CA  1 
ATOM   1177 C  C   . GLY A 1 158 ? 23.042 23.109  11.642  1.00 49.75  ? 199 GLY A C   1 
ATOM   1178 O  O   . GLY A 1 158 ? 22.511 23.915  10.867  1.00 55.06  ? 199 GLY A O   1 
ATOM   1179 N  N   . ASN A 1 159 ? 23.199 21.811  11.354  1.00 36.33  ? 200 ASN A N   1 
ATOM   1180 C  CA  . ASN A 1 159 ? 22.925 21.210  10.049  1.00 45.79  ? 200 ASN A CA  1 
ATOM   1181 C  C   . ASN A 1 159 ? 21.881 20.163  10.124  1.00 47.48  ? 200 ASN A C   1 
ATOM   1182 O  O   . ASN A 1 159 ? 21.070 19.959  9.201   1.00 44.92  ? 200 ASN A O   1 
ATOM   1183 C  CB  . ASN A 1 159 ? 24.186 20.481  9.524   1.00 49.01  ? 200 ASN A CB  1 
ATOM   1184 C  CG  . ASN A 1 159 ? 24.840 21.221  8.440   1.00 45.88  ? 200 ASN A CG  1 
ATOM   1185 O  OD1 . ASN A 1 159 ? 24.264 22.175  7.910   1.00 64.80  ? 200 ASN A OD1 1 
ATOM   1186 N  ND2 . ASN A 1 159 ? 26.028 20.811  8.073   1.00 48.64  ? 200 ASN A ND2 1 
ATOM   1187 N  N   . SER A 1 160 ? 21.985 19.454  11.237  1.00 46.07  ? 201 SER A N   1 
ATOM   1188 C  CA  . SER A 1 160 ? 21.143 18.350  11.541  1.00 36.48  ? 201 SER A CA  1 
ATOM   1189 C  C   . SER A 1 160 ? 19.674 18.615  11.320  1.00 33.27  ? 201 SER A C   1 
ATOM   1190 O  O   . SER A 1 160 ? 19.077 19.514  11.925  1.00 37.63  ? 201 SER A O   1 
ATOM   1191 C  CB  . SER A 1 160 ? 21.412 17.889  12.970  1.00 35.00  ? 201 SER A CB  1 
ATOM   1192 O  OG  . SER A 1 160 ? 21.212 16.479  13.036  1.00 51.21  ? 201 SER A OG  1 
ATOM   1193 N  N   . GLY A 1 161 ? 19.078 17.773  10.475  1.00 34.28  ? 202 GLY A N   1 
ATOM   1194 C  CA  . GLY A 1 161 ? 17.667 17.916  10.165  1.00 35.51  ? 202 GLY A CA  1 
ATOM   1195 C  C   . GLY A 1 161 ? 17.531 18.806  8.929   1.00 34.12  ? 202 GLY A C   1 
ATOM   1196 O  O   . GLY A 1 161 ? 16.436 18.955  8.371   1.00 34.93  ? 202 GLY A O   1 
ATOM   1197 N  N   . GLY A 1 162 ? 18.661 19.374  8.509   1.00 27.85  ? 203 GLY A N   1 
ATOM   1198 C  CA  . GLY A 1 162 ? 18.698 20.253  7.354   1.00 29.55  ? 203 GLY A CA  1 
ATOM   1199 C  C   . GLY A 1 162 ? 18.765 19.460  6.059   1.00 30.65  ? 203 GLY A C   1 
ATOM   1200 O  O   . GLY A 1 162 ? 18.638 18.226  6.046   1.00 22.07  ? 203 GLY A O   1 
ATOM   1201 N  N   . ALA A 1 163 ? 19.059 20.145  4.965   1.00 25.17  ? 204 ALA A N   1 
ATOM   1202 C  CA  . ALA A 1 163 ? 19.052 19.433  3.694   1.00 28.90  ? 204 ALA A CA  1 
ATOM   1203 C  C   . ALA A 1 163 ? 20.391 19.189  3.068   1.00 21.21  ? 204 ALA A C   1 
ATOM   1204 O  O   . ALA A 1 163 ? 21.323 19.980  3.239   1.00 18.06  ? 204 ALA A O   1 
ATOM   1205 C  CB  . ALA A 1 163 ? 18.136 20.206  2.677   1.00 26.41  ? 204 ALA A CB  1 
ATOM   1206 N  N   . LEU A 1 164 ? 20.478 18.066  2.357   1.00 18.16  ? 205 LEU A N   1 
ATOM   1207 C  CA  . LEU A 1 164 ? 21.657 17.747  1.581   1.00 19.36  ? 205 LEU A CA  1 
ATOM   1208 C  C   . LEU A 1 164 ? 21.122 17.854  0.110   1.00 24.36  ? 205 LEU A C   1 
ATOM   1209 O  O   . LEU A 1 164 ? 20.223 17.115  -0.270  1.00 18.43  ? 205 LEU A O   1 
ATOM   1210 C  CB  . LEU A 1 164 ? 22.090 16.302  1.860   1.00 20.82  ? 205 LEU A CB  1 
ATOM   1211 C  CG  . LEU A 1 164 ? 23.526 15.858  2.050   1.00 32.54  ? 205 LEU A CG  1 
ATOM   1212 C  CD1 . LEU A 1 164 ? 23.763 14.609  1.217   1.00 32.80  ? 205 LEU A CD1 1 
ATOM   1213 C  CD2 . LEU A 1 164 ? 24.505 16.975  1.777   1.00 23.74  ? 205 LEU A CD2 1 
ATOM   1214 N  N   . VAL A 1 165 ? 21.663 18.729  -0.715  1.00 20.14  ? 206 VAL A N   1 
ATOM   1215 C  CA  . VAL A 1 165 ? 21.147 18.862  -2.101  1.00 18.20  ? 206 VAL A CA  1 
ATOM   1216 C  C   . VAL A 1 165 ? 22.246 18.727  -3.126  1.00 24.26  ? 206 VAL A C   1 
ATOM   1217 O  O   . VAL A 1 165 ? 23.407 18.966  -2.791  1.00 17.73  ? 206 VAL A O   1 
ATOM   1218 C  CB  . VAL A 1 165 ? 20.461 20.269  -2.355  1.00 20.56  ? 206 VAL A CB  1 
ATOM   1219 C  CG1 . VAL A 1 165 ? 19.255 20.467  -1.370  1.00 15.16  ? 206 VAL A CG1 1 
ATOM   1220 C  CG2 . VAL A 1 165 ? 21.484 21.410  -2.117  1.00 19.41  ? 206 VAL A CG2 1 
ATOM   1221 N  N   . ASN A 1 166 ? 21.908 18.380  -4.382  1.00 16.54  ? 207 ASN A N   1 
ATOM   1222 C  CA  . ASN A 1 166 ? 22.986 18.272  -5.361  1.00 19.07  ? 207 ASN A CA  1 
ATOM   1223 C  C   . ASN A 1 166 ? 23.204 19.642  -5.933  1.00 18.62  ? 207 ASN A C   1 
ATOM   1224 O  O   . ASN A 1 166 ? 22.598 20.593  -5.453  1.00 19.82  ? 207 ASN A O   1 
ATOM   1225 C  CB  . ASN A 1 166 ? 22.662 17.237  -6.474  1.00 24.99  ? 207 ASN A CB  1 
ATOM   1226 C  CG  . ASN A 1 166 ? 21.393 17.551  -7.235  1.00 25.14  ? 207 ASN A CG  1 
ATOM   1227 O  OD1 . ASN A 1 166 ? 20.967 18.716  -7.352  1.00 22.98  ? 207 ASN A OD1 1 
ATOM   1228 N  ND2 . ASN A 1 166 ? 20.789 16.511  -7.786  1.00 23.96  ? 207 ASN A ND2 1 
ATOM   1229 N  N   . SER A 1 167 ? 24.048 19.764  -6.955  1.00 23.72  ? 208 SER A N   1 
ATOM   1230 C  CA  . SER A 1 167 ? 24.325 21.085  -7.568  1.00 26.60  ? 208 SER A CA  1 
ATOM   1231 C  C   . SER A 1 167 ? 23.148 21.759  -8.306  1.00 28.41  ? 208 SER A C   1 
ATOM   1232 O  O   . SER A 1 167 ? 23.255 22.925  -8.734  1.00 22.87  ? 208 SER A O   1 
ATOM   1233 C  CB  . SER A 1 167 ? 25.501 20.995  -8.556  1.00 27.85  ? 208 SER A CB  1 
ATOM   1234 O  OG  . SER A 1 167 ? 25.155 20.254  -9.718  1.00 26.80  ? 208 SER A OG  1 
ATOM   1235 N  N   . LEU A 1 168 ? 22.050 21.032  -8.470  1.00 22.72  ? 209 LEU A N   1 
ATOM   1236 C  CA  . LEU A 1 168 ? 20.861 21.594  -9.115  1.00 27.26  ? 209 LEU A CA  1 
ATOM   1237 C  C   . LEU A 1 168 ? 19.906 22.084  -8.021  1.00 31.48  ? 209 LEU A C   1 
ATOM   1238 O  O   . LEU A 1 168 ? 18.862 22.684  -8.308  1.00 28.27  ? 209 LEU A O   1 
ATOM   1239 C  CB  . LEU A 1 168 ? 20.145 20.522  -9.967  1.00 27.14  ? 209 LEU A CB  1 
ATOM   1240 C  CG  . LEU A 1 168 ? 20.990 19.912  -11.118 1.00 37.78  ? 209 LEU A CG  1 
ATOM   1241 C  CD1 . LEU A 1 168 ? 20.124 18.963  -11.973 1.00 37.00  ? 209 LEU A CD1 1 
ATOM   1242 C  CD2 . LEU A 1 168 ? 21.565 21.046  -11.991 1.00 28.37  ? 209 LEU A CD2 1 
ATOM   1243 N  N   . GLY A 1 169 ? 20.245 21.820  -6.757  1.00 22.90  ? 210 GLY A N   1 
ATOM   1244 C  CA  . GLY A 1 169 ? 19.347 22.260  -5.710  1.00 20.54  ? 210 GLY A CA  1 
ATOM   1245 C  C   . GLY A 1 169 ? 18.354 21.179  -5.366  1.00 25.21  ? 210 GLY A C   1 
ATOM   1246 O  O   . GLY A 1 169 ? 17.502 21.398  -4.515  1.00 26.39  ? 210 GLY A O   1 
ATOM   1247 N  N   . GLU A 1 170 ? 18.476 19.994  -5.978  1.00 21.23  ? 211 GLU A N   1 
ATOM   1248 C  CA  . GLU A 1 170 ? 17.518 18.920  -5.695  1.00 28.31  ? 211 GLU A CA  1 
ATOM   1249 C  C   . GLU A 1 170 ? 17.893 18.153  -4.435  1.00 23.47  ? 211 GLU A C   1 
ATOM   1250 O  O   . GLU A 1 170 ? 19.073 17.803  -4.231  1.00 25.33  ? 211 GLU A O   1 
ATOM   1251 C  CB  . GLU A 1 170 ? 17.435 17.910  -6.863  1.00 26.32  ? 211 GLU A CB  1 
ATOM   1252 C  CG  . GLU A 1 170 ? 17.081 18.513  -8.183  1.00 35.52  ? 211 GLU A CG  1 
ATOM   1253 C  CD  . GLU A 1 170 ? 17.455 17.608  -9.390  1.00 40.56  ? 211 GLU A CD  1 
ATOM   1254 O  OE1 . GLU A 1 170 ? 17.004 17.922  -10.504 1.00 44.54  ? 211 GLU A OE1 1 
ATOM   1255 O  OE2 . GLU A 1 170 ? 18.200 16.606  -9.247  1.00 34.01  ? 211 GLU A OE2 1 
ATOM   1256 N  N   . LEU A 1 171 ? 16.878 17.846  -3.633  1.00 27.64  ? 212 LEU A N   1 
ATOM   1257 C  CA  . LEU A 1 171 ? 17.057 17.133  -2.360  1.00 26.13  ? 212 LEU A CA  1 
ATOM   1258 C  C   . LEU A 1 171 ? 17.672 15.740  -2.539  1.00 29.19  ? 212 LEU A C   1 
ATOM   1259 O  O   . LEU A 1 171 ? 17.099 14.894  -3.242  1.00 31.52  ? 212 LEU A O   1 
ATOM   1260 C  CB  . LEU A 1 171 ? 15.704 17.005  -1.619  1.00 15.95  ? 212 LEU A CB  1 
ATOM   1261 C  CG  . LEU A 1 171 ? 15.910 16.405  -0.205  1.00 26.57  ? 212 LEU A CG  1 
ATOM   1262 C  CD1 . LEU A 1 171 ? 16.770 17.375  0.668   1.00 17.45  ? 212 LEU A CD1 1 
ATOM   1263 C  CD2 . LEU A 1 171 ? 14.571 16.132  0.436   1.00 20.74  ? 212 LEU A CD2 1 
HETATM 1264 N  N   . MSE A 1 172 ? 18.832 15.505  -1.920  1.00 26.05  ? 213 MSE A N   1 
HETATM 1265 C  CA  . MSE A 1 172 ? 19.542 14.194  -1.999  1.00 28.10  ? 213 MSE A CA  1 
HETATM 1266 C  C   . MSE A 1 172 ? 19.277 13.435  -0.686  1.00 29.47  ? 213 MSE A C   1 
HETATM 1267 O  O   . MSE A 1 172 ? 19.218 12.223  -0.666  1.00 30.63  ? 213 MSE A O   1 
HETATM 1268 C  CB  . MSE A 1 172 ? 21.062 14.394  -2.186  1.00 23.10  ? 213 MSE A CB  1 
HETATM 1269 C  CG  . MSE A 1 172 ? 21.487 14.848  -3.558  1.00 31.64  ? 213 MSE A CG  1 
HETATM 1270 SE SE  . MSE A 1 172 ? 20.981 13.494  -4.882  1.00 44.92  ? 213 MSE A SE  1 
HETATM 1271 C  CE  . MSE A 1 172 ? 22.218 13.938  -6.368  1.00 57.17  ? 213 MSE A CE  1 
ATOM   1272 N  N   . GLY A 1 173 ? 19.115 14.176  0.412   1.00 29.01  ? 214 GLY A N   1 
ATOM   1273 C  CA  . GLY A 1 173 ? 18.822 13.555  1.684   1.00 21.86  ? 214 GLY A CA  1 
ATOM   1274 C  C   . GLY A 1 173 ? 18.596 14.516  2.845   1.00 28.60  ? 214 GLY A C   1 
ATOM   1275 O  O   . GLY A 1 173 ? 18.644 15.727  2.673   1.00 26.40  ? 214 GLY A O   1 
ATOM   1276 N  N   . ILE A 1 174 ? 18.318 13.960  4.029   1.00 29.22  ? 215 ILE A N   1 
ATOM   1277 C  CA  . ILE A 1 174 ? 18.074 14.737  5.236   1.00 27.36  ? 215 ILE A CA  1 
ATOM   1278 C  C   . ILE A 1 174 ? 19.285 14.524  6.157   1.00 35.80  ? 215 ILE A C   1 
ATOM   1279 O  O   . ILE A 1 174 ? 19.509 13.402  6.623   1.00 28.39  ? 215 ILE A O   1 
ATOM   1280 C  CB  . ILE A 1 174 ? 16.782 14.235  5.965   1.00 29.72  ? 215 ILE A CB  1 
ATOM   1281 C  CG1 . ILE A 1 174 ? 15.552 14.385  5.046   1.00 26.80  ? 215 ILE A CG1 1 
ATOM   1282 C  CG2 . ILE A 1 174 ? 16.576 15.037  7.283   1.00 20.53  ? 215 ILE A CG2 1 
ATOM   1283 C  CD1 . ILE A 1 174 ? 15.215 15.851  4.700   1.00 24.91  ? 215 ILE A CD1 1 
ATOM   1284 N  N   . ASN A 1 175 ? 20.055 15.578  6.423   1.00 33.02  ? 216 ASN A N   1 
ATOM   1285 C  CA  . ASN A 1 175 ? 21.237 15.427  7.279   1.00 35.93  ? 216 ASN A CA  1 
ATOM   1286 C  C   . ASN A 1 175 ? 20.844 14.956  8.668   1.00 41.53  ? 216 ASN A C   1 
ATOM   1287 O  O   . ASN A 1 175 ? 19.840 15.414  9.242   1.00 37.09  ? 216 ASN A O   1 
ATOM   1288 C  CB  . ASN A 1 175 ? 21.990 16.743  7.453   1.00 32.99  ? 216 ASN A CB  1 
ATOM   1289 C  CG  . ASN A 1 175 ? 22.216 17.484  6.147   1.00 44.15  ? 216 ASN A CG  1 
ATOM   1290 O  OD1 . ASN A 1 175 ? 22.137 18.728  6.103   1.00 46.86  ? 216 ASN A OD1 1 
ATOM   1291 N  ND2 . ASN A 1 175 ? 22.508 16.745  5.088   1.00 42.88  ? 216 ASN A ND2 1 
ATOM   1292 N  N   . THR A 1 176 ? 21.632 14.038  9.205   1.00 38.65  ? 217 THR A N   1 
ATOM   1293 C  CA  . THR A 1 176 ? 21.389 13.526  10.552  1.00 57.10  ? 217 THR A CA  1 
ATOM   1294 C  C   . THR A 1 176 ? 22.693 13.357  11.352  1.00 54.55  ? 217 THR A C   1 
ATOM   1295 O  O   . THR A 1 176 ? 23.593 12.650  10.940  1.00 49.99  ? 217 THR A O   1 
ATOM   1296 C  CB  . THR A 1 176 ? 20.607 12.184  10.521  1.00 55.50  ? 217 THR A CB  1 
ATOM   1297 O  OG1 . THR A 1 176 ? 20.529 11.660  11.852  1.00 61.80  ? 217 THR A OG1 1 
ATOM   1298 C  CG2 . THR A 1 176 ? 21.278 11.180  9.634   1.00 62.58  ? 217 THR A CG2 1 
ATOM   1299 N  N   . LEU A 1 177 ? 22.797 14.023  12.496  1.00 67.66  ? 218 LEU A N   1 
ATOM   1300 C  CA  . LEU A 1 177 ? 24.009 13.904  13.310  1.00 75.37  ? 218 LEU A CA  1 
ATOM   1301 C  C   . LEU A 1 177 ? 24.357 12.475  13.708  1.00 82.96  ? 218 LEU A C   1 
ATOM   1302 O  O   . LEU A 1 177 ? 23.735 11.894  14.598  1.00 86.59  ? 218 LEU A O   1 
ATOM   1303 C  CB  . LEU A 1 177 ? 23.906 14.761  14.560  1.00 73.22  ? 218 LEU A CB  1 
ATOM   1304 C  CG  . LEU A 1 177 ? 24.672 16.074  14.430  1.00 78.98  ? 218 LEU A CG  1 
ATOM   1305 C  CD1 . LEU A 1 177 ? 24.642 16.808  15.763  1.00 82.42  ? 218 LEU A CD1 1 
ATOM   1306 C  CD2 . LEU A 1 177 ? 26.115 15.796  14.028  1.00 78.66  ? 218 LEU A CD2 1 
ATOM   1307 N  N   . SER A 1 178 ? 25.372 11.939  13.029  1.00 92.27  ? 219 SER A N   1 
ATOM   1308 C  CA  . SER A 1 178 ? 25.900 10.583  13.211  1.00 100.06 ? 219 SER A CA  1 
ATOM   1309 C  C   . SER A 1 178 ? 24.905 9.466   13.504  1.00 104.41 ? 219 SER A C   1 
ATOM   1310 O  O   . SER A 1 178 ? 23.685 9.676   13.512  1.00 105.51 ? 219 SER A O   1 
ATOM   1311 C  CB  . SER A 1 178 ? 26.986 10.572  14.287  1.00 102.53 ? 219 SER A CB  1 
ATOM   1312 O  OG  . SER A 1 178 ? 28.240 10.240  13.716  1.00 110.07 ? 219 SER A OG  1 
ATOM   1313 N  N   . PHE A 1 179 ? 25.454 8.270   13.725  1.00 107.38 ? 220 PHE A N   1 
ATOM   1314 C  CA  . PHE A 1 179 ? 24.664 7.072   14.023  1.00 110.90 ? 220 PHE A CA  1 
ATOM   1315 C  C   . PHE A 1 179 ? 25.534 5.815   14.168  1.00 112.20 ? 220 PHE A C   1 
ATOM   1316 O  O   . PHE A 1 179 ? 26.767 5.881   14.068  1.00 114.45 ? 220 PHE A O   1 
ATOM   1317 C  CB  . PHE A 1 179 ? 23.614 6.833   12.926  1.00 110.07 ? 220 PHE A CB  1 
ATOM   1318 C  CG  . PHE A 1 179 ? 22.191 6.976   13.405  1.00 110.27 ? 220 PHE A CG  1 
ATOM   1319 C  CD1 . PHE A 1 179 ? 21.704 6.175   14.440  1.00 110.15 ? 220 PHE A CD1 1 
ATOM   1320 C  CD2 . PHE A 1 179 ? 21.338 7.910   12.822  1.00 106.67 ? 220 PHE A CD2 1 
ATOM   1321 C  CE1 . PHE A 1 179 ? 20.388 6.304   14.884  1.00 109.24 ? 220 PHE A CE1 1 
ATOM   1322 C  CE2 . PHE A 1 179 ? 20.026 8.043   13.258  1.00 104.99 ? 220 PHE A CE2 1 
ATOM   1323 C  CZ  . PHE A 1 179 ? 19.548 7.240   14.292  1.00 106.26 ? 220 PHE A CZ  1 
ATOM   1324 N  N   . ASP A 1 180 ? 24.863 4.683   14.401  1.00 111.54 ? 221 ASP A N   1 
ATOM   1325 C  CA  . ASP A 1 180 ? 25.481 3.366   14.569  1.00 110.13 ? 221 ASP A CA  1 
ATOM   1326 C  C   . ASP A 1 180 ? 25.795 3.093   16.034  1.00 108.94 ? 221 ASP A C   1 
ATOM   1327 O  O   . ASP A 1 180 ? 24.922 2.682   16.798  1.00 110.06 ? 221 ASP A O   1 
ATOM   1328 C  CB  . ASP A 1 180 ? 26.768 3.250   13.742  1.00 111.45 ? 221 ASP A CB  1 
ATOM   1329 C  CG  . ASP A 1 180 ? 27.208 1.810   13.546  1.00 113.32 ? 221 ASP A CG  1 
ATOM   1330 O  OD1 . ASP A 1 180 ? 26.516 1.073   12.804  1.00 106.76 ? 221 ASP A OD1 1 
ATOM   1331 O  OD2 . ASP A 1 180 ? 28.240 1.417   14.140  1.00 113.10 ? 221 ASP A OD2 1 
ATOM   1332 N  N   . GLU A 1 189 ? 35.665 9.673   12.126  1.00 84.31  ? 230 GLU A N   1 
ATOM   1333 C  CA  . GLU A 1 189 ? 35.137 11.031  11.983  1.00 84.15  ? 230 GLU A CA  1 
ATOM   1334 C  C   . GLU A 1 189 ? 35.431 11.579  10.588  1.00 81.66  ? 230 GLU A C   1 
ATOM   1335 O  O   . GLU A 1 189 ? 36.060 10.902  9.766   1.00 80.85  ? 230 GLU A O   1 
ATOM   1336 C  CB  . GLU A 1 189 ? 35.747 11.948  13.047  1.00 82.35  ? 230 GLU A CB  1 
ATOM   1337 N  N   . GLY A 1 190 ? 34.978 12.804  10.329  1.00 79.51  ? 231 GLY A N   1 
ATOM   1338 C  CA  . GLY A 1 190 ? 35.201 13.423  9.029   1.00 74.12  ? 231 GLY A CA  1 
ATOM   1339 C  C   . GLY A 1 190 ? 34.186 12.980  7.984   1.00 68.43  ? 231 GLY A C   1 
ATOM   1340 O  O   . GLY A 1 190 ? 34.314 13.270  6.790   1.00 64.84  ? 231 GLY A O   1 
ATOM   1341 N  N   . ILE A 1 191 ? 33.169 12.262  8.437   1.00 63.74  ? 232 ILE A N   1 
ATOM   1342 C  CA  . ILE A 1 191 ? 32.137 11.783  7.539   1.00 61.36  ? 232 ILE A CA  1 
ATOM   1343 C  C   . ILE A 1 191 ? 30.769 11.994  8.199   1.00 56.61  ? 232 ILE A C   1 
ATOM   1344 O  O   . ILE A 1 191 ? 30.604 11.791  9.412   1.00 58.87  ? 232 ILE A O   1 
ATOM   1345 C  CB  . ILE A 1 191 ? 32.356 10.283  7.207   1.00 61.11  ? 232 ILE A CB  1 
ATOM   1346 C  CG1 . ILE A 1 191 ? 31.691 9.927   5.869   1.00 62.49  ? 232 ILE A CG1 1 
ATOM   1347 C  CG2 . ILE A 1 191 ? 31.797 9.419   8.312   1.00 64.86  ? 232 ILE A CG2 1 
ATOM   1348 C  CD1 . ILE A 1 191 ? 32.478 10.384  4.610   1.00 51.21  ? 232 ILE A CD1 1 
ATOM   1349 N  N   . GLY A 1 192 ? 29.804 12.439  7.404   1.00 48.54  ? 233 GLY A N   1 
ATOM   1350 C  CA  . GLY A 1 192 ? 28.462 12.673  7.913   1.00 40.60  ? 233 GLY A CA  1 
ATOM   1351 C  C   . GLY A 1 192 ? 27.483 11.729  7.242   1.00 35.53  ? 233 GLY A C   1 
ATOM   1352 O  O   . GLY A 1 192 ? 27.815 11.068  6.243   1.00 43.05  ? 233 GLY A O   1 
ATOM   1353 N  N   . PHE A 1 193 ? 26.291 11.651  7.816   1.00 33.31  ? 234 PHE A N   1 
ATOM   1354 C  CA  . PHE A 1 193 ? 25.236 10.796  7.318   1.00 36.22  ? 234 PHE A CA  1 
ATOM   1355 C  C   . PHE A 1 193 ? 23.972 11.599  7.044   1.00 41.67  ? 234 PHE A C   1 
ATOM   1356 O  O   . PHE A 1 193 ? 23.776 12.699  7.576   1.00 52.34  ? 234 PHE A O   1 
ATOM   1357 C  CB  . PHE A 1 193 ? 24.901 9.705   8.333   1.00 33.87  ? 234 PHE A CB  1 
ATOM   1358 C  CG  . PHE A 1 193 ? 26.096 8.890   8.765   1.00 47.22  ? 234 PHE A CG  1 
ATOM   1359 C  CD1 . PHE A 1 193 ? 26.930 9.339   9.803   1.00 46.71  ? 234 PHE A CD1 1 
ATOM   1360 C  CD2 . PHE A 1 193 ? 26.418 7.699   8.106   1.00 40.67  ? 234 PHE A CD2 1 
ATOM   1361 C  CE1 . PHE A 1 193 ? 28.078 8.606   10.175  1.00 47.31  ? 234 PHE A CE1 1 
ATOM   1362 C  CE2 . PHE A 1 193 ? 27.563 6.960   8.468   1.00 52.12  ? 234 PHE A CE2 1 
ATOM   1363 C  CZ  . PHE A 1 193 ? 28.392 7.421   9.507   1.00 46.00  ? 234 PHE A CZ  1 
ATOM   1364 N  N   . ALA A 1 194 ? 23.138 11.025  6.184   1.00 36.74  ? 235 ALA A N   1 
ATOM   1365 C  CA  . ALA A 1 194 ? 21.842 11.599  5.830   1.00 34.34  ? 235 ALA A CA  1 
ATOM   1366 C  C   . ALA A 1 194 ? 20.925 10.449  5.430   1.00 33.99  ? 235 ALA A C   1 
ATOM   1367 O  O   . ALA A 1 194 ? 21.411 9.409   4.982   1.00 32.54  ? 235 ALA A O   1 
ATOM   1368 C  CB  . ALA A 1 194 ? 21.988 12.586  4.659   1.00 29.28  ? 235 ALA A CB  1 
ATOM   1369 N  N   . ILE A 1 195 ? 19.615 10.623  5.622   1.00 27.64  ? 236 ILE A N   1 
ATOM   1370 C  CA  . ILE A 1 195 ? 18.655 9.612   5.194   1.00 32.98  ? 236 ILE A CA  1 
ATOM   1371 C  C   . ILE A 1 195 ? 18.448 9.855   3.679   1.00 33.99  ? 236 ILE A C   1 
ATOM   1372 O  O   . ILE A 1 195 ? 18.153 10.970  3.284   1.00 31.32  ? 236 ILE A O   1 
ATOM   1373 C  CB  . ILE A 1 195 ? 17.275 9.773   5.908   1.00 31.50  ? 236 ILE A CB  1 
ATOM   1374 C  CG1 . ILE A 1 195 ? 17.444 9.660   7.436   1.00 42.91  ? 236 ILE A CG1 1 
ATOM   1375 C  CG2 . ILE A 1 195 ? 16.316 8.661   5.446   1.00 26.84  ? 236 ILE A CG2 1 
ATOM   1376 C  CD1 . ILE A 1 195 ? 18.108 10.847  8.076   1.00 54.87  ? 236 ILE A CD1 1 
ATOM   1377 N  N   . PRO A 1 196 ? 18.635 8.830   2.823   1.00 34.30  ? 237 PRO A N   1 
ATOM   1378 C  CA  . PRO A 1 196 ? 18.428 9.081   1.376   1.00 28.71  ? 237 PRO A CA  1 
ATOM   1379 C  C   . PRO A 1 196 ? 17.052 9.672   1.193   1.00 25.83  ? 237 PRO A C   1 
ATOM   1380 O  O   . PRO A 1 196 ? 16.076 9.254   1.873   1.00 29.29  ? 237 PRO A O   1 
ATOM   1381 C  CB  . PRO A 1 196 ? 18.574 7.690   0.748   1.00 29.25  ? 237 PRO A CB  1 
ATOM   1382 C  CG  . PRO A 1 196 ? 19.596 6.977   1.716   1.00 25.54  ? 237 PRO A CG  1 
ATOM   1383 C  CD  . PRO A 1 196 ? 19.051 7.437   3.082   1.00 31.58  ? 237 PRO A CD  1 
ATOM   1384 N  N   . PHE A 1 197 ? 16.935 10.639  0.285   1.00 28.36  ? 238 PHE A N   1 
ATOM   1385 C  CA  . PHE A 1 197 ? 15.622 11.279  0.107   1.00 27.17  ? 238 PHE A CA  1 
ATOM   1386 C  C   . PHE A 1 197 ? 14.517 10.302  -0.223  1.00 30.45  ? 238 PHE A C   1 
ATOM   1387 O  O   . PHE A 1 197 ? 13.387 10.521  0.208   1.00 31.70  ? 238 PHE A O   1 
ATOM   1388 C  CB  . PHE A 1 197 ? 15.659 12.427  -0.939  1.00 26.52  ? 238 PHE A CB  1 
ATOM   1389 C  CG  . PHE A 1 197 ? 15.656 11.974  -2.369  1.00 32.08  ? 238 PHE A CG  1 
ATOM   1390 C  CD1 . PHE A 1 197 ? 14.453 11.840  -3.067  1.00 35.57  ? 238 PHE A CD1 1 
ATOM   1391 C  CD2 . PHE A 1 197 ? 16.857 11.682  -3.034  1.00 29.35  ? 238 PHE A CD2 1 
ATOM   1392 C  CE1 . PHE A 1 197 ? 14.441 11.416  -4.430  1.00 42.81  ? 238 PHE A CE1 1 
ATOM   1393 C  CE2 . PHE A 1 197 ? 16.853 11.254  -4.400  1.00 33.59  ? 238 PHE A CE2 1 
ATOM   1394 C  CZ  . PHE A 1 197 ? 15.645 11.123  -5.095  1.00 32.94  ? 238 PHE A CZ  1 
ATOM   1395 N  N   . GLN A 1 198 ? 14.832 9.214   -0.935  1.00 29.15  ? 239 GLN A N   1 
ATOM   1396 C  CA  . GLN A 1 198 ? 13.777 8.232   -1.308  1.00 32.21  ? 239 GLN A CA  1 
ATOM   1397 C  C   . GLN A 1 198 ? 13.170 7.543   -0.084  1.00 36.32  ? 239 GLN A C   1 
ATOM   1398 O  O   . GLN A 1 198 ? 11.976 7.229   -0.069  1.00 37.56  ? 239 GLN A O   1 
ATOM   1399 C  CB  . GLN A 1 198 ? 14.331 7.154   -2.270  1.00 34.21  ? 239 GLN A CB  1 
ATOM   1400 C  CG  . GLN A 1 198 ? 15.042 7.701   -3.510  1.00 33.53  ? 239 GLN A CG  1 
ATOM   1401 C  CD  . GLN A 1 198 ? 16.574 7.728   -3.350  1.00 47.86  ? 239 GLN A CD  1 
ATOM   1402 O  OE1 . GLN A 1 198 ? 17.299 7.211   -4.213  1.00 44.67  ? 239 GLN A OE1 1 
ATOM   1403 N  NE2 . GLN A 1 198 ? 17.066 8.320   -2.243  1.00 34.02  ? 239 GLN A NE2 1 
ATOM   1404 N  N   . LEU A 1 199 ? 14.011 7.277   0.925   1.00 36.02  ? 240 LEU A N   1 
ATOM   1405 C  CA  . LEU A 1 199 ? 13.560 6.675   2.179   1.00 31.48  ? 240 LEU A CA  1 
ATOM   1406 C  C   . LEU A 1 199 ? 12.871 7.776   3.027   1.00 29.13  ? 240 LEU A C   1 
ATOM   1407 O  O   . LEU A 1 199 ? 11.853 7.547   3.637   1.00 30.23  ? 240 LEU A O   1 
ATOM   1408 C  CB  . LEU A 1 199 ? 14.754 6.120   2.961   1.00 29.56  ? 240 LEU A CB  1 
ATOM   1409 C  CG  . LEU A 1 199 ? 14.553 4.808   3.713   1.00 46.90  ? 240 LEU A CG  1 
ATOM   1410 C  CD1 . LEU A 1 199 ? 15.614 4.683   4.825   1.00 31.95  ? 240 LEU A CD1 1 
ATOM   1411 C  CD2 . LEU A 1 199 ? 13.135 4.741   4.275   1.00 39.69  ? 240 LEU A CD2 1 
ATOM   1412 N  N   . ALA A 1 200 ? 13.471 8.959   3.114   1.00 30.43  ? 241 ALA A N   1 
ATOM   1413 C  CA  . ALA A 1 200 ? 12.854 10.028  3.869   1.00 28.15  ? 241 ALA A CA  1 
ATOM   1414 C  C   . ALA A 1 200 ? 11.428 10.273  3.309   1.00 31.54  ? 241 ALA A C   1 
ATOM   1415 O  O   . ALA A 1 200 ? 10.508 10.492  4.064   1.00 33.29  ? 241 ALA A O   1 
ATOM   1416 C  CB  . ALA A 1 200 ? 13.685 11.297  3.759   1.00 26.30  ? 241 ALA A CB  1 
ATOM   1417 N  N   . THR A 1 201 ? 11.240 10.222  1.991   1.00 28.02  ? 242 THR A N   1 
ATOM   1418 C  CA  . THR A 1 201 ? 9.889  10.413  1.441   1.00 30.71  ? 242 THR A CA  1 
ATOM   1419 C  C   . THR A 1 201 ? 8.925  9.290   1.861   1.00 28.35  ? 242 THR A C   1 
ATOM   1420 O  O   . THR A 1 201 ? 7.796  9.559   2.285   1.00 31.09  ? 242 THR A O   1 
ATOM   1421 C  CB  . THR A 1 201 ? 9.911  10.517  -0.110  1.00 32.45  ? 242 THR A CB  1 
ATOM   1422 O  OG1 . THR A 1 201 ? 10.456 11.789  -0.472  1.00 38.03  ? 242 THR A OG1 1 
ATOM   1423 C  CG2 . THR A 1 201 ? 8.462  10.405  -0.708  1.00 39.10  ? 242 THR A CG2 1 
ATOM   1424 N  N   . LYS A 1 202 ? 9.376  8.046   1.771   1.00 29.99  ? 243 LYS A N   1 
ATOM   1425 C  CA  . LYS A 1 202 ? 8.534  6.897   2.144   1.00 34.58  ? 243 LYS A CA  1 
ATOM   1426 C  C   . LYS A 1 202 ? 8.145  6.989   3.614   1.00 35.86  ? 243 LYS A C   1 
ATOM   1427 O  O   . LYS A 1 202 ? 7.011  6.719   3.992   1.00 36.11  ? 243 LYS A O   1 
ATOM   1428 C  CB  . LYS A 1 202 ? 9.284  5.573   1.937   1.00 41.30  ? 243 LYS A CB  1 
ATOM   1429 C  CG  . LYS A 1 202 ? 9.475  5.101   0.492   1.00 55.49  ? 243 LYS A CG  1 
ATOM   1430 C  CD  . LYS A 1 202 ? 10.234 3.753   0.464   1.00 57.34  ? 243 LYS A CD  1 
ATOM   1431 C  CE  . LYS A 1 202 ? 10.828 3.474   -0.924  1.00 66.08  ? 243 LYS A CE  1 
ATOM   1432 N  NZ  . LYS A 1 202 ? 11.594 2.183   -1.028  1.00 64.03  ? 243 LYS A NZ  1 
ATOM   1433 N  N   . ILE A 1 203 ? 9.106  7.349   4.458   1.00 37.48  ? 244 ILE A N   1 
ATOM   1434 C  CA  . ILE A 1 203 ? 8.835  7.449   5.879   1.00 30.51  ? 244 ILE A CA  1 
ATOM   1435 C  C   . ILE A 1 203 ? 7.831  8.568   6.164   1.00 34.28  ? 244 ILE A C   1 
ATOM   1436 O  O   . ILE A 1 203 ? 6.877  8.375   6.929   1.00 37.52  ? 244 ILE A O   1 
ATOM   1437 C  CB  . ILE A 1 203 ? 10.165 7.607   6.641   1.00 31.45  ? 244 ILE A CB  1 
ATOM   1438 C  CG1 . ILE A 1 203 ? 10.865 6.230   6.616   1.00 40.28  ? 244 ILE A CG1 1 
ATOM   1439 C  CG2 . ILE A 1 203 ? 9.929  8.113   8.070   1.00 29.53  ? 244 ILE A CG2 1 
ATOM   1440 C  CD1 . ILE A 1 203 ? 12.167 6.176   7.284   1.00 46.04  ? 244 ILE A CD1 1 
HETATM 1441 N  N   . MSE A 1 204 ? 8.001  9.729   5.533   1.00 33.09  ? 245 MSE A N   1 
HETATM 1442 C  CA  . MSE A 1 204 ? 7.032  10.801  5.766   1.00 37.22  ? 245 MSE A CA  1 
HETATM 1443 C  C   . MSE A 1 204 ? 5.606  10.375  5.396   1.00 36.76  ? 245 MSE A C   1 
HETATM 1444 O  O   . MSE A 1 204 ? 4.676  10.627  6.148   1.00 33.39  ? 245 MSE A O   1 
HETATM 1445 C  CB  . MSE A 1 204 ? 7.395  12.046  4.975   1.00 37.22  ? 245 MSE A CB  1 
HETATM 1446 C  CG  . MSE A 1 204 ? 6.311  13.107  5.063   1.00 38.46  ? 245 MSE A CG  1 
HETATM 1447 SE SE  . MSE A 1 204 ? 6.836  14.722  4.165   1.00 41.28  ? 245 MSE A SE  1 
HETATM 1448 C  CE  . MSE A 1 204 ? 7.157  13.928  2.417   1.00 33.50  ? 245 MSE A CE  1 
ATOM   1449 N  N   . ASP A 1 205 ? 5.438  9.724   4.245   1.00 33.86  ? 246 ASP A N   1 
ATOM   1450 C  CA  . ASP A 1 205 ? 4.109  9.274   3.812   1.00 38.74  ? 246 ASP A CA  1 
ATOM   1451 C  C   . ASP A 1 205 ? 3.512  8.282   4.848   1.00 39.92  ? 246 ASP A C   1 
ATOM   1452 O  O   . ASP A 1 205 ? 2.340  8.375   5.209   1.00 36.23  ? 246 ASP A O   1 
ATOM   1453 C  CB  . ASP A 1 205 ? 4.182  8.606   2.409   1.00 35.02  ? 246 ASP A CB  1 
ATOM   1454 C  CG  . ASP A 1 205 ? 4.442  9.615   1.265   1.00 45.92  ? 246 ASP A CG  1 
ATOM   1455 O  OD1 . ASP A 1 205 ? 4.274  10.850  1.447   1.00 43.70  ? 246 ASP A OD1 1 
ATOM   1456 O  OD2 . ASP A 1 205 ? 4.805  9.161   0.155   1.00 50.94  ? 246 ASP A OD2 1 
ATOM   1457 N  N   . LYS A 1 206 ? 4.321  7.337   5.320   1.00 41.56  ? 247 LYS A N   1 
ATOM   1458 C  CA  . LYS A 1 206 ? 3.862  6.379   6.328   1.00 41.01  ? 247 LYS A CA  1 
ATOM   1459 C  C   . LYS A 1 206 ? 3.496  7.069   7.637   1.00 41.99  ? 247 LYS A C   1 
ATOM   1460 O  O   . LYS A 1 206 ? 2.531  6.685   8.296   1.00 42.47  ? 247 LYS A O   1 
ATOM   1461 C  CB  . LYS A 1 206 ? 4.931  5.315   6.575   1.00 39.69  ? 247 LYS A CB  1 
ATOM   1462 C  CG  . LYS A 1 206 ? 5.196  4.474   5.345   1.00 35.75  ? 247 LYS A CG  1 
ATOM   1463 C  CD  . LYS A 1 206 ? 6.340  3.520   5.571   1.00 49.39  ? 247 LYS A CD  1 
ATOM   1464 C  CE  . LYS A 1 206 ? 6.368  2.477   4.460   1.00 58.48  ? 247 LYS A CE  1 
ATOM   1465 N  NZ  . LYS A 1 206 ? 5.152  1.590   4.519   1.00 69.46  ? 247 LYS A NZ  1 
ATOM   1466 N  N   . LEU A 1 207 ? 4.253  8.099   8.008   1.00 41.24  ? 248 LEU A N   1 
ATOM   1467 C  CA  . LEU A 1 207 ? 3.962  8.830   9.235   1.00 42.41  ? 248 LEU A CA  1 
ATOM   1468 C  C   . LEU A 1 207 ? 2.687  9.679   9.097   1.00 39.97  ? 248 LEU A C   1 
ATOM   1469 O  O   . LEU A 1 207 ? 1.983  9.922   10.082  1.00 42.35  ? 248 LEU A O   1 
ATOM   1470 C  CB  . LEU A 1 207 ? 5.154  9.734   9.623   1.00 33.83  ? 248 LEU A CB  1 
ATOM   1471 C  CG  . LEU A 1 207 ? 6.406  9.045   10.192  1.00 45.51  ? 248 LEU A CG  1 
ATOM   1472 C  CD1 . LEU A 1 207 ? 7.511  10.098  10.472  1.00 32.98  ? 248 LEU A CD1 1 
ATOM   1473 C  CD2 . LEU A 1 207 ? 6.041  8.291   11.508  1.00 42.38  ? 248 LEU A CD2 1 
ATOM   1474 N  N   . ILE A 1 208 ? 2.393  10.172  7.898   1.00 44.64  ? 249 ILE A N   1 
ATOM   1475 C  CA  . ILE A 1 208 ? 1.176  10.970  7.738   1.00 41.26  ? 249 ILE A CA  1 
ATOM   1476 C  C   . ILE A 1 208 ? -0.031 10.022  7.754   1.00 49.99  ? 249 ILE A C   1 
ATOM   1477 O  O   . ILE A 1 208 ? -1.006 10.262  8.463   1.00 47.51  ? 249 ILE A O   1 
ATOM   1478 C  CB  . ILE A 1 208 ? 1.187  11.752  6.411   1.00 47.02  ? 249 ILE A CB  1 
ATOM   1479 C  CG1 . ILE A 1 208 ? 2.227  12.873  6.489   1.00 40.14  ? 249 ILE A CG1 1 
ATOM   1480 C  CG2 . ILE A 1 208 ? -0.217 12.326  6.114   1.00 43.06  ? 249 ILE A CG2 1 
ATOM   1481 C  CD1 . ILE A 1 208 ? 2.629  13.463  5.138   1.00 30.77  ? 249 ILE A CD1 1 
ATOM   1482 N  N   . ARG A 1 209 ? 0.058  8.930   6.995   1.00 48.42  ? 250 ARG A N   1 
ATOM   1483 C  CA  . ARG A 1 209 ? -1.037 7.967   6.907   1.00 55.43  ? 250 ARG A CA  1 
ATOM   1484 C  C   . ARG A 1 209 ? -1.330 7.382   8.295   1.00 59.18  ? 250 ARG A C   1 
ATOM   1485 O  O   . ARG A 1 209 ? -2.370 7.663   8.886   1.00 59.81  ? 250 ARG A O   1 
ATOM   1486 C  CB  . ARG A 1 209 ? -0.672 6.861   5.910   1.00 59.90  ? 250 ARG A CB  1 
ATOM   1487 C  CG  . ARG A 1 209 ? -1.880 6.176   5.275   1.00 76.83  ? 250 ARG A CG  1 
ATOM   1488 C  CD  . ARG A 1 209 ? -1.470 5.011   4.394   1.00 81.20  ? 250 ARG A CD  1 
ATOM   1489 N  NE  . ARG A 1 209 ? -0.701 4.023   5.146   1.00 88.09  ? 250 ARG A NE  1 
ATOM   1490 C  CZ  . ARG A 1 209 ? 0.557  3.696   4.866   1.00 91.32  ? 250 ARG A CZ  1 
ATOM   1491 N  NH1 . ARG A 1 209 ? 1.183  4.282   3.846   1.00 90.55  ? 250 ARG A NH1 1 
ATOM   1492 N  NH2 . ARG A 1 209 ? 1.192  2.792   5.606   1.00 90.34  ? 250 ARG A NH2 1 
ATOM   1493 N  N   . ASP A 1 210 ? -0.409 6.565   8.796   1.00 61.21  ? 251 ASP A N   1 
ATOM   1494 C  CA  . ASP A 1 210 ? -0.498 5.982   10.133  1.00 61.87  ? 251 ASP A CA  1 
ATOM   1495 C  C   . ASP A 1 210 ? 0.311  7.017   10.908  1.00 61.18  ? 251 ASP A C   1 
ATOM   1496 O  O   . ASP A 1 210 ? 0.973  7.845   10.285  1.00 67.41  ? 251 ASP A O   1 
ATOM   1497 C  CB  . ASP A 1 210 ? 0.230  4.636   10.161  1.00 64.24  ? 251 ASP A CB  1 
ATOM   1498 C  CG  . ASP A 1 210 ? 0.074  3.862   8.854   1.00 71.79  ? 251 ASP A CG  1 
ATOM   1499 O  OD1 . ASP A 1 210 ? -1.081 3.631   8.433   1.00 75.72  ? 251 ASP A OD1 1 
ATOM   1500 O  OD2 . ASP A 1 210 ? 1.099  3.481   8.243   1.00 73.43  ? 251 ASP A OD2 1 
ATOM   1501 N  N   . GLY A 1 211 ? 0.282  7.016   12.233  1.00 57.43  ? 252 GLY A N   1 
ATOM   1502 C  CA  . GLY A 1 211 ? 1.099  8.010   12.933  1.00 40.61  ? 252 GLY A CA  1 
ATOM   1503 C  C   . GLY A 1 211 ? 2.428  7.433   13.377  1.00 40.46  ? 252 GLY A C   1 
ATOM   1504 O  O   . GLY A 1 211 ? 3.034  7.918   14.343  1.00 45.37  ? 252 GLY A O   1 
ATOM   1505 N  N   . ARG A 1 212 ? 2.886  6.386   12.688  1.00 40.76  ? 253 ARG A N   1 
ATOM   1506 C  CA  . ARG A 1 212 ? 4.160  5.735   13.023  1.00 42.91  ? 253 ARG A CA  1 
ATOM   1507 C  C   . ARG A 1 212 ? 4.584  4.895   11.842  1.00 42.70  ? 253 ARG A C   1 
ATOM   1508 O  O   . ARG A 1 212 ? 3.775  4.637   10.960  1.00 42.89  ? 253 ARG A O   1 
ATOM   1509 C  CB  . ARG A 1 212 ? 3.996  4.826   14.254  1.00 49.03  ? 253 ARG A CB  1 
ATOM   1510 C  CG  . ARG A 1 212 ? 2.994  3.673   14.076  1.00 45.35  ? 253 ARG A CG  1 
ATOM   1511 C  CD  . ARG A 1 212 ? 2.805  2.920   15.407  1.00 64.12  ? 253 ARG A CD  1 
ATOM   1512 N  NE  . ARG A 1 212 ? 2.482  1.501   15.234  1.00 71.23  ? 253 ARG A NE  1 
ATOM   1513 C  CZ  . ARG A 1 212 ? 1.301  1.042   14.836  1.00 75.84  ? 253 ARG A CZ  1 
ATOM   1514 N  NH1 . ARG A 1 212 ? 0.309  1.883   14.568  1.00 80.42  ? 253 ARG A NH1 1 
ATOM   1515 N  NH2 . ARG A 1 212 ? 1.116  -0.260  14.697  1.00 76.32  ? 253 ARG A NH2 1 
ATOM   1516 N  N   . VAL A 1 213 ? 5.843  4.463   11.814  1.00 45.85  ? 254 VAL A N   1 
ATOM   1517 C  CA  . VAL A 1 213 ? 6.315  3.652   10.691  1.00 46.80  ? 254 VAL A CA  1 
ATOM   1518 C  C   . VAL A 1 213 ? 6.171  2.180   11.087  1.00 52.82  ? 254 VAL A C   1 
ATOM   1519 O  O   . VAL A 1 213 ? 6.838  1.705   12.008  1.00 50.22  ? 254 VAL A O   1 
ATOM   1520 C  CB  . VAL A 1 213 ? 7.791  3.985   10.337  1.00 44.80  ? 254 VAL A CB  1 
ATOM   1521 C  CG1 . VAL A 1 213 ? 8.239  3.177   9.141   1.00 45.82  ? 254 VAL A CG1 1 
ATOM   1522 C  CG2 . VAL A 1 213 ? 7.937  5.463   10.016  1.00 39.05  ? 254 VAL A CG2 1 
ATOM   1523 N  N   . ILE A 1 214 ? 5.265  1.485   10.399  1.00 54.93  ? 255 ILE A N   1 
ATOM   1524 C  CA  . ILE A 1 214 ? 4.961  0.071   10.648  1.00 53.88  ? 255 ILE A CA  1 
ATOM   1525 C  C   . ILE A 1 214 ? 5.792  -0.813  9.731   1.00 54.96  ? 255 ILE A C   1 
ATOM   1526 O  O   . ILE A 1 214 ? 5.615  -0.788  8.516   1.00 55.34  ? 255 ILE A O   1 
ATOM   1527 C  CB  . ILE A 1 214 ? 3.450  -0.216  10.388  1.00 59.17  ? 255 ILE A CB  1 
ATOM   1528 C  CG1 . ILE A 1 214 ? 2.577  0.603   11.354  1.00 58.21  ? 255 ILE A CG1 1 
ATOM   1529 C  CG2 . ILE A 1 214 ? 3.155  -1.703  10.538  1.00 55.85  ? 255 ILE A CG2 1 
ATOM   1530 C  CD1 . ILE A 1 214 ? 1.096  0.535   11.039  1.00 54.27  ? 255 ILE A CD1 1 
ATOM   1531 N  N   . ARG A 1 215 ? 6.705  -1.589  10.302  1.00 55.79  ? 256 ARG A N   1 
ATOM   1532 C  CA  . ARG A 1 215 ? 7.549  -2.456  9.480   1.00 60.30  ? 256 ARG A CA  1 
ATOM   1533 C  C   . ARG A 1 215 ? 7.231  -3.938  9.635   1.00 63.71  ? 256 ARG A C   1 
ATOM   1534 O  O   . ARG A 1 215 ? 6.833  -4.395  10.707  1.00 61.99  ? 256 ARG A O   1 
ATOM   1535 C  CB  . ARG A 1 215 ? 9.026  -2.235  9.811   1.00 57.66  ? 256 ARG A CB  1 
ATOM   1536 C  CG  . ARG A 1 215 ? 9.581  -0.857  9.465   1.00 54.42  ? 256 ARG A CG  1 
ATOM   1537 C  CD  . ARG A 1 215 ? 10.940 -0.690  10.110  1.00 47.18  ? 256 ARG A CD  1 
ATOM   1538 N  NE  . ARG A 1 215 ? 11.716 0.438   9.610   1.00 44.91  ? 256 ARG A NE  1 
ATOM   1539 C  CZ  . ARG A 1 215 ? 11.601 1.691   10.030  1.00 49.68  ? 256 ARG A CZ  1 
ATOM   1540 N  NH1 . ARG A 1 215 ? 10.726 2.010   10.974  1.00 49.18  ? 256 ARG A NH1 1 
ATOM   1541 N  NH2 . ARG A 1 215 ? 12.380 2.630   9.505   1.00 51.44  ? 256 ARG A NH2 1 
ATOM   1542 N  N   . GLY A 1 216 ? 7.416  -4.680  8.549   1.00 69.46  ? 257 GLY A N   1 
ATOM   1543 C  CA  . GLY A 1 216 ? 7.174  -6.112  8.567   1.00 76.90  ? 257 GLY A CA  1 
ATOM   1544 C  C   . GLY A 1 216 ? 8.387  -6.888  9.055   1.00 79.67  ? 257 GLY A C   1 
ATOM   1545 O  O   . GLY A 1 216 ? 9.483  -6.753  8.506   1.00 75.37  ? 257 GLY A O   1 
ATOM   1546 N  N   . TYR A 1 217 ? 8.181  -7.718  10.077  1.00 86.32  ? 258 TYR A N   1 
ATOM   1547 C  CA  . TYR A 1 217 ? 9.254  -8.516  10.680  1.00 92.95  ? 258 TYR A CA  1 
ATOM   1548 C  C   . TYR A 1 217 ? 9.127  -10.024 10.418  1.00 94.91  ? 258 TYR A C   1 
ATOM   1549 O  O   . TYR A 1 217 ? 8.030  -10.532 10.182  1.00 96.46  ? 258 TYR A O   1 
ATOM   1550 C  CB  . TYR A 1 217 ? 9.266  -8.254  12.189  1.00 98.27  ? 258 TYR A CB  1 
ATOM   1551 C  CG  . TYR A 1 217 ? 10.400 -8.901  12.948  1.00 103.16 ? 258 TYR A CG  1 
ATOM   1552 C  CD1 . TYR A 1 217 ? 11.727 -8.685  12.577  1.00 104.79 ? 258 TYR A CD1 1 
ATOM   1553 C  CD2 . TYR A 1 217 ? 10.148 -9.694  14.069  1.00 104.43 ? 258 TYR A CD2 1 
ATOM   1554 C  CE1 . TYR A 1 217 ? 12.778 -9.238  13.307  1.00 108.36 ? 258 TYR A CE1 1 
ATOM   1555 C  CE2 . TYR A 1 217 ? 11.191 -10.252 14.807  1.00 107.26 ? 258 TYR A CE2 1 
ATOM   1556 C  CZ  . TYR A 1 217 ? 12.503 -10.019 14.422  1.00 108.73 ? 258 TYR A CZ  1 
ATOM   1557 O  OH  . TYR A 1 217 ? 13.540 -10.551 15.161  1.00 109.19 ? 258 TYR A OH  1 
ATOM   1558 N  N   . ILE A 1 218 ? 10.250 -10.740 10.461  1.00 97.16  ? 259 ILE A N   1 
ATOM   1559 C  CA  . ILE A 1 218 ? 10.224 -12.186 10.242  1.00 98.26  ? 259 ILE A CA  1 
ATOM   1560 C  C   . ILE A 1 218 ? 11.298 -12.937 11.044  1.00 100.41 ? 259 ILE A C   1 
ATOM   1561 O  O   . ILE A 1 218 ? 11.292 -14.167 11.099  1.00 100.53 ? 259 ILE A O   1 
ATOM   1562 C  CB  . ILE A 1 218 ? 10.353 -12.528 8.731   1.00 95.09  ? 259 ILE A CB  1 
ATOM   1563 C  CG1 . ILE A 1 218 ? 9.663  -13.861 8.440   1.00 90.60  ? 259 ILE A CG1 1 
ATOM   1564 C  CG2 . ILE A 1 218 ? 11.817 -12.595 8.322   1.00 95.57  ? 259 ILE A CG2 1 
ATOM   1565 C  CD1 . ILE A 1 218 ? 9.575  -14.199 6.967   1.00 85.93  ? 259 ILE A CD1 1 
ATOM   1566 N  N   . GLY A 1 219 ? 12.207 -12.192 11.671  1.00 101.99 ? 260 GLY A N   1 
ATOM   1567 C  CA  . GLY A 1 219 ? 13.259 -12.801 12.472  1.00 105.06 ? 260 GLY A CA  1 
ATOM   1568 C  C   . GLY A 1 219 ? 14.096 -13.860 11.773  1.00 107.42 ? 260 GLY A C   1 
ATOM   1569 O  O   . GLY A 1 219 ? 13.934 -15.051 12.030  1.00 107.27 ? 260 GLY A O   1 
ATOM   1570 N  N   . ILE A 1 220 ? 14.998 -13.423 10.897  1.00 110.09 ? 261 ILE A N   1 
ATOM   1571 C  CA  . ILE A 1 220 ? 15.875 -14.324 10.146  1.00 111.73 ? 261 ILE A CA  1 
ATOM   1572 C  C   . ILE A 1 220 ? 17.190 -13.625 9.777   1.00 114.24 ? 261 ILE A C   1 
ATOM   1573 O  O   . ILE A 1 220 ? 17.271 -12.393 9.768   1.00 114.35 ? 261 ILE A O   1 
ATOM   1574 C  CB  . ILE A 1 220 ? 15.195 -14.815 8.828   1.00 110.70 ? 261 ILE A CB  1 
ATOM   1575 C  CG1 . ILE A 1 220 ? 13.981 -15.685 9.155   1.00 110.34 ? 261 ILE A CG1 1 
ATOM   1576 C  CG2 . ILE A 1 220 ? 16.185 -15.611 7.972   1.00 109.85 ? 261 ILE A CG2 1 
ATOM   1577 C  CD1 . ILE A 1 220 ? 13.304 -16.266 7.927   1.00 109.82 ? 261 ILE A CD1 1 
ATOM   1578 N  N   . GLY A 1 221 ? 18.215 -14.424 9.479   1.00 115.81 ? 262 GLY A N   1 
ATOM   1579 C  CA  . GLY A 1 221 ? 19.512 -13.892 9.092   1.00 115.39 ? 262 GLY A CA  1 
ATOM   1580 C  C   . GLY A 1 221 ? 19.986 -14.571 7.818   1.00 116.28 ? 262 GLY A C   1 
ATOM   1581 O  O   . GLY A 1 221 ? 19.171 -14.974 6.984   1.00 116.93 ? 262 GLY A O   1 
ATOM   1582 N  N   . GLY A 1 222 ? 21.299 -14.702 7.655   1.00 116.05 ? 263 GLY A N   1 
ATOM   1583 C  CA  . GLY A 1 222 ? 21.818 -15.355 6.467   1.00 115.89 ? 263 GLY A CA  1 
ATOM   1584 C  C   . GLY A 1 222 ? 22.623 -14.471 5.535   1.00 115.69 ? 263 GLY A C   1 
ATOM   1585 O  O   . GLY A 1 222 ? 23.085 -13.399 5.925   1.00 114.91 ? 263 GLY A O   1 
ATOM   1586 N  N   . ARG A 1 223 ? 22.793 -14.935 4.299   1.00 115.25 ? 264 ARG A N   1 
ATOM   1587 C  CA  . ARG A 1 223 ? 23.544 -14.202 3.283   1.00 116.74 ? 264 ARG A CA  1 
ATOM   1588 C  C   . ARG A 1 223 ? 23.572 -14.979 1.969   1.00 116.53 ? 264 ARG A C   1 
ATOM   1589 O  O   . ARG A 1 223 ? 23.259 -16.170 1.933   1.00 116.00 ? 264 ARG A O   1 
ATOM   1590 C  CB  . ARG A 1 223 ? 24.971 -13.939 3.766   1.00 116.06 ? 264 ARG A CB  1 
ATOM   1591 N  N   . GLY A 1 240 ? 20.296 -18.968 -4.080  1.00 103.16 ? 281 GLY A N   1 
ATOM   1592 C  CA  . GLY A 1 240 ? 19.513 -19.076 -2.863  1.00 106.19 ? 281 GLY A CA  1 
ATOM   1593 C  C   . GLY A 1 240 ? 20.107 -18.314 -1.690  1.00 107.41 ? 281 GLY A C   1 
ATOM   1594 O  O   . GLY A 1 240 ? 21.230 -17.813 -1.768  1.00 107.66 ? 281 GLY A O   1 
ATOM   1595 N  N   . ILE A 1 241 ? 19.347 -18.229 -0.599  1.00 108.20 ? 282 ILE A N   1 
ATOM   1596 C  CA  . ILE A 1 241 ? 19.784 -17.529 0.609   1.00 110.15 ? 282 ILE A CA  1 
ATOM   1597 C  C   . ILE A 1 241 ? 19.829 -18.483 1.804   1.00 109.49 ? 282 ILE A C   1 
ATOM   1598 O  O   . ILE A 1 241 ? 18.820 -19.089 2.164   1.00 108.84 ? 282 ILE A O   1 
ATOM   1599 C  CB  . ILE A 1 241 ? 18.839 -16.334 0.932   1.00 112.50 ? 282 ILE A CB  1 
ATOM   1600 C  CG1 . ILE A 1 241 ? 19.182 -15.741 2.302   1.00 112.63 ? 282 ILE A CG1 1 
ATOM   1601 C  CG2 . ILE A 1 241 ? 17.386 -16.787 0.882   1.00 113.86 ? 282 ILE A CG2 1 
ATOM   1602 C  CD1 . ILE A 1 241 ? 18.319 -14.549 2.687   1.00 114.18 ? 282 ILE A CD1 1 
ATOM   1603 N  N   . VAL A 1 242 ? 21.004 -18.602 2.418   1.00 109.78 ? 283 VAL A N   1 
ATOM   1604 C  CA  . VAL A 1 242 ? 21.210 -19.496 3.559   1.00 109.26 ? 283 VAL A CA  1 
ATOM   1605 C  C   . VAL A 1 242 ? 20.771 -18.916 4.906   1.00 108.73 ? 283 VAL A C   1 
ATOM   1606 O  O   . VAL A 1 242 ? 21.317 -17.916 5.365   1.00 109.64 ? 283 VAL A O   1 
ATOM   1607 C  CB  . VAL A 1 242 ? 22.703 -19.909 3.665   1.00 108.92 ? 283 VAL A CB  1 
ATOM   1608 C  CG1 . VAL A 1 242 ? 22.934 -20.728 4.927   1.00 107.40 ? 283 VAL A CG1 1 
ATOM   1609 C  CG2 . VAL A 1 242 ? 23.112 -20.705 2.432   1.00 106.16 ? 283 VAL A CG2 1 
ATOM   1610 N  N   . VAL A 1 243 ? 19.792 -19.559 5.538   1.00 108.36 ? 284 VAL A N   1 
ATOM   1611 C  CA  . VAL A 1 243 ? 19.286 -19.119 6.837   1.00 109.18 ? 284 VAL A CA  1 
ATOM   1612 C  C   . VAL A 1 243 ? 20.349 -19.283 7.919   1.00 112.28 ? 284 VAL A C   1 
ATOM   1613 O  O   . VAL A 1 243 ? 20.376 -20.288 8.628   1.00 113.99 ? 284 VAL A O   1 
ATOM   1614 C  CB  . VAL A 1 243 ? 18.037 -19.923 7.254   1.00 106.81 ? 284 VAL A CB  1 
ATOM   1615 C  CG1 . VAL A 1 243 ? 17.666 -19.604 8.694   1.00 105.59 ? 284 VAL A CG1 1 
ATOM   1616 C  CG2 . VAL A 1 243 ? 16.880 -19.594 6.334   1.00 105.03 ? 284 VAL A CG2 1 
ATOM   1617 N  N   . ASN A 1 244 ? 21.218 -18.285 8.048   1.00 115.56 ? 285 ASN A N   1 
ATOM   1618 C  CA  . ASN A 1 244 ? 22.289 -18.326 9.039   1.00 118.84 ? 285 ASN A CA  1 
ATOM   1619 C  C   . ASN A 1 244 ? 21.731 -18.426 10.464  1.00 120.02 ? 285 ASN A C   1 
ATOM   1620 O  O   . ASN A 1 244 ? 21.837 -19.466 11.113  1.00 121.53 ? 285 ASN A O   1 
ATOM   1621 C  CB  . ASN A 1 244 ? 23.172 -17.079 8.903   1.00 119.30 ? 285 ASN A CB  1 
ATOM   1622 C  CG  . ASN A 1 244 ? 24.612 -17.332 9.314   1.00 120.58 ? 285 ASN A CG  1 
ATOM   1623 O  OD1 . ASN A 1 244 ? 25.307 -18.156 8.712   1.00 120.50 ? 285 ASN A OD1 1 
ATOM   1624 N  ND2 . ASN A 1 244 ? 25.069 -16.622 10.342  1.00 121.16 ? 285 ASN A ND2 1 
ATOM   1625 N  N   . GLU A 1 245 ? 21.134 -17.343 10.947  1.00 121.62 ? 286 GLU A N   1 
ATOM   1626 C  CA  . GLU A 1 245 ? 20.567 -17.323 12.290  1.00 123.06 ? 286 GLU A CA  1 
ATOM   1627 C  C   . GLU A 1 245 ? 19.104 -16.892 12.196  1.00 124.93 ? 286 GLU A C   1 
ATOM   1628 O  O   . GLU A 1 245 ? 18.807 -15.752 11.837  1.00 124.97 ? 286 GLU A O   1 
ATOM   1629 C  CB  . GLU A 1 245 ? 21.365 -16.348 13.163  1.00 122.85 ? 286 GLU A CB  1 
ATOM   1630 C  CG  . GLU A 1 245 ? 21.073 -16.409 14.656  1.00 122.17 ? 286 GLU A CG  1 
ATOM   1631 C  CD  . GLU A 1 245 ? 19.709 -15.859 15.020  1.00 122.74 ? 286 GLU A CD  1 
ATOM   1632 O  OE1 . GLU A 1 245 ? 18.695 -16.542 14.767  1.00 123.19 ? 286 GLU A OE1 1 
ATOM   1633 O  OE2 . GLU A 1 245 ? 19.648 -14.735 15.559  1.00 122.49 ? 286 GLU A OE2 1 
ATOM   1634 N  N   . VAL A 1 246 ? 18.192 -17.806 12.517  1.00 126.45 ? 287 VAL A N   1 
ATOM   1635 C  CA  . VAL A 1 246 ? 16.763 -17.510 12.451  1.00 127.36 ? 287 VAL A CA  1 
ATOM   1636 C  C   . VAL A 1 246 ? 15.985 -18.050 13.647  1.00 127.92 ? 287 VAL A C   1 
ATOM   1637 O  O   . VAL A 1 246 ? 14.990 -18.755 13.478  1.00 128.03 ? 287 VAL A O   1 
ATOM   1638 C  CB  . VAL A 1 246 ? 16.181 -18.073 11.161  1.00 127.28 ? 287 VAL A CB  1 
ATOM   1639 N  N   . SER A 1 247 ? 16.428 -17.709 14.852  1.00 129.17 ? 288 SER A N   1 
ATOM   1640 C  CA  . SER A 1 247 ? 15.759 -18.172 16.063  1.00 130.99 ? 288 SER A CA  1 
ATOM   1641 C  C   . SER A 1 247 ? 15.315 -17.040 16.987  1.00 131.31 ? 288 SER A C   1 
ATOM   1642 O  O   . SER A 1 247 ? 15.275 -17.209 18.208  1.00 131.75 ? 288 SER A O   1 
ATOM   1643 C  CB  . SER A 1 247 ? 16.672 -19.133 16.826  1.00 131.33 ? 288 SER A CB  1 
ATOM   1644 N  N   . PRO A 1 248 ? 14.972 -15.871 16.426  1.00 131.53 ? 289 PRO A N   1 
ATOM   1645 C  CA  . PRO A 1 248 ? 14.547 -14.791 17.317  1.00 132.44 ? 289 PRO A CA  1 
ATOM   1646 C  C   . PRO A 1 248 ? 13.274 -15.177 18.067  1.00 133.27 ? 289 PRO A C   1 
ATOM   1647 O  O   . PRO A 1 248 ? 12.809 -14.440 18.938  1.00 133.47 ? 289 PRO A O   1 
ATOM   1648 C  CB  . PRO A 1 248 ? 14.315 -13.622 16.358  1.00 131.67 ? 289 PRO A CB  1 
ATOM   1649 C  CG  . PRO A 1 248 ? 15.232 -13.924 15.213  1.00 131.31 ? 289 PRO A CG  1 
ATOM   1650 C  CD  . PRO A 1 248 ? 15.020 -15.400 15.031  1.00 131.71 ? 289 PRO A CD  1 
ATOM   1651 N  N   . ASP A 1 249 ? 12.723 -16.339 17.722  1.00 133.87 ? 290 ASP A N   1 
ATOM   1652 C  CA  . ASP A 1 249 ? 11.487 -16.831 18.326  1.00 134.69 ? 290 ASP A CA  1 
ATOM   1653 C  C   . ASP A 1 249 ? 10.302 -16.059 17.747  1.00 136.04 ? 290 ASP A C   1 
ATOM   1654 O  O   . ASP A 1 249 ? 9.164  -16.209 18.194  1.00 135.78 ? 290 ASP A O   1 
ATOM   1655 C  CB  . ASP A 1 249 ? 11.520 -16.665 19.849  1.00 132.38 ? 290 ASP A CB  1 
ATOM   1656 C  CG  . ASP A 1 249 ? 10.164 -16.882 20.485  1.00 130.86 ? 290 ASP A CG  1 
ATOM   1657 O  OD1 . ASP A 1 249 ? 9.580  -17.964 20.280  1.00 130.90 ? 290 ASP A OD1 1 
ATOM   1658 O  OD2 . ASP A 1 249 ? 9.677  -15.969 21.183  1.00 130.46 ? 290 ASP A OD2 1 
ATOM   1659 N  N   . GLY A 1 250 ? 10.584 -15.233 16.742  1.00 137.12 ? 291 GLY A N   1 
ATOM   1660 C  CA  . GLY A 1 250 ? 9.543  -14.444 16.111  1.00 137.73 ? 291 GLY A CA  1 
ATOM   1661 C  C   . GLY A 1 250 ? 8.608  -15.292 15.271  1.00 138.01 ? 291 GLY A C   1 
ATOM   1662 O  O   . GLY A 1 250 ? 8.212  -16.378 15.692  1.00 139.32 ? 291 GLY A O   1 
ATOM   1663 N  N   . PRO A 1 251 ? 8.237  -14.826 14.070  1.00 137.54 ? 292 PRO A N   1 
ATOM   1664 C  CA  . PRO A 1 251 ? 7.336  -15.583 13.198  1.00 137.40 ? 292 PRO A CA  1 
ATOM   1665 C  C   . PRO A 1 251 ? 8.006  -16.782 12.530  1.00 137.39 ? 292 PRO A C   1 
ATOM   1666 O  O   . PRO A 1 251 ? 7.393  -17.841 12.395  1.00 136.97 ? 292 PRO A O   1 
ATOM   1667 C  CB  . PRO A 1 251 ? 6.887  -14.534 12.190  1.00 136.76 ? 292 PRO A CB  1 
ATOM   1668 C  CG  . PRO A 1 251 ? 8.114  -13.713 12.030  1.00 136.17 ? 292 PRO A CG  1 
ATOM   1669 C  CD  . PRO A 1 251 ? 8.591  -13.533 13.458  1.00 136.40 ? 292 PRO A CD  1 
ATOM   1670 N  N   . ALA A 1 252 ? 9.261  -16.607 12.119  1.00 137.58 ? 293 ALA A N   1 
ATOM   1671 C  CA  . ALA A 1 252 ? 10.022 -17.666 11.457  1.00 137.78 ? 293 ALA A CA  1 
ATOM   1672 C  C   . ALA A 1 252 ? 10.137 -18.912 12.333  1.00 138.40 ? 293 ALA A C   1 
ATOM   1673 O  O   . ALA A 1 252 ? 10.428 -20.004 11.843  1.00 137.39 ? 293 ALA A O   1 
ATOM   1674 C  CB  . ALA A 1 252 ? 11.412 -17.157 11.088  1.00 136.00 ? 293 ALA A CB  1 
ATOM   1675 N  N   . ALA A 1 253 ? 9.907  -18.738 13.631  1.00 139.14 ? 294 ALA A N   1 
ATOM   1676 C  CA  . ALA A 1 253 ? 9.974  -19.842 14.579  1.00 138.90 ? 294 ALA A CA  1 
ATOM   1677 C  C   . ALA A 1 253 ? 8.620  -20.536 14.653  1.00 138.56 ? 294 ALA A C   1 
ATOM   1678 O  O   . ALA A 1 253 ? 8.522  -21.746 14.447  1.00 138.84 ? 294 ALA A O   1 
ATOM   1679 C  CB  . ALA A 1 253 ? 10.377 -19.325 15.960  1.00 138.66 ? 294 ALA A CB  1 
ATOM   1680 N  N   . ASN A 1 254 ? 7.580  -19.758 14.941  1.00 138.10 ? 295 ASN A N   1 
ATOM   1681 C  CA  . ASN A 1 254 ? 6.224  -20.284 15.044  1.00 137.72 ? 295 ASN A CA  1 
ATOM   1682 C  C   . ASN A 1 254 ? 5.686  -20.704 13.679  1.00 138.36 ? 295 ASN A C   1 
ATOM   1683 O  O   . ASN A 1 254 ? 4.548  -20.396 13.324  1.00 137.50 ? 295 ASN A O   1 
ATOM   1684 C  CB  . ASN A 1 254 ? 5.302  -19.234 15.663  1.00 136.95 ? 295 ASN A CB  1 
ATOM   1685 C  CG  . ASN A 1 254 ? 5.807  -18.733 17.000  1.00 136.12 ? 295 ASN A CG  1 
ATOM   1686 O  OD1 . ASN A 1 254 ? 6.073  -19.517 17.909  1.00 135.87 ? 295 ASN A OD1 1 
ATOM   1687 N  ND2 . ASN A 1 254 ? 5.937  -17.420 17.127  1.00 135.97 ? 295 ASN A ND2 1 
ATOM   1688 N  N   . ALA A 1 255 ? 6.521  -21.408 12.921  1.00 140.02 ? 296 ALA A N   1 
ATOM   1689 C  CA  . ALA A 1 255 ? 6.160  -21.894 11.595  1.00 141.62 ? 296 ALA A CA  1 
ATOM   1690 C  C   . ALA A 1 255 ? 7.276  -22.775 11.039  1.00 142.71 ? 296 ALA A C   1 
ATOM   1691 O  O   . ALA A 1 255 ? 8.265  -23.049 11.726  1.00 142.24 ? 296 ALA A O   1 
ATOM   1692 C  CB  . ALA A 1 255 ? 5.898  -20.724 10.661  1.00 142.13 ? 296 ALA A CB  1 
ATOM   1693 N  N   . GLY A 1 256 ? 7.117  -23.210 9.792   1.00 143.58 ? 297 GLY A N   1 
ATOM   1694 C  CA  . GLY A 1 256 ? 8.114  -24.064 9.173   1.00 144.89 ? 297 GLY A CA  1 
ATOM   1695 C  C   . GLY A 1 256 ? 9.415  -23.375 8.799   1.00 145.65 ? 297 GLY A C   1 
ATOM   1696 O  O   . GLY A 1 256 ? 9.532  -22.811 7.710   1.00 146.10 ? 297 GLY A O   1 
ATOM   1697 N  N   . ILE A 1 257 ? 10.394 -23.429 9.701   1.00 145.61 ? 298 ILE A N   1 
ATOM   1698 C  CA  . ILE A 1 257 ? 11.701 -22.819 9.470   1.00 145.50 ? 298 ILE A CA  1 
ATOM   1699 C  C   . ILE A 1 257 ? 12.711 -23.286 10.517  1.00 145.75 ? 298 ILE A C   1 
ATOM   1700 O  O   . ILE A 1 257 ? 12.514 -23.073 11.713  1.00 145.57 ? 298 ILE A O   1 
ATOM   1701 C  CB  . ILE A 1 257 ? 11.583 -21.298 9.499   1.00 144.08 ? 298 ILE A CB  1 
ATOM   1702 N  N   . GLN A 1 258 ? 13.787 -23.925 10.058  1.00 146.41 ? 299 GLN A N   1 
ATOM   1703 C  CA  . GLN A 1 258 ? 14.843 -24.426 10.943  1.00 146.74 ? 299 GLN A CA  1 
ATOM   1704 C  C   . GLN A 1 258 ? 15.981 -23.406 11.074  1.00 147.05 ? 299 GLN A C   1 
ATOM   1705 O  O   . GLN A 1 258 ? 16.093 -22.485 10.265  1.00 148.61 ? 299 GLN A O   1 
ATOM   1706 C  CB  . GLN A 1 258 ? 15.393 -25.755 10.409  1.00 145.99 ? 299 GLN A CB  1 
ATOM   1707 C  CG  . GLN A 1 258 ? 14.395 -26.911 10.430  1.00 144.20 ? 299 GLN A CG  1 
ATOM   1708 C  CD  . GLN A 1 258 ? 14.099 -27.425 11.833  1.00 142.57 ? 299 GLN A CD  1 
ATOM   1709 O  OE1 . GLN A 1 258 ? 13.266 -28.311 12.014  1.00 141.33 ? 299 GLN A OE1 1 
ATOM   1710 N  NE2 . GLN A 1 258 ? 14.783 -26.873 12.828  1.00 141.79 ? 299 GLN A NE2 1 
ATOM   1711 N  N   . VAL A 1 259 ? 16.829 -23.579 12.087  1.00 146.41 ? 300 VAL A N   1 
ATOM   1712 C  CA  . VAL A 1 259 ? 17.938 -22.657 12.331  1.00 144.81 ? 300 VAL A CA  1 
ATOM   1713 C  C   . VAL A 1 259 ? 19.187 -22.954 11.500  1.00 143.69 ? 300 VAL A C   1 
ATOM   1714 O  O   . VAL A 1 259 ? 20.297 -22.585 11.884  1.00 142.79 ? 300 VAL A O   1 
ATOM   1715 C  CB  . VAL A 1 259 ? 18.325 -22.649 13.838  1.00 144.74 ? 300 VAL A CB  1 
ATOM   1716 C  CG1 . VAL A 1 259 ? 18.957 -23.977 14.226  1.00 144.91 ? 300 VAL A CG1 1 
ATOM   1717 C  CG2 . VAL A 1 259 ? 19.265 -21.486 14.139  1.00 144.88 ? 300 VAL A CG2 1 
ATOM   1718 N  N   . ASN A 1 260 ? 19.013 -23.610 10.357  1.00 143.11 ? 301 ASN A N   1 
ATOM   1719 C  CA  . ASN A 1 260 ? 20.161 -23.929 9.520   1.00 142.56 ? 301 ASN A CA  1 
ATOM   1720 C  C   . ASN A 1 260 ? 19.785 -24.497 8.154   1.00 141.74 ? 301 ASN A C   1 
ATOM   1721 O  O   . ASN A 1 260 ? 20.252 -25.570 7.777   1.00 141.95 ? 301 ASN A O   1 
ATOM   1722 C  CB  . ASN A 1 260 ? 21.073 -24.918 10.253  1.00 143.62 ? 301 ASN A CB  1 
ATOM   1723 C  CG  . ASN A 1 260 ? 22.470 -24.973 9.667   1.00 144.35 ? 301 ASN A CG  1 
ATOM   1724 O  OD1 . ASN A 1 260 ? 23.207 -23.987 9.699   1.00 145.14 ? 301 ASN A OD1 1 
ATOM   1725 N  ND2 . ASN A 1 260 ? 22.842 -26.127 9.129   1.00 145.24 ? 301 ASN A ND2 1 
ATOM   1726 N  N   . ASP A 1 261 ? 18.946 -23.779 7.413   1.00 140.89 ? 302 ASP A N   1 
ATOM   1727 C  CA  . ASP A 1 261 ? 18.544 -24.221 6.080   1.00 140.64 ? 302 ASP A CA  1 
ATOM   1728 C  C   . ASP A 1 261 ? 18.597 -23.086 5.062   1.00 140.19 ? 302 ASP A C   1 
ATOM   1729 O  O   . ASP A 1 261 ? 19.118 -22.012 5.352   1.00 139.51 ? 302 ASP A O   1 
ATOM   1730 C  CB  . ASP A 1 261 ? 17.146 -24.847 6.116   1.00 140.95 ? 302 ASP A CB  1 
ATOM   1731 C  CG  . ASP A 1 261 ? 16.176 -24.061 6.962   1.00 141.22 ? 302 ASP A CG  1 
ATOM   1732 O  OD1 . ASP A 1 261 ? 16.470 -23.853 8.157   1.00 140.72 ? 302 ASP A OD1 1 
ATOM   1733 O  OD2 . ASP A 1 261 ? 15.118 -23.660 6.435   1.00 141.57 ? 302 ASP A OD2 1 
ATOM   1734 N  N   . LEU A 1 262 ? 18.059 -23.322 3.870   1.00 140.32 ? 303 LEU A N   1 
ATOM   1735 C  CA  . LEU A 1 262 ? 18.089 -22.314 2.814   1.00 141.00 ? 303 LEU A CA  1 
ATOM   1736 C  C   . LEU A 1 262 ? 16.715 -21.999 2.215   1.00 141.75 ? 303 LEU A C   1 
ATOM   1737 O  O   . LEU A 1 262 ? 16.083 -22.861 1.607   1.00 142.23 ? 303 LEU A O   1 
ATOM   1738 C  CB  . LEU A 1 262 ? 19.059 -22.779 1.717   1.00 140.68 ? 303 LEU A CB  1 
ATOM   1739 C  CG  . LEU A 1 262 ? 19.323 -21.930 0.471   1.00 141.18 ? 303 LEU A CG  1 
ATOM   1740 C  CD1 . LEU A 1 262 ? 20.636 -22.361 -0.157  1.00 141.27 ? 303 LEU A CD1 1 
ATOM   1741 C  CD2 . LEU A 1 262 ? 18.186 -22.079 -0.521  1.00 141.57 ? 303 LEU A CD2 1 
ATOM   1742 N  N   . ILE A 1 263 ? 16.266 -20.756 2.391   1.00 141.59 ? 304 ILE A N   1 
ATOM   1743 C  CA  . ILE A 1 263 ? 14.975 -20.304 1.868   1.00 140.56 ? 304 ILE A CA  1 
ATOM   1744 C  C   . ILE A 1 263 ? 15.116 -20.006 0.379   1.00 140.83 ? 304 ILE A C   1 
ATOM   1745 O  O   . ILE A 1 263 ? 16.218 -19.752 -0.102  1.00 140.33 ? 304 ILE A O   1 
ATOM   1746 C  CB  . ILE A 1 263 ? 14.511 -18.997 2.545   1.00 140.07 ? 304 ILE A CB  1 
ATOM   1747 C  CG1 . ILE A 1 263 ? 14.626 -19.101 4.067   1.00 139.54 ? 304 ILE A CG1 1 
ATOM   1748 C  CG2 . ILE A 1 263 ? 13.082 -18.689 2.130   1.00 139.93 ? 304 ILE A CG2 1 
ATOM   1749 C  CD1 . ILE A 1 263 ? 13.637 -20.039 4.711   1.00 141.51 ? 304 ILE A CD1 1 
ATOM   1750 N  N   . ILE A 1 264 ? 14.004 -20.022 -0.348  1.00 141.82 ? 305 ILE A N   1 
ATOM   1751 C  CA  . ILE A 1 264 ? 14.042 -19.735 -1.780  1.00 143.69 ? 305 ILE A CA  1 
ATOM   1752 C  C   . ILE A 1 264 ? 13.168 -18.538 -2.153  1.00 144.25 ? 305 ILE A C   1 
ATOM   1753 O  O   . ILE A 1 264 ? 13.685 -17.455 -2.428  1.00 145.12 ? 305 ILE A O   1 
ATOM   1754 C  CB  . ILE A 1 264 ? 13.605 -20.964 -2.615  1.00 144.57 ? 305 ILE A CB  1 
ATOM   1755 C  CG1 . ILE A 1 264 ? 14.628 -22.092 -2.456  1.00 144.58 ? 305 ILE A CG1 1 
ATOM   1756 C  CG2 . ILE A 1 264 ? 13.466 -20.581 -4.086  1.00 144.86 ? 305 ILE A CG2 1 
ATOM   1757 C  CD1 . ILE A 1 264 ? 16.006 -21.761 -3.008  1.00 144.58 ? 305 ILE A CD1 1 
ATOM   1758 N  N   . SER A 1 265 ? 11.851 -18.726 -2.170  1.00 144.33 ? 306 SER A N   1 
ATOM   1759 C  CA  . SER A 1 265 ? 10.948 -17.632 -2.515  1.00 143.99 ? 306 SER A CA  1 
ATOM   1760 C  C   . SER A 1 265 ? 10.538 -16.859 -1.263  1.00 144.50 ? 306 SER A C   1 
ATOM   1761 O  O   . SER A 1 265 ? 9.909  -17.414 -0.360  1.00 144.59 ? 306 SER A O   1 
ATOM   1762 C  CB  . SER A 1 265 ? 9.697  -18.162 -3.232  1.00 142.76 ? 306 SER A CB  1 
ATOM   1763 O  OG  . SER A 1 265 ? 8.789  -18.769 -2.329  1.00 140.70 ? 306 SER A OG  1 
ATOM   1764 N  N   . VAL A 1 266 ? 10.911 -15.582 -1.212  1.00 144.30 ? 307 VAL A N   1 
ATOM   1765 C  CA  . VAL A 1 266 ? 10.580 -14.727 -0.076  1.00 143.26 ? 307 VAL A CA  1 
ATOM   1766 C  C   . VAL A 1 266 ? 9.072  -14.780 0.103   1.00 142.05 ? 307 VAL A C   1 
ATOM   1767 O  O   . VAL A 1 266 ? 8.558  -14.804 1.222   1.00 142.14 ? 307 VAL A O   1 
ATOM   1768 C  CB  . VAL A 1 266 ? 10.998 -13.265 -0.334  1.00 144.51 ? 307 VAL A CB  1 
ATOM   1769 C  CG1 . VAL A 1 266 ? 10.814 -12.443 0.930   1.00 144.95 ? 307 VAL A CG1 1 
ATOM   1770 C  CG2 . VAL A 1 266 ? 12.440 -13.209 -0.808  1.00 144.31 ? 307 VAL A CG2 1 
ATOM   1771 N  N   . ASP A 1 267 ? 8.374  -14.801 -1.025  1.00 140.28 ? 308 ASP A N   1 
ATOM   1772 C  CA  . ASP A 1 267 ? 6.925  -14.868 -1.044  1.00 139.34 ? 308 ASP A CA  1 
ATOM   1773 C  C   . ASP A 1 267 ? 6.533  -15.485 -2.378  1.00 140.19 ? 308 ASP A C   1 
ATOM   1774 O  O   . ASP A 1 267 ? 5.968  -16.577 -2.428  1.00 141.26 ? 308 ASP A O   1 
ATOM   1775 C  CB  . ASP A 1 267 ? 6.328  -13.470 -0.913  1.00 137.76 ? 308 ASP A CB  1 
ATOM   1776 C  CG  . ASP A 1 267 ? 4.823  -13.493 -0.772  1.00 137.40 ? 308 ASP A CG  1 
ATOM   1777 O  OD1 . ASP A 1 267 ? 4.143  -13.944 -1.713  1.00 138.59 ? 308 ASP A OD1 1 
ATOM   1778 O  OD2 . ASP A 1 267 ? 4.317  -13.061 0.283   1.00 136.37 ? 308 ASP A OD2 1 
ATOM   1779 N  N   . ASN A 1 268 ? 6.851  -14.782 -3.459  1.00 140.33 ? 309 ASN A N   1 
ATOM   1780 C  CA  . ASN A 1 268 ? 6.552  -15.261 -4.803  1.00 140.82 ? 309 ASN A CA  1 
ATOM   1781 C  C   . ASN A 1 268 ? 7.660  -14.884 -5.774  1.00 139.85 ? 309 ASN A C   1 
ATOM   1782 O  O   . ASN A 1 268 ? 7.547  -15.120 -6.978  1.00 139.27 ? 309 ASN A O   1 
ATOM   1783 C  CB  . ASN A 1 268 ? 5.224  -14.686 -5.304  1.00 143.29 ? 309 ASN A CB  1 
ATOM   1784 C  CG  . ASN A 1 268 ? 4.023  -15.362 -4.674  1.00 144.83 ? 309 ASN A CG  1 
ATOM   1785 O  OD1 . ASN A 1 268 ? 3.896  -16.587 -4.713  1.00 145.04 ? 309 ASN A OD1 1 
ATOM   1786 N  ND2 . ASN A 1 268 ? 3.129  -14.565 -4.098  1.00 145.80 ? 309 ASN A ND2 1 
ATOM   1787 N  N   . LYS A 1 269 ? 8.730  -14.297 -5.244  1.00 138.49 ? 310 LYS A N   1 
ATOM   1788 C  CA  . LYS A 1 269 ? 9.863  -13.891 -6.066  1.00 137.30 ? 310 LYS A CA  1 
ATOM   1789 C  C   . LYS A 1 269 ? 11.196 -14.251 -5.412  1.00 135.18 ? 310 LYS A C   1 
ATOM   1790 O  O   . LYS A 1 269 ? 11.338 -14.189 -4.190  1.00 135.40 ? 310 LYS A O   1 
ATOM   1791 C  CB  . LYS A 1 269 ? 9.793  -12.387 -6.346  1.00 138.53 ? 310 LYS A CB  1 
ATOM   1792 C  CG  . LYS A 1 269 ? 9.566  -12.043 -7.821  1.00 140.12 ? 310 LYS A CG  1 
ATOM   1793 C  CD  . LYS A 1 269 ? 8.333  -12.737 -8.412  1.00 140.47 ? 310 LYS A CD  1 
ATOM   1794 C  CE  . LYS A 1 269 ? 7.033  -12.253 -7.774  1.00 141.42 ? 310 LYS A CE  1 
ATOM   1795 N  NZ  . LYS A 1 269 ? 5.833  -12.898 -8.385  1.00 141.02 ? 310 LYS A NZ  1 
ATOM   1796 N  N   . PRO A 1 270 ? 12.193 -14.627 -6.231  1.00 133.21 ? 311 PRO A N   1 
ATOM   1797 C  CA  . PRO A 1 270 ? 13.538 -15.016 -5.797  1.00 132.36 ? 311 PRO A CA  1 
ATOM   1798 C  C   . PRO A 1 270 ? 14.077 -14.258 -4.590  1.00 131.96 ? 311 PRO A C   1 
ATOM   1799 O  O   . PRO A 1 270 ? 13.803 -13.071 -4.411  1.00 132.82 ? 311 PRO A O   1 
ATOM   1800 C  CB  . PRO A 1 270 ? 14.374 -14.783 -7.048  1.00 132.64 ? 311 PRO A CB  1 
ATOM   1801 C  CG  . PRO A 1 270 ? 13.433 -15.196 -8.128  1.00 133.35 ? 311 PRO A CG  1 
ATOM   1802 C  CD  . PRO A 1 270 ? 12.135 -14.531 -7.702  1.00 132.99 ? 311 PRO A CD  1 
ATOM   1803 N  N   . ALA A 1 271 ? 14.845 -14.961 -3.764  1.00 130.63 ? 312 ALA A N   1 
ATOM   1804 C  CA  . ALA A 1 271 ? 15.442 -14.376 -2.570  1.00 129.78 ? 312 ALA A CA  1 
ATOM   1805 C  C   . ALA A 1 271 ? 16.955 -14.259 -2.743  1.00 129.03 ? 312 ALA A C   1 
ATOM   1806 O  O   . ALA A 1 271 ? 17.724 -14.897 -2.021  1.00 128.82 ? 312 ALA A O   1 
ATOM   1807 C  CB  . ALA A 1 271 ? 15.121 -15.231 -1.352  1.00 128.91 ? 312 ALA A CB  1 
ATOM   1808 N  N   . ILE A 1 272 ? 17.368 -13.440 -3.708  1.00 127.33 ? 313 ILE A N   1 
ATOM   1809 C  CA  . ILE A 1 272 ? 18.781 -13.221 -4.000  1.00 124.21 ? 313 ILE A CA  1 
ATOM   1810 C  C   . ILE A 1 272 ? 19.604 -12.981 -2.735  1.00 122.20 ? 313 ILE A C   1 
ATOM   1811 O  O   . ILE A 1 272 ? 20.245 -13.898 -2.222  1.00 122.43 ? 313 ILE A O   1 
ATOM   1812 C  CB  . ILE A 1 272 ? 18.972 -12.012 -4.945  1.00 125.31 ? 313 ILE A CB  1 
ATOM   1813 C  CG1 . ILE A 1 272 ? 18.190 -12.231 -6.244  1.00 126.17 ? 313 ILE A CG1 1 
ATOM   1814 C  CG2 . ILE A 1 272 ? 20.453 -11.814 -5.244  1.00 125.63 ? 313 ILE A CG2 1 
ATOM   1815 C  CD1 . ILE A 1 272 ? 18.253 -11.054 -7.211  1.00 125.69 ? 313 ILE A CD1 1 
ATOM   1816 N  N   . SER A 1 273 ? 19.579 -11.747 -2.234  1.00 118.74 ? 314 SER A N   1 
ATOM   1817 C  CA  . SER A 1 273 ? 20.339 -11.391 -1.039  1.00 113.83 ? 314 SER A CA  1 
ATOM   1818 C  C   . SER A 1 273 ? 19.477 -11.261 0.211   1.00 110.19 ? 314 SER A C   1 
ATOM   1819 O  O   . SER A 1 273 ? 18.267 -11.062 0.127   1.00 109.52 ? 314 SER A O   1 
ATOM   1820 C  CB  . SER A 1 273 ? 21.102 -10.082 -1.276  1.00 115.01 ? 314 SER A CB  1 
ATOM   1821 O  OG  . SER A 1 273 ? 20.232 -9.025  -1.646  1.00 113.85 ? 314 SER A OG  1 
ATOM   1822 N  N   . ALA A 1 274 ? 20.111 -11.382 1.372   1.00 106.33 ? 315 ALA A N   1 
ATOM   1823 C  CA  . ALA A 1 274 ? 19.405 -11.264 2.639   1.00 104.39 ? 315 ALA A CA  1 
ATOM   1824 C  C   . ALA A 1 274 ? 18.860 -9.843  2.788   1.00 104.28 ? 315 ALA A C   1 
ATOM   1825 O  O   . ALA A 1 274 ? 17.692 -9.650  3.132   1.00 103.82 ? 315 ALA A O   1 
ATOM   1826 C  CB  . ALA A 1 274 ? 20.338 -11.588 3.786   1.00 102.03 ? 315 ALA A CB  1 
ATOM   1827 N  N   . LEU A 1 275 ? 19.716 -8.854  2.529   1.00 102.32 ? 316 LEU A N   1 
ATOM   1828 C  CA  . LEU A 1 275 ? 19.335 -7.445  2.615   1.00 97.68  ? 316 LEU A CA  1 
ATOM   1829 C  C   . LEU A 1 275 ? 18.149 -7.131  1.707   1.00 97.11  ? 316 LEU A C   1 
ATOM   1830 O  O   . LEU A 1 275 ? 17.141 -6.584  2.154   1.00 96.52  ? 316 LEU A O   1 
ATOM   1831 C  CB  . LEU A 1 275 ? 20.508 -6.550  2.214   1.00 95.39  ? 316 LEU A CB  1 
ATOM   1832 C  CG  . LEU A 1 275 ? 21.669 -6.416  3.192   1.00 94.67  ? 316 LEU A CG  1 
ATOM   1833 C  CD1 . LEU A 1 275 ? 22.864 -5.776  2.500   1.00 90.67  ? 316 LEU A CD1 1 
ATOM   1834 C  CD2 . LEU A 1 275 ? 21.218 -5.593  4.384   1.00 96.05  ? 316 LEU A CD2 1 
ATOM   1835 N  N   . GLU A 1 276 ? 18.274 -7.477  0.430   1.00 94.76  ? 317 GLU A N   1 
ATOM   1836 C  CA  . GLU A 1 276 ? 17.216 -7.212  -0.532  1.00 95.26  ? 317 GLU A CA  1 
ATOM   1837 C  C   . GLU A 1 276 ? 15.982 -8.097  -0.322  1.00 93.77  ? 317 GLU A C   1 
ATOM   1838 O  O   . GLU A 1 276 ? 15.045 -8.064  -1.121  1.00 94.17  ? 317 GLU A O   1 
ATOM   1839 C  CB  . GLU A 1 276 ? 17.763 -7.367  -1.956  1.00 99.27  ? 317 GLU A CB  1 
ATOM   1840 C  CG  . GLU A 1 276 ? 16.822 -6.884  -3.049  1.00 105.22 ? 317 GLU A CG  1 
ATOM   1841 C  CD  . GLU A 1 276 ? 17.525 -6.687  -4.384  1.00 109.24 ? 317 GLU A CD  1 
ATOM   1842 O  OE1 . GLU A 1 276 ? 18.230 -7.620  -4.834  1.00 110.77 ? 317 GLU A OE1 1 
ATOM   1843 O  OE2 . GLU A 1 276 ? 17.366 -5.599  -4.985  1.00 107.97 ? 317 GLU A OE2 1 
ATOM   1844 N  N   . THR A 1 277 ? 15.983 -8.882  0.756   1.00 90.49  ? 318 THR A N   1 
ATOM   1845 C  CA  . THR A 1 277 ? 14.850 -9.748  1.090   1.00 86.91  ? 318 THR A CA  1 
ATOM   1846 C  C   . THR A 1 277 ? 14.187 -9.234  2.370   1.00 82.68  ? 318 THR A C   1 
ATOM   1847 O  O   . THR A 1 277 ? 12.980 -9.352  2.544   1.00 79.37  ? 318 THR A O   1 
ATOM   1848 C  CB  . THR A 1 277 ? 15.285 -11.233 1.282   1.00 89.18  ? 318 THR A CB  1 
ATOM   1849 O  OG1 . THR A 1 277 ? 15.561 -11.827 0.002   1.00 86.66  ? 318 THR A OG1 1 
ATOM   1850 C  CG2 . THR A 1 277 ? 14.184 -12.031 1.979   1.00 85.36  ? 318 THR A CG2 1 
HETATM 1851 N  N   . MSE A 1 278 ? 14.979 -8.657  3.267   1.00 81.08  ? 319 MSE A N   1 
HETATM 1852 C  CA  . MSE A 1 278 ? 14.420 -8.105  4.494   1.00 82.28  ? 319 MSE A CA  1 
HETATM 1853 C  C   . MSE A 1 278 ? 13.626 -6.836  4.182   1.00 77.84  ? 319 MSE A C   1 
HETATM 1854 O  O   . MSE A 1 278 ? 12.763 -6.438  4.958   1.00 73.90  ? 319 MSE A O   1 
HETATM 1855 C  CB  . MSE A 1 278 ? 15.525 -7.799  5.508   1.00 88.46  ? 319 MSE A CB  1 
HETATM 1856 C  CG  . MSE A 1 278 ? 16.193 -9.042  6.061   1.00 98.90  ? 319 MSE A CG  1 
HETATM 1857 SE SE  . MSE A 1 278 ? 14.879 -10.369 6.598   1.00 115.87 ? 319 MSE A SE  1 
HETATM 1858 C  CE  . MSE A 1 278 ? 14.352 -9.608  8.301   1.00 112.97 ? 319 MSE A CE  1 
ATOM   1859 N  N   . ASP A 1 279 ? 13.926 -6.203  3.048   1.00 73.71  ? 320 ASP A N   1 
ATOM   1860 C  CA  . ASP A 1 279 ? 13.205 -5.002  2.635   1.00 74.64  ? 320 ASP A CA  1 
ATOM   1861 C  C   . ASP A 1 279 ? 11.796 -5.360  2.161   1.00 75.55  ? 320 ASP A C   1 
ATOM   1862 O  O   . ASP A 1 279 ? 10.845 -4.627  2.441   1.00 75.61  ? 320 ASP A O   1 
ATOM   1863 C  CB  . ASP A 1 279 ? 13.948 -4.254  1.517   1.00 68.66  ? 320 ASP A CB  1 
ATOM   1864 C  CG  . ASP A 1 279 ? 15.018 -3.304  2.051   1.00 70.96  ? 320 ASP A CG  1 
ATOM   1865 O  OD1 . ASP A 1 279 ? 14.968 -2.935  3.251   1.00 68.37  ? 320 ASP A OD1 1 
ATOM   1866 O  OD2 . ASP A 1 279 ? 15.902 -2.906  1.260   1.00 69.09  ? 320 ASP A OD2 1 
ATOM   1867 N  N   . GLN A 1 280 ? 11.658 -6.481  1.448   1.00 75.59  ? 321 GLN A N   1 
ATOM   1868 C  CA  . GLN A 1 280 ? 10.346 -6.927  0.963   1.00 77.02  ? 321 GLN A CA  1 
ATOM   1869 C  C   . GLN A 1 280 ? 9.480  -7.236  2.175   1.00 70.59  ? 321 GLN A C   1 
ATOM   1870 O  O   . GLN A 1 280 ? 8.305  -6.884  2.227   1.00 69.35  ? 321 GLN A O   1 
ATOM   1871 C  CB  . GLN A 1 280 ? 10.470 -8.195  0.115   1.00 82.69  ? 321 GLN A CB  1 
ATOM   1872 C  CG  . GLN A 1 280 ? 11.327 -8.073  -1.127  1.00 92.05  ? 321 GLN A CG  1 
ATOM   1873 C  CD  . GLN A 1 280 ? 11.844 -9.431  -1.592  1.00 97.34  ? 321 GLN A CD  1 
ATOM   1874 O  OE1 . GLN A 1 280 ? 12.552 -10.123 -0.852  1.00 96.92  ? 321 GLN A OE1 1 
ATOM   1875 N  NE2 . GLN A 1 280 ? 11.491 -9.817  -2.815  1.00 99.33  ? 321 GLN A NE2 1 
ATOM   1876 N  N   . VAL A 1 281 ? 10.080 -7.908  3.147   1.00 67.89  ? 322 VAL A N   1 
ATOM   1877 C  CA  . VAL A 1 281 ? 9.388  -8.269  4.374   1.00 68.87  ? 322 VAL A CA  1 
ATOM   1878 C  C   . VAL A 1 281 ? 8.944  -7.034  5.164   1.00 64.23  ? 322 VAL A C   1 
ATOM   1879 O  O   . VAL A 1 281 ? 7.839  -7.003  5.722   1.00 59.55  ? 322 VAL A O   1 
ATOM   1880 C  CB  . VAL A 1 281 ? 10.298 -9.143  5.259   1.00 71.70  ? 322 VAL A CB  1 
ATOM   1881 C  CG1 . VAL A 1 281 ? 9.682  -9.319  6.643   1.00 73.36  ? 322 VAL A CG1 1 
ATOM   1882 C  CG2 . VAL A 1 281 ? 10.508 -10.497 4.587   1.00 73.68  ? 322 VAL A CG2 1 
ATOM   1883 N  N   . ALA A 1 282 ? 9.815  -6.024  5.206   1.00 62.18  ? 323 ALA A N   1 
ATOM   1884 C  CA  . ALA A 1 282 ? 9.544  -4.777  5.921   1.00 59.59  ? 323 ALA A CA  1 
ATOM   1885 C  C   . ALA A 1 282 ? 8.288  -4.093  5.408   1.00 58.27  ? 323 ALA A C   1 
ATOM   1886 O  O   . ALA A 1 282 ? 7.514  -3.537  6.182   1.00 57.54  ? 323 ALA A O   1 
ATOM   1887 C  CB  . ALA A 1 282 ? 10.726 -3.844  5.797   1.00 60.18  ? 323 ALA A CB  1 
ATOM   1888 N  N   . GLU A 1 283 ? 8.086  -4.160  4.099   1.00 61.84  ? 324 GLU A N   1 
ATOM   1889 C  CA  . GLU A 1 283 ? 6.932  -3.551  3.460   1.00 67.64  ? 324 GLU A CA  1 
ATOM   1890 C  C   . GLU A 1 283 ? 5.634  -4.351  3.647   1.00 72.28  ? 324 GLU A C   1 
ATOM   1891 O  O   . GLU A 1 283 ? 4.536  -3.831  3.422   1.00 69.96  ? 324 GLU A O   1 
ATOM   1892 C  CB  . GLU A 1 283 ? 7.217  -3.377  1.971   1.00 70.82  ? 324 GLU A CB  1 
ATOM   1893 C  CG  . GLU A 1 283 ? 6.462  -2.210  1.356   1.00 82.54  ? 324 GLU A CG  1 
ATOM   1894 C  CD  . GLU A 1 283 ? 6.849  -0.875  1.991   1.00 85.97  ? 324 GLU A CD  1 
ATOM   1895 O  OE1 . GLU A 1 283 ? 8.019  -0.454  1.820   1.00 84.42  ? 324 GLU A OE1 1 
ATOM   1896 O  OE2 . GLU A 1 283 ? 5.987  -0.255  2.662   1.00 84.96  ? 324 GLU A OE2 1 
ATOM   1897 N  N   . ILE A 1 284 ? 5.754  -5.614  4.053   1.00 75.04  ? 325 ILE A N   1 
ATOM   1898 C  CA  . ILE A 1 284 ? 4.579  -6.467  4.262   1.00 77.94  ? 325 ILE A CA  1 
ATOM   1899 C  C   . ILE A 1 284 ? 3.830  -6.082  5.545   1.00 78.34  ? 325 ILE A C   1 
ATOM   1900 O  O   . ILE A 1 284 ? 4.420  -6.035  6.626   1.00 75.89  ? 325 ILE A O   1 
ATOM   1901 C  CB  . ILE A 1 284 ? 4.990  -7.957  4.350   1.00 76.67  ? 325 ILE A CB  1 
ATOM   1902 C  CG1 . ILE A 1 284 ? 5.645  -8.393  3.045   1.00 74.05  ? 325 ILE A CG1 1 
ATOM   1903 C  CG2 . ILE A 1 284 ? 3.773  -8.822  4.644   1.00 77.45  ? 325 ILE A CG2 1 
ATOM   1904 C  CD1 . ILE A 1 284 ? 4.720  -8.313  1.859   1.00 79.66  ? 325 ILE A CD1 1 
ATOM   1905 N  N   . ARG A 1 285 ? 2.531  -5.818  5.430   1.00 81.73  ? 326 ARG A N   1 
ATOM   1906 C  CA  . ARG A 1 285 ? 1.747  -5.431  6.598   1.00 86.87  ? 326 ARG A CA  1 
ATOM   1907 C  C   . ARG A 1 285 ? 1.514  -6.554  7.590   1.00 88.17  ? 326 ARG A C   1 
ATOM   1908 O  O   . ARG A 1 285 ? 1.152  -7.664  7.213   1.00 87.91  ? 326 ARG A O   1 
ATOM   1909 C  CB  . ARG A 1 285 ? 0.403  -4.833  6.179   1.00 90.92  ? 326 ARG A CB  1 
ATOM   1910 C  CG  . ARG A 1 285 ? 0.410  -3.317  6.225   1.00 99.78  ? 326 ARG A CG  1 
ATOM   1911 C  CD  . ARG A 1 285 ? -0.982 -2.716  6.096   1.00 107.96 ? 326 ARG A CD  1 
ATOM   1912 N  NE  . ARG A 1 285 ? -0.982 -1.284  6.403   1.00 112.39 ? 326 ARG A NE  1 
ATOM   1913 C  CZ  . ARG A 1 285 ? -0.602 -0.770  7.571   1.00 113.88 ? 326 ARG A CZ  1 
ATOM   1914 N  NH1 . ARG A 1 285 ? -0.189 -1.568  8.547   1.00 114.99 ? 326 ARG A NH1 1 
ATOM   1915 N  NH2 . ARG A 1 285 ? -0.639 0.542   7.768   1.00 114.36 ? 326 ARG A NH2 1 
ATOM   1916 N  N   . PRO A 1 286 ? 1.723  -6.270  8.886   1.00 91.66  ? 327 PRO A N   1 
ATOM   1917 C  CA  . PRO A 1 286 ? 1.544  -7.241  9.972   1.00 93.10  ? 327 PRO A CA  1 
ATOM   1918 C  C   . PRO A 1 286 ? 0.204  -7.978  9.895   1.00 94.02  ? 327 PRO A C   1 
ATOM   1919 O  O   . PRO A 1 286 ? -0.833 -7.383  9.588   1.00 89.79  ? 327 PRO A O   1 
ATOM   1920 C  CB  . PRO A 1 286 ? 1.663  -6.377  11.226  1.00 92.51  ? 327 PRO A CB  1 
ATOM   1921 C  CG  . PRO A 1 286 ? 2.629  -5.319  10.801  1.00 91.29  ? 327 PRO A CG  1 
ATOM   1922 C  CD  . PRO A 1 286 ? 2.122  -4.957  9.427   1.00 90.31  ? 327 PRO A CD  1 
ATOM   1923 N  N   . GLY A 1 287 ? 0.240  -9.275  10.181  1.00 95.87  ? 328 GLY A N   1 
ATOM   1924 C  CA  . GLY A 1 287 ? -0.963 -10.085 10.131  1.00 98.91  ? 328 GLY A CA  1 
ATOM   1925 C  C   . GLY A 1 287 ? -1.018 -10.878 8.839   1.00 100.08 ? 328 GLY A C   1 
ATOM   1926 O  O   . GLY A 1 287 ? -1.786 -11.835 8.707   1.00 101.58 ? 328 GLY A O   1 
ATOM   1927 N  N   . SER A 1 288 ? -0.197 -10.471 7.877   1.00 100.57 ? 329 SER A N   1 
ATOM   1928 C  CA  . SER A 1 288 ? -0.144 -11.141 6.587   1.00 100.50 ? 329 SER A CA  1 
ATOM   1929 C  C   . SER A 1 288 ? 0.542  -12.501 6.716   1.00 101.67 ? 329 SER A C   1 
ATOM   1930 O  O   . SER A 1 288 ? 1.501  -12.662 7.478   1.00 101.92 ? 329 SER A O   1 
ATOM   1931 C  CB  . SER A 1 288 ? 0.610  -10.275 5.566   1.00 98.52  ? 329 SER A CB  1 
ATOM   1932 O  OG  . SER A 1 288 ? -0.090 -9.078  5.269   1.00 94.37  ? 329 SER A OG  1 
ATOM   1933 N  N   . VAL A 1 289 ? 0.031  -13.478 5.977   1.00 100.49 ? 330 VAL A N   1 
ATOM   1934 C  CA  . VAL A 1 289 ? 0.594  -14.820 5.979   1.00 97.94  ? 330 VAL A CA  1 
ATOM   1935 C  C   . VAL A 1 289 ? 1.207  -15.042 4.606   1.00 95.63  ? 330 VAL A C   1 
ATOM   1936 O  O   . VAL A 1 289 ? 0.525  -14.909 3.590   1.00 94.35  ? 330 VAL A O   1 
ATOM   1937 C  CB  . VAL A 1 289 ? -0.499 -15.891 6.227   1.00 99.85  ? 330 VAL A CB  1 
ATOM   1938 C  CG1 . VAL A 1 289 ? 0.082  -17.280 6.037   1.00 99.99  ? 330 VAL A CG1 1 
ATOM   1939 C  CG2 . VAL A 1 289 ? -1.064 -15.748 7.636   1.00 98.15  ? 330 VAL A CG2 1 
ATOM   1940 N  N   . ILE A 1 290 ? 2.493  -15.366 4.568   1.00 95.48  ? 331 ILE A N   1 
ATOM   1941 C  CA  . ILE A 1 290 ? 3.154  -15.594 3.287   1.00 96.71  ? 331 ILE A CA  1 
ATOM   1942 C  C   . ILE A 1 290 ? 3.852  -16.952 3.197   1.00 97.09  ? 331 ILE A C   1 
ATOM   1943 O  O   . ILE A 1 290 ? 4.190  -17.564 4.214   1.00 95.37  ? 331 ILE A O   1 
ATOM   1944 C  CB  . ILE A 1 290 ? 4.191  -14.477 2.972   1.00 95.68  ? 331 ILE A CB  1 
ATOM   1945 C  CG1 . ILE A 1 290 ? 5.367  -14.547 3.949   1.00 94.46  ? 331 ILE A CG1 1 
ATOM   1946 C  CG2 . ILE A 1 290 ? 3.524  -13.114 3.074   1.00 97.43  ? 331 ILE A CG2 1 
ATOM   1947 C  CD1 . ILE A 1 290 ? 6.598  -13.788 3.482   1.00 90.67  ? 331 ILE A CD1 1 
ATOM   1948 N  N   . PRO A 1 291 ? 4.065  -17.440 1.964   1.00 97.78  ? 332 PRO A N   1 
ATOM   1949 C  CA  . PRO A 1 291 ? 4.718  -18.723 1.686   1.00 99.13  ? 332 PRO A CA  1 
ATOM   1950 C  C   . PRO A 1 291 ? 6.245  -18.666 1.573   1.00 100.72 ? 332 PRO A C   1 
ATOM   1951 O  O   . PRO A 1 291 ? 6.788  -18.199 0.569   1.00 98.54  ? 332 PRO A O   1 
ATOM   1952 C  CB  . PRO A 1 291 ? 4.068  -19.148 0.377   1.00 98.50  ? 332 PRO A CB  1 
ATOM   1953 C  CG  . PRO A 1 291 ? 3.938  -17.846 -0.336  1.00 98.49  ? 332 PRO A CG  1 
ATOM   1954 C  CD  . PRO A 1 291 ? 3.407  -16.923 0.748   1.00 96.79  ? 332 PRO A CD  1 
ATOM   1955 N  N   . VAL A 1 292 ? 6.926  -19.153 2.605   1.00 103.60 ? 333 VAL A N   1 
ATOM   1956 C  CA  . VAL A 1 292 ? 8.387  -19.192 2.624   1.00 106.52 ? 333 VAL A CA  1 
ATOM   1957 C  C   . VAL A 1 292 ? 8.815  -20.569 2.119   1.00 108.68 ? 333 VAL A C   1 
ATOM   1958 O  O   . VAL A 1 292 ? 8.527  -21.575 2.766   1.00 109.20 ? 333 VAL A O   1 
ATOM   1959 C  CB  . VAL A 1 292 ? 8.926  -19.023 4.051   1.00 106.31 ? 333 VAL A CB  1 
ATOM   1960 C  CG1 . VAL A 1 292 ? 10.435 -18.869 4.019   1.00 105.13 ? 333 VAL A CG1 1 
ATOM   1961 C  CG2 . VAL A 1 292 ? 8.258  -17.834 4.719   1.00 107.85 ? 333 VAL A CG2 1 
ATOM   1962 N  N   . VAL A 1 293 ? 9.503  -20.619 0.981   1.00 111.37 ? 334 VAL A N   1 
ATOM   1963 C  CA  . VAL A 1 293 ? 9.936  -21.896 0.408   1.00 113.73 ? 334 VAL A CA  1 
ATOM   1964 C  C   . VAL A 1 293 ? 10.622 -22.851 1.390   1.00 116.74 ? 334 VAL A C   1 
ATOM   1965 O  O   . VAL A 1 293 ? 9.957  -23.683 2.013   1.00 119.16 ? 334 VAL A O   1 
ATOM   1966 C  CB  . VAL A 1 293 ? 10.862 -21.687 -0.826  1.00 113.14 ? 334 VAL A CB  1 
ATOM   1967 C  CG1 . VAL A 1 293 ? 11.531 -23.000 -1.215  1.00 112.85 ? 334 VAL A CG1 1 
ATOM   1968 C  CG2 . VAL A 1 293 ? 10.045 -21.196 -2.008  1.00 111.66 ? 334 VAL A CG2 1 
ATOM   1969 N  N   . VAL A 1 294 ? 11.942 -22.746 1.533   1.00 117.01 ? 335 VAL A N   1 
ATOM   1970 C  CA  . VAL A 1 294 ? 12.662 -23.646 2.430   1.00 116.71 ? 335 VAL A CA  1 
ATOM   1971 C  C   . VAL A 1 294 ? 13.250 -22.939 3.643   1.00 116.71 ? 335 VAL A C   1 
ATOM   1972 O  O   . VAL A 1 294 ? 13.035 -23.362 4.780   1.00 116.41 ? 335 VAL A O   1 
ATOM   1973 C  CB  . VAL A 1 294 ? 13.760 -24.372 1.662   1.00 115.69 ? 335 VAL A CB  1 
ATOM   1974 N  N   . GLN A 1 300 ? 11.524 -28.708 -0.255  1.00 120.87 ? 341 GLN A N   1 
ATOM   1975 C  CA  . GLN A 1 300 ? 10.694 -27.601 -0.710  1.00 121.87 ? 341 GLN A CA  1 
ATOM   1976 C  C   . GLN A 1 300 ? 9.304  -27.667 -0.078  1.00 122.72 ? 341 GLN A C   1 
ATOM   1977 O  O   . GLN A 1 300 ? 8.288  -27.608 -0.777  1.00 122.64 ? 341 GLN A O   1 
ATOM   1978 C  CB  . GLN A 1 300 ? 10.585 -27.619 -2.237  1.00 119.68 ? 341 GLN A CB  1 
ATOM   1979 N  N   . LEU A 1 301 ? 9.271  -27.782 1.248   1.00 123.35 ? 342 LEU A N   1 
ATOM   1980 C  CA  . LEU A 1 301 ? 8.016  -27.854 1.997   1.00 123.65 ? 342 LEU A CA  1 
ATOM   1981 C  C   . LEU A 1 301 ? 7.449  -26.459 2.278   1.00 122.97 ? 342 LEU A C   1 
ATOM   1982 O  O   . LEU A 1 301 ? 7.883  -25.782 3.209   1.00 123.92 ? 342 LEU A O   1 
ATOM   1983 C  CB  . LEU A 1 301 ? 8.240  -28.602 3.312   1.00 123.22 ? 342 LEU A CB  1 
ATOM   1984 N  N   . THR A 1 302 ? 6.475  -26.040 1.473   1.00 121.30 ? 343 THR A N   1 
ATOM   1985 C  CA  . THR A 1 302 ? 5.852  -24.728 1.622   1.00 117.57 ? 343 THR A CA  1 
ATOM   1986 C  C   . THR A 1 302 ? 5.326  -24.494 3.035   1.00 116.65 ? 343 THR A C   1 
ATOM   1987 O  O   . THR A 1 302 ? 4.216  -24.907 3.362   1.00 117.86 ? 343 THR A O   1 
ATOM   1988 C  CB  . THR A 1 302 ? 4.718  -24.578 0.612   1.00 115.23 ? 343 THR A CB  1 
ATOM   1989 N  N   . LEU A 1 303 ? 6.127  -23.829 3.867   1.00 115.46 ? 344 LEU A N   1 
ATOM   1990 C  CA  . LEU A 1 303 ? 5.747  -23.525 5.249   1.00 114.68 ? 344 LEU A CA  1 
ATOM   1991 C  C   . LEU A 1 303 ? 5.304  -22.063 5.358   1.00 114.64 ? 344 LEU A C   1 
ATOM   1992 O  O   . LEU A 1 303 ? 6.116  -21.151 5.183   1.00 115.27 ? 344 LEU A O   1 
ATOM   1993 C  CB  . LEU A 1 303 ? 6.925  -23.785 6.180   1.00 112.33 ? 344 LEU A CB  1 
ATOM   1994 N  N   . GLN A 1 304 ? 4.023  -21.842 5.653   1.00 113.07 ? 345 GLN A N   1 
ATOM   1995 C  CA  . GLN A 1 304 ? 3.482  -20.486 5.756   1.00 110.92 ? 345 GLN A CA  1 
ATOM   1996 C  C   . GLN A 1 304 ? 3.738  -19.821 7.110   1.00 108.88 ? 345 GLN A C   1 
ATOM   1997 O  O   . GLN A 1 304 ? 3.706  -20.477 8.153   1.00 108.10 ? 345 GLN A O   1 
ATOM   1998 C  CB  . GLN A 1 304 ? 1.975  -20.487 5.470   1.00 111.00 ? 345 GLN A CB  1 
ATOM   1999 C  CG  . GLN A 1 304 ? 1.107  -20.818 6.672   1.00 110.06 ? 345 GLN A CG  1 
ATOM   2000 C  CD  . GLN A 1 304 ? -0.364 -20.542 6.425   1.00 111.39 ? 345 GLN A CD  1 
ATOM   2001 O  OE1 . GLN A 1 304 ? -1.183 -20.599 7.346   1.00 111.23 ? 345 GLN A OE1 1 
ATOM   2002 N  NE2 . GLN A 1 304 ? -0.709 -20.240 5.175   1.00 112.35 ? 345 GLN A NE2 1 
ATOM   2003 N  N   . VAL A 1 305 ? 3.981  -18.510 7.078   1.00 107.32 ? 346 VAL A N   1 
ATOM   2004 C  CA  . VAL A 1 305 ? 4.256  -17.736 8.290   1.00 104.29 ? 346 VAL A CA  1 
ATOM   2005 C  C   . VAL A 1 305 ? 3.520  -16.400 8.318   1.00 100.54 ? 346 VAL A C   1 
ATOM   2006 O  O   . VAL A 1 305 ? 3.278  -15.792 7.276   1.00 100.11 ? 346 VAL A O   1 
ATOM   2007 C  CB  . VAL A 1 305 ? 5.754  -17.422 8.426   1.00 105.25 ? 346 VAL A CB  1 
ATOM   2008 C  CG1 . VAL A 1 305 ? 6.034  -16.867 9.812   1.00 106.55 ? 346 VAL A CG1 1 
ATOM   2009 C  CG2 . VAL A 1 305 ? 6.583  -18.666 8.151   1.00 105.61 ? 346 VAL A CG2 1 
ATOM   2010 N  N   . THR A 1 306 ? 3.170  -15.947 9.518   1.00 97.19  ? 347 THR A N   1 
ATOM   2011 C  CA  . THR A 1 306 ? 2.480  -14.672 9.680   1.00 95.93  ? 347 THR A CA  1 
ATOM   2012 C  C   . THR A 1 306 ? 3.512  -13.626 10.090  1.00 94.44  ? 347 THR A C   1 
ATOM   2013 O  O   . THR A 1 306 ? 4.231  -13.809 11.075  1.00 93.83  ? 347 THR A O   1 
ATOM   2014 C  CB  . THR A 1 306 ? 1.399  -14.737 10.779  1.00 96.31  ? 347 THR A CB  1 
ATOM   2015 O  OG1 . THR A 1 306 ? 2.028  -14.846 12.062  1.00 97.81  ? 347 THR A OG1 1 
ATOM   2016 C  CG2 . THR A 1 306 ? 0.489  -15.932 10.566  1.00 95.74  ? 347 THR A CG2 1 
ATOM   2017 N  N   . ILE A 1 307 ? 3.587  -12.537 9.330   1.00 92.38  ? 348 ILE A N   1 
ATOM   2018 C  CA  . ILE A 1 307 ? 4.535  -11.463 9.615   1.00 90.26  ? 348 ILE A CA  1 
ATOM   2019 C  C   . ILE A 1 307 ? 4.116  -10.674 10.859  1.00 90.83  ? 348 ILE A C   1 
ATOM   2020 O  O   . ILE A 1 307 ? 2.930  -10.433 11.080  1.00 90.58  ? 348 ILE A O   1 
ATOM   2021 C  CB  . ILE A 1 307 ? 4.658  -10.504 8.396   1.00 89.76  ? 348 ILE A CB  1 
ATOM   2022 C  CG1 . ILE A 1 307 ? 5.539  -11.137 7.314   1.00 88.05  ? 348 ILE A CG1 1 
ATOM   2023 C  CG2 . ILE A 1 307 ? 5.246  -9.169  8.827   1.00 88.69  ? 348 ILE A CG2 1 
ATOM   2024 C  CD1 . ILE A 1 307 ? 4.989  -12.402 6.721   1.00 86.76  ? 348 ILE A CD1 1 
ATOM   2025 N  N   . GLN A 1 308 ? 5.089  -10.292 11.681  1.00 92.29  ? 349 GLN A N   1 
ATOM   2026 C  CA  . GLN A 1 308 ? 4.808  -9.528  12.894  1.00 97.65  ? 349 GLN A CA  1 
ATOM   2027 C  C   . GLN A 1 308 ? 5.190  -8.068  12.697  1.00 98.88  ? 349 GLN A C   1 
ATOM   2028 O  O   . GLN A 1 308 ? 5.637  -7.673  11.622  1.00 98.98  ? 349 GLN A O   1 
ATOM   2029 C  CB  . GLN A 1 308 ? 5.590  -10.085 14.090  1.00 100.05 ? 349 GLN A CB  1 
ATOM   2030 C  CG  . GLN A 1 308 ? 5.081  -11.410 14.634  1.00 105.75 ? 349 GLN A CG  1 
ATOM   2031 C  CD  . GLN A 1 308 ? 5.767  -11.810 15.936  1.00 109.12 ? 349 GLN A CD  1 
ATOM   2032 O  OE1 . GLN A 1 308 ? 6.992  -11.961 15.992  1.00 108.89 ? 349 GLN A OE1 1 
ATOM   2033 N  NE2 . GLN A 1 308 ? 4.975  -11.983 16.992  1.00 108.89 ? 349 GLN A NE2 1 
ATOM   2034 N  N   . GLU A 1 309 ? 5.018  -7.270  13.743  1.00 99.60  ? 350 GLU A N   1 
ATOM   2035 C  CA  . GLU A 1 309 ? 5.364  -5.864  13.670  1.00 99.96  ? 350 GLU A CA  1 
ATOM   2036 C  C   . GLU A 1 309 ? 6.672  -5.629  14.396  1.00 99.11  ? 350 GLU A C   1 
ATOM   2037 O  O   . GLU A 1 309 ? 6.706  -5.652  15.625  1.00 97.47  ? 350 GLU A O   1 
ATOM   2038 C  CB  . GLU A 1 309 ? 4.274  -5.005  14.305  1.00 103.77 ? 350 GLU A CB  1 
ATOM   2039 C  CG  . GLU A 1 309 ? 4.494  -3.516  14.094  1.00 107.63 ? 350 GLU A CG  1 
ATOM   2040 C  CD  . GLU A 1 309 ? 3.366  -2.673  14.641  1.00 109.64 ? 350 GLU A CD  1 
ATOM   2041 O  OE1 . GLU A 1 309 ? 2.192  -3.001  14.355  1.00 112.71 ? 350 GLU A OE1 1 
ATOM   2042 O  OE2 . GLU A 1 309 ? 3.655  -1.679  15.343  1.00 109.81 ? 350 GLU A OE2 1 
ATOM   2043 N  N   . TYR A 1 310 ? 7.735  -5.408  13.621  1.00 98.73  ? 351 TYR A N   1 
ATOM   2044 C  CA  . TYR A 1 310 ? 9.084  -5.157  14.135  1.00 99.60  ? 351 TYR A CA  1 
ATOM   2045 C  C   . TYR A 1 310 ? 9.045  -4.792  15.626  1.00 102.44 ? 351 TYR A C   1 
ATOM   2046 O  O   . TYR A 1 310 ? 8.302  -3.899  16.034  1.00 101.94 ? 351 TYR A O   1 
ATOM   2047 C  CB  . TYR A 1 310 ? 9.727  -4.023  13.329  1.00 97.70  ? 351 TYR A CB  1 
ATOM   2048 C  CG  . TYR A 1 310 ? 11.236 -4.012  13.341  1.00 94.09  ? 351 TYR A CG  1 
ATOM   2049 C  CD1 . TYR A 1 310 ? 11.965 -4.875  12.532  1.00 93.60  ? 351 TYR A CD1 1 
ATOM   2050 C  CD2 . TYR A 1 310 ? 11.937 -3.142  14.177  1.00 95.02  ? 351 TYR A CD2 1 
ATOM   2051 C  CE1 . TYR A 1 310 ? 13.364 -4.874  12.555  1.00 95.42  ? 351 TYR A CE1 1 
ATOM   2052 C  CE2 . TYR A 1 310 ? 13.330 -3.132  14.211  1.00 93.83  ? 351 TYR A CE2 1 
ATOM   2053 C  CZ  . TYR A 1 310 ? 14.037 -3.999  13.400  1.00 94.97  ? 351 TYR A CZ  1 
ATOM   2054 O  OH  . TYR A 1 310 ? 15.414 -3.997  13.446  1.00 92.89  ? 351 TYR A OH  1 
ATOM   2055 N  N   . PRO A 1 311 ? 9.856  -5.477  16.456  1.00 105.64 ? 352 PRO A N   1 
ATOM   2056 C  CA  . PRO A 1 311 ? 9.900  -5.224  17.904  1.00 106.85 ? 352 PRO A CA  1 
ATOM   2057 C  C   . PRO A 1 311 ? 10.044 -3.751  18.288  1.00 108.50 ? 352 PRO A C   1 
ATOM   2058 O  O   . PRO A 1 311 ? 10.599 -2.954  17.534  1.00 110.93 ? 352 PRO A O   1 
ATOM   2059 C  CB  . PRO A 1 311 ? 11.089 -6.070  18.364  1.00 107.76 ? 352 PRO A CB  1 
ATOM   2060 C  CG  . PRO A 1 311 ? 11.985 -6.085  17.152  1.00 106.57 ? 352 PRO A CG  1 
ATOM   2061 C  CD  . PRO A 1 311 ? 10.991 -6.325  16.044  1.00 105.50 ? 352 PRO A CD  1 
ATOM   2062 N  N   . ALA A 1 312 ? 9.544  -3.398  19.467  1.00 108.48 ? 353 ALA A N   1 
ATOM   2063 C  CA  . ALA A 1 312 ? 9.611  -2.022  19.951  1.00 108.08 ? 353 ALA A CA  1 
ATOM   2064 C  C   . ALA A 1 312 ? 11.019 -1.434  19.836  1.00 108.24 ? 353 ALA A C   1 
ATOM   2065 O  O   . ALA A 1 312 ? 11.956 -2.186  19.491  1.00 106.82 ? 353 ALA A O   1 
ATOM   2066 C  CB  . ALA A 1 312 ? 9.133  -1.961  21.404  1.00 107.10 ? 353 ALA A CB  1 
HETATM 2067 N  N   . MSE B 1 1   ? 39.061 16.118  -22.295 1.00 98.05  ? 42  MSE B N   1 
HETATM 2068 C  CA  . MSE B 1 1   ? 39.253 15.469  -20.968 1.00 93.35  ? 42  MSE B CA  1 
HETATM 2069 C  C   . MSE B 1 1   ? 40.564 15.883  -20.293 1.00 84.91  ? 42  MSE B C   1 
HETATM 2070 O  O   . MSE B 1 1   ? 41.617 15.276  -20.513 1.00 83.70  ? 42  MSE B O   1 
HETATM 2071 C  CB  . MSE B 1 1   ? 39.207 13.939  -21.116 1.00 103.28 ? 42  MSE B CB  1 
HETATM 2072 C  CG  . MSE B 1 1   ? 37.825 13.363  -21.470 1.00 115.14 ? 42  MSE B CG  1 
HETATM 2073 SE SE  . MSE B 1 1   ? 36.611 13.079  -19.958 1.00 133.69 ? 42  MSE B SE  1 
HETATM 2074 C  CE  . MSE B 1 1   ? 35.967 14.894  -19.740 1.00 127.64 ? 42  MSE B CE  1 
ATOM   2075 N  N   . THR B 1 2   ? 40.493 16.946  -19.501 1.00 74.06  ? 43  THR B N   1 
ATOM   2076 C  CA  . THR B 1 2   ? 41.642 17.423  -18.732 1.00 65.79  ? 43  THR B CA  1 
ATOM   2077 C  C   . THR B 1 2   ? 41.120 17.293  -17.303 1.00 51.44  ? 43  THR B C   1 
ATOM   2078 O  O   . THR B 1 2   ? 39.928 17.470  -17.061 1.00 42.66  ? 43  THR B O   1 
ATOM   2079 C  CB  . THR B 1 2   ? 41.999 18.893  -19.058 1.00 69.22  ? 43  THR B CB  1 
ATOM   2080 O  OG1 . THR B 1 2   ? 41.223 19.782  -18.248 1.00 72.20  ? 43  THR B OG1 1 
ATOM   2081 C  CG2 . THR B 1 2   ? 41.714 19.187  -20.526 1.00 74.16  ? 43  THR B CG2 1 
ATOM   2082 N  N   . PRO B 1 3   ? 41.985 16.960  -16.342 1.00 45.56  ? 44  PRO B N   1 
ATOM   2083 C  CA  . PRO B 1 3   ? 41.438 16.829  -14.989 1.00 41.19  ? 44  PRO B CA  1 
ATOM   2084 C  C   . PRO B 1 3   ? 40.898 18.121  -14.395 1.00 41.70  ? 44  PRO B C   1 
ATOM   2085 O  O   . PRO B 1 3   ? 41.418 19.192  -14.667 1.00 39.58  ? 44  PRO B O   1 
ATOM   2086 C  CB  . PRO B 1 3   ? 42.605 16.262  -14.198 1.00 42.58  ? 44  PRO B CB  1 
ATOM   2087 C  CG  . PRO B 1 3   ? 43.810 16.815  -14.927 1.00 54.51  ? 44  PRO B CG  1 
ATOM   2088 C  CD  . PRO B 1 3   ? 43.427 16.663  -16.376 1.00 45.41  ? 44  PRO B CD  1 
ATOM   2089 N  N   . ALA B 1 4   ? 39.830 18.006  -13.604 1.00 40.61  ? 45  ALA B N   1 
ATOM   2090 C  CA  . ALA B 1 4   ? 39.227 19.165  -12.937 1.00 40.50  ? 45  ALA B CA  1 
ATOM   2091 C  C   . ALA B 1 4   ? 40.328 19.768  -12.049 1.00 38.91  ? 45  ALA B C   1 
ATOM   2092 O  O   . ALA B 1 4   ? 41.010 19.039  -11.321 1.00 32.72  ? 45  ALA B O   1 
ATOM   2093 C  CB  . ALA B 1 4   ? 38.045 18.714  -12.108 1.00 37.91  ? 45  ALA B CB  1 
ATOM   2094 N  N   . SER B 1 5   ? 40.497 21.088  -12.105 1.00 33.75  ? 46  SER B N   1 
ATOM   2095 C  CA  . SER B 1 5   ? 41.582 21.732  -11.366 1.00 37.88  ? 46  SER B CA  1 
ATOM   2096 C  C   . SER B 1 5   ? 41.400 23.231  -11.029 1.00 36.21  ? 46  SER B C   1 
ATOM   2097 O  O   . SER B 1 5   ? 40.770 23.978  -11.767 1.00 36.95  ? 46  SER B O   1 
ATOM   2098 C  CB  . SER B 1 5   ? 42.881 21.555  -12.194 1.00 35.02  ? 46  SER B CB  1 
ATOM   2099 O  OG  . SER B 1 5   ? 44.001 22.190  -11.579 1.00 34.05  ? 46  SER B OG  1 
ATOM   2100 N  N   . TYR B 1 6   ? 41.986 23.668  -9.923  1.00 36.04  ? 47  TYR B N   1 
ATOM   2101 C  CA  . TYR B 1 6   ? 41.922 25.068  -9.545  1.00 35.35  ? 47  TYR B CA  1 
ATOM   2102 C  C   . TYR B 1 6   ? 43.308 25.664  -9.626  1.00 36.26  ? 47  TYR B C   1 
ATOM   2103 O  O   . TYR B 1 6   ? 43.583 26.714  -9.037  1.00 36.00  ? 47  TYR B O   1 
ATOM   2104 C  CB  . TYR B 1 6   ? 41.378 25.217  -8.133  1.00 32.06  ? 47  TYR B CB  1 
ATOM   2105 C  CG  . TYR B 1 6   ? 39.929 24.813  -8.053  1.00 38.14  ? 47  TYR B CG  1 
ATOM   2106 C  CD1 . TYR B 1 6   ? 39.551 23.631  -7.411  1.00 29.55  ? 47  TYR B CD1 1 
ATOM   2107 C  CD2 . TYR B 1 6   ? 38.942 25.564  -8.702  1.00 29.24  ? 47  TYR B CD2 1 
ATOM   2108 C  CE1 . TYR B 1 6   ? 38.242 23.197  -7.422  1.00 29.83  ? 47  TYR B CE1 1 
ATOM   2109 C  CE2 . TYR B 1 6   ? 37.612 25.131  -8.723  1.00 36.88  ? 47  TYR B CE2 1 
ATOM   2110 C  CZ  . TYR B 1 6   ? 37.271 23.940  -8.081  1.00 40.23  ? 47  TYR B CZ  1 
ATOM   2111 O  OH  . TYR B 1 6   ? 35.965 23.472  -8.127  1.00 44.79  ? 47  TYR B OH  1 
ATOM   2112 N  N   . ASN B 1 7   ? 44.180 25.009  -10.391 1.00 40.86  ? 48  ASN B N   1 
ATOM   2113 C  CA  . ASN B 1 7   ? 45.568 25.454  -10.504 1.00 35.52  ? 48  ASN B CA  1 
ATOM   2114 C  C   . ASN B 1 7   ? 45.750 26.881  -11.012 1.00 33.38  ? 48  ASN B C   1 
ATOM   2115 O  O   . ASN B 1 7   ? 46.672 27.586  -10.592 1.00 36.08  ? 48  ASN B O   1 
ATOM   2116 C  CB  . ASN B 1 7   ? 46.378 24.481  -11.361 1.00 36.71  ? 48  ASN B CB  1 
ATOM   2117 C  CG  . ASN B 1 7   ? 47.822 24.907  -11.460 1.00 40.10  ? 48  ASN B CG  1 
ATOM   2118 O  OD1 . ASN B 1 7   ? 48.214 25.509  -12.442 1.00 44.31  ? 48  ASN B OD1 1 
ATOM   2119 N  ND2 . ASN B 1 7   ? 48.609 24.654  -10.401 1.00 36.69  ? 48  ASN B ND2 1 
ATOM   2120 N  N   . LEU B 1 8   ? 44.873 27.295  -11.912 1.00 27.85  ? 49  LEU B N   1 
ATOM   2121 C  CA  . LEU B 1 8   ? 44.878 28.654  -12.446 1.00 40.05  ? 49  LEU B CA  1 
ATOM   2122 C  C   . LEU B 1 8   ? 44.774 29.677  -11.303 1.00 39.41  ? 49  LEU B C   1 
ATOM   2123 O  O   . LEU B 1 8   ? 45.534 30.645  -11.264 1.00 42.06  ? 49  LEU B O   1 
ATOM   2124 C  CB  . LEU B 1 8   ? 43.697 28.867  -13.405 1.00 39.82  ? 49  LEU B CB  1 
ATOM   2125 C  CG  . LEU B 1 8   ? 43.495 30.317  -13.901 1.00 51.46  ? 49  LEU B CG  1 
ATOM   2126 C  CD1 . LEU B 1 8   ? 44.767 30.845  -14.545 1.00 48.64  ? 49  LEU B CD1 1 
ATOM   2127 C  CD2 . LEU B 1 8   ? 42.345 30.363  -14.906 1.00 51.02  ? 49  LEU B CD2 1 
ATOM   2128 N  N   . ALA B 1 9   ? 43.835 29.456  -10.379 1.00 38.90  ? 50  ALA B N   1 
ATOM   2129 C  CA  . ALA B 1 9   ? 43.645 30.346  -9.221  1.00 32.60  ? 50  ALA B CA  1 
ATOM   2130 C  C   . ALA B 1 9   ? 44.908 30.305  -8.381  1.00 34.38  ? 50  ALA B C   1 
ATOM   2131 O  O   . ALA B 1 9   ? 45.339 31.321  -7.850  1.00 35.30  ? 50  ALA B O   1 
ATOM   2132 C  CB  . ALA B 1 9   ? 42.424 29.882  -8.359  1.00 30.92  ? 50  ALA B CB  1 
ATOM   2133 N  N   . VAL B 1 10  ? 45.499 29.118  -8.258  1.00 34.03  ? 51  VAL B N   1 
ATOM   2134 C  CA  . VAL B 1 10  ? 46.739 28.957  -7.491  1.00 31.60  ? 51  VAL B CA  1 
ATOM   2135 C  C   . VAL B 1 10  ? 47.920 29.757  -8.078  1.00 36.63  ? 51  VAL B C   1 
ATOM   2136 O  O   . VAL B 1 10  ? 48.662 30.422  -7.334  1.00 35.12  ? 51  VAL B O   1 
ATOM   2137 C  CB  . VAL B 1 10  ? 47.156 27.455  -7.411  1.00 34.06  ? 51  VAL B CB  1 
ATOM   2138 C  CG1 . VAL B 1 10  ? 48.589 27.325  -6.889  1.00 26.60  ? 51  VAL B CG1 1 
ATOM   2139 C  CG2 . VAL B 1 10  ? 46.166 26.674  -6.507  1.00 36.75  ? 51  VAL B CG2 1 
ATOM   2140 N  N   . ARG B 1 11  ? 48.098 29.674  -9.400  1.00 39.26  ? 52  ARG B N   1 
ATOM   2141 C  CA  . ARG B 1 11  ? 49.200 30.360  -10.113 1.00 42.44  ? 52  ARG B CA  1 
ATOM   2142 C  C   . ARG B 1 11  ? 49.073 31.874  -10.034 1.00 39.14  ? 52  ARG B C   1 
ATOM   2143 O  O   . ARG B 1 11  ? 50.059 32.587  -9.997  1.00 48.14  ? 52  ARG B O   1 
ATOM   2144 C  CB  . ARG B 1 11  ? 49.224 29.981  -11.619 1.00 37.98  ? 52  ARG B CB  1 
ATOM   2145 C  CG  . ARG B 1 11  ? 49.541 28.515  -11.914 1.00 51.48  ? 52  ARG B CG  1 
ATOM   2146 C  CD  . ARG B 1 11  ? 49.807 28.256  -13.407 1.00 53.46  ? 52  ARG B CD  1 
ATOM   2147 N  NE  . ARG B 1 11  ? 48.787 28.773  -14.338 1.00 59.25  ? 52  ARG B NE  1 
ATOM   2148 C  CZ  . ARG B 1 11  ? 47.674 28.130  -14.704 1.00 63.74  ? 52  ARG B CZ  1 
ATOM   2149 N  NH1 . ARG B 1 11  ? 47.394 26.921  -14.223 1.00 63.53  ? 52  ARG B NH1 1 
ATOM   2150 N  NH2 . ARG B 1 11  ? 46.841 28.686  -15.581 1.00 58.89  ? 52  ARG B NH2 1 
ATOM   2151 N  N   . ARG B 1 12  ? 47.846 32.362  -10.064 1.00 39.70  ? 53  ARG B N   1 
ATOM   2152 C  CA  . ARG B 1 12  ? 47.622 33.796  -10.002 1.00 43.12  ? 53  ARG B CA  1 
ATOM   2153 C  C   . ARG B 1 12  ? 47.770 34.354  -8.592  1.00 43.12  ? 53  ARG B C   1 
ATOM   2154 O  O   . ARG B 1 12  ? 48.404 35.393  -8.395  1.00 44.45  ? 53  ARG B O   1 
ATOM   2155 C  CB  . ARG B 1 12  ? 46.225 34.133  -10.529 1.00 42.23  ? 53  ARG B CB  1 
ATOM   2156 C  CG  . ARG B 1 12  ? 46.046 33.927  -12.024 1.00 36.24  ? 53  ARG B CG  1 
ATOM   2157 C  CD  . ARG B 1 12  ? 44.596 34.156  -12.405 1.00 38.04  ? 53  ARG B CD  1 
ATOM   2158 N  NE  . ARG B 1 12  ? 44.360 33.976  -13.838 1.00 48.64  ? 53  ARG B NE  1 
ATOM   2159 C  CZ  . ARG B 1 12  ? 43.163 34.056  -14.424 1.00 53.48  ? 53  ARG B CZ  1 
ATOM   2160 N  NH1 . ARG B 1 12  ? 42.074 34.315  -13.701 1.00 49.16  ? 53  ARG B NH1 1 
ATOM   2161 N  NH2 . ARG B 1 12  ? 43.050 33.877  -15.735 1.00 44.48  ? 53  ARG B NH2 1 
ATOM   2162 N  N   . ALA B 1 13  ? 47.239 33.632  -7.610  1.00 38.17  ? 54  ALA B N   1 
ATOM   2163 C  CA  . ALA B 1 13  ? 47.235 34.116  -6.223  1.00 39.44  ? 54  ALA B CA  1 
ATOM   2164 C  C   . ALA B 1 13  ? 48.316 33.666  -5.250  1.00 37.37  ? 54  ALA B C   1 
ATOM   2165 O  O   . ALA B 1 13  ? 48.746 34.459  -4.424  1.00 39.69  ? 54  ALA B O   1 
ATOM   2166 C  CB  . ALA B 1 13  ? 45.832 33.838  -5.589  1.00 33.14  ? 54  ALA B CB  1 
ATOM   2167 N  N   . ALA B 1 14  ? 48.750 32.408  -5.316  1.00 38.45  ? 55  ALA B N   1 
ATOM   2168 C  CA  . ALA B 1 14  ? 49.760 31.932  -4.363  1.00 39.79  ? 55  ALA B CA  1 
ATOM   2169 C  C   . ALA B 1 14  ? 51.059 32.767  -4.301  1.00 35.28  ? 55  ALA B C   1 
ATOM   2170 O  O   . ALA B 1 14  ? 51.634 32.941  -3.221  1.00 39.42  ? 55  ALA B O   1 
ATOM   2171 C  CB  . ALA B 1 14  ? 50.086 30.451  -4.638  1.00 38.02  ? 55  ALA B CB  1 
ATOM   2172 N  N   . PRO B 1 15  ? 51.550 33.277  -5.448  1.00 33.62  ? 56  PRO B N   1 
ATOM   2173 C  CA  . PRO B 1 15  ? 52.793 34.069  -5.333  1.00 38.62  ? 56  PRO B CA  1 
ATOM   2174 C  C   . PRO B 1 15  ? 52.652 35.280  -4.366  1.00 40.36  ? 56  PRO B C   1 
ATOM   2175 O  O   . PRO B 1 15  ? 53.600 35.658  -3.682  1.00 40.22  ? 56  PRO B O   1 
ATOM   2176 C  CB  . PRO B 1 15  ? 53.072 34.493  -6.787  1.00 35.77  ? 56  PRO B CB  1 
ATOM   2177 C  CG  . PRO B 1 15  ? 52.535 33.334  -7.584  1.00 35.72  ? 56  PRO B CG  1 
ATOM   2178 C  CD  . PRO B 1 15  ? 51.207 33.022  -6.864  1.00 31.48  ? 56  PRO B CD  1 
ATOM   2179 N  N   . ALA B 1 16  ? 51.453 35.860  -4.284  1.00 39.46  ? 57  ALA B N   1 
ATOM   2180 C  CA  . ALA B 1 16  ? 51.229 36.999  -3.399  1.00 38.39  ? 57  ALA B CA  1 
ATOM   2181 C  C   . ALA B 1 16  ? 51.042 36.665  -1.919  1.00 39.41  ? 57  ALA B C   1 
ATOM   2182 O  O   . ALA B 1 16  ? 50.845 37.570  -1.118  1.00 43.44  ? 57  ALA B O   1 
ATOM   2183 C  CB  . ALA B 1 16  ? 50.036 37.798  -3.889  1.00 38.25  ? 57  ALA B CB  1 
ATOM   2184 N  N   . VAL B 1 17  ? 51.079 35.389  -1.539  1.00 39.63  ? 58  VAL B N   1 
ATOM   2185 C  CA  . VAL B 1 17  ? 50.884 35.040  -0.127  1.00 37.55  ? 58  VAL B CA  1 
ATOM   2186 C  C   . VAL B 1 17  ? 52.213 34.773  0.526   1.00 36.01  ? 58  VAL B C   1 
ATOM   2187 O  O   . VAL B 1 17  ? 52.969 33.921  0.090   1.00 41.22  ? 58  VAL B O   1 
ATOM   2188 C  CB  . VAL B 1 17  ? 49.935 33.819  0.038   1.00 36.77  ? 58  VAL B CB  1 
ATOM   2189 C  CG1 . VAL B 1 17  ? 49.771 33.472  1.526   1.00 33.88  ? 58  VAL B CG1 1 
ATOM   2190 C  CG2 . VAL B 1 17  ? 48.590 34.151  -0.596  1.00 28.57  ? 58  VAL B CG2 1 
ATOM   2191 N  N   . VAL B 1 18  ? 52.501 35.524  1.575   1.00 37.44  ? 59  VAL B N   1 
ATOM   2192 C  CA  . VAL B 1 18  ? 53.790 35.426  2.241   1.00 37.68  ? 59  VAL B CA  1 
ATOM   2193 C  C   . VAL B 1 18  ? 53.784 34.878  3.657   1.00 36.45  ? 59  VAL B C   1 
ATOM   2194 O  O   . VAL B 1 18  ? 52.731 34.767  4.305   1.00 38.33  ? 59  VAL B O   1 
ATOM   2195 C  CB  . VAL B 1 18  ? 54.471 36.850  2.300   1.00 43.27  ? 59  VAL B CB  1 
ATOM   2196 C  CG1 . VAL B 1 18  ? 54.480 37.500  0.918   1.00 36.80  ? 59  VAL B CG1 1 
ATOM   2197 C  CG2 . VAL B 1 18  ? 53.723 37.742  3.266   1.00 34.44  ? 59  VAL B CG2 1 
ATOM   2198 N  N   . ASN B 1 19  ? 54.986 34.549  4.125   1.00 42.00  ? 60  ASN B N   1 
ATOM   2199 C  CA  . ASN B 1 19  ? 55.197 34.086  5.491   1.00 46.06  ? 60  ASN B CA  1 
ATOM   2200 C  C   . ASN B 1 19  ? 55.532 35.352  6.261   1.00 44.82  ? 60  ASN B C   1 
ATOM   2201 O  O   . ASN B 1 19  ? 56.303 36.183  5.786   1.00 44.50  ? 60  ASN B O   1 
ATOM   2202 C  CB  . ASN B 1 19  ? 56.414 33.152  5.599   1.00 53.66  ? 60  ASN B CB  1 
ATOM   2203 C  CG  . ASN B 1 19  ? 56.297 31.933  4.727   1.00 64.80  ? 60  ASN B CG  1 
ATOM   2204 O  OD1 . ASN B 1 19  ? 55.545 31.014  5.031   1.00 74.94  ? 60  ASN B OD1 1 
ATOM   2205 N  ND2 . ASN B 1 19  ? 57.040 31.917  3.624   1.00 74.48  ? 60  ASN B ND2 1 
ATOM   2206 N  N   . VAL B 1 20  ? 54.970 35.495  7.447   1.00 45.48  ? 61  VAL B N   1 
ATOM   2207 C  CA  . VAL B 1 20  ? 55.241 36.655  8.276   1.00 46.92  ? 61  VAL B CA  1 
ATOM   2208 C  C   . VAL B 1 20  ? 55.829 36.139  9.597   1.00 54.08  ? 61  VAL B C   1 
ATOM   2209 O  O   . VAL B 1 20  ? 55.232 35.264  10.249  1.00 50.13  ? 61  VAL B O   1 
ATOM   2210 C  CB  . VAL B 1 20  ? 53.934 37.424  8.576   1.00 47.25  ? 61  VAL B CB  1 
ATOM   2211 C  CG1 . VAL B 1 20  ? 54.223 38.555  9.535   1.00 36.02  ? 61  VAL B CG1 1 
ATOM   2212 C  CG2 . VAL B 1 20  ? 53.290 37.927  7.260   1.00 36.50  ? 61  VAL B CG2 1 
ATOM   2213 N  N   . TYR B 1 21  ? 56.984 36.679  9.994   1.00 56.79  ? 62  TYR B N   1 
ATOM   2214 C  CA  . TYR B 1 21  ? 57.648 36.256  11.231  1.00 60.47  ? 62  TYR B CA  1 
ATOM   2215 C  C   . TYR B 1 21  ? 57.734 37.361  12.276  1.00 64.46  ? 62  TYR B C   1 
ATOM   2216 O  O   . TYR B 1 21  ? 58.324 38.420  12.032  1.00 63.29  ? 62  TYR B O   1 
ATOM   2217 C  CB  . TYR B 1 21  ? 59.071 35.761  10.943  1.00 62.82  ? 62  TYR B CB  1 
ATOM   2218 C  CG  . TYR B 1 21  ? 59.188 34.735  9.838   1.00 66.37  ? 62  TYR B CG  1 
ATOM   2219 C  CD1 . TYR B 1 21  ? 59.553 35.110  8.543   1.00 68.05  ? 62  TYR B CD1 1 
ATOM   2220 C  CD2 . TYR B 1 21  ? 58.929 33.384  10.086  1.00 71.01  ? 62  TYR B CD2 1 
ATOM   2221 C  CE1 . TYR B 1 21  ? 59.658 34.157  7.519   1.00 75.06  ? 62  TYR B CE1 1 
ATOM   2222 C  CE2 . TYR B 1 21  ? 59.030 32.422  9.071   1.00 71.74  ? 62  TYR B CE2 1 
ATOM   2223 C  CZ  . TYR B 1 21  ? 59.392 32.812  7.795   1.00 74.65  ? 62  TYR B CZ  1 
ATOM   2224 O  OH  . TYR B 1 21  ? 59.484 31.857  6.802   1.00 78.63  ? 62  TYR B OH  1 
ATOM   2225 N  N   . ASN B 1 22  ? 57.158 37.098  13.447  1.00 69.31  ? 63  ASN B N   1 
ATOM   2226 C  CA  . ASN B 1 22  ? 57.160 38.043  14.573  1.00 74.65  ? 63  ASN B CA  1 
ATOM   2227 C  C   . ASN B 1 22  ? 58.200 37.629  15.620  1.00 75.82  ? 63  ASN B C   1 
ATOM   2228 O  O   . ASN B 1 22  ? 58.102 36.551  16.201  1.00 77.60  ? 63  ASN B O   1 
ATOM   2229 C  CB  . ASN B 1 22  ? 55.772 38.080  15.230  1.00 74.95  ? 63  ASN B CB  1 
ATOM   2230 C  CG  . ASN B 1 22  ? 55.761 38.835  16.559  1.00 78.63  ? 63  ASN B CG  1 
ATOM   2231 O  OD1 . ASN B 1 22  ? 54.773 38.797  17.289  1.00 82.13  ? 63  ASN B OD1 1 
ATOM   2232 N  ND2 . ASN B 1 22  ? 56.851 39.524  16.871  1.00 80.24  ? 63  ASN B ND2 1 
ATOM   2233 N  N   . ARG B 1 23  ? 59.179 38.488  15.882  1.00 78.77  ? 64  ARG B N   1 
ATOM   2234 C  CA  . ARG B 1 23  ? 60.208 38.151  16.860  1.00 81.32  ? 64  ARG B CA  1 
ATOM   2235 C  C   . ARG B 1 23  ? 60.309 39.170  17.988  1.00 81.72  ? 64  ARG B C   1 
ATOM   2236 O  O   . ARG B 1 23  ? 60.233 40.372  17.751  1.00 82.51  ? 64  ARG B O   1 
ATOM   2237 C  CB  . ARG B 1 23  ? 61.547 38.028  16.153  1.00 81.86  ? 64  ARG B CB  1 
ATOM   2238 C  CG  . ARG B 1 23  ? 61.434 37.377  14.782  1.00 84.82  ? 64  ARG B CG  1 
ATOM   2239 C  CD  . ARG B 1 23  ? 62.795 37.280  14.160  1.00 86.94  ? 64  ARG B CD  1 
ATOM   2240 N  NE  . ARG B 1 23  ? 63.676 38.305  14.708  1.00 86.80  ? 64  ARG B NE  1 
ATOM   2241 C  CZ  . ARG B 1 23  ? 64.942 38.469  14.348  1.00 89.53  ? 64  ARG B CZ  1 
ATOM   2242 N  NH1 . ARG B 1 23  ? 65.477 37.673  13.429  1.00 87.28  ? 64  ARG B NH1 1 
ATOM   2243 N  NH2 . ARG B 1 23  ? 65.676 39.416  14.920  1.00 90.23  ? 64  ARG B NH2 1 
ATOM   2244 N  N   . GLY B 1 24  ? 61.032 38.689  18.847  1.00 107.69 ? 65  GLY B N   1 
ATOM   2245 C  CA  . GLY B 1 24  ? 61.153 39.534  20.018  1.00 112.57 ? 65  GLY B CA  1 
ATOM   2246 C  C   . GLY B 1 24  ? 62.591 39.553  20.498  1.00 116.31 ? 65  GLY B C   1 
ATOM   2247 O  O   . GLY B 1 24  ? 63.311 38.564  20.347  1.00 115.65 ? 65  GLY B O   1 
ATOM   2248 N  N   . LEU B 1 25  ? 63.010 40.678  21.072  1.00 120.14 ? 66  LEU B N   1 
ATOM   2249 C  CA  . LEU B 1 25  ? 64.373 40.834  21.576  1.00 123.86 ? 66  LEU B CA  1 
ATOM   2250 C  C   . LEU B 1 25  ? 64.613 40.105  22.897  1.00 126.15 ? 66  LEU B C   1 
ATOM   2251 O  O   . LEU B 1 25  ? 65.737 39.700  23.190  1.00 126.23 ? 66  LEU B O   1 
ATOM   2252 C  CB  . LEU B 1 25  ? 64.709 42.322  21.746  1.00 124.28 ? 66  LEU B CB  1 
ATOM   2253 C  CG  . LEU B 1 25  ? 65.005 43.137  20.480  1.00 125.59 ? 66  LEU B CG  1 
ATOM   2254 C  CD1 . LEU B 1 25  ? 65.031 44.627  20.813  1.00 125.42 ? 66  LEU B CD1 1 
ATOM   2255 C  CD2 . LEU B 1 25  ? 66.340 42.690  19.885  1.00 125.42 ? 66  LEU B CD2 1 
ATOM   2256 N  N   . ASN B 1 26  ? 63.560 39.940  23.692  1.00 129.03 ? 67  ASN B N   1 
ATOM   2257 C  CA  . ASN B 1 26  ? 63.682 39.254  24.977  1.00 132.30 ? 67  ASN B CA  1 
ATOM   2258 C  C   . ASN B 1 26  ? 62.916 37.928  24.948  1.00 133.83 ? 67  ASN B C   1 
ATOM   2259 O  O   . ASN B 1 26  ? 62.278 37.543  25.931  1.00 133.66 ? 67  ASN B O   1 
ATOM   2260 C  CB  . ASN B 1 26  ? 63.147 40.146  26.106  1.00 132.56 ? 67  ASN B CB  1 
ATOM   2261 C  CG  . ASN B 1 26  ? 63.511 39.625  27.489  1.00 133.17 ? 67  ASN B CG  1 
ATOM   2262 O  OD1 . ASN B 1 26  ? 64.690 39.537  27.843  1.00 133.14 ? 67  ASN B OD1 1 
ATOM   2263 N  ND2 . ASN B 1 26  ? 62.498 39.278  28.278  1.00 133.08 ? 67  ASN B ND2 1 
ATOM   2264 N  N   . THR B 1 27  ? 62.989 37.237  23.812  0.00 135.99 ? 68  THR B N   1 
ATOM   2265 C  CA  . THR B 1 27  ? 62.309 35.956  23.633  0.00 137.09 ? 68  THR B CA  1 
ATOM   2266 C  C   . THR B 1 27  ? 62.991 34.877  24.474  0.00 138.08 ? 68  THR B C   1 
ATOM   2267 O  O   . THR B 1 27  ? 62.335 34.138  25.213  0.00 137.35 ? 68  THR B O   1 
ATOM   2268 C  CB  . THR B 1 27  ? 62.328 35.517  22.148  0.00 137.09 ? 68  THR B CB  1 
ATOM   2269 O  OG1 . THR B 1 27  ? 61.886 36.599  21.318  0.00 136.43 ? 68  THR B OG1 1 
ATOM   2270 C  CG2 . THR B 1 27  ? 61.408 34.325  21.936  0.00 136.57 ? 68  THR B CG2 1 
ATOM   2271 N  N   . ASN B 1 28  ? 64.312 34.794  24.350  0.00 139.45 ? 69  ASN B N   1 
ATOM   2272 C  CA  . ASN B 1 28  ? 65.097 33.820  25.100  0.00 140.35 ? 69  ASN B CA  1 
ATOM   2273 C  C   . ASN B 1 28  ? 65.853 34.511  26.235  0.00 140.71 ? 69  ASN B C   1 
ATOM   2274 O  O   . ASN B 1 28  ? 65.391 35.524  26.770  0.00 140.49 ? 69  ASN B O   1 
ATOM   2275 C  CB  . ASN B 1 28  ? 66.075 33.096  24.164  0.00 140.48 ? 69  ASN B CB  1 
ATOM   2276 C  CG  . ASN B 1 28  ? 66.939 34.053  23.360  0.00 141.03 ? 69  ASN B CG  1 
ATOM   2277 O  OD1 . ASN B 1 28  ? 67.857 34.675  23.890  0.00 141.70 ? 69  ASN B OD1 1 
ATOM   2278 N  ND2 . ASN B 1 28  ? 66.641 34.177  22.071  0.00 140.67 ? 69  ASN B ND2 1 
ATOM   2279 N  N   . SER B 1 29  ? 67.010 33.964  26.599  0.00 140.83 ? 70  SER B N   1 
ATOM   2280 C  CA  . SER B 1 29  ? 67.817 34.533  27.674  0.00 140.74 ? 70  SER B CA  1 
ATOM   2281 C  C   . SER B 1 29  ? 69.176 35.022  27.167  0.00 140.73 ? 70  SER B C   1 
ATOM   2282 O  O   . SER B 1 29  ? 70.172 34.972  27.890  0.00 141.18 ? 70  SER B O   1 
ATOM   2283 C  CB  . SER B 1 29  ? 68.018 33.491  28.778  0.00 140.20 ? 70  SER B CB  1 
ATOM   2284 O  OG  . SER B 1 29  ? 66.774 33.037  29.284  0.00 139.01 ? 70  SER B OG  1 
ATOM   2285 N  N   . HIS B 1 30  ? 69.208 35.501  25.926  0.00 140.49 ? 71  HIS B N   1 
ATOM   2286 C  CA  . HIS B 1 30  ? 70.445 35.989  25.324  0.00 140.08 ? 71  HIS B CA  1 
ATOM   2287 C  C   . HIS B 1 30  ? 70.243 37.344  24.647  0.00 139.38 ? 71  HIS B C   1 
ATOM   2288 O  O   . HIS B 1 30  ? 71.204 37.987  24.222  0.00 138.59 ? 71  HIS B O   1 
ATOM   2289 C  CB  . HIS B 1 30  ? 70.959 34.966  24.308  0.00 140.90 ? 71  HIS B CB  1 
ATOM   2290 C  CG  . HIS B 1 30  ? 71.070 33.578  24.858  0.00 141.89 ? 71  HIS B CG  1 
ATOM   2291 N  ND1 . HIS B 1 30  ? 71.846 33.274  25.956  0.00 142.35 ? 71  HIS B ND1 1 
ATOM   2292 C  CD2 . HIS B 1 30  ? 70.489 32.416  24.474  0.00 142.06 ? 71  HIS B CD2 1 
ATOM   2293 C  CE1 . HIS B 1 30  ? 71.737 31.985  26.226  0.00 142.53 ? 71  HIS B CE1 1 
ATOM   2294 N  NE2 . HIS B 1 30  ? 70.919 31.442  25.342  0.00 142.34 ? 71  HIS B NE2 1 
ATOM   2295 N  N   . ASN B 1 31  ? 68.984 37.765  24.555  0.00 139.00 ? 72  ASN B N   1 
ATOM   2296 C  CA  . ASN B 1 31  ? 68.615 39.041  23.943  0.00 138.41 ? 72  ASN B CA  1 
ATOM   2297 C  C   . ASN B 1 31  ? 68.892 39.095  22.441  0.00 137.66 ? 72  ASN B C   1 
ATOM   2298 O  O   . ASN B 1 31  ? 69.648 39.942  21.961  0.00 137.43 ? 72  ASN B O   1 
ATOM   2299 C  CB  . ASN B 1 31  ? 69.326 40.190  24.661  0.00 138.25 ? 72  ASN B CB  1 
ATOM   2300 C  CG  . ASN B 1 31  ? 68.929 40.292  26.122  0.00 138.32 ? 72  ASN B CG  1 
ATOM   2301 O  OD1 . ASN B 1 31  ? 67.758 40.503  26.447  0.00 137.66 ? 72  ASN B OD1 1 
ATOM   2302 N  ND2 . ASN B 1 31  ? 69.902 40.134  27.011  0.00 138.68 ? 72  ASN B ND2 1 
ATOM   2303 N  N   . GLN B 1 32  ? 68.254 38.184  21.712  0.00 136.68 ? 73  GLN B N   1 
ATOM   2304 C  CA  . GLN B 1 32  ? 68.391 38.081  20.264  0.00 135.20 ? 73  GLN B CA  1 
ATOM   2305 C  C   . GLN B 1 32  ? 66.998 37.896  19.663  0.00 134.27 ? 73  GLN B C   1 
ATOM   2306 O  O   . GLN B 1 32  ? 66.147 37.224  20.250  0.00 134.80 ? 73  GLN B O   1 
ATOM   2307 C  CB  . GLN B 1 32  ? 69.257 36.873  19.911  0.00 134.96 ? 73  GLN B CB  1 
ATOM   2308 C  CG  . GLN B 1 32  ? 70.586 36.830  20.636  0.00 135.33 ? 73  GLN B CG  1 
ATOM   2309 C  CD  . GLN B 1 32  ? 71.184 35.439  20.658  0.00 136.40 ? 73  GLN B CD  1 
ATOM   2310 O  OE1 . GLN B 1 32  ? 72.303 35.241  21.127  0.00 137.12 ? 73  GLN B OE1 1 
ATOM   2311 N  NE2 . GLN B 1 32  ? 70.435 34.462  20.155  0.00 136.71 ? 73  GLN B NE2 1 
ATOM   2312 N  N   . LEU B 1 33  ? 66.765 38.489  18.496  0.00 132.45 ? 74  LEU B N   1 
ATOM   2313 C  CA  . LEU B 1 33  ? 65.471 38.378  17.827  0.00 129.68 ? 74  LEU B CA  1 
ATOM   2314 C  C   . LEU B 1 33  ? 65.142 36.916  17.528  0.00 127.81 ? 74  LEU B C   1 
ATOM   2315 O  O   . LEU B 1 33  ? 65.574 36.359  16.516  0.00 127.03 ? 74  LEU B O   1 
ATOM   2316 C  CB  . LEU B 1 33  ? 65.483 39.202  16.538  0.00 129.18 ? 74  LEU B CB  1 
ATOM   2317 C  CG  . LEU B 1 33  ? 65.667 40.702  16.792  0.00 128.59 ? 74  LEU B CG  1 
ATOM   2318 C  CD1 . LEU B 1 33  ? 66.049 41.416  15.508  0.00 128.21 ? 74  LEU B CD1 1 
ATOM   2319 C  CD2 . LEU B 1 33  ? 64.385 41.272  17.383  0.00 128.07 ? 74  LEU B CD2 1 
ATOM   2320 N  N   . GLU B 1 34  ? 64.370 36.309  18.427  0.00 125.85 ? 75  GLU B N   1 
ATOM   2321 C  CA  . GLU B 1 34  ? 63.967 34.909  18.320  0.00 123.40 ? 75  GLU B CA  1 
ATOM   2322 C  C   . GLU B 1 34  ? 62.538 34.746  17.800  0.00 120.83 ? 75  GLU B C   1 
ATOM   2323 O  O   . GLU B 1 34  ? 61.589 35.232  18.418  0.00 120.73 ? 75  GLU B O   1 
ATOM   2324 C  CB  . GLU B 1 34  ? 64.092 34.245  19.692  0.00 123.62 ? 75  GLU B CB  1 
ATOM   2325 C  CG  . GLU B 1 34  ? 63.637 32.805  19.747  0.00 125.03 ? 75  GLU B CG  1 
ATOM   2326 C  CD  . GLU B 1 34  ? 63.732 32.230  21.146  0.00 126.35 ? 75  GLU B CD  1 
ATOM   2327 O  OE1 . GLU B 1 34  ? 64.838 32.263  21.723  0.00 127.17 ? 75  GLU B OE1 1 
ATOM   2328 O  OE2 . GLU B 1 34  ? 62.706 31.744  21.670  0.00 127.05 ? 75  GLU B OE2 1 
ATOM   2329 N  N   . ILE B 1 35  ? 62.392 34.054  16.669  0.00 117.53 ? 76  ILE B N   1 
ATOM   2330 C  CA  . ILE B 1 35  ? 61.081 33.827  16.062  0.00 113.70 ? 76  ILE B CA  1 
ATOM   2331 C  C   . ILE B 1 35  ? 60.072 33.348  17.096  0.00 110.91 ? 76  ILE B C   1 
ATOM   2332 O  O   . ILE B 1 35  ? 60.187 32.244  17.623  0.00 110.76 ? 76  ILE B O   1 
ATOM   2333 C  CB  . ILE B 1 35  ? 61.148 32.776  14.929  0.00 113.62 ? 76  ILE B CB  1 
ATOM   2334 C  CG1 . ILE B 1 35  ? 62.101 33.250  13.829  0.00 113.68 ? 76  ILE B CG1 1 
ATOM   2335 C  CG2 . ILE B 1 35  ? 59.757 32.549  14.354  0.00 113.39 ? 76  ILE B CG2 1 
ATOM   2336 C  CD1 . ILE B 1 35  ? 62.266 32.267  12.686  0.00 112.65 ? 76  ILE B CD1 1 
ATOM   2337 N  N   . ARG B 1 36  ? 59.084 34.190  17.375  0.00 107.79 ? 77  ARG B N   1 
ATOM   2338 C  CA  . ARG B 1 36  ? 58.041 33.882  18.345  0.00 104.14 ? 77  ARG B CA  1 
ATOM   2339 C  C   . ARG B 1 36  ? 56.774 33.382  17.652  0.00 100.33 ? 77  ARG B C   1 
ATOM   2340 O  O   . ARG B 1 36  ? 56.546 32.176  17.555  0.00 99.74  ? 77  ARG B O   1 
ATOM   2341 C  CB  . ARG B 1 36  ? 57.739 35.131  19.182  0.00 106.13 ? 77  ARG B CB  1 
ATOM   2342 C  CG  . ARG B 1 36  ? 58.910 35.569  20.054  0.00 107.98 ? 77  ARG B CG  1 
ATOM   2343 C  CD  . ARG B 1 36  ? 58.812 37.032  20.480  0.00 111.40 ? 77  ARG B CD  1 
ATOM   2344 N  NE  . ARG B 1 36  ? 57.631 37.332  21.290  0.00 112.62 ? 77  ARG B NE  1 
ATOM   2345 C  CZ  . ARG B 1 36  ? 57.392 38.517  21.850  0.00 113.03 ? 77  ARG B CZ  1 
ATOM   2346 N  NH1 . ARG B 1 36  ? 58.254 39.515  21.689  0.00 112.62 ? 77  ARG B NH1 1 
ATOM   2347 N  NH2 . ARG B 1 36  ? 56.292 38.708  22.572  0.00 111.26 ? 77  ARG B NH2 1 
ATOM   2348 N  N   . THR B 1 37  ? 56.192 33.868  17.114  0.00 76.57  ? 78  THR B N   1 
ATOM   2349 C  CA  . THR B 1 37  ? 54.902 33.753  16.428  0.00 79.07  ? 78  THR B CA  1 
ATOM   2350 C  C   . THR B 1 37  ? 55.023 33.862  14.899  0.00 75.65  ? 78  THR B C   1 
ATOM   2351 O  O   . THR B 1 37  ? 55.650 34.786  14.382  0.00 75.53  ? 78  THR B O   1 
ATOM   2352 C  CB  . THR B 1 37  ? 53.901 34.848  16.907  0.00 81.08  ? 78  THR B CB  1 
ATOM   2353 O  OG1 . THR B 1 37  ? 53.801 34.827  18.338  0.00 82.64  ? 78  THR B OG1 1 
ATOM   2354 C  CG2 . THR B 1 37  ? 52.514 34.595  16.317  0.00 81.98  ? 78  THR B CG2 1 
ATOM   2355 N  N   . LEU B 1 38  ? 54.416 32.914  14.187  1.00 71.54  ? 79  LEU B N   1 
ATOM   2356 C  CA  . LEU B 1 38  ? 54.431 32.915  12.721  1.00 67.08  ? 79  LEU B CA  1 
ATOM   2357 C  C   . LEU B 1 38  ? 53.062 33.308  12.148  1.00 59.53  ? 79  LEU B C   1 
ATOM   2358 O  O   . LEU B 1 38  ? 52.090 33.500  12.881  1.00 59.07  ? 79  LEU B O   1 
ATOM   2359 C  CB  . LEU B 1 38  ? 54.818 31.540  12.168  1.00 67.57  ? 79  LEU B CB  1 
ATOM   2360 C  CG  . LEU B 1 38  ? 56.187 30.969  12.528  1.00 71.90  ? 79  LEU B CG  1 
ATOM   2361 C  CD1 . LEU B 1 38  ? 56.090 30.168  13.825  1.00 73.80  ? 79  LEU B CD1 1 
ATOM   2362 C  CD2 . LEU B 1 38  ? 56.657 30.074  11.393  1.00 73.96  ? 79  LEU B CD2 1 
ATOM   2363 N  N   . GLY B 1 39  ? 52.997 33.435  10.831  1.00 51.13  ? 80  GLY B N   1 
ATOM   2364 C  CA  . GLY B 1 39  ? 51.753 33.810  10.205  1.00 42.74  ? 80  GLY B CA  1 
ATOM   2365 C  C   . GLY B 1 39  ? 51.886 33.962  8.706   1.00 42.51  ? 80  GLY B C   1 
ATOM   2366 O  O   . GLY B 1 39  ? 52.958 33.791  8.108   1.00 42.56  ? 80  GLY B O   1 
ATOM   2367 N  N   . SER B 1 40  ? 50.763 34.290  8.092   1.00 39.82  ? 81  SER B N   1 
ATOM   2368 C  CA  . SER B 1 40  ? 50.693 34.501  6.653   1.00 39.31  ? 81  SER B CA  1 
ATOM   2369 C  C   . SER B 1 40  ? 50.259 35.938  6.420   1.00 37.06  ? 81  SER B C   1 
ATOM   2370 O  O   . SER B 1 40  ? 49.685 36.574  7.309   1.00 32.37  ? 81  SER B O   1 
ATOM   2371 C  CB  . SER B 1 40  ? 49.642 33.575  6.028   1.00 36.54  ? 81  SER B CB  1 
ATOM   2372 O  OG  . SER B 1 40  ? 50.085 32.241  6.042   1.00 41.77  ? 81  SER B OG  1 
ATOM   2373 N  N   . GLY B 1 41  ? 50.496 36.433  5.212   1.00 35.21  ? 82  GLY B N   1 
ATOM   2374 C  CA  . GLY B 1 41  ? 50.078 37.779  4.900   1.00 30.48  ? 82  GLY B CA  1 
ATOM   2375 C  C   . GLY B 1 41  ? 49.877 37.804  3.413   1.00 36.65  ? 82  GLY B C   1 
ATOM   2376 O  O   . GLY B 1 41  ? 50.324 36.900  2.708   1.00 37.39  ? 82  GLY B O   1 
ATOM   2377 N  N   . VAL B 1 42  ? 49.231 38.855  2.932   1.00 33.32  ? 83  VAL B N   1 
ATOM   2378 C  CA  . VAL B 1 42  ? 48.929 38.989  1.520   1.00 35.32  ? 83  VAL B CA  1 
ATOM   2379 C  C   . VAL B 1 42  ? 49.399 40.347  0.993   1.00 37.37  ? 83  VAL B C   1 
ATOM   2380 O  O   . VAL B 1 42  ? 49.076 41.399  1.576   1.00 35.23  ? 83  VAL B O   1 
ATOM   2381 C  CB  . VAL B 1 42  ? 47.392 38.888  1.318   1.00 37.70  ? 83  VAL B CB  1 
ATOM   2382 C  CG1 . VAL B 1 42  ? 47.055 38.991  -0.157  1.00 34.34  ? 83  VAL B CG1 1 
ATOM   2383 C  CG2 . VAL B 1 42  ? 46.847 37.571  1.974   1.00 30.78  ? 83  VAL B CG2 1 
ATOM   2384 N  N   . ILE B 1 43  ? 50.166 40.320  -0.096  1.00 36.71  ? 84  ILE B N   1 
ATOM   2385 C  CA  . ILE B 1 43  ? 50.636 41.549  -0.729  1.00 35.42  ? 84  ILE B CA  1 
ATOM   2386 C  C   . ILE B 1 43  ? 49.464 42.085  -1.516  1.00 35.92  ? 84  ILE B C   1 
ATOM   2387 O  O   . ILE B 1 43  ? 48.981 41.440  -2.469  1.00 38.14  ? 84  ILE B O   1 
ATOM   2388 C  CB  . ILE B 1 43  ? 51.817 41.278  -1.675  1.00 38.73  ? 84  ILE B CB  1 
ATOM   2389 C  CG1 . ILE B 1 43  ? 53.009 40.780  -0.852  1.00 35.65  ? 84  ILE B CG1 1 
ATOM   2390 C  CG2 . ILE B 1 43  ? 52.186 42.558  -2.456  1.00 37.90  ? 84  ILE B CG2 1 
ATOM   2391 C  CD1 . ILE B 1 43  ? 54.055 40.068  -1.687  1.00 47.16  ? 84  ILE B CD1 1 
HETATM 2392 N  N   . MSE B 1 44  ? 49.007 43.268  -1.117  1.00 33.56  ? 85  MSE B N   1 
HETATM 2393 C  CA  . MSE B 1 44  ? 47.847 43.914  -1.738  1.00 36.32  ? 85  MSE B CA  1 
HETATM 2394 C  C   . MSE B 1 44  ? 48.138 44.788  -2.984  1.00 42.27  ? 85  MSE B C   1 
HETATM 2395 O  O   . MSE B 1 44  ? 47.250 44.997  -3.812  1.00 46.29  ? 85  MSE B O   1 
HETATM 2396 C  CB  . MSE B 1 44  ? 47.125 44.744  -0.665  1.00 33.36  ? 85  MSE B CB  1 
HETATM 2397 C  CG  . MSE B 1 44  ? 46.768 43.925  0.589   1.00 43.09  ? 85  MSE B CG  1 
HETATM 2398 SE SE  . MSE B 1 44  ? 45.475 42.496  0.115   1.00 51.28  ? 85  MSE B SE  1 
HETATM 2399 C  CE  . MSE B 1 44  ? 43.955 43.641  -0.204  1.00 38.17  ? 85  MSE B CE  1 
ATOM   2400 N  N   . ASP B 1 45  ? 49.355 45.318  -3.108  1.00 44.11  ? 86  ASP B N   1 
ATOM   2401 C  CA  . ASP B 1 45  ? 49.696 46.131  -4.281  1.00 46.07  ? 86  ASP B CA  1 
ATOM   2402 C  C   . ASP B 1 45  ? 51.199 46.329  -4.454  1.00 38.30  ? 86  ASP B C   1 
ATOM   2403 O  O   . ASP B 1 45  ? 51.970 46.091  -3.523  1.00 42.16  ? 86  ASP B O   1 
ATOM   2404 C  CB  . ASP B 1 45  ? 48.976 47.483  -4.210  1.00 51.22  ? 86  ASP B CB  1 
ATOM   2405 C  CG  . ASP B 1 45  ? 49.476 48.358  -3.071  1.00 56.85  ? 86  ASP B CG  1 
ATOM   2406 O  OD1 . ASP B 1 45  ? 48.829 49.387  -2.790  1.00 65.21  ? 86  ASP B OD1 1 
ATOM   2407 O  OD2 . ASP B 1 45  ? 50.515 48.029  -2.459  1.00 65.96  ? 86  ASP B OD2 1 
ATOM   2408 N  N   . GLN B 1 46  ? 51.611 46.765  -5.645  1.00 46.07  ? 87  GLN B N   1 
ATOM   2409 C  CA  . GLN B 1 46  ? 53.034 47.007  -5.970  1.00 48.01  ? 87  GLN B CA  1 
ATOM   2410 C  C   . GLN B 1 46  ? 53.786 47.941  -5.003  1.00 48.48  ? 87  GLN B C   1 
ATOM   2411 O  O   . GLN B 1 46  ? 54.990 47.802  -4.817  1.00 50.79  ? 87  GLN B O   1 
ATOM   2412 C  CB  . GLN B 1 46  ? 53.180 47.565  -7.391  1.00 50.30  ? 87  GLN B CB  1 
ATOM   2413 C  CG  . GLN B 1 46  ? 52.796 46.601  -8.512  1.00 56.65  ? 87  GLN B CG  1 
ATOM   2414 C  CD  . GLN B 1 46  ? 53.816 45.487  -8.723  1.00 64.32  ? 87  GLN B CD  1 
ATOM   2415 O  OE1 . GLN B 1 46  ? 53.566 44.535  -9.473  1.00 67.07  ? 87  GLN B OE1 1 
ATOM   2416 N  NE2 . GLN B 1 46  ? 54.973 45.602  -8.069  1.00 65.29  ? 87  GLN B NE2 1 
ATOM   2417 N  N   . ARG B 1 47  ? 53.107 48.902  -4.392  1.00 45.01  ? 88  ARG B N   1 
ATOM   2418 C  CA  . ARG B 1 47  ? 53.817 49.769  -3.462  1.00 43.09  ? 88  ARG B CA  1 
ATOM   2419 C  C   . ARG B 1 47  ? 54.418 48.951  -2.318  1.00 43.92  ? 88  ARG B C   1 
ATOM   2420 O  O   . ARG B 1 47  ? 55.301 49.421  -1.606  1.00 48.64  ? 88  ARG B O   1 
ATOM   2421 C  CB  . ARG B 1 47  ? 52.884 50.819  -2.879  1.00 42.92  ? 88  ARG B CB  1 
ATOM   2422 C  CG  . ARG B 1 47  ? 52.358 51.842  -3.860  1.00 36.75  ? 88  ARG B CG  1 
ATOM   2423 C  CD  . ARG B 1 47  ? 51.390 52.789  -3.131  1.00 45.15  ? 88  ARG B CD  1 
ATOM   2424 N  NE  . ARG B 1 47  ? 50.204 52.084  -2.644  1.00 49.90  ? 88  ARG B NE  1 
ATOM   2425 C  CZ  . ARG B 1 47  ? 49.235 52.625  -1.902  1.00 51.30  ? 88  ARG B CZ  1 
ATOM   2426 N  NH1 . ARG B 1 47  ? 49.274 53.905  -1.523  1.00 42.38  ? 88  ARG B NH1 1 
ATOM   2427 N  NH2 . ARG B 1 47  ? 48.213 51.868  -1.536  1.00 53.88  ? 88  ARG B NH2 1 
ATOM   2428 N  N   . GLY B 1 48  ? 53.938 47.729  -2.111  1.00 42.61  ? 89  GLY B N   1 
ATOM   2429 C  CA  . GLY B 1 48  ? 54.509 46.946  -1.030  1.00 34.60  ? 89  GLY B CA  1 
ATOM   2430 C  C   . GLY B 1 48  ? 53.662 46.854  0.227   1.00 37.80  ? 89  GLY B C   1 
ATOM   2431 O  O   . GLY B 1 48  ? 54.165 46.426  1.266   1.00 38.76  ? 89  GLY B O   1 
ATOM   2432 N  N   . TYR B 1 49  ? 52.390 47.255  0.176   1.00 34.85  ? 90  TYR B N   1 
ATOM   2433 C  CA  . TYR B 1 49  ? 51.589 47.107  1.387   1.00 41.36  ? 90  TYR B CA  1 
ATOM   2434 C  C   . TYR B 1 49  ? 51.110 45.669  1.501   1.00 40.02  ? 90  TYR B C   1 
ATOM   2435 O  O   . TYR B 1 49  ? 50.743 45.040  0.515   1.00 37.40  ? 90  TYR B O   1 
ATOM   2436 C  CB  . TYR B 1 49  ? 50.406 48.069  1.409   1.00 35.48  ? 90  TYR B CB  1 
ATOM   2437 C  CG  . TYR B 1 49  ? 50.871 49.489  1.646   1.00 45.10  ? 90  TYR B CG  1 
ATOM   2438 C  CD1 . TYR B 1 49  ? 50.980 50.397  0.587   1.00 40.49  ? 90  TYR B CD1 1 
ATOM   2439 C  CD2 . TYR B 1 49  ? 51.235 49.915  2.928   1.00 40.66  ? 90  TYR B CD2 1 
ATOM   2440 C  CE1 . TYR B 1 49  ? 51.430 51.683  0.800   1.00 45.19  ? 90  TYR B CE1 1 
ATOM   2441 C  CE2 . TYR B 1 49  ? 51.692 51.199  3.150   1.00 39.63  ? 90  TYR B CE2 1 
ATOM   2442 C  CZ  . TYR B 1 49  ? 51.783 52.080  2.082   1.00 46.70  ? 90  TYR B CZ  1 
ATOM   2443 O  OH  . TYR B 1 49  ? 52.217 53.366  2.291   1.00 42.86  ? 90  TYR B OH  1 
ATOM   2444 N  N   . ILE B 1 50  ? 51.103 45.183  2.731   1.00 36.76  ? 91  ILE B N   1 
ATOM   2445 C  CA  . ILE B 1 50  ? 50.750 43.822  3.027   1.00 35.58  ? 91  ILE B CA  1 
ATOM   2446 C  C   . ILE B 1 50  ? 49.749 43.696  4.136   1.00 38.46  ? 91  ILE B C   1 
ATOM   2447 O  O   . ILE B 1 50  ? 49.928 44.306  5.188   1.00 34.53  ? 91  ILE B O   1 
ATOM   2448 C  CB  . ILE B 1 50  ? 51.980 43.041  3.501   1.00 36.23  ? 91  ILE B CB  1 
ATOM   2449 C  CG1 . ILE B 1 50  ? 52.977 42.915  2.353   1.00 44.86  ? 91  ILE B CG1 1 
ATOM   2450 C  CG2 . ILE B 1 50  ? 51.552 41.651  4.036   1.00 43.08  ? 91  ILE B CG2 1 
ATOM   2451 C  CD1 . ILE B 1 50  ? 54.307 42.354  2.760   1.00 44.15  ? 91  ILE B CD1 1 
ATOM   2452 N  N   . ILE B 1 51  ? 48.707 42.884  3.926   1.00 37.16  ? 92  ILE B N   1 
ATOM   2453 C  CA  . ILE B 1 51  ? 47.749 42.665  5.011   1.00 36.13  ? 92  ILE B CA  1 
ATOM   2454 C  C   . ILE B 1 51  ? 48.045 41.317  5.692   1.00 32.53  ? 92  ILE B C   1 
ATOM   2455 O  O   . ILE B 1 51  ? 48.432 40.345  5.044   1.00 32.65  ? 92  ILE B O   1 
ATOM   2456 C  CB  . ILE B 1 51  ? 46.276 42.637  4.553   1.00 36.95  ? 92  ILE B CB  1 
ATOM   2457 C  CG1 . ILE B 1 51  ? 45.893 43.951  3.868   1.00 41.50  ? 92  ILE B CG1 1 
ATOM   2458 C  CG2 . ILE B 1 51  ? 45.369 42.451  5.788   1.00 32.99  ? 92  ILE B CG2 1 
ATOM   2459 C  CD1 . ILE B 1 51  ? 44.443 44.039  3.461   1.00 36.99  ? 92  ILE B CD1 1 
ATOM   2460 N  N   . THR B 1 52  ? 47.887 41.292  7.007   1.00 33.76  ? 93  THR B N   1 
ATOM   2461 C  CA  . THR B 1 52  ? 48.071 40.092  7.794   1.00 35.37  ? 93  THR B CA  1 
ATOM   2462 C  C   . THR B 1 52  ? 47.180 40.259  9.006   1.00 37.33  ? 93  THR B C   1 
ATOM   2463 O  O   . THR B 1 52  ? 46.376 41.195  9.045   1.00 36.36  ? 93  THR B O   1 
ATOM   2464 C  CB  . THR B 1 52  ? 49.531 39.910  8.220   1.00 45.26  ? 93  THR B CB  1 
ATOM   2465 O  OG1 . THR B 1 52  ? 49.663 38.648  8.865   1.00 46.58  ? 93  THR B OG1 1 
ATOM   2466 C  CG2 . THR B 1 52  ? 49.970 41.008  9.197   1.00 47.50  ? 93  THR B CG2 1 
ATOM   2467 N  N   . ASN B 1 53  ? 47.311 39.372  9.993   1.00 40.54  ? 94  ASN B N   1 
ATOM   2468 C  CA  . ASN B 1 53  ? 46.485 39.460  11.197  1.00 36.65  ? 94  ASN B CA  1 
ATOM   2469 C  C   . ASN B 1 53  ? 47.180 40.224  12.313  1.00 37.04  ? 94  ASN B C   1 
ATOM   2470 O  O   . ASN B 1 53  ? 48.398 40.128  12.482  1.00 35.05  ? 94  ASN B O   1 
ATOM   2471 C  CB  . ASN B 1 53  ? 46.126 38.054  11.727  1.00 36.70  ? 94  ASN B CB  1 
ATOM   2472 C  CG  . ASN B 1 53  ? 45.199 37.270  10.783  1.00 51.28  ? 94  ASN B CG  1 
ATOM   2473 O  OD1 . ASN B 1 53  ? 45.560 36.187  10.335  1.00 55.32  ? 94  ASN B OD1 1 
ATOM   2474 N  ND2 . ASN B 1 53  ? 44.005 37.812  10.491  1.00 43.53  ? 94  ASN B ND2 1 
ATOM   2475 N  N   . LYS B 1 54  ? 46.398 40.961  13.089  1.00 38.96  ? 95  LYS B N   1 
ATOM   2476 C  CA  . LYS B 1 54  ? 46.947 41.698  14.200  1.00 46.88  ? 95  LYS B CA  1 
ATOM   2477 C  C   . LYS B 1 54  ? 47.628 40.774  15.210  1.00 51.45  ? 95  LYS B C   1 
ATOM   2478 O  O   . LYS B 1 54  ? 48.761 41.036  15.596  1.00 55.77  ? 95  LYS B O   1 
ATOM   2479 C  CB  . LYS B 1 54  ? 45.861 42.504  14.909  1.00 47.30  ? 95  LYS B CB  1 
ATOM   2480 C  CG  . LYS B 1 54  ? 46.399 43.322  16.083  1.00 42.15  ? 95  LYS B CG  1 
ATOM   2481 C  CD  . LYS B 1 54  ? 45.312 44.131  16.741  1.00 46.31  ? 95  LYS B CD  1 
ATOM   2482 C  CE  . LYS B 1 54  ? 45.866 44.956  17.911  1.00 57.79  ? 95  LYS B CE  1 
ATOM   2483 N  NZ  . LYS B 1 54  ? 46.408 44.106  19.014  1.00 59.13  ? 95  LYS B NZ  1 
ATOM   2484 N  N   . HIS B 1 55  ? 46.950 39.698  15.627  1.00 60.60  ? 96  HIS B N   1 
ATOM   2485 C  CA  . HIS B 1 55  ? 47.515 38.753  16.613  1.00 60.47  ? 96  HIS B CA  1 
ATOM   2486 C  C   . HIS B 1 55  ? 48.843 38.149  16.179  1.00 61.39  ? 96  HIS B C   1 
ATOM   2487 O  O   . HIS B 1 55  ? 49.610 37.657  17.001  1.00 65.98  ? 96  HIS B O   1 
ATOM   2488 C  CB  . HIS B 1 55  ? 46.539 37.613  16.932  1.00 63.01  ? 96  HIS B CB  1 
ATOM   2489 C  CG  . HIS B 1 55  ? 46.380 36.606  15.831  1.00 65.41  ? 96  HIS B CG  1 
ATOM   2490 N  ND1 . HIS B 1 55  ? 45.320 36.626  14.949  1.00 70.61  ? 96  HIS B ND1 1 
ATOM   2491 C  CD2 . HIS B 1 55  ? 47.149 35.551  15.466  1.00 72.57  ? 96  HIS B CD2 1 
ATOM   2492 C  CE1 . HIS B 1 55  ? 45.444 35.631  14.086  1.00 73.48  ? 96  HIS B CE1 1 
ATOM   2493 N  NE2 . HIS B 1 55  ? 46.546 34.964  14.376  1.00 71.90  ? 96  HIS B NE2 1 
ATOM   2494 N  N   . VAL B 1 56  ? 49.119 38.182  14.887  1.00 60.23  ? 97  VAL B N   1 
ATOM   2495 C  CA  . VAL B 1 56  ? 50.375 37.648  14.397  1.00 61.44  ? 97  VAL B CA  1 
ATOM   2496 C  C   . VAL B 1 56  ? 51.533 38.613  14.623  1.00 60.48  ? 97  VAL B C   1 
ATOM   2497 O  O   . VAL B 1 56  ? 52.650 38.182  14.883  1.00 67.05  ? 97  VAL B O   1 
ATOM   2498 C  CB  . VAL B 1 56  ? 50.307 37.332  12.887  1.00 61.38  ? 97  VAL B CB  1 
ATOM   2499 C  CG1 . VAL B 1 56  ? 51.684 36.925  12.375  1.00 59.77  ? 97  VAL B CG1 1 
ATOM   2500 C  CG2 . VAL B 1 56  ? 49.317 36.223  12.642  1.00 64.44  ? 97  VAL B CG2 1 
ATOM   2501 N  N   . ILE B 1 57  ? 51.281 39.915  14.533  1.00 56.80  ? 98  ILE B N   1 
ATOM   2502 C  CA  . ILE B 1 57  ? 52.373 40.869  14.697  1.00 56.13  ? 98  ILE B CA  1 
ATOM   2503 C  C   . ILE B 1 57  ? 52.429 41.576  16.061  1.00 59.32  ? 98  ILE B C   1 
ATOM   2504 O  O   . ILE B 1 57  ? 53.332 42.377  16.312  1.00 59.37  ? 98  ILE B O   1 
ATOM   2505 C  CB  . ILE B 1 57  ? 52.379 41.924  13.518  1.00 50.40  ? 98  ILE B CB  1 
ATOM   2506 C  CG1 . ILE B 1 57  ? 50.998 42.573  13.330  1.00 35.52  ? 98  ILE B CG1 1 
ATOM   2507 C  CG2 . ILE B 1 57  ? 52.771 41.242  12.224  1.00 40.79  ? 98  ILE B CG2 1 
ATOM   2508 C  CD1 . ILE B 1 57  ? 50.523 43.434  14.504  1.00 32.69  ? 98  ILE B CD1 1 
ATOM   2509 N  N   . ASN B 1 58  ? 51.473 41.273  16.937  1.00 59.10  ? 99  ASN B N   1 
ATOM   2510 C  CA  . ASN B 1 58  ? 51.432 41.869  18.269  1.00 68.98  ? 99  ASN B CA  1 
ATOM   2511 C  C   . ASN B 1 58  ? 52.741 41.716  19.070  1.00 75.10  ? 99  ASN B C   1 
ATOM   2512 O  O   . ASN B 1 58  ? 53.326 40.628  19.138  1.00 70.80  ? 99  ASN B O   1 
ATOM   2513 C  CB  . ASN B 1 58  ? 50.294 41.259  19.091  1.00 72.30  ? 99  ASN B CB  1 
ATOM   2514 C  CG  . ASN B 1 58  ? 48.979 41.996  18.919  1.00 76.07  ? 99  ASN B CG  1 
ATOM   2515 O  OD1 . ASN B 1 58  ? 48.937 43.228  18.911  1.00 75.68  ? 99  ASN B OD1 1 
ATOM   2516 N  ND2 . ASN B 1 58  ? 47.889 41.240  18.806  1.00 80.92  ? 99  ASN B ND2 1 
ATOM   2517 N  N   . ASP B 1 59  ? 53.182 42.812  19.686  1.00 79.88  ? 100 ASP B N   1 
ATOM   2518 C  CA  . ASP B 1 59  ? 54.398 42.818  20.498  1.00 87.05  ? 100 ASP B CA  1 
ATOM   2519 C  C   . ASP B 1 59  ? 55.657 42.434  19.722  1.00 89.15  ? 100 ASP B C   1 
ATOM   2520 O  O   . ASP B 1 59  ? 56.605 41.913  20.305  1.00 91.08  ? 100 ASP B O   1 
ATOM   2521 C  CB  . ASP B 1 59  ? 54.247 41.855  21.687  1.00 90.31  ? 100 ASP B CB  1 
ATOM   2522 C  CG  . ASP B 1 59  ? 53.072 42.206  22.586  1.00 94.55  ? 100 ASP B CG  1 
ATOM   2523 O  OD1 . ASP B 1 59  ? 52.951 43.384  22.980  1.00 96.18  ? 100 ASP B OD1 1 
ATOM   2524 O  OD2 . ASP B 1 59  ? 52.276 41.296  22.909  1.00 97.12  ? 100 ASP B OD2 1 
ATOM   2525 N  N   . ALA B 1 60  ? 55.669 42.692  18.417  1.00 92.24  ? 101 ALA B N   1 
ATOM   2526 C  CA  . ALA B 1 60  ? 56.817 42.351  17.573  1.00 92.99  ? 101 ALA B CA  1 
ATOM   2527 C  C   . ALA B 1 60  ? 57.958 43.355  17.684  1.00 93.31  ? 101 ALA B C   1 
ATOM   2528 O  O   . ALA B 1 60  ? 57.757 44.560  17.523  1.00 95.54  ? 101 ALA B O   1 
ATOM   2529 C  CB  . ALA B 1 60  ? 56.376 42.232  16.112  1.00 92.75  ? 101 ALA B CB  1 
ATOM   2530 N  N   . ASP B 1 61  ? 59.159 42.852  17.952  1.00 91.45  ? 102 ASP B N   1 
ATOM   2531 C  CA  . ASP B 1 61  ? 60.335 43.705  18.074  1.00 89.74  ? 102 ASP B CA  1 
ATOM   2532 C  C   . ASP B 1 61  ? 60.896 43.924  16.670  1.00 85.91  ? 102 ASP B C   1 
ATOM   2533 O  O   . ASP B 1 61  ? 61.615 44.891  16.413  1.00 87.39  ? 102 ASP B O   1 
ATOM   2534 C  CB  . ASP B 1 61  ? 61.381 43.038  18.981  1.00 93.14  ? 102 ASP B CB  1 
ATOM   2535 C  CG  . ASP B 1 61  ? 60.823 42.676  20.358  1.00 96.62  ? 102 ASP B CG  1 
ATOM   2536 O  OD1 . ASP B 1 61  ? 60.425 43.598  21.108  1.00 98.24  ? 102 ASP B OD1 1 
ATOM   2537 O  OD2 . ASP B 1 61  ? 60.779 41.467  20.689  1.00 96.16  ? 102 ASP B OD2 1 
ATOM   2538 N  N   . GLN B 1 62  ? 60.560 43.006  15.768  1.00 80.37  ? 103 GLN B N   1 
ATOM   2539 C  CA  . GLN B 1 62  ? 60.987 43.080  14.374  1.00 72.69  ? 103 GLN B CA  1 
ATOM   2540 C  C   . GLN B 1 62  ? 60.143 42.133  13.539  1.00 67.18  ? 103 GLN B C   1 
ATOM   2541 O  O   . GLN B 1 62  ? 60.051 40.939  13.831  1.00 62.16  ? 103 GLN B O   1 
ATOM   2542 C  CB  . GLN B 1 62  ? 62.461 42.703  14.206  1.00 74.98  ? 103 GLN B CB  1 
ATOM   2543 C  CG  . GLN B 1 62  ? 62.913 42.743  12.742  1.00 82.98  ? 103 GLN B CG  1 
ATOM   2544 C  CD  . GLN B 1 62  ? 64.358 42.296  12.535  1.00 89.10  ? 103 GLN B CD  1 
ATOM   2545 O  OE1 . GLN B 1 62  ? 64.703 41.134  12.771  1.00 86.00  ? 103 GLN B OE1 1 
ATOM   2546 N  NE2 . GLN B 1 62  ? 65.208 43.223  12.087  1.00 88.54  ? 103 GLN B NE2 1 
ATOM   2547 N  N   . ILE B 1 63  ? 59.543 42.672  12.486  1.00 63.55  ? 104 ILE B N   1 
ATOM   2548 C  CA  . ILE B 1 63  ? 58.696 41.886  11.609  1.00 55.42  ? 104 ILE B CA  1 
ATOM   2549 C  C   . ILE B 1 63  ? 59.404 41.615  10.296  1.00 53.60  ? 104 ILE B C   1 
ATOM   2550 O  O   . ILE B 1 63  ? 59.890 42.532  9.643   1.00 56.48  ? 104 ILE B O   1 
ATOM   2551 C  CB  . ILE B 1 63  ? 57.372 42.630  11.349  1.00 57.44  ? 104 ILE B CB  1 
ATOM   2552 C  CG1 . ILE B 1 63  ? 56.706 42.966  12.695  1.00 59.64  ? 104 ILE B CG1 1 
ATOM   2553 C  CG2 . ILE B 1 63  ? 56.440 41.765  10.506  1.00 57.95  ? 104 ILE B CG2 1 
ATOM   2554 C  CD1 . ILE B 1 63  ? 55.504 43.896  12.598  1.00 57.21  ? 104 ILE B CD1 1 
ATOM   2555 N  N   . ILE B 1 64  ? 59.503 40.346  9.920   1.00 51.08  ? 105 ILE B N   1 
ATOM   2556 C  CA  . ILE B 1 64  ? 60.134 40.005  8.656   1.00 50.79  ? 105 ILE B CA  1 
ATOM   2557 C  C   . ILE B 1 64  ? 59.116 39.263  7.805   1.00 52.58  ? 105 ILE B C   1 
ATOM   2558 O  O   . ILE B 1 64  ? 58.271 38.524  8.318   1.00 47.28  ? 105 ILE B O   1 
ATOM   2559 C  CB  . ILE B 1 64  ? 61.380 39.123  8.835   1.00 60.21  ? 105 ILE B CB  1 
ATOM   2560 C  CG1 . ILE B 1 64  ? 61.821 38.582  7.474   1.00 54.55  ? 105 ILE B CG1 1 
ATOM   2561 C  CG2 . ILE B 1 64  ? 61.086 37.981  9.779   1.00 64.55  ? 105 ILE B CG2 1 
ATOM   2562 C  CD1 . ILE B 1 64  ? 63.057 37.723  7.548   1.00 72.46  ? 105 ILE B CD1 1 
ATOM   2563 N  N   . VAL B 1 65  ? 59.227 39.461  6.500   1.00 45.42  ? 106 VAL B N   1 
ATOM   2564 C  CA  . VAL B 1 65  ? 58.316 38.891  5.543   1.00 47.57  ? 106 VAL B CA  1 
ATOM   2565 C  C   . VAL B 1 65  ? 59.125 38.140  4.512   1.00 48.45  ? 106 VAL B C   1 
ATOM   2566 O  O   . VAL B 1 65  ? 60.130 38.649  4.030   1.00 47.06  ? 106 VAL B O   1 
ATOM   2567 C  CB  . VAL B 1 65  ? 57.498 40.037  4.881   1.00 47.24  ? 106 VAL B CB  1 
ATOM   2568 C  CG1 . VAL B 1 65  ? 57.099 39.681  3.477   1.00 43.62  ? 106 VAL B CG1 1 
ATOM   2569 C  CG2 . VAL B 1 65  ? 56.289 40.334  5.723   1.00 46.60  ? 106 VAL B CG2 1 
ATOM   2570 N  N   . ALA B 1 66  ? 58.678 36.933  4.171   1.00 49.25  ? 107 ALA B N   1 
ATOM   2571 C  CA  . ALA B 1 66  ? 59.383 36.097  3.193   1.00 51.03  ? 107 ALA B CA  1 
ATOM   2572 C  C   . ALA B 1 66  ? 58.443 35.706  2.068   1.00 51.18  ? 107 ALA B C   1 
ATOM   2573 O  O   . ALA B 1 66  ? 57.362 35.153  2.315   1.00 57.11  ? 107 ALA B O   1 
ATOM   2574 C  CB  . ALA B 1 66  ? 59.927 34.829  3.888   1.00 52.27  ? 107 ALA B CB  1 
ATOM   2575 N  N   . LEU B 1 67  ? 58.849 35.984  0.838   1.00 48.47  ? 108 LEU B N   1 
ATOM   2576 C  CA  . LEU B 1 67  ? 58.030 35.659  -0.308  1.00 50.55  ? 108 LEU B CA  1 
ATOM   2577 C  C   . LEU B 1 67  ? 58.337 34.269  -0.794  1.00 58.32  ? 108 LEU B C   1 
ATOM   2578 O  O   . LEU B 1 67  ? 59.400 33.714  -0.502  1.00 63.31  ? 108 LEU B O   1 
ATOM   2579 C  CB  . LEU B 1 67  ? 58.279 36.615  -1.462  1.00 48.99  ? 108 LEU B CB  1 
ATOM   2580 C  CG  . LEU B 1 67  ? 58.307 38.127  -1.272  1.00 50.91  ? 108 LEU B CG  1 
ATOM   2581 C  CD1 . LEU B 1 67  ? 57.709 38.728  -2.527  1.00 40.91  ? 108 LEU B CD1 1 
ATOM   2582 C  CD2 . LEU B 1 67  ? 57.561 38.581  -0.032  1.00 42.89  ? 108 LEU B CD2 1 
ATOM   2583 N  N   . GLN B 1 68  ? 57.410 33.724  -1.569  1.00 60.96  ? 109 GLN B N   1 
ATOM   2584 C  CA  . GLN B 1 68  ? 57.555 32.390  -2.124  1.00 66.19  ? 109 GLN B CA  1 
ATOM   2585 C  C   . GLN B 1 68  ? 58.780 32.299  -3.037  1.00 65.76  ? 109 GLN B C   1 
ATOM   2586 O  O   . GLN B 1 68  ? 59.503 31.308  -3.000  1.00 66.04  ? 109 GLN B O   1 
ATOM   2587 C  CB  . GLN B 1 68  ? 56.290 32.017  -2.910  1.00 72.25  ? 109 GLN B CB  1 
ATOM   2588 C  CG  . GLN B 1 68  ? 56.155 30.541  -3.252  1.00 79.15  ? 109 GLN B CG  1 
ATOM   2589 C  CD  . GLN B 1 68  ? 55.880 29.678  -2.029  1.00 81.29  ? 109 GLN B CD  1 
ATOM   2590 O  OE1 . GLN B 1 68  ? 55.722 28.456  -2.135  1.00 81.80  ? 109 GLN B OE1 1 
ATOM   2591 N  NE2 . GLN B 1 68  ? 55.820 30.311  -0.861  1.00 79.18  ? 109 GLN B NE2 1 
ATOM   2592 N  N   . ASP B 1 69  ? 59.022 33.324  -3.855  1.00 64.37  ? 110 ASP B N   1 
ATOM   2593 C  CA  . ASP B 1 69  ? 60.172 33.281  -4.757  1.00 63.93  ? 110 ASP B CA  1 
ATOM   2594 C  C   . ASP B 1 69  ? 61.514 33.401  -4.040  1.00 65.06  ? 110 ASP B C   1 
ATOM   2595 O  O   . ASP B 1 69  ? 62.535 33.607  -4.684  1.00 67.83  ? 110 ASP B O   1 
ATOM   2596 C  CB  . ASP B 1 69  ? 60.085 34.361  -5.853  1.00 61.49  ? 110 ASP B CB  1 
ATOM   2597 C  CG  . ASP B 1 69  ? 60.154 35.797  -5.307  1.00 63.04  ? 110 ASP B CG  1 
ATOM   2598 O  OD1 . ASP B 1 69  ? 60.574 36.005  -4.142  1.00 55.20  ? 110 ASP B OD1 1 
ATOM   2599 O  OD2 . ASP B 1 69  ? 59.793 36.729  -6.067  1.00 59.30  ? 110 ASP B OD2 1 
ATOM   2600 N  N   . GLY B 1 70  ? 61.510 33.277  -2.715  1.00 61.70  ? 111 GLY B N   1 
ATOM   2601 C  CA  . GLY B 1 70  ? 62.750 33.370  -1.968  1.00 60.84  ? 111 GLY B CA  1 
ATOM   2602 C  C   . GLY B 1 70  ? 63.031 34.709  -1.295  1.00 62.01  ? 111 GLY B C   1 
ATOM   2603 O  O   . GLY B 1 70  ? 63.423 34.739  -0.122  1.00 65.00  ? 111 GLY B O   1 
ATOM   2604 N  N   . ARG B 1 71  ? 62.843 35.813  -2.018  1.00 55.32  ? 112 ARG B N   1 
ATOM   2605 C  CA  . ARG B 1 71  ? 63.094 37.140  -1.455  1.00 52.44  ? 112 ARG B CA  1 
ATOM   2606 C  C   . ARG B 1 71  ? 62.618 37.266  -0.017  1.00 53.52  ? 112 ARG B C   1 
ATOM   2607 O  O   . ARG B 1 71  ? 61.578 36.723  0.358   1.00 57.49  ? 112 ARG B O   1 
ATOM   2608 C  CB  . ARG B 1 71  ? 62.414 38.222  -2.288  1.00 54.45  ? 112 ARG B CB  1 
ATOM   2609 C  CG  . ARG B 1 71  ? 62.974 38.403  -3.672  1.00 56.49  ? 112 ARG B CG  1 
ATOM   2610 C  CD  . ARG B 1 71  ? 62.285 39.570  -4.350  1.00 62.65  ? 112 ARG B CD  1 
ATOM   2611 N  NE  . ARG B 1 71  ? 61.137 39.153  -5.151  1.00 61.90  ? 112 ARG B NE  1 
ATOM   2612 C  CZ  . ARG B 1 71  ? 60.364 39.994  -5.823  1.00 58.22  ? 112 ARG B CZ  1 
ATOM   2613 N  NH1 . ARG B 1 71  ? 60.608 41.301  -5.778  1.00 59.39  ? 112 ARG B NH1 1 
ATOM   2614 N  NH2 . ARG B 1 71  ? 59.377 39.528  -6.573  1.00 55.37  ? 112 ARG B NH2 1 
ATOM   2615 N  N   . VAL B 1 72  ? 63.382 38.001  0.778   1.00 53.83  ? 113 VAL B N   1 
ATOM   2616 C  CA  . VAL B 1 72  ? 63.076 38.225  2.184   1.00 55.20  ? 113 VAL B CA  1 
ATOM   2617 C  C   . VAL B 1 72  ? 63.221 39.718  2.525   1.00 57.89  ? 113 VAL B C   1 
ATOM   2618 O  O   . VAL B 1 72  ? 64.212 40.346  2.154   1.00 56.62  ? 113 VAL B O   1 
ATOM   2619 C  CB  . VAL B 1 72  ? 64.016 37.394  3.046   1.00 57.12  ? 113 VAL B CB  1 
ATOM   2620 C  CG1 . VAL B 1 72  ? 63.747 37.641  4.523   1.00 54.83  ? 113 VAL B CG1 1 
ATOM   2621 C  CG2 . VAL B 1 72  ? 63.832 35.922  2.698   1.00 59.92  ? 113 VAL B CG2 1 
ATOM   2622 N  N   . PHE B 1 73  ? 62.228 40.282  3.215   1.00 59.03  ? 114 PHE B N   1 
ATOM   2623 C  CA  . PHE B 1 73  ? 62.239 41.705  3.576   1.00 54.14  ? 114 PHE B CA  1 
ATOM   2624 C  C   . PHE B 1 73  ? 61.909 41.989  5.020   1.00 55.40  ? 114 PHE B C   1 
ATOM   2625 O  O   . PHE B 1 73  ? 61.180 41.229  5.651   1.00 56.83  ? 114 PHE B O   1 
ATOM   2626 C  CB  . PHE B 1 73  ? 61.207 42.489  2.785   1.00 47.11  ? 114 PHE B CB  1 
ATOM   2627 C  CG  . PHE B 1 73  ? 61.353 42.392  1.314   1.00 47.63  ? 114 PHE B CG  1 
ATOM   2628 C  CD1 . PHE B 1 73  ? 60.685 41.406  0.606   1.00 41.89  ? 114 PHE B CD1 1 
ATOM   2629 C  CD2 . PHE B 1 73  ? 62.099 43.337  0.616   1.00 47.05  ? 114 PHE B CD2 1 
ATOM   2630 C  CE1 . PHE B 1 73  ? 60.745 41.367  -0.784  1.00 41.14  ? 114 PHE B CE1 1 
ATOM   2631 C  CE2 . PHE B 1 73  ? 62.163 43.301  -0.779  1.00 49.72  ? 114 PHE B CE2 1 
ATOM   2632 C  CZ  . PHE B 1 73  ? 61.482 42.316  -1.476  1.00 41.52  ? 114 PHE B CZ  1 
ATOM   2633 N  N   . GLU B 1 74  ? 62.421 43.107  5.533   1.00 55.32  ? 115 GLU B N   1 
ATOM   2634 C  CA  . GLU B 1 74  ? 62.097 43.502  6.893   1.00 56.91  ? 115 GLU B CA  1 
ATOM   2635 C  C   . GLU B 1 74  ? 60.888 44.390  6.634   1.00 56.19  ? 115 GLU B C   1 
ATOM   2636 O  O   . GLU B 1 74  ? 60.828 45.051  5.591   1.00 53.21  ? 115 GLU B O   1 
ATOM   2637 C  CB  . GLU B 1 74  ? 63.207 44.321  7.553   1.00 63.01  ? 115 GLU B CB  1 
ATOM   2638 C  CG  . GLU B 1 74  ? 63.096 44.301  9.081   1.00 72.47  ? 115 GLU B CG  1 
ATOM   2639 C  CD  . GLU B 1 74  ? 63.668 45.535  9.758   1.00 81.50  ? 115 GLU B CD  1 
ATOM   2640 O  OE1 . GLU B 1 74  ? 63.686 45.558  11.010  1.00 81.46  ? 115 GLU B OE1 1 
ATOM   2641 O  OE2 . GLU B 1 74  ? 64.086 46.481  9.049   1.00 85.31  ? 115 GLU B OE2 1 
ATOM   2642 N  N   . ALA B 1 75  ? 59.952 44.436  7.579   1.00 52.16  ? 116 ALA B N   1 
ATOM   2643 C  CA  . ALA B 1 75  ? 58.726 45.191  7.365   1.00 52.35  ? 116 ALA B CA  1 
ATOM   2644 C  C   . ALA B 1 75  ? 58.385 46.210  8.409   1.00 52.22  ? 116 ALA B C   1 
ATOM   2645 O  O   . ALA B 1 75  ? 58.704 46.057  9.588   1.00 48.86  ? 116 ALA B O   1 
ATOM   2646 C  CB  . ALA B 1 75  ? 57.544 44.225  7.214   1.00 45.11  ? 116 ALA B CB  1 
ATOM   2647 N  N   . LEU B 1 76  ? 57.701 47.250  7.949   1.00 48.83  ? 117 LEU B N   1 
ATOM   2648 C  CA  . LEU B 1 76  ? 57.258 48.315  8.827   1.00 50.36  ? 117 LEU B CA  1 
ATOM   2649 C  C   . LEU B 1 76  ? 55.783 48.077  9.150   1.00 44.28  ? 117 LEU B C   1 
ATOM   2650 O  O   . LEU B 1 76  ? 54.986 47.817  8.251   1.00 45.93  ? 117 LEU B O   1 
ATOM   2651 C  CB  . LEU B 1 76  ? 57.436 49.673  8.126   1.00 48.86  ? 117 LEU B CB  1 
ATOM   2652 C  CG  . LEU B 1 76  ? 56.695 50.862  8.753   1.00 53.44  ? 117 LEU B CG  1 
ATOM   2653 C  CD1 . LEU B 1 76  ? 57.347 51.240  10.087  1.00 50.08  ? 117 LEU B CD1 1 
ATOM   2654 C  CD2 . LEU B 1 76  ? 56.719 52.044  7.790   1.00 50.61  ? 117 LEU B CD2 1 
ATOM   2655 N  N   . LEU B 1 77  ? 55.448 48.147  10.435  1.00 44.17  ? 118 LEU B N   1 
ATOM   2656 C  CA  . LEU B 1 77  ? 54.088 47.995  10.933  1.00 43.00  ? 118 LEU B CA  1 
ATOM   2657 C  C   . LEU B 1 77  ? 53.409 49.340  10.723  1.00 45.52  ? 118 LEU B C   1 
ATOM   2658 O  O   . LEU B 1 77  ? 53.750 50.300  11.429  1.00 46.58  ? 118 LEU B O   1 
ATOM   2659 C  CB  . LEU B 1 77  ? 54.092 47.752  12.438  1.00 41.78  ? 118 LEU B CB  1 
ATOM   2660 C  CG  . LEU B 1 77  ? 53.044 46.807  13.037  1.00 57.88  ? 118 LEU B CG  1 
ATOM   2661 C  CD1 . LEU B 1 77  ? 52.864 47.143  14.528  1.00 54.04  ? 118 LEU B CD1 1 
ATOM   2662 C  CD2 . LEU B 1 77  ? 51.717 46.912  12.296  1.00 42.27  ? 118 LEU B CD2 1 
ATOM   2663 N  N   . VAL B 1 78  ? 52.444 49.441  9.810   1.00 36.17  ? 119 VAL B N   1 
ATOM   2664 C  CA  . VAL B 1 78  ? 51.851 50.735  9.654   1.00 35.79  ? 119 VAL B CA  1 
ATOM   2665 C  C   . VAL B 1 78  ? 50.710 50.938  10.577  1.00 35.83  ? 119 VAL B C   1 
ATOM   2666 O  O   . VAL B 1 78  ? 50.363 52.083  10.881  1.00 38.49  ? 119 VAL B O   1 
ATOM   2667 C  CB  . VAL B 1 78  ? 51.484 51.086  8.172   1.00 38.32  ? 119 VAL B CB  1 
ATOM   2668 C  CG1 . VAL B 1 78  ? 52.056 50.080  7.238   1.00 32.38  ? 119 VAL B CG1 1 
ATOM   2669 C  CG2 . VAL B 1 78  ? 50.020 51.328  8.011   1.00 34.38  ? 119 VAL B CG2 1 
ATOM   2670 N  N   . GLY B 1 79  ? 50.152 49.839  11.072  1.00 39.20  ? 120 GLY B N   1 
ATOM   2671 C  CA  . GLY B 1 79  ? 49.038 49.927  12.018  1.00 39.79  ? 120 GLY B CA  1 
ATOM   2672 C  C   . GLY B 1 79  ? 48.223 48.639  12.144  1.00 40.76  ? 120 GLY B C   1 
ATOM   2673 O  O   . GLY B 1 79  ? 48.486 47.656  11.442  1.00 37.73  ? 120 GLY B O   1 
ATOM   2674 N  N   . SER B 1 80  ? 47.237 48.631  13.036  1.00 39.95  ? 121 SER B N   1 
ATOM   2675 C  CA  . SER B 1 80  ? 46.394 47.453  13.186  1.00 39.70  ? 121 SER B CA  1 
ATOM   2676 C  C   . SER B 1 80  ? 45.004 47.814  13.668  1.00 37.87  ? 121 SER B C   1 
ATOM   2677 O  O   . SER B 1 80  ? 44.745 48.949  14.068  1.00 36.88  ? 121 SER B O   1 
ATOM   2678 C  CB  . SER B 1 80  ? 47.042 46.439  14.133  1.00 37.57  ? 121 SER B CB  1 
ATOM   2679 O  OG  . SER B 1 80  ? 47.048 46.927  15.456  1.00 47.85  ? 121 SER B OG  1 
ATOM   2680 N  N   . ASP B 1 81  ? 44.103 46.837  13.611  1.00 38.23  ? 122 ASP B N   1 
ATOM   2681 C  CA  . ASP B 1 81  ? 42.730 47.025  14.036  1.00 36.38  ? 122 ASP B CA  1 
ATOM   2682 C  C   . ASP B 1 81  ? 42.194 45.767  14.763  1.00 43.64  ? 122 ASP B C   1 
ATOM   2683 O  O   . ASP B 1 81  ? 41.968 44.724  14.149  1.00 40.56  ? 122 ASP B O   1 
ATOM   2684 C  CB  . ASP B 1 81  ? 41.893 47.323  12.803  1.00 40.60  ? 122 ASP B CB  1 
ATOM   2685 C  CG  . ASP B 1 81  ? 40.455 47.538  13.124  1.00 43.04  ? 122 ASP B CG  1 
ATOM   2686 O  OD1 . ASP B 1 81  ? 40.153 48.441  13.930  1.00 52.76  ? 122 ASP B OD1 1 
ATOM   2687 O  OD2 . ASP B 1 81  ? 39.615 46.809  12.563  1.00 52.68  ? 122 ASP B OD2 1 
ATOM   2688 N  N   . SER B 1 82  ? 41.994 45.878  16.071  1.00 44.79  ? 123 SER B N   1 
ATOM   2689 C  CA  . SER B 1 82  ? 41.495 44.766  16.901  1.00 48.70  ? 123 SER B CA  1 
ATOM   2690 C  C   . SER B 1 82  ? 40.139 44.235  16.452  1.00 42.97  ? 123 SER B C   1 
ATOM   2691 O  O   . SER B 1 82  ? 39.910 43.024  16.370  1.00 44.07  ? 123 SER B O   1 
ATOM   2692 C  CB  . SER B 1 82  ? 41.360 45.219  18.362  1.00 48.45  ? 123 SER B CB  1 
ATOM   2693 O  OG  . SER B 1 82  ? 42.622 45.572  18.882  1.00 62.68  ? 123 SER B OG  1 
ATOM   2694 N  N   . LEU B 1 83  ? 39.234 45.161  16.183  1.00 36.19  ? 124 LEU B N   1 
ATOM   2695 C  CA  . LEU B 1 83  ? 37.914 44.796  15.755  1.00 41.30  ? 124 LEU B CA  1 
ATOM   2696 C  C   . LEU B 1 83  ? 37.842 43.792  14.589  1.00 44.18  ? 124 LEU B C   1 
ATOM   2697 O  O   . LEU B 1 83  ? 36.971 42.916  14.585  1.00 49.63  ? 124 LEU B O   1 
ATOM   2698 C  CB  . LEU B 1 83  ? 37.150 46.046  15.400  1.00 40.45  ? 124 LEU B CB  1 
ATOM   2699 C  CG  . LEU B 1 83  ? 35.709 45.739  15.734  1.00 57.96  ? 124 LEU B CG  1 
ATOM   2700 C  CD1 . LEU B 1 83  ? 35.512 45.921  17.249  1.00 58.95  ? 124 LEU B CD1 1 
ATOM   2701 C  CD2 . LEU B 1 83  ? 34.797 46.628  14.929  1.00 61.78  ? 124 LEU B CD2 1 
ATOM   2702 N  N   . THR B 1 84  ? 38.746 43.911  13.614  1.00 38.58  ? 125 THR B N   1 
ATOM   2703 C  CA  . THR B 1 84  ? 38.767 43.017  12.450  1.00 34.03  ? 125 THR B CA  1 
ATOM   2704 C  C   . THR B 1 84  ? 39.960 42.097  12.474  1.00 36.02  ? 125 THR B C   1 
ATOM   2705 O  O   . THR B 1 84  ? 40.167 41.305  11.546  1.00 37.13  ? 125 THR B O   1 
ATOM   2706 C  CB  . THR B 1 84  ? 38.854 43.811  11.114  1.00 33.82  ? 125 THR B CB  1 
ATOM   2707 O  OG1 . THR B 1 84  ? 39.995 44.686  11.153  1.00 37.22  ? 125 THR B OG1 1 
ATOM   2708 C  CG2 . THR B 1 84  ? 37.600 44.619  10.874  1.00 34.89  ? 125 THR B CG2 1 
ATOM   2709 N  N   . ASP B 1 85  ? 40.761 42.213  13.529  1.00 35.79  ? 126 ASP B N   1 
ATOM   2710 C  CA  . ASP B 1 85  ? 41.987 41.435  13.666  1.00 35.08  ? 126 ASP B CA  1 
ATOM   2711 C  C   . ASP B 1 85  ? 42.910 41.621  12.445  1.00 40.04  ? 126 ASP B C   1 
ATOM   2712 O  O   . ASP B 1 85  ? 43.610 40.686  12.016  1.00 45.25  ? 126 ASP B O   1 
ATOM   2713 C  CB  . ASP B 1 85  ? 41.677 39.958  13.882  1.00 39.30  ? 126 ASP B CB  1 
ATOM   2714 C  CG  . ASP B 1 85  ? 42.935 39.130  14.216  1.00 50.00  ? 126 ASP B CG  1 
ATOM   2715 O  OD1 . ASP B 1 85  ? 43.867 39.680  14.843  1.00 54.58  ? 126 ASP B OD1 1 
ATOM   2716 O  OD2 . ASP B 1 85  ? 42.993 37.929  13.860  1.00 53.64  ? 126 ASP B OD2 1 
ATOM   2717 N  N   . LEU B 1 86  ? 42.929 42.826  11.874  1.00 31.76  ? 127 LEU B N   1 
ATOM   2718 C  CA  . LEU B 1 86  ? 43.820 43.054  10.738  1.00 35.23  ? 127 LEU B CA  1 
ATOM   2719 C  C   . LEU B 1 86  ? 44.955 43.987  11.114  1.00 36.18  ? 127 LEU B C   1 
ATOM   2720 O  O   . LEU B 1 86  ? 44.822 44.801  12.019  1.00 37.22  ? 127 LEU B O   1 
ATOM   2721 C  CB  . LEU B 1 86  ? 43.072 43.687  9.558   1.00 38.04  ? 127 LEU B CB  1 
ATOM   2722 C  CG  . LEU B 1 86  ? 42.012 42.844  8.855   1.00 46.09  ? 127 LEU B CG  1 
ATOM   2723 C  CD1 . LEU B 1 86  ? 41.375 43.664  7.748   1.00 34.36  ? 127 LEU B CD1 1 
ATOM   2724 C  CD2 . LEU B 1 86  ? 42.646 41.554  8.305   1.00 37.62  ? 127 LEU B CD2 1 
ATOM   2725 N  N   . ALA B 1 87  ? 46.054 43.874  10.377  1.00 38.57  ? 128 ALA B N   1 
ATOM   2726 C  CA  . ALA B 1 87  ? 47.218 44.743  10.519  1.00 34.76  ? 128 ALA B CA  1 
ATOM   2727 C  C   . ALA B 1 87  ? 47.766 44.927  9.098   1.00 38.80  ? 128 ALA B C   1 
ATOM   2728 O  O   . ALA B 1 87  ? 47.514 44.097  8.205   1.00 36.85  ? 128 ALA B O   1 
ATOM   2729 C  CB  . ALA B 1 87  ? 48.308 44.093  11.426  1.00 35.96  ? 128 ALA B CB  1 
ATOM   2730 N  N   . VAL B 1 88  ? 48.522 46.006  8.899   1.00 36.47  ? 129 VAL B N   1 
ATOM   2731 C  CA  . VAL B 1 88  ? 49.131 46.308  7.623   1.00 31.81  ? 129 VAL B CA  1 
ATOM   2732 C  C   . VAL B 1 88  ? 50.644 46.462  7.813   1.00 36.71  ? 129 VAL B C   1 
ATOM   2733 O  O   . VAL B 1 88  ? 51.124 47.071  8.782   1.00 35.02  ? 129 VAL B O   1 
ATOM   2734 C  CB  . VAL B 1 88  ? 48.521 47.602  7.022   1.00 40.21  ? 129 VAL B CB  1 
ATOM   2735 C  CG1 . VAL B 1 88  ? 49.281 48.021  5.768   1.00 36.93  ? 129 VAL B CG1 1 
ATOM   2736 C  CG2 . VAL B 1 88  ? 47.051 47.363  6.691   1.00 36.01  ? 129 VAL B CG2 1 
ATOM   2737 N  N   . LEU B 1 89  ? 51.393 45.871  6.898   1.00 34.01  ? 130 LEU B N   1 
ATOM   2738 C  CA  . LEU B 1 89  ? 52.836 45.934  6.930   1.00 37.13  ? 130 LEU B CA  1 
ATOM   2739 C  C   . LEU B 1 89  ? 53.266 46.618  5.648   1.00 44.03  ? 130 LEU B C   1 
ATOM   2740 O  O   . LEU B 1 89  ? 52.507 46.632  4.664   1.00 39.79  ? 130 LEU B O   1 
ATOM   2741 C  CB  . LEU B 1 89  ? 53.437 44.529  6.953   1.00 35.43  ? 130 LEU B CB  1 
ATOM   2742 C  CG  . LEU B 1 89  ? 53.014 43.626  8.116   1.00 41.46  ? 130 LEU B CG  1 
ATOM   2743 C  CD1 . LEU B 1 89  ? 53.739 42.288  8.028   1.00 35.06  ? 130 LEU B CD1 1 
ATOM   2744 C  CD2 . LEU B 1 89  ? 53.312 44.332  9.416   1.00 37.11  ? 130 LEU B CD2 1 
ATOM   2745 N  N   . LYS B 1 90  ? 54.472 47.188  5.648   1.00 44.48  ? 131 LYS B N   1 
ATOM   2746 C  CA  . LYS B 1 90  ? 54.983 47.826  4.436   1.00 44.18  ? 131 LYS B CA  1 
ATOM   2747 C  C   . LYS B 1 90  ? 56.427 47.363  4.224   1.00 44.07  ? 131 LYS B C   1 
ATOM   2748 O  O   . LYS B 1 90  ? 57.232 47.333  5.157   1.00 43.99  ? 131 LYS B O   1 
ATOM   2749 C  CB  . LYS B 1 90  ? 54.910 49.361  4.563   1.00 49.65  ? 131 LYS B CB  1 
ATOM   2750 C  CG  . LYS B 1 90  ? 55.551 50.165  3.408   1.00 41.97  ? 131 LYS B CG  1 
ATOM   2751 C  CD  . LYS B 1 90  ? 54.720 50.017  2.121   1.00 47.92  ? 131 LYS B CD  1 
ATOM   2752 C  CE  . LYS B 1 90  ? 55.260 50.883  1.005   1.00 47.99  ? 131 LYS B CE  1 
ATOM   2753 N  NZ  . LYS B 1 90  ? 56.664 50.517  0.664   1.00 52.77  ? 131 LYS B NZ  1 
ATOM   2754 N  N   . ILE B 1 91  ? 56.735 46.946  3.009   1.00 41.64  ? 132 ILE B N   1 
ATOM   2755 C  CA  . ILE B 1 91  ? 58.092 46.539  2.694   1.00 45.46  ? 132 ILE B CA  1 
ATOM   2756 C  C   . ILE B 1 91  ? 58.504 47.329  1.467   1.00 49.82  ? 132 ILE B C   1 
ATOM   2757 O  O   . ILE B 1 91  ? 57.681 47.638  0.615   1.00 48.02  ? 132 ILE B O   1 
ATOM   2758 C  CB  . ILE B 1 91  ? 58.209 45.027  2.358   1.00 43.82  ? 132 ILE B CB  1 
ATOM   2759 C  CG1 . ILE B 1 91  ? 57.315 44.671  1.171   1.00 40.54  ? 132 ILE B CG1 1 
ATOM   2760 C  CG2 . ILE B 1 91  ? 57.880 44.199  3.581   1.00 42.90  ? 132 ILE B CG2 1 
ATOM   2761 C  CD1 . ILE B 1 91  ? 57.487 43.227  0.723   1.00 41.81  ? 132 ILE B CD1 1 
ATOM   2762 N  N   . ASN B 1 92  ? 59.782 47.660  1.373   1.00 61.62  ? 133 ASN B N   1 
ATOM   2763 C  CA  . ASN B 1 92  ? 60.259 48.417  0.227   1.00 68.19  ? 133 ASN B CA  1 
ATOM   2764 C  C   . ASN B 1 92  ? 60.930 47.479  -0.734  1.00 70.79  ? 133 ASN B C   1 
ATOM   2765 O  O   . ASN B 1 92  ? 62.044 47.035  -0.497  1.00 77.85  ? 133 ASN B O   1 
ATOM   2766 C  CB  . ASN B 1 92  ? 61.247 49.502  0.667   1.00 74.65  ? 133 ASN B CB  1 
ATOM   2767 C  CG  . ASN B 1 92  ? 60.558 50.818  1.025   1.00 83.00  ? 133 ASN B CG  1 
ATOM   2768 O  OD1 . ASN B 1 92  ? 59.609 50.855  1.823   1.00 82.34  ? 133 ASN B OD1 1 
ATOM   2769 N  ND2 . ASN B 1 92  ? 61.043 51.910  0.437   1.00 84.34  ? 133 ASN B ND2 1 
ATOM   2770 N  N   . ALA B 1 93  ? 60.240 47.157  -1.816  1.00 74.27  ? 134 ALA B N   1 
ATOM   2771 C  CA  . ALA B 1 93  ? 60.799 46.271  -2.818  1.00 77.38  ? 134 ALA B CA  1 
ATOM   2772 C  C   . ALA B 1 93  ? 60.869 47.033  -4.129  1.00 78.97  ? 134 ALA B C   1 
ATOM   2773 O  O   . ALA B 1 93  ? 59.851 47.469  -4.666  1.00 79.37  ? 134 ALA B O   1 
ATOM   2774 C  CB  . ALA B 1 93  ? 59.933 45.035  -2.967  1.00 78.76  ? 134 ALA B CB  1 
ATOM   2775 N  N   . THR B 1 94  ? 62.077 47.189  -4.645  1.00 78.91  ? 135 THR B N   1 
ATOM   2776 C  CA  . THR B 1 94  ? 62.261 47.922  -5.883  1.00 80.61  ? 135 THR B CA  1 
ATOM   2777 C  C   . THR B 1 94  ? 62.235 47.053  -7.143  1.00 78.82  ? 135 THR B C   1 
ATOM   2778 O  O   . THR B 1 94  ? 62.102 47.572  -8.253  1.00 81.03  ? 135 THR B O   1 
ATOM   2779 C  CB  . THR B 1 94  ? 63.576 48.750  -5.824  1.00 82.73  ? 135 THR B CB  1 
ATOM   2780 O  OG1 . THR B 1 94  ? 64.667 47.909  -5.416  1.00 84.39  ? 135 THR B OG1 1 
ATOM   2781 C  CG2 . THR B 1 94  ? 63.427 49.898  -4.817  1.00 84.11  ? 135 THR B CG2 1 
ATOM   2782 N  N   . GLY B 1 95  ? 62.321 45.735  -6.977  1.00 75.12  ? 136 GLY B N   1 
ATOM   2783 C  CA  . GLY B 1 95  ? 62.320 44.858  -8.137  1.00 72.07  ? 136 GLY B CA  1 
ATOM   2784 C  C   . GLY B 1 95  ? 60.992 44.272  -8.599  1.00 70.62  ? 136 GLY B C   1 
ATOM   2785 O  O   . GLY B 1 95  ? 60.976 43.207  -9.221  1.00 68.12  ? 136 GLY B O   1 
ATOM   2786 N  N   . GLY B 1 96  ? 59.883 44.951  -8.313  1.00 66.84  ? 137 GLY B N   1 
ATOM   2787 C  CA  . GLY B 1 96  ? 58.583 44.443  -8.724  1.00 61.49  ? 137 GLY B CA  1 
ATOM   2788 C  C   . GLY B 1 96  ? 58.094 43.357  -7.783  1.00 60.80  ? 137 GLY B C   1 
ATOM   2789 O  O   . GLY B 1 96  ? 58.846 42.451  -7.422  1.00 63.55  ? 137 GLY B O   1 
ATOM   2790 N  N   . LEU B 1 97  ? 56.836 43.443  -7.367  1.00 57.85  ? 138 LEU B N   1 
ATOM   2791 C  CA  . LEU B 1 97  ? 56.284 42.448  -6.454  1.00 54.47  ? 138 LEU B CA  1 
ATOM   2792 C  C   . LEU B 1 97  ? 55.097 41.689  -7.022  1.00 49.21  ? 138 LEU B C   1 
ATOM   2793 O  O   . LEU B 1 97  ? 54.393 42.156  -7.916  1.00 48.62  ? 138 LEU B O   1 
ATOM   2794 C  CB  . LEU B 1 97  ? 55.817 43.103  -5.151  1.00 50.06  ? 138 LEU B CB  1 
ATOM   2795 C  CG  . LEU B 1 97  ? 56.800 43.751  -4.187  1.00 51.51  ? 138 LEU B CG  1 
ATOM   2796 C  CD1 . LEU B 1 97  ? 56.025 44.655  -3.211  1.00 48.18  ? 138 LEU B CD1 1 
ATOM   2797 C  CD2 . LEU B 1 97  ? 57.588 42.678  -3.457  1.00 45.40  ? 138 LEU B CD2 1 
ATOM   2798 N  N   . PRO B 1 98  ? 54.873 40.482  -6.517  1.00 48.57  ? 139 PRO B N   1 
ATOM   2799 C  CA  . PRO B 1 98  ? 53.715 39.748  -7.031  1.00 49.26  ? 139 PRO B CA  1 
ATOM   2800 C  C   . PRO B 1 98  ? 52.550 40.259  -6.156  1.00 46.26  ? 139 PRO B C   1 
ATOM   2801 O  O   . PRO B 1 98  ? 52.688 40.306  -4.940  1.00 48.34  ? 139 PRO B O   1 
ATOM   2802 C  CB  . PRO B 1 98  ? 54.084 38.291  -6.742  1.00 46.34  ? 139 PRO B CB  1 
ATOM   2803 C  CG  . PRO B 1 98  ? 54.888 38.404  -5.446  1.00 51.22  ? 139 PRO B CG  1 
ATOM   2804 C  CD  . PRO B 1 98  ? 55.746 39.627  -5.685  1.00 50.07  ? 139 PRO B CD  1 
ATOM   2805 N  N   . THR B 1 99  ? 51.446 40.702  -6.757  1.00 45.81  ? 140 THR B N   1 
ATOM   2806 C  CA  . THR B 1 99  ? 50.312 41.171  -5.964  1.00 41.99  ? 140 THR B CA  1 
ATOM   2807 C  C   . THR B 1 99  ? 49.097 40.240  -6.115  1.00 42.11  ? 140 THR B C   1 
ATOM   2808 O  O   . THR B 1 99  ? 48.960 39.545  -7.129  1.00 36.14  ? 140 THR B O   1 
ATOM   2809 C  CB  . THR B 1 99  ? 49.879 42.623  -6.348  1.00 44.93  ? 140 THR B CB  1 
ATOM   2810 O  OG1 . THR B 1 99  ? 49.492 42.674  -7.727  1.00 48.28  ? 140 THR B OG1 1 
ATOM   2811 C  CG2 . THR B 1 99  ? 51.001 43.605  -6.074  1.00 44.52  ? 140 THR B CG2 1 
ATOM   2812 N  N   . ILE B 1 100 ? 48.202 40.260  -5.128  1.00 38.50  ? 141 ILE B N   1 
ATOM   2813 C  CA  . ILE B 1 100 ? 47.020 39.404  -5.154  1.00 37.70  ? 141 ILE B CA  1 
ATOM   2814 C  C   . ILE B 1 100 ? 46.002 39.952  -6.167  1.00 38.50  ? 141 ILE B C   1 
ATOM   2815 O  O   . ILE B 1 100 ? 45.774 41.147  -6.216  1.00 35.30  ? 141 ILE B O   1 
ATOM   2816 C  CB  . ILE B 1 100 ? 46.358 39.334  -3.726  1.00 37.82  ? 141 ILE B CB  1 
ATOM   2817 C  CG1 . ILE B 1 100 ? 45.352 38.186  -3.661  1.00 33.62  ? 141 ILE B CG1 1 
ATOM   2818 C  CG2 . ILE B 1 100 ? 45.672 40.666  -3.378  1.00 39.63  ? 141 ILE B CG2 1 
ATOM   2819 C  CD1 . ILE B 1 100 ? 46.009 36.812  -3.593  1.00 35.40  ? 141 ILE B CD1 1 
ATOM   2820 N  N   . PRO B 1 101 ? 45.380 39.083  -6.992  1.00 35.32  ? 142 PRO B N   1 
ATOM   2821 C  CA  . PRO B 1 101 ? 44.401 39.632  -7.951  1.00 30.17  ? 142 PRO B CA  1 
ATOM   2822 C  C   . PRO B 1 101 ? 43.200 40.164  -7.157  1.00 40.51  ? 142 PRO B C   1 
ATOM   2823 O  O   . PRO B 1 101 ? 42.707 39.533  -6.200  1.00 39.74  ? 142 PRO B O   1 
ATOM   2824 C  CB  . PRO B 1 101 ? 44.027 38.436  -8.829  1.00 30.40  ? 142 PRO B CB  1 
ATOM   2825 C  CG  . PRO B 1 101 ? 45.263 37.520  -8.748  1.00 35.31  ? 142 PRO B CG  1 
ATOM   2826 C  CD  . PRO B 1 101 ? 45.669 37.664  -7.255  1.00 38.11  ? 142 PRO B CD  1 
ATOM   2827 N  N   . ILE B 1 102 ? 42.741 41.340  -7.534  1.00 38.92  ? 143 ILE B N   1 
ATOM   2828 C  CA  . ILE B 1 102 ? 41.640 41.959  -6.844  1.00 37.56  ? 143 ILE B CA  1 
ATOM   2829 C  C   . ILE B 1 102 ? 40.676 42.563  -7.838  1.00 42.01  ? 143 ILE B C   1 
ATOM   2830 O  O   . ILE B 1 102 ? 41.088 43.274  -8.740  1.00 38.21  ? 143 ILE B O   1 
ATOM   2831 C  CB  . ILE B 1 102 ? 42.135 43.093  -5.935  1.00 45.05  ? 143 ILE B CB  1 
ATOM   2832 C  CG1 . ILE B 1 102 ? 42.967 42.507  -4.801  1.00 52.10  ? 143 ILE B CG1 1 
ATOM   2833 C  CG2 . ILE B 1 102 ? 40.932 43.909  -5.405  1.00 45.82  ? 143 ILE B CG2 1 
ATOM   2834 C  CD1 . ILE B 1 102 ? 43.614 43.558  -3.912  1.00 60.24  ? 143 ILE B CD1 1 
ATOM   2835 N  N   . ASN B 1 103 ? 39.392 42.290  -7.652  1.00 38.52  ? 144 ASN B N   1 
ATOM   2836 C  CA  . ASN B 1 103 ? 38.382 42.852  -8.508  1.00 36.77  ? 144 ASN B CA  1 
ATOM   2837 C  C   . ASN B 1 103 ? 37.271 43.472  -7.666  1.00 36.58  ? 144 ASN B C   1 
ATOM   2838 O  O   . ASN B 1 103 ? 36.350 42.779  -7.219  1.00 34.44  ? 144 ASN B O   1 
ATOM   2839 C  CB  . ASN B 1 103 ? 37.787 41.775  -9.397  1.00 42.91  ? 144 ASN B CB  1 
ATOM   2840 C  CG  . ASN B 1 103 ? 37.047 42.363  -10.558 1.00 43.75  ? 144 ASN B CG  1 
ATOM   2841 O  OD1 . ASN B 1 103 ? 36.215 43.272  -10.397 1.00 40.42  ? 144 ASN B OD1 1 
ATOM   2842 N  ND2 . ASN B 1 103 ? 37.358 41.869  -11.748 1.00 50.11  ? 144 ASN B ND2 1 
ATOM   2843 N  N   . ALA B 1 104 ? 37.356 44.778  -7.472  1.00 37.59  ? 145 ALA B N   1 
ATOM   2844 C  CA  . ALA B 1 104 ? 36.398 45.535  -6.678  1.00 40.41  ? 145 ALA B CA  1 
ATOM   2845 C  C   . ALA B 1 104 ? 34.939 45.460  -7.133  1.00 38.84  ? 145 ALA B C   1 
ATOM   2846 O  O   . ALA B 1 104 ? 34.036 45.834  -6.388  1.00 46.07  ? 145 ALA B O   1 
ATOM   2847 C  CB  . ALA B 1 104 ? 36.847 46.991  -6.608  1.00 40.24  ? 145 ALA B CB  1 
ATOM   2848 N  N   . ARG B 1 105 ? 34.695 44.965  -8.338  1.00 45.77  ? 146 ARG B N   1 
ATOM   2849 C  CA  . ARG B 1 105 ? 33.321 44.857  -8.845  1.00 43.33  ? 146 ARG B CA  1 
ATOM   2850 C  C   . ARG B 1 105 ? 32.750 43.457  -8.702  1.00 38.96  ? 146 ARG B C   1 
ATOM   2851 O  O   . ARG B 1 105 ? 31.558 43.234  -8.890  1.00 38.77  ? 146 ARG B O   1 
ATOM   2852 C  CB  . ARG B 1 105 ? 33.270 45.256  -10.309 1.00 48.66  ? 146 ARG B CB  1 
ATOM   2853 C  CG  . ARG B 1 105 ? 33.698 46.684  -10.560 1.00 57.89  ? 146 ARG B CG  1 
ATOM   2854 C  CD  . ARG B 1 105 ? 33.451 47.045  -12.011 1.00 61.12  ? 146 ARG B CD  1 
ATOM   2855 N  NE  . ARG B 1 105 ? 33.494 48.485  -12.206 1.00 71.34  ? 146 ARG B NE  1 
ATOM   2856 C  CZ  . ARG B 1 105 ? 33.001 49.107  -13.271 1.00 75.14  ? 146 ARG B CZ  1 
ATOM   2857 N  NH1 . ARG B 1 105 ? 32.425 48.406  -14.244 1.00 75.25  ? 146 ARG B NH1 1 
ATOM   2858 N  NH2 . ARG B 1 105 ? 33.078 50.431  -13.360 1.00 71.94  ? 146 ARG B NH2 1 
ATOM   2859 N  N   . ARG B 1 106 ? 33.597 42.494  -8.383  1.00 36.24  ? 147 ARG B N   1 
ATOM   2860 C  CA  . ARG B 1 106 ? 33.102 41.130  -8.213  1.00 37.55  ? 147 ARG B CA  1 
ATOM   2861 C  C   . ARG B 1 106 ? 32.210 41.094  -6.967  1.00 31.26  ? 147 ARG B C   1 
ATOM   2862 O  O   . ARG B 1 106 ? 32.597 41.625  -5.931  1.00 32.91  ? 147 ARG B O   1 
ATOM   2863 C  CB  . ARG B 1 106 ? 34.268 40.190  -7.987  1.00 35.11  ? 147 ARG B CB  1 
ATOM   2864 C  CG  . ARG B 1 106 ? 33.890 38.750  -8.066  1.00 40.46  ? 147 ARG B CG  1 
ATOM   2865 C  CD  . ARG B 1 106 ? 34.470 38.223  -9.339  1.00 45.83  ? 147 ARG B CD  1 
ATOM   2866 N  NE  . ARG B 1 106 ? 33.447 37.954  -10.309 1.00 47.71  ? 147 ARG B NE  1 
ATOM   2867 C  CZ  . ARG B 1 106 ? 33.673 37.851  -11.608 1.00 41.40  ? 147 ARG B CZ  1 
ATOM   2868 N  NH1 . ARG B 1 106 ? 34.897 38.006  -12.085 1.00 42.78  ? 147 ARG B NH1 1 
ATOM   2869 N  NH2 . ARG B 1 106 ? 32.665 37.581  -12.413 1.00 45.47  ? 147 ARG B NH2 1 
ATOM   2870 N  N   . VAL B 1 107 ? 31.020 40.515  -7.051  1.00 33.82  ? 148 VAL B N   1 
ATOM   2871 C  CA  . VAL B 1 107 ? 30.226 40.445  -5.848  1.00 34.49  ? 148 VAL B CA  1 
ATOM   2872 C  C   . VAL B 1 107 ? 30.219 38.984  -5.448  1.00 38.68  ? 148 VAL B C   1 
ATOM   2873 O  O   . VAL B 1 107 ? 29.800 38.110  -6.203  1.00 37.32  ? 148 VAL B O   1 
ATOM   2874 C  CB  . VAL B 1 107 ? 28.791 41.093  -5.970  1.00 43.43  ? 148 VAL B CB  1 
ATOM   2875 C  CG1 . VAL B 1 107 ? 28.593 41.756  -7.328  1.00 35.12  ? 148 VAL B CG1 1 
ATOM   2876 C  CG2 . VAL B 1 107 ? 27.707 40.109  -5.589  1.00 39.57  ? 148 VAL B CG2 1 
ATOM   2877 N  N   . PRO B 1 108 ? 30.805 38.696  -4.278  1.00 33.19  ? 149 PRO B N   1 
ATOM   2878 C  CA  . PRO B 1 108 ? 30.865 37.314  -3.779  1.00 32.33  ? 149 PRO B CA  1 
ATOM   2879 C  C   . PRO B 1 108 ? 29.459 36.760  -3.569  1.00 30.01  ? 149 PRO B C   1 
ATOM   2880 O  O   . PRO B 1 108 ? 28.545 37.474  -3.157  1.00 31.74  ? 149 PRO B O   1 
ATOM   2881 C  CB  . PRO B 1 108 ? 31.619 37.435  -2.441  1.00 37.59  ? 149 PRO B CB  1 
ATOM   2882 C  CG  . PRO B 1 108 ? 32.442 38.760  -2.601  1.00 44.04  ? 149 PRO B CG  1 
ATOM   2883 C  CD  . PRO B 1 108 ? 31.483 39.656  -3.375  1.00 32.49  ? 149 PRO B CD  1 
ATOM   2884 N  N   . HIS B 1 109 ? 29.291 35.481  -3.859  1.00 22.58  ? 150 HIS B N   1 
ATOM   2885 C  CA  . HIS B 1 109 ? 28.009 34.826  -3.655  1.00 27.48  ? 150 HIS B CA  1 
ATOM   2886 C  C   . HIS B 1 109 ? 28.167 33.591  -2.792  1.00 26.45  ? 150 HIS B C   1 
ATOM   2887 O  O   . HIS B 1 109 ? 29.174 32.883  -2.884  1.00 29.05  ? 150 HIS B O   1 
ATOM   2888 C  CB  . HIS B 1 109 ? 27.391 34.385  -4.990  1.00 31.14  ? 150 HIS B CB  1 
ATOM   2889 C  CG  . HIS B 1 109 ? 27.071 35.523  -5.898  1.00 41.02  ? 150 HIS B CG  1 
ATOM   2890 N  ND1 . HIS B 1 109 ? 26.169 36.503  -5.559  1.00 48.31  ? 150 HIS B ND1 1 
ATOM   2891 C  CD2 . HIS B 1 109 ? 27.595 35.886  -7.090  1.00 46.88  ? 150 HIS B CD2 1 
ATOM   2892 C  CE1 . HIS B 1 109 ? 26.153 37.428  -6.500  1.00 48.18  ? 150 HIS B CE1 1 
ATOM   2893 N  NE2 . HIS B 1 109 ? 27.011 37.077  -7.440  1.00 52.07  ? 150 HIS B NE2 1 
ATOM   2894 N  N   . ILE B 1 110 ? 27.157 33.345  -1.966  1.00 23.73  ? 151 ILE B N   1 
ATOM   2895 C  CA  . ILE B 1 110 ? 27.107 32.141  -1.148  1.00 24.24  ? 151 ILE B CA  1 
ATOM   2896 C  C   . ILE B 1 110 ? 27.132 30.939  -2.122  1.00 27.01  ? 151 ILE B C   1 
ATOM   2897 O  O   . ILE B 1 110 ? 26.350 30.906  -3.109  1.00 24.07  ? 151 ILE B O   1 
ATOM   2898 C  CB  . ILE B 1 110 ? 25.796 32.094  -0.352  1.00 26.01  ? 151 ILE B CB  1 
ATOM   2899 C  CG1 . ILE B 1 110 ? 25.755 33.268  0.652   1.00 29.26  ? 151 ILE B CG1 1 
ATOM   2900 C  CG2 . ILE B 1 110 ? 25.729 30.806  0.463   1.00 28.02  ? 151 ILE B CG2 1 
ATOM   2901 C  CD1 . ILE B 1 110 ? 24.358 33.473  1.289   1.00 28.79  ? 151 ILE B CD1 1 
ATOM   2902 N  N   . GLY B 1 111 ? 28.024 29.984  -1.854  1.00 20.48  ? 152 GLY B N   1 
ATOM   2903 C  CA  . GLY B 1 111 ? 28.185 28.806  -2.696  1.00 20.72  ? 152 GLY B CA  1 
ATOM   2904 C  C   . GLY B 1 111 ? 29.375 28.942  -3.663  1.00 32.00  ? 152 GLY B C   1 
ATOM   2905 O  O   . GLY B 1 111 ? 29.766 27.952  -4.306  1.00 23.81  ? 152 GLY B O   1 
ATOM   2906 N  N   . ASP B 1 112 ? 29.957 30.144  -3.778  1.00 28.19  ? 153 ASP B N   1 
ATOM   2907 C  CA  . ASP B 1 112 ? 31.133 30.335  -4.650  1.00 29.19  ? 153 ASP B CA  1 
ATOM   2908 C  C   . ASP B 1 112 ? 32.265 29.454  -4.118  1.00 25.25  ? 153 ASP B C   1 
ATOM   2909 O  O   . ASP B 1 112 ? 32.451 29.343  -2.893  1.00 19.58  ? 153 ASP B O   1 
ATOM   2910 C  CB  . ASP B 1 112 ? 31.655 31.789  -4.627  1.00 22.32  ? 153 ASP B CB  1 
ATOM   2911 C  CG  . ASP B 1 112 ? 30.811 32.736  -5.430  1.00 34.68  ? 153 ASP B CG  1 
ATOM   2912 O  OD1 . ASP B 1 112 ? 29.862 32.276  -6.127  1.00 33.39  ? 153 ASP B OD1 1 
ATOM   2913 O  OD2 . ASP B 1 112 ? 31.102 33.953  -5.352  1.00 36.29  ? 153 ASP B OD2 1 
ATOM   2914 N  N   . VAL B 1 113 ? 33.029 28.848  -5.021  1.00 25.88  ? 154 VAL B N   1 
ATOM   2915 C  CA  . VAL B 1 113 ? 34.139 28.000  -4.602  1.00 23.39  ? 154 VAL B CA  1 
ATOM   2916 C  C   . VAL B 1 113 ? 35.272 28.931  -4.224  1.00 27.99  ? 154 VAL B C   1 
ATOM   2917 O  O   . VAL B 1 113 ? 35.488 29.936  -4.885  1.00 26.63  ? 154 VAL B O   1 
ATOM   2918 C  CB  . VAL B 1 113 ? 34.612 27.041  -5.735  1.00 23.01  ? 154 VAL B CB  1 
ATOM   2919 C  CG1 . VAL B 1 113 ? 35.909 26.377  -5.357  1.00 24.27  ? 154 VAL B CG1 1 
ATOM   2920 C  CG2 . VAL B 1 113 ? 33.535 25.989  -6.027  1.00 19.66  ? 154 VAL B CG2 1 
ATOM   2921 N  N   . VAL B 1 114 ? 35.985 28.591  -3.151  1.00 26.25  ? 155 VAL B N   1 
ATOM   2922 C  CA  . VAL B 1 114 ? 37.100 29.385  -2.700  1.00 25.50  ? 155 VAL B CA  1 
ATOM   2923 C  C   . VAL B 1 114 ? 38.275 28.507  -2.285  1.00 30.01  ? 155 VAL B C   1 
ATOM   2924 O  O   . VAL B 1 114 ? 38.107 27.347  -1.878  1.00 30.61  ? 155 VAL B O   1 
ATOM   2925 C  CB  . VAL B 1 114 ? 36.716 30.309  -1.490  1.00 26.19  ? 155 VAL B CB  1 
ATOM   2926 C  CG1 . VAL B 1 114 ? 35.795 31.442  -1.961  1.00 25.03  ? 155 VAL B CG1 1 
ATOM   2927 C  CG2 . VAL B 1 114 ? 36.014 29.480  -0.377  1.00 25.23  ? 155 VAL B CG2 1 
ATOM   2928 N  N   . LEU B 1 115 ? 39.473 29.067  -2.422  1.00 26.44  ? 156 LEU B N   1 
ATOM   2929 C  CA  . LEU B 1 115 ? 40.680 28.405  -2.004  1.00 28.92  ? 156 LEU B CA  1 
ATOM   2930 C  C   . LEU B 1 115 ? 41.266 29.249  -0.875  1.00 32.57  ? 156 LEU B C   1 
ATOM   2931 O  O   . LEU B 1 115 ? 41.288 30.480  -0.966  1.00 34.89  ? 156 LEU B O   1 
ATOM   2932 C  CB  . LEU B 1 115 ? 41.679 28.301  -3.158  1.00 27.66  ? 156 LEU B CB  1 
ATOM   2933 C  CG  . LEU B 1 115 ? 41.233 27.621  -4.462  1.00 36.04  ? 156 LEU B CG  1 
ATOM   2934 C  CD1 . LEU B 1 115 ? 42.419 27.526  -5.381  1.00 37.08  ? 156 LEU B CD1 1 
ATOM   2935 C  CD2 . LEU B 1 115 ? 40.661 26.219  -4.190  1.00 26.09  ? 156 LEU B CD2 1 
ATOM   2936 N  N   . ALA B 1 116 ? 41.701 28.594  0.200   1.00 32.85  ? 157 ALA B N   1 
ATOM   2937 C  CA  . ALA B 1 116 ? 42.351 29.279  1.332   1.00 26.80  ? 157 ALA B CA  1 
ATOM   2938 C  C   . ALA B 1 116 ? 43.856 29.004  1.163   1.00 33.09  ? 157 ALA B C   1 
ATOM   2939 O  O   . ALA B 1 116 ? 44.293 27.853  1.121   1.00 30.15  ? 157 ALA B O   1 
ATOM   2940 C  CB  . ALA B 1 116 ? 41.847 28.725  2.655   1.00 25.91  ? 157 ALA B CB  1 
ATOM   2941 N  N   . ILE B 1 117 ? 44.638 30.072  1.026   1.00 32.01  ? 158 ILE B N   1 
ATOM   2942 C  CA  . ILE B 1 117 ? 46.064 29.972  0.820   1.00 29.78  ? 158 ILE B CA  1 
ATOM   2943 C  C   . ILE B 1 117 ? 46.756 30.500  2.069   1.00 36.41  ? 158 ILE B C   1 
ATOM   2944 O  O   . ILE B 1 117 ? 46.553 31.644  2.481   1.00 34.14  ? 158 ILE B O   1 
ATOM   2945 C  CB  . ILE B 1 117 ? 46.481 30.779  -0.423  1.00 31.12  ? 158 ILE B CB  1 
ATOM   2946 C  CG1 . ILE B 1 117 ? 45.626 30.345  -1.622  1.00 26.33  ? 158 ILE B CG1 1 
ATOM   2947 C  CG2 . ILE B 1 117 ? 47.950 30.544  -0.726  1.00 28.34  ? 158 ILE B CG2 1 
ATOM   2948 C  CD1 . ILE B 1 117 ? 45.900 31.128  -2.893  1.00 36.74  ? 158 ILE B CD1 1 
ATOM   2949 N  N   . GLY B 1 118 ? 47.527 29.627  2.703   1.00 39.63  ? 159 GLY B N   1 
ATOM   2950 C  CA  . GLY B 1 118 ? 48.242 29.988  3.906   1.00 49.38  ? 159 GLY B CA  1 
ATOM   2951 C  C   . GLY B 1 118 ? 49.675 29.582  3.679   1.00 63.35  ? 159 GLY B C   1 
ATOM   2952 O  O   . GLY B 1 118 ? 49.928 28.481  3.183   1.00 58.25  ? 159 GLY B O   1 
ATOM   2953 N  N   . ASN B 1 119 ? 50.603 30.486  4.005   1.00 73.72  ? 160 ASN B N   1 
ATOM   2954 C  CA  . ASN B 1 119 ? 52.038 30.250  3.846   1.00 80.55  ? 160 ASN B CA  1 
ATOM   2955 C  C   . ASN B 1 119 ? 52.673 29.999  5.207   1.00 87.82  ? 160 ASN B C   1 
ATOM   2956 O  O   . ASN B 1 119 ? 53.319 30.886  5.779   1.00 85.54  ? 160 ASN B O   1 
ATOM   2957 C  CB  . ASN B 1 119 ? 52.715 31.460  3.209   1.00 81.83  ? 160 ASN B CB  1 
ATOM   2958 C  CG  . ASN B 1 119 ? 53.553 31.090  2.007   1.00 88.55  ? 160 ASN B CG  1 
ATOM   2959 O  OD1 . ASN B 1 119 ? 54.646 31.624  1.801   1.00 88.98  ? 160 ASN B OD1 1 
ATOM   2960 N  ND2 . ASN B 1 119 ? 53.036 30.179  1.192   1.00 93.35  ? 160 ASN B ND2 1 
ATOM   2961 N  N   . PRO B 1 120 ? 52.476 28.795  5.762   1.00 94.40  ? 161 PRO B N   1 
ATOM   2962 C  CA  . PRO B 1 120 ? 53.072 28.520  7.067   1.00 100.54 ? 161 PRO B CA  1 
ATOM   2963 C  C   . PRO B 1 120 ? 54.476 27.955  6.926   1.00 104.72 ? 161 PRO B C   1 
ATOM   2964 O  O   . PRO B 1 120 ? 54.821 27.363  5.899   1.00 104.00 ? 161 PRO B O   1 
ATOM   2965 C  CB  . PRO B 1 120 ? 52.105 27.514  7.673   1.00 99.49  ? 161 PRO B CB  1 
ATOM   2966 C  CG  . PRO B 1 120 ? 51.710 26.708  6.482   1.00 99.74  ? 161 PRO B CG  1 
ATOM   2967 C  CD  . PRO B 1 120 ? 51.476 27.767  5.420   1.00 97.26  ? 161 PRO B CD  1 
ATOM   2968 N  N   . TYR B 1 121 ? 55.283 28.153  7.960   1.00 108.83 ? 162 TYR B N   1 
ATOM   2969 C  CA  . TYR B 1 121 ? 56.640 27.640  7.963   1.00 111.69 ? 162 TYR B CA  1 
ATOM   2970 C  C   . TYR B 1 121 ? 56.673 26.377  8.833   1.00 111.70 ? 162 TYR B C   1 
ATOM   2971 O  O   . TYR B 1 121 ? 57.263 26.353  9.916   1.00 110.57 ? 162 TYR B O   1 
ATOM   2972 C  CB  . TYR B 1 121 ? 57.602 28.715  8.483   1.00 115.65 ? 162 TYR B CB  1 
ATOM   2973 C  CG  . TYR B 1 121 ? 59.047 28.286  8.530   1.00 120.05 ? 162 TYR B CG  1 
ATOM   2974 C  CD1 . TYR B 1 121 ? 59.655 27.675  7.429   1.00 121.35 ? 162 TYR B CD1 1 
ATOM   2975 C  CD2 . TYR B 1 121 ? 59.812 28.485  9.682   1.00 123.16 ? 162 TYR B CD2 1 
ATOM   2976 C  CE1 . TYR B 1 121 ? 60.992 27.271  7.478   1.00 124.22 ? 162 TYR B CE1 1 
ATOM   2977 C  CE2 . TYR B 1 121 ? 61.147 28.087  9.744   1.00 124.56 ? 162 TYR B CE2 1 
ATOM   2978 C  CZ  . TYR B 1 121 ? 61.732 27.481  8.642   1.00 125.50 ? 162 TYR B CZ  1 
ATOM   2979 O  OH  . TYR B 1 121 ? 63.052 27.088  8.712   1.00 124.66 ? 162 TYR B OH  1 
ATOM   2980 N  N   . ASN B 1 122 ? 55.994 25.340  8.341   1.00 111.58 ? 163 ASN B N   1 
ATOM   2981 C  CA  . ASN B 1 122 ? 55.913 24.039  8.999   1.00 109.52 ? 163 ASN B CA  1 
ATOM   2982 C  C   . ASN B 1 122 ? 55.566 22.960  7.955   1.00 107.77 ? 163 ASN B C   1 
ATOM   2983 O  O   . ASN B 1 122 ? 55.954 21.796  8.094   1.00 110.62 ? 163 ASN B O   1 
ATOM   2984 C  CB  . ASN B 1 122 ? 54.865 24.060  10.121  1.00 111.17 ? 163 ASN B CB  1 
ATOM   2985 C  CG  . ASN B 1 122 ? 53.444 24.107  9.599   1.00 112.83 ? 163 ASN B CG  1 
ATOM   2986 O  OD1 . ASN B 1 122 ? 53.035 25.073  8.961   1.00 113.22 ? 163 ASN B OD1 1 
ATOM   2987 N  ND2 . ASN B 1 122 ? 52.681 23.054  9.872   1.00 114.92 ? 163 ASN B ND2 1 
ATOM   2988 N  N   . LEU B 1 123 ? 54.837 23.351  6.912   1.00 101.23 ? 164 LEU B N   1 
ATOM   2989 C  CA  . LEU B 1 123 ? 54.468 22.430  5.835   1.00 95.38  ? 164 LEU B CA  1 
ATOM   2990 C  C   . LEU B 1 123 ? 54.520 23.132  4.476   1.00 90.61  ? 164 LEU B C   1 
ATOM   2991 O  O   . LEU B 1 123 ? 54.093 22.575  3.459   1.00 91.59  ? 164 LEU B O   1 
ATOM   2992 C  CB  . LEU B 1 123 ? 53.060 21.848  6.054   1.00 94.43  ? 164 LEU B CB  1 
ATOM   2993 C  CG  . LEU B 1 123 ? 52.937 20.450  6.679   1.00 92.68  ? 164 LEU B CG  1 
ATOM   2994 C  CD1 . LEU B 1 123 ? 53.907 19.503  5.985   1.00 94.07  ? 164 LEU B CD1 1 
ATOM   2995 C  CD2 . LEU B 1 123 ? 53.236 20.500  8.161   1.00 93.29  ? 164 LEU B CD2 1 
ATOM   2996 N  N   . GLY B 1 124 ? 55.055 24.351  4.465   1.00 83.58  ? 165 GLY B N   1 
ATOM   2997 C  CA  . GLY B 1 124 ? 55.136 25.120  3.231   1.00 76.18  ? 165 GLY B CA  1 
ATOM   2998 C  C   . GLY B 1 124 ? 53.788 25.739  2.908   1.00 68.85  ? 165 GLY B C   1 
ATOM   2999 O  O   . GLY B 1 124 ? 52.841 25.621  3.685   1.00 68.20  ? 165 GLY B O   1 
ATOM   3000 N  N   . GLN B 1 125 ? 53.681 26.397  1.765   1.00 62.46  ? 166 GLN B N   1 
ATOM   3001 C  CA  . GLN B 1 125 ? 52.415 27.014  1.381   1.00 57.76  ? 166 GLN B CA  1 
ATOM   3002 C  C   . GLN B 1 125 ? 51.309 25.950  1.320   1.00 54.07  ? 166 GLN B C   1 
ATOM   3003 O  O   . GLN B 1 125 ? 51.474 24.926  0.657   1.00 50.21  ? 166 GLN B O   1 
ATOM   3004 C  CB  . GLN B 1 125 ? 52.587 27.690  0.023   1.00 54.39  ? 166 GLN B CB  1 
ATOM   3005 C  CG  . GLN B 1 125 ? 51.405 28.476  -0.459  1.00 52.17  ? 166 GLN B CG  1 
ATOM   3006 C  CD  . GLN B 1 125 ? 51.821 29.546  -1.444  1.00 56.35  ? 166 GLN B CD  1 
ATOM   3007 O  OE1 . GLN B 1 125 ? 51.949 30.729  -1.098  1.00 50.05  ? 166 GLN B OE1 1 
ATOM   3008 N  NE2 . GLN B 1 125 ? 52.059 29.135  -2.675  1.00 51.45  ? 166 GLN B NE2 1 
ATOM   3009 N  N   . THR B 1 126 ? 50.200 26.181  2.023   1.00 51.99  ? 167 THR B N   1 
ATOM   3010 C  CA  . THR B 1 126 ? 49.080 25.230  2.020   1.00 54.53  ? 167 THR B CA  1 
ATOM   3011 C  C   . THR B 1 126 ? 47.839 25.771  1.348   1.00 47.77  ? 167 THR B C   1 
ATOM   3012 O  O   . THR B 1 126 ? 47.454 26.907  1.563   1.00 51.26  ? 167 THR B O   1 
ATOM   3013 C  CB  . THR B 1 126 ? 48.659 24.809  3.425   1.00 55.53  ? 167 THR B CB  1 
ATOM   3014 O  OG1 . THR B 1 126 ? 48.532 25.975  4.261   1.00 61.42  ? 167 THR B OG1 1 
ATOM   3015 C  CG2 . THR B 1 126 ? 49.672 23.847  3.999   1.00 63.85  ? 167 THR B CG2 1 
ATOM   3016 N  N   . ILE B 1 127 ? 47.204 24.936  0.543   1.00 42.97  ? 168 ILE B N   1 
ATOM   3017 C  CA  . ILE B 1 127 ? 46.011 25.339  -0.168  1.00 41.73  ? 168 ILE B CA  1 
ATOM   3018 C  C   . ILE B 1 127 ? 44.866 24.355  0.052   1.00 42.72  ? 168 ILE B C   1 
ATOM   3019 O  O   . ILE B 1 127 ? 45.045 23.161  -0.133  1.00 41.03  ? 168 ILE B O   1 
ATOM   3020 C  CB  . ILE B 1 127 ? 46.336 25.483  -1.654  1.00 37.46  ? 168 ILE B CB  1 
ATOM   3021 C  CG1 . ILE B 1 127 ? 47.526 26.458  -1.788  1.00 45.45  ? 168 ILE B CG1 1 
ATOM   3022 C  CG2 . ILE B 1 127 ? 45.102 25.984  -2.438  1.00 36.44  ? 168 ILE B CG2 1 
ATOM   3023 C  CD1 . ILE B 1 127 ? 47.816 26.955  -3.179  1.00 40.13  ? 168 ILE B CD1 1 
ATOM   3024 N  N   . THR B 1 128 ? 43.697 24.861  0.448   1.00 40.20  ? 169 THR B N   1 
ATOM   3025 C  CA  . THR B 1 128 ? 42.534 24.002  0.691   1.00 41.08  ? 169 THR B CA  1 
ATOM   3026 C  C   . THR B 1 128 ? 41.295 24.599  0.041   1.00 32.38  ? 169 THR B C   1 
ATOM   3027 O  O   . THR B 1 128 ? 41.248 25.800  -0.148  1.00 32.15  ? 169 THR B O   1 
ATOM   3028 C  CB  . THR B 1 128 ? 42.297 23.875  2.199   1.00 44.01  ? 169 THR B CB  1 
ATOM   3029 O  OG1 . THR B 1 128 ? 42.241 25.185  2.774   1.00 43.52  ? 169 THR B OG1 1 
ATOM   3030 C  CG2 . THR B 1 128 ? 43.447 23.094  2.856   1.00 45.50  ? 169 THR B CG2 1 
ATOM   3031 N  N   . GLN B 1 129 ? 40.305 23.785  -0.334  1.00 27.56  ? 170 GLN B N   1 
ATOM   3032 C  CA  . GLN B 1 129 ? 39.122 24.365  -0.932  1.00 29.86  ? 170 GLN B CA  1 
ATOM   3033 C  C   . GLN B 1 129 ? 37.821 24.083  -0.275  1.00 27.50  ? 170 GLN B C   1 
ATOM   3034 O  O   . GLN B 1 129 ? 37.628 23.066  0.375   1.00 33.63  ? 170 GLN B O   1 
ATOM   3035 C  CB  . GLN B 1 129 ? 38.998 24.113  -2.459  1.00 28.32  ? 170 GLN B CB  1 
ATOM   3036 C  CG  . GLN B 1 129 ? 38.602 22.815  -3.013  1.00 37.03  ? 170 GLN B CG  1 
ATOM   3037 C  CD  . GLN B 1 129 ? 37.131 22.463  -2.956  1.00 41.38  ? 170 GLN B CD  1 
ATOM   3038 O  OE1 . GLN B 1 129 ? 36.226 23.312  -2.990  1.00 49.60  ? 170 GLN B OE1 1 
ATOM   3039 N  NE2 . GLN B 1 129 ? 36.885 21.169  -2.900  1.00 47.12  ? 170 GLN B NE2 1 
ATOM   3040 N  N   . GLY B 1 130 ? 36.928 25.050  -0.450  1.00 27.10  ? 171 GLY B N   1 
ATOM   3041 C  CA  . GLY B 1 130 ? 35.601 24.982  0.099   1.00 23.60  ? 171 GLY B CA  1 
ATOM   3042 C  C   . GLY B 1 130 ? 34.783 25.927  -0.731  1.00 25.01  ? 171 GLY B C   1 
ATOM   3043 O  O   . GLY B 1 130 ? 35.114 26.211  -1.884  1.00 22.38  ? 171 GLY B O   1 
ATOM   3044 N  N   . ILE B 1 131 ? 33.747 26.458  -0.111  1.00 22.04  ? 172 ILE B N   1 
ATOM   3045 C  CA  . ILE B 1 131 ? 32.845 27.388  -0.746  1.00 27.29  ? 172 ILE B CA  1 
ATOM   3046 C  C   . ILE B 1 131 ? 32.557 28.483  0.283   1.00 30.95  ? 172 ILE B C   1 
ATOM   3047 O  O   . ILE B 1 131 ? 32.929 28.372  1.455   1.00 25.35  ? 172 ILE B O   1 
ATOM   3048 C  CB  . ILE B 1 131 ? 31.485 26.741  -1.050  1.00 25.71  ? 172 ILE B CB  1 
ATOM   3049 C  CG1 . ILE B 1 131 ? 30.849 26.286  0.274   1.00 24.39  ? 172 ILE B CG1 1 
ATOM   3050 C  CG2 . ILE B 1 131 ? 31.646 25.584  -2.009  1.00 24.69  ? 172 ILE B CG2 1 
ATOM   3051 C  CD1 . ILE B 1 131 ? 29.409 25.823  0.095   1.00 20.67  ? 172 ILE B CD1 1 
ATOM   3052 N  N   . ILE B 1 132 ? 31.888 29.536  -0.167  1.00 29.00  ? 173 ILE B N   1 
ATOM   3053 C  CA  . ILE B 1 132 ? 31.492 30.585  0.745   1.00 26.66  ? 173 ILE B CA  1 
ATOM   3054 C  C   . ILE B 1 132 ? 30.203 30.094  1.380   1.00 28.89  ? 173 ILE B C   1 
ATOM   3055 O  O   . ILE B 1 132 ? 29.266 29.706  0.670   1.00 26.71  ? 173 ILE B O   1 
ATOM   3056 C  CB  . ILE B 1 132 ? 31.241 31.917  0.007   1.00 28.16  ? 173 ILE B CB  1 
ATOM   3057 C  CG1 . ILE B 1 132 ? 32.596 32.481  -0.482  1.00 26.95  ? 173 ILE B CG1 1 
ATOM   3058 C  CG2 . ILE B 1 132 ? 30.553 32.906  0.960   1.00 21.66  ? 173 ILE B CG2 1 
ATOM   3059 C  CD1 . ILE B 1 132 ? 32.520 33.793  -1.296  1.00 31.99  ? 173 ILE B CD1 1 
ATOM   3060 N  N   . SER B 1 133 ? 30.170 30.048  2.712   1.00 25.31  ? 174 SER B N   1 
ATOM   3061 C  CA  . SER B 1 133 ? 28.976 29.613  3.424   1.00 23.85  ? 174 SER B CA  1 
ATOM   3062 C  C   . SER B 1 133 ? 28.076 30.785  3.722   1.00 23.19  ? 174 SER B C   1 
ATOM   3063 O  O   . SER B 1 133 ? 26.889 30.609  3.819   1.00 29.71  ? 174 SER B O   1 
ATOM   3064 C  CB  . SER B 1 133 ? 29.343 28.913  4.734   1.00 33.50  ? 174 SER B CB  1 
ATOM   3065 O  OG  . SER B 1 133 ? 30.370 27.971  4.469   1.00 35.72  ? 174 SER B OG  1 
ATOM   3066 N  N   . ALA B 1 134 ? 28.652 31.965  3.922   1.00 22.74  ? 175 ALA B N   1 
ATOM   3067 C  CA  . ALA B 1 134 ? 27.881 33.190  4.202   1.00 25.89  ? 175 ALA B CA  1 
ATOM   3068 C  C   . ALA B 1 134 ? 28.818 34.313  3.807   1.00 22.22  ? 175 ALA B C   1 
ATOM   3069 O  O   . ALA B 1 134 ? 30.016 34.243  4.077   1.00 25.16  ? 175 ALA B O   1 
ATOM   3070 C  CB  . ALA B 1 134 ? 27.514 33.314  5.690   1.00 22.27  ? 175 ALA B CB  1 
ATOM   3071 N  N   . THR B 1 135 ? 28.272 35.304  3.126   1.00 24.04  ? 176 THR B N   1 
ATOM   3072 C  CA  . THR B 1 135 ? 29.029 36.442  2.654   1.00 33.03  ? 176 THR B CA  1 
ATOM   3073 C  C   . THR B 1 135 ? 29.521 37.470  3.691   1.00 38.06  ? 176 THR B C   1 
ATOM   3074 O  O   . THR B 1 135 ? 30.568 38.080  3.484   1.00 45.53  ? 176 THR B O   1 
ATOM   3075 C  CB  . THR B 1 135 ? 28.230 37.198  1.592   1.00 32.62  ? 176 THR B CB  1 
ATOM   3076 O  OG1 . THR B 1 135 ? 26.882 37.349  2.049   1.00 34.64  ? 176 THR B OG1 1 
ATOM   3077 C  CG2 . THR B 1 135 ? 28.253 36.433  0.253   1.00 32.37  ? 176 THR B CG2 1 
ATOM   3078 N  N   . GLY B 1 136 ? 28.811 37.696  4.788   1.00 39.34  ? 177 GLY B N   1 
ATOM   3079 C  CA  . GLY B 1 136 ? 29.341 38.694  5.732   1.00 46.42  ? 177 GLY B CA  1 
ATOM   3080 C  C   . GLY B 1 136 ? 29.031 40.149  5.371   1.00 48.25  ? 177 GLY B C   1 
ATOM   3081 O  O   . GLY B 1 136 ? 28.483 40.403  4.307   1.00 56.38  ? 177 GLY B O   1 
ATOM   3082 N  N   . ARG B 1 137 ? 29.360 41.102  6.249   1.00 46.65  ? 178 ARG B N   1 
ATOM   3083 C  CA  . ARG B 1 137 ? 29.088 42.529  6.001   1.00 41.18  ? 178 ARG B CA  1 
ATOM   3084 C  C   . ARG B 1 137 ? 30.357 43.320  5.718   1.00 35.81  ? 178 ARG B C   1 
ATOM   3085 O  O   . ARG B 1 137 ? 31.428 42.974  6.196   1.00 35.06  ? 178 ARG B O   1 
ATOM   3086 C  CB  . ARG B 1 137 ? 28.375 43.168  7.209   1.00 44.14  ? 178 ARG B CB  1 
ATOM   3087 C  CG  . ARG B 1 137 ? 26.972 42.666  7.465   1.00 45.38  ? 178 ARG B CG  1 
ATOM   3088 C  CD  . ARG B 1 137 ? 26.294 43.480  8.583   1.00 62.69  ? 178 ARG B CD  1 
ATOM   3089 N  NE  . ARG B 1 137 ? 25.525 44.625  8.068   1.00 71.09  ? 178 ARG B NE  1 
ATOM   3090 C  CZ  . ARG B 1 137 ? 26.040 45.781  7.648   1.00 73.52  ? 178 ARG B CZ  1 
ATOM   3091 N  NH1 . ARG B 1 137 ? 27.357 45.997  7.672   1.00 73.31  ? 178 ARG B NH1 1 
ATOM   3092 N  NH2 . ARG B 1 137 ? 25.227 46.726  7.187   1.00 71.52  ? 178 ARG B NH2 1 
ATOM   3093 N  N   . ILE B 1 138 ? 30.233 44.414  4.980   1.00 36.32  ? 179 ILE B N   1 
ATOM   3094 C  CA  . ILE B 1 138 ? 31.403 45.195  4.630   1.00 37.90  ? 179 ILE B CA  1 
ATOM   3095 C  C   . ILE B 1 138 ? 31.557 46.595  5.225   1.00 40.35  ? 179 ILE B C   1 
ATOM   3096 O  O   . ILE B 1 138 ? 32.482 47.299  4.863   1.00 44.21  ? 179 ILE B O   1 
ATOM   3097 C  CB  . ILE B 1 138 ? 31.522 45.304  3.091   1.00 42.69  ? 179 ILE B CB  1 
ATOM   3098 C  CG1 . ILE B 1 138 ? 30.309 46.050  2.518   1.00 44.88  ? 179 ILE B CG1 1 
ATOM   3099 C  CG2 . ILE B 1 138 ? 31.631 43.894  2.488   1.00 45.61  ? 179 ILE B CG2 1 
ATOM   3100 C  CD1 . ILE B 1 138 ? 30.478 46.495  1.059   1.00 42.58  ? 179 ILE B CD1 1 
ATOM   3101 N  N   . GLY B 1 139 ? 30.678 47.001  6.134   1.00 46.10  ? 180 GLY B N   1 
ATOM   3102 C  CA  . GLY B 1 139 ? 30.780 48.336  6.720   1.00 45.10  ? 180 GLY B CA  1 
ATOM   3103 C  C   . GLY B 1 139 ? 31.753 48.434  7.894   1.00 40.05  ? 180 GLY B C   1 
ATOM   3104 O  O   . GLY B 1 139 ? 32.120 47.432  8.493   1.00 42.30  ? 180 GLY B O   1 
ATOM   3105 N  N   . LEU B 1 140 ? 32.164 49.649  8.229   1.00 47.36  ? 181 LEU B N   1 
ATOM   3106 C  CA  . LEU B 1 140 ? 33.115 49.871  9.316   1.00 53.42  ? 181 LEU B CA  1 
ATOM   3107 C  C   . LEU B 1 140 ? 32.552 49.611  10.703  1.00 57.87  ? 181 LEU B C   1 
ATOM   3108 O  O   . LEU B 1 140 ? 33.305 49.272  11.617  1.00 58.15  ? 181 LEU B O   1 
ATOM   3109 C  CB  . LEU B 1 140 ? 33.637 51.305  9.281   1.00 54.90  ? 181 LEU B CB  1 
ATOM   3110 C  CG  . LEU B 1 140 ? 34.885 51.623  8.471   1.00 57.13  ? 181 LEU B CG  1 
ATOM   3111 C  CD1 . LEU B 1 140 ? 35.343 53.038  8.841   1.00 61.25  ? 181 LEU B CD1 1 
ATOM   3112 C  CD2 . LEU B 1 140 ? 35.979 50.624  8.787   1.00 50.92  ? 181 LEU B CD2 1 
ATOM   3113 N  N   . ASN B 1 141 ? 31.241 49.787  10.857  1.00 56.64  ? 182 ASN B N   1 
ATOM   3114 C  CA  . ASN B 1 141 ? 30.594 49.586  12.143  1.00 67.96  ? 182 ASN B CA  1 
ATOM   3115 C  C   . ASN B 1 141 ? 30.871 48.186  12.696  1.00 68.54  ? 182 ASN B C   1 
ATOM   3116 O  O   . ASN B 1 141 ? 30.701 47.184  12.001  1.00 66.32  ? 182 ASN B O   1 
ATOM   3117 C  CB  . ASN B 1 141 ? 29.082 49.837  12.024  1.00 74.51  ? 182 ASN B CB  1 
ATOM   3118 C  CG  . ASN B 1 141 ? 28.395 49.932  13.382  1.00 80.72  ? 182 ASN B CG  1 
ATOM   3119 O  OD1 . ASN B 1 141 ? 28.887 50.602  14.296  1.00 78.54  ? 182 ASN B OD1 1 
ATOM   3120 N  ND2 . ASN B 1 141 ? 27.246 49.273  13.513  1.00 82.42  ? 182 ASN B ND2 1 
ATOM   3121 N  N   . PRO B 1 142 ? 31.338 48.114  13.955  1.00 72.52  ? 183 PRO B N   1 
ATOM   3122 C  CA  . PRO B 1 142 ? 31.667 46.876  14.673  1.00 76.28  ? 183 PRO B CA  1 
ATOM   3123 C  C   . PRO B 1 142 ? 30.521 45.864  14.730  1.00 75.39  ? 183 PRO B C   1 
ATOM   3124 O  O   . PRO B 1 142 ? 29.366 46.244  14.936  1.00 72.72  ? 183 PRO B O   1 
ATOM   3125 C  CB  . PRO B 1 142 ? 32.068 47.382  16.065  1.00 79.26  ? 183 PRO B CB  1 
ATOM   3126 C  CG  . PRO B 1 142 ? 31.361 48.718  16.177  1.00 77.81  ? 183 PRO B CG  1 
ATOM   3127 C  CD  . PRO B 1 142 ? 31.580 49.287  14.815  1.00 74.01  ? 183 PRO B CD  1 
ATOM   3128 N  N   . THR B 1 143 ? 30.850 44.581  14.572  1.00 77.96  ? 184 THR B N   1 
ATOM   3129 C  CA  . THR B 1 143 ? 29.835 43.527  14.590  1.00 81.73  ? 184 THR B CA  1 
ATOM   3130 C  C   . THR B 1 143 ? 30.229 42.177  15.206  1.00 82.81  ? 184 THR B C   1 
ATOM   3131 O  O   . THR B 1 143 ? 29.408 41.527  15.854  1.00 85.03  ? 184 THR B O   1 
ATOM   3132 C  CB  . THR B 1 143 ? 29.314 43.245  13.158  1.00 83.21  ? 184 THR B CB  1 
ATOM   3133 O  OG1 . THR B 1 143 ? 28.146 44.032  12.893  1.00 77.70  ? 184 THR B OG1 1 
ATOM   3134 C  CG2 . THR B 1 143 ? 28.980 41.785  13.011  1.00 84.34  ? 184 THR B CG2 1 
ATOM   3135 N  N   . GLY B 1 144 ? 31.461 41.734  14.983  1.00 84.31  ? 185 GLY B N   1 
ATOM   3136 C  CA  . GLY B 1 144 ? 31.871 40.445  15.525  1.00 83.46  ? 185 GLY B CA  1 
ATOM   3137 C  C   . GLY B 1 144 ? 31.682 39.297  14.538  1.00 82.58  ? 185 GLY B C   1 
ATOM   3138 O  O   . GLY B 1 144 ? 30.817 39.367  13.663  1.00 79.96  ? 185 GLY B O   1 
ATOM   3139 N  N   . ARG B 1 145 ? 32.489 38.244  14.701  1.00 82.19  ? 186 ARG B N   1 
ATOM   3140 C  CA  . ARG B 1 145 ? 32.495 37.041  13.852  1.00 81.64  ? 186 ARG B CA  1 
ATOM   3141 C  C   . ARG B 1 145 ? 31.224 36.713  13.072  1.00 78.98  ? 186 ARG B C   1 
ATOM   3142 O  O   . ARG B 1 145 ? 31.291 36.328  11.904  1.00 77.19  ? 186 ARG B O   1 
ATOM   3143 C  CB  . ARG B 1 145 ? 32.903 35.817  14.683  1.00 80.86  ? 186 ARG B CB  1 
ATOM   3144 N  N   . GLN B 1 146 ? 30.074 36.841  13.723  1.00 77.63  ? 187 GLN B N   1 
ATOM   3145 C  CA  . GLN B 1 146 ? 28.794 36.551  13.085  1.00 72.96  ? 187 GLN B CA  1 
ATOM   3146 C  C   . GLN B 1 146 ? 28.662 37.215  11.712  1.00 67.50  ? 187 GLN B C   1 
ATOM   3147 O  O   . GLN B 1 146 ? 28.005 36.667  10.821  1.00 65.70  ? 187 GLN B O   1 
ATOM   3148 C  CB  . GLN B 1 146 ? 27.643 36.996  13.996  1.00 80.88  ? 187 GLN B CB  1 
ATOM   3149 C  CG  . GLN B 1 146 ? 26.268 36.968  13.336  1.00 90.30  ? 187 GLN B CG  1 
ATOM   3150 C  CD  . GLN B 1 146 ? 25.190 37.604  14.205  1.00 97.27  ? 187 GLN B CD  1 
ATOM   3151 O  OE1 . GLN B 1 146 ? 24.755 37.020  15.201  1.00 99.05  ? 187 GLN B OE1 1 
ATOM   3152 N  NE2 . GLN B 1 146 ? 24.763 38.815  13.836  1.00 96.89  ? 187 GLN B NE2 1 
ATOM   3153 N  N   . ASN B 1 147 ? 29.279 38.384  11.526  1.00 56.08  ? 188 ASN B N   1 
ATOM   3154 C  CA  . ASN B 1 147 ? 29.178 39.046  10.229  1.00 52.38  ? 188 ASN B CA  1 
ATOM   3155 C  C   . ASN B 1 147 ? 30.440 39.081  9.359   1.00 44.08  ? 188 ASN B C   1 
ATOM   3156 O  O   . ASN B 1 147 ? 30.593 39.931  8.491   1.00 43.56  ? 188 ASN B O   1 
ATOM   3157 C  CB  . ASN B 1 147 ? 28.589 40.448  10.383  1.00 54.45  ? 188 ASN B CB  1 
ATOM   3158 C  CG  . ASN B 1 147 ? 27.113 40.409  10.781  1.00 66.15  ? 188 ASN B CG  1 
ATOM   3159 O  OD1 . ASN B 1 147 ? 26.321 39.676  10.187  1.00 70.80  ? 188 ASN B OD1 1 
ATOM   3160 N  ND2 . ASN B 1 147 ? 26.741 41.196  11.780  1.00 71.51  ? 188 ASN B ND2 1 
ATOM   3161 N  N   . PHE B 1 148 ? 31.340 38.147  9.597   1.00 31.20  ? 189 PHE B N   1 
ATOM   3162 C  CA  . PHE B 1 148 ? 32.505 38.052  8.774   1.00 37.74  ? 189 PHE B CA  1 
ATOM   3163 C  C   . PHE B 1 148 ? 32.042 37.073  7.688   1.00 41.97  ? 189 PHE B C   1 
ATOM   3164 O  O   . PHE B 1 148 ? 30.932 36.518  7.743   1.00 34.68  ? 189 PHE B O   1 
ATOM   3165 C  CB  . PHE B 1 148 ? 33.671 37.430  9.540   1.00 47.92  ? 189 PHE B CB  1 
ATOM   3166 C  CG  . PHE B 1 148 ? 34.312 38.350  10.539  1.00 61.05  ? 189 PHE B CG  1 
ATOM   3167 C  CD1 . PHE B 1 148 ? 35.255 37.861  11.433  1.00 63.46  ? 189 PHE B CD1 1 
ATOM   3168 C  CD2 . PHE B 1 148 ? 33.978 39.703  10.587  1.00 67.44  ? 189 PHE B CD2 1 
ATOM   3169 C  CE1 . PHE B 1 148 ? 35.852 38.696  12.360  1.00 68.68  ? 189 PHE B CE1 1 
ATOM   3170 C  CE2 . PHE B 1 148 ? 34.572 40.556  11.515  1.00 72.20  ? 189 PHE B CE2 1 
ATOM   3171 C  CZ  . PHE B 1 148 ? 35.511 40.050  12.405  1.00 71.73  ? 189 PHE B CZ  1 
ATOM   3172 N  N   . LEU B 1 149 ? 32.885 36.869  6.691   1.00 31.31  ? 190 LEU B N   1 
ATOM   3173 C  CA  . LEU B 1 149 ? 32.561 35.913  5.670   1.00 31.56  ? 190 LEU B CA  1 
ATOM   3174 C  C   . LEU B 1 149 ? 32.832 34.520  6.281   1.00 25.41  ? 190 LEU B C   1 
ATOM   3175 O  O   . LEU B 1 149 ? 33.814 34.341  6.976   1.00 29.96  ? 190 LEU B O   1 
ATOM   3176 C  CB  . LEU B 1 149 ? 33.460 36.185  4.466   1.00 28.03  ? 190 LEU B CB  1 
ATOM   3177 C  CG  . LEU B 1 149 ? 33.364 35.279  3.257   1.00 31.77  ? 190 LEU B CG  1 
ATOM   3178 C  CD1 . LEU B 1 149 ? 34.151 35.910  2.091   1.00 28.95  ? 190 LEU B CD1 1 
ATOM   3179 C  CD2 . LEU B 1 149 ? 33.954 33.910  3.643   1.00 22.69  ? 190 LEU B CD2 1 
ATOM   3180 N  N   . GLN B 1 150 ? 31.976 33.537  6.024   1.00 25.42  ? 191 GLN B N   1 
ATOM   3181 C  CA  . GLN B 1 150 ? 32.192 32.179  6.560   1.00 26.33  ? 191 GLN B CA  1 
ATOM   3182 C  C   . GLN B 1 150 ? 32.444 31.199  5.435   1.00 31.23  ? 191 GLN B C   1 
ATOM   3183 O  O   . GLN B 1 150 ? 31.820 31.297  4.382   1.00 28.73  ? 191 GLN B O   1 
ATOM   3184 C  CB  . GLN B 1 150 ? 30.974 31.708  7.329   1.00 27.48  ? 191 GLN B CB  1 
ATOM   3185 C  CG  . GLN B 1 150 ? 30.652 32.530  8.558   1.00 35.97  ? 191 GLN B CG  1 
ATOM   3186 C  CD  . GLN B 1 150 ? 29.359 32.094  9.213   1.00 34.62  ? 191 GLN B CD  1 
ATOM   3187 O  OE1 . GLN B 1 150 ? 28.538 32.924  9.602   1.00 47.21  ? 191 GLN B OE1 1 
ATOM   3188 N  NE2 . GLN B 1 150 ? 29.167 30.797  9.332   1.00 41.59  ? 191 GLN B NE2 1 
ATOM   3189 N  N   . THR B 1 151 ? 33.315 30.226  5.678   1.00 28.40  ? 192 THR B N   1 
ATOM   3190 C  CA  . THR B 1 151 ? 33.658 29.249  4.670   1.00 31.91  ? 192 THR B CA  1 
ATOM   3191 C  C   . THR B 1 151 ? 34.039 27.898  5.266   1.00 32.79  ? 192 THR B C   1 
ATOM   3192 O  O   . THR B 1 151 ? 34.527 27.835  6.388   1.00 37.35  ? 192 THR B O   1 
ATOM   3193 C  CB  . THR B 1 151 ? 34.858 29.748  3.830   1.00 37.39  ? 192 THR B CB  1 
ATOM   3194 O  OG1 . THR B 1 151 ? 35.246 28.699  2.940   1.00 37.74  ? 192 THR B OG1 1 
ATOM   3195 C  CG2 . THR B 1 151 ? 36.067 30.099  4.739   1.00 34.91  ? 192 THR B CG2 1 
ATOM   3196 N  N   . ASP B 1 152 ? 33.835 26.818  4.526   1.00 31.63  ? 193 ASP B N   1 
ATOM   3197 C  CA  . ASP B 1 152 ? 34.213 25.491  5.046   1.00 29.26  ? 193 ASP B CA  1 
ATOM   3198 C  C   . ASP B 1 152 ? 35.591 25.122  4.560   1.00 31.16  ? 193 ASP B C   1 
ATOM   3199 O  O   . ASP B 1 152 ? 36.019 23.976  4.633   1.00 42.00  ? 193 ASP B O   1 
ATOM   3200 C  CB  . ASP B 1 152 ? 33.189 24.409  4.661   1.00 31.37  ? 193 ASP B CB  1 
ATOM   3201 C  CG  . ASP B 1 152 ? 33.037 24.235  3.141   1.00 35.70  ? 193 ASP B CG  1 
ATOM   3202 O  OD1 . ASP B 1 152 ? 33.487 25.121  2.398   1.00 31.10  ? 193 ASP B OD1 1 
ATOM   3203 O  OD2 . ASP B 1 152 ? 32.468 23.198  2.702   1.00 32.33  ? 193 ASP B OD2 1 
ATOM   3204 N  N   . ALA B 1 153 ? 36.286 26.110  4.015   1.00 33.53  ? 194 ALA B N   1 
ATOM   3205 C  CA  . ALA B 1 153 ? 37.658 25.908  3.620   1.00 41.53  ? 194 ALA B CA  1 
ATOM   3206 C  C   . ALA B 1 153 ? 38.235 25.883  5.056   1.00 48.85  ? 194 ALA B C   1 
ATOM   3207 O  O   . ALA B 1 153 ? 37.772 26.641  5.926   1.00 52.47  ? 194 ALA B O   1 
ATOM   3208 C  CB  . ALA B 1 153 ? 38.140 27.107  2.833   1.00 37.68  ? 194 ALA B CB  1 
ATOM   3209 N  N   . SER B 1 154 ? 39.173 24.990  5.348   1.00 55.60  ? 195 SER B N   1 
ATOM   3210 C  CA  . SER B 1 154 ? 39.688 24.921  6.721   1.00 60.78  ? 195 SER B CA  1 
ATOM   3211 C  C   . SER B 1 154 ? 40.627 26.072  7.075   1.00 61.68  ? 195 SER B C   1 
ATOM   3212 O  O   . SER B 1 154 ? 41.663 26.240  6.455   1.00 63.08  ? 195 SER B O   1 
ATOM   3213 C  CB  . SER B 1 154 ? 40.388 23.574  6.962   1.00 65.83  ? 195 SER B CB  1 
ATOM   3214 O  OG  . SER B 1 154 ? 41.437 23.349  6.035   1.00 72.99  ? 195 SER B OG  1 
ATOM   3215 N  N   . ILE B 1 155 ? 40.251 26.867  8.072   1.00 63.16  ? 196 ILE B N   1 
ATOM   3216 C  CA  . ILE B 1 155 ? 41.070 28.004  8.493   1.00 66.28  ? 196 ILE B CA  1 
ATOM   3217 C  C   . ILE B 1 155 ? 41.824 27.751  9.807   1.00 66.94  ? 196 ILE B C   1 
ATOM   3218 O  O   . ILE B 1 155 ? 41.223 27.755  10.887  1.00 66.34  ? 196 ILE B O   1 
ATOM   3219 C  CB  . ILE B 1 155 ? 40.205 29.285  8.677   1.00 64.26  ? 196 ILE B CB  1 
ATOM   3220 C  CG1 . ILE B 1 155 ? 39.348 29.546  7.419   1.00 66.67  ? 196 ILE B CG1 1 
ATOM   3221 C  CG2 . ILE B 1 155 ? 41.099 30.466  9.007   1.00 60.49  ? 196 ILE B CG2 1 
ATOM   3222 C  CD1 . ILE B 1 155 ? 40.115 29.532  6.105   1.00 60.59  ? 196 ILE B CD1 1 
ATOM   3223 N  N   . ASN B 1 156 ? 43.133 27.521  9.714   1.00 71.63  ? 197 ASN B N   1 
ATOM   3224 C  CA  . ASN B 1 156 ? 43.942 27.304  10.917  1.00 77.06  ? 197 ASN B CA  1 
ATOM   3225 C  C   . ASN B 1 156 ? 45.176 28.212  10.999  1.00 75.01  ? 197 ASN B C   1 
ATOM   3226 O  O   . ASN B 1 156 ? 45.334 29.148  10.209  1.00 72.53  ? 197 ASN B O   1 
ATOM   3227 C  CB  . ASN B 1 156 ? 44.393 25.847  11.027  1.00 82.90  ? 197 ASN B CB  1 
ATOM   3228 C  CG  . ASN B 1 156 ? 44.912 25.511  12.426  1.00 92.61  ? 197 ASN B CG  1 
ATOM   3229 O  OD1 . ASN B 1 156 ? 44.173 25.619  13.413  1.00 94.92  ? 197 ASN B OD1 1 
ATOM   3230 N  ND2 . ASN B 1 156 ? 46.187 25.122  12.520  1.00 90.87  ? 197 ASN B ND2 1 
ATOM   3231 N  N   . HIS B 1 157 ? 46.047 27.922  11.962  1.00 71.65  ? 198 HIS B N   1 
ATOM   3232 C  CA  . HIS B 1 157 ? 47.260 28.696  12.171  1.00 69.25  ? 198 HIS B CA  1 
ATOM   3233 C  C   . HIS B 1 157 ? 48.104 28.934  10.934  1.00 64.86  ? 198 HIS B C   1 
ATOM   3234 O  O   . HIS B 1 157 ? 48.621 30.029  10.766  1.00 64.37  ? 198 HIS B O   1 
ATOM   3235 C  CB  . HIS B 1 157 ? 48.103 28.048  13.257  1.00 75.37  ? 198 HIS B CB  1 
ATOM   3236 C  CG  . HIS B 1 157 ? 47.586 28.309  14.635  1.00 83.54  ? 198 HIS B CG  1 
ATOM   3237 N  ND1 . HIS B 1 157 ? 47.468 29.581  15.153  1.00 85.87  ? 198 HIS B ND1 1 
ATOM   3238 C  CD2 . HIS B 1 157 ? 47.139 27.467  15.598  1.00 87.57  ? 198 HIS B CD2 1 
ATOM   3239 C  CE1 . HIS B 1 157 ? 46.971 29.513  16.375  1.00 89.17  ? 198 HIS B CE1 1 
ATOM   3240 N  NE2 . HIS B 1 157 ? 46.762 28.241  16.669  1.00 90.45  ? 198 HIS B NE2 1 
ATOM   3241 N  N   . GLY B 1 158 ? 48.233 27.931  10.066  1.00 60.74  ? 199 GLY B N   1 
ATOM   3242 C  CA  . GLY B 1 158 ? 49.029 28.094  8.854   1.00 58.64  ? 199 GLY B CA  1 
ATOM   3243 C  C   . GLY B 1 158 ? 48.311 28.845  7.728   1.00 63.58  ? 199 GLY B C   1 
ATOM   3244 O  O   . GLY B 1 158 ? 48.836 28.980  6.603   1.00 62.73  ? 199 GLY B O   1 
ATOM   3245 N  N   . ASN B 1 159 ? 47.120 29.359  8.037   1.00 53.27  ? 200 ASN B N   1 
ATOM   3246 C  CA  . ASN B 1 159 ? 46.294 30.066  7.056   1.00 56.41  ? 200 ASN B CA  1 
ATOM   3247 C  C   . ASN B 1 159 ? 46.020 31.486  7.454   1.00 49.99  ? 200 ASN B C   1 
ATOM   3248 O  O   . ASN B 1 159 ? 45.900 32.374  6.615   1.00 49.18  ? 200 ASN B O   1 
ATOM   3249 C  CB  . ASN B 1 159 ? 44.904 29.401  6.923   1.00 56.76  ? 200 ASN B CB  1 
ATOM   3250 C  CG  . ASN B 1 159 ? 44.821 28.474  5.758   1.00 57.81  ? 200 ASN B CG  1 
ATOM   3251 O  OD1 . ASN B 1 159 ? 45.615 28.566  4.820   1.00 66.10  ? 200 ASN B OD1 1 
ATOM   3252 N  ND2 . ASN B 1 159 ? 43.857 27.583  5.790   1.00 45.14  ? 200 ASN B ND2 1 
ATOM   3253 N  N   . SER B 1 160 ? 45.873 31.663  8.757   1.00 48.58  ? 201 SER B N   1 
ATOM   3254 C  CA  . SER B 1 160 ? 45.512 32.936  9.312   1.00 45.06  ? 201 SER B CA  1 
ATOM   3255 C  C   . SER B 1 160 ? 46.368 34.038  8.755   1.00 43.94  ? 201 SER B C   1 
ATOM   3256 O  O   . SER B 1 160 ? 47.591 33.944  8.756   1.00 46.75  ? 201 SER B O   1 
ATOM   3257 C  CB  . SER B 1 160 ? 45.586 32.882  10.838  1.00 48.28  ? 201 SER B CB  1 
ATOM   3258 O  OG  . SER B 1 160 ? 44.593 33.728  11.407  1.00 51.42  ? 201 SER B OG  1 
ATOM   3259 N  N   . GLY B 1 161 ? 45.694 35.068  8.254   1.00 43.90  ? 202 GLY B N   1 
ATOM   3260 C  CA  . GLY B 1 161 ? 46.363 36.221  7.690   1.00 44.35  ? 202 GLY B CA  1 
ATOM   3261 C  C   . GLY B 1 161 ? 46.574 36.015  6.215   1.00 40.85  ? 202 GLY B C   1 
ATOM   3262 O  O   . GLY B 1 161 ? 46.953 36.953  5.513   1.00 43.87  ? 202 GLY B O   1 
ATOM   3263 N  N   . GLY B 1 162 ? 46.330 34.779  5.767   1.00 36.31  ? 203 GLY B N   1 
ATOM   3264 C  CA  . GLY B 1 162 ? 46.474 34.406  4.366   1.00 31.32  ? 203 GLY B CA  1 
ATOM   3265 C  C   . GLY B 1 162 ? 45.280 34.813  3.527   1.00 31.20  ? 203 GLY B C   1 
ATOM   3266 O  O   . GLY B 1 162 ? 44.365 35.493  4.020   1.00 27.91  ? 203 GLY B O   1 
ATOM   3267 N  N   . ALA B 1 163 ? 45.259 34.356  2.273   1.00 30.26  ? 204 ALA B N   1 
ATOM   3268 C  CA  . ALA B 1 163 ? 44.196 34.709  1.332   1.00 29.51  ? 204 ALA B CA  1 
ATOM   3269 C  C   . ALA B 1 163 ? 43.106 33.664  1.091   1.00 31.53  ? 204 ALA B C   1 
ATOM   3270 O  O   . ALA B 1 163 ? 43.366 32.472  1.067   1.00 28.17  ? 204 ALA B O   1 
ATOM   3271 C  CB  . ALA B 1 163 ? 44.817 35.092  -0.059  1.00 24.33  ? 204 ALA B CB  1 
ATOM   3272 N  N   . LEU B 1 164 ? 41.889 34.153  0.864   1.00 25.98  ? 205 LEU B N   1 
ATOM   3273 C  CA  . LEU B 1 164 ? 40.754 33.326  0.522   1.00 27.80  ? 205 LEU B CA  1 
ATOM   3274 C  C   . LEU B 1 164 ? 40.464 33.878  -0.889  1.00 30.22  ? 205 LEU B C   1 
ATOM   3275 O  O   . LEU B 1 164 ? 40.148 35.071  -1.029  1.00 27.52  ? 205 LEU B O   1 
ATOM   3276 C  CB  . LEU B 1 164 ? 39.578 33.621  1.462   1.00 24.76  ? 205 LEU B CB  1 
ATOM   3277 C  CG  . LEU B 1 164 ? 38.571 32.545  1.910   1.00 35.08  ? 205 LEU B CG  1 
ATOM   3278 C  CD1 . LEU B 1 164 ? 37.209 32.928  1.475   1.00 28.76  ? 205 LEU B CD1 1 
ATOM   3279 C  CD2 . LEU B 1 164 ? 38.963 31.160  1.426   1.00 22.75  ? 205 LEU B CD2 1 
ATOM   3280 N  N   . VAL B 1 165 ? 40.576 33.041  -1.920  1.00 24.02  ? 206 VAL B N   1 
ATOM   3281 C  CA  . VAL B 1 165 ? 40.346 33.509  -3.290  1.00 25.81  ? 206 VAL B CA  1 
ATOM   3282 C  C   . VAL B 1 165 ? 39.286 32.678  -4.018  1.00 30.25  ? 206 VAL B C   1 
ATOM   3283 O  O   . VAL B 1 165 ? 39.034 31.543  -3.614  1.00 23.35  ? 206 VAL B O   1 
ATOM   3284 C  CB  . VAL B 1 165 ? 41.702 33.487  -4.112  1.00 34.64  ? 206 VAL B CB  1 
ATOM   3285 C  CG1 . VAL B 1 165 ? 42.730 34.359  -3.411  1.00 21.87  ? 206 VAL B CG1 1 
ATOM   3286 C  CG2 . VAL B 1 165 ? 42.280 32.043  -4.205  1.00 27.44  ? 206 VAL B CG2 1 
ATOM   3287 N  N   . ASN B 1 166 ? 38.666 33.224  -5.081  1.00 24.92  ? 207 ASN B N   1 
ATOM   3288 C  CA  . ASN B 1 166 ? 37.665 32.445  -5.811  1.00 20.06  ? 207 ASN B CA  1 
ATOM   3289 C  C   . ASN B 1 166 ? 38.364 31.614  -6.884  1.00 23.52  ? 207 ASN B C   1 
ATOM   3290 O  O   . ASN B 1 166 ? 39.579 31.551  -6.908  1.00 22.30  ? 207 ASN B O   1 
ATOM   3291 C  CB  . ASN B 1 166 ? 36.545 33.329  -6.415  1.00 24.89  ? 207 ASN B CB  1 
ATOM   3292 C  CG  . ASN B 1 166 ? 37.066 34.376  -7.430  1.00 30.46  ? 207 ASN B CG  1 
ATOM   3293 O  OD1 . ASN B 1 166 ? 38.163 34.250  -7.967  1.00 27.90  ? 207 ASN B OD1 1 
ATOM   3294 N  ND2 . ASN B 1 166 ? 36.257 35.413  -7.686  1.00 28.30  ? 207 ASN B ND2 1 
ATOM   3295 N  N   . SER B 1 167 ? 37.626 30.948  -7.762  1.00 28.02  ? 208 SER B N   1 
ATOM   3296 C  CA  . SER B 1 167 ? 38.325 30.120  -8.753  1.00 35.79  ? 208 SER B CA  1 
ATOM   3297 C  C   . SER B 1 167 ? 39.114 30.909  -9.824  1.00 37.43  ? 208 SER B C   1 
ATOM   3298 O  O   . SER B 1 167 ? 39.834 30.324  -10.628 1.00 33.91  ? 208 SER B O   1 
ATOM   3299 C  CB  . SER B 1 167 ? 37.348 29.188  -9.463  1.00 26.65  ? 208 SER B CB  1 
ATOM   3300 O  OG  . SER B 1 167 ? 36.480 29.938  -10.290 1.00 29.96  ? 208 SER B OG  1 
ATOM   3301 N  N   . LEU B 1 168 ? 38.978 32.223  -9.855  1.00 34.77  ? 209 LEU B N   1 
ATOM   3302 C  CA  . LEU B 1 168 ? 39.734 32.996  -10.843 1.00 37.93  ? 209 LEU B CA  1 
ATOM   3303 C  C   . LEU B 1 168 ? 40.973 33.542  -10.155 1.00 35.21  ? 209 LEU B C   1 
ATOM   3304 O  O   . LEU B 1 168 ? 41.758 34.255  -10.763 1.00 39.98  ? 209 LEU B O   1 
ATOM   3305 C  CB  . LEU B 1 168 ? 38.889 34.163  -11.390 1.00 36.84  ? 209 LEU B CB  1 
ATOM   3306 C  CG  . LEU B 1 168 ? 37.498 33.809  -11.967 1.00 43.17  ? 209 LEU B CG  1 
ATOM   3307 C  CD1 . LEU B 1 168 ? 36.809 35.045  -12.489 1.00 39.77  ? 209 LEU B CD1 1 
ATOM   3308 C  CD2 . LEU B 1 168 ? 37.653 32.811  -13.111 1.00 37.66  ? 209 LEU B CD2 1 
ATOM   3309 N  N   . GLY B 1 169 ? 41.160 33.218  -8.881  1.00 29.30  ? 210 GLY B N   1 
ATOM   3310 C  CA  . GLY B 1 169 ? 42.317 33.761  -8.189  1.00 27.25  ? 210 GLY B CA  1 
ATOM   3311 C  C   . GLY B 1 169 ? 42.054 35.144  -7.568  1.00 32.00  ? 210 GLY B C   1 
ATOM   3312 O  O   . GLY B 1 169 ? 42.956 35.771  -6.989  1.00 31.83  ? 210 GLY B O   1 
ATOM   3313 N  N   . GLU B 1 170 ? 40.826 35.638  -7.665  1.00 25.47  ? 211 GLU B N   1 
ATOM   3314 C  CA  . GLU B 1 170 ? 40.515 36.948  -7.072  1.00 33.58  ? 211 GLU B CA  1 
ATOM   3315 C  C   . GLU B 1 170 ? 40.258 36.843  -5.562  1.00 35.91  ? 211 GLU B C   1 
ATOM   3316 O  O   . GLU B 1 170 ? 39.608 35.885  -5.084  1.00 28.88  ? 211 GLU B O   1 
ATOM   3317 C  CB  . GLU B 1 170 ? 39.286 37.572  -7.751  1.00 32.66  ? 211 GLU B CB  1 
ATOM   3318 C  CG  . GLU B 1 170 ? 39.475 37.778  -9.281  1.00 35.90  ? 211 GLU B CG  1 
ATOM   3319 C  CD  . GLU B 1 170 ? 38.147 37.905  -10.027 1.00 49.88  ? 211 GLU B CD  1 
ATOM   3320 O  OE1 . GLU B 1 170 ? 38.181 38.278  -11.220 1.00 48.59  ? 211 GLU B OE1 1 
ATOM   3321 O  OE2 . GLU B 1 170 ? 37.069 37.622  -9.428  1.00 46.55  ? 211 GLU B OE2 1 
ATOM   3322 N  N   . LEU B 1 171 ? 40.765 37.839  -4.831  1.00 29.51  ? 212 LEU B N   1 
ATOM   3323 C  CA  . LEU B 1 171 ? 40.616 37.925  -3.384  1.00 27.63  ? 212 LEU B CA  1 
ATOM   3324 C  C   . LEU B 1 171 ? 39.174 38.079  -2.947  1.00 29.00  ? 212 LEU B C   1 
ATOM   3325 O  O   . LEU B 1 171 ? 38.468 39.022  -3.356  1.00 31.41  ? 212 LEU B O   1 
ATOM   3326 C  CB  . LEU B 1 171 ? 41.429 39.112  -2.829  1.00 18.89  ? 212 LEU B CB  1 
ATOM   3327 C  CG  . LEU B 1 171 ? 41.518 39.257  -1.306  1.00 29.80  ? 212 LEU B CG  1 
ATOM   3328 C  CD1 . LEU B 1 171 ? 42.317 38.073  -0.682  1.00 27.20  ? 212 LEU B CD1 1 
ATOM   3329 C  CD2 . LEU B 1 171 ? 42.240 40.579  -0.986  1.00 33.35  ? 212 LEU B CD2 1 
HETATM 3330 N  N   . MSE B 1 172 ? 38.739 37.163  -2.095  1.00 25.60  ? 213 MSE B N   1 
HETATM 3331 C  CA  . MSE B 1 172 ? 37.383 37.209  -1.541  1.00 22.88  ? 213 MSE B CA  1 
HETATM 3332 C  C   . MSE B 1 172 ? 37.493 37.711  -0.080  1.00 26.65  ? 213 MSE B C   1 
HETATM 3333 O  O   . MSE B 1 172 ? 36.577 38.329  0.437   1.00 25.50  ? 213 MSE B O   1 
HETATM 3334 C  CB  . MSE B 1 172 ? 36.745 35.809  -1.511  1.00 27.44  ? 213 MSE B CB  1 
HETATM 3335 C  CG  . MSE B 1 172 ? 36.426 35.242  -2.891  1.00 35.64  ? 213 MSE B CG  1 
HETATM 3336 SE SE  . MSE B 1 172 ? 35.030 36.240  -3.810  1.00 48.56  ? 213 MSE B SE  1 
HETATM 3337 C  CE  . MSE B 1 172 ? 33.925 34.677  -3.923  1.00 51.93  ? 213 MSE B CE  1 
ATOM   3338 N  N   . GLY B 1 173 ? 38.604 37.437  0.590   1.00 25.52  ? 214 GLY B N   1 
ATOM   3339 C  CA  . GLY B 1 173 ? 38.702 37.864  1.991   1.00 26.57  ? 214 GLY B CA  1 
ATOM   3340 C  C   . GLY B 1 173 ? 40.063 37.522  2.587   1.00 28.16  ? 214 GLY B C   1 
ATOM   3341 O  O   . GLY B 1 173 ? 40.881 36.925  1.903   1.00 29.64  ? 214 GLY B O   1 
ATOM   3342 N  N   . ILE B 1 174 ? 40.311 37.934  3.828   1.00 27.07  ? 215 ILE B N   1 
ATOM   3343 C  CA  . ILE B 1 174 ? 41.560 37.657  4.518   1.00 24.48  ? 215 ILE B CA  1 
ATOM   3344 C  C   . ILE B 1 174 ? 41.239 36.638  5.632   1.00 26.19  ? 215 ILE B C   1 
ATOM   3345 O  O   . ILE B 1 174 ? 40.397 36.888  6.498   1.00 25.05  ? 215 ILE B O   1 
ATOM   3346 C  CB  . ILE B 1 174 ? 42.162 38.943  5.205   1.00 32.08  ? 215 ILE B CB  1 
ATOM   3347 C  CG1 . ILE B 1 174 ? 42.523 40.019  4.166   1.00 29.36  ? 215 ILE B CG1 1 
ATOM   3348 C  CG2 . ILE B 1 174 ? 43.396 38.548  6.051   1.00 29.84  ? 215 ILE B CG2 1 
ATOM   3349 C  CD1 . ILE B 1 174 ? 43.559 39.559  3.123   1.00 32.65  ? 215 ILE B CD1 1 
ATOM   3350 N  N   . ASN B 1 175 ? 41.914 35.503  5.630   1.00 26.82  ? 216 ASN B N   1 
ATOM   3351 C  CA  . ASN B 1 175 ? 41.622 34.497  6.655   1.00 39.84  ? 216 ASN B CA  1 
ATOM   3352 C  C   . ASN B 1 175 ? 41.919 34.986  8.066   1.00 39.51  ? 216 ASN B C   1 
ATOM   3353 O  O   . ASN B 1 175 ? 42.939 35.611  8.297   1.00 39.63  ? 216 ASN B O   1 
ATOM   3354 C  CB  . ASN B 1 175 ? 42.441 33.243  6.392   1.00 40.10  ? 216 ASN B CB  1 
ATOM   3355 C  CG  . ASN B 1 175 ? 42.208 32.682  5.005   1.00 44.01  ? 216 ASN B CG  1 
ATOM   3356 O  OD1 . ASN B 1 175 ? 43.137 32.203  4.345   1.00 49.23  ? 216 ASN B OD1 1 
ATOM   3357 N  ND2 . ASN B 1 175 ? 40.966 32.720  4.563   1.00 37.17  ? 216 ASN B ND2 1 
ATOM   3358 N  N   . THR B 1 176 ? 41.027 34.705  9.002   1.00 41.99  ? 217 THR B N   1 
ATOM   3359 C  CA  . THR B 1 176 ? 41.257 35.089  10.386  1.00 50.80  ? 217 THR B CA  1 
ATOM   3360 C  C   . THR B 1 176 ? 40.805 33.972  11.348  1.00 53.93  ? 217 THR B C   1 
ATOM   3361 O  O   . THR B 1 176 ? 39.771 33.346  11.145  1.00 51.46  ? 217 THR B O   1 
ATOM   3362 C  CB  . THR B 1 176 ? 40.527 36.394  10.725  1.00 50.02  ? 217 THR B CB  1 
ATOM   3363 O  OG1 . THR B 1 176 ? 40.876 36.797  12.055  1.00 58.25  ? 217 THR B OG1 1 
ATOM   3364 C  CG2 . THR B 1 176 ? 39.046 36.208  10.644  1.00 51.84  ? 217 THR B CG2 1 
ATOM   3365 N  N   . LEU B 1 177 ? 41.587 33.700  12.382  1.00 59.82  ? 218 LEU B N   1 
ATOM   3366 C  CA  . LEU B 1 177 ? 41.194 32.659  13.328  1.00 70.42  ? 218 LEU B CA  1 
ATOM   3367 C  C   . LEU B 1 177 ? 40.053 33.079  14.247  1.00 78.49  ? 218 LEU B C   1 
ATOM   3368 O  O   . LEU B 1 177 ? 40.224 33.924  15.122  1.00 81.57  ? 218 LEU B O   1 
ATOM   3369 C  CB  . LEU B 1 177 ? 42.385 32.204  14.164  1.00 70.47  ? 218 LEU B CB  1 
ATOM   3370 C  CG  . LEU B 1 177 ? 43.161 31.034  13.552  1.00 70.82  ? 218 LEU B CG  1 
ATOM   3371 C  CD1 . LEU B 1 177 ? 44.244 30.611  14.538  1.00 74.86  ? 218 LEU B CD1 1 
ATOM   3372 C  CD2 . LEU B 1 177 ? 42.221 29.853  13.257  1.00 66.87  ? 218 LEU B CD2 1 
ATOM   3373 N  N   . SER B 1 178 ? 38.889 32.472  14.021  1.00 86.63  ? 219 SER B N   1 
ATOM   3374 C  CA  . SER B 1 178 ? 37.657 32.714  14.780  1.00 93.63  ? 219 SER B CA  1 
ATOM   3375 C  C   . SER B 1 178 ? 37.382 34.162  15.191  1.00 98.27  ? 219 SER B C   1 
ATOM   3376 O  O   . SER B 1 178 ? 38.082 35.085  14.759  1.00 97.80  ? 219 SER B O   1 
ATOM   3377 C  CB  . SER B 1 178 ? 37.623 31.814  16.022  1.00 92.96  ? 219 SER B CB  1 
ATOM   3378 O  OG  . SER B 1 178 ? 37.587 30.449  15.647  1.00 91.84  ? 219 SER B OG  1 
ATOM   3379 N  N   . PHE B 1 179 ? 36.340 34.338  16.012  1.00 101.14 ? 220 PHE B N   1 
ATOM   3380 C  CA  . PHE B 1 179 ? 35.928 35.649  16.518  1.00 104.54 ? 220 PHE B CA  1 
ATOM   3381 C  C   . PHE B 1 179 ? 34.570 35.645  17.230  1.00 107.88 ? 220 PHE B C   1 
ATOM   3382 O  O   . PHE B 1 179 ? 34.012 34.580  17.517  1.00 110.04 ? 220 PHE B O   1 
ATOM   3383 C  CB  . PHE B 1 179 ? 35.890 36.672  15.382  1.00 102.46 ? 220 PHE B CB  1 
ATOM   3384 C  CG  . PHE B 1 179 ? 36.946 37.723  15.492  1.00 100.51 ? 220 PHE B CG  1 
ATOM   3385 C  CD1 . PHE B 1 179 ? 36.999 38.554  16.606  1.00 98.25  ? 220 PHE B CD1 1 
ATOM   3386 C  CD2 . PHE B 1 179 ? 37.899 37.876  14.491  1.00 99.73  ? 220 PHE B CD2 1 
ATOM   3387 C  CE1 . PHE B 1 179 ? 37.987 39.525  16.720  1.00 100.16 ? 220 PHE B CE1 1 
ATOM   3388 C  CE2 . PHE B 1 179 ? 38.887 38.842  14.595  1.00 99.04  ? 220 PHE B CE2 1 
ATOM   3389 C  CZ  . PHE B 1 179 ? 38.933 39.671  15.713  1.00 99.46  ? 220 PHE B CZ  1 
ATOM   3390 N  N   . ASP B 1 180 ? 34.061 36.852  17.502  1.00 108.43 ? 221 ASP B N   1 
ATOM   3391 C  CA  . ASP B 1 180 ? 32.773 37.092  18.173  1.00 106.97 ? 221 ASP B CA  1 
ATOM   3392 C  C   . ASP B 1 180 ? 32.964 37.361  19.663  1.00 107.64 ? 221 ASP B C   1 
ATOM   3393 O  O   . ASP B 1 180 ? 32.362 38.282  20.223  1.00 108.04 ? 221 ASP B O   1 
ATOM   3394 C  CB  . ASP B 1 180 ? 31.816 35.903  17.985  1.00 105.06 ? 221 ASP B CB  1 
ATOM   3395 C  CG  . ASP B 1 180 ? 30.387 36.227  18.387  1.00 103.03 ? 221 ASP B CG  1 
ATOM   3396 O  OD1 . ASP B 1 180 ? 29.770 37.101  17.738  1.00 98.73  ? 221 ASP B OD1 1 
ATOM   3397 O  OD2 . ASP B 1 180 ? 29.882 35.607  19.350  1.00 101.63 ? 221 ASP B OD2 1 
ATOM   3398 N  N   . PRO B 1 188 ? 31.630 27.722  16.152  1.00 109.13 ? 229 PRO B N   1 
ATOM   3399 C  CA  . PRO B 1 188 ? 32.666 27.492  15.139  1.00 108.56 ? 229 PRO B CA  1 
ATOM   3400 C  C   . PRO B 1 188 ? 33.349 26.114  15.199  1.00 106.43 ? 229 PRO B C   1 
ATOM   3401 O  O   . PRO B 1 188 ? 34.415 25.953  15.802  1.00 107.40 ? 229 PRO B O   1 
ATOM   3402 C  CB  . PRO B 1 188 ? 33.633 28.649  15.382  1.00 109.28 ? 229 PRO B CB  1 
ATOM   3403 C  CG  . PRO B 1 188 ? 32.691 29.771  15.735  1.00 109.08 ? 229 PRO B CG  1 
ATOM   3404 C  CD  . PRO B 1 188 ? 31.711 29.097  16.685  1.00 109.74 ? 229 PRO B CD  1 
ATOM   3405 N  N   . GLU B 1 189 ? 32.718 25.127  14.567  1.00 102.01 ? 230 GLU B N   1 
ATOM   3406 C  CA  . GLU B 1 189 ? 33.246 23.766  14.507  1.00 96.19  ? 230 GLU B CA  1 
ATOM   3407 C  C   . GLU B 1 189 ? 34.147 23.632  13.268  1.00 90.21  ? 230 GLU B C   1 
ATOM   3408 O  O   . GLU B 1 189 ? 35.318 24.002  13.312  1.00 89.11  ? 230 GLU B O   1 
ATOM   3409 C  CB  . GLU B 1 189 ? 32.088 22.751  14.453  1.00 98.38  ? 230 GLU B CB  1 
ATOM   3410 C  CG  . GLU B 1 189 ? 30.728 23.346  14.080  1.00 97.91  ? 230 GLU B CG  1 
ATOM   3411 C  CD  . GLU B 1 189 ? 30.154 24.238  15.174  1.00 100.81 ? 230 GLU B CD  1 
ATOM   3412 O  OE1 . GLU B 1 189 ? 29.090 24.859  14.947  1.00 99.10  ? 230 GLU B OE1 1 
ATOM   3413 O  OE2 . GLU B 1 189 ? 30.767 24.316  16.264  1.00 101.99 ? 230 GLU B OE2 1 
ATOM   3414 N  N   . GLY B 1 190 ? 33.606 23.114  12.168  1.00 85.36  ? 231 GLY B N   1 
ATOM   3415 C  CA  . GLY B 1 190 ? 34.398 22.982  10.953  1.00 78.73  ? 231 GLY B CA  1 
ATOM   3416 C  C   . GLY B 1 190 ? 34.128 24.161  10.033  1.00 73.29  ? 231 GLY B C   1 
ATOM   3417 O  O   . GLY B 1 190 ? 34.040 24.014  8.811   1.00 73.09  ? 231 GLY B O   1 
ATOM   3418 N  N   . ILE B 1 191 ? 33.992 25.337  10.637  1.00 64.51  ? 232 ILE B N   1 
ATOM   3419 C  CA  . ILE B 1 191 ? 33.705 26.566  9.910   1.00 58.53  ? 232 ILE B CA  1 
ATOM   3420 C  C   . ILE B 1 191 ? 34.718 27.675  10.149  1.00 50.61  ? 232 ILE B C   1 
ATOM   3421 O  O   . ILE B 1 191 ? 34.961 28.063  11.285  1.00 51.19  ? 232 ILE B O   1 
ATOM   3422 C  CB  . ILE B 1 191 ? 32.330 27.114  10.289  1.00 59.41  ? 232 ILE B CB  1 
ATOM   3423 C  CG1 . ILE B 1 191 ? 32.252 28.591  9.899   1.00 58.65  ? 232 ILE B CG1 1 
ATOM   3424 C  CG2 . ILE B 1 191 ? 32.081 26.901  11.772  1.00 69.12  ? 232 ILE B CG2 1 
ATOM   3425 C  CD1 . ILE B 1 191 ? 31.128 29.325  10.528  1.00 64.70  ? 232 ILE B CD1 1 
ATOM   3426 N  N   . GLY B 1 192 ? 35.270 28.197  9.056   1.00 45.19  ? 233 GLY B N   1 
ATOM   3427 C  CA  . GLY B 1 192 ? 36.266 29.262  9.109   1.00 37.70  ? 233 GLY B CA  1 
ATOM   3428 C  C   . GLY B 1 192 ? 35.716 30.637  8.806   1.00 34.58  ? 233 GLY B C   1 
ATOM   3429 O  O   . GLY B 1 192 ? 34.647 30.767  8.228   1.00 33.45  ? 233 GLY B O   1 
ATOM   3430 N  N   . PHE B 1 193 ? 36.445 31.667  9.221   1.00 32.14  ? 234 PHE B N   1 
ATOM   3431 C  CA  . PHE B 1 193 ? 36.038 33.050  9.014   1.00 31.39  ? 234 PHE B CA  1 
ATOM   3432 C  C   . PHE B 1 193 ? 37.115 33.825  8.276   1.00 34.50  ? 234 PHE B C   1 
ATOM   3433 O  O   . PHE B 1 193 ? 38.301 33.496  8.371   1.00 27.65  ? 234 PHE B O   1 
ATOM   3434 C  CB  . PHE B 1 193 ? 35.773 33.741  10.355  1.00 29.62  ? 234 PHE B CB  1 
ATOM   3435 C  CG  . PHE B 1 193 ? 34.722 33.061  11.175  1.00 35.12  ? 234 PHE B CG  1 
ATOM   3436 C  CD1 . PHE B 1 193 ? 35.043 31.956  11.963  1.00 41.43  ? 234 PHE B CD1 1 
ATOM   3437 C  CD2 . PHE B 1 193 ? 33.405 33.486  11.126  1.00 32.27  ? 234 PHE B CD2 1 
ATOM   3438 C  CE1 . PHE B 1 193 ? 34.061 31.285  12.690  1.00 40.21  ? 234 PHE B CE1 1 
ATOM   3439 C  CE2 . PHE B 1 193 ? 32.408 32.822  11.848  1.00 37.90  ? 234 PHE B CE2 1 
ATOM   3440 C  CZ  . PHE B 1 193 ? 32.731 31.727  12.625  1.00 38.85  ? 234 PHE B CZ  1 
ATOM   3441 N  N   . ALA B 1 194 ? 36.687 34.850  7.539   1.00 29.20  ? 235 ALA B N   1 
ATOM   3442 C  CA  . ALA B 1 194 ? 37.613 35.713  6.806   1.00 31.25  ? 235 ALA B CA  1 
ATOM   3443 C  C   . ALA B 1 194 ? 37.010 37.099  6.826   1.00 27.11  ? 235 ALA B C   1 
ATOM   3444 O  O   . ALA B 1 194 ? 35.794 37.238  6.984   1.00 26.47  ? 235 ALA B O   1 
ATOM   3445 C  CB  . ALA B 1 194 ? 37.795 35.227  5.320   1.00 24.12  ? 235 ALA B CB  1 
ATOM   3446 N  N   . ILE B 1 195 ? 37.851 38.126  6.725   1.00 28.50  ? 236 ILE B N   1 
ATOM   3447 C  CA  . ILE B 1 195 ? 37.339 39.508  6.670   1.00 26.53  ? 236 ILE B CA  1 
ATOM   3448 C  C   . ILE B 1 195 ? 37.010 39.718  5.171   1.00 26.41  ? 236 ILE B C   1 
ATOM   3449 O  O   . ILE B 1 195 ? 37.878 39.563  4.328   1.00 27.10  ? 236 ILE B O   1 
ATOM   3450 C  CB  . ILE B 1 195 ? 38.449 40.553  7.070   1.00 25.79  ? 236 ILE B CB  1 
ATOM   3451 C  CG1 . ILE B 1 195 ? 38.970 40.254  8.484   1.00 29.07  ? 236 ILE B CG1 1 
ATOM   3452 C  CG2 . ILE B 1 195 ? 37.919 41.976  6.881   1.00 29.47  ? 236 ILE B CG2 1 
ATOM   3453 C  CD1 . ILE B 1 195 ? 37.874 40.258  9.565   1.00 36.59  ? 236 ILE B CD1 1 
ATOM   3454 N  N   . PRO B 1 196 ? 35.768 40.051  4.832   1.00 26.43  ? 237 PRO B N   1 
ATOM   3455 C  CA  . PRO B 1 196 ? 35.431 40.265  3.405   1.00 28.40  ? 237 PRO B CA  1 
ATOM   3456 C  C   . PRO B 1 196 ? 36.454 41.242  2.773   1.00 33.69  ? 237 PRO B C   1 
ATOM   3457 O  O   . PRO B 1 196 ? 36.816 42.261  3.407   1.00 27.96  ? 237 PRO B O   1 
ATOM   3458 C  CB  . PRO B 1 196 ? 34.035 40.896  3.460   1.00 27.22  ? 237 PRO B CB  1 
ATOM   3459 C  CG  . PRO B 1 196 ? 33.425 40.339  4.772   1.00 29.86  ? 237 PRO B CG  1 
ATOM   3460 C  CD  . PRO B 1 196 ? 34.640 40.377  5.725   1.00 23.69  ? 237 PRO B CD  1 
ATOM   3461 N  N   . PHE B 1 197 ? 36.894 40.967  1.536   1.00 26.62  ? 238 PHE B N   1 
ATOM   3462 C  CA  . PHE B 1 197 ? 37.889 41.835  0.896   1.00 26.31  ? 238 PHE B CA  1 
ATOM   3463 C  C   . PHE B 1 197 ? 37.475 43.310  0.798   1.00 27.96  ? 238 PHE B C   1 
ATOM   3464 O  O   . PHE B 1 197 ? 38.322 44.184  0.927   1.00 32.07  ? 238 PHE B O   1 
ATOM   3465 C  CB  . PHE B 1 197 ? 38.304 41.286  -0.493  1.00 29.47  ? 238 PHE B CB  1 
ATOM   3466 C  CG  . PHE B 1 197 ? 37.392 41.687  -1.635  1.00 29.30  ? 238 PHE B CG  1 
ATOM   3467 C  CD1 . PHE B 1 197 ? 37.623 42.863  -2.341  1.00 25.56  ? 238 PHE B CD1 1 
ATOM   3468 C  CD2 . PHE B 1 197 ? 36.304 40.872  -2.008  1.00 28.19  ? 238 PHE B CD2 1 
ATOM   3469 C  CE1 . PHE B 1 197 ? 36.773 43.245  -3.421  1.00 33.58  ? 238 PHE B CE1 1 
ATOM   3470 C  CE2 . PHE B 1 197 ? 35.456 41.227  -3.070  1.00 33.56  ? 238 PHE B CE2 1 
ATOM   3471 C  CZ  . PHE B 1 197 ? 35.686 42.424  -3.784  1.00 35.49  ? 238 PHE B CZ  1 
ATOM   3472 N  N   . GLN B 1 198 ? 36.192 43.591  0.576   1.00 27.98  ? 239 GLN B N   1 
ATOM   3473 C  CA  . GLN B 1 198 ? 35.724 44.976  0.478   1.00 31.44  ? 239 GLN B CA  1 
ATOM   3474 C  C   . GLN B 1 198 ? 36.000 45.700  1.801   1.00 33.99  ? 239 GLN B C   1 
ATOM   3475 O  O   . GLN B 1 198 ? 36.359 46.861  1.784   1.00 35.33  ? 239 GLN B O   1 
ATOM   3476 C  CB  . GLN B 1 198 ? 34.206 45.046  0.180   1.00 30.30  ? 239 GLN B CB  1 
ATOM   3477 C  CG  . GLN B 1 198 ? 33.705 44.280  -1.048  1.00 29.21  ? 239 GLN B CG  1 
ATOM   3478 C  CD  . GLN B 1 198 ? 33.105 42.906  -0.675  1.00 43.28  ? 239 GLN B CD  1 
ATOM   3479 O  OE1 . GLN B 1 198 ? 31.998 42.555  -1.119  1.00 40.85  ? 239 GLN B OE1 1 
ATOM   3480 N  NE2 . GLN B 1 198 ? 33.826 42.138  0.152   1.00 25.38  ? 239 GLN B NE2 1 
ATOM   3481 N  N   . LEU B 1 199 ? 35.825 45.011  2.938   1.00 37.78  ? 240 LEU B N   1 
ATOM   3482 C  CA  . LEU B 1 199 ? 36.088 45.598  4.267   1.00 32.70  ? 240 LEU B CA  1 
ATOM   3483 C  C   . LEU B 1 199 ? 37.603 45.740  4.501   1.00 29.08  ? 240 LEU B C   1 
ATOM   3484 O  O   . LEU B 1 199 ? 38.073 46.772  4.961   1.00 30.99  ? 240 LEU B O   1 
ATOM   3485 C  CB  . LEU B 1 199 ? 35.526 44.703  5.381   1.00 29.01  ? 240 LEU B CB  1 
ATOM   3486 C  CG  . LEU B 1 199 ? 34.943 45.332  6.660   1.00 44.57  ? 240 LEU B CG  1 
ATOM   3487 C  CD1 . LEU B 1 199 ? 35.015 44.341  7.832   1.00 33.30  ? 240 LEU B CD1 1 
ATOM   3488 C  CD2 . LEU B 1 199 ? 35.651 46.643  6.977   1.00 32.57  ? 240 LEU B CD2 1 
ATOM   3489 N  N   . ALA B 1 200 ? 38.352 44.678  4.198   1.00 23.56  ? 241 ALA B N   1 
ATOM   3490 C  CA  . ALA B 1 200 ? 39.792 44.661  4.383   1.00 32.00  ? 241 ALA B CA  1 
ATOM   3491 C  C   . ALA B 1 200 ? 40.451 45.803  3.587   1.00 30.73  ? 241 ALA B C   1 
ATOM   3492 O  O   . ALA B 1 200 ? 41.394 46.416  4.059   1.00 34.26  ? 241 ALA B O   1 
ATOM   3493 C  CB  . ALA B 1 200 ? 40.370 43.301  3.949   1.00 22.68  ? 241 ALA B CB  1 
ATOM   3494 N  N   . THR B 1 201 ? 39.957 46.066  2.384   1.00 32.45  ? 242 THR B N   1 
ATOM   3495 C  CA  . THR B 1 201 ? 40.491 47.153  1.561   1.00 36.04  ? 242 THR B CA  1 
ATOM   3496 C  C   . THR B 1 201 ? 40.233 48.510  2.244   1.00 35.46  ? 242 THR B C   1 
ATOM   3497 O  O   . THR B 1 201 ? 41.135 49.355  2.306   1.00 28.05  ? 242 THR B O   1 
ATOM   3498 C  CB  . THR B 1 201 ? 39.851 47.133  0.148   1.00 32.28  ? 242 THR B CB  1 
ATOM   3499 O  OG1 . THR B 1 201 ? 40.497 46.117  -0.628  1.00 34.86  ? 242 THR B OG1 1 
ATOM   3500 C  CG2 . THR B 1 201 ? 40.005 48.490  -0.560  1.00 43.63  ? 242 THR B CG2 1 
ATOM   3501 N  N   . LYS B 1 202 ? 39.029 48.700  2.788   1.00 27.66  ? 243 LYS B N   1 
ATOM   3502 C  CA  . LYS B 1 202 ? 38.710 49.967  3.445   1.00 37.95  ? 243 LYS B CA  1 
ATOM   3503 C  C   . LYS B 1 202 ? 39.569 50.147  4.700   1.00 40.45  ? 243 LYS B C   1 
ATOM   3504 O  O   . LYS B 1 202 ? 40.074 51.236  4.977   1.00 40.83  ? 243 LYS B O   1 
ATOM   3505 C  CB  . LYS B 1 202 ? 37.258 50.009  3.881   1.00 41.44  ? 243 LYS B CB  1 
ATOM   3506 C  CG  . LYS B 1 202 ? 36.222 50.215  2.818   1.00 47.62  ? 243 LYS B CG  1 
ATOM   3507 C  CD  . LYS B 1 202 ? 34.846 50.073  3.515   1.00 46.56  ? 243 LYS B CD  1 
ATOM   3508 C  CE  . LYS B 1 202 ? 33.720 50.498  2.628   1.00 58.65  ? 243 LYS B CE  1 
ATOM   3509 N  NZ  . LYS B 1 202 ? 32.482 49.782  3.003   1.00 63.76  ? 243 LYS B NZ  1 
ATOM   3510 N  N   . ILE B 1 203 ? 39.726 49.063  5.453   1.00 37.29  ? 244 ILE B N   1 
ATOM   3511 C  CA  . ILE B 1 203 ? 40.515 49.081  6.678   1.00 34.48  ? 244 ILE B CA  1 
ATOM   3512 C  C   . ILE B 1 203 ? 41.970 49.432  6.370   1.00 35.53  ? 244 ILE B C   1 
ATOM   3513 O  O   . ILE B 1 203 ? 42.551 50.315  6.996   1.00 33.28  ? 244 ILE B O   1 
ATOM   3514 C  CB  . ILE B 1 203 ? 40.466 47.714  7.370   1.00 35.04  ? 244 ILE B CB  1 
ATOM   3515 C  CG1 . ILE B 1 203 ? 39.053 47.472  7.955   1.00 36.14  ? 244 ILE B CG1 1 
ATOM   3516 C  CG2 . ILE B 1 203 ? 41.579 47.590  8.405   1.00 28.97  ? 244 ILE B CG2 1 
ATOM   3517 C  CD1 . ILE B 1 203 ? 38.683 48.323  9.123   1.00 47.26  ? 244 ILE B CD1 1 
HETATM 3518 N  N   . MSE B 1 204 ? 42.554 48.728  5.413   1.00 33.92  ? 245 MSE B N   1 
HETATM 3519 C  CA  . MSE B 1 204 ? 43.934 48.966  5.044   1.00 35.74  ? 245 MSE B CA  1 
HETATM 3520 C  C   . MSE B 1 204 ? 44.153 50.434  4.642   1.00 36.45  ? 245 MSE B C   1 
HETATM 3521 O  O   . MSE B 1 204 ? 45.136 51.024  5.060   1.00 33.09  ? 245 MSE B O   1 
HETATM 3522 C  CB  . MSE B 1 204 ? 44.357 48.017  3.902   1.00 38.77  ? 245 MSE B CB  1 
HETATM 3523 C  CG  . MSE B 1 204 ? 45.670 48.430  3.238   1.00 40.34  ? 245 MSE B CG  1 
HETATM 3524 SE SE  . MSE B 1 204 ? 46.253 47.335  1.756   1.00 51.34  ? 245 MSE B SE  1 
HETATM 3525 C  CE  . MSE B 1 204 ? 44.929 47.824  0.431   1.00 46.36  ? 245 MSE B CE  1 
ATOM   3526 N  N   . ASP B 1 205 ? 43.240 51.016  3.854   1.00 34.60  ? 246 ASP B N   1 
ATOM   3527 C  CA  . ASP B 1 205 ? 43.360 52.429  3.430   1.00 37.42  ? 246 ASP B CA  1 
ATOM   3528 C  C   . ASP B 1 205 ? 43.384 53.357  4.624   1.00 35.74  ? 246 ASP B C   1 
ATOM   3529 O  O   . ASP B 1 205 ? 44.182 54.287  4.673   1.00 34.16  ? 246 ASP B O   1 
ATOM   3530 C  CB  . ASP B 1 205 ? 42.204 52.858  2.497   1.00 31.50  ? 246 ASP B CB  1 
ATOM   3531 C  CG  . ASP B 1 205 ? 42.274 52.178  1.150   1.00 46.03  ? 246 ASP B CG  1 
ATOM   3532 O  OD1 . ASP B 1 205 ? 43.384 51.711  0.799   1.00 51.34  ? 246 ASP B OD1 1 
ATOM   3533 O  OD2 . ASP B 1 205 ? 41.241 52.115  0.441   1.00 53.58  ? 246 ASP B OD2 1 
ATOM   3534 N  N   . LYS B 1 206 ? 42.481 53.115  5.569   1.00 35.06  ? 247 LYS B N   1 
ATOM   3535 C  CA  . LYS B 1 206 ? 42.419 53.914  6.773   1.00 33.61  ? 247 LYS B CA  1 
ATOM   3536 C  C   . LYS B 1 206 ? 43.677 53.730  7.609   1.00 37.58  ? 247 LYS B C   1 
ATOM   3537 O  O   . LYS B 1 206 ? 44.136 54.692  8.223   1.00 34.59  ? 247 LYS B O   1 
ATOM   3538 C  CB  . LYS B 1 206 ? 41.170 53.557  7.588   1.00 35.81  ? 247 LYS B CB  1 
ATOM   3539 C  CG  . LYS B 1 206 ? 39.932 54.038  6.882   1.00 37.09  ? 247 LYS B CG  1 
ATOM   3540 C  CD  . LYS B 1 206 ? 38.656 53.688  7.598   1.00 41.54  ? 247 LYS B CD  1 
ATOM   3541 C  CE  . LYS B 1 206 ? 37.473 54.232  6.795   1.00 48.05  ? 247 LYS B CE  1 
ATOM   3542 N  NZ  . LYS B 1 206 ? 37.473 55.746  6.701   1.00 43.15  ? 247 LYS B NZ  1 
ATOM   3543 N  N   . LEU B 1 207 ? 44.244 52.517  7.636   1.00 30.44  ? 248 LEU B N   1 
ATOM   3544 C  CA  . LEU B 1 207 ? 45.464 52.299  8.426   1.00 33.96  ? 248 LEU B CA  1 
ATOM   3545 C  C   . LEU B 1 207 ? 46.648 53.017  7.794   1.00 38.92  ? 248 LEU B C   1 
ATOM   3546 O  O   . LEU B 1 207 ? 47.539 53.532  8.482   1.00 36.84  ? 248 LEU B O   1 
ATOM   3547 C  CB  . LEU B 1 207 ? 45.812 50.804  8.537   1.00 26.45  ? 248 LEU B CB  1 
ATOM   3548 C  CG  . LEU B 1 207 ? 44.911 50.007  9.502   1.00 41.99  ? 248 LEU B CG  1 
ATOM   3549 C  CD1 . LEU B 1 207 ? 45.311 48.502  9.548   1.00 33.86  ? 248 LEU B CD1 1 
ATOM   3550 C  CD2 . LEU B 1 207 ? 45.027 50.629  10.899  1.00 38.84  ? 248 LEU B CD2 1 
ATOM   3551 N  N   . ILE B 1 208 ? 46.664 53.037  6.471   1.00 36.04  ? 249 ILE B N   1 
ATOM   3552 C  CA  . ILE B 1 208 ? 47.740 53.684  5.777   1.00 39.06  ? 249 ILE B CA  1 
ATOM   3553 C  C   . ILE B 1 208 ? 47.724 55.200  6.028   1.00 41.78  ? 249 ILE B C   1 
ATOM   3554 O  O   . ILE B 1 208 ? 48.773 55.779  6.303   1.00 38.99  ? 249 ILE B O   1 
ATOM   3555 C  CB  . ILE B 1 208 ? 47.666 53.342  4.284   1.00 40.56  ? 249 ILE B CB  1 
ATOM   3556 C  CG1 . ILE B 1 208 ? 48.122 51.894  4.095   1.00 34.75  ? 249 ILE B CG1 1 
ATOM   3557 C  CG2 . ILE B 1 208 ? 48.563 54.268  3.474   1.00 44.89  ? 249 ILE B CG2 1 
ATOM   3558 C  CD1 . ILE B 1 208 ? 47.856 51.338  2.720   1.00 36.04  ? 249 ILE B CD1 1 
ATOM   3559 N  N   . ARG B 1 209 ? 46.537 55.816  5.969   1.00 33.03  ? 250 ARG B N   1 
ATOM   3560 C  CA  . ARG B 1 209 ? 46.376 57.247  6.183   1.00 38.17  ? 250 ARG B CA  1 
ATOM   3561 C  C   . ARG B 1 209 ? 46.536 57.724  7.626   1.00 39.83  ? 250 ARG B C   1 
ATOM   3562 O  O   . ARG B 1 209 ? 47.215 58.717  7.864   1.00 39.73  ? 250 ARG B O   1 
ATOM   3563 C  CB  . ARG B 1 209 ? 44.990 57.718  5.683   1.00 35.45  ? 250 ARG B CB  1 
ATOM   3564 C  CG  . ARG B 1 209 ? 44.859 57.798  4.169   1.00 36.11  ? 250 ARG B CG  1 
ATOM   3565 C  CD  . ARG B 1 209 ? 43.424 58.173  3.771   1.00 39.23  ? 250 ARG B CD  1 
ATOM   3566 N  NE  . ARG B 1 209 ? 43.018 59.494  4.242   1.00 45.56  ? 250 ARG B NE  1 
ATOM   3567 C  CZ  . ARG B 1 209 ? 43.408 60.653  3.695   1.00 49.37  ? 250 ARG B CZ  1 
ATOM   3568 N  NH1 . ARG B 1 209 ? 44.233 60.669  2.648   1.00 36.68  ? 250 ARG B NH1 1 
ATOM   3569 N  NH2 . ARG B 1 209 ? 42.936 61.802  4.170   1.00 33.36  ? 250 ARG B NH2 1 
ATOM   3570 N  N   . ASP B 1 210 ? 45.922 57.015  8.581   1.00 40.05  ? 251 ASP B N   1 
ATOM   3571 C  CA  . ASP B 1 210 ? 45.941 57.437  9.986   1.00 42.70  ? 251 ASP B CA  1 
ATOM   3572 C  C   . ASP B 1 210 ? 46.765 56.636  10.997  1.00 38.30  ? 251 ASP B C   1 
ATOM   3573 O  O   . ASP B 1 210 ? 47.002 57.109  12.104  1.00 46.79  ? 251 ASP B O   1 
ATOM   3574 C  CB  . ASP B 1 210 ? 44.503 57.551  10.496  1.00 40.22  ? 251 ASP B CB  1 
ATOM   3575 C  CG  . ASP B 1 210 ? 43.679 58.577  9.717   1.00 53.58  ? 251 ASP B CG  1 
ATOM   3576 O  OD1 . ASP B 1 210 ? 44.060 59.785  9.704   1.00 47.52  ? 251 ASP B OD1 1 
ATOM   3577 O  OD2 . ASP B 1 210 ? 42.643 58.173  9.122   1.00 49.27  ? 251 ASP B OD2 1 
ATOM   3578 N  N   . GLY B 1 211 ? 47.226 55.452  10.627  1.00 41.81  ? 252 GLY B N   1 
ATOM   3579 C  CA  . GLY B 1 211 ? 48.016 54.653  11.562  1.00 40.39  ? 252 GLY B CA  1 
ATOM   3580 C  C   . GLY B 1 211 ? 47.129 53.816  12.478  1.00 43.26  ? 252 GLY B C   1 
ATOM   3581 O  O   . GLY B 1 211 ? 47.602 52.988  13.261  1.00 47.76  ? 252 GLY B O   1 
ATOM   3582 N  N   . ARG B 1 212 ? 45.824 54.042  12.390  1.00 44.81  ? 253 ARG B N   1 
ATOM   3583 C  CA  . ARG B 1 212 ? 44.854 53.296  13.190  1.00 46.12  ? 253 ARG B CA  1 
ATOM   3584 C  C   . ARG B 1 212 ? 43.553 53.529  12.448  1.00 44.60  ? 253 ARG B C   1 
ATOM   3585 O  O   . ARG B 1 212 ? 43.529 54.328  11.509  1.00 45.63  ? 253 ARG B O   1 
ATOM   3586 C  CB  . ARG B 1 212 ? 44.780 53.846  14.629  1.00 41.84  ? 253 ARG B CB  1 
ATOM   3587 C  CG  . ARG B 1 212 ? 44.235 55.272  14.745  1.00 48.25  ? 253 ARG B CG  1 
ATOM   3588 C  CD  . ARG B 1 212 ? 44.431 55.842  16.167  1.00 52.02  ? 253 ARG B CD  1 
ATOM   3589 N  NE  . ARG B 1 212 ? 43.375 56.797  16.490  1.00 51.42  ? 253 ARG B NE  1 
ATOM   3590 C  CZ  . ARG B 1 212 ? 43.442 58.103  16.272  1.00 57.56  ? 253 ARG B CZ  1 
ATOM   3591 N  NH1 . ARG B 1 212 ? 44.535 58.647  15.738  1.00 62.57  ? 253 ARG B NH1 1 
ATOM   3592 N  NH2 . ARG B 1 212 ? 42.389 58.862  16.543  1.00 56.26  ? 253 ARG B NH2 1 
ATOM   3593 N  N   . VAL B 1 213 ? 42.485 52.848  12.851  1.00 42.43  ? 254 VAL B N   1 
ATOM   3594 C  CA  . VAL B 1 213 ? 41.202 53.006  12.193  1.00 40.01  ? 254 VAL B CA  1 
ATOM   3595 C  C   . VAL B 1 213 ? 40.387 53.954  13.009  1.00 39.69  ? 254 VAL B C   1 
ATOM   3596 O  O   . VAL B 1 213 ? 40.112 53.686  14.157  1.00 47.97  ? 254 VAL B O   1 
ATOM   3597 C  CB  . VAL B 1 213 ? 40.439 51.666  12.090  1.00 42.83  ? 254 VAL B CB  1 
ATOM   3598 C  CG1 . VAL B 1 213 ? 39.015 51.905  11.621  1.00 41.23  ? 254 VAL B CG1 1 
ATOM   3599 C  CG2 . VAL B 1 213 ? 41.143 50.750  11.128  1.00 36.48  ? 254 VAL B CG2 1 
ATOM   3600 N  N   . ILE B 1 214 ? 39.977 55.065  12.424  1.00 41.62  ? 255 ILE B N   1 
ATOM   3601 C  CA  . ILE B 1 214 ? 39.188 56.024  13.179  1.00 43.36  ? 255 ILE B CA  1 
ATOM   3602 C  C   . ILE B 1 214 ? 37.736 55.889  12.761  1.00 44.98  ? 255 ILE B C   1 
ATOM   3603 O  O   . ILE B 1 214 ? 37.387 56.120  11.602  1.00 48.43  ? 255 ILE B O   1 
ATOM   3604 C  CB  . ILE B 1 214 ? 39.694 57.465  12.939  1.00 43.40  ? 255 ILE B CB  1 
ATOM   3605 C  CG1 . ILE B 1 214 ? 41.163 57.555  13.350  1.00 41.15  ? 255 ILE B CG1 1 
ATOM   3606 C  CG2 . ILE B 1 214 ? 38.847 58.477  13.733  1.00 43.72  ? 255 ILE B CG2 1 
ATOM   3607 C  CD1 . ILE B 1 214 ? 41.798 58.931  13.073  1.00 43.00  ? 255 ILE B CD1 1 
ATOM   3608 N  N   . ARG B 1 215 ? 36.885 55.497  13.705  1.00 46.71  ? 256 ARG B N   1 
ATOM   3609 C  CA  . ARG B 1 215 ? 35.478 55.316  13.390  1.00 43.66  ? 256 ARG B CA  1 
ATOM   3610 C  C   . ARG B 1 215 ? 34.595 56.376  14.008  1.00 47.32  ? 256 ARG B C   1 
ATOM   3611 O  O   . ARG B 1 215 ? 34.769 56.751  15.175  1.00 46.88  ? 256 ARG B O   1 
ATOM   3612 C  CB  . ARG B 1 215 ? 35.000 53.941  13.858  1.00 42.52  ? 256 ARG B CB  1 
ATOM   3613 C  CG  . ARG B 1 215 ? 35.606 52.755  13.126  1.00 35.63  ? 256 ARG B CG  1 
ATOM   3614 C  CD  . ARG B 1 215 ? 35.203 51.476  13.853  1.00 39.76  ? 256 ARG B CD  1 
ATOM   3615 N  NE  . ARG B 1 215 ? 35.556 50.264  13.129  1.00 35.99  ? 256 ARG B NE  1 
ATOM   3616 C  CZ  . ARG B 1 215 ? 36.706 49.623  13.252  1.00 38.28  ? 256 ARG B CZ  1 
ATOM   3617 N  NH1 . ARG B 1 215 ? 37.649 50.063  14.090  1.00 40.85  ? 256 ARG B NH1 1 
ATOM   3618 N  NH2 . ARG B 1 215 ? 36.916 48.540  12.529  1.00 39.21  ? 256 ARG B NH2 1 
ATOM   3619 N  N   . GLY B 1 216 ? 33.649 56.869  13.217  1.00 46.84  ? 257 GLY B N   1 
ATOM   3620 C  CA  . GLY B 1 216 ? 32.709 57.843  13.737  1.00 57.69  ? 257 GLY B CA  1 
ATOM   3621 C  C   . GLY B 1 216 ? 31.714 57.125  14.646  1.00 66.77  ? 257 GLY B C   1 
ATOM   3622 O  O   . GLY B 1 216 ? 31.349 55.975  14.400  1.00 63.29  ? 257 GLY B O   1 
ATOM   3623 N  N   . TYR B 1 217 ? 31.288 57.811  15.703  1.00 75.55  ? 258 TYR B N   1 
ATOM   3624 C  CA  . TYR B 1 217 ? 30.340 57.277  16.680  1.00 80.90  ? 258 TYR B CA  1 
ATOM   3625 C  C   . TYR B 1 217 ? 29.234 58.296  16.969  1.00 82.64  ? 258 TYR B C   1 
ATOM   3626 O  O   . TYR B 1 217 ? 29.507 59.492  17.115  1.00 79.64  ? 258 TYR B O   1 
ATOM   3627 C  CB  . TYR B 1 217 ? 31.071 56.949  17.976  1.00 86.52  ? 258 TYR B CB  1 
ATOM   3628 C  CG  . TYR B 1 217 ? 30.156 56.565  19.108  1.00 94.11  ? 258 TYR B CG  1 
ATOM   3629 C  CD1 . TYR B 1 217 ? 29.328 55.449  19.009  1.00 96.33  ? 258 TYR B CD1 1 
ATOM   3630 C  CD2 . TYR B 1 217 ? 30.134 57.304  20.290  1.00 95.97  ? 258 TYR B CD2 1 
ATOM   3631 C  CE1 . TYR B 1 217 ? 28.505 55.073  20.061  1.00 100.32 ? 258 TYR B CE1 1 
ATOM   3632 C  CE2 . TYR B 1 217 ? 29.315 56.937  21.349  1.00 99.91  ? 258 TYR B CE2 1 
ATOM   3633 C  CZ  . TYR B 1 217 ? 28.504 55.820  21.228  1.00 100.87 ? 258 TYR B CZ  1 
ATOM   3634 O  OH  . TYR B 1 217 ? 27.694 55.444  22.272  1.00 101.66 ? 258 TYR B OH  1 
ATOM   3635 N  N   . ILE B 1 218 ? 27.992 57.827  17.059  1.00 81.97  ? 259 ILE B N   1 
ATOM   3636 C  CA  . ILE B 1 218 ? 26.885 58.729  17.319  1.00 85.07  ? 259 ILE B CA  1 
ATOM   3637 C  C   . ILE B 1 218 ? 26.137 58.404  18.608  1.00 89.77  ? 259 ILE B C   1 
ATOM   3638 O  O   . ILE B 1 218 ? 25.336 59.209  19.072  1.00 89.94  ? 259 ILE B O   1 
ATOM   3639 C  CB  . ILE B 1 218 ? 25.895 58.737  16.144  1.00 85.48  ? 259 ILE B CB  1 
ATOM   3640 C  CG1 . ILE B 1 218 ? 25.036 59.997  16.199  1.00 84.60  ? 259 ILE B CG1 1 
ATOM   3641 C  CG2 . ILE B 1 218 ? 25.025 57.491  16.185  1.00 86.21  ? 259 ILE B CG2 1 
ATOM   3642 C  CD1 . ILE B 1 218 ? 24.118 60.161  15.005  1.00 85.29  ? 259 ILE B CD1 1 
ATOM   3643 N  N   . GLY B 1 219 ? 26.396 57.232  19.184  1.00 93.76  ? 260 GLY B N   1 
ATOM   3644 C  CA  . GLY B 1 219 ? 25.740 56.856  20.428  1.00 100.03 ? 260 GLY B CA  1 
ATOM   3645 C  C   . GLY B 1 219 ? 24.269 56.481  20.354  1.00 103.99 ? 260 GLY B C   1 
ATOM   3646 O  O   . GLY B 1 219 ? 23.413 57.157  20.926  1.00 102.93 ? 260 GLY B O   1 
ATOM   3647 N  N   . ILE B 1 220 ? 23.970 55.390  19.659  1.00 108.61 ? 261 ILE B N   1 
ATOM   3648 C  CA  . ILE B 1 220 ? 22.595 54.934  19.518  1.00 112.28 ? 261 ILE B CA  1 
ATOM   3649 C  C   . ILE B 1 220 ? 22.543 53.435  19.267  1.00 115.72 ? 261 ILE B C   1 
ATOM   3650 O  O   . ILE B 1 220 ? 23.412 52.878  18.593  1.00 117.35 ? 261 ILE B O   1 
ATOM   3651 C  CB  . ILE B 1 220 ? 21.880 55.651  18.348  1.00 111.47 ? 261 ILE B CB  1 
ATOM   3652 C  CG1 . ILE B 1 220 ? 21.638 57.117  18.703  1.00 110.00 ? 261 ILE B CG1 1 
ATOM   3653 C  CG2 . ILE B 1 220 ? 20.564 54.954  18.030  1.00 112.51 ? 261 ILE B CG2 1 
ATOM   3654 C  CD1 . ILE B 1 220 ? 20.873 57.879  17.649  1.00 110.38 ? 261 ILE B CD1 1 
ATOM   3655 N  N   . GLY B 1 221 ? 21.520 52.790  19.819  1.00 118.87 ? 262 GLY B N   1 
ATOM   3656 C  CA  . GLY B 1 221 ? 21.344 51.360  19.635  1.00 120.91 ? 262 GLY B CA  1 
ATOM   3657 C  C   . GLY B 1 221 ? 19.935 51.086  19.143  1.00 121.52 ? 262 GLY B C   1 
ATOM   3658 O  O   . GLY B 1 221 ? 19.351 50.041  19.438  1.00 121.67 ? 262 GLY B O   1 
ATOM   3659 N  N   . GLY B 1 222 ? 19.398 52.037  18.382  1.00 121.16 ? 263 GLY B N   1 
ATOM   3660 C  CA  . GLY B 1 222 ? 18.048 51.925  17.861  1.00 122.15 ? 263 GLY B CA  1 
ATOM   3661 C  C   . GLY B 1 222 ? 17.774 50.865  16.807  1.00 121.94 ? 263 GLY B C   1 
ATOM   3662 O  O   . GLY B 1 222 ? 18.232 50.975  15.670  1.00 123.15 ? 263 GLY B O   1 
ATOM   3663 N  N   . ARG B 1 223 ? 17.004 49.846  17.185  1.00 120.47 ? 264 ARG B N   1 
ATOM   3664 C  CA  . ARG B 1 223 ? 16.647 48.761  16.277  1.00 118.50 ? 264 ARG B CA  1 
ATOM   3665 C  C   . ARG B 1 223 ? 15.269 49.008  15.670  1.00 117.02 ? 264 ARG B C   1 
ATOM   3666 O  O   . ARG B 1 223 ? 15.012 50.064  15.089  1.00 114.54 ? 264 ARG B O   1 
ATOM   3667 C  CB  . ARG B 1 223 ? 16.659 47.431  17.025  1.00 117.97 ? 264 ARG B CB  1 
ATOM   3668 N  N   . GLN B 1 239 ? 10.021 53.821  7.753   1.00 105.59 ? 280 GLN B N   1 
ATOM   3669 C  CA  . GLN B 1 239 ? 10.352 55.190  7.378   1.00 106.17 ? 280 GLN B CA  1 
ATOM   3670 C  C   . GLN B 1 239 ? 11.088 55.917  8.516   1.00 104.79 ? 280 GLN B C   1 
ATOM   3671 O  O   . GLN B 1 239 ? 10.930 57.129  8.692   1.00 104.70 ? 280 GLN B O   1 
ATOM   3672 C  CB  . GLN B 1 239 ? 9.070  55.948  7.011   1.00 109.16 ? 280 GLN B CB  1 
ATOM   3673 C  CG  . GLN B 1 239 ? 9.292  57.285  6.306   1.00 113.32 ? 280 GLN B CG  1 
ATOM   3674 C  CD  . GLN B 1 239 ? 7.995  58.051  6.074   1.00 116.12 ? 280 GLN B CD  1 
ATOM   3675 O  OE1 . GLN B 1 239 ? 7.359  58.528  7.019   1.00 115.57 ? 280 GLN B OE1 1 
ATOM   3676 N  NE2 . GLN B 1 239 ? 7.595  58.167  4.810   1.00 116.84 ? 280 GLN B NE2 1 
ATOM   3677 N  N   . GLY B 1 240 ? 11.890 55.177  9.282   1.00 101.46 ? 281 GLY B N   1 
ATOM   3678 C  CA  . GLY B 1 240 ? 12.631 55.783  10.378  1.00 98.03  ? 281 GLY B CA  1 
ATOM   3679 C  C   . GLY B 1 240 ? 13.254 54.771  11.319  1.00 95.61  ? 281 GLY B C   1 
ATOM   3680 O  O   . GLY B 1 240 ? 12.957 53.582  11.230  1.00 94.48  ? 281 GLY B O   1 
ATOM   3681 N  N   . ILE B 1 241 ? 14.114 55.239  12.223  1.00 94.68  ? 282 ILE B N   1 
ATOM   3682 C  CA  . ILE B 1 241 ? 14.781 54.359  13.185  1.00 95.41  ? 282 ILE B CA  1 
ATOM   3683 C  C   . ILE B 1 241 ? 14.310 54.598  14.615  1.00 96.53  ? 282 ILE B C   1 
ATOM   3684 O  O   . ILE B 1 241 ? 14.081 55.732  15.024  1.00 97.44  ? 282 ILE B O   1 
ATOM   3685 C  CB  . ILE B 1 241 ? 16.319 54.529  13.138  1.00 94.18  ? 282 ILE B CB  1 
ATOM   3686 C  CG1 . ILE B 1 241 ? 16.844 54.093  11.765  1.00 93.74  ? 282 ILE B CG1 1 
ATOM   3687 C  CG2 . ILE B 1 241 ? 16.967 53.712  14.248  1.00 89.09  ? 282 ILE B CG2 1 
ATOM   3688 C  CD1 . ILE B 1 241 ? 18.339 54.238  11.598  1.00 94.52  ? 282 ILE B CD1 1 
ATOM   3689 N  N   . VAL B 1 242 ? 14.187 53.518  15.377  1.00 98.33  ? 283 VAL B N   1 
ATOM   3690 C  CA  . VAL B 1 242 ? 13.717 53.601  16.756  1.00 99.52  ? 283 VAL B CA  1 
ATOM   3691 C  C   . VAL B 1 242 ? 14.828 53.456  17.786  1.00 99.83  ? 283 VAL B C   1 
ATOM   3692 O  O   . VAL B 1 242 ? 15.382 52.375  17.953  1.00 99.20  ? 283 VAL B O   1 
ATOM   3693 C  CB  . VAL B 1 242 ? 12.646 52.505  17.041  1.00 101.67 ? 283 VAL B CB  1 
ATOM   3694 C  CG1 . VAL B 1 242 ? 12.232 52.536  18.514  1.00 98.44  ? 283 VAL B CG1 1 
ATOM   3695 C  CG2 . VAL B 1 242 ? 11.434 52.708  16.132  1.00 100.05 ? 283 VAL B CG2 1 
ATOM   3696 N  N   . VAL B 1 243 ? 15.135 54.542  18.488  1.00 100.12 ? 284 VAL B N   1 
ATOM   3697 C  CA  . VAL B 1 243 ? 16.171 54.513  19.511  1.00 101.93 ? 284 VAL B CA  1 
ATOM   3698 C  C   . VAL B 1 243 ? 15.862 53.447  20.570  1.00 105.01 ? 284 VAL B C   1 
ATOM   3699 O  O   . VAL B 1 243 ? 14.740 53.349  21.056  1.00 105.75 ? 284 VAL B O   1 
ATOM   3700 C  CB  . VAL B 1 243 ? 16.297 55.886  20.210  1.00 99.31  ? 284 VAL B CB  1 
ATOM   3701 C  CG1 . VAL B 1 243 ? 17.403 55.845  21.247  1.00 98.01  ? 284 VAL B CG1 1 
ATOM   3702 C  CG2 . VAL B 1 243 ? 16.577 56.963  19.188  1.00 97.91  ? 284 VAL B CG2 1 
ATOM   3703 N  N   . ASN B 1 244 ? 16.863 52.641  20.911  1.00 108.44 ? 285 ASN B N   1 
ATOM   3704 C  CA  . ASN B 1 244 ? 16.712 51.594  21.920  1.00 111.70 ? 285 ASN B CA  1 
ATOM   3705 C  C   . ASN B 1 244 ? 17.441 52.041  23.176  1.00 113.09 ? 285 ASN B C   1 
ATOM   3706 O  O   . ASN B 1 244 ? 16.946 51.887  24.293  1.00 114.71 ? 285 ASN B O   1 
ATOM   3707 C  CB  . ASN B 1 244 ? 17.333 50.278  21.434  1.00 113.82 ? 285 ASN B CB  1 
ATOM   3708 C  CG  . ASN B 1 244 ? 16.434 49.517  20.474  1.00 116.21 ? 285 ASN B CG  1 
ATOM   3709 O  OD1 . ASN B 1 244 ? 15.791 50.105  19.601  1.00 117.50 ? 285 ASN B OD1 1 
ATOM   3710 N  ND2 . ASN B 1 244 ? 16.398 48.195  20.623  1.00 114.88 ? 285 ASN B ND2 1 
ATOM   3711 N  N   . GLU B 1 245 ? 18.628 52.600  22.971  1.00 114.53 ? 286 GLU B N   1 
ATOM   3712 C  CA  . GLU B 1 245 ? 19.466 53.069  24.063  1.00 116.19 ? 286 GLU B CA  1 
ATOM   3713 C  C   . GLU B 1 245 ? 20.219 54.320  23.602  1.00 116.54 ? 286 GLU B C   1 
ATOM   3714 O  O   . GLU B 1 245 ? 20.338 54.576  22.403  1.00 116.94 ? 286 GLU B O   1 
ATOM   3715 C  CB  . GLU B 1 245 ? 20.443 51.953  24.459  1.00 116.65 ? 286 GLU B CB  1 
ATOM   3716 C  CG  . GLU B 1 245 ? 21.049 52.069  25.850  1.00 118.86 ? 286 GLU B CG  1 
ATOM   3717 C  CD  . GLU B 1 245 ? 22.361 52.829  25.868  1.00 120.50 ? 286 GLU B CD  1 
ATOM   3718 O  OE1 . GLU B 1 245 ? 23.280 52.456  25.103  1.00 121.04 ? 286 GLU B OE1 1 
ATOM   3719 O  OE2 . GLU B 1 245 ? 22.478 53.792  26.654  1.00 121.36 ? 286 GLU B OE2 1 
ATOM   3720 N  N   . VAL B 1 246 ? 20.701 55.107  24.560  1.00 117.05 ? 287 VAL B N   1 
ATOM   3721 C  CA  . VAL B 1 246 ? 21.448 56.329  24.275  1.00 116.68 ? 287 VAL B CA  1 
ATOM   3722 C  C   . VAL B 1 246 ? 22.538 56.483  25.331  1.00 117.72 ? 287 VAL B C   1 
ATOM   3723 O  O   . VAL B 1 246 ? 22.428 57.296  26.251  1.00 116.02 ? 287 VAL B O   1 
ATOM   3724 C  CB  . VAL B 1 246 ? 20.525 57.572  24.289  1.00 115.30 ? 287 VAL B CB  1 
ATOM   3725 C  CG1 . VAL B 1 246 ? 21.352 58.840  24.187  1.00 115.94 ? 287 VAL B CG1 1 
ATOM   3726 C  CG2 . VAL B 1 246 ? 19.550 57.504  23.124  1.00 113.83 ? 287 VAL B CG2 1 
ATOM   3727 N  N   . SER B 1 247 ? 23.585 55.677  25.182  1.00 120.62 ? 288 SER B N   1 
ATOM   3728 C  CA  . SER B 1 247 ? 24.718 55.664  26.099  1.00 123.88 ? 288 SER B CA  1 
ATOM   3729 C  C   . SER B 1 247 ? 25.008 57.017  26.751  1.00 125.26 ? 288 SER B C   1 
ATOM   3730 O  O   . SER B 1 247 ? 24.878 58.067  26.121  1.00 125.29 ? 288 SER B O   1 
ATOM   3731 C  CB  . SER B 1 247 ? 25.959 55.135  25.370  1.00 123.80 ? 288 SER B CB  1 
ATOM   3732 O  OG  . SER B 1 247 ? 25.981 55.578  24.026  1.00 125.12 ? 288 SER B OG  1 
ATOM   3733 N  N   . PRO B 1 248 ? 25.407 56.996  28.035  1.00 126.35 ? 289 PRO B N   1 
ATOM   3734 C  CA  . PRO B 1 248 ? 25.726 58.182  28.837  1.00 126.33 ? 289 PRO B CA  1 
ATOM   3735 C  C   . PRO B 1 248 ? 26.894 59.038  28.346  1.00 125.88 ? 289 PRO B C   1 
ATOM   3736 O  O   . PRO B 1 248 ? 28.017 58.555  28.205  1.00 125.31 ? 289 PRO B O   1 
ATOM   3737 C  CB  . PRO B 1 248 ? 25.990 57.591  30.222  1.00 126.25 ? 289 PRO B CB  1 
ATOM   3738 C  CG  . PRO B 1 248 ? 26.578 56.254  29.902  1.00 125.57 ? 289 PRO B CG  1 
ATOM   3739 C  CD  . PRO B 1 248 ? 25.651 55.767  28.814  1.00 125.96 ? 289 PRO B CD  1 
ATOM   3740 N  N   . ASP B 1 249 ? 26.608 60.315  28.099  1.00 125.62 ? 290 ASP B N   1 
ATOM   3741 C  CA  . ASP B 1 249 ? 27.605 61.286  27.649  1.00 125.63 ? 290 ASP B CA  1 
ATOM   3742 C  C   . ASP B 1 249 ? 28.057 61.108  26.200  1.00 125.13 ? 290 ASP B C   1 
ATOM   3743 O  O   . ASP B 1 249 ? 29.143 61.554  25.827  1.00 124.35 ? 290 ASP B O   1 
ATOM   3744 C  CB  . ASP B 1 249 ? 28.820 61.261  28.587  1.00 124.93 ? 290 ASP B CB  1 
ATOM   3745 N  N   . GLY B 1 250 ? 27.222 60.469  25.386  1.00 124.74 ? 291 GLY B N   1 
ATOM   3746 C  CA  . GLY B 1 250 ? 27.565 60.264  23.989  1.00 123.73 ? 291 GLY B CA  1 
ATOM   3747 C  C   . GLY B 1 250 ? 27.049 61.393  23.114  1.00 122.47 ? 291 GLY B C   1 
ATOM   3748 O  O   . GLY B 1 250 ? 26.225 62.185  23.568  1.00 123.22 ? 291 GLY B O   1 
ATOM   3749 N  N   . PRO B 1 251 ? 27.508 61.499  21.855  1.00 121.46 ? 292 PRO B N   1 
ATOM   3750 C  CA  . PRO B 1 251 ? 27.056 62.564  20.950  1.00 121.05 ? 292 PRO B CA  1 
ATOM   3751 C  C   . PRO B 1 251 ? 25.537 62.687  20.819  1.00 121.64 ? 292 PRO B C   1 
ATOM   3752 O  O   . PRO B 1 251 ? 25.022 63.758  20.498  1.00 120.62 ? 292 PRO B O   1 
ATOM   3753 C  CB  . PRO B 1 251 ? 27.741 62.214  19.627  1.00 119.36 ? 292 PRO B CB  1 
ATOM   3754 C  CG  . PRO B 1 251 ? 28.001 60.741  19.740  1.00 119.78 ? 292 PRO B CG  1 
ATOM   3755 C  CD  . PRO B 1 251 ? 28.431 60.585  21.165  1.00 119.94 ? 292 PRO B CD  1 
ATOM   3756 N  N   . ALA B 1 252 ? 24.827 61.590  21.068  1.00 123.67 ? 293 ALA B N   1 
ATOM   3757 C  CA  . ALA B 1 252 ? 23.368 61.585  20.998  1.00 124.44 ? 293 ALA B CA  1 
ATOM   3758 C  C   . ALA B 1 252 ? 22.817 61.902  22.384  1.00 125.62 ? 293 ALA B C   1 
ATOM   3759 O  O   . ALA B 1 252 ? 21.840 62.636  22.524  1.00 125.44 ? 293 ALA B O   1 
ATOM   3760 C  CB  . ALA B 1 252 ? 22.862 60.227  20.531  1.00 123.40 ? 293 ALA B CB  1 
ATOM   3761 N  N   . ALA B 1 253 ? 23.456 61.341  23.407  1.00 126.57 ? 294 ALA B N   1 
ATOM   3762 C  CA  . ALA B 1 253 ? 23.047 61.571  24.785  1.00 127.57 ? 294 ALA B CA  1 
ATOM   3763 C  C   . ALA B 1 253 ? 23.173 63.052  25.121  1.00 128.52 ? 294 ALA B C   1 
ATOM   3764 O  O   . ALA B 1 253 ? 22.280 63.639  25.727  1.00 128.94 ? 294 ALA B O   1 
ATOM   3765 C  CB  . ALA B 1 253 ? 23.911 60.748  25.727  1.00 128.34 ? 294 ALA B CB  1 
ATOM   3766 N  N   . ASN B 1 254 ? 24.288 63.652  24.719  1.00 129.22 ? 295 ASN B N   1 
ATOM   3767 C  CA  . ASN B 1 254 ? 24.528 65.063  24.979  1.00 130.36 ? 295 ASN B CA  1 
ATOM   3768 C  C   . ASN B 1 254 ? 23.871 65.944  23.928  1.00 130.42 ? 295 ASN B C   1 
ATOM   3769 O  O   . ASN B 1 254 ? 24.493 66.856  23.394  1.00 130.12 ? 295 ASN B O   1 
ATOM   3770 C  CB  . ASN B 1 254 ? 26.029 65.344  25.020  1.00 131.80 ? 295 ASN B CB  1 
ATOM   3771 C  CG  . ASN B 1 254 ? 26.752 64.479  26.029  1.00 134.11 ? 295 ASN B CG  1 
ATOM   3772 O  OD1 . ASN B 1 254 ? 26.318 64.347  27.174  1.00 135.71 ? 295 ASN B OD1 1 
ATOM   3773 N  ND2 . ASN B 1 254 ? 27.866 63.891  25.614  1.00 135.26 ? 295 ASN B ND2 1 
ATOM   3774 N  N   . ALA B 1 255 ? 22.607 65.663  23.638  1.00 131.83 ? 296 ALA B N   1 
ATOM   3775 C  CA  . ALA B 1 255 ? 21.850 66.429  22.656  1.00 133.63 ? 296 ALA B CA  1 
ATOM   3776 C  C   . ALA B 1 255 ? 20.420 65.908  22.611  1.00 134.77 ? 296 ALA B C   1 
ATOM   3777 O  O   . ALA B 1 255 ? 20.030 65.076  23.431  1.00 134.50 ? 296 ALA B O   1 
ATOM   3778 C  CB  . ALA B 1 255 ? 22.497 66.309  21.279  1.00 133.43 ? 296 ALA B CB  1 
ATOM   3779 N  N   . GLY B 1 256 ? 19.642 66.397  21.653  1.00 136.18 ? 297 GLY B N   1 
ATOM   3780 C  CA  . GLY B 1 256 ? 18.264 65.958  21.532  1.00 138.55 ? 297 GLY B CA  1 
ATOM   3781 C  C   . GLY B 1 256 ? 18.138 64.475  21.229  1.00 139.82 ? 297 GLY B C   1 
ATOM   3782 O  O   . GLY B 1 256 ? 18.159 64.067  20.066  1.00 139.85 ? 297 GLY B O   1 
ATOM   3783 N  N   . ILE B 1 257 ? 18.005 63.666  22.277  1.00 141.16 ? 298 ILE B N   1 
ATOM   3784 C  CA  . ILE B 1 257 ? 17.870 62.218  22.130  1.00 142.46 ? 298 ILE B CA  1 
ATOM   3785 C  C   . ILE B 1 257 ? 17.774 61.555  23.501  1.00 142.67 ? 298 ILE B C   1 
ATOM   3786 O  O   . ILE B 1 257 ? 18.664 61.716  24.337  1.00 142.76 ? 298 ILE B O   1 
ATOM   3787 C  CB  . ILE B 1 257 ? 19.064 61.653  21.358  1.00 143.41 ? 298 ILE B CB  1 
ATOM   3788 N  N   . GLN B 1 258 ? 16.698 60.805  23.728  1.00 142.44 ? 299 GLN B N   1 
ATOM   3789 C  CA  . GLN B 1 258 ? 16.511 60.135  25.009  1.00 141.95 ? 299 GLN B CA  1 
ATOM   3790 C  C   . GLN B 1 258 ? 16.194 58.643  24.950  1.00 141.30 ? 299 GLN B C   1 
ATOM   3791 O  O   . GLN B 1 258 ? 16.866 57.846  25.608  1.00 141.85 ? 299 GLN B O   1 
ATOM   3792 C  CB  . GLN B 1 258 ? 15.444 60.859  25.831  1.00 142.40 ? 299 GLN B CB  1 
ATOM   3793 C  CG  . GLN B 1 258 ? 16.027 61.879  26.796  1.00 143.34 ? 299 GLN B CG  1 
ATOM   3794 C  CD  . GLN B 1 258 ? 16.892 61.231  27.869  1.00 143.94 ? 299 GLN B CD  1 
ATOM   3795 O  OE1 . GLN B 1 258 ? 17.789 60.440  27.570  1.00 143.17 ? 299 GLN B OE1 1 
ATOM   3796 N  NE2 . GLN B 1 258 ? 16.627 61.570  29.126  1.00 143.93 ? 299 GLN B NE2 1 
ATOM   3797 N  N   . VAL B 1 259 ? 15.182 58.251  24.181  1.00 139.38 ? 300 VAL B N   1 
ATOM   3798 C  CA  . VAL B 1 259 ? 14.854 56.833  24.109  1.00 136.73 ? 300 VAL B CA  1 
ATOM   3799 C  C   . VAL B 1 259 ? 13.857 56.397  23.036  1.00 134.98 ? 300 VAL B C   1 
ATOM   3800 O  O   . VAL B 1 259 ? 14.136 55.462  22.293  1.00 135.39 ? 300 VAL B O   1 
ATOM   3801 C  CB  . VAL B 1 259 ? 14.362 56.321  25.485  1.00 136.44 ? 300 VAL B CB  1 
ATOM   3802 C  CG1 . VAL B 1 259 ? 13.124 57.090  25.918  1.00 137.09 ? 300 VAL B CG1 1 
ATOM   3803 C  CG2 . VAL B 1 259 ? 14.085 54.831  25.416  1.00 136.16 ? 300 VAL B CG2 1 
ATOM   3804 N  N   . ASN B 1 260 ? 12.706 57.055  22.943  1.00 132.89 ? 301 ASN B N   1 
ATOM   3805 C  CA  . ASN B 1 260 ? 11.704 56.664  21.949  1.00 131.63 ? 301 ASN B CA  1 
ATOM   3806 C  C   . ASN B 1 260 ? 11.562 57.623  20.775  1.00 129.63 ? 301 ASN B C   1 
ATOM   3807 O  O   . ASN B 1 260 ? 10.510 57.681  20.135  1.00 128.68 ? 301 ASN B O   1 
ATOM   3808 C  CB  . ASN B 1 260 ? 10.339 56.490  22.619  1.00 134.09 ? 301 ASN B CB  1 
ATOM   3809 C  CG  . ASN B 1 260 ? 10.322 55.346  23.612  1.00 136.40 ? 301 ASN B CG  1 
ATOM   3810 O  OD1 . ASN B 1 260 ? 10.564 54.191  23.252  1.00 137.19 ? 301 ASN B OD1 1 
ATOM   3811 N  ND2 . ASN B 1 260 ? 10.034 55.661  24.871  1.00 137.35 ? 301 ASN B ND2 1 
ATOM   3812 N  N   . ASP B 1 261 ? 12.628 58.361  20.490  1.00 127.50 ? 302 ASP B N   1 
ATOM   3813 C  CA  . ASP B 1 261 ? 12.640 59.332  19.401  1.00 124.69 ? 302 ASP B CA  1 
ATOM   3814 C  C   . ASP B 1 261 ? 12.828 58.638  18.048  1.00 123.09 ? 302 ASP B C   1 
ATOM   3815 O  O   . ASP B 1 261 ? 13.644 57.724  17.919  1.00 122.20 ? 302 ASP B O   1 
ATOM   3816 C  CB  . ASP B 1 261 ? 13.765 60.333  19.651  1.00 125.08 ? 302 ASP B CB  1 
ATOM   3817 C  CG  . ASP B 1 261 ? 13.884 60.716  21.122  1.00 125.28 ? 302 ASP B CG  1 
ATOM   3818 O  OD1 . ASP B 1 261 ? 12.941 61.336  21.658  1.00 125.34 ? 302 ASP B OD1 1 
ATOM   3819 O  OD2 . ASP B 1 261 ? 14.916 60.386  21.746  1.00 123.12 ? 302 ASP B OD2 1 
ATOM   3820 N  N   . LEU B 1 262 ? 12.071 59.072  17.043  1.00 122.02 ? 303 LEU B N   1 
ATOM   3821 C  CA  . LEU B 1 262 ? 12.150 58.478  15.709  1.00 121.06 ? 303 LEU B CA  1 
ATOM   3822 C  C   . LEU B 1 262 ? 13.049 59.284  14.770  1.00 121.17 ? 303 LEU B C   1 
ATOM   3823 O  O   . LEU B 1 262 ? 12.714 60.407  14.387  1.00 120.73 ? 303 LEU B O   1 
ATOM   3824 C  CB  . LEU B 1 262 ? 10.739 58.349  15.109  1.00 120.87 ? 303 LEU B CB  1 
ATOM   3825 C  CG  . LEU B 1 262 ? 10.521 57.660  13.750  1.00 120.32 ? 303 LEU B CG  1 
ATOM   3826 C  CD1 . LEU B 1 262 ? 9.077  57.198  13.647  1.00 120.34 ? 303 LEU B CD1 1 
ATOM   3827 C  CD2 . LEU B 1 262 ? 10.856 58.604  12.606  1.00 119.00 ? 303 LEU B CD2 1 
ATOM   3828 N  N   . ILE B 1 263 ? 14.190 58.700  14.407  1.00 120.78 ? 304 ILE B N   1 
ATOM   3829 C  CA  . ILE B 1 263 ? 15.147 59.343  13.507  1.00 119.02 ? 304 ILE B CA  1 
ATOM   3830 C  C   . ILE B 1 263 ? 14.654 59.226  12.069  1.00 118.09 ? 304 ILE B C   1 
ATOM   3831 O  O   . ILE B 1 263 ? 14.318 58.137  11.610  1.00 119.03 ? 304 ILE B O   1 
ATOM   3832 C  CB  . ILE B 1 263 ? 16.545 58.686  13.587  1.00 117.90 ? 304 ILE B CB  1 
ATOM   3833 C  CG1 . ILE B 1 263 ? 17.103 58.781  15.010  1.00 117.06 ? 304 ILE B CG1 1 
ATOM   3834 C  CG2 . ILE B 1 263 ? 17.488 59.368  12.608  1.00 118.44 ? 304 ILE B CG2 1 
ATOM   3835 C  CD1 . ILE B 1 263 ? 16.429 57.867  16.007  1.00 117.90 ? 304 ILE B CD1 1 
ATOM   3836 N  N   . ILE B 1 264 ? 14.620 60.346  11.358  1.00 116.55 ? 305 ILE B N   1 
ATOM   3837 C  CA  . ILE B 1 264 ? 14.150 60.354  9.980   1.00 115.94 ? 305 ILE B CA  1 
ATOM   3838 C  C   . ILE B 1 264 ? 15.314 60.325  9.004   1.00 115.08 ? 305 ILE B C   1 
ATOM   3839 O  O   . ILE B 1 264 ? 15.191 59.815  7.889   1.00 114.79 ? 305 ILE B O   1 
ATOM   3840 C  CB  . ILE B 1 264 ? 13.319 61.608  9.695   1.00 117.18 ? 305 ILE B CB  1 
ATOM   3841 C  CG1 . ILE B 1 264 ? 12.311 61.815  10.820  1.00 117.61 ? 305 ILE B CG1 1 
ATOM   3842 C  CG2 . ILE B 1 264 ? 12.600 61.473  8.357   1.00 115.65 ? 305 ILE B CG2 1 
ATOM   3843 C  CD1 . ILE B 1 264 ? 11.626 63.146  10.752  1.00 120.59 ? 305 ILE B CD1 1 
ATOM   3844 N  N   . SER B 1 265 ? 16.440 60.893  9.425   1.00 113.54 ? 306 SER B N   1 
ATOM   3845 C  CA  . SER B 1 265 ? 17.636 60.934  8.596   1.00 111.64 ? 306 SER B CA  1 
ATOM   3846 C  C   . SER B 1 265 ? 18.817 61.516  9.372   1.00 108.66 ? 306 SER B C   1 
ATOM   3847 O  O   . SER B 1 265 ? 18.637 62.315  10.289  1.00 107.36 ? 306 SER B O   1 
ATOM   3848 C  CB  . SER B 1 265 ? 17.381 61.760  7.325   1.00 112.50 ? 306 SER B CB  1 
ATOM   3849 O  OG  . SER B 1 265 ? 17.140 63.126  7.613   1.00 114.46 ? 306 SER B OG  1 
ATOM   3850 N  N   . VAL B 1 266 ? 20.022 61.089  9.008   1.00 105.51 ? 307 VAL B N   1 
ATOM   3851 C  CA  . VAL B 1 266 ? 21.239 61.567  9.648   1.00 101.49 ? 307 VAL B CA  1 
ATOM   3852 C  C   . VAL B 1 266 ? 22.130 62.174  8.576   1.00 101.82 ? 307 VAL B C   1 
ATOM   3853 O  O   . VAL B 1 266 ? 22.298 61.598  7.501   1.00 99.42  ? 307 VAL B O   1 
ATOM   3854 C  CB  . VAL B 1 266 ? 21.991 60.424  10.355  1.00 97.65  ? 307 VAL B CB  1 
ATOM   3855 C  CG1 . VAL B 1 266 ? 23.306 60.924  10.883  1.00 95.45  ? 307 VAL B CG1 1 
ATOM   3856 C  CG2 . VAL B 1 266 ? 21.157 59.885  11.497  1.00 95.48  ? 307 VAL B CG2 1 
ATOM   3857 N  N   . ASP B 1 267 ? 22.690 63.343  8.871   1.00 103.27 ? 308 ASP B N   1 
ATOM   3858 C  CA  . ASP B 1 267 ? 23.553 64.044  7.928   1.00 106.33 ? 308 ASP B CA  1 
ATOM   3859 C  C   . ASP B 1 267 ? 22.832 64.219  6.591   1.00 106.60 ? 308 ASP B C   1 
ATOM   3860 O  O   . ASP B 1 267 ? 23.443 64.123  5.522   1.00 105.35 ? 308 ASP B O   1 
ATOM   3861 C  CB  . ASP B 1 267 ? 24.864 63.271  7.729   1.00 110.11 ? 308 ASP B CB  1 
ATOM   3862 C  CG  . ASP B 1 267 ? 25.863 64.023  6.860   1.00 113.37 ? 308 ASP B CG  1 
ATOM   3863 O  OD1 . ASP B 1 267 ? 26.156 65.199  7.170   1.00 113.25 ? 308 ASP B OD1 1 
ATOM   3864 O  OD2 . ASP B 1 267 ? 26.359 63.437  5.871   1.00 115.42 ? 308 ASP B OD2 1 
ATOM   3865 N  N   . ASN B 1 268 ? 21.526 64.474  6.662   1.00 107.12 ? 309 ASN B N   1 
ATOM   3866 C  CA  . ASN B 1 268 ? 20.701 64.672  5.471   1.00 108.01 ? 309 ASN B CA  1 
ATOM   3867 C  C   . ASN B 1 268 ? 20.723 63.485  4.509   1.00 106.74 ? 309 ASN B C   1 
ATOM   3868 O  O   . ASN B 1 268 ? 21.050 63.633  3.331   1.00 105.59 ? 309 ASN B O   1 
ATOM   3869 C  CB  . ASN B 1 268 ? 21.136 65.946  4.727   1.00 110.74 ? 309 ASN B CB  1 
ATOM   3870 C  CG  . ASN B 1 268 ? 20.451 67.202  5.253   1.00 111.20 ? 309 ASN B CG  1 
ATOM   3871 O  OD1 . ASN B 1 268 ? 20.422 67.457  6.459   1.00 111.86 ? 309 ASN B OD1 1 
ATOM   3872 N  ND2 . ASN B 1 268 ? 19.902 67.998  4.341   1.00 112.31 ? 309 ASN B ND2 1 
ATOM   3873 N  N   . LYS B 1 269 ? 20.375 62.310  5.019   1.00 105.80 ? 310 LYS B N   1 
ATOM   3874 C  CA  . LYS B 1 269 ? 20.330 61.098  4.209   1.00 107.38 ? 310 LYS B CA  1 
ATOM   3875 C  C   . LYS B 1 269 ? 19.250 60.173  4.760   1.00 107.08 ? 310 LYS B C   1 
ATOM   3876 O  O   . LYS B 1 269 ? 19.183 59.939  5.968   1.00 107.81 ? 310 LYS B O   1 
ATOM   3877 C  CB  . LYS B 1 269 ? 21.682 60.377  4.226   1.00 107.64 ? 310 LYS B CB  1 
ATOM   3878 C  CG  . LYS B 1 269 ? 22.797 61.088  3.475   1.00 108.67 ? 310 LYS B CG  1 
ATOM   3879 C  CD  . LYS B 1 269 ? 24.083 60.271  3.517   1.00 112.12 ? 310 LYS B CD  1 
ATOM   3880 C  CE  . LYS B 1 269 ? 25.245 61.008  2.858   1.00 114.39 ? 310 LYS B CE  1 
ATOM   3881 N  NZ  . LYS B 1 269 ? 26.524 60.251  2.975   1.00 112.75 ? 310 LYS B NZ  1 
ATOM   3882 N  N   . PRO B 1 270 ? 18.389 59.634  3.879   1.00 106.12 ? 311 PRO B N   1 
ATOM   3883 C  CA  . PRO B 1 270 ? 17.308 58.731  4.293   1.00 105.54 ? 311 PRO B CA  1 
ATOM   3884 C  C   . PRO B 1 270 ? 17.770 57.685  5.311   1.00 105.17 ? 311 PRO B C   1 
ATOM   3885 O  O   . PRO B 1 270 ? 18.572 56.813  4.983   1.00 106.46 ? 311 PRO B O   1 
ATOM   3886 C  CB  . PRO B 1 270 ? 16.866 58.108  2.972   1.00 105.75 ? 311 PRO B CB  1 
ATOM   3887 C  CG  . PRO B 1 270 ? 17.065 59.230  2.001   1.00 105.78 ? 311 PRO B CG  1 
ATOM   3888 C  CD  . PRO B 1 270 ? 18.419 59.777  2.410   1.00 105.79 ? 311 PRO B CD  1 
ATOM   3889 N  N   . ALA B 1 271 ? 17.260 57.776  6.540   1.00 104.29 ? 312 ALA B N   1 
ATOM   3890 C  CA  . ALA B 1 271 ? 17.627 56.842  7.609   1.00 105.28 ? 312 ALA B CA  1 
ATOM   3891 C  C   . ALA B 1 271 ? 16.791 55.552  7.622   1.00 105.99 ? 312 ALA B C   1 
ATOM   3892 O  O   . ALA B 1 271 ? 16.065 55.277  8.583   1.00 107.02 ? 312 ALA B O   1 
ATOM   3893 C  CB  . ALA B 1 271 ? 17.528 57.539  8.967   1.00 102.49 ? 312 ALA B CB  1 
ATOM   3894 N  N   . ILE B 1 272 ? 16.915 54.758  6.562   1.00 104.03 ? 313 ILE B N   1 
ATOM   3895 C  CA  . ILE B 1 272 ? 16.180 53.505  6.445   1.00 100.66 ? 313 ILE B CA  1 
ATOM   3896 C  C   . ILE B 1 272 ? 16.533 52.472  7.518   1.00 98.50  ? 313 ILE B C   1 
ATOM   3897 O  O   . ILE B 1 272 ? 15.751 52.235  8.439   1.00 99.38  ? 313 ILE B O   1 
ATOM   3898 C  CB  . ILE B 1 272 ? 16.404 52.850  5.061   1.00 101.81 ? 313 ILE B CB  1 
ATOM   3899 C  CG1 . ILE B 1 272 ? 15.752 53.692  3.960   1.00 102.94 ? 313 ILE B CG1 1 
ATOM   3900 C  CG2 . ILE B 1 272 ? 15.814 51.446  5.050   1.00 102.97 ? 313 ILE B CG2 1 
ATOM   3901 C  CD1 . ILE B 1 272 ? 16.403 55.024  3.724   1.00 100.21 ? 313 ILE B CD1 1 
ATOM   3902 N  N   . SER B 1 273 ? 17.712 51.864  7.400   1.00 93.24  ? 314 SER B N   1 
ATOM   3903 C  CA  . SER B 1 273 ? 18.141 50.831  8.342   1.00 88.31  ? 314 SER B CA  1 
ATOM   3904 C  C   . SER B 1 273 ? 19.128 51.266  9.426   1.00 83.69  ? 314 SER B C   1 
ATOM   3905 O  O   . SER B 1 273 ? 20.007 52.087  9.188   1.00 82.13  ? 314 SER B O   1 
ATOM   3906 C  CB  . SER B 1 273 ? 18.744 49.659  7.561   1.00 89.96  ? 314 SER B CB  1 
ATOM   3907 O  OG  . SER B 1 273 ? 19.284 48.682  8.435   1.00 91.35  ? 314 SER B OG  1 
ATOM   3908 N  N   . ALA B 1 274 ? 18.982 50.694  10.618  1.00 80.04  ? 315 ALA B N   1 
ATOM   3909 C  CA  . ALA B 1 274 ? 19.878 51.003  11.728  1.00 81.41  ? 315 ALA B CA  1 
ATOM   3910 C  C   . ALA B 1 274 ? 21.314 50.647  11.338  1.00 81.94  ? 315 ALA B C   1 
ATOM   3911 O  O   . ALA B 1 274 ? 22.238 51.439  11.514  1.00 83.33  ? 315 ALA B O   1 
ATOM   3912 C  CB  . ALA B 1 274 ? 19.476 50.218  12.967  1.00 75.94  ? 315 ALA B CB  1 
ATOM   3913 N  N   . LEU B 1 275 ? 21.492 49.449  10.800  1.00 80.37  ? 316 LEU B N   1 
ATOM   3914 C  CA  . LEU B 1 275 ? 22.809 49.003  10.395  1.00 77.62  ? 316 LEU B CA  1 
ATOM   3915 C  C   . LEU B 1 275 ? 23.425 49.856  9.289   1.00 75.18  ? 316 LEU B C   1 
ATOM   3916 O  O   . LEU B 1 275 ? 24.618 50.149  9.341   1.00 69.57  ? 316 LEU B O   1 
ATOM   3917 C  CB  . LEU B 1 275 ? 22.765 47.537  9.952   1.00 81.37  ? 316 LEU B CB  1 
ATOM   3918 C  CG  . LEU B 1 275 ? 22.546 46.486  11.041  1.00 82.40  ? 316 LEU B CG  1 
ATOM   3919 C  CD1 . LEU B 1 275 ? 22.684 45.088  10.438  1.00 82.57  ? 316 LEU B CD1 1 
ATOM   3920 C  CD2 . LEU B 1 275 ? 23.565 46.687  12.159  1.00 85.64  ? 316 LEU B CD2 1 
ATOM   3921 N  N   . GLU B 1 276 ? 22.635 50.249  8.289   1.00 72.68  ? 317 GLU B N   1 
ATOM   3922 C  CA  . GLU B 1 276 ? 23.181 51.066  7.207   1.00 71.28  ? 317 GLU B CA  1 
ATOM   3923 C  C   . GLU B 1 276 ? 23.602 52.414  7.756   1.00 68.71  ? 317 GLU B C   1 
ATOM   3924 O  O   . GLU B 1 276 ? 24.671 52.926  7.421   1.00 64.63  ? 317 GLU B O   1 
ATOM   3925 C  CB  . GLU B 1 276 ? 22.162 51.266  6.082   1.00 72.91  ? 317 GLU B CB  1 
ATOM   3926 C  CG  . GLU B 1 276 ? 21.856 50.007  5.294   1.00 82.25  ? 317 GLU B CG  1 
ATOM   3927 C  CD  . GLU B 1 276 ? 23.112 49.242  4.899   1.00 88.74  ? 317 GLU B CD  1 
ATOM   3928 O  OE1 . GLU B 1 276 ? 23.738 48.619  5.787   1.00 89.77  ? 317 GLU B OE1 1 
ATOM   3929 O  OE2 . GLU B 1 276 ? 23.480 49.269  3.703   1.00 91.80  ? 317 GLU B OE2 1 
ATOM   3930 N  N   . THR B 1 277 ? 22.748 52.969  8.614   1.00 68.96  ? 318 THR B N   1 
ATOM   3931 C  CA  . THR B 1 277 ? 22.987 54.261  9.246   1.00 64.26  ? 318 THR B CA  1 
ATOM   3932 C  C   . THR B 1 277 ? 24.160 54.216  10.207  1.00 62.25  ? 318 THR B C   1 
ATOM   3933 O  O   . THR B 1 277 ? 24.876 55.203  10.349  1.00 62.09  ? 318 THR B O   1 
ATOM   3934 C  CB  . THR B 1 277 ? 21.728 54.751  9.995   1.00 63.44  ? 318 THR B CB  1 
ATOM   3935 O  OG1 . THR B 1 277 ? 20.821 55.319  9.045   1.00 61.43  ? 318 THR B OG1 1 
ATOM   3936 C  CG2 . THR B 1 277 ? 22.082 55.796  11.060  1.00 56.48  ? 318 THR B CG2 1 
HETATM 3937 N  N   . MSE B 1 278 ? 24.367 53.084  10.871  1.00 58.82  ? 319 MSE B N   1 
HETATM 3938 C  CA  . MSE B 1 278 ? 25.491 53.003  11.783  1.00 60.28  ? 319 MSE B CA  1 
HETATM 3939 C  C   . MSE B 1 278 ? 26.806 52.913  11.001  1.00 60.40  ? 319 MSE B C   1 
HETATM 3940 O  O   . MSE B 1 278 ? 27.830 53.454  11.432  1.00 56.88  ? 319 MSE B O   1 
HETATM 3941 C  CB  . MSE B 1 278 ? 25.329 51.815  12.738  1.00 68.45  ? 319 MSE B CB  1 
HETATM 3942 C  CG  . MSE B 1 278 ? 24.157 51.992  13.723  1.00 81.36  ? 319 MSE B CG  1 
HETATM 3943 SE SE  . MSE B 1 278 ? 23.970 53.811  14.491  1.00 95.13  ? 319 MSE B SE  1 
HETATM 3944 C  CE  . MSE B 1 278 ? 24.946 53.517  16.145  1.00 87.53  ? 319 MSE B CE  1 
ATOM   3945 N  N   . ASP B 1 279 ? 26.767 52.243  9.848   1.00 56.74  ? 320 ASP B N   1 
ATOM   3946 C  CA  . ASP B 1 279 ? 27.946 52.098  9.008   1.00 56.49  ? 320 ASP B CA  1 
ATOM   3947 C  C   . ASP B 1 279 ? 28.258 53.477  8.409   1.00 54.74  ? 320 ASP B C   1 
ATOM   3948 O  O   . ASP B 1 279 ? 29.414 53.842  8.205   1.00 52.24  ? 320 ASP B O   1 
ATOM   3949 C  CB  . ASP B 1 279 ? 27.705 51.052  7.898   1.00 58.52  ? 320 ASP B CB  1 
ATOM   3950 C  CG  . ASP B 1 279 ? 27.894 49.593  8.385   1.00 63.33  ? 320 ASP B CG  1 
ATOM   3951 O  OD1 . ASP B 1 279 ? 28.600 49.349  9.383   1.00 64.59  ? 320 ASP B OD1 1 
ATOM   3952 O  OD2 . ASP B 1 279 ? 27.347 48.667  7.751   1.00 67.99  ? 320 ASP B OD2 1 
ATOM   3953 N  N   . GLN B 1 280 ? 27.211 54.252  8.165   1.00 54.53  ? 321 GLN B N   1 
ATOM   3954 C  CA  . GLN B 1 280 ? 27.349 55.589  7.614   1.00 54.68  ? 321 GLN B CA  1 
ATOM   3955 C  C   . GLN B 1 280 ? 27.990 56.531  8.650   1.00 55.24  ? 321 GLN B C   1 
ATOM   3956 O  O   . GLN B 1 280 ? 28.776 57.420  8.307   1.00 56.74  ? 321 GLN B O   1 
ATOM   3957 C  CB  . GLN B 1 280 ? 25.974 56.087  7.193   1.00 55.30  ? 321 GLN B CB  1 
ATOM   3958 C  CG  . GLN B 1 280 ? 25.937 57.479  6.596   1.00 62.54  ? 321 GLN B CG  1 
ATOM   3959 C  CD  . GLN B 1 280 ? 24.537 58.084  6.705   1.00 69.92  ? 321 GLN B CD  1 
ATOM   3960 O  OE1 . GLN B 1 280 ? 23.539 57.358  6.625   1.00 68.22  ? 321 GLN B OE1 1 
ATOM   3961 N  NE2 . GLN B 1 280 ? 24.458 59.410  6.884   1.00 65.45  ? 321 GLN B NE2 1 
ATOM   3962 N  N   . VAL B 1 281 ? 27.678 56.314  9.921   1.00 53.34  ? 322 VAL B N   1 
ATOM   3963 C  CA  . VAL B 1 281 ? 28.233 57.130  10.993  1.00 50.68  ? 322 VAL B CA  1 
ATOM   3964 C  C   . VAL B 1 281 ? 29.699 56.767  11.254  1.00 51.34  ? 322 VAL B C   1 
ATOM   3965 O  O   . VAL B 1 281 ? 30.534 57.638  11.549  1.00 45.35  ? 322 VAL B O   1 
ATOM   3966 C  CB  . VAL B 1 281 ? 27.400 56.957  12.296  1.00 49.98  ? 322 VAL B CB  1 
ATOM   3967 C  CG1 . VAL B 1 281 ? 28.189 57.456  13.494  1.00 46.83  ? 322 VAL B CG1 1 
ATOM   3968 C  CG2 . VAL B 1 281 ? 26.069 57.739  12.177  1.00 44.33  ? 322 VAL B CG2 1 
ATOM   3969 N  N   . ALA B 1 282 ? 30.008 55.479  11.151  1.00 47.47  ? 323 ALA B N   1 
ATOM   3970 C  CA  . ALA B 1 282 ? 31.372 55.008  11.360  1.00 48.08  ? 323 ALA B CA  1 
ATOM   3971 C  C   . ALA B 1 282 ? 32.327 55.688  10.363  1.00 49.62  ? 323 ALA B C   1 
ATOM   3972 O  O   . ALA B 1 282 ? 33.480 55.960  10.667  1.00 48.20  ? 323 ALA B O   1 
ATOM   3973 C  CB  . ALA B 1 282 ? 31.431 53.508  11.174  1.00 44.96  ? 323 ALA B CB  1 
ATOM   3974 N  N   . GLU B 1 283 ? 31.799 55.973  9.182   1.00 48.99  ? 324 GLU B N   1 
ATOM   3975 C  CA  . GLU B 1 283 ? 32.526 56.591  8.092   1.00 50.31  ? 324 GLU B CA  1 
ATOM   3976 C  C   . GLU B 1 283 ? 32.695 58.115  8.241   1.00 49.51  ? 324 GLU B C   1 
ATOM   3977 O  O   . GLU B 1 283 ? 33.404 58.746  7.460   1.00 55.29  ? 324 GLU B O   1 
ATOM   3978 C  CB  . GLU B 1 283 ? 31.778 56.252  6.799   1.00 49.07  ? 324 GLU B CB  1 
ATOM   3979 C  CG  . GLU B 1 283 ? 32.598 56.297  5.558   1.00 60.89  ? 324 GLU B CG  1 
ATOM   3980 C  CD  . GLU B 1 283 ? 33.800 55.376  5.625   1.00 61.55  ? 324 GLU B CD  1 
ATOM   3981 O  OE1 . GLU B 1 283 ? 33.671 54.167  5.314   1.00 59.41  ? 324 GLU B OE1 1 
ATOM   3982 O  OE2 . GLU B 1 283 ? 34.879 55.881  5.998   1.00 65.02  ? 324 GLU B OE2 1 
ATOM   3983 N  N   . ILE B 1 284 ? 32.048 58.713  9.237   1.00 50.02  ? 325 ILE B N   1 
ATOM   3984 C  CA  . ILE B 1 284 ? 32.139 60.153  9.442   1.00 47.77  ? 325 ILE B CA  1 
ATOM   3985 C  C   . ILE B 1 284 ? 33.288 60.507  10.376  1.00 51.94  ? 325 ILE B C   1 
ATOM   3986 O  O   . ILE B 1 284 ? 33.415 59.923  11.461  1.00 45.32  ? 325 ILE B O   1 
ATOM   3987 C  CB  . ILE B 1 284 ? 30.821 60.709  10.028  1.00 58.07  ? 325 ILE B CB  1 
ATOM   3988 C  CG1 . ILE B 1 284 ? 29.685 60.506  9.023   1.00 58.40  ? 325 ILE B CG1 1 
ATOM   3989 C  CG2 . ILE B 1 284 ? 30.977 62.200  10.387  1.00 56.66  ? 325 ILE B CG2 1 
ATOM   3990 C  CD1 . ILE B 1 284 ? 28.307 60.927  9.545   1.00 63.53  ? 325 ILE B CD1 1 
ATOM   3991 N  N   . ARG B 1 285 ? 34.113 61.482  9.975   1.00 50.18  ? 326 ARG B N   1 
ATOM   3992 C  CA  . ARG B 1 285 ? 35.269 61.866  10.788  1.00 49.93  ? 326 ARG B CA  1 
ATOM   3993 C  C   . ARG B 1 285 ? 34.832 62.459  12.123  1.00 50.71  ? 326 ARG B C   1 
ATOM   3994 O  O   . ARG B 1 285 ? 33.942 63.299  12.182  1.00 50.09  ? 326 ARG B O   1 
ATOM   3995 C  CB  . ARG B 1 285 ? 36.168 62.870  10.029  1.00 51.06  ? 326 ARG B CB  1 
ATOM   3996 C  CG  . ARG B 1 285 ? 37.655 62.913  10.510  1.00 49.88  ? 326 ARG B CG  1 
ATOM   3997 C  CD  . ARG B 1 285 ? 38.298 61.532  10.338  1.00 55.70  ? 326 ARG B CD  1 
ATOM   3998 N  NE  . ARG B 1 285 ? 39.718 61.520  9.975   1.00 52.16  ? 326 ARG B NE  1 
ATOM   3999 C  CZ  . ARG B 1 285 ? 40.713 61.609  10.842  1.00 57.70  ? 326 ARG B CZ  1 
ATOM   4000 N  NH1 . ARG B 1 285 ? 40.451 61.716  12.140  1.00 70.21  ? 326 ARG B NH1 1 
ATOM   4001 N  NH2 . ARG B 1 285 ? 41.969 61.600  10.417  1.00 53.41  ? 326 ARG B NH2 1 
ATOM   4002 N  N   . PRO B 1 286 ? 35.444 62.010  13.222  1.00 52.64  ? 327 PRO B N   1 
ATOM   4003 C  CA  . PRO B 1 286 ? 35.057 62.562  14.522  1.00 54.97  ? 327 PRO B CA  1 
ATOM   4004 C  C   . PRO B 1 286 ? 35.221 64.073  14.486  1.00 58.19  ? 327 PRO B C   1 
ATOM   4005 O  O   . PRO B 1 286 ? 36.118 64.594  13.806  1.00 57.56  ? 327 PRO B O   1 
ATOM   4006 C  CB  . PRO B 1 286 ? 36.063 61.935  15.487  1.00 50.34  ? 327 PRO B CB  1 
ATOM   4007 C  CG  . PRO B 1 286 ? 36.386 60.626  14.827  1.00 54.94  ? 327 PRO B CG  1 
ATOM   4008 C  CD  . PRO B 1 286 ? 36.525 61.024  13.370  1.00 50.63  ? 327 PRO B CD  1 
ATOM   4009 N  N   . GLY B 1 287 ? 34.362 64.770  15.219  1.00 57.86  ? 328 GLY B N   1 
ATOM   4010 C  CA  . GLY B 1 287 ? 34.463 66.212  15.288  1.00 58.63  ? 328 GLY B CA  1 
ATOM   4011 C  C   . GLY B 1 287 ? 33.520 66.910  14.345  1.00 61.58  ? 328 GLY B C   1 
ATOM   4012 O  O   . GLY B 1 287 ? 33.246 68.098  14.518  1.00 59.92  ? 328 GLY B O   1 
ATOM   4013 N  N   . SER B 1 288 ? 33.040 66.187  13.337  1.00 59.45  ? 329 SER B N   1 
ATOM   4014 C  CA  . SER B 1 288 ? 32.112 66.771  12.389  1.00 58.40  ? 329 SER B CA  1 
ATOM   4015 C  C   . SER B 1 288 ? 30.806 67.047  13.131  1.00 63.41  ? 329 SER B C   1 
ATOM   4016 O  O   . SER B 1 288 ? 30.482 66.361  14.103  1.00 60.89  ? 329 SER B O   1 
ATOM   4017 C  CB  . SER B 1 288 ? 31.859 65.802  11.247  1.00 56.00  ? 329 SER B CB  1 
ATOM   4018 O  OG  . SER B 1 288 ? 33.079 65.266  10.782  1.00 59.55  ? 329 SER B OG  1 
ATOM   4019 N  N   . VAL B 1 289 ? 30.072 68.061  12.681  1.00 68.61  ? 330 VAL B N   1 
ATOM   4020 C  CA  . VAL B 1 289 ? 28.784 68.436  13.274  1.00 69.53  ? 330 VAL B CA  1 
ATOM   4021 C  C   . VAL B 1 289 ? 27.717 68.212  12.196  1.00 74.10  ? 330 VAL B C   1 
ATOM   4022 O  O   . VAL B 1 289 ? 27.697 68.909  11.177  1.00 75.16  ? 330 VAL B O   1 
ATOM   4023 C  CB  . VAL B 1 289 ? 28.780 69.930  13.702  1.00 71.75  ? 330 VAL B CB  1 
ATOM   4024 C  CG1 . VAL B 1 289 ? 27.418 70.301  14.290  1.00 65.67  ? 330 VAL B CG1 1 
ATOM   4025 C  CG2 . VAL B 1 289 ? 29.909 70.195  14.721  1.00 63.34  ? 330 VAL B CG2 1 
ATOM   4026 N  N   . ILE B 1 290 ? 26.831 67.245  12.419  1.00 75.15  ? 331 ILE B N   1 
ATOM   4027 C  CA  . ILE B 1 290 ? 25.798 66.918  11.431  1.00 76.12  ? 331 ILE B CA  1 
ATOM   4028 C  C   . ILE B 1 290 ? 24.352 67.080  11.908  1.00 76.63  ? 331 ILE B C   1 
ATOM   4029 O  O   . ILE B 1 290 ? 24.058 66.931  13.096  1.00 76.25  ? 331 ILE B O   1 
ATOM   4030 C  CB  . ILE B 1 290 ? 25.952 65.454  10.946  1.00 76.06  ? 331 ILE B CB  1 
ATOM   4031 C  CG1 . ILE B 1 290 ? 25.791 64.505  12.136  1.00 72.55  ? 331 ILE B CG1 1 
ATOM   4032 C  CG2 . ILE B 1 290 ? 27.320 65.243  10.310  1.00 72.90  ? 331 ILE B CG2 1 
ATOM   4033 C  CD1 . ILE B 1 290 ? 25.831 63.058  11.757  1.00 78.43  ? 331 ILE B CD1 1 
ATOM   4034 N  N   . PRO B 1 291 ? 23.429 67.370  10.972  1.00 77.44  ? 332 PRO B N   1 
ATOM   4035 C  CA  . PRO B 1 291 ? 22.004 67.544  11.277  1.00 80.04  ? 332 PRO B CA  1 
ATOM   4036 C  C   . PRO B 1 291 ? 21.254 66.200  11.342  1.00 83.04  ? 332 PRO B C   1 
ATOM   4037 O  O   . PRO B 1 291 ? 21.330 65.389  10.412  1.00 81.40  ? 332 PRO B O   1 
ATOM   4038 C  CB  . PRO B 1 291 ? 21.517 68.421  10.122  1.00 79.49  ? 332 PRO B CB  1 
ATOM   4039 C  CG  . PRO B 1 291 ? 22.319 67.893  8.964   1.00 77.28  ? 332 PRO B CG  1 
ATOM   4040 C  CD  . PRO B 1 291 ? 23.714 67.748  9.570   1.00 78.02  ? 332 PRO B CD  1 
ATOM   4041 N  N   . VAL B 1 292 ? 20.532 65.969  12.438  1.00 84.61  ? 333 VAL B N   1 
ATOM   4042 C  CA  . VAL B 1 292 ? 19.763 64.739  12.605  1.00 87.14  ? 333 VAL B CA  1 
ATOM   4043 C  C   . VAL B 1 292 ? 18.279 65.023  12.779  1.00 91.32  ? 333 VAL B C   1 
ATOM   4044 O  O   . VAL B 1 292 ? 17.832 65.398  13.866  1.00 88.86  ? 333 VAL B O   1 
ATOM   4045 C  CB  . VAL B 1 292 ? 20.217 63.922  13.834  1.00 86.51  ? 333 VAL B CB  1 
ATOM   4046 C  CG1 . VAL B 1 292 ? 19.372 62.653  13.951  1.00 79.74  ? 333 VAL B CG1 1 
ATOM   4047 C  CG2 . VAL B 1 292 ? 21.692 63.581  13.720  1.00 85.77  ? 333 VAL B CG2 1 
ATOM   4048 N  N   . VAL B 1 293 ? 17.525 64.825  11.703  1.00 96.47  ? 334 VAL B N   1 
ATOM   4049 C  CA  . VAL B 1 293 ? 16.082 65.035  11.701  1.00 101.09 ? 334 VAL B CA  1 
ATOM   4050 C  C   . VAL B 1 293 ? 15.355 63.929  12.488  1.00 105.72 ? 334 VAL B C   1 
ATOM   4051 O  O   . VAL B 1 293 ? 15.526 62.736  12.223  1.00 105.67 ? 334 VAL B O   1 
ATOM   4052 C  CB  . VAL B 1 293 ? 15.529 65.079  10.243  1.00 99.90  ? 334 VAL B CB  1 
ATOM   4053 C  CG1 . VAL B 1 293 ? 14.031 65.324  10.256  1.00 99.15  ? 334 VAL B CG1 1 
ATOM   4054 C  CG2 . VAL B 1 293 ? 16.229 66.173  9.445   1.00 95.78  ? 334 VAL B CG2 1 
ATOM   4055 N  N   . VAL B 1 294 ? 14.554 64.348  13.464  1.00 110.56 ? 335 VAL B N   1 
ATOM   4056 C  CA  . VAL B 1 294 ? 13.775 63.440  14.302  1.00 115.53 ? 335 VAL B CA  1 
ATOM   4057 C  C   . VAL B 1 294 ? 12.315 63.907  14.196  1.00 120.29 ? 335 VAL B C   1 
ATOM   4058 O  O   . VAL B 1 294 ? 12.052 64.997  13.682  1.00 121.19 ? 335 VAL B O   1 
ATOM   4059 C  CB  . VAL B 1 294 ? 14.243 63.513  15.780  1.00 114.12 ? 335 VAL B CB  1 
ATOM   4060 C  CG1 . VAL B 1 294 ? 13.596 62.402  16.593  1.00 113.14 ? 335 VAL B CG1 1 
ATOM   4061 C  CG2 . VAL B 1 294 ? 15.755 63.412  15.850  1.00 112.20 ? 335 VAL B CG2 1 
HETATM 4062 N  N   . MSE B 1 295 ? 11.369 63.094  14.664  1.00 125.40 ? 336 MSE B N   1 
HETATM 4063 C  CA  . MSE B 1 295 ? 9.950  63.463  14.593  1.00 129.28 ? 336 MSE B CA  1 
HETATM 4064 C  C   . MSE B 1 295 ? 9.401  63.997  15.915  1.00 128.44 ? 336 MSE B C   1 
HETATM 4065 O  O   . MSE B 1 295 ? 8.745  65.042  15.947  1.00 127.04 ? 336 MSE B O   1 
HETATM 4066 C  CB  . MSE B 1 295 ? 9.110  62.265  14.133  1.00 133.87 ? 336 MSE B CB  1 
HETATM 4067 C  CG  . MSE B 1 295 ? 9.188  61.972  12.633  1.00 141.56 ? 336 MSE B CG  1 
HETATM 4068 SE SE  . MSE B 1 295 ? 7.977  63.021  11.510  1.00 153.61 ? 336 MSE B SE  1 
HETATM 4069 C  CE  . MSE B 1 295 ? 8.990  64.648  11.303  1.00 147.20 ? 336 MSE B CE  1 
ATOM   4070 N  N   . GLN B 1 300 ? 11.049 67.347  10.907  1.00 111.50 ? 341 GLN B N   1 
ATOM   4071 C  CA  . GLN B 1 300 ? 10.399 68.198  11.897  1.00 114.12 ? 341 GLN B CA  1 
ATOM   4072 C  C   . GLN B 1 300 ? 11.394 68.819  12.877  1.00 114.93 ? 341 GLN B C   1 
ATOM   4073 O  O   . GLN B 1 300 ? 11.704 70.006  12.787  1.00 116.28 ? 341 GLN B O   1 
ATOM   4074 C  CB  . GLN B 1 300 ? 9.342  67.404  12.665  1.00 113.24 ? 341 GLN B CB  1 
ATOM   4075 N  N   . LEU B 1 301 ? 11.890 68.013  13.811  1.00 115.39 ? 342 LEU B N   1 
ATOM   4076 C  CA  . LEU B 1 301 ? 12.839 68.486  14.822  1.00 115.01 ? 342 LEU B CA  1 
ATOM   4077 C  C   . LEU B 1 301 ? 14.310 68.243  14.451  1.00 114.51 ? 342 LEU B C   1 
ATOM   4078 O  O   . LEU B 1 301 ? 14.871 67.192  14.766  1.00 115.16 ? 342 LEU B O   1 
ATOM   4079 C  CB  . LEU B 1 301 ? 12.524 67.814  16.164  1.00 114.37 ? 342 LEU B CB  1 
ATOM   4080 C  CG  . LEU B 1 301 ? 13.467 68.054  17.345  1.00 114.29 ? 342 LEU B CG  1 
ATOM   4081 C  CD1 . LEU B 1 301 ? 13.567 69.545  17.632  1.00 114.49 ? 342 LEU B CD1 1 
ATOM   4082 C  CD2 . LEU B 1 301 ? 12.954 67.296  18.564  1.00 112.74 ? 342 LEU B CD2 1 
ATOM   4083 N  N   . THR B 1 302 ? 14.930 69.224  13.793  1.00 112.62 ? 343 THR B N   1 
ATOM   4084 C  CA  . THR B 1 302 ? 16.332 69.127  13.376  1.00 110.41 ? 343 THR B CA  1 
ATOM   4085 C  C   . THR B 1 302 ? 17.302 69.318  14.548  1.00 108.85 ? 343 THR B C   1 
ATOM   4086 O  O   . THR B 1 302 ? 17.135 70.236  15.352  1.00 109.30 ? 343 THR B O   1 
ATOM   4087 C  CB  . THR B 1 302 ? 16.651 70.172  12.285  1.00 110.08 ? 343 THR B CB  1 
ATOM   4088 O  OG1 . THR B 1 302 ? 15.928 69.849  11.090  1.00 111.68 ? 343 THR B OG1 1 
ATOM   4089 C  CG2 . THR B 1 302 ? 18.139 70.197  11.977  1.00 111.77 ? 343 THR B CG2 1 
ATOM   4090 N  N   . LEU B 1 303 ? 18.319 68.457  14.629  1.00 106.36 ? 344 LEU B N   1 
ATOM   4091 C  CA  . LEU B 1 303 ? 19.308 68.520  15.713  1.00 103.64 ? 344 LEU B CA  1 
ATOM   4092 C  C   . LEU B 1 303 ? 20.777 68.373  15.283  1.00 100.82 ? 344 LEU B C   1 
ATOM   4093 O  O   . LEU B 1 303 ? 21.154 67.398  14.627  1.00 99.91  ? 344 LEU B O   1 
ATOM   4094 C  CB  . LEU B 1 303 ? 18.982 67.456  16.759  1.00 102.58 ? 344 LEU B CB  1 
ATOM   4095 C  CG  . LEU B 1 303 ? 17.577 67.597  17.338  1.00 104.53 ? 344 LEU B CG  1 
ATOM   4096 C  CD1 . LEU B 1 303 ? 17.266 66.416  18.241  1.00 105.22 ? 344 LEU B CD1 1 
ATOM   4097 C  CD2 . LEU B 1 303 ? 17.481 68.913  18.097  1.00 104.73 ? 344 LEU B CD2 1 
ATOM   4098 N  N   . GLN B 1 304 ? 21.599 69.347  15.675  1.00 97.99  ? 345 GLN B N   1 
ATOM   4099 C  CA  . GLN B 1 304 ? 23.025 69.356  15.352  1.00 94.03  ? 345 GLN B CA  1 
ATOM   4100 C  C   . GLN B 1 304 ? 23.808 68.473  16.328  1.00 91.47  ? 345 GLN B C   1 
ATOM   4101 O  O   . GLN B 1 304 ? 23.820 68.727  17.537  1.00 89.70  ? 345 GLN B O   1 
ATOM   4102 C  CB  . GLN B 1 304 ? 23.574 70.786  15.406  1.00 94.94  ? 345 GLN B CB  1 
ATOM   4103 C  CG  . GLN B 1 304 ? 22.922 71.782  14.444  1.00 97.33  ? 345 GLN B CG  1 
ATOM   4104 C  CD  . GLN B 1 304 ? 23.092 71.414  12.975  1.00 99.17  ? 345 GLN B CD  1 
ATOM   4105 O  OE1 . GLN B 1 304 ? 24.113 70.854  12.574  1.00 99.86  ? 345 GLN B OE1 1 
ATOM   4106 N  NE2 . GLN B 1 304 ? 22.094 71.749  12.162  1.00 99.66  ? 345 GLN B NE2 1 
ATOM   4107 N  N   . VAL B 1 305 ? 24.470 67.449  15.786  1.00 87.34  ? 346 VAL B N   1 
ATOM   4108 C  CA  . VAL B 1 305 ? 25.247 66.500  16.579  1.00 82.13  ? 346 VAL B CA  1 
ATOM   4109 C  C   . VAL B 1 305 ? 26.720 66.468  16.172  1.00 78.81  ? 346 VAL B C   1 
ATOM   4110 O  O   . VAL B 1 305 ? 27.042 66.374  14.986  1.00 77.53  ? 346 VAL B O   1 
ATOM   4111 C  CB  . VAL B 1 305 ? 24.676 65.068  16.427  1.00 82.68  ? 346 VAL B CB  1 
ATOM   4112 C  CG1 . VAL B 1 305 ? 25.398 64.114  17.364  1.00 78.27  ? 346 VAL B CG1 1 
ATOM   4113 C  CG2 . VAL B 1 305 ? 23.176 65.074  16.704  1.00 81.74  ? 346 VAL B CG2 1 
ATOM   4114 N  N   . THR B 1 306 ? 27.616 66.550  17.150  1.00 75.22  ? 347 THR B N   1 
ATOM   4115 C  CA  . THR B 1 306 ? 29.039 66.503  16.842  1.00 75.37  ? 347 THR B CA  1 
ATOM   4116 C  C   . THR B 1 306 ? 29.525 65.085  17.130  1.00 72.21  ? 347 THR B C   1 
ATOM   4117 O  O   . THR B 1 306 ? 29.588 64.642  18.280  1.00 71.40  ? 347 THR B O   1 
ATOM   4118 C  CB  . THR B 1 306 ? 29.885 67.566  17.649  1.00 75.49  ? 347 THR B CB  1 
ATOM   4119 O  OG1 . THR B 1 306 ? 30.170 67.092  18.971  1.00 75.21  ? 347 THR B OG1 1 
ATOM   4120 C  CG2 . THR B 1 306 ? 29.126 68.890  17.745  1.00 75.47  ? 347 THR B CG2 1 
ATOM   4121 N  N   . ILE B 1 307 ? 29.843 64.382  16.048  1.00 71.98  ? 348 ILE B N   1 
ATOM   4122 C  CA  . ILE B 1 307 ? 30.304 63.002  16.078  1.00 66.47  ? 348 ILE B CA  1 
ATOM   4123 C  C   . ILE B 1 307 ? 31.626 62.834  16.778  1.00 63.19  ? 348 ILE B C   1 
ATOM   4124 O  O   . ILE B 1 307 ? 32.520 63.647  16.609  1.00 66.37  ? 348 ILE B O   1 
ATOM   4125 C  CB  . ILE B 1 307 ? 30.390 62.456  14.639  1.00 68.63  ? 348 ILE B CB  1 
ATOM   4126 C  CG1 . ILE B 1 307 ? 28.962 62.244  14.119  1.00 69.65  ? 348 ILE B CG1 1 
ATOM   4127 C  CG2 . ILE B 1 307 ? 31.258 61.197  14.587  1.00 66.12  ? 348 ILE B CG2 1 
ATOM   4128 C  CD1 . ILE B 1 307 ? 28.874 61.535  12.796  1.00 79.38  ? 348 ILE B CD1 1 
ATOM   4129 N  N   . GLN B 1 308 ? 31.740 61.771  17.569  1.00 64.79  ? 349 GLN B N   1 
ATOM   4130 C  CA  . GLN B 1 308 ? 32.963 61.489  18.310  1.00 66.86  ? 349 GLN B CA  1 
ATOM   4131 C  C   . GLN B 1 308 ? 33.676 60.250  17.766  1.00 65.31  ? 349 GLN B C   1 
ATOM   4132 O  O   . GLN B 1 308 ? 33.176 59.589  16.852  1.00 59.42  ? 349 GLN B O   1 
ATOM   4133 C  CB  . GLN B 1 308 ? 32.640 61.273  19.789  1.00 71.88  ? 349 GLN B CB  1 
ATOM   4134 C  CG  . GLN B 1 308 ? 31.793 62.373  20.400  1.00 86.02  ? 349 GLN B CG  1 
ATOM   4135 C  CD  . GLN B 1 308 ? 31.906 62.422  21.917  1.00 93.57  ? 349 GLN B CD  1 
ATOM   4136 O  OE1 . GLN B 1 308 ? 31.789 61.398  22.600  1.00 93.76  ? 349 GLN B OE1 1 
ATOM   4137 N  NE2 . GLN B 1 308 ? 32.132 63.620  22.453  1.00 95.07  ? 349 GLN B NE2 1 
ATOM   4138 N  N   . GLU B 1 309 ? 34.846 59.947  18.323  1.00 63.07  ? 350 GLU B N   1 
ATOM   4139 C  CA  . GLU B 1 309 ? 35.595 58.781  17.894  1.00 68.62  ? 350 GLU B CA  1 
ATOM   4140 C  C   . GLU B 1 309 ? 34.940 57.608  18.577  1.00 72.63  ? 350 GLU B C   1 
ATOM   4141 O  O   . GLU B 1 309 ? 34.412 57.757  19.678  1.00 71.28  ? 350 GLU B O   1 
ATOM   4142 C  CB  . GLU B 1 309 ? 37.054 58.870  18.322  1.00 69.00  ? 350 GLU B CB  1 
ATOM   4143 C  CG  . GLU B 1 309 ? 37.913 57.779  17.707  1.00 75.64  ? 350 GLU B CG  1 
ATOM   4144 C  CD  . GLU B 1 309 ? 39.373 58.171  17.609  1.00 80.04  ? 350 GLU B CD  1 
ATOM   4145 O  OE1 . GLU B 1 309 ? 39.643 59.377  17.415  1.00 81.97  ? 350 GLU B OE1 1 
ATOM   4146 O  OE2 . GLU B 1 309 ? 40.246 57.278  17.705  1.00 83.86  ? 350 GLU B OE2 1 
ATOM   4147 N  N   . TYR B 1 310 ? 34.957 56.447  17.927  1.00 77.42  ? 351 TYR B N   1 
ATOM   4148 C  CA  . TYR B 1 310 ? 34.332 55.265  18.504  1.00 79.98  ? 351 TYR B CA  1 
ATOM   4149 C  C   . TYR B 1 310 ? 34.990 54.954  19.838  1.00 81.36  ? 351 TYR B C   1 
ATOM   4150 O  O   . TYR B 1 310 ? 36.214 54.811  19.915  1.00 74.67  ? 351 TYR B O   1 
ATOM   4151 C  CB  . TYR B 1 310 ? 34.464 54.051  17.582  1.00 82.99  ? 351 TYR B CB  1 
ATOM   4152 C  CG  . TYR B 1 310 ? 33.563 52.909  17.996  1.00 84.84  ? 351 TYR B CG  1 
ATOM   4153 C  CD1 . TYR B 1 310 ? 32.183 52.969  17.773  1.00 87.96  ? 351 TYR B CD1 1 
ATOM   4154 C  CD2 . TYR B 1 310 ? 34.075 51.792  18.652  1.00 88.05  ? 351 TYR B CD2 1 
ATOM   4155 C  CE1 . TYR B 1 310 ? 31.335 51.947  18.194  1.00 89.53  ? 351 TYR B CE1 1 
ATOM   4156 C  CE2 . TYR B 1 310 ? 33.237 50.758  19.080  1.00 90.85  ? 351 TYR B CE2 1 
ATOM   4157 C  CZ  . TYR B 1 310 ? 31.868 50.842  18.846  1.00 91.80  ? 351 TYR B CZ  1 
ATOM   4158 O  OH  . TYR B 1 310 ? 31.037 49.819  19.250  1.00 93.30  ? 351 TYR B OH  1 
ATOM   4159 N  N   . PRO B 1 311 ? 34.174 54.844  20.908  1.00 83.30  ? 352 PRO B N   1 
ATOM   4160 C  CA  . PRO B 1 311 ? 34.644 54.549  22.265  1.00 85.15  ? 352 PRO B CA  1 
ATOM   4161 C  C   . PRO B 1 311 ? 35.756 53.513  22.237  1.00 84.85  ? 352 PRO B C   1 
ATOM   4162 O  O   . PRO B 1 311 ? 35.533 52.363  21.860  1.00 84.51  ? 352 PRO B O   1 
ATOM   4163 C  CB  . PRO B 1 311 ? 33.387 54.029  22.957  1.00 85.59  ? 352 PRO B CB  1 
ATOM   4164 C  CG  . PRO B 1 311 ? 32.305 54.833  22.311  1.00 84.91  ? 352 PRO B CG  1 
ATOM   4165 C  CD  . PRO B 1 311 ? 32.698 54.811  20.847  1.00 82.61  ? 352 PRO B CD  1 
ATOM   4166 N  N   . ALA B 1 312 ? 36.955 53.931  22.625  1.00 85.99  ? 353 ALA B N   1 
ATOM   4167 C  CA  . ALA B 1 312 ? 38.104 53.037  22.642  1.00 89.76  ? 353 ALA B CA  1 
ATOM   4168 C  C   . ALA B 1 312 ? 37.869 51.882  23.613  1.00 91.16  ? 353 ALA B C   1 
ATOM   4169 O  O   . ALA B 1 312 ? 37.726 52.092  24.823  1.00 93.38  ? 353 ALA B O   1 
ATOM   4170 C  CB  . ALA B 1 312 ? 39.362 53.811  23.040  1.00 88.21  ? 353 ALA B CB  1 
ATOM   4171 N  N   . THR B 1 313 ? 37.818 50.663  23.086  1.00 89.17  ? 354 THR B N   1 
ATOM   4172 C  CA  . THR B 1 313 ? 37.609 49.499  23.941  1.00 90.89  ? 354 THR B CA  1 
ATOM   4173 C  C   . THR B 1 313 ? 37.793 48.164  23.219  1.00 87.78  ? 354 THR B C   1 
ATOM   4174 O  O   . THR B 1 313 ? 37.139 47.877  22.201  1.00 86.81  ? 354 THR B O   1 
ATOM   4175 C  CB  . THR B 1 313 ? 36.206 49.559  24.603  1.00 88.07  ? 354 THR B CB  1 
ATOM   4176 N  N   . ASN B 1 314 ? 38.699 47.355  23.760  1.00 83.65  ? 355 ASN B N   1 
ATOM   4177 C  CA  . ASN B 1 314 ? 38.963 46.034  23.211  1.00 82.51  ? 355 ASN B CA  1 
ATOM   4178 C  C   . ASN B 1 314 ? 37.995 45.047  23.861  1.00 75.41  ? 355 ASN B C   1 
ATOM   4179 O  O   . ASN B 1 314 ? 38.269 43.856  23.906  1.00 72.98  ? 355 ASN B O   1 
ATOM   4180 C  CB  . ASN B 1 314 ? 40.406 45.616  23.502  1.00 85.63  ? 355 ASN B CB  1 
ATOM   4181 N  N   . HIS B 1 315 ? 36.863 45.553  24.348  1.00 70.88  ? 356 HIS B N   1 
ATOM   4182 C  CA  . HIS B 1 315 ? 35.862 44.725  25.024  1.00 73.32  ? 356 HIS B CA  1 
ATOM   4183 C  C   . HIS B 1 315 ? 34.748 44.222  24.085  1.00 71.25  ? 356 HIS B C   1 
ATOM   4184 O  O   . HIS B 1 315 ? 33.873 43.454  24.504  1.00 62.82  ? 356 HIS B O   1 
ATOM   4185 C  CB  . HIS B 1 315 ? 35.204 45.518  26.173  1.00 75.09  ? 356 HIS B CB  1 
ATOM   4186 C  CG  . HIS B 1 315 ? 36.150 45.969  27.256  1.00 82.15  ? 356 HIS B CG  1 
ATOM   4187 N  ND1 . HIS B 1 315 ? 36.855 45.089  28.051  1.00 83.23  ? 356 HIS B ND1 1 
ATOM   4188 C  CD2 . HIS B 1 315 ? 36.427 47.206  27.737  1.00 83.78  ? 356 HIS B CD2 1 
ATOM   4189 C  CE1 . HIS B 1 315 ? 37.518 45.760  28.975  1.00 84.89  ? 356 HIS B CE1 1 
ATOM   4190 N  NE2 . HIS B 1 315 ? 37.276 47.047  28.806  1.00 85.75  ? 356 HIS B NE2 1 
ATOM   4191 N  N   . HIS B 1 316 ? 34.781 44.641  22.821  1.00 68.75  ? 357 HIS B N   1 
ATOM   4192 C  CA  . HIS B 1 316 ? 33.734 44.262  21.869  1.00 67.59  ? 357 HIS B CA  1 
ATOM   4193 C  C   . HIS B 1 316 ? 33.442 42.772  21.593  1.00 65.44  ? 357 HIS B C   1 
ATOM   4194 O  O   . HIS B 1 316 ? 32.281 42.375  21.495  1.00 62.69  ? 357 HIS B O   1 
ATOM   4195 C  CB  . HIS B 1 316 ? 33.962 44.989  20.539  1.00 68.79  ? 357 HIS B CB  1 
ATOM   4196 C  CG  . HIS B 1 316 ? 32.825 44.840  19.580  1.00 61.59  ? 357 HIS B CG  1 
ATOM   4197 N  ND1 . HIS B 1 316 ? 32.666 43.725  18.784  1.00 68.58  ? 357 HIS B ND1 1 
ATOM   4198 C  CD2 . HIS B 1 316 ? 31.745 45.623  19.352  1.00 63.88  ? 357 HIS B CD2 1 
ATOM   4199 C  CE1 . HIS B 1 316 ? 31.533 43.827  18.111  1.00 67.61  ? 357 HIS B CE1 1 
ATOM   4200 N  NE2 . HIS B 1 316 ? 30.955 44.968  18.438  1.00 62.56  ? 357 HIS B NE2 1 
ATOM   4201 N  N   . HIS B 1 317 ? 34.469 41.916  21.499  1.00 65.62  ? 358 HIS B N   1 
ATOM   4202 C  CA  . HIS B 1 317 ? 34.238 40.498  21.229  1.00 73.04  ? 358 HIS B CA  1 
ATOM   4203 C  C   . HIS B 1 317 ? 34.235 39.585  22.469  1.00 76.12  ? 358 HIS B C   1 
ATOM   4204 O  O   . HIS B 1 317 ? 34.542 38.411  22.348  1.00 74.33  ? 358 HIS B O   1 
ATOM   4205 C  CB  . HIS B 1 317 ? 35.310 39.959  20.279  1.00 73.75  ? 358 HIS B CB  1 
ATOM   4206 C  CG  . HIS B 1 317 ? 35.423 40.755  18.967  1.00 75.48  ? 358 HIS B CG  1 
ATOM   4207 N  ND1 . HIS B 1 317 ? 34.422 40.771  18.020  1.00 78.74  ? 358 HIS B ND1 1 
ATOM   4208 C  CD2 . HIS B 1 317 ? 36.416 41.534  18.480  1.00 73.43  ? 358 HIS B CD2 1 
ATOM   4209 C  CE1 . HIS B 1 317 ? 34.795 41.528  17.003  1.00 77.70  ? 358 HIS B CE1 1 
ATOM   4210 N  NE2 . HIS B 1 317 ? 36.001 42.002  17.257  1.00 75.77  ? 358 HIS B NE2 1 
ATOM   4211 N  N   . HIS B 1 318 ? 33.889 40.085  23.671  1.00 77.35  ? 359 HIS B N   1 
ATOM   4212 C  CA  . HIS B 1 318 ? 33.946 39.343  24.948  1.00 81.99  ? 359 HIS B CA  1 
ATOM   4213 C  C   . HIS B 1 318 ? 32.592 38.868  25.475  1.00 86.12  ? 359 HIS B C   1 
ATOM   4214 O  O   . HIS B 1 318 ? 32.411 37.793  26.069  1.00 87.08  ? 359 HIS B O   1 
ATOM   4215 C  CB  . HIS B 1 318 ? 34.510 40.297  26.012  1.00 74.06  ? 359 HIS B CB  1 
ATOM   4216 C  CG  . HIS B 1 318 ? 35.971 40.794  25.744  1.00 72.17  ? 359 HIS B CG  1 
ATOM   4217 N  ND1 . HIS B 1 318 ? 36.648 41.724  26.541  1.00 71.79  ? 359 HIS B ND1 1 
ATOM   4218 C  CD2 . HIS B 1 318 ? 36.855 40.419  24.802  1.00 72.91  ? 359 HIS B CD2 1 
ATOM   4219 C  CE1 . HIS B 1 318 ? 37.887 41.886  26.102  1.00 72.55  ? 359 HIS B CE1 1 
ATOM   4220 N  NE2 . HIS B 1 318 ? 38.039 41.104  25.047  1.00 71.92  ? 359 HIS B NE2 1 
ATOM   4221 N  N   . HIS B 1 319 ? 31.700 39.787  25.185  1.00 90.35  ? 360 HIS B N   1 
ATOM   4222 C  CA  . HIS B 1 319 ? 30.339 39.811  25.546  1.00 93.50  ? 360 HIS B CA  1 
ATOM   4223 C  C   . HIS B 1 319 ? 30.237 40.468  26.929  1.00 96.51  ? 360 HIS B C   1 
ATOM   4224 O  O   . HIS B 1 319 ? 29.138 40.738  27.419  1.00 97.55  ? 360 HIS B O   1 
ATOM   4225 C  CB  . HIS B 1 319 ? 29.744 38.404  25.483  1.00 95.59  ? 360 HIS B CB  1 
ATOM   4226 C  CG  . HIS B 1 319 ? 28.483 38.218  26.363  1.00 100.00 ? 360 HIS B CG  1 
ATOM   4227 N  ND1 . HIS B 1 319 ? 28.535 38.187  27.740  1.00 100.00 ? 360 HIS B ND1 1 
ATOM   4228 C  CD2 . HIS B 1 319 ? 27.181 38.061  26.030  1.00 100.00 ? 360 HIS B CD2 1 
ATOM   4229 C  CE1 . HIS B 1 319 ? 27.316 38.017  28.218  1.00 100.00 ? 360 HIS B CE1 1 
ATOM   4230 N  NE2 . HIS B 1 319 ? 26.477 37.938  27.203  1.00 100.00 ? 360 HIS B NE2 1 
ATOM   4231 N  N   . HIS B 1 320 ? 31.383 40.741  27.576  1.00 79.83  ? 361 HIS B N   1 
ATOM   4232 C  CA  . HIS B 1 320 ? 31.324 41.216  28.964  1.00 79.34  ? 361 HIS B CA  1 
ATOM   4233 C  C   . HIS B 1 320 ? 30.794 42.629  29.193  1.00 86.65  ? 361 HIS B C   1 
ATOM   4234 O  O   . HIS B 1 320 ? 29.985 42.864  30.091  1.00 93.51  ? 361 HIS B O   1 
ATOM   4235 C  CB  . HIS B 1 320 ? 32.710 41.005  29.600  1.00 64.18  ? 361 HIS B CB  1 
ATOM   4236 C  CG  . HIS B 1 320 ? 33.880 41.891  29.118  1.00 56.39  ? 361 HIS B CG  1 
ATOM   4237 N  ND1 . HIS B 1 320 ? 33.771 43.239  28.859  1.00 55.82  ? 361 HIS B ND1 1 
ATOM   4238 C  CD2 . HIS B 1 320 ? 35.175 41.577  28.842  1.00 57.36  ? 361 HIS B CD2 1 
ATOM   4239 C  CE1 . HIS B 1 320 ? 34.950 43.721  28.481  1.00 50.33  ? 361 HIS B CE1 1 
ATOM   4240 N  NE2 . HIS B 1 320 ? 35.826 42.739  28.460  1.00 9.14   ? 361 HIS B NE2 1 
ATOM   4241 O  OXT . HIS B 1 320 ? 31.500 43.791  29.149  1.00 95.46  ? 361 HIS B OXT 1 
HETATM 4242 N  N   . MSE C 1 1   ? 20.347 20.092  -17.813 1.00 74.61  ? 42  MSE C N   1 
HETATM 4243 C  CA  . MSE C 1 1   ? 21.462 20.228  -16.830 1.00 71.99  ? 42  MSE C CA  1 
HETATM 4244 C  C   . MSE C 1 1   ? 21.678 18.955  -16.041 1.00 65.33  ? 42  MSE C C   1 
HETATM 4245 O  O   . MSE C 1 1   ? 20.720 18.279  -15.642 1.00 60.42  ? 42  MSE C O   1 
HETATM 4246 C  CB  . MSE C 1 1   ? 21.176 21.344  -15.827 1.00 83.84  ? 42  MSE C CB  1 
HETATM 4247 C  CG  . MSE C 1 1   ? 21.273 22.755  -16.366 1.00 98.56  ? 42  MSE C CG  1 
HETATM 4248 SE SE  . MSE C 1 1   ? 21.221 24.043  -14.901 1.00 121.15 ? 42  MSE C SE  1 
HETATM 4249 C  CE  . MSE C 1 1   ? 23.137 24.341  -14.695 1.00 110.98 ? 42  MSE C CE  1 
ATOM   4250 N  N   . THR C 1 2   ? 22.946 18.631  -15.815 1.00 55.79  ? 43  THR C N   1 
ATOM   4251 C  CA  . THR C 1 2   ? 23.289 17.457  -15.029 1.00 53.18  ? 43  THR C CA  1 
ATOM   4252 C  C   . THR C 1 2   ? 24.000 17.887  -13.727 1.00 40.13  ? 43  THR C C   1 
ATOM   4253 O  O   . THR C 1 2   ? 24.716 18.882  -13.694 1.00 37.14  ? 43  THR C O   1 
ATOM   4254 C  CB  . THR C 1 2   ? 24.188 16.496  -15.846 1.00 58.24  ? 43  THR C CB  1 
ATOM   4255 O  OG1 . THR C 1 2   ? 25.504 17.055  -15.987 1.00 65.48  ? 43  THR C OG1 1 
ATOM   4256 C  CG2 . THR C 1 2   ? 23.584 16.284  -17.237 1.00 62.60  ? 43  THR C CG2 1 
ATOM   4257 N  N   . PRO C 1 3   ? 23.774 17.154  -12.631 1.00 37.24  ? 44  PRO C N   1 
ATOM   4258 C  CA  . PRO C 1 3   ? 24.409 17.477  -11.333 1.00 35.26  ? 44  PRO C CA  1 
ATOM   4259 C  C   . PRO C 1 3   ? 25.935 17.423  -11.456 1.00 29.72  ? 44  PRO C C   1 
ATOM   4260 O  O   . PRO C 1 3   ? 26.456 16.504  -12.086 1.00 32.49  ? 44  PRO C O   1 
ATOM   4261 C  CB  . PRO C 1 3   ? 23.913 16.368  -10.411 1.00 30.12  ? 44  PRO C CB  1 
ATOM   4262 C  CG  . PRO C 1 3   ? 22.606 15.926  -11.015 1.00 34.83  ? 44  PRO C CG  1 
ATOM   4263 C  CD  . PRO C 1 3   ? 22.839 16.020  -12.517 1.00 33.42  ? 44  PRO C CD  1 
ATOM   4264 N  N   . ALA C 1 4   ? 26.651 18.397  -10.895 1.00 18.48  ? 45  ALA C N   1 
ATOM   4265 C  CA  . ALA C 1 4   ? 28.105 18.343  -10.937 1.00 22.08  ? 45  ALA C CA  1 
ATOM   4266 C  C   . ALA C 1 4   ? 28.418 17.020  -10.226 1.00 29.73  ? 45  ALA C C   1 
ATOM   4267 O  O   . ALA C 1 4   ? 27.695 16.622  -9.287  1.00 27.86  ? 45  ALA C O   1 
ATOM   4268 C  CB  . ALA C 1 4   ? 28.718 19.504  -10.190 1.00 19.37  ? 45  ALA C CB  1 
ATOM   4269 N  N   . SER C 1 5   ? 29.481 16.340  -10.657 1.00 28.60  ? 46  SER C N   1 
ATOM   4270 C  CA  . SER C 1 5   ? 29.817 15.027  -10.099 1.00 26.78  ? 46  SER C CA  1 
ATOM   4271 C  C   . SER C 1 5   ? 31.180 14.487  -10.514 1.00 33.05  ? 46  SER C C   1 
ATOM   4272 O  O   . SER C 1 5   ? 31.692 14.809  -11.592 1.00 31.23  ? 46  SER C O   1 
ATOM   4273 C  CB  . SER C 1 5   ? 28.728 14.022  -10.520 1.00 34.44  ? 46  SER C CB  1 
ATOM   4274 O  OG  . SER C 1 5   ? 29.074 12.675  -10.191 1.00 30.32  ? 46  SER C OG  1 
ATOM   4275 N  N   . TYR C 1 6   ? 31.783 13.686  -9.632  1.00 35.50  ? 47  TYR C N   1 
ATOM   4276 C  CA  . TYR C 1 6   ? 33.064 13.050  -9.923  1.00 28.85  ? 47  TYR C CA  1 
ATOM   4277 C  C   . TYR C 1 6   ? 32.828 11.531  -10.006 1.00 27.48  ? 47  TYR C C   1 
ATOM   4278 O  O   . TYR C 1 6   ? 33.717 10.711  -9.716  1.00 30.32  ? 47  TYR C O   1 
ATOM   4279 C  CB  . TYR C 1 6   ? 34.105 13.384  -8.832  1.00 28.65  ? 47  TYR C CB  1 
ATOM   4280 C  CG  . TYR C 1 6   ? 34.379 14.860  -8.735  1.00 30.60  ? 47  TYR C CG  1 
ATOM   4281 C  CD1 . TYR C 1 6   ? 33.857 15.610  -7.681  1.00 28.33  ? 47  TYR C CD1 1 
ATOM   4282 C  CD2 . TYR C 1 6   ? 35.100 15.526  -9.725  1.00 28.28  ? 47  TYR C CD2 1 
ATOM   4283 C  CE1 . TYR C 1 6   ? 34.045 16.973  -7.615  1.00 24.76  ? 47  TYR C CE1 1 
ATOM   4284 C  CE2 . TYR C 1 6   ? 35.288 16.919  -9.672  1.00 32.29  ? 47  TYR C CE2 1 
ATOM   4285 C  CZ  . TYR C 1 6   ? 34.748 17.623  -8.590  1.00 32.54  ? 47  TYR C CZ  1 
ATOM   4286 O  OH  . TYR C 1 6   ? 34.912 18.983  -8.451  1.00 44.76  ? 47  TYR C OH  1 
ATOM   4287 N  N   . ASN C 1 7   ? 31.623 11.146  -10.406 1.00 32.15  ? 48  ASN C N   1 
ATOM   4288 C  CA  . ASN C 1 7   ? 31.301 9.731   -10.503 1.00 33.05  ? 48  ASN C CA  1 
ATOM   4289 C  C   . ASN C 1 7   ? 32.150 9.017   -11.577 1.00 36.05  ? 48  ASN C C   1 
ATOM   4290 O  O   . ASN C 1 7   ? 32.423 7.832   -11.462 1.00 36.99  ? 48  ASN C O   1 
ATOM   4291 C  CB  . ASN C 1 7   ? 29.806 9.562   -10.755 1.00 31.21  ? 48  ASN C CB  1 
ATOM   4292 C  CG  . ASN C 1 7   ? 29.383 8.103   -10.821 1.00 37.60  ? 48  ASN C CG  1 
ATOM   4293 O  OD1 . ASN C 1 7   ? 29.175 7.586   -11.901 1.00 37.92  ? 48  ASN C OD1 1 
ATOM   4294 N  ND2 . ASN C 1 7   ? 29.276 7.431   -9.659  1.00 36.64  ? 48  ASN C ND2 1 
ATOM   4295 N  N   . LEU C 1 8   ? 32.554 9.740   -12.615 1.00 34.73  ? 49  LEU C N   1 
ATOM   4296 C  CA  . LEU C 1 8   ? 33.406 9.169   -13.641 1.00 41.36  ? 49  LEU C CA  1 
ATOM   4297 C  C   . LEU C 1 8   ? 34.669 8.580   -12.961 1.00 43.23  ? 49  LEU C C   1 
ATOM   4298 O  O   . LEU C 1 8   ? 35.018 7.402   -13.149 1.00 41.99  ? 49  LEU C O   1 
ATOM   4299 C  CB  . LEU C 1 8   ? 33.838 10.258  -14.624 1.00 42.52  ? 49  LEU C CB  1 
ATOM   4300 C  CG  . LEU C 1 8   ? 34.920 9.797   -15.617 1.00 51.72  ? 49  LEU C CG  1 
ATOM   4301 C  CD1 . LEU C 1 8   ? 34.307 8.768   -16.574 1.00 42.26  ? 49  LEU C CD1 1 
ATOM   4302 C  CD2 . LEU C 1 8   ? 35.488 10.988  -16.379 1.00 47.36  ? 49  LEU C CD2 1 
ATOM   4303 N  N   . ALA C 1 9   ? 35.351 9.419   -12.183 1.00 36.69  ? 50  ALA C N   1 
ATOM   4304 C  CA  . ALA C 1 9   ? 36.552 9.001   -11.480 1.00 31.10  ? 50  ALA C CA  1 
ATOM   4305 C  C   . ALA C 1 9   ? 36.270 7.809   -10.611 1.00 38.67  ? 50  ALA C C   1 
ATOM   4306 O  O   . ALA C 1 9   ? 37.073 6.878   -10.550 1.00 36.61  ? 50  ALA C O   1 
ATOM   4307 C  CB  . ALA C 1 9   ? 37.092 10.103  -10.649 1.00 29.53  ? 50  ALA C CB  1 
ATOM   4308 N  N   . VAL C 1 10  ? 35.126 7.840   -9.933  1.00 35.23  ? 51  VAL C N   1 
ATOM   4309 C  CA  . VAL C 1 10  ? 34.744 6.745   -9.078  1.00 34.98  ? 51  VAL C CA  1 
ATOM   4310 C  C   . VAL C 1 10  ? 34.573 5.426   -9.870  1.00 40.36  ? 51  VAL C C   1 
ATOM   4311 O  O   . VAL C 1 10  ? 35.102 4.379   -9.475  1.00 40.45  ? 51  VAL C O   1 
ATOM   4312 C  CB  . VAL C 1 10  ? 33.423 7.052   -8.316  1.00 32.70  ? 51  VAL C CB  1 
ATOM   4313 C  CG1 . VAL C 1 10  ? 32.992 5.822   -7.491  1.00 30.14  ? 51  VAL C CG1 1 
ATOM   4314 C  CG2 . VAL C 1 10  ? 33.607 8.266   -7.397  1.00 36.65  ? 51  VAL C CG2 1 
ATOM   4315 N  N   . ARG C 1 11  ? 33.820 5.469   -10.965 1.00 41.04  ? 52  ARG C N   1 
ATOM   4316 C  CA  . ARG C 1 11  ? 33.587 4.264   -11.770 1.00 45.22  ? 52  ARG C CA  1 
ATOM   4317 C  C   . ARG C 1 11  ? 34.884 3.636   -12.281 1.00 36.15  ? 52  ARG C C   1 
ATOM   4318 O  O   . ARG C 1 11  ? 35.007 2.440   -12.304 1.00 41.05  ? 52  ARG C O   1 
ATOM   4319 C  CB  . ARG C 1 11  ? 32.660 4.555   -12.971 1.00 41.75  ? 52  ARG C CB  1 
ATOM   4320 C  CG  . ARG C 1 11  ? 31.230 4.947   -12.557 1.00 52.02  ? 52  ARG C CG  1 
ATOM   4321 C  CD  . ARG C 1 11  ? 30.270 5.070   -13.747 1.00 48.97  ? 52  ARG C CD  1 
ATOM   4322 N  NE  . ARG C 1 11  ? 30.775 5.866   -14.876 1.00 53.13  ? 52  ARG C NE  1 
ATOM   4323 C  CZ  . ARG C 1 11  ? 30.559 7.172   -15.056 1.00 57.16  ? 52  ARG C CZ  1 
ATOM   4324 N  NH1 . ARG C 1 11  ? 29.847 7.877   -14.182 1.00 52.88  ? 52  ARG C NH1 1 
ATOM   4325 N  NH2 . ARG C 1 11  ? 31.038 7.777   -16.134 1.00 56.32  ? 52  ARG C NH2 1 
ATOM   4326 N  N   . ARG C 1 12  ? 35.830 4.466   -12.676 1.00 31.78  ? 53  ARG C N   1 
ATOM   4327 C  CA  . ARG C 1 12  ? 37.092 4.024   -13.199 1.00 34.92  ? 53  ARG C CA  1 
ATOM   4328 C  C   . ARG C 1 12  ? 38.084 3.523   -12.177 1.00 41.74  ? 53  ARG C C   1 
ATOM   4329 O  O   . ARG C 1 12  ? 38.795 2.544   -12.432 1.00 43.39  ? 53  ARG C O   1 
ATOM   4330 C  CB  . ARG C 1 12  ? 37.754 5.155   -13.965 1.00 33.60  ? 53  ARG C CB  1 
ATOM   4331 C  CG  . ARG C 1 12  ? 37.011 5.548   -15.219 1.00 39.23  ? 53  ARG C CG  1 
ATOM   4332 C  CD  . ARG C 1 12  ? 37.833 6.536   -16.019 1.00 40.34  ? 53  ARG C CD  1 
ATOM   4333 N  NE  . ARG C 1 12  ? 37.181 6.902   -17.275 1.00 51.17  ? 53  ARG C NE  1 
ATOM   4334 C  CZ  . ARG C 1 12  ? 37.553 7.938   -18.031 1.00 58.37  ? 53  ARG C CZ  1 
ATOM   4335 N  NH1 . ARG C 1 12  ? 38.571 8.712   -17.647 1.00 53.33  ? 53  ARG C NH1 1 
ATOM   4336 N  NH2 . ARG C 1 12  ? 36.928 8.192   -19.180 1.00 51.80  ? 53  ARG C NH2 1 
ATOM   4337 N  N   . ALA C 1 13  ? 38.135 4.175   -11.016 1.00 34.75  ? 54  ALA C N   1 
ATOM   4338 C  CA  . ALA C 1 13  ? 39.123 3.806   -10.030 1.00 30.00  ? 54  ALA C CA  1 
ATOM   4339 C  C   . ALA C 1 13  ? 38.714 2.922   -8.872  1.00 35.35  ? 54  ALA C C   1 
ATOM   4340 O  O   . ALA C 1 13  ? 39.475 2.033   -8.499  1.00 38.05  ? 54  ALA C O   1 
ATOM   4341 C  CB  . ALA C 1 13  ? 39.833 5.089   -9.499  1.00 29.97  ? 54  ALA C CB  1 
ATOM   4342 N  N   . ALA C 1 14  ? 37.519 3.124   -8.320  1.00 37.02  ? 55  ALA C N   1 
ATOM   4343 C  CA  . ALA C 1 14  ? 37.093 2.357   -7.151  1.00 36.50  ? 55  ALA C CA  1 
ATOM   4344 C  C   . ALA C 1 14  ? 37.120 0.822   -7.244  1.00 38.45  ? 55  ALA C C   1 
ATOM   4345 O  O   . ALA C 1 14  ? 37.337 0.155   -6.240  1.00 35.52  ? 55  ALA C O   1 
ATOM   4346 C  CB  . ALA C 1 14  ? 35.712 2.815   -6.698  1.00 27.78  ? 55  ALA C CB  1 
ATOM   4347 N  N   . PRO C 1 15  ? 36.858 0.244   -8.429  1.00 35.89  ? 56  PRO C N   1 
ATOM   4348 C  CA  . PRO C 1 15  ? 36.900 -1.233  -8.472  1.00 35.46  ? 56  PRO C CA  1 
ATOM   4349 C  C   . PRO C 1 15  ? 38.317 -1.784  -8.146  1.00 37.97  ? 56  PRO C C   1 
ATOM   4350 O  O   . PRO C 1 15  ? 38.452 -2.878  -7.629  1.00 34.45  ? 56  PRO C O   1 
ATOM   4351 C  CB  . PRO C 1 15  ? 36.467 -1.559  -9.906  1.00 36.88  ? 56  PRO C CB  1 
ATOM   4352 C  CG  . PRO C 1 15  ? 35.538 -0.372  -10.274 1.00 37.33  ? 56  PRO C CG  1 
ATOM   4353 C  CD  . PRO C 1 15  ? 36.326 0.818   -9.681  1.00 34.37  ? 56  PRO C CD  1 
ATOM   4354 N  N   . ALA C 1 16  ? 39.352 -0.994  -8.428  1.00 38.72  ? 57  ALA C N   1 
ATOM   4355 C  CA  . ALA C 1 16  ? 40.749 -1.376  -8.182  1.00 37.29  ? 57  ALA C CA  1 
ATOM   4356 C  C   . ALA C 1 16  ? 41.224 -1.180  -6.738  1.00 38.77  ? 57  ALA C C   1 
ATOM   4357 O  O   . ALA C 1 16  ? 42.349 -1.547  -6.408  1.00 35.47  ? 57  ALA C O   1 
ATOM   4358 C  CB  . ALA C 1 16  ? 41.671 -0.594  -9.122  1.00 32.25  ? 57  ALA C CB  1 
ATOM   4359 N  N   . VAL C 1 17  ? 40.384 -0.600  -5.881  1.00 38.31  ? 58  VAL C N   1 
ATOM   4360 C  CA  . VAL C 1 17  ? 40.781 -0.373  -4.487  1.00 35.08  ? 58  VAL C CA  1 
ATOM   4361 C  C   . VAL C 1 17  ? 40.200 -1.491  -3.630  1.00 38.37  ? 58  VAL C C   1 
ATOM   4362 O  O   . VAL C 1 17  ? 39.015 -1.789  -3.713  1.00 35.30  ? 58  VAL C O   1 
ATOM   4363 C  CB  . VAL C 1 17  ? 40.304 1.028   -3.986  1.00 39.50  ? 58  VAL C CB  1 
ATOM   4364 C  CG1 . VAL C 1 17  ? 40.694 1.244   -2.515  1.00 25.31  ? 58  VAL C CG1 1 
ATOM   4365 C  CG2 . VAL C 1 17  ? 40.935 2.108   -4.851  1.00 27.71  ? 58  VAL C CG2 1 
ATOM   4366 N  N   . VAL C 1 18  ? 41.047 -2.128  -2.821  1.00 36.38  ? 59  VAL C N   1 
ATOM   4367 C  CA  . VAL C 1 18  ? 40.609 -3.257  -2.012  1.00 31.84  ? 59  VAL C CA  1 
ATOM   4368 C  C   . VAL C 1 18  ? 40.762 -3.112  -0.502  1.00 32.98  ? 59  VAL C C   1 
ATOM   4369 O  O   . VAL C 1 18  ? 41.474 -2.240  0.008   1.00 33.08  ? 59  VAL C O   1 
ATOM   4370 C  CB  . VAL C 1 18  ? 41.430 -4.544  -2.373  1.00 34.49  ? 59  VAL C CB  1 
ATOM   4371 C  CG1 . VAL C 1 18  ? 41.344 -4.872  -3.907  1.00 27.36  ? 59  VAL C CG1 1 
ATOM   4372 C  CG2 . VAL C 1 18  ? 42.875 -4.331  -1.946  1.00 26.61  ? 59  VAL C CG2 1 
ATOM   4373 N  N   . ASN C 1 19  ? 40.098 -4.019  0.198   1.00 34.42  ? 60  ASN C N   1 
ATOM   4374 C  CA  . ASN C 1 19  ? 40.237 -4.130  1.650   1.00 40.02  ? 60  ASN C CA  1 
ATOM   4375 C  C   . ASN C 1 19  ? 41.410 -5.074  1.909   1.00 42.56  ? 60  ASN C C   1 
ATOM   4376 O  O   . ASN C 1 19  ? 41.591 -6.077  1.193   1.00 44.35  ? 60  ASN C O   1 
ATOM   4377 C  CB  . ASN C 1 19  ? 38.991 -4.759  2.253   1.00 45.21  ? 60  ASN C CB  1 
ATOM   4378 C  CG  . ASN C 1 19  ? 38.126 -3.752  2.932   1.00 61.65  ? 60  ASN C CG  1 
ATOM   4379 O  OD1 . ASN C 1 19  ? 38.412 -3.339  4.063   1.00 72.61  ? 60  ASN C OD1 1 
ATOM   4380 N  ND2 . ASN C 1 19  ? 37.071 -3.321  2.250   1.00 59.64  ? 60  ASN C ND2 1 
ATOM   4381 N  N   . VAL C 1 20  ? 42.192 -4.769  2.935   1.00 45.50  ? 61  VAL C N   1 
ATOM   4382 C  CA  . VAL C 1 20  ? 43.330 -5.596  3.300   1.00 47.17  ? 61  VAL C CA  1 
ATOM   4383 C  C   . VAL C 1 20  ? 43.171 -5.993  4.768   1.00 50.82  ? 61  VAL C C   1 
ATOM   4384 O  O   . VAL C 1 20  ? 43.032 -5.137  5.635   1.00 53.31  ? 61  VAL C O   1 
ATOM   4385 C  CB  . VAL C 1 20  ? 44.642 -4.818  3.104   1.00 50.10  ? 61  VAL C CB  1 
ATOM   4386 C  CG1 . VAL C 1 20  ? 45.820 -5.646  3.569   1.00 40.13  ? 61  VAL C CG1 1 
ATOM   4387 C  CG2 . VAL C 1 20  ? 44.800 -4.422  1.636   1.00 40.41  ? 61  VAL C CG2 1 
ATOM   4388 N  N   . TYR C 1 21  ? 43.161 -7.292  5.047   1.00 53.58  ? 62  TYR C N   1 
ATOM   4389 C  CA  . TYR C 1 21  ? 43.010 -7.749  6.423   1.00 51.95  ? 62  TYR C CA  1 
ATOM   4390 C  C   . TYR C 1 21  ? 44.287 -8.370  6.927   1.00 54.75  ? 62  TYR C C   1 
ATOM   4391 O  O   . TYR C 1 21  ? 44.784 -9.345  6.349   1.00 50.55  ? 62  TYR C O   1 
ATOM   4392 C  CB  . TYR C 1 21  ? 41.911 -8.801  6.548   1.00 51.21  ? 62  TYR C CB  1 
ATOM   4393 C  CG  . TYR C 1 21  ? 40.593 -8.402  5.972   1.00 55.11  ? 62  TYR C CG  1 
ATOM   4394 C  CD1 . TYR C 1 21  ? 40.313 -8.600  4.625   1.00 58.20  ? 62  TYR C CD1 1 
ATOM   4395 C  CD2 . TYR C 1 21  ? 39.614 -7.806  6.775   1.00 67.89  ? 62  TYR C CD2 1 
ATOM   4396 C  CE1 . TYR C 1 21  ? 39.085 -8.213  4.078   1.00 67.07  ? 62  TYR C CE1 1 
ATOM   4397 C  CE2 . TYR C 1 21  ? 38.378 -7.410  6.241   1.00 68.92  ? 62  TYR C CE2 1 
ATOM   4398 C  CZ  . TYR C 1 21  ? 38.121 -7.618  4.890   1.00 69.70  ? 62  TYR C CZ  1 
ATOM   4399 O  OH  . TYR C 1 21  ? 36.905 -7.240  4.350   1.00 73.90  ? 62  TYR C OH  1 
ATOM   4400 N  N   . ASN C 1 22  ? 44.818 -7.811  8.005   1.00 58.29  ? 63  ASN C N   1 
ATOM   4401 C  CA  . ASN C 1 22  ? 46.034 -8.346  8.608   1.00 63.29  ? 63  ASN C CA  1 
ATOM   4402 C  C   . ASN C 1 22  ? 45.627 -9.323  9.725   1.00 65.91  ? 63  ASN C C   1 
ATOM   4403 O  O   . ASN C 1 22  ? 45.153 -8.915  10.799  1.00 66.17  ? 63  ASN C O   1 
ATOM   4404 C  CB  . ASN C 1 22  ? 46.916 -7.194  9.151   1.00 59.63  ? 63  ASN C CB  1 
ATOM   4405 C  CG  . ASN C 1 22  ? 48.074 -7.680  10.038  1.00 57.50  ? 63  ASN C CG  1 
ATOM   4406 O  OD1 . ASN C 1 22  ? 48.990 -6.913  10.373  1.00 53.77  ? 63  ASN C OD1 1 
ATOM   4407 N  ND2 . ASN C 1 22  ? 48.028 -8.943  10.431  1.00 59.05  ? 63  ASN C ND2 1 
ATOM   4408 N  N   . ARG C 1 23  ? 45.793 -10.615 9.454   1.00 63.03  ? 64  ARG C N   1 
ATOM   4409 C  CA  . ARG C 1 23  ? 45.470 -11.641 10.440  1.00 63.36  ? 64  ARG C CA  1 
ATOM   4410 C  C   . ARG C 1 23  ? 46.769 -12.169 11.043  1.00 63.22  ? 64  ARG C C   1 
ATOM   4411 O  O   . ARG C 1 23  ? 46.857 -12.421 12.250  1.00 68.45  ? 64  ARG C O   1 
ATOM   4412 C  CB  . ARG C 1 23  ? 44.705 -12.791 9.785   1.00 62.82  ? 64  ARG C CB  1 
ATOM   4413 C  CG  . ARG C 1 23  ? 43.348 -12.426 9.223   1.00 63.91  ? 64  ARG C CG  1 
ATOM   4414 C  CD  . ARG C 1 23  ? 42.789 -13.569 8.377   1.00 71.31  ? 64  ARG C CD  1 
ATOM   4415 N  NE  . ARG C 1 23  ? 43.038 -14.874 8.988   1.00 78.62  ? 64  ARG C NE  1 
ATOM   4416 C  CZ  . ARG C 1 23  ? 42.602 -16.036 8.504   1.00 83.53  ? 64  ARG C CZ  1 
ATOM   4417 N  NH1 . ARG C 1 23  ? 41.878 -16.075 7.390   1.00 81.99  ? 64  ARG C NH1 1 
ATOM   4418 N  NH2 . ARG C 1 23  ? 42.911 -17.168 9.129   1.00 84.92  ? 64  ARG C NH2 1 
ATOM   4419 N  N   . GLY C 1 24  ? 46.279 -12.551 12.108  1.00 94.22  ? 65  GLY C N   1 
ATOM   4420 C  CA  . GLY C 1 24  ? 47.280 -13.138 13.088  1.00 100.84 ? 65  GLY C CA  1 
ATOM   4421 C  C   . GLY C 1 24  ? 46.965 -14.380 13.962  1.00 105.54 ? 65  GLY C C   1 
ATOM   4422 O  O   . GLY C 1 24  ? 45.950 -14.373 14.665  1.00 105.65 ? 65  GLY C O   1 
ATOM   4423 N  N   . LEU C 1 25  ? 47.779 -15.446 13.935  1.00 109.89 ? 66  LEU C N   1 
ATOM   4424 C  CA  . LEU C 1 25  ? 47.530 -16.651 14.758  1.00 113.74 ? 66  LEU C CA  1 
ATOM   4425 C  C   . LEU C 1 25  ? 47.630 -16.331 16.242  1.00 116.24 ? 66  LEU C C   1 
ATOM   4426 O  O   . LEU C 1 25  ? 46.725 -16.649 17.013  1.00 115.82 ? 66  LEU C O   1 
ATOM   4427 C  CB  . LEU C 1 25  ? 48.538 -17.754 14.399  1.00 114.08 ? 66  LEU C CB  1 
ATOM   4428 C  CG  . LEU C 1 25  ? 48.302 -18.565 13.131  1.00 114.99 ? 66  LEU C CG  1 
ATOM   4429 C  CD1 . LEU C 1 25  ? 49.495 -19.481 12.850  1.00 114.92 ? 66  LEU C CD1 1 
ATOM   4430 C  CD2 . LEU C 1 25  ? 47.015 -19.369 13.226  1.00 114.12 ? 66  LEU C CD2 1 
ATOM   4431 N  N   . ASN C 1 26  ? 48.766 -15.704 16.606  1.00 119.68 ? 67  ASN C N   1 
ATOM   4432 C  CA  . ASN C 1 26  ? 49.046 -15.329 18.005  1.00 122.44 ? 67  ASN C CA  1 
ATOM   4433 C  C   . ASN C 1 26  ? 48.311 -14.045 18.391  1.00 124.24 ? 67  ASN C C   1 
ATOM   4434 O  O   . ASN C 1 26  ? 48.841 -13.166 19.079  1.00 124.46 ? 67  ASN C O   1 
ATOM   4435 C  CB  . ASN C 1 26  ? 50.516 -15.290 18.301  1.00 123.36 ? 67  ASN C CB  1 
ATOM   4436 C  CG  . ASN C 1 26  ? 50.756 -15.323 19.821  1.00 124.16 ? 67  ASN C CG  1 
ATOM   4437 O  OD1 . ASN C 1 26  ? 50.253 -16.176 20.539  1.00 124.51 ? 67  ASN C OD1 1 
ATOM   4438 N  ND2 . ASN C 1 26  ? 51.552 -14.365 20.291  1.00 123.60 ? 67  ASN C ND2 1 
ATOM   4439 N  N   . THR C 1 27  ? 47.063 -13.983 17.892  0.00 126.58 ? 68  THR C N   1 
ATOM   4440 C  CA  . THR C 1 27  ? 46.068 -12.973 18.275  0.00 128.55 ? 68  THR C CA  1 
ATOM   4441 C  C   . THR C 1 27  ? 45.526 -13.620 19.561  0.00 129.83 ? 68  THR C C   1 
ATOM   4442 O  O   . THR C 1 27  ? 46.300 -14.429 20.056  0.00 129.03 ? 68  THR C O   1 
ATOM   4443 C  CB  . THR C 1 27  ? 45.138 -12.559 17.149  0.00 128.28 ? 68  THR C CB  1 
ATOM   4444 O  OG1 . THR C 1 27  ? 45.881 -12.478 15.916  0.00 127.54 ? 68  THR C OG1 1 
ATOM   4445 C  CG2 . THR C 1 27  ? 44.476 -11.225 17.455  0.00 128.21 ? 68  THR C CG2 1 
ATOM   4446 N  N   . ASN C 1 28  ? 44.367 -13.402 20.233  0.00 131.34 ? 69  ASN C N   1 
ATOM   4447 C  CA  . ASN C 1 28  ? 44.358 -14.126 21.549  0.00 132.64 ? 69  ASN C CA  1 
ATOM   4448 C  C   . ASN C 1 28  ? 44.151 -15.658 21.465  0.00 133.22 ? 69  ASN C C   1 
ATOM   4449 O  O   . ASN C 1 28  ? 43.445 -16.175 20.606  0.00 133.56 ? 69  ASN C O   1 
ATOM   4450 C  CB  . ASN C 1 28  ? 43.486 -13.437 22.591  0.00 132.81 ? 69  ASN C CB  1 
ATOM   4451 C  CG  . ASN C 1 28  ? 42.143 -12.979 22.133  0.00 133.52 ? 69  ASN C CG  1 
ATOM   4452 O  OD1 . ASN C 1 28  ? 41.972 -11.822 21.743  0.00 133.89 ? 69  ASN C OD1 1 
ATOM   4453 N  ND2 . ASN C 1 28  ? 41.171 -13.881 22.163  0.00 133.64 ? 69  ASN C ND2 1 
ATOM   4454 N  N   . SER C 1 29  ? 44.833 -16.362 22.369  0.00 133.15 ? 70  SER C N   1 
ATOM   4455 C  CA  . SER C 1 29  ? 45.028 -17.823 22.341  0.00 133.48 ? 70  SER C CA  1 
ATOM   4456 C  C   . SER C 1 29  ? 43.893 -18.869 22.326  0.00 133.17 ? 70  SER C C   1 
ATOM   4457 O  O   . SER C 1 29  ? 43.150 -19.117 23.279  0.00 133.08 ? 70  SER C O   1 
ATOM   4458 C  CB  . SER C 1 29  ? 46.128 -18.091 23.375  0.00 133.81 ? 70  SER C CB  1 
ATOM   4459 O  OG  . SER C 1 29  ? 47.313 -17.373 23.055  0.00 133.20 ? 70  SER C OG  1 
ATOM   4460 N  N   . HIS C 1 30  ? 43.935 -19.440 21.108  0.00 132.65 ? 71  HIS C N   1 
ATOM   4461 C  CA  . HIS C 1 30  ? 43.284 -20.590 20.473  0.00 132.41 ? 71  HIS C CA  1 
ATOM   4462 C  C   . HIS C 1 30  ? 44.230 -20.837 19.319  0.00 131.93 ? 71  HIS C C   1 
ATOM   4463 O  O   . HIS C 1 30  ? 44.147 -21.836 18.598  0.00 131.63 ? 71  HIS C O   1 
ATOM   4464 C  CB  . HIS C 1 30  ? 41.853 -20.405 19.927  0.00 133.14 ? 71  HIS C CB  1 
ATOM   4465 C  CG  . HIS C 1 30  ? 40.769 -20.733 20.978  0.00 133.93 ? 71  HIS C CG  1 
ATOM   4466 N  ND1 . HIS C 1 30  ? 40.692 -21.905 21.713  0.00 134.13 ? 71  HIS C ND1 1 
ATOM   4467 C  CD2 . HIS C 1 30  ? 39.740 -19.943 21.413  0.00 134.01 ? 71  HIS C CD2 1 
ATOM   4468 C  CE1 . HIS C 1 30  ? 39.640 -21.811 22.543  0.00 134.13 ? 71  HIS C CE1 1 
ATOM   4469 N  NE2 . HIS C 1 30  ? 39.052 -20.630 22.375  0.00 133.99 ? 71  HIS C NE2 1 
ATOM   4470 N  N   . ASN C 1 31  ? 45.122 -19.862 19.157  0.00 131.34 ? 72  ASN C N   1 
ATOM   4471 C  CA  . ASN C 1 31  ? 46.119 -19.888 18.092  0.00 130.60 ? 72  ASN C CA  1 
ATOM   4472 C  C   . ASN C 1 31  ? 45.436 -19.926 16.725  0.00 130.25 ? 72  ASN C C   1 
ATOM   4473 O  O   . ASN C 1 31  ? 45.894 -20.600 15.798  0.00 130.43 ? 72  ASN C O   1 
ATOM   4474 C  CB  . ASN C 1 31  ? 47.042 -21.097 18.266  0.00 129.92 ? 72  ASN C CB  1 
ATOM   4475 C  CG  . ASN C 1 31  ? 47.830 -21.042 19.560  0.00 129.21 ? 72  ASN C CG  1 
ATOM   4476 O  OD1 . ASN C 1 31  ? 48.593 -20.107 19.793  0.00 128.49 ? 72  ASN C OD1 1 
ATOM   4477 N  ND2 . ASN C 1 31  ? 47.645 -22.044 20.411  0.00 129.44 ? 72  ASN C ND2 1 
ATOM   4478 N  N   . GLN C 1 32  ? 44.336 -19.185 16.615  0.00 128.74 ? 73  GLN C N   1 
ATOM   4479 C  CA  . GLN C 1 32  ? 43.564 -19.112 15.381  0.00 126.47 ? 73  GLN C CA  1 
ATOM   4480 C  C   . GLN C 1 32  ? 43.679 -17.715 14.783  0.00 124.18 ? 73  GLN C C   1 
ATOM   4481 O  O   . GLN C 1 32  ? 43.620 -16.715 15.502  0.00 123.95 ? 73  GLN C O   1 
ATOM   4482 C  CB  . GLN C 1 32  ? 42.098 -19.444 15.668  0.00 127.10 ? 73  GLN C CB  1 
ATOM   4483 C  CG  . GLN C 1 32  ? 41.915 -20.760 16.415  0.00 127.84 ? 73  GLN C CG  1 
ATOM   4484 C  CD  . GLN C 1 32  ? 40.460 -21.092 16.682  0.00 128.88 ? 73  GLN C CD  1 
ATOM   4485 O  OE1 . GLN C 1 32  ? 40.151 -22.101 17.320  0.00 128.68 ? 73  GLN C OE1 1 
ATOM   4486 N  NE2 . GLN C 1 32  ? 39.557 -20.248 16.191  0.00 129.60 ? 73  GLN C NE2 1 
ATOM   4487 N  N   . LEU C 1 33  ? 43.842 -17.657 13.464  0.00 121.22 ? 74  LEU C N   1 
ATOM   4488 C  CA  . LEU C 1 33  ? 43.987 -16.391 12.753  0.00 118.71 ? 74  LEU C CA  1 
ATOM   4489 C  C   . LEU C 1 33  ? 42.876 -15.377 13.030  0.00 116.54 ? 74  LEU C C   1 
ATOM   4490 O  O   . LEU C 1 33  ? 41.778 -15.472 12.479  0.00 115.85 ? 74  LEU C O   1 
ATOM   4491 C  CB  . LEU C 1 33  ? 44.092 -16.646 11.245  0.00 118.40 ? 74  LEU C CB  1 
ATOM   4492 C  CG  . LEU C 1 33  ? 45.383 -17.320 10.769  0.00 117.87 ? 74  LEU C CG  1 
ATOM   4493 C  CD1 . LEU C 1 33  ? 45.259 -17.688 9.302   0.00 117.95 ? 74  LEU C CD1 1 
ATOM   4494 C  CD2 . LEU C 1 33  ? 46.567 -16.389 10.996  0.00 116.99 ? 74  LEU C CD2 1 
ATOM   4495 N  N   . GLU C 1 34  ? 43.180 -14.405 13.887  0.00 113.60 ? 75  GLU C N   1 
ATOM   4496 C  CA  . GLU C 1 34  ? 42.231 -13.356 14.236  0.00 110.21 ? 75  GLU C CA  1 
ATOM   4497 C  C   . GLU C 1 34  ? 42.616 -12.064 13.520  0.00 107.05 ? 75  GLU C C   1 
ATOM   4498 O  O   . GLU C 1 34  ? 43.796 -11.711 13.450  0.00 105.48 ? 75  GLU C O   1 
ATOM   4499 C  CB  . GLU C 1 34  ? 42.228 -13.114 15.750  0.00 111.12 ? 75  GLU C CB  1 
ATOM   4500 C  CG  . GLU C 1 34  ? 41.262 -12.016 16.194  0.00 112.21 ? 75  GLU C CG  1 
ATOM   4501 C  CD  . GLU C 1 34  ? 41.347 -11.714 17.682  0.00 112.55 ? 75  GLU C CD  1 
ATOM   4502 O  OE1 . GLU C 1 34  ? 41.150 -12.647 18.491  0.00 112.91 ? 75  GLU C OE1 1 
ATOM   4503 O  OE2 . GLU C 1 34  ? 41.606 -10.543 18.040  0.00 110.84 ? 75  GLU C OE2 1 
ATOM   4504 N  N   . ILE C 1 35  ? 41.618 -11.365 12.990  0.00 103.17 ? 76  ILE C N   1 
ATOM   4505 C  CA  . ILE C 1 35  ? 41.857 -10.112 12.286  0.00 98.88  ? 76  ILE C CA  1 
ATOM   4506 C  C   . ILE C 1 35  ? 42.452 -9.096  13.252  0.00 96.34  ? 76  ILE C C   1 
ATOM   4507 O  O   . ILE C 1 35  ? 41.814 -8.721  14.230  0.00 96.30  ? 76  ILE C O   1 
ATOM   4508 C  CB  . ILE C 1 35  ? 40.551 -9.559  11.704  0.00 98.24  ? 76  ILE C CB  1 
ATOM   4509 C  CG1 . ILE C 1 35  ? 39.927 -10.598 10.771  0.00 98.29  ? 76  ILE C CG1 1 
ATOM   4510 C  CG2 . ILE C 1 35  ? 40.826 -8.277  10.957  0.00 98.00  ? 76  ILE C CG2 1 
ATOM   4511 C  CD1 . ILE C 1 35  ? 38.608 -10.178 10.169  0.00 98.91  ? 76  ILE C CD1 1 
ATOM   4512 N  N   . ARG C 1 36  ? 43.677 -8.659  12.979  0.00 93.58  ? 77  ARG C N   1 
ATOM   4513 C  CA  . ARG C 1 36  ? 44.359 -7.703  13.845  0.00 90.61  ? 77  ARG C CA  1 
ATOM   4514 C  C   . ARG C 1 36  ? 44.330 -6.269  13.338  0.00 88.39  ? 77  ARG C C   1 
ATOM   4515 O  O   . ARG C 1 36  ? 44.098 -5.339  14.112  0.00 86.83  ? 77  ARG C O   1 
ATOM   4516 C  CB  . ARG C 1 36  ? 45.809 -8.125  14.051  0.00 93.05  ? 77  ARG C CB  1 
ATOM   4517 C  CG  . ARG C 1 36  ? 45.973 -9.446  14.767  0.00 96.77  ? 77  ARG C CG  1 
ATOM   4518 C  CD  . ARG C 1 36  ? 47.445 -9.766  14.953  0.00 99.33  ? 77  ARG C CD  1 
ATOM   4519 N  NE  . ARG C 1 36  ? 48.123 -8.761  15.766  0.00 100.67 ? 77  ARG C NE  1 
ATOM   4520 C  CZ  . ARG C 1 36  ? 49.444 -8.684  15.907  0.00 103.00 ? 77  ARG C CZ  1 
ATOM   4521 N  NH1 . ARG C 1 36  ? 50.235 -9.553  15.286  0.00 104.03 ? 77  ARG C NH1 1 
ATOM   4522 N  NH2 . ARG C 1 36  ? 49.978 -7.739  16.669  0.00 102.81 ? 77  ARG C NH2 1 
ATOM   4523 N  N   . THR C 1 37  ? 44.336 -5.916  12.283  0.00 78.28  ? 78  THR C N   1 
ATOM   4524 C  CA  . THR C 1 37  ? 44.457 -4.642  11.583  0.00 76.44  ? 78  THR C CA  1 
ATOM   4525 C  C   . THR C 1 37  ? 43.880 -4.700  10.168  0.00 73.47  ? 78  THR C C   1 
ATOM   4526 O  O   . THR C 1 37  ? 44.200 -5.600  9.391   0.00 76.82  ? 78  THR C O   1 
ATOM   4527 C  CB  . THR C 1 37  ? 45.933 -4.198  11.462  0.00 79.17  ? 78  THR C CB  1 
ATOM   4528 O  OG1 . THR C 1 37  ? 46.576 -4.270  12.742  0.00 83.03  ? 78  THR C OG1 1 
ATOM   4529 C  CG2 . THR C 1 37  ? 46.006 -2.759  10.942  0.00 79.61  ? 78  THR C CG2 1 
ATOM   4530 N  N   . LEU C 1 38  ? 43.035 -3.728  9.844   1.00 68.37  ? 79  LEU C N   1 
ATOM   4531 C  CA  . LEU C 1 38  ? 42.417 -3.616  8.525   1.00 65.82  ? 79  LEU C CA  1 
ATOM   4532 C  C   . LEU C 1 38  ? 43.060 -2.460  7.751   1.00 61.43  ? 79  LEU C C   1 
ATOM   4533 O  O   . LEU C 1 38  ? 43.745 -1.620  8.338   1.00 60.96  ? 79  LEU C O   1 
ATOM   4534 C  CB  . LEU C 1 38  ? 40.912 -3.355  8.655   1.00 64.24  ? 79  LEU C CB  1 
ATOM   4535 C  CG  . LEU C 1 38  ? 40.027 -4.599  8.693   1.00 73.33  ? 79  LEU C CG  1 
ATOM   4536 C  CD1 . LEU C 1 38  ? 40.366 -5.461  9.896   1.00 77.27  ? 79  LEU C CD1 1 
ATOM   4537 C  CD2 . LEU C 1 38  ? 38.588 -4.180  8.738   1.00 74.94  ? 79  LEU C CD2 1 
ATOM   4538 N  N   . GLY C 1 39  ? 42.841 -2.414  6.438   1.00 51.16  ? 80  GLY C N   1 
ATOM   4539 C  CA  . GLY C 1 39  ? 43.408 -1.336  5.651   1.00 37.73  ? 80  GLY C CA  1 
ATOM   4540 C  C   . GLY C 1 39  ? 42.907 -1.390  4.227   1.00 39.53  ? 80  GLY C C   1 
ATOM   4541 O  O   . GLY C 1 39  ? 42.017 -2.173  3.901   1.00 37.97  ? 80  GLY C O   1 
ATOM   4542 N  N   . SER C 1 40  ? 43.485 -0.558  3.371   1.00 34.75  ? 81  SER C N   1 
ATOM   4543 C  CA  . SER C 1 40  ? 43.104 -0.533  1.965   1.00 37.29  ? 81  SER C CA  1 
ATOM   4544 C  C   . SER C 1 40  ? 44.363 -0.706  1.135   1.00 37.12  ? 81  SER C C   1 
ATOM   4545 O  O   . SER C 1 40  ? 45.481 -0.503  1.621   1.00 32.27  ? 81  SER C O   1 
ATOM   4546 C  CB  . SER C 1 40  ? 42.450 0.810   1.572   1.00 33.81  ? 81  SER C CB  1 
ATOM   4547 O  OG  . SER C 1 40  ? 41.163 0.964   2.179   1.00 45.19  ? 81  SER C OG  1 
ATOM   4548 N  N   . GLY C 1 41  ? 44.151 -1.055  -0.127  1.00 33.41  ? 82  GLY C N   1 
ATOM   4549 C  CA  . GLY C 1 41  ? 45.240 -1.236  -1.048  1.00 30.90  ? 82  GLY C CA  1 
ATOM   4550 C  C   . GLY C 1 41  ? 44.763 -0.944  -2.452  1.00 29.62  ? 82  GLY C C   1 
ATOM   4551 O  O   . GLY C 1 41  ? 43.560 -0.846  -2.715  1.00 31.04  ? 82  GLY C O   1 
ATOM   4552 N  N   . VAL C 1 42  ? 45.725 -0.812  -3.352  1.00 27.70  ? 83  VAL C N   1 
ATOM   4553 C  CA  . VAL C 1 42  ? 45.452 -0.515  -4.741  1.00 31.98  ? 83  VAL C CA  1 
ATOM   4554 C  C   . VAL C 1 42  ? 46.030 -1.588  -5.680  1.00 34.47  ? 83  VAL C C   1 
ATOM   4555 O  O   . VAL C 1 42  ? 47.240 -1.881  -5.668  1.00 30.17  ? 83  VAL C O   1 
ATOM   4556 C  CB  . VAL C 1 42  ? 46.047 0.894   -5.102  1.00 31.44  ? 83  VAL C CB  1 
ATOM   4557 C  CG1 . VAL C 1 42  ? 45.619 1.317   -6.511  1.00 31.07  ? 83  VAL C CG1 1 
ATOM   4558 C  CG2 . VAL C 1 42  ? 45.562 1.937   -4.076  1.00 37.63  ? 83  VAL C CG2 1 
ATOM   4559 N  N   . ILE C 1 43  ? 45.163 -2.191  -6.481  1.00 34.55  ? 84  ILE C N   1 
ATOM   4560 C  CA  . ILE C 1 43  ? 45.625 -3.184  -7.442  1.00 36.45  ? 84  ILE C CA  1 
ATOM   4561 C  C   . ILE C 1 43  ? 46.277 -2.371  -8.546  1.00 40.17  ? 84  ILE C C   1 
ATOM   4562 O  O   . ILE C 1 43  ? 45.592 -1.570  -9.204  1.00 33.16  ? 84  ILE C O   1 
ATOM   4563 C  CB  . ILE C 1 43  ? 44.458 -3.993  -8.019  1.00 37.96  ? 84  ILE C CB  1 
ATOM   4564 C  CG1 . ILE C 1 43  ? 43.795 -4.774  -6.891  1.00 29.88  ? 84  ILE C CG1 1 
ATOM   4565 C  CG2 . ILE C 1 43  ? 44.972 -4.951  -9.095  1.00 31.16  ? 84  ILE C CG2 1 
ATOM   4566 C  CD1 . ILE C 1 43  ? 42.534 -5.516  -7.311  1.00 29.12  ? 84  ILE C CD1 1 
HETATM 4567 N  N   . MSE C 1 44  ? 47.585 -2.588  -8.745  1.00 36.19  ? 85  MSE C N   1 
HETATM 4568 C  CA  . MSE C 1 44  ? 48.383 -1.840  -9.720  1.00 37.01  ? 85  MSE C CA  1 
HETATM 4569 C  C   . MSE C 1 44  ? 48.452 -2.372  -11.147 1.00 42.29  ? 85  MSE C C   1 
HETATM 4570 O  O   . MSE C 1 44  ? 48.589 -1.586  -12.083 1.00 43.35  ? 85  MSE C O   1 
HETATM 4571 C  CB  . MSE C 1 44  ? 49.827 -1.683  -9.204  1.00 41.38  ? 85  MSE C CB  1 
HETATM 4572 C  CG  . MSE C 1 44  ? 49.981 -1.006  -7.830  1.00 37.90  ? 85  MSE C CG  1 
HETATM 4573 SE SE  . MSE C 1 44  ? 49.191 0.826   -7.803  1.00 49.40  ? 85  MSE C SE  1 
HETATM 4574 C  CE  . MSE C 1 44  ? 50.364 1.737   -9.047  1.00 36.34  ? 85  MSE C CE  1 
ATOM   4575 N  N   . ASP C 1 45  ? 48.385 -3.687  -11.331 1.00 38.16  ? 86  ASP C N   1 
ATOM   4576 C  CA  . ASP C 1 45  ? 48.466 -4.226  -12.678 1.00 40.65  ? 86  ASP C CA  1 
ATOM   4577 C  C   . ASP C 1 45  ? 47.915 -5.635  -12.799 1.00 42.10  ? 86  ASP C C   1 
ATOM   4578 O  O   . ASP C 1 45  ? 47.488 -6.229  -11.799 1.00 37.46  ? 86  ASP C O   1 
ATOM   4579 C  CB  . ASP C 1 45  ? 49.926 -4.147  -13.200 1.00 42.93  ? 86  ASP C CB  1 
ATOM   4580 C  CG  . ASP C 1 45  ? 50.906 -5.061  -12.430 1.00 50.37  ? 86  ASP C CG  1 
ATOM   4581 O  OD1 . ASP C 1 45  ? 52.127 -4.829  -12.547 1.00 57.29  ? 86  ASP C OD1 1 
ATOM   4582 O  OD2 . ASP C 1 45  ? 50.481 -6.011  -11.731 1.00 49.88  ? 86  ASP C OD2 1 
ATOM   4583 N  N   . GLN C 1 46  ? 47.919 -6.168  -14.024 1.00 42.61  ? 87  GLN C N   1 
ATOM   4584 C  CA  . GLN C 1 46  ? 47.382 -7.506  -14.278 1.00 44.51  ? 87  GLN C CA  1 
ATOM   4585 C  C   . GLN C 1 46  ? 48.259 -8.642  -13.781 1.00 43.57  ? 87  GLN C C   1 
ATOM   4586 O  O   . GLN C 1 46  ? 47.868 -9.800  -13.845 1.00 48.43  ? 87  GLN C O   1 
ATOM   4587 C  CB  . GLN C 1 46  ? 47.088 -7.697  -15.773 1.00 52.14  ? 87  GLN C CB  1 
ATOM   4588 C  CG  . GLN C 1 46  ? 45.943 -6.809  -16.291 1.00 55.30  ? 87  GLN C CG  1 
ATOM   4589 C  CD  . GLN C 1 46  ? 44.589 -7.083  -15.610 1.00 60.29  ? 87  GLN C CD  1 
ATOM   4590 O  OE1 . GLN C 1 46  ? 43.627 -6.348  -15.816 1.00 67.03  ? 87  GLN C OE1 1 
ATOM   4591 N  NE2 . GLN C 1 46  ? 44.516 -8.137  -14.808 1.00 57.20  ? 87  GLN C NE2 1 
ATOM   4592 N  N   . ARG C 1 47  ? 49.440 -8.327  -13.278 1.00 38.32  ? 88  ARG C N   1 
ATOM   4593 C  CA  . ARG C 1 47  ? 50.288 -9.387  -12.759 1.00 39.18  ? 88  ARG C CA  1 
ATOM   4594 C  C   . ARG C 1 47  ? 49.837 -9.663  -11.332 1.00 42.03  ? 88  ARG C C   1 
ATOM   4595 O  O   . ARG C 1 47  ? 50.299 -10.590 -10.673 1.00 43.17  ? 88  ARG C O   1 
ATOM   4596 C  CB  . ARG C 1 47  ? 51.740 -8.962  -12.797 1.00 39.84  ? 88  ARG C CB  1 
ATOM   4597 C  CG  . ARG C 1 47  ? 52.315 -8.953  -14.220 1.00 42.99  ? 88  ARG C CG  1 
ATOM   4598 C  CD  . ARG C 1 47  ? 53.782 -8.599  -14.161 1.00 44.14  ? 88  ARG C CD  1 
ATOM   4599 N  NE  . ARG C 1 47  ? 53.951 -7.299  -13.536 1.00 44.45  ? 88  ARG C NE  1 
ATOM   4600 C  CZ  . ARG C 1 47  ? 55.113 -6.821  -13.101 1.00 57.27  ? 88  ARG C CZ  1 
ATOM   4601 N  NH1 . ARG C 1 47  ? 56.234 -7.544  -13.212 1.00 53.15  ? 88  ARG C NH1 1 
ATOM   4602 N  NH2 . ARG C 1 47  ? 55.153 -5.607  -12.566 1.00 46.68  ? 88  ARG C NH2 1 
ATOM   4603 N  N   . GLY C 1 48  ? 48.914 -8.836  -10.861 1.00 35.06  ? 89  GLY C N   1 
ATOM   4604 C  CA  . GLY C 1 48  ? 48.385 -9.034  -9.541  1.00 31.28  ? 89  GLY C CA  1 
ATOM   4605 C  C   . GLY C 1 48  ? 49.062 -8.293  -8.414  1.00 31.85  ? 89  GLY C C   1 
ATOM   4606 O  O   . GLY C 1 48  ? 48.833 -8.652  -7.253  1.00 33.96  ? 89  GLY C O   1 
ATOM   4607 N  N   . TYR C 1 49  ? 49.890 -7.289  -8.723  1.00 26.91  ? 90  TYR C N   1 
ATOM   4608 C  CA  . TYR C 1 49  ? 50.558 -6.527  -7.662  1.00 32.25  ? 90  TYR C CA  1 
ATOM   4609 C  C   . TYR C 1 49  ? 49.637 -5.469  -7.053  1.00 33.63  ? 90  TYR C C   1 
ATOM   4610 O  O   . TYR C 1 49  ? 48.896 -4.779  -7.758  1.00 35.60  ? 90  TYR C O   1 
ATOM   4611 C  CB  . TYR C 1 49  ? 51.835 -5.873  -8.197  1.00 29.39  ? 90  TYR C CB  1 
ATOM   4612 C  CG  . TYR C 1 49  ? 52.936 -6.890  -8.382  1.00 35.87  ? 90  TYR C CG  1 
ATOM   4613 C  CD1 . TYR C 1 49  ? 53.337 -7.299  -9.663  1.00 31.72  ? 90  TYR C CD1 1 
ATOM   4614 C  CD2 . TYR C 1 49  ? 53.568 -7.473  -7.263  1.00 29.17  ? 90  TYR C CD2 1 
ATOM   4615 C  CE1 . TYR C 1 49  ? 54.337 -8.266  -9.837  1.00 33.41  ? 90  TYR C CE1 1 
ATOM   4616 C  CE2 . TYR C 1 49  ? 54.580 -8.429  -7.424  1.00 33.72  ? 90  TYR C CE2 1 
ATOM   4617 C  CZ  . TYR C 1 49  ? 54.957 -8.825  -8.709  1.00 35.63  ? 90  TYR C CZ  1 
ATOM   4618 O  OH  . TYR C 1 49  ? 55.930 -9.784  -8.871  1.00 40.91  ? 90  TYR C OH  1 
ATOM   4619 N  N   . ILE C 1 50  ? 49.717 -5.357  -5.739  1.00 33.05  ? 91  ILE C N   1 
ATOM   4620 C  CA  . ILE C 1 50  ? 48.906 -4.442  -4.948  1.00 35.30  ? 91  ILE C CA  1 
ATOM   4621 C  C   . ILE C 1 50  ? 49.783 -3.612  -4.018  1.00 37.96  ? 91  ILE C C   1 
ATOM   4622 O  O   . ILE C 1 50  ? 50.664 -4.152  -3.348  1.00 39.81  ? 91  ILE C O   1 
ATOM   4623 C  CB  . ILE C 1 50  ? 47.897 -5.237  -4.073  1.00 34.83  ? 91  ILE C CB  1 
ATOM   4624 C  CG1 . ILE C 1 50  ? 46.852 -5.923  -4.961  1.00 37.76  ? 91  ILE C CG1 1 
ATOM   4625 C  CG2 . ILE C 1 50  ? 47.214 -4.327  -3.078  1.00 34.56  ? 91  ILE C CG2 1 
ATOM   4626 C  CD1 . ILE C 1 50  ? 45.933 -6.896  -4.179  1.00 32.00  ? 91  ILE C CD1 1 
ATOM   4627 N  N   . ILE C 1 51  ? 49.550 -2.301  -3.982  1.00 36.70  ? 92  ILE C N   1 
ATOM   4628 C  CA  . ILE C 1 51  ? 50.301 -1.427  -3.089  1.00 32.36  ? 92  ILE C CA  1 
ATOM   4629 C  C   . ILE C 1 51  ? 49.376 -1.060  -1.910  1.00 36.89  ? 92  ILE C C   1 
ATOM   4630 O  O   . ILE C 1 51  ? 48.198 -0.712  -2.117  1.00 34.58  ? 92  ILE C O   1 
ATOM   4631 C  CB  . ILE C 1 51  ? 50.742 -0.118  -3.793  1.00 35.91  ? 92  ILE C CB  1 
ATOM   4632 C  CG1 . ILE C 1 51  ? 51.726 -0.407  -4.917  1.00 33.18  ? 92  ILE C CG1 1 
ATOM   4633 C  CG2 . ILE C 1 51  ? 51.437 0.808   -2.792  1.00 39.01  ? 92  ILE C CG2 1 
ATOM   4634 C  CD1 . ILE C 1 51  ? 52.391 0.844   -5.459  1.00 33.10  ? 92  ILE C CD1 1 
ATOM   4635 N  N   . THR C 1 52  ? 49.894 -1.184  -0.682  1.00 38.06  ? 93  THR C N   1 
ATOM   4636 C  CA  . THR C 1 52  ? 49.155 -0.821  0.537   1.00 35.75  ? 93  THR C CA  1 
ATOM   4637 C  C   . THR C 1 52  ? 50.178 -0.173  1.469   1.00 31.98  ? 93  THR C C   1 
ATOM   4638 O  O   . THR C 1 52  ? 51.257 0.201   1.006   1.00 33.62  ? 93  THR C O   1 
ATOM   4639 C  CB  . THR C 1 52  ? 48.464 -2.045  1.205   1.00 44.76  ? 93  THR C CB  1 
ATOM   4640 O  OG1 . THR C 1 52  ? 47.774 -1.618  2.391   1.00 38.04  ? 93  THR C OG1 1 
ATOM   4641 C  CG2 . THR C 1 52  ? 49.479 -3.129  1.563   1.00 44.63  ? 93  THR C CG2 1 
ATOM   4642 N  N   . ASN C 1 53  ? 49.864 0.003   2.747   1.00 33.60  ? 94  ASN C N   1 
ATOM   4643 C  CA  . ASN C 1 53  ? 50.824 0.639   3.659   1.00 35.62  ? 94  ASN C CA  1 
ATOM   4644 C  C   . ASN C 1 53  ? 51.601 -0.390  4.463   1.00 36.97  ? 94  ASN C C   1 
ATOM   4645 O  O   . ASN C 1 53  ? 51.092 -1.451  4.774   1.00 39.32  ? 94  ASN C O   1 
ATOM   4646 C  CB  . ASN C 1 53  ? 50.116 1.538   4.684   1.00 42.24  ? 94  ASN C CB  1 
ATOM   4647 C  CG  . ASN C 1 53  ? 49.479 2.784   4.065   1.00 48.49  ? 94  ASN C CG  1 
ATOM   4648 O  OD1 . ASN C 1 53  ? 48.304 3.042   4.279   1.00 56.13  ? 94  ASN C OD1 1 
ATOM   4649 N  ND2 . ASN C 1 53  ? 50.254 3.561   3.326   1.00 42.64  ? 94  ASN C ND2 1 
ATOM   4650 N  N   . LYS C 1 54  ? 52.822 -0.058  4.842   1.00 42.98  ? 95  LYS C N   1 
ATOM   4651 C  CA  . LYS C 1 54  ? 53.583 -0.977  5.660   1.00 46.34  ? 95  LYS C CA  1 
ATOM   4652 C  C   . LYS C 1 54  ? 52.905 -1.188  7.045   1.00 48.89  ? 95  LYS C C   1 
ATOM   4653 O  O   . LYS C 1 54  ? 52.851 -2.313  7.535   1.00 46.66  ? 95  LYS C O   1 
ATOM   4654 C  CB  . LYS C 1 54  ? 55.024 -0.461  5.817   1.00 47.17  ? 95  LYS C CB  1 
ATOM   4655 C  CG  . LYS C 1 54  ? 55.923 -1.378  6.660   1.00 49.30  ? 95  LYS C CG  1 
ATOM   4656 C  CD  . LYS C 1 54  ? 57.391 -0.970  6.599   1.00 51.29  ? 95  LYS C CD  1 
ATOM   4657 C  CE  . LYS C 1 54  ? 58.280 -1.917  7.424   1.00 51.92  ? 95  LYS C CE  1 
ATOM   4658 N  NZ  . LYS C 1 54  ? 57.885 -1.923  8.849   1.00 59.99  ? 95  LYS C NZ  1 
ATOM   4659 N  N   . HIS C 1 55  ? 52.349 -0.142  7.666   1.00 53.90  ? 96  HIS C N   1 
ATOM   4660 C  CA  . HIS C 1 55  ? 51.740 -0.332  9.002   1.00 53.51  ? 96  HIS C CA  1 
ATOM   4661 C  C   . HIS C 1 55  ? 50.543 -1.262  9.004   1.00 54.27  ? 96  HIS C C   1 
ATOM   4662 O  O   . HIS C 1 55  ? 50.291 -1.948  9.988   1.00 58.10  ? 96  HIS C O   1 
ATOM   4663 C  CB  . HIS C 1 55  ? 51.362 1.004   9.669   1.00 58.13  ? 96  HIS C CB  1 
ATOM   4664 C  CG  . HIS C 1 55  ? 50.171 1.684   9.066   1.00 61.88  ? 96  HIS C CG  1 
ATOM   4665 N  ND1 . HIS C 1 55  ? 50.254 2.487   7.947   1.00 69.00  ? 96  HIS C ND1 1 
ATOM   4666 C  CD2 . HIS C 1 55  ? 48.865 1.676   9.425   1.00 63.17  ? 96  HIS C CD2 1 
ATOM   4667 C  CE1 . HIS C 1 55  ? 49.052 2.943   7.642   1.00 64.51  ? 96  HIS C CE1 1 
ATOM   4668 N  NE2 . HIS C 1 55  ? 48.191 2.464   8.522   1.00 68.83  ? 96  HIS C NE2 1 
ATOM   4669 N  N   . VAL C 1 56  ? 49.807 -1.301  7.902   1.00 51.69  ? 97  VAL C N   1 
ATOM   4670 C  CA  . VAL C 1 56  ? 48.671 -2.203  7.806   1.00 53.12  ? 97  VAL C CA  1 
ATOM   4671 C  C   . VAL C 1 56  ? 49.114 -3.675  7.912   1.00 56.47  ? 97  VAL C C   1 
ATOM   4672 O  O   . VAL C 1 56  ? 48.474 -4.476  8.609   1.00 60.51  ? 97  VAL C O   1 
ATOM   4673 C  CB  . VAL C 1 56  ? 47.930 -2.066  6.441   1.00 54.45  ? 97  VAL C CB  1 
ATOM   4674 C  CG1 . VAL C 1 56  ? 46.746 -3.031  6.399   1.00 56.73  ? 97  VAL C CG1 1 
ATOM   4675 C  CG2 . VAL C 1 56  ? 47.459 -0.647  6.219   1.00 49.73  ? 97  VAL C CG2 1 
ATOM   4676 N  N   . ILE C 1 57  ? 50.213 -4.024  7.238   1.00 53.11  ? 98  ILE C N   1 
ATOM   4677 C  CA  . ILE C 1 57  ? 50.678 -5.415  7.201   1.00 52.29  ? 98  ILE C CA  1 
ATOM   4678 C  C   . ILE C 1 57  ? 51.738 -5.885  8.203   1.00 55.63  ? 98  ILE C C   1 
ATOM   4679 O  O   . ILE C 1 57  ? 52.165 -7.045  8.167   1.00 54.79  ? 98  ILE C O   1 
ATOM   4680 C  CB  . ILE C 1 57  ? 51.120 -5.807  5.736   1.00 50.15  ? 98  ILE C CB  1 
ATOM   4681 C  CG1 . ILE C 1 57  ? 52.260 -4.903  5.222   1.00 40.16  ? 98  ILE C CG1 1 
ATOM   4682 C  CG2 . ILE C 1 57  ? 49.914 -5.715  4.808   1.00 47.14  ? 98  ILE C CG2 1 
ATOM   4683 C  CD1 . ILE C 1 57  ? 53.665 -5.299  5.731   1.00 40.25  ? 98  ILE C CD1 1 
ATOM   4684 N  N   . ASN C 1 58  ? 52.153 -5.004  9.106   1.00 61.64  ? 99  ASN C N   1 
ATOM   4685 C  CA  . ASN C 1 58  ? 53.132 -5.385  10.125  1.00 64.86  ? 99  ASN C CA  1 
ATOM   4686 C  C   . ASN C 1 58  ? 52.650 -6.559  10.994  1.00 67.09  ? 99  ASN C C   1 
ATOM   4687 O  O   . ASN C 1 58  ? 51.543 -6.533  11.555  1.00 61.58  ? 99  ASN C O   1 
ATOM   4688 C  CB  . ASN C 1 58  ? 53.468 -4.194  11.038  1.00 60.64  ? 99  ASN C CB  1 
ATOM   4689 C  CG  . ASN C 1 58  ? 54.499 -3.260  10.424  1.00 61.53  ? 99  ASN C CG  1 
ATOM   4690 O  OD1 . ASN C 1 58  ? 55.406 -3.706  9.714   1.00 61.13  ? 99  ASN C OD1 1 
ATOM   4691 N  ND2 . ASN C 1 58  ? 54.380 -1.964  10.706  1.00 57.79  ? 99  ASN C ND2 1 
ATOM   4692 N  N   . ASP C 1 59  ? 53.486 -7.595  11.066  1.00 70.21  ? 100 ASP C N   1 
ATOM   4693 C  CA  . ASP C 1 59  ? 53.227 -8.786  11.884  1.00 76.57  ? 100 ASP C CA  1 
ATOM   4694 C  C   . ASP C 1 59  ? 52.026 -9.625  11.485  1.00 74.72  ? 100 ASP C C   1 
ATOM   4695 O  O   . ASP C 1 59  ? 51.542 -10.433 12.279  1.00 71.72  ? 100 ASP C O   1 
ATOM   4696 C  CB  . ASP C 1 59  ? 53.061 -8.378  13.353  1.00 81.25  ? 100 ASP C CB  1 
ATOM   4697 C  CG  . ASP C 1 59  ? 54.225 -7.559  13.861  1.00 86.37  ? 100 ASP C CG  1 
ATOM   4698 O  OD1 . ASP C 1 59  ? 55.378 -8.035  13.743  1.00 91.82  ? 100 ASP C OD1 1 
ATOM   4699 O  OD2 . ASP C 1 59  ? 53.986 -6.443  14.375  1.00 87.71  ? 100 ASP C OD2 1 
ATOM   4700 N  N   . ALA C 1 60  ? 51.562 -9.455  10.258  1.00 73.47  ? 101 ALA C N   1 
ATOM   4701 C  CA  . ALA C 1 60  ? 50.396 -10.179 9.790   1.00 74.39  ? 101 ALA C CA  1 
ATOM   4702 C  C   . ALA C 1 60  ? 50.352 -11.695 10.026  1.00 76.61  ? 101 ALA C C   1 
ATOM   4703 O  O   . ALA C 1 60  ? 49.466 -12.190 10.720  1.00 79.31  ? 101 ALA C O   1 
ATOM   4704 C  CB  . ALA C 1 60  ? 50.169 -9.877  8.310   1.00 75.33  ? 101 ALA C CB  1 
ATOM   4705 N  N   . ASP C 1 61  ? 51.297 -12.429 9.453   1.00 75.89  ? 102 ASP C N   1 
ATOM   4706 C  CA  . ASP C 1 61  ? 51.314 -13.890 9.554   1.00 78.33  ? 102 ASP C CA  1 
ATOM   4707 C  C   . ASP C 1 61  ? 50.271 -14.494 8.574   1.00 74.39  ? 102 ASP C C   1 
ATOM   4708 O  O   . ASP C 1 61  ? 50.189 -15.706 8.391   1.00 74.15  ? 102 ASP C O   1 
ATOM   4709 C  CB  . ASP C 1 61  ? 51.151 -14.337 11.033  1.00 84.47  ? 102 ASP C CB  1 
ATOM   4710 C  CG  . ASP C 1 61  ? 49.815 -15.000 11.342  1.00 90.03  ? 102 ASP C CG  1 
ATOM   4711 O  OD1 . ASP C 1 61  ? 49.661 -15.445 12.505  1.00 90.00  ? 102 ASP C OD1 1 
ATOM   4712 O  OD2 . ASP C 1 61  ? 48.927 -15.081 10.465  1.00 95.40  ? 102 ASP C OD2 1 
ATOM   4713 N  N   . GLN C 1 62  ? 49.481 -13.612 7.959   1.00 69.39  ? 103 GLN C N   1 
ATOM   4714 C  CA  . GLN C 1 62  ? 48.510 -13.937 6.905   1.00 63.35  ? 103 GLN C CA  1 
ATOM   4715 C  C   . GLN C 1 62  ? 47.711 -12.719 6.444   1.00 58.64  ? 103 GLN C C   1 
ATOM   4716 O  O   . GLN C 1 62  ? 46.997 -12.090 7.221   1.00 59.19  ? 103 GLN C O   1 
ATOM   4717 C  CB  . GLN C 1 62  ? 47.521 -15.037 7.259   1.00 62.61  ? 103 GLN C CB  1 
ATOM   4718 C  CG  . GLN C 1 62  ? 46.794 -15.458 5.966   1.00 56.57  ? 103 GLN C CG  1 
ATOM   4719 C  CD  . GLN C 1 62  ? 45.525 -16.229 6.209   1.00 63.65  ? 103 GLN C CD  1 
ATOM   4720 O  OE1 . GLN C 1 62  ? 44.700 -15.835 7.028   1.00 68.41  ? 103 GLN C OE1 1 
ATOM   4721 N  NE2 . GLN C 1 62  ? 45.350 -17.330 5.486   1.00 68.88  ? 103 GLN C NE2 1 
ATOM   4722 N  N   . ILE C 1 63  ? 47.834 -12.408 5.161   1.00 49.79  ? 104 ILE C N   1 
ATOM   4723 C  CA  . ILE C 1 63  ? 47.178 -11.258 4.571   1.00 37.88  ? 104 ILE C CA  1 
ATOM   4724 C  C   . ILE C 1 63  ? 46.140 -11.665 3.564   1.00 37.77  ? 104 ILE C C   1 
ATOM   4725 O  O   . ILE C 1 63  ? 46.390 -12.482 2.675   1.00 41.84  ? 104 ILE C O   1 
ATOM   4726 C  CB  . ILE C 1 63  ? 48.228 -10.351 3.903   1.00 35.87  ? 104 ILE C CB  1 
ATOM   4727 C  CG1 . ILE C 1 63  ? 49.299 -10.000 4.936   1.00 33.92  ? 104 ILE C CG1 1 
ATOM   4728 C  CG2 . ILE C 1 63  ? 47.556 -9.082  3.335   1.00 35.52  ? 104 ILE C CG2 1 
ATOM   4729 C  CD1 . ILE C 1 63  ? 50.613 -9.460  4.365   1.00 35.98  ? 104 ILE C CD1 1 
ATOM   4730 N  N   . ILE C 1 64  ? 44.955 -11.095 3.716   1.00 43.21  ? 105 ILE C N   1 
ATOM   4731 C  CA  . ILE C 1 64  ? 43.837 -11.367 2.828   1.00 40.74  ? 105 ILE C CA  1 
ATOM   4732 C  C   . ILE C 1 64  ? 43.418 -10.056 2.172   1.00 44.50  ? 105 ILE C C   1 
ATOM   4733 O  O   . ILE C 1 64  ? 43.470 -8.993  2.796   1.00 43.37  ? 105 ILE C O   1 
ATOM   4734 C  CB  . ILE C 1 64  ? 42.618 -11.910 3.600   1.00 44.71  ? 105 ILE C CB  1 
ATOM   4735 C  CG1 . ILE C 1 64  ? 43.040 -13.083 4.499   1.00 48.17  ? 105 ILE C CG1 1 
ATOM   4736 C  CG2 . ILE C 1 64  ? 41.530 -12.318 2.596   1.00 42.47  ? 105 ILE C CG2 1 
ATOM   4737 C  CD1 . ILE C 1 64  ? 43.490 -14.321 3.730   1.00 52.92  ? 105 ILE C CD1 1 
ATOM   4738 N  N   . VAL C 1 65  ? 42.974 -10.156 0.926   1.00 44.11  ? 106 VAL C N   1 
ATOM   4739 C  CA  . VAL C 1 65  ? 42.542 -9.022  0.131   1.00 43.17  ? 106 VAL C CA  1 
ATOM   4740 C  C   . VAL C 1 65  ? 41.139 -9.314  -0.410  1.00 44.77  ? 106 VAL C C   1 
ATOM   4741 O  O   . VAL C 1 65  ? 40.910 -10.388 -0.947  1.00 41.34  ? 106 VAL C O   1 
ATOM   4742 C  CB  . VAL C 1 65  ? 43.527 -8.797  -1.055  1.00 43.72  ? 106 VAL C CB  1 
ATOM   4743 C  CG1 . VAL C 1 65  ? 42.896 -7.973  -2.133  1.00 45.62  ? 106 VAL C CG1 1 
ATOM   4744 C  CG2 . VAL C 1 65  ? 44.786 -8.113  -0.555  1.00 38.90  ? 106 VAL C CG2 1 
ATOM   4745 N  N   . ALA C 1 66  ? 40.214 -8.357  -0.257  1.00 41.37  ? 107 ALA C N   1 
ATOM   4746 C  CA  . ALA C 1 66  ? 38.835 -8.493  -0.756  1.00 43.06  ? 107 ALA C CA  1 
ATOM   4747 C  C   . ALA C 1 66  ? 38.525 -7.368  -1.748  1.00 37.60  ? 107 ALA C C   1 
ATOM   4748 O  O   . ALA C 1 66  ? 38.673 -6.188  -1.413  1.00 43.01  ? 107 ALA C O   1 
ATOM   4749 C  CB  . ALA C 1 66  ? 37.818 -8.433  0.440   1.00 34.80  ? 107 ALA C CB  1 
ATOM   4750 N  N   . LEU C 1 67  ? 38.095 -7.713  -2.953  1.00 39.83  ? 108 LEU C N   1 
ATOM   4751 C  CA  . LEU C 1 67  ? 37.775 -6.690  -3.939  1.00 44.24  ? 108 LEU C CA  1 
ATOM   4752 C  C   . LEU C 1 67  ? 36.311 -6.246  -3.832  1.00 50.19  ? 108 LEU C C   1 
ATOM   4753 O  O   . LEU C 1 67  ? 35.441 -6.965  -3.318  1.00 48.54  ? 108 LEU C O   1 
ATOM   4754 C  CB  . LEU C 1 67  ? 38.003 -7.185  -5.369  1.00 42.70  ? 108 LEU C CB  1 
ATOM   4755 C  CG  . LEU C 1 67  ? 39.071 -8.195  -5.772  1.00 50.74  ? 108 LEU C CG  1 
ATOM   4756 C  CD1 . LEU C 1 67  ? 39.300 -8.071  -7.275  1.00 47.13  ? 108 LEU C CD1 1 
ATOM   4757 C  CD2 . LEU C 1 67  ? 40.343 -7.975  -5.007  1.00 37.92  ? 108 LEU C CD2 1 
ATOM   4758 N  N   . GLN C 1 68  ? 36.033 -5.061  -4.349  1.00 48.72  ? 109 GLN C N   1 
ATOM   4759 C  CA  . GLN C 1 68  ? 34.675 -4.563  -4.308  1.00 52.10  ? 109 GLN C CA  1 
ATOM   4760 C  C   . GLN C 1 68  ? 33.715 -5.531  -5.009  1.00 55.59  ? 109 GLN C C   1 
ATOM   4761 O  O   . GLN C 1 68  ? 32.546 -5.620  -4.630  1.00 57.28  ? 109 GLN C O   1 
ATOM   4762 C  CB  . GLN C 1 68  ? 34.612 -3.165  -4.936  1.00 49.33  ? 109 GLN C CB  1 
ATOM   4763 C  CG  . GLN C 1 68  ? 35.439 -2.125  -4.152  1.00 57.89  ? 109 GLN C CG  1 
ATOM   4764 C  CD  . GLN C 1 68  ? 35.191 -2.189  -2.636  1.00 66.82  ? 109 GLN C CD  1 
ATOM   4765 O  OE1 . GLN C 1 68  ? 34.043 -2.109  -2.177  1.00 68.09  ? 109 GLN C OE1 1 
ATOM   4766 N  NE2 . GLN C 1 68  ? 36.275 -2.336  -1.854  1.00 68.23  ? 109 GLN C NE2 1 
ATOM   4767 N  N   . ASP C 1 69  ? 34.193 -6.276  -6.009  1.00 53.06  ? 110 ASP C N   1 
ATOM   4768 C  CA  . ASP C 1 69  ? 33.302 -7.204  -6.689  1.00 52.97  ? 110 ASP C CA  1 
ATOM   4769 C  C   . ASP C 1 69  ? 33.042 -8.497  -5.901  1.00 54.27  ? 110 ASP C C   1 
ATOM   4770 O  O   . ASP C 1 69  ? 32.444 -9.434  -6.433  1.00 53.82  ? 110 ASP C O   1 
ATOM   4771 C  CB  . ASP C 1 69  ? 33.805 -7.532  -8.111  1.00 53.97  ? 110 ASP C CB  1 
ATOM   4772 C  CG  . ASP C 1 69  ? 35.130 -8.335  -8.133  1.00 60.91  ? 110 ASP C CG  1 
ATOM   4773 O  OD1 . ASP C 1 69  ? 35.443 -9.070  -7.161  1.00 55.97  ? 110 ASP C OD1 1 
ATOM   4774 O  OD2 . ASP C 1 69  ? 35.850 -8.244  -9.156  1.00 57.54  ? 110 ASP C OD2 1 
ATOM   4775 N  N   . GLY C 1 70  ? 33.480 -8.550  -4.642  1.00 54.32  ? 111 GLY C N   1 
ATOM   4776 C  CA  . GLY C 1 70  ? 33.252 -9.746  -3.836  1.00 57.63  ? 111 GLY C CA  1 
ATOM   4777 C  C   . GLY C 1 70  ? 34.360 -10.805 -3.739  1.00 56.79  ? 111 GLY C C   1 
ATOM   4778 O  O   . GLY C 1 70  ? 34.462 -11.504 -2.729  1.00 56.96  ? 111 GLY C O   1 
ATOM   4779 N  N   . ARG C 1 71  ? 35.185 -10.958 -4.772  1.00 51.67  ? 112 ARG C N   1 
ATOM   4780 C  CA  . ARG C 1 71  ? 36.261 -11.951 -4.702  1.00 46.56  ? 112 ARG C CA  1 
ATOM   4781 C  C   . ARG C 1 71  ? 37.229 -11.698 -3.543  1.00 46.06  ? 112 ARG C C   1 
ATOM   4782 O  O   . ARG C 1 71  ? 37.547 -10.547 -3.199  1.00 47.84  ? 112 ARG C O   1 
ATOM   4783 C  CB  . ARG C 1 71  ? 37.031 -11.987 -6.010  1.00 40.22  ? 112 ARG C CB  1 
ATOM   4784 C  CG  . ARG C 1 71  ? 36.215 -12.479 -7.179  1.00 44.26  ? 112 ARG C CG  1 
ATOM   4785 C  CD  . ARG C 1 71  ? 37.075 -12.531 -8.413  1.00 51.95  ? 112 ARG C CD  1 
ATOM   4786 N  NE  . ARG C 1 71  ? 37.241 -11.238 -9.067  1.00 51.62  ? 112 ARG C NE  1 
ATOM   4787 C  CZ  . ARG C 1 71  ? 38.136 -11.030 -10.027 1.00 56.50  ? 112 ARG C CZ  1 
ATOM   4788 N  NH1 . ARG C 1 71  ? 38.927 -12.035 -10.401 1.00 54.12  ? 112 ARG C NH1 1 
ATOM   4789 N  NH2 . ARG C 1 71  ? 38.225 -9.845  -10.635 1.00 47.39  ? 112 ARG C NH2 1 
ATOM   4790 N  N   . VAL C 1 72  ? 37.685 -12.791 -2.940  1.00 46.53  ? 113 VAL C N   1 
ATOM   4791 C  CA  . VAL C 1 72  ? 38.607 -12.751 -1.816  1.00 45.33  ? 113 VAL C CA  1 
ATOM   4792 C  C   . VAL C 1 72  ? 39.863 -13.549 -2.177  1.00 48.50  ? 113 VAL C C   1 
ATOM   4793 O  O   . VAL C 1 72  ? 39.752 -14.619 -2.768  1.00 49.07  ? 113 VAL C O   1 
ATOM   4794 C  CB  . VAL C 1 72  ? 37.942 -13.352 -0.572  1.00 42.32  ? 113 VAL C CB  1 
ATOM   4795 C  CG1 . VAL C 1 72  ? 38.818 -13.133 0.643   1.00 48.47  ? 113 VAL C CG1 1 
ATOM   4796 C  CG2 . VAL C 1 72  ? 36.577 -12.690 -0.355  1.00 47.16  ? 113 VAL C CG2 1 
ATOM   4797 N  N   . PHE C 1 73  ? 41.044 -13.022 -1.830  1.00 46.52  ? 114 PHE C N   1 
ATOM   4798 C  CA  . PHE C 1 73  ? 42.325 -13.670 -2.129  1.00 42.44  ? 114 PHE C CA  1 
ATOM   4799 C  C   . PHE C 1 73  ? 43.311 -13.656 -0.994  1.00 41.36  ? 114 PHE C C   1 
ATOM   4800 O  O   . PHE C 1 73  ? 43.319 -12.751 -0.179  1.00 44.21  ? 114 PHE C O   1 
ATOM   4801 C  CB  . PHE C 1 73  ? 43.059 -12.983 -3.273  1.00 41.57  ? 114 PHE C CB  1 
ATOM   4802 C  CG  . PHE C 1 73  ? 42.295 -12.917 -4.540  1.00 47.23  ? 114 PHE C CG  1 
ATOM   4803 C  CD1 . PHE C 1 73  ? 41.492 -11.818 -4.814  1.00 38.12  ? 114 PHE C CD1 1 
ATOM   4804 C  CD2 . PHE C 1 73  ? 42.442 -13.916 -5.512  1.00 40.71  ? 114 PHE C CD2 1 
ATOM   4805 C  CE1 . PHE C 1 73  ? 40.846 -11.692 -6.054  1.00 42.06  ? 114 PHE C CE1 1 
ATOM   4806 C  CE2 . PHE C 1 73  ? 41.803 -13.799 -6.755  1.00 46.58  ? 114 PHE C CE2 1 
ATOM   4807 C  CZ  . PHE C 1 73  ? 41.001 -12.674 -7.028  1.00 40.81  ? 114 PHE C CZ  1 
ATOM   4808 N  N   . GLU C 1 74  ? 44.171 -14.661 -0.969  1.00 41.96  ? 115 GLU C N   1 
ATOM   4809 C  CA  . GLU C 1 74  ? 45.226 -14.712 0.022   1.00 41.90  ? 115 GLU C CA  1 
ATOM   4810 C  C   . GLU C 1 74  ? 46.295 -13.915 -0.702  1.00 37.40  ? 115 GLU C C   1 
ATOM   4811 O  O   . GLU C 1 74  ? 46.368 -13.951 -1.936  1.00 35.45  ? 115 GLU C O   1 
ATOM   4812 C  CB  . GLU C 1 74  ? 45.692 -16.150 0.256   1.00 47.90  ? 115 GLU C CB  1 
ATOM   4813 C  CG  . GLU C 1 74  ? 46.919 -16.252 1.164   1.00 61.29  ? 115 GLU C CG  1 
ATOM   4814 C  CD  . GLU C 1 74  ? 47.482 -17.683 1.269   1.00 70.57  ? 115 GLU C CD  1 
ATOM   4815 O  OE1 . GLU C 1 74  ? 48.664 -17.837 1.675   1.00 68.48  ? 115 GLU C OE1 1 
ATOM   4816 O  OE2 . GLU C 1 74  ? 46.740 -18.647 0.954   1.00 70.19  ? 115 GLU C OE2 1 
ATOM   4817 N  N   . ALA C 1 75  ? 47.109 -13.181 0.038   1.00 36.50  ? 116 ALA C N   1 
ATOM   4818 C  CA  . ALA C 1 75  ? 48.144 -12.374 -0.595  1.00 43.80  ? 116 ALA C CA  1 
ATOM   4819 C  C   . ALA C 1 75  ? 49.569 -12.640 -0.099  1.00 45.14  ? 116 ALA C C   1 
ATOM   4820 O  O   . ALA C 1 75  ? 49.800 -12.925 1.079   1.00 42.60  ? 116 ALA C O   1 
ATOM   4821 C  CB  . ALA C 1 75  ? 47.811 -10.891 -0.432  1.00 38.88  ? 116 ALA C CB  1 
ATOM   4822 N  N   . LEU C 1 76  ? 50.523 -12.557 -1.025  1.00 43.52  ? 117 LEU C N   1 
ATOM   4823 C  CA  . LEU C 1 76  ? 51.927 -12.753 -0.692  1.00 41.93  ? 117 LEU C CA  1 
ATOM   4824 C  C   . LEU C 1 76  ? 52.534 -11.392 -0.405  1.00 39.24  ? 117 LEU C C   1 
ATOM   4825 O  O   . LEU C 1 76  ? 52.269 -10.454 -1.156  1.00 40.35  ? 117 LEU C O   1 
ATOM   4826 C  CB  . LEU C 1 76  ? 52.670 -13.369 -1.886  1.00 42.60  ? 117 LEU C CB  1 
ATOM   4827 C  CG  . LEU C 1 76  ? 54.203 -13.311 -1.825  1.00 40.63  ? 117 LEU C CG  1 
ATOM   4828 C  CD1 . LEU C 1 76  ? 54.668 -14.360 -0.792  1.00 40.09  ? 117 LEU C CD1 1 
ATOM   4829 C  CD2 . LEU C 1 76  ? 54.834 -13.608 -3.222  1.00 36.34  ? 117 LEU C CD2 1 
ATOM   4830 N  N   . LEU C 1 77  ? 53.304 -11.266 0.680   1.00 33.45  ? 118 LEU C N   1 
ATOM   4831 C  CA  . LEU C 1 77  ? 53.998 -10.004 0.979   1.00 39.29  ? 118 LEU C CA  1 
ATOM   4832 C  C   . LEU C 1 77  ? 55.272 -10.009 0.114   1.00 36.69  ? 118 LEU C C   1 
ATOM   4833 O  O   . LEU C 1 77  ? 56.139 -10.874 0.292   1.00 47.14  ? 118 LEU C O   1 
ATOM   4834 C  CB  . LEU C 1 77  ? 54.428 -9.937  2.464   1.00 43.45  ? 118 LEU C CB  1 
ATOM   4835 C  CG  . LEU C 1 77  ? 54.868 -8.593  3.098   1.00 49.94  ? 118 LEU C CG  1 
ATOM   4836 C  CD1 . LEU C 1 77  ? 55.741 -8.837  4.355   1.00 43.45  ? 118 LEU C CD1 1 
ATOM   4837 C  CD2 . LEU C 1 77  ? 55.649 -7.789  2.122   1.00 54.49  ? 118 LEU C CD2 1 
ATOM   4838 N  N   . VAL C 1 78  ? 55.428 -9.092  -0.827  1.00 35.21  ? 119 VAL C N   1 
ATOM   4839 C  CA  . VAL C 1 78  ? 56.666 -9.149  -1.586  1.00 30.85  ? 119 VAL C CA  1 
ATOM   4840 C  C   . VAL C 1 78  ? 57.758 -8.231  -1.052  1.00 38.05  ? 119 VAL C C   1 
ATOM   4841 O  O   . VAL C 1 78  ? 58.939 -8.428  -1.351  1.00 39.05  ? 119 VAL C O   1 
ATOM   4842 C  CB  . VAL C 1 78  ? 56.453 -8.964  -3.151  1.00 35.33  ? 119 VAL C CB  1 
ATOM   4843 C  CG1 . VAL C 1 78  ? 55.005 -8.862  -3.503  1.00 32.75  ? 119 VAL C CG1 1 
ATOM   4844 C  CG2 . VAL C 1 78  ? 57.261 -7.828  -3.692  1.00 31.35  ? 119 VAL C CG2 1 
ATOM   4845 N  N   . GLY C 1 79  ? 57.374 -7.278  -0.208  1.00 39.84  ? 120 GLY C N   1 
ATOM   4846 C  CA  . GLY C 1 79  ? 58.329 -6.339  0.372   1.00 39.19  ? 120 GLY C CA  1 
ATOM   4847 C  C   . GLY C 1 79  ? 57.635 -5.130  1.017   1.00 43.48  ? 120 GLY C C   1 
ATOM   4848 O  O   . GLY C 1 79  ? 56.437 -4.912  0.836   1.00 36.75  ? 120 GLY C O   1 
ATOM   4849 N  N   . SER C 1 80  ? 58.388 -4.339  1.770   1.00 40.56  ? 121 SER C N   1 
ATOM   4850 C  CA  . SER C 1 80  ? 57.831 -3.176  2.429   1.00 46.93  ? 121 SER C CA  1 
ATOM   4851 C  C   . SER C 1 80  ? 58.947 -2.162  2.601   1.00 46.13  ? 121 SER C C   1 
ATOM   4852 O  O   . SER C 1 80  ? 60.126 -2.507  2.502   1.00 44.11  ? 121 SER C O   1 
ATOM   4853 C  CB  . SER C 1 80  ? 57.201 -3.558  3.789   1.00 42.81  ? 121 SER C CB  1 
ATOM   4854 O  OG  . SER C 1 80  ? 58.159 -4.081  4.699   1.00 51.34  ? 121 SER C OG  1 
ATOM   4855 N  N   . ASP C 1 81  ? 58.569 -0.905  2.811   1.00 44.56  ? 122 ASP C N   1 
ATOM   4856 C  CA  . ASP C 1 81  ? 59.535 0.171   2.983   1.00 46.66  ? 122 ASP C CA  1 
ATOM   4857 C  C   . ASP C 1 81  ? 59.034 1.135   4.059   1.00 49.44  ? 122 ASP C C   1 
ATOM   4858 O  O   . ASP C 1 81  ? 57.976 1.749   3.914   1.00 52.53  ? 122 ASP C O   1 
ATOM   4859 C  CB  . ASP C 1 81  ? 59.737 0.901   1.652   1.00 46.90  ? 122 ASP C CB  1 
ATOM   4860 C  CG  . ASP C 1 81  ? 60.853 1.925   1.715   1.00 59.52  ? 122 ASP C CG  1 
ATOM   4861 O  OD1 . ASP C 1 81  ? 61.963 1.565   2.189   1.00 65.44  ? 122 ASP C OD1 1 
ATOM   4862 O  OD2 . ASP C 1 81  ? 60.629 3.083   1.286   1.00 52.65  ? 122 ASP C OD2 1 
ATOM   4863 N  N   . SER C 1 82  ? 59.792 1.239   5.147   1.00 54.00  ? 123 SER C N   1 
ATOM   4864 C  CA  . SER C 1 82  ? 59.464 2.113   6.277   1.00 52.68  ? 123 SER C CA  1 
ATOM   4865 C  C   . SER C 1 82  ? 59.491 3.597   5.948   1.00 52.91  ? 123 SER C C   1 
ATOM   4866 O  O   . SER C 1 82  ? 58.612 4.352   6.364   1.00 54.50  ? 123 SER C O   1 
ATOM   4867 C  CB  . SER C 1 82  ? 60.434 1.860   7.429   1.00 50.77  ? 123 SER C CB  1 
ATOM   4868 O  OG  . SER C 1 82  ? 59.929 0.863   8.280   1.00 60.84  ? 123 SER C OG  1 
ATOM   4869 N  N   . LEU C 1 83  ? 60.508 4.019   5.209   1.00 52.72  ? 124 LEU C N   1 
ATOM   4870 C  CA  . LEU C 1 83  ? 60.632 5.423   4.865   1.00 56.26  ? 124 LEU C CA  1 
ATOM   4871 C  C   . LEU C 1 83  ? 59.412 6.001   4.151   1.00 58.39  ? 124 LEU C C   1 
ATOM   4872 O  O   . LEU C 1 83  ? 59.109 7.188   4.298   1.00 60.71  ? 124 LEU C O   1 
ATOM   4873 C  CB  . LEU C 1 83  ? 61.888 5.635   4.027   1.00 60.00  ? 124 LEU C CB  1 
ATOM   4874 C  CG  . LEU C 1 83  ? 63.159 5.145   4.734   1.00 63.89  ? 124 LEU C CG  1 
ATOM   4875 C  CD1 . LEU C 1 83  ? 64.386 5.573   3.941   1.00 64.79  ? 124 LEU C CD1 1 
ATOM   4876 C  CD2 . LEU C 1 83  ? 63.223 5.723   6.146   1.00 68.79  ? 124 LEU C CD2 1 
ATOM   4877 N  N   . THR C 1 84  ? 58.698 5.175   3.389   1.00 53.68  ? 125 THR C N   1 
ATOM   4878 C  CA  . THR C 1 84  ? 57.519 5.663   2.669   1.00 48.27  ? 125 THR C CA  1 
ATOM   4879 C  C   . THR C 1 84  ? 56.252 4.977   3.140   1.00 45.92  ? 125 THR C C   1 
ATOM   4880 O  O   . THR C 1 84  ? 55.182 5.194   2.578   1.00 46.87  ? 125 THR C O   1 
ATOM   4881 C  CB  . THR C 1 84  ? 57.641 5.418   1.135   1.00 51.24  ? 125 THR C CB  1 
ATOM   4882 O  OG1 . THR C 1 84  ? 57.989 4.047   0.892   1.00 47.88  ? 125 THR C OG1 1 
ATOM   4883 C  CG2 . THR C 1 84  ? 58.700 6.313   0.520   1.00 44.49  ? 125 THR C CG2 1 
ATOM   4884 N  N   . ASP C 1 85  ? 56.373 4.157   4.176   1.00 38.86  ? 126 ASP C N   1 
ATOM   4885 C  CA  . ASP C 1 85  ? 55.237 3.388   4.688   1.00 40.32  ? 126 ASP C CA  1 
ATOM   4886 C  C   . ASP C 1 85  ? 54.450 2.627   3.588   1.00 38.04  ? 126 ASP C C   1 
ATOM   4887 O  O   . ASP C 1 85  ? 53.242 2.442   3.684   1.00 40.39  ? 126 ASP C O   1 
ATOM   4888 C  CB  . ASP C 1 85  ? 54.296 4.279   5.520   1.00 42.02  ? 126 ASP C CB  1 
ATOM   4889 C  CG  . ASP C 1 85  ? 53.196 3.485   6.211   1.00 43.55  ? 126 ASP C CG  1 
ATOM   4890 O  OD1 . ASP C 1 85  ? 53.453 2.337   6.637   1.00 48.61  ? 126 ASP C OD1 1 
ATOM   4891 O  OD2 . ASP C 1 85  ? 52.063 4.006   6.340   1.00 53.12  ? 126 ASP C OD2 1 
ATOM   4892 N  N   . LEU C 1 86  ? 55.140 2.184   2.540   1.00 33.78  ? 127 LEU C N   1 
ATOM   4893 C  CA  . LEU C 1 86  ? 54.481 1.385   1.517   1.00 37.13  ? 127 LEU C CA  1 
ATOM   4894 C  C   . LEU C 1 86  ? 54.841 -0.084  1.708   1.00 39.61  ? 127 LEU C C   1 
ATOM   4895 O  O   . LEU C 1 86  ? 55.827 -0.420  2.356   1.00 41.43  ? 127 LEU C O   1 
ATOM   4896 C  CB  . LEU C 1 86  ? 54.922 1.801   0.114   1.00 34.50  ? 127 LEU C CB  1 
ATOM   4897 C  CG  . LEU C 1 86  ? 54.460 3.204   -0.255  1.00 44.32  ? 127 LEU C CG  1 
ATOM   4898 C  CD1 . LEU C 1 86  ? 55.062 3.597   -1.568  1.00 40.00  ? 127 LEU C CD1 1 
ATOM   4899 C  CD2 . LEU C 1 86  ? 52.914 3.260   -0.271  1.00 46.74  ? 127 LEU C CD2 1 
ATOM   4900 N  N   . ALA C 1 87  ? 54.032 -0.950  1.118   1.00 42.99  ? 128 ALA C N   1 
ATOM   4901 C  CA  . ALA C 1 87  ? 54.268 -2.386  1.129   1.00 39.94  ? 128 ALA C CA  1 
ATOM   4902 C  C   . ALA C 1 87  ? 53.640 -2.921  -0.165  1.00 39.56  ? 128 ALA C C   1 
ATOM   4903 O  O   . ALA C 1 87  ? 52.618 -2.393  -0.630  1.00 37.15  ? 128 ALA C O   1 
ATOM   4904 C  CB  . ALA C 1 87  ? 53.609 -3.022  2.336   1.00 31.68  ? 128 ALA C CB  1 
ATOM   4905 N  N   . VAL C 1 88  ? 54.234 -3.961  -0.747  1.00 34.37  ? 129 VAL C N   1 
ATOM   4906 C  CA  . VAL C 1 88  ? 53.683 -4.537  -1.962  1.00 30.39  ? 129 VAL C CA  1 
ATOM   4907 C  C   . VAL C 1 88  ? 53.186 -5.950  -1.696  1.00 32.12  ? 129 VAL C C   1 
ATOM   4908 O  O   . VAL C 1 88  ? 53.833 -6.718  -1.006  1.00 34.95  ? 129 VAL C O   1 
ATOM   4909 C  CB  . VAL C 1 88  ? 54.735 -4.527  -3.100  1.00 34.32  ? 129 VAL C CB  1 
ATOM   4910 C  CG1 . VAL C 1 88  ? 54.232 -5.334  -4.344  1.00 29.44  ? 129 VAL C CG1 1 
ATOM   4911 C  CG2 . VAL C 1 88  ? 55.026 -3.081  -3.471  1.00 31.12  ? 129 VAL C CG2 1 
ATOM   4912 N  N   . LEU C 1 89  ? 52.022 -6.272  -2.241  1.00 30.19  ? 130 LEU C N   1 
ATOM   4913 C  CA  . LEU C 1 89  ? 51.400 -7.568  -2.082  1.00 31.37  ? 130 LEU C CA  1 
ATOM   4914 C  C   . LEU C 1 89  ? 51.201 -8.119  -3.477  1.00 37.20  ? 130 LEU C C   1 
ATOM   4915 O  O   . LEU C 1 89  ? 51.248 -7.351  -4.445  1.00 31.61  ? 130 LEU C O   1 
ATOM   4916 C  CB  . LEU C 1 89  ? 50.001 -7.438  -1.453  1.00 32.56  ? 130 LEU C CB  1 
ATOM   4917 C  CG  . LEU C 1 89  ? 49.796 -6.821  -0.072  1.00 37.67  ? 130 LEU C CG  1 
ATOM   4918 C  CD1 . LEU C 1 89  ? 48.313 -6.935  0.299   1.00 31.62  ? 130 LEU C CD1 1 
ATOM   4919 C  CD2 . LEU C 1 89  ? 50.679 -7.524  0.945   1.00 33.66  ? 130 LEU C CD2 1 
ATOM   4920 N  N   . LYS C 1 90  ? 50.934 -9.432  -3.565  1.00 33.68  ? 131 LYS C N   1 
ATOM   4921 C  CA  . LYS C 1 90  ? 50.679 -10.095 -4.842  1.00 31.49  ? 131 LYS C CA  1 
ATOM   4922 C  C   . LYS C 1 90  ? 49.600 -11.152 -4.647  1.00 34.92  ? 131 LYS C C   1 
ATOM   4923 O  O   . LYS C 1 90  ? 49.622 -11.916 -3.683  1.00 31.47  ? 131 LYS C O   1 
ATOM   4924 C  CB  . LYS C 1 90  ? 51.939 -10.760 -5.407  1.00 35.06  ? 131 LYS C CB  1 
ATOM   4925 C  CG  . LYS C 1 90  ? 51.749 -11.225 -6.872  1.00 38.98  ? 131 LYS C CG  1 
ATOM   4926 C  CD  . LYS C 1 90  ? 53.072 -11.721 -7.501  1.00 42.15  ? 131 LYS C CD  1 
ATOM   4927 C  CE  . LYS C 1 90  ? 52.927 -12.021 -9.011  1.00 38.78  ? 131 LYS C CE  1 
ATOM   4928 N  NZ  . LYS C 1 90  ? 54.267 -12.296 -9.608  1.00 52.13  ? 131 LYS C NZ  1 
ATOM   4929 N  N   . ILE C 1 91  ? 48.643 -11.173 -5.560  1.00 29.47  ? 132 ILE C N   1 
ATOM   4930 C  CA  . ILE C 1 91  ? 47.563 -12.114 -5.466  1.00 33.49  ? 132 ILE C CA  1 
ATOM   4931 C  C   . ILE C 1 91  ? 47.416 -12.798 -6.815  1.00 33.33  ? 132 ILE C C   1 
ATOM   4932 O  O   . ILE C 1 91  ? 47.951 -12.339 -7.820  1.00 36.87  ? 132 ILE C O   1 
ATOM   4933 C  CB  . ILE C 1 91  ? 46.209 -11.407 -5.107  1.00 37.41  ? 132 ILE C CB  1 
ATOM   4934 C  CG1 . ILE C 1 91  ? 45.860 -10.342 -6.155  1.00 34.91  ? 132 ILE C CG1 1 
ATOM   4935 C  CG2 . ILE C 1 91  ? 46.279 -10.825 -3.716  1.00 29.88  ? 132 ILE C CG2 1 
ATOM   4936 C  CD1 . ILE C 1 91  ? 44.442 -9.832  -6.052  1.00 34.50  ? 132 ILE C CD1 1 
ATOM   4937 N  N   . ASN C 1 92  ? 46.673 -13.890 -6.820  1.00 38.76  ? 133 ASN C N   1 
ATOM   4938 C  CA  . ASN C 1 92  ? 46.418 -14.662 -8.030  1.00 38.32  ? 133 ASN C CA  1 
ATOM   4939 C  C   . ASN C 1 92  ? 45.661 -13.796 -9.025  1.00 39.44  ? 133 ASN C C   1 
ATOM   4940 O  O   . ASN C 1 92  ? 44.533 -13.373 -8.769  1.00 45.88  ? 133 ASN C O   1 
ATOM   4941 C  CB  . ASN C 1 92  ? 45.603 -15.908 -7.655  1.00 37.28  ? 133 ASN C CB  1 
ATOM   4942 C  CG  . ASN C 1 92  ? 45.049 -16.629 -8.862  1.00 43.55  ? 133 ASN C CG  1 
ATOM   4943 O  OD1 . ASN C 1 92  ? 45.545 -16.467 -9.972  1.00 43.07  ? 133 ASN C OD1 1 
ATOM   4944 N  ND2 . ASN C 1 92  ? 44.013 -17.437 -8.649  1.00 43.95  ? 133 ASN C ND2 1 
ATOM   4945 N  N   . ALA C 1 93  ? 46.277 -13.538 -10.167 1.00 43.03  ? 134 ALA C N   1 
ATOM   4946 C  CA  . ALA C 1 93  ? 45.669 -12.709 -11.197 1.00 41.81  ? 134 ALA C CA  1 
ATOM   4947 C  C   . ALA C 1 93  ? 44.950 -13.494 -12.304 1.00 45.87  ? 134 ALA C C   1 
ATOM   4948 O  O   . ALA C 1 93  ? 44.493 -12.918 -13.283 1.00 48.93  ? 134 ALA C O   1 
ATOM   4949 C  CB  . ALA C 1 93  ? 46.730 -11.821 -11.797 1.00 36.11  ? 134 ALA C CB  1 
ATOM   4950 N  N   . THR C 1 94  ? 44.835 -14.803 -12.129 1.00 50.60  ? 135 THR C N   1 
ATOM   4951 C  CA  . THR C 1 94  ? 44.199 -15.704 -13.113 1.00 54.95  ? 135 THR C CA  1 
ATOM   4952 C  C   . THR C 1 94  ? 42.907 -15.217 -13.791 1.00 55.46  ? 135 THR C C   1 
ATOM   4953 O  O   . THR C 1 94  ? 42.848 -15.065 -15.017 1.00 60.16  ? 135 THR C O   1 
ATOM   4954 C  CB  . THR C 1 94  ? 43.916 -17.098 -12.454 1.00 58.06  ? 135 THR C CB  1 
ATOM   4955 O  OG1 . THR C 1 94  ? 45.157 -17.783 -12.245 1.00 55.00  ? 135 THR C OG1 1 
ATOM   4956 C  CG2 . THR C 1 94  ? 42.977 -17.948 -13.317 1.00 57.30  ? 135 THR C CG2 1 
ATOM   4957 N  N   . GLY C 1 95  ? 41.865 -14.997 -13.003 1.00 55.56  ? 136 GLY C N   1 
ATOM   4958 C  CA  . GLY C 1 95  ? 40.603 -14.563 -13.584 1.00 63.14  ? 136 GLY C CA  1 
ATOM   4959 C  C   . GLY C 1 95  ? 40.463 -13.117 -14.049 1.00 61.12  ? 136 GLY C C   1 
ATOM   4960 O  O   . GLY C 1 95  ? 39.341 -12.659 -14.234 1.00 68.11  ? 136 GLY C O   1 
ATOM   4961 N  N   . GLY C 1 96  ? 41.573 -12.410 -14.262 1.00 58.93  ? 137 GLY C N   1 
ATOM   4962 C  CA  . GLY C 1 96  ? 41.507 -11.018 -14.684 1.00 48.29  ? 137 GLY C CA  1 
ATOM   4963 C  C   . GLY C 1 96  ? 41.249 -10.142 -13.466 1.00 46.67  ? 137 GLY C C   1 
ATOM   4964 O  O   . GLY C 1 96  ? 40.431 -10.491 -12.619 1.00 47.20  ? 137 GLY C O   1 
ATOM   4965 N  N   . LEU C 1 97  ? 41.936 -9.008  -13.362 1.00 46.42  ? 138 LEU C N   1 
ATOM   4966 C  CA  . LEU C 1 97  ? 41.757 -8.125  -12.200 1.00 45.09  ? 138 LEU C CA  1 
ATOM   4967 C  C   . LEU C 1 97  ? 41.415 -6.668  -12.541 1.00 44.11  ? 138 LEU C C   1 
ATOM   4968 O  O   . LEU C 1 97  ? 41.838 -6.128  -13.562 1.00 40.20  ? 138 LEU C O   1 
ATOM   4969 C  CB  . LEU C 1 97  ? 43.037 -8.098  -11.345 1.00 41.12  ? 138 LEU C CB  1 
ATOM   4970 C  CG  . LEU C 1 97  ? 43.556 -9.343  -10.603 1.00 45.63  ? 138 LEU C CG  1 
ATOM   4971 C  CD1 . LEU C 1 97  ? 44.912 -9.032  -10.013 1.00 39.13  ? 138 LEU C CD1 1 
ATOM   4972 C  CD2 . LEU C 1 97  ? 42.594 -9.763  -9.497  1.00 38.36  ? 138 LEU C CD2 1 
ATOM   4973 N  N   . PRO C 1 98  ? 40.621 -6.015  -11.686 1.00 41.83  ? 139 PRO C N   1 
ATOM   4974 C  CA  . PRO C 1 98  ? 40.324 -4.613  -11.996 1.00 44.33  ? 139 PRO C CA  1 
ATOM   4975 C  C   . PRO C 1 98  ? 41.636 -3.879  -11.636 1.00 42.80  ? 139 PRO C C   1 
ATOM   4976 O  O   . PRO C 1 98  ? 42.253 -4.169  -10.616 1.00 46.45  ? 139 PRO C O   1 
ATOM   4977 C  CB  . PRO C 1 98  ? 39.178 -4.283  -11.042 1.00 42.83  ? 139 PRO C CB  1 
ATOM   4978 C  CG  . PRO C 1 98  ? 39.453 -5.239  -9.860  1.00 44.03  ? 139 PRO C CG  1 
ATOM   4979 C  CD  . PRO C 1 98  ? 39.809 -6.507  -10.559 1.00 41.25  ? 139 PRO C CD  1 
ATOM   4980 N  N   . THR C 1 99  ? 42.041 -2.934  -12.469 1.00 36.12  ? 140 THR C N   1 
ATOM   4981 C  CA  . THR C 1 99  ? 43.272 -2.209  -12.288 1.00 38.43  ? 140 THR C CA  1 
ATOM   4982 C  C   . THR C 1 99  ? 43.034 -0.695  -12.161 1.00 38.93  ? 140 THR C C   1 
ATOM   4983 O  O   . THR C 1 99  ? 42.102 -0.170  -12.746 1.00 39.97  ? 140 THR C O   1 
ATOM   4984 C  CB  . THR C 1 99  ? 44.178 -2.549  -13.514 1.00 41.40  ? 140 THR C CB  1 
ATOM   4985 O  OG1 . THR C 1 99  ? 45.284 -3.338  -13.069 1.00 58.88  ? 140 THR C OG1 1 
ATOM   4986 C  CG2 . THR C 1 99  ? 44.645 -1.316  -14.258 1.00 45.56  ? 140 THR C CG2 1 
ATOM   4987 N  N   . ILE C 1 100 ? 43.893 -0.010  -11.413 1.00 39.24  ? 141 ILE C N   1 
ATOM   4988 C  CA  . ILE C 1 100 ? 43.795 1.428   -11.202 1.00 40.36  ? 141 ILE C CA  1 
ATOM   4989 C  C   . ILE C 1 100 ? 44.285 2.163   -12.452 1.00 42.47  ? 141 ILE C C   1 
ATOM   4990 O  O   . ILE C 1 100 ? 45.326 1.835   -13.015 1.00 41.28  ? 141 ILE C O   1 
ATOM   4991 C  CB  . ILE C 1 100 ? 44.672 1.890   -9.967  1.00 37.63  ? 141 ILE C CB  1 
ATOM   4992 C  CG1 . ILE C 1 100 ? 44.307 3.316   -9.516  1.00 41.25  ? 141 ILE C CG1 1 
ATOM   4993 C  CG2 . ILE C 1 100 ? 46.157 1.919   -10.350 1.00 32.89  ? 141 ILE C CG2 1 
ATOM   4994 C  CD1 . ILE C 1 100 ? 43.026 3.428   -8.690  1.00 37.39  ? 141 ILE C CD1 1 
ATOM   4995 N  N   . PRO C 1 101 ? 43.529 3.169   -12.910 1.00 43.81  ? 142 PRO C N   1 
ATOM   4996 C  CA  . PRO C 1 101 ? 43.959 3.914   -14.100 1.00 43.67  ? 142 PRO C CA  1 
ATOM   4997 C  C   . PRO C 1 101 ? 45.247 4.669   -13.785 1.00 48.66  ? 142 PRO C C   1 
ATOM   4998 O  O   . PRO C 1 101 ? 45.386 5.290   -12.717 1.00 41.99  ? 142 PRO C O   1 
ATOM   4999 C  CB  . PRO C 1 101 ? 42.785 4.858   -14.358 1.00 43.45  ? 142 PRO C CB  1 
ATOM   5000 C  CG  . PRO C 1 101 ? 41.612 4.055   -13.906 1.00 40.18  ? 142 PRO C CG  1 
ATOM   5001 C  CD  . PRO C 1 101 ? 42.123 3.452   -12.587 1.00 40.14  ? 142 PRO C CD  1 
ATOM   5002 N  N   . ILE C 1 102 ? 46.204 4.629   -14.699 1.00 49.68  ? 143 ILE C N   1 
ATOM   5003 C  CA  . ILE C 1 102 ? 47.443 5.321   -14.417 1.00 51.54  ? 143 ILE C CA  1 
ATOM   5004 C  C   . ILE C 1 102 ? 48.086 5.921   -15.663 1.00 54.94  ? 143 ILE C C   1 
ATOM   5005 O  O   . ILE C 1 102 ? 48.207 5.266   -16.702 1.00 62.78  ? 143 ILE C O   1 
ATOM   5006 C  CB  . ILE C 1 102 ? 48.411 4.357   -13.687 1.00 51.31  ? 143 ILE C CB  1 
ATOM   5007 C  CG1 . ILE C 1 102 ? 49.636 5.109   -13.179 1.00 56.09  ? 143 ILE C CG1 1 
ATOM   5008 C  CG2 . ILE C 1 102 ? 48.816 3.242   -14.612 1.00 55.46  ? 143 ILE C CG2 1 
ATOM   5009 C  CD1 . ILE C 1 102 ? 50.269 4.439   -11.968 1.00 61.81  ? 143 ILE C CD1 1 
ATOM   5010 N  N   . ASN C 1 103 ? 48.469 7.188   -15.561 1.00 52.33  ? 144 ASN C N   1 
ATOM   5011 C  CA  . ASN C 1 103 ? 49.108 7.876   -16.665 1.00 52.35  ? 144 ASN C CA  1 
ATOM   5012 C  C   . ASN C 1 103 ? 50.455 8.385   -16.188 1.00 50.93  ? 144 ASN C C   1 
ATOM   5013 O  O   . ASN C 1 103 ? 50.525 9.337   -15.404 1.00 47.28  ? 144 ASN C O   1 
ATOM   5014 C  CB  . ASN C 1 103 ? 48.267 9.059   -17.133 1.00 61.26  ? 144 ASN C CB  1 
ATOM   5015 C  CG  . ASN C 1 103 ? 48.757 9.623   -18.459 1.00 66.05  ? 144 ASN C CG  1 
ATOM   5016 O  OD1 . ASN C 1 103 ? 49.941 9.504   -18.801 1.00 70.74  ? 144 ASN C OD1 1 
ATOM   5017 N  ND2 . ASN C 1 103 ? 47.853 10.246  -19.207 1.00 65.30  ? 144 ASN C ND2 1 
ATOM   5018 N  N   . ALA C 1 104 ? 51.523 7.755   -16.669 1.00 46.20  ? 145 ALA C N   1 
ATOM   5019 C  CA  . ALA C 1 104 ? 52.876 8.137   -16.286 1.00 49.64  ? 145 ALA C CA  1 
ATOM   5020 C  C   . ALA C 1 104 ? 53.277 9.528   -16.780 1.00 44.53  ? 145 ALA C C   1 
ATOM   5021 O  O   . ALA C 1 104 ? 54.199 10.142  -16.262 1.00 45.00  ? 145 ALA C O   1 
ATOM   5022 C  CB  . ALA C 1 104 ? 53.889 7.076   -16.799 1.00 53.12  ? 145 ALA C CB  1 
ATOM   5023 N  N   . ARG C 1 105 ? 52.595 10.040  -17.789 1.00 50.03  ? 146 ARG C N   1 
ATOM   5024 C  CA  . ARG C 1 105 ? 52.973 11.354  -18.274 1.00 52.97  ? 146 ARG C CA  1 
ATOM   5025 C  C   . ARG C 1 105 ? 52.198 12.492  -17.625 1.00 52.64  ? 146 ARG C C   1 
ATOM   5026 O  O   . ARG C 1 105 ? 52.528 13.665  -17.818 1.00 53.05  ? 146 ARG C O   1 
ATOM   5027 C  CB  . ARG C 1 105 ? 52.812 11.398  -19.787 1.00 59.11  ? 146 ARG C CB  1 
ATOM   5028 C  CG  . ARG C 1 105 ? 53.945 10.715  -20.545 1.00 66.56  ? 146 ARG C CG  1 
ATOM   5029 C  CD  . ARG C 1 105 ? 53.411 10.057  -21.802 1.00 76.56  ? 146 ARG C CD  1 
ATOM   5030 N  NE  . ARG C 1 105 ? 52.422 10.901  -22.470 1.00 90.45  ? 146 ARG C NE  1 
ATOM   5031 C  CZ  . ARG C 1 105 ? 51.722 10.537  -23.544 1.00 99.82  ? 146 ARG C CZ  1 
ATOM   5032 N  NH1 . ARG C 1 105 ? 51.900 9.333   -24.084 1.00 100.00 ? 146 ARG C NH1 1 
ATOM   5033 N  NH2 . ARG C 1 105 ? 50.838 11.376  -24.079 1.00 102.54 ? 146 ARG C NH2 1 
ATOM   5034 N  N   . ARG C 1 106 ? 51.187 12.143  -16.836 1.00 53.64  ? 147 ARG C N   1 
ATOM   5035 C  CA  . ARG C 1 106 ? 50.343 13.136  -16.174 1.00 49.50  ? 147 ARG C CA  1 
ATOM   5036 C  C   . ARG C 1 106 ? 51.114 13.907  -15.118 1.00 47.25  ? 147 ARG C C   1 
ATOM   5037 O  O   . ARG C 1 106 ? 51.621 13.325  -14.162 1.00 48.84  ? 147 ARG C O   1 
ATOM   5038 C  CB  . ARG C 1 106 ? 49.135 12.456  -15.521 1.00 48.94  ? 147 ARG C CB  1 
ATOM   5039 C  CG  . ARG C 1 106 ? 48.092 13.418  -14.969 1.00 46.96  ? 147 ARG C CG  1 
ATOM   5040 C  CD  . ARG C 1 106 ? 46.870 13.417  -15.875 1.00 45.00  ? 147 ARG C CD  1 
ATOM   5041 N  NE  . ARG C 1 106 ? 46.838 14.579  -16.744 1.00 43.89  ? 147 ARG C NE  1 
ATOM   5042 C  CZ  . ARG C 1 106 ? 46.143 14.659  -17.876 1.00 46.76  ? 147 ARG C CZ  1 
ATOM   5043 N  NH1 . ARG C 1 106 ? 45.411 13.638  -18.309 1.00 46.63  ? 147 ARG C NH1 1 
ATOM   5044 N  NH2 . ARG C 1 106 ? 46.165 15.783  -18.570 1.00 51.89  ? 147 ARG C NH2 1 
ATOM   5045 N  N   . VAL C 1 107 ? 51.197 15.222  -15.281 1.00 44.88  ? 148 VAL C N   1 
ATOM   5046 C  CA  . VAL C 1 107 ? 51.913 16.028  -14.308 1.00 47.80  ? 148 VAL C CA  1 
ATOM   5047 C  C   . VAL C 1 107 ? 50.916 16.575  -13.282 1.00 49.38  ? 148 VAL C C   1 
ATOM   5048 O  O   . VAL C 1 107 ? 50.046 17.371  -13.615 1.00 46.88  ? 148 VAL C O   1 
ATOM   5049 C  CB  . VAL C 1 107 ? 52.622 17.204  -14.981 1.00 50.88  ? 148 VAL C CB  1 
ATOM   5050 C  CG1 . VAL C 1 107 ? 53.558 17.867  -13.977 1.00 52.78  ? 148 VAL C CG1 1 
ATOM   5051 C  CG2 . VAL C 1 107 ? 53.395 16.726  -16.225 1.00 49.09  ? 148 VAL C CG2 1 
ATOM   5052 N  N   . PRO C 1 108 ? 51.034 16.153  -12.019 1.00 48.86  ? 149 PRO C N   1 
ATOM   5053 C  CA  . PRO C 1 108 ? 50.088 16.661  -11.015 1.00 48.73  ? 149 PRO C CA  1 
ATOM   5054 C  C   . PRO C 1 108 ? 50.365 18.133  -10.689 1.00 46.38  ? 149 PRO C C   1 
ATOM   5055 O  O   . PRO C 1 108 ? 51.510 18.567  -10.685 1.00 46.30  ? 149 PRO C O   1 
ATOM   5056 C  CB  . PRO C 1 108 ? 50.325 15.744  -9.803  1.00 46.98  ? 149 PRO C CB  1 
ATOM   5057 C  CG  . PRO C 1 108 ? 51.020 14.505  -10.413 1.00 49.37  ? 149 PRO C CG  1 
ATOM   5058 C  CD  . PRO C 1 108 ? 51.932 15.137  -11.439 1.00 45.17  ? 149 PRO C CD  1 
ATOM   5059 N  N   . HIS C 1 109 ? 49.307 18.895  -10.421 1.00 45.40  ? 150 HIS C N   1 
ATOM   5060 C  CA  . HIS C 1 109 ? 49.449 20.315  -10.088 1.00 45.41  ? 150 HIS C CA  1 
ATOM   5061 C  C   . HIS C 1 109 ? 48.634 20.668  -8.866  1.00 37.69  ? 150 HIS C C   1 
ATOM   5062 O  O   . HIS C 1 109 ? 47.567 20.116  -8.643  1.00 37.30  ? 150 HIS C O   1 
ATOM   5063 C  CB  . HIS C 1 109 ? 48.970 21.211  -11.240 1.00 42.70  ? 150 HIS C CB  1 
ATOM   5064 C  CG  . HIS C 1 109 ? 49.764 21.062  -12.501 1.00 53.87  ? 150 HIS C CG  1 
ATOM   5065 N  ND1 . HIS C 1 109 ? 51.089 21.437  -12.598 1.00 57.27  ? 150 HIS C ND1 1 
ATOM   5066 C  CD2 . HIS C 1 109 ? 49.408 20.619  -13.732 1.00 51.46  ? 150 HIS C CD2 1 
ATOM   5067 C  CE1 . HIS C 1 109 ? 51.512 21.237  -13.835 1.00 56.40  ? 150 HIS C CE1 1 
ATOM   5068 N  NE2 . HIS C 1 109 ? 50.511 20.743  -14.543 1.00 52.56  ? 150 HIS C NE2 1 
ATOM   5069 N  N   . ILE C 1 110 ? 49.167 21.589  -8.085  1.00 37.42  ? 151 ILE C N   1 
ATOM   5070 C  CA  . ILE C 1 110 ? 48.506 22.108  -6.914  1.00 34.99  ? 151 ILE C CA  1 
ATOM   5071 C  C   . ILE C 1 110 ? 47.174 22.696  -7.397  1.00 35.72  ? 151 ILE C C   1 
ATOM   5072 O  O   . ILE C 1 110 ? 47.132 23.413  -8.406  1.00 34.93  ? 151 ILE C O   1 
ATOM   5073 C  CB  . ILE C 1 110 ? 49.377 23.207  -6.299  1.00 40.77  ? 151 ILE C CB  1 
ATOM   5074 C  CG1 . ILE C 1 110 ? 50.686 22.583  -5.820  1.00 40.18  ? 151 ILE C CG1 1 
ATOM   5075 C  CG2 . ILE C 1 110 ? 48.638 23.913  -5.165  1.00 43.49  ? 151 ILE C CG2 1 
ATOM   5076 C  CD1 . ILE C 1 110 ? 51.694 23.595  -5.284  1.00 44.54  ? 151 ILE C CD1 1 
ATOM   5077 N  N   . GLY C 1 111 ? 46.089 22.380  -6.695  1.00 33.01  ? 152 GLY C N   1 
ATOM   5078 C  CA  . GLY C 1 111 ? 44.787 22.871  -7.108  1.00 28.22  ? 152 GLY C CA  1 
ATOM   5079 C  C   . GLY C 1 111 ? 43.963 21.814  -7.804  1.00 34.88  ? 152 GLY C C   1 
ATOM   5080 O  O   . GLY C 1 111 ? 42.738 21.981  -7.981  1.00 31.16  ? 152 GLY C O   1 
ATOM   5081 N  N   . ASP C 1 112 ? 44.614 20.709  -8.197  1.00 34.18  ? 153 ASP C N   1 
ATOM   5082 C  CA  . ASP C 1 112 ? 43.901 19.625  -8.887  1.00 29.23  ? 153 ASP C CA  1 
ATOM   5083 C  C   . ASP C 1 112 ? 42.876 18.983  -7.964  1.00 31.32  ? 153 ASP C C   1 
ATOM   5084 O  O   . ASP C 1 112 ? 43.162 18.745  -6.786  1.00 25.14  ? 153 ASP C O   1 
ATOM   5085 C  CB  . ASP C 1 112 ? 44.872 18.523  -9.343  1.00 38.73  ? 153 ASP C CB  1 
ATOM   5086 C  CG  . ASP C 1 112 ? 45.644 18.886  -10.628 1.00 41.51  ? 153 ASP C CG  1 
ATOM   5087 O  OD1 . ASP C 1 112 ? 45.314 19.889  -11.288 1.00 39.96  ? 153 ASP C OD1 1 
ATOM   5088 O  OD2 . ASP C 1 112 ? 46.590 18.152  -10.981 1.00 49.36  ? 153 ASP C OD2 1 
ATOM   5089 N  N   . VAL C 1 113 ? 41.683 18.716  -8.485  1.00 25.58  ? 154 VAL C N   1 
ATOM   5090 C  CA  . VAL C 1 113 ? 40.685 18.039  -7.687  1.00 28.39  ? 154 VAL C CA  1 
ATOM   5091 C  C   . VAL C 1 113 ? 41.076 16.554  -7.584  1.00 37.24  ? 154 VAL C C   1 
ATOM   5092 O  O   . VAL C 1 113 ? 41.433 15.912  -8.589  1.00 36.44  ? 154 VAL C O   1 
ATOM   5093 C  CB  . VAL C 1 113 ? 39.316 18.110  -8.332  1.00 31.26  ? 154 VAL C CB  1 
ATOM   5094 C  CG1 . VAL C 1 113 ? 38.339 17.205  -7.563  1.00 23.67  ? 154 VAL C CG1 1 
ATOM   5095 C  CG2 . VAL C 1 113 ? 38.845 19.566  -8.372  1.00 30.57  ? 154 VAL C CG2 1 
ATOM   5096 N  N   . VAL C 1 114 ? 41.019 16.024  -6.370  1.00 33.60  ? 155 VAL C N   1 
ATOM   5097 C  CA  . VAL C 1 114 ? 41.317 14.625  -6.122  1.00 31.26  ? 155 VAL C CA  1 
ATOM   5098 C  C   . VAL C 1 114 ? 40.287 13.963  -5.241  1.00 30.62  ? 155 VAL C C   1 
ATOM   5099 O  O   . VAL C 1 114 ? 39.646 14.608  -4.403  1.00 33.94  ? 155 VAL C O   1 
ATOM   5100 C  CB  . VAL C 1 114 ? 42.713 14.404  -5.447  1.00 30.36  ? 155 VAL C CB  1 
ATOM   5101 C  CG1 . VAL C 1 114 ? 43.800 14.721  -6.422  1.00 30.01  ? 155 VAL C CG1 1 
ATOM   5102 C  CG2 . VAL C 1 114 ? 42.856 15.227  -4.183  1.00 26.17  ? 155 VAL C CG2 1 
ATOM   5103 N  N   . LEU C 1 115 ? 40.131 12.657  -5.439  1.00 31.86  ? 156 LEU C N   1 
ATOM   5104 C  CA  . LEU C 1 115 ? 39.231 11.856  -4.637  1.00 25.24  ? 156 LEU C CA  1 
ATOM   5105 C  C   . LEU C 1 115 ? 40.067 10.846  -3.843  1.00 29.36  ? 156 LEU C C   1 
ATOM   5106 O  O   . LEU C 1 115 ? 40.969 10.169  -4.389  1.00 25.50  ? 156 LEU C O   1 
ATOM   5107 C  CB  . LEU C 1 115 ? 38.232 11.085  -5.527  1.00 31.98  ? 156 LEU C CB  1 
ATOM   5108 C  CG  . LEU C 1 115 ? 37.243 11.827  -6.449  1.00 40.81  ? 156 LEU C CG  1 
ATOM   5109 C  CD1 . LEU C 1 115 ? 36.269 10.782  -6.958  1.00 39.15  ? 156 LEU C CD1 1 
ATOM   5110 C  CD2 . LEU C 1 115 ? 36.464 12.946  -5.706  1.00 33.89  ? 156 LEU C CD2 1 
ATOM   5111 N  N   . ALA C 1 116 ? 39.774 10.733  -2.560  1.00 29.55  ? 157 ALA C N   1 
ATOM   5112 C  CA  . ALA C 1 116 ? 40.478 9.766   -1.710  1.00 32.72  ? 157 ALA C CA  1 
ATOM   5113 C  C   . ALA C 1 116 ? 39.523 8.557   -1.628  1.00 33.48  ? 157 ALA C C   1 
ATOM   5114 O  O   . ALA C 1 116 ? 38.368 8.689   -1.204  1.00 32.47  ? 157 ALA C O   1 
ATOM   5115 C  CB  . ALA C 1 116 ? 40.756 10.363  -0.298  1.00 25.22  ? 157 ALA C CB  1 
ATOM   5116 N  N   . ILE C 1 117 ? 39.987 7.396   -2.094  1.00 30.72  ? 158 ILE C N   1 
ATOM   5117 C  CA  . ILE C 1 117 ? 39.177 6.186   -2.072  1.00 29.08  ? 158 ILE C CA  1 
ATOM   5118 C  C   . ILE C 1 117 ? 39.758 5.171   -1.097  1.00 38.65  ? 158 ILE C C   1 
ATOM   5119 O  O   . ILE C 1 117 ? 40.840 4.606   -1.340  1.00 37.24  ? 158 ILE C O   1 
ATOM   5120 C  CB  . ILE C 1 117 ? 39.154 5.511   -3.413  1.00 29.38  ? 158 ILE C CB  1 
ATOM   5121 C  CG1 . ILE C 1 117 ? 38.657 6.511   -4.472  1.00 33.55  ? 158 ILE C CG1 1 
ATOM   5122 C  CG2 . ILE C 1 117 ? 38.266 4.242   -3.312  1.00 23.16  ? 158 ILE C CG2 1 
ATOM   5123 C  CD1 . ILE C 1 117 ? 38.835 6.034   -5.891  1.00 40.37  ? 158 ILE C CD1 1 
ATOM   5124 N  N   . GLY C 1 118 ? 39.039 4.955   -0.002  1.00 43.24  ? 159 GLY C N   1 
ATOM   5125 C  CA  . GLY C 1 118 ? 39.458 4.008   1.013   1.00 56.15  ? 159 GLY C CA  1 
ATOM   5126 C  C   . GLY C 1 118 ? 38.362 2.989   1.248   1.00 65.88  ? 159 GLY C C   1 
ATOM   5127 O  O   . GLY C 1 118 ? 37.183 3.334   1.279   1.00 58.51  ? 159 GLY C O   1 
ATOM   5128 N  N   . ASN C 1 119 ? 38.752 1.722   1.401   1.00 82.74  ? 160 ASN C N   1 
ATOM   5129 C  CA  . ASN C 1 119 ? 37.805 0.624   1.631   1.00 92.12  ? 160 ASN C CA  1 
ATOM   5130 C  C   . ASN C 1 119 ? 37.803 0.136   3.067   1.00 97.53  ? 160 ASN C C   1 
ATOM   5131 O  O   . ASN C 1 119 ? 38.362 -0.917  3.368   1.00 98.93  ? 160 ASN C O   1 
ATOM   5132 C  CB  . ASN C 1 119 ? 38.140 -0.558  0.739   1.00 93.43  ? 160 ASN C CB  1 
ATOM   5133 C  CG  . ASN C 1 119 ? 38.152 -0.191  -0.714  1.00 99.26  ? 160 ASN C CG  1 
ATOM   5134 O  OD1 . ASN C 1 119 ? 38.396 -1.038  -1.570  1.00 98.50  ? 160 ASN C OD1 1 
ATOM   5135 N  ND2 . ASN C 1 119 ? 37.889 1.083   -1.009  1.00 100.06 ? 160 ASN C ND2 1 
ATOM   5136 N  N   . PRO C 1 120 ? 37.182 0.895   3.976   1.00 102.59 ? 161 PRO C N   1 
ATOM   5137 C  CA  . PRO C 1 120 ? 37.145 0.472   5.374   1.00 106.33 ? 161 PRO C CA  1 
ATOM   5138 C  C   . PRO C 1 120 ? 36.058 -0.572  5.590   1.00 109.72 ? 161 PRO C C   1 
ATOM   5139 O  O   . PRO C 1 120 ? 34.928 -0.410  5.115   1.00 109.88 ? 161 PRO C O   1 
ATOM   5140 C  CB  . PRO C 1 120 ? 36.858 1.774   6.108   1.00 105.50 ? 161 PRO C CB  1 
ATOM   5141 C  CG  . PRO C 1 120 ? 35.961 2.471   5.164   1.00 104.35 ? 161 PRO C CG  1 
ATOM   5142 C  CD  . PRO C 1 120 ? 36.660 2.266   3.841   1.00 104.94 ? 161 PRO C CD  1 
ATOM   5143 N  N   . TYR C 1 121 ? 36.398 -1.651  6.291   1.00 112.42 ? 162 TYR C N   1 
ATOM   5144 C  CA  . TYR C 1 121 ? 35.407 -2.684  6.555   1.00 112.87 ? 162 TYR C CA  1 
ATOM   5145 C  C   . TYR C 1 121 ? 34.672 -2.374  7.858   1.00 111.08 ? 162 TYR C C   1 
ATOM   5146 O  O   . TYR C 1 121 ? 34.718 -3.145  8.825   1.00 110.24 ? 162 TYR C O   1 
ATOM   5147 C  CB  . TYR C 1 121 ? 36.047 -4.073  6.636   1.00 115.00 ? 162 TYR C CB  1 
ATOM   5148 C  CG  . TYR C 1 121 ? 35.036 -5.194  6.495   1.00 118.01 ? 162 TYR C CG  1 
ATOM   5149 C  CD1 . TYR C 1 121 ? 35.313 -6.477  6.974   1.00 119.87 ? 162 TYR C CD1 1 
ATOM   5150 C  CD2 . TYR C 1 121 ? 33.800 -4.974  5.872   1.00 119.12 ? 162 TYR C CD2 1 
ATOM   5151 C  CE1 . TYR C 1 121 ? 34.383 -7.516  6.836   1.00 121.78 ? 162 TYR C CE1 1 
ATOM   5152 C  CE2 . TYR C 1 121 ? 32.865 -6.002  5.729   1.00 120.04 ? 162 TYR C CE2 1 
ATOM   5153 C  CZ  . TYR C 1 121 ? 33.162 -7.270  6.212   1.00 121.39 ? 162 TYR C CZ  1 
ATOM   5154 O  OH  . TYR C 1 121 ? 32.248 -8.291  6.068   1.00 121.28 ? 162 TYR C OH  1 
ATOM   5155 N  N   . ASN C 1 122 ? 34.016 -1.218  7.869   1.00 107.61 ? 163 ASN C N   1 
ATOM   5156 C  CA  . ASN C 1 122 ? 33.227 -0.765  9.004   1.00 103.18 ? 163 ASN C CA  1 
ATOM   5157 C  C   . ASN C 1 122 ? 32.074 0.050   8.425   1.00 99.78  ? 163 ASN C C   1 
ATOM   5158 O  O   . ASN C 1 122 ? 30.938 -0.043  8.894   1.00 101.39 ? 163 ASN C O   1 
ATOM   5159 C  CB  . ASN C 1 122 ? 34.076 0.076   9.976   1.00 102.58 ? 163 ASN C CB  1 
ATOM   5160 C  CG  . ASN C 1 122 ? 34.686 1.302   9.326   1.00 100.96 ? 163 ASN C CG  1 
ATOM   5161 O  OD1 . ASN C 1 122 ? 35.479 1.194   8.395   1.00 98.95  ? 163 ASN C OD1 1 
ATOM   5162 N  ND2 . ASN C 1 122 ? 34.321 2.476   9.823   1.00 97.46  ? 163 ASN C ND2 1 
ATOM   5163 N  N   . LEU C 1 123 ? 32.371 0.838   7.395   1.00 93.37  ? 164 LEU C N   1 
ATOM   5164 C  CA  . LEU C 1 123 ? 31.352 1.641   6.725   1.00 86.98  ? 164 LEU C CA  1 
ATOM   5165 C  C   . LEU C 1 123 ? 31.461 1.466   5.214   1.00 80.09  ? 164 LEU C C   1 
ATOM   5166 O  O   . LEU C 1 123 ? 30.946 2.286   4.451   1.00 83.22  ? 164 LEU C O   1 
ATOM   5167 C  CB  . LEU C 1 123 ? 31.484 3.132   7.078   1.00 88.18  ? 164 LEU C CB  1 
ATOM   5168 C  CG  . LEU C 1 123 ? 31.048 3.626   8.464   1.00 86.28  ? 164 LEU C CG  1 
ATOM   5169 C  CD1 . LEU C 1 123 ? 31.142 5.139   8.490   1.00 81.88  ? 164 LEU C CD1 1 
ATOM   5170 C  CD2 . LEU C 1 123 ? 29.621 3.184   8.776   1.00 86.04  ? 164 LEU C CD2 1 
ATOM   5171 N  N   . GLY C 1 124 ? 32.135 0.398   4.792   1.00 71.84  ? 165 GLY C N   1 
ATOM   5172 C  CA  . GLY C 1 124 ? 32.296 0.121   3.374   1.00 59.72  ? 165 GLY C CA  1 
ATOM   5173 C  C   . GLY C 1 124 ? 33.210 1.115   2.681   1.00 57.11  ? 165 GLY C C   1 
ATOM   5174 O  O   . GLY C 1 124 ? 33.784 2.008   3.323   1.00 53.53  ? 165 GLY C O   1 
ATOM   5175 N  N   . GLN C 1 125 ? 33.342 0.977   1.365   1.00 47.34  ? 166 GLN C N   1 
ATOM   5176 C  CA  . GLN C 1 125 ? 34.206 1.865   0.599   1.00 49.78  ? 166 GLN C CA  1 
ATOM   5177 C  C   . GLN C 1 125 ? 33.695 3.323   0.672   1.00 47.44  ? 166 GLN C C   1 
ATOM   5178 O  O   . GLN C 1 125 ? 32.544 3.604   0.348   1.00 45.01  ? 166 GLN C O   1 
ATOM   5179 C  CB  . GLN C 1 125 ? 34.284 1.354   -0.845  1.00 50.89  ? 166 GLN C CB  1 
ATOM   5180 C  CG  . GLN C 1 125 ? 35.199 2.119   -1.740  1.00 51.83  ? 166 GLN C CG  1 
ATOM   5181 C  CD  . GLN C 1 125 ? 35.384 1.432   -3.083  1.00 57.11  ? 166 GLN C CD  1 
ATOM   5182 O  OE1 . GLN C 1 125 ? 36.446 0.863   -3.377  1.00 55.15  ? 166 GLN C OE1 1 
ATOM   5183 N  NE2 . GLN C 1 125 ? 34.350 1.466   -3.900  1.00 56.68  ? 166 GLN C NE2 1 
ATOM   5184 N  N   . THR C 1 126 ? 34.561 4.228   1.116   1.00 41.60  ? 167 THR C N   1 
ATOM   5185 C  CA  . THR C 1 126 ? 34.226 5.632   1.271   1.00 40.79  ? 167 THR C CA  1 
ATOM   5186 C  C   . THR C 1 126 ? 35.068 6.500   0.351   1.00 42.49  ? 167 THR C C   1 
ATOM   5187 O  O   . THR C 1 126 ? 36.285 6.297   0.225   1.00 40.56  ? 167 THR C O   1 
ATOM   5188 C  CB  . THR C 1 126 ? 34.482 6.119   2.710   1.00 41.75  ? 167 THR C CB  1 
ATOM   5189 O  OG1 . THR C 1 126 ? 35.894 6.210   2.932   1.00 63.06  ? 167 THR C OG1 1 
ATOM   5190 C  CG2 . THR C 1 126 ? 33.890 5.148   3.712   1.00 47.19  ? 167 THR C CG2 1 
ATOM   5191 N  N   . ILE C 1 127 ? 34.414 7.480   -0.276  1.00 39.31  ? 168 ILE C N   1 
ATOM   5192 C  CA  . ILE C 1 127 ? 35.079 8.388   -1.192  1.00 33.12  ? 168 ILE C CA  1 
ATOM   5193 C  C   . ILE C 1 127 ? 34.982 9.821   -0.686  1.00 34.64  ? 168 ILE C C   1 
ATOM   5194 O  O   . ILE C 1 127 ? 33.899 10.292  -0.367  1.00 31.39  ? 168 ILE C O   1 
ATOM   5195 C  CB  . ILE C 1 127 ? 34.443 8.321   -2.582  1.00 29.71  ? 168 ILE C CB  1 
ATOM   5196 C  CG1 . ILE C 1 127 ? 34.194 6.854   -2.982  1.00 42.81  ? 168 ILE C CG1 1 
ATOM   5197 C  CG2 . ILE C 1 127 ? 35.296 9.108   -3.552  1.00 24.16  ? 168 ILE C CG2 1 
ATOM   5198 C  CD1 . ILE C 1 127 ? 35.108 6.255   -4.027  1.00 29.50  ? 168 ILE C CD1 1 
ATOM   5199 N  N   . THR C 1 128 ? 36.107 10.520  -0.617  1.00 29.42  ? 169 THR C N   1 
ATOM   5200 C  CA  . THR C 1 128 ? 36.089 11.899  -0.156  1.00 35.10  ? 169 THR C CA  1 
ATOM   5201 C  C   . THR C 1 128 ? 36.774 12.775  -1.193  1.00 31.15  ? 169 THR C C   1 
ATOM   5202 O  O   . THR C 1 128 ? 37.592 12.290  -1.971  1.00 29.59  ? 169 THR C O   1 
ATOM   5203 C  CB  . THR C 1 128 ? 36.738 12.008  1.231   1.00 36.04  ? 169 THR C CB  1 
ATOM   5204 O  OG1 . THR C 1 128 ? 38.055 11.456  1.194   1.00 38.13  ? 169 THR C OG1 1 
ATOM   5205 C  CG2 . THR C 1 128 ? 35.907 11.204  2.240   1.00 40.50  ? 169 THR C CG2 1 
ATOM   5206 N  N   . GLN C 1 129 ? 36.414 14.054  -1.225  1.00 27.68  ? 170 GLN C N   1 
ATOM   5207 C  CA  . GLN C 1 129 ? 36.944 14.978  -2.233  1.00 30.11  ? 170 GLN C CA  1 
ATOM   5208 C  C   . GLN C 1 129 ? 37.722 16.131  -1.656  1.00 26.74  ? 170 GLN C C   1 
ATOM   5209 O  O   . GLN C 1 129 ? 37.391 16.629  -0.603  1.00 33.39  ? 170 GLN C O   1 
ATOM   5210 C  CB  . GLN C 1 129 ? 35.786 15.483  -3.106  1.00 28.86  ? 170 GLN C CB  1 
ATOM   5211 C  CG  . GLN C 1 129 ? 36.168 16.396  -4.253  1.00 28.64  ? 170 GLN C CG  1 
ATOM   5212 C  CD  . GLN C 1 129 ? 36.141 17.865  -3.865  1.00 42.66  ? 170 GLN C CD  1 
ATOM   5213 O  OE1 . GLN C 1 129 ? 37.101 18.638  -4.120  1.00 40.39  ? 170 GLN C OE1 1 
ATOM   5214 N  NE2 . GLN C 1 129 ? 35.045 18.268  -3.243  1.00 31.38  ? 170 GLN C NE2 1 
ATOM   5215 N  N   . GLY C 1 130 ? 38.785 16.525  -2.353  1.00 30.12  ? 171 GLY C N   1 
ATOM   5216 C  CA  . GLY C 1 130 ? 39.637 17.610  -1.906  1.00 22.82  ? 171 GLY C CA  1 
ATOM   5217 C  C   . GLY C 1 130 ? 40.416 18.070  -3.115  1.00 27.38  ? 171 GLY C C   1 
ATOM   5218 O  O   . GLY C 1 130 ? 39.993 17.841  -4.243  1.00 24.17  ? 171 GLY C O   1 
ATOM   5219 N  N   . ILE C 1 131 ? 41.532 18.739  -2.889  1.00 23.40  ? 172 ILE C N   1 
ATOM   5220 C  CA  . ILE C 1 131 ? 42.381 19.165  -3.977  1.00 29.64  ? 172 ILE C CA  1 
ATOM   5221 C  C   . ILE C 1 131 ? 43.778 18.859  -3.500  1.00 35.57  ? 172 ILE C C   1 
ATOM   5222 O  O   . ILE C 1 131 ? 43.980 18.522  -2.326  1.00 31.22  ? 172 ILE C O   1 
ATOM   5223 C  CB  . ILE C 1 131 ? 42.359 20.693  -4.254  1.00 31.92  ? 172 ILE C CB  1 
ATOM   5224 C  CG1 . ILE C 1 131 ? 42.858 21.453  -3.015  1.00 29.01  ? 172 ILE C CG1 1 
ATOM   5225 C  CG2 . ILE C 1 131 ? 40.979 21.132  -4.685  1.00 29.03  ? 172 ILE C CG2 1 
ATOM   5226 C  CD1 . ILE C 1 131 ? 42.970 22.971  -3.247  1.00 30.25  ? 172 ILE C CD1 1 
ATOM   5227 N  N   . ILE C 1 132 ? 44.744 18.964  -4.410  1.00 32.21  ? 173 ILE C N   1 
ATOM   5228 C  CA  . ILE C 1 132 ? 46.123 18.762  -4.015  1.00 34.54  ? 173 ILE C CA  1 
ATOM   5229 C  C   . ILE C 1 132 ? 46.626 20.094  -3.408  1.00 35.01  ? 173 ILE C C   1 
ATOM   5230 O  O   . ILE C 1 132 ? 46.530 21.159  -4.056  1.00 35.66  ? 173 ILE C O   1 
ATOM   5231 C  CB  . ILE C 1 132 ? 47.028 18.401  -5.256  1.00 33.84  ? 173 ILE C CB  1 
ATOM   5232 C  CG1 . ILE C 1 132 ? 46.670 17.004  -5.808  1.00 37.05  ? 173 ILE C CG1 1 
ATOM   5233 C  CG2 . ILE C 1 132 ? 48.506 18.463  -4.838  1.00 30.06  ? 173 ILE C CG2 1 
ATOM   5234 C  CD1 . ILE C 1 132 ? 47.558 16.550  -7.004  1.00 36.03  ? 173 ILE C CD1 1 
ATOM   5235 N  N   . SER C 1 133 ? 47.167 20.041  -2.192  1.00 35.98  ? 174 SER C N   1 
ATOM   5236 C  CA  . SER C 1 133 ? 47.718 21.239  -1.532  1.00 37.99  ? 174 SER C CA  1 
ATOM   5237 C  C   . SER C 1 133 ? 49.204 21.441  -1.824  1.00 39.51  ? 174 SER C C   1 
ATOM   5238 O  O   . SER C 1 133 ? 49.677 22.568  -1.857  1.00 45.18  ? 174 SER C O   1 
ATOM   5239 C  CB  . SER C 1 133 ? 47.514 21.162  -0.023  1.00 38.89  ? 174 SER C CB  1 
ATOM   5240 O  OG  . SER C 1 133 ? 46.193 20.721  0.252   1.00 49.18  ? 174 SER C OG  1 
ATOM   5241 N  N   . ALA C 1 134 ? 49.943 20.346  -2.003  1.00 40.43  ? 175 ALA C N   1 
ATOM   5242 C  CA  . ALA C 1 134 ? 51.383 20.386  -2.353  1.00 36.41  ? 175 ALA C CA  1 
ATOM   5243 C  C   . ALA C 1 134 ? 51.702 19.065  -3.059  1.00 39.67  ? 175 ALA C C   1 
ATOM   5244 O  O   . ALA C 1 134 ? 51.276 17.990  -2.602  1.00 46.05  ? 175 ALA C O   1 
ATOM   5245 C  CB  . ALA C 1 134 ? 52.225 20.556  -1.120  1.00 32.71  ? 175 ALA C CB  1 
ATOM   5246 N  N   . THR C 1 135 ? 52.422 19.140  -4.179  1.00 45.05  ? 176 THR C N   1 
ATOM   5247 C  CA  . THR C 1 135 ? 52.761 17.963  -4.989  1.00 47.63  ? 176 THR C CA  1 
ATOM   5248 C  C   . THR C 1 135 ? 53.785 16.966  -4.458  1.00 49.92  ? 176 THR C C   1 
ATOM   5249 O  O   . THR C 1 135 ? 53.783 15.793  -4.855  1.00 52.45  ? 176 THR C O   1 
ATOM   5250 C  CB  . THR C 1 135 ? 53.208 18.368  -6.399  1.00 44.24  ? 176 THR C CB  1 
ATOM   5251 O  OG1 . THR C 1 135 ? 54.002 19.554  -6.315  1.00 57.31  ? 176 THR C OG1 1 
ATOM   5252 C  CG2 . THR C 1 135 ? 52.029 18.637  -7.275  1.00 47.02  ? 176 THR C CG2 1 
ATOM   5253 N  N   . GLY C 1 136 ? 54.665 17.387  -3.573  1.00 49.45  ? 177 GLY C N   1 
ATOM   5254 C  CA  . GLY C 1 136 ? 55.631 16.411  -3.086  1.00 58.71  ? 177 GLY C CA  1 
ATOM   5255 C  C   . GLY C 1 136 ? 56.667 15.898  -4.102  1.00 59.98  ? 177 GLY C C   1 
ATOM   5256 O  O   . GLY C 1 136 ? 56.454 15.853  -5.324  1.00 60.42  ? 177 GLY C O   1 
ATOM   5257 N  N   . ARG C 1 137 ? 57.809 15.493  -3.570  1.00 59.57  ? 178 ARG C N   1 
ATOM   5258 C  CA  . ARG C 1 137 ? 58.915 14.997  -4.370  1.00 57.69  ? 178 ARG C CA  1 
ATOM   5259 C  C   . ARG C 1 137 ? 58.761 13.531  -4.720  1.00 54.73  ? 178 ARG C C   1 
ATOM   5260 O  O   . ARG C 1 137 ? 58.191 12.751  -3.950  1.00 51.53  ? 178 ARG C O   1 
ATOM   5261 C  CB  . ARG C 1 137 ? 60.215 15.209  -3.596  1.00 59.82  ? 178 ARG C CB  1 
ATOM   5262 C  CG  . ARG C 1 137 ? 60.509 16.676  -3.332  1.00 65.22  ? 178 ARG C CG  1 
ATOM   5263 C  CD  . ARG C 1 137 ? 61.778 16.879  -2.523  1.00 71.92  ? 178 ARG C CD  1 
ATOM   5264 N  NE  . ARG C 1 137 ? 62.465 18.085  -2.972  1.00 81.67  ? 178 ARG C NE  1 
ATOM   5265 C  CZ  . ARG C 1 137 ? 63.139 18.184  -4.117  1.00 84.34  ? 178 ARG C CZ  1 
ATOM   5266 N  NH1 . ARG C 1 137 ? 63.236 17.142  -4.936  1.00 83.44  ? 178 ARG C NH1 1 
ATOM   5267 N  NH2 . ARG C 1 137 ? 63.694 19.340  -4.461  1.00 87.49  ? 178 ARG C NH2 1 
ATOM   5268 N  N   . ILE C 1 138 ? 59.269 13.154  -5.885  1.00 53.15  ? 179 ILE C N   1 
ATOM   5269 C  CA  . ILE C 1 138 ? 59.191 11.764  -6.309  1.00 61.27  ? 179 ILE C CA  1 
ATOM   5270 C  C   . ILE C 1 138 ? 60.547 11.070  -6.240  1.00 61.90  ? 179 ILE C C   1 
ATOM   5271 O  O   . ILE C 1 138 ? 60.709 9.985   -6.792  1.00 62.76  ? 179 ILE C O   1 
ATOM   5272 C  CB  . ILE C 1 138 ? 58.668 11.637  -7.748  1.00 60.70  ? 179 ILE C CB  1 
ATOM   5273 C  CG1 . ILE C 1 138 ? 59.627 12.357  -8.700  1.00 62.29  ? 179 ILE C CG1 1 
ATOM   5274 C  CG2 . ILE C 1 138 ? 57.253 12.198  -7.832  1.00 59.34  ? 179 ILE C CG2 1 
ATOM   5275 C  CD1 . ILE C 1 138 ? 59.432 12.020  -10.162 1.00 58.55  ? 179 ILE C CD1 1 
ATOM   5276 N  N   . GLY C 1 139 ? 61.510 11.692  -5.562  1.00 62.81  ? 180 GLY C N   1 
ATOM   5277 C  CA  . GLY C 1 139 ? 62.841 11.104  -5.450  1.00 65.65  ? 180 GLY C CA  1 
ATOM   5278 C  C   . GLY C 1 139 ? 62.969 10.065  -4.345  1.00 63.59  ? 180 GLY C C   1 
ATOM   5279 O  O   . GLY C 1 139 ? 62.101 9.995   -3.484  1.00 65.76  ? 180 GLY C O   1 
ATOM   5280 N  N   . LEU C 1 140 ? 64.056 9.287   -4.358  1.00 63.99  ? 181 LEU C N   1 
ATOM   5281 C  CA  . LEU C 1 140 ? 64.296 8.220   -3.379  1.00 66.97  ? 181 LEU C CA  1 
ATOM   5282 C  C   . LEU C 1 140 ? 64.912 8.580   -2.033  1.00 67.42  ? 181 LEU C C   1 
ATOM   5283 O  O   . LEU C 1 140 ? 64.752 7.844   -1.056  1.00 66.28  ? 181 LEU C O   1 
ATOM   5284 C  CB  . LEU C 1 140 ? 65.153 7.122   -4.005  1.00 69.42  ? 181 LEU C CB  1 
ATOM   5285 C  CG  . LEU C 1 140 ? 64.437 5.867   -4.488  1.00 72.01  ? 181 LEU C CG  1 
ATOM   5286 C  CD1 . LEU C 1 140 ? 63.370 6.231   -5.506  1.00 67.03  ? 181 LEU C CD1 1 
ATOM   5287 C  CD2 . LEU C 1 140 ? 65.477 4.919   -5.088  1.00 70.31  ? 181 LEU C CD2 1 
ATOM   5288 N  N   . ASN C 1 141 ? 65.643 9.682   -1.975  1.00 69.87  ? 182 ASN C N   1 
ATOM   5289 C  CA  . ASN C 1 141 ? 66.257 10.098  -0.720  1.00 71.75  ? 182 ASN C CA  1 
ATOM   5290 C  C   . ASN C 1 141 ? 65.134 10.464  0.253   1.00 72.04  ? 182 ASN C C   1 
ATOM   5291 O  O   . ASN C 1 141 ? 64.342 11.370  -0.002  1.00 66.13  ? 182 ASN C O   1 
ATOM   5292 C  CB  . ASN C 1 141 ? 67.195 11.289  -0.977  1.00 78.87  ? 182 ASN C CB  1 
ATOM   5293 C  CG  . ASN C 1 141 ? 67.690 11.943  0.300   1.00 80.40  ? 182 ASN C CG  1 
ATOM   5294 O  OD1 . ASN C 1 141 ? 67.225 13.021  0.674   1.00 81.04  ? 182 ASN C OD1 1 
ATOM   5295 N  ND2 . ASN C 1 141 ? 68.635 11.294  0.976   1.00 83.22  ? 182 ASN C ND2 1 
ATOM   5296 N  N   . PRO C 1 142 ? 65.046 9.744   1.377   1.00 73.73  ? 183 PRO C N   1 
ATOM   5297 C  CA  . PRO C 1 142 ? 64.020 9.975   2.395   1.00 78.17  ? 183 PRO C CA  1 
ATOM   5298 C  C   . PRO C 1 142 ? 64.177 11.338  3.047   1.00 83.19  ? 183 PRO C C   1 
ATOM   5299 O  O   . PRO C 1 142 ? 65.280 11.726  3.433   1.00 83.56  ? 183 PRO C O   1 
ATOM   5300 C  CB  . PRO C 1 142 ? 64.253 8.831   3.370   1.00 80.32  ? 183 PRO C CB  1 
ATOM   5301 C  CG  . PRO C 1 142 ? 65.737 8.664   3.312   1.00 79.11  ? 183 PRO C CG  1 
ATOM   5302 C  CD  . PRO C 1 142 ? 66.018 8.735   1.831   1.00 76.85  ? 183 PRO C CD  1 
ATOM   5303 N  N   . THR C 1 143 ? 63.071 12.062  3.179   1.00 84.38  ? 184 THR C N   1 
ATOM   5304 C  CA  . THR C 1 143 ? 63.125 13.387  3.770   1.00 86.64  ? 184 THR C CA  1 
ATOM   5305 C  C   . THR C 1 143 ? 62.096 13.589  4.873   1.00 89.43  ? 184 THR C C   1 
ATOM   5306 O  O   . THR C 1 143 ? 62.402 14.175  5.915   1.00 94.82  ? 184 THR C O   1 
ATOM   5307 C  CB  . THR C 1 143 ? 62.924 14.474  2.696   1.00 84.39  ? 184 THR C CB  1 
ATOM   5308 O  OG1 . THR C 1 143 ? 61.683 14.253  2.021   1.00 81.19  ? 184 THR C OG1 1 
ATOM   5309 C  CG2 . THR C 1 143 ? 64.056 14.439  1.676   1.00 83.79  ? 184 THR C CG2 1 
ATOM   5310 N  N   . GLY C 1 144 ? 60.882 13.103  4.649   1.00 88.15  ? 185 GLY C N   1 
ATOM   5311 C  CA  . GLY C 1 144 ? 59.836 13.264  5.644   1.00 88.33  ? 185 GLY C CA  1 
ATOM   5312 C  C   . GLY C 1 144 ? 58.474 13.630  5.070   1.00 86.74  ? 185 GLY C C   1 
ATOM   5313 O  O   . GLY C 1 144 ? 58.386 14.210  3.980   1.00 87.10  ? 185 GLY C O   1 
ATOM   5314 N  N   . ARG C 1 145 ? 57.413 13.293  5.807   1.00 82.54  ? 186 ARG C N   1 
ATOM   5315 C  CA  . ARG C 1 145 ? 56.046 13.580  5.382   1.00 79.79  ? 186 ARG C CA  1 
ATOM   5316 C  C   . ARG C 1 145 ? 55.954 14.909  4.633   1.00 77.95  ? 186 ARG C C   1 
ATOM   5317 O  O   . ARG C 1 145 ? 55.250 15.012  3.631   1.00 76.43  ? 186 ARG C O   1 
ATOM   5318 C  CB  . ARG C 1 145 ? 55.110 13.588  6.595   1.00 79.61  ? 186 ARG C CB  1 
ATOM   5319 N  N   . GLN C 1 146 ? 56.681 15.918  5.109   1.00 77.95  ? 187 GLN C N   1 
ATOM   5320 C  CA  . GLN C 1 146 ? 56.671 17.238  4.477   1.00 76.49  ? 187 GLN C CA  1 
ATOM   5321 C  C   . GLN C 1 146 ? 56.858 17.210  2.961   1.00 72.72  ? 187 GLN C C   1 
ATOM   5322 O  O   . GLN C 1 146 ? 56.269 18.031  2.252   1.00 71.71  ? 187 GLN C O   1 
ATOM   5323 C  CB  . GLN C 1 146 ? 57.728 18.151  5.112   1.00 82.87  ? 187 GLN C CB  1 
ATOM   5324 C  CG  . GLN C 1 146 ? 58.991 17.440  5.559   1.00 91.02  ? 187 GLN C CG  1 
ATOM   5325 C  CD  . GLN C 1 146 ? 59.125 17.404  7.072   1.00 97.99  ? 187 GLN C CD  1 
ATOM   5326 O  OE1 . GLN C 1 146 ? 59.283 18.445  7.717   1.00 103.10 ? 187 GLN C OE1 1 
ATOM   5327 N  NE2 . GLN C 1 146 ? 59.058 16.206  7.649   1.00 100.11 ? 187 GLN C NE2 1 
ATOM   5328 N  N   . ASN C 1 147 ? 57.668 16.284  2.451   1.00 66.01  ? 188 ASN C N   1 
ATOM   5329 C  CA  . ASN C 1 147 ? 57.849 16.214  1.008   1.00 60.26  ? 188 ASN C CA  1 
ATOM   5330 C  C   . ASN C 1 147 ? 56.886 15.261  0.291   1.00 56.17  ? 188 ASN C C   1 
ATOM   5331 O  O   . ASN C 1 147 ? 57.042 14.994  -0.902  1.00 54.25  ? 188 ASN C O   1 
ATOM   5332 C  CB  . ASN C 1 147 ? 59.296 15.868  0.658   1.00 67.34  ? 188 ASN C CB  1 
ATOM   5333 C  CG  . ASN C 1 147 ? 60.222 17.083  0.741   1.00 74.20  ? 188 ASN C CG  1 
ATOM   5334 O  OD1 . ASN C 1 147 ? 59.866 18.183  0.298   1.00 75.36  ? 188 ASN C OD1 1 
ATOM   5335 N  ND2 . ASN C 1 147 ? 61.420 16.885  1.296   1.00 73.14  ? 188 ASN C ND2 1 
ATOM   5336 N  N   . PHE C 1 148 ? 55.906 14.735  1.020   1.00 49.08  ? 189 PHE C N   1 
ATOM   5337 C  CA  . PHE C 1 148 ? 54.896 13.859  0.418   1.00 48.54  ? 189 PHE C CA  1 
ATOM   5338 C  C   . PHE C 1 148 ? 53.840 14.781  -0.155  1.00 48.58  ? 189 PHE C C   1 
ATOM   5339 O  O   . PHE C 1 148 ? 53.826 15.990  0.123   1.00 46.63  ? 189 PHE C O   1 
ATOM   5340 C  CB  . PHE C 1 148 ? 54.195 12.980  1.458   1.00 44.24  ? 189 PHE C CB  1 
ATOM   5341 C  CG  . PHE C 1 148 ? 55.037 11.857  1.982   1.00 50.12  ? 189 PHE C CG  1 
ATOM   5342 C  CD1 . PHE C 1 148 ? 54.650 11.171  3.127   1.00 51.46  ? 189 PHE C CD1 1 
ATOM   5343 C  CD2 . PHE C 1 148 ? 56.220 11.490  1.344   1.00 56.88  ? 189 PHE C CD2 1 
ATOM   5344 C  CE1 . PHE C 1 148 ? 55.430 10.137  3.637   1.00 56.50  ? 189 PHE C CE1 1 
ATOM   5345 C  CE2 . PHE C 1 148 ? 57.010 10.454  1.844   1.00 54.48  ? 189 PHE C CE2 1 
ATOM   5346 C  CZ  . PHE C 1 148 ? 56.612 9.779   2.995   1.00 58.68  ? 189 PHE C CZ  1 
ATOM   5347 N  N   . LEU C 1 149 ? 52.946 14.210  -0.943  1.00 41.79  ? 190 LEU C N   1 
ATOM   5348 C  CA  . LEU C 1 149 ? 51.869 14.989  -1.512  1.00 35.82  ? 190 LEU C CA  1 
ATOM   5349 C  C   . LEU C 1 149 ? 50.891 15.300  -0.364  1.00 38.79  ? 190 LEU C C   1 
ATOM   5350 O  O   . LEU C 1 149 ? 50.645 14.442  0.498   1.00 36.94  ? 190 LEU C O   1 
ATOM   5351 C  CB  . LEU C 1 149 ? 51.215 14.177  -2.610  1.00 34.56  ? 190 LEU C CB  1 
ATOM   5352 C  CG  . LEU C 1 149 ? 50.015 14.734  -3.360  1.00 40.90  ? 190 LEU C CG  1 
ATOM   5353 C  CD1 . LEU C 1 149 ? 49.794 13.938  -4.637  1.00 30.75  ? 190 LEU C CD1 1 
ATOM   5354 C  CD2 . LEU C 1 149 ? 48.788 14.678  -2.455  1.00 33.80  ? 190 LEU C CD2 1 
ATOM   5355 N  N   . GLN C 1 150 ? 50.367 16.529  -0.321  1.00 28.23  ? 191 GLN C N   1 
ATOM   5356 C  CA  . GLN C 1 150 ? 49.420 16.898  0.734   1.00 30.71  ? 191 GLN C CA  1 
ATOM   5357 C  C   . GLN C 1 150 ? 48.096 17.229  0.108   1.00 30.61  ? 191 GLN C C   1 
ATOM   5358 O  O   . GLN C 1 150 ? 48.049 17.811  -0.965  1.00 31.36  ? 191 GLN C O   1 
ATOM   5359 C  CB  . GLN C 1 150 ? 49.932 18.107  1.531   1.00 33.20  ? 191 GLN C CB  1 
ATOM   5360 C  CG  . GLN C 1 150 ? 51.282 17.818  2.194   1.00 47.43  ? 191 GLN C CG  1 
ATOM   5361 C  CD  . GLN C 1 150 ? 51.976 19.057  2.765   1.00 53.38  ? 191 GLN C CD  1 
ATOM   5362 O  OE1 . GLN C 1 150 ? 53.210 19.139  2.778   1.00 57.58  ? 191 GLN C OE1 1 
ATOM   5363 N  NE2 . GLN C 1 150 ? 51.190 20.014  3.246   1.00 58.02  ? 191 GLN C NE2 1 
ATOM   5364 N  N   . THR C 1 151 ? 47.018 16.869  0.784   1.00 28.20  ? 192 THR C N   1 
ATOM   5365 C  CA  . THR C 1 151 ? 45.706 17.126  0.258   1.00 33.82  ? 192 THR C CA  1 
ATOM   5366 C  C   . THR C 1 151 ? 44.774 17.366  1.416   1.00 33.43  ? 192 THR C C   1 
ATOM   5367 O  O   . THR C 1 151 ? 45.087 17.002  2.545   1.00 39.10  ? 192 THR C O   1 
ATOM   5368 C  CB  . THR C 1 151 ? 45.194 15.894  -0.556  1.00 37.69  ? 192 THR C CB  1 
ATOM   5369 O  OG1 . THR C 1 151 ? 43.890 16.168  -1.095  1.00 39.83  ? 192 THR C OG1 1 
ATOM   5370 C  CG2 . THR C 1 151 ? 45.101 14.678  0.332   1.00 35.09  ? 192 THR C CG2 1 
ATOM   5371 N  N   . ASP C 1 152 ? 43.628 17.972  1.135   1.00 33.71  ? 193 ASP C N   1 
ATOM   5372 C  CA  . ASP C 1 152 ? 42.625 18.207  2.171   1.00 37.68  ? 193 ASP C CA  1 
ATOM   5373 C  C   . ASP C 1 152 ? 41.476 17.227  2.016   1.00 40.27  ? 193 ASP C C   1 
ATOM   5374 O  O   . ASP C 1 152 ? 40.445 17.369  2.668   1.00 47.16  ? 193 ASP C O   1 
ATOM   5375 C  CB  . ASP C 1 152 ? 42.078 19.629  2.120   1.00 41.08  ? 193 ASP C CB  1 
ATOM   5376 C  CG  . ASP C 1 152 ? 41.467 19.986  0.760   1.00 40.57  ? 193 ASP C CG  1 
ATOM   5377 O  OD1 . ASP C 1 152 ? 41.636 19.201  -0.193  1.00 36.66  ? 193 ASP C OD1 1 
ATOM   5378 O  OD2 . ASP C 1 152 ? 40.824 21.060  0.657   1.00 38.16  ? 193 ASP C OD2 1 
ATOM   5379 N  N   . ALA C 1 153 ? 41.632 16.241  1.142   1.00 39.56  ? 194 ALA C N   1 
ATOM   5380 C  CA  . ALA C 1 153 ? 40.586 15.221  0.992   1.00 53.89  ? 194 ALA C CA  1 
ATOM   5381 C  C   . ALA C 1 153 ? 40.782 14.306  2.206   1.00 59.79  ? 194 ALA C C   1 
ATOM   5382 O  O   . ALA C 1 153 ? 41.793 13.614  2.303   1.00 67.97  ? 194 ALA C O   1 
ATOM   5383 C  CB  . ALA C 1 153 ? 40.771 14.432  -0.324  1.00 41.20  ? 194 ALA C CB  1 
ATOM   5384 N  N   . SER C 1 154 ? 39.835 14.333  3.139   1.00 71.25  ? 195 SER C N   1 
ATOM   5385 C  CA  . SER C 1 154 ? 39.908 13.531  4.372   1.00 77.60  ? 195 SER C CA  1 
ATOM   5386 C  C   . SER C 1 154 ? 40.679 12.222  4.219   1.00 80.36  ? 195 SER C C   1 
ATOM   5387 O  O   . SER C 1 154 ? 40.264 11.333  3.478   1.00 77.66  ? 195 SER C O   1 
ATOM   5388 C  CB  . SER C 1 154 ? 38.497 13.210  4.887   1.00 77.70  ? 195 SER C CB  1 
ATOM   5389 O  OG  . SER C 1 154 ? 37.724 14.386  5.071   1.00 80.71  ? 195 SER C OG  1 
ATOM   5390 N  N   . ILE C 1 155 ? 41.801 12.117  4.924   1.00 85.72  ? 196 ILE C N   1 
ATOM   5391 C  CA  . ILE C 1 155 ? 42.639 10.916  4.892   1.00 89.78  ? 196 ILE C CA  1 
ATOM   5392 C  C   . ILE C 1 155 ? 42.673 10.282  6.284   1.00 90.89  ? 196 ILE C C   1 
ATOM   5393 O  O   . ILE C 1 155 ? 43.296 10.824  7.203   1.00 92.05  ? 196 ILE C O   1 
ATOM   5394 C  CB  . ILE C 1 155 ? 44.085 11.258  4.474   1.00 90.42  ? 196 ILE C CB  1 
ATOM   5395 C  CG1 . ILE C 1 155 ? 44.114 11.701  3.009   1.00 89.58  ? 196 ILE C CG1 1 
ATOM   5396 C  CG2 . ILE C 1 155 ? 44.997 10.048  4.703   1.00 90.36  ? 196 ILE C CG2 1 
ATOM   5397 C  CD1 . ILE C 1 155 ? 43.858 10.589  2.027   1.00 90.23  ? 196 ILE C CD1 1 
ATOM   5398 N  N   . ASN C 1 156 ? 42.013 9.134   6.434   1.00 92.23  ? 197 ASN C N   1 
ATOM   5399 C  CA  . ASN C 1 156 ? 41.952 8.455   7.729   1.00 93.79  ? 197 ASN C CA  1 
ATOM   5400 C  C   . ASN C 1 156 ? 42.268 6.953   7.671   1.00 92.30  ? 197 ASN C C   1 
ATOM   5401 O  O   . ASN C 1 156 ? 42.795 6.461   6.671   1.00 90.83  ? 197 ASN C O   1 
ATOM   5402 C  CB  . ASN C 1 156 ? 40.568 8.676   8.342   1.00 96.83  ? 197 ASN C CB  1 
ATOM   5403 C  CG  . ASN C 1 156 ? 39.874 9.907   7.774   1.00 101.61 ? 197 ASN C CG  1 
ATOM   5404 O  OD1 . ASN C 1 156 ? 40.474 10.982  7.655   1.00 102.29 ? 197 ASN C OD1 1 
ATOM   5405 N  ND2 . ASN C 1 156 ? 38.602 9.756   7.421   1.00 105.19 ? 197 ASN C ND2 1 
ATOM   5406 N  N   . HIS C 1 157 ? 41.942 6.235   8.748   1.00 90.49  ? 198 HIS C N   1 
ATOM   5407 C  CA  . HIS C 1 157 ? 42.204 4.795   8.833   1.00 86.92  ? 198 HIS C CA  1 
ATOM   5408 C  C   . HIS C 1 157 ? 41.554 3.936   7.765   1.00 80.89  ? 198 HIS C C   1 
ATOM   5409 O  O   . HIS C 1 157 ? 42.162 2.970   7.317   1.00 80.29  ? 198 HIS C O   1 
ATOM   5410 C  CB  . HIS C 1 157 ? 41.803 4.250   10.206  1.00 88.89  ? 198 HIS C CB  1 
ATOM   5411 C  CG  . HIS C 1 157 ? 42.757 4.613   11.299  1.00 94.48  ? 198 HIS C CG  1 
ATOM   5412 N  ND1 . HIS C 1 157 ? 44.120 4.453   11.176  1.00 96.32  ? 198 HIS C ND1 1 
ATOM   5413 C  CD2 . HIS C 1 157 ? 42.545 5.109   12.541  1.00 97.03  ? 198 HIS C CD2 1 
ATOM   5414 C  CE1 . HIS C 1 157 ? 44.709 4.836   12.296  1.00 98.87  ? 198 HIS C CE1 1 
ATOM   5415 N  NE2 . HIS C 1 157 ? 43.775 5.239   13.140  1.00 98.41  ? 198 HIS C NE2 1 
ATOM   5416 N  N   . GLY C 1 158 ? 40.322 4.275   7.377   1.00 78.48  ? 199 GLY C N   1 
ATOM   5417 C  CA  . GLY C 1 158 ? 39.604 3.514   6.359   1.00 76.48  ? 199 GLY C CA  1 
ATOM   5418 C  C   . GLY C 1 158 ? 39.978 3.950   4.951   1.00 76.83  ? 199 GLY C C   1 
ATOM   5419 O  O   . GLY C 1 158 ? 39.308 3.590   3.962   1.00 74.98  ? 199 GLY C O   1 
ATOM   5420 N  N   . ASN C 1 159 ? 41.074 4.711   4.884   1.00 67.33  ? 200 ASN C N   1 
ATOM   5421 C  CA  . ASN C 1 159 ? 41.623 5.280   3.657   1.00 64.89  ? 200 ASN C CA  1 
ATOM   5422 C  C   . ASN C 1 159 ? 43.056 4.833   3.462   1.00 62.08  ? 200 ASN C C   1 
ATOM   5423 O  O   . ASN C 1 159 ? 43.492 4.502   2.350   1.00 59.38  ? 200 ASN C O   1 
ATOM   5424 C  CB  . ASN C 1 159 ? 41.644 6.809   3.756   1.00 65.41  ? 200 ASN C CB  1 
ATOM   5425 C  CG  . ASN C 1 159 ? 40.579 7.454   2.932   1.00 67.83  ? 200 ASN C CG  1 
ATOM   5426 O  OD1 . ASN C 1 159 ? 39.911 6.796   2.131   1.00 75.91  ? 200 ASN C OD1 1 
ATOM   5427 N  ND2 . ASN C 1 159 ? 40.417 8.753   3.102   1.00 63.56  ? 200 ASN C ND2 1 
ATOM   5428 N  N   . SER C 1 160 ? 43.784 4.874   4.570   1.00 56.82  ? 201 SER C N   1 
ATOM   5429 C  CA  . SER C 1 160 ? 45.183 4.520   4.610   1.00 55.44  ? 201 SER C CA  1 
ATOM   5430 C  C   . SER C 1 160 ? 45.533 3.309   3.752   1.00 54.81  ? 201 SER C C   1 
ATOM   5431 O  O   . SER C 1 160 ? 45.064 2.185   3.985   1.00 57.15  ? 201 SER C O   1 
ATOM   5432 C  CB  . SER C 1 160 ? 45.605 4.280   6.051   1.00 58.44  ? 201 SER C CB  1 
ATOM   5433 O  OG  . SER C 1 160 ? 46.989 4.025   6.115   1.00 66.85  ? 201 SER C OG  1 
ATOM   5434 N  N   . GLY C 1 161 ? 46.380 3.560   2.761   1.00 45.31  ? 202 GLY C N   1 
ATOM   5435 C  CA  . GLY C 1 161 ? 46.809 2.510   1.864   1.00 48.88  ? 202 GLY C CA  1 
ATOM   5436 C  C   . GLY C 1 161 ? 45.929 2.534   0.634   1.00 46.05  ? 202 GLY C C   1 
ATOM   5437 O  O   . GLY C 1 161 ? 46.208 1.844   -0.323  1.00 43.27  ? 202 GLY C O   1 
ATOM   5438 N  N   . GLY C 1 162 ? 44.865 3.337   0.669   1.00 43.83  ? 203 GLY C N   1 
ATOM   5439 C  CA  . GLY C 1 162 ? 43.976 3.426   -0.476  1.00 40.01  ? 203 GLY C CA  1 
ATOM   5440 C  C   . GLY C 1 162 ? 44.492 4.381   -1.531  1.00 37.19  ? 203 GLY C C   1 
ATOM   5441 O  O   . GLY C 1 162 ? 45.595 4.903   -1.453  1.00 33.83  ? 203 GLY C O   1 
ATOM   5442 N  N   . ALA C 1 163 ? 43.648 4.663   -2.501  1.00 36.76  ? 204 ALA C N   1 
ATOM   5443 C  CA  . ALA C 1 163 ? 44.034 5.507   -3.613  1.00 33.42  ? 204 ALA C CA  1 
ATOM   5444 C  C   . ALA C 1 163 ? 43.573 6.966   -3.567  1.00 38.75  ? 204 ALA C C   1 
ATOM   5445 O  O   . ALA C 1 163 ? 42.492 7.301   -3.050  1.00 32.97  ? 204 ALA C O   1 
ATOM   5446 C  CB  . ALA C 1 163 ? 43.522 4.863   -4.909  1.00 24.25  ? 204 ALA C CB  1 
ATOM   5447 N  N   . LEU C 1 164 ? 44.424 7.808   -4.140  1.00 33.59  ? 205 LEU C N   1 
ATOM   5448 C  CA  . LEU C 1 164 ? 44.175 9.221   -4.306  1.00 34.15  ? 205 LEU C CA  1 
ATOM   5449 C  C   . LEU C 1 164 ? 44.204 9.391   -5.842  1.00 32.34  ? 205 LEU C C   1 
ATOM   5450 O  O   . LEU C 1 164 ? 45.255 9.229   -6.455  1.00 36.07  ? 205 LEU C O   1 
ATOM   5451 C  CB  . LEU C 1 164 ? 45.318 10.016  -3.676  1.00 37.11  ? 205 LEU C CB  1 
ATOM   5452 C  CG  . LEU C 1 164 ? 45.159 11.343  -2.926  1.00 40.78  ? 205 LEU C CG  1 
ATOM   5453 C  CD1 . LEU C 1 164 ? 45.851 12.428  -3.714  1.00 38.36  ? 205 LEU C CD1 1 
ATOM   5454 C  CD2 . LEU C 1 164 ? 43.701 11.664  -2.602  1.00 27.57  ? 205 LEU C CD2 1 
ATOM   5455 N  N   . VAL C 1 165 ? 43.073 9.731   -6.455  1.00 29.33  ? 206 VAL C N   1 
ATOM   5456 C  CA  . VAL C 1 165 ? 43.011 9.887   -7.908  1.00 32.04  ? 206 VAL C CA  1 
ATOM   5457 C  C   . VAL C 1 165 ? 42.470 11.257  -8.319  1.00 35.49  ? 206 VAL C C   1 
ATOM   5458 O  O   . VAL C 1 165 ? 41.852 11.951  -7.499  1.00 36.65  ? 206 VAL C O   1 
ATOM   5459 C  CB  . VAL C 1 165 ? 42.079 8.794   -8.535  1.00 32.28  ? 206 VAL C CB  1 
ATOM   5460 C  CG1 . VAL C 1 165 ? 42.557 7.355   -8.119  1.00 27.86  ? 206 VAL C CG1 1 
ATOM   5461 C  CG2 . VAL C 1 165 ? 40.665 9.007   -8.060  1.00 34.25  ? 206 VAL C CG2 1 
ATOM   5462 N  N   . ASN C 1 166 ? 42.687 11.637  -9.586  1.00 28.74  ? 207 ASN C N   1 
ATOM   5463 C  CA  . ASN C 1 166 ? 42.161 12.901  -10.074 1.00 27.83  ? 207 ASN C CA  1 
ATOM   5464 C  C   . ASN C 1 166 ? 40.770 12.697  -10.671 1.00 30.11  ? 207 ASN C C   1 
ATOM   5465 O  O   . ASN C 1 166 ? 40.210 11.606  -10.565 1.00 33.33  ? 207 ASN C O   1 
ATOM   5466 C  CB  . ASN C 1 166 ? 43.133 13.598  -11.048 1.00 28.88  ? 207 ASN C CB  1 
ATOM   5467 C  CG  . ASN C 1 166 ? 43.461 12.772  -12.313 1.00 37.91  ? 207 ASN C CG  1 
ATOM   5468 O  OD1 . ASN C 1 166 ? 42.699 11.888  -12.746 1.00 30.74  ? 207 ASN C OD1 1 
ATOM   5469 N  ND2 . ASN C 1 166 ? 44.609 13.100  -12.924 1.00 27.00  ? 207 ASN C ND2 1 
ATOM   5470 N  N   . SER C 1 167 ? 40.192 13.724  -11.291 1.00 32.64  ? 208 SER C N   1 
ATOM   5471 C  CA  . SER C 1 167 ? 38.822 13.575  -11.812 1.00 34.52  ? 208 SER C CA  1 
ATOM   5472 C  C   . SER C 1 167 ? 38.667 12.652  -13.010 1.00 35.04  ? 208 SER C C   1 
ATOM   5473 O  O   . SER C 1 167 ? 37.542 12.349  -13.417 1.00 33.31  ? 208 SER C O   1 
ATOM   5474 C  CB  . SER C 1 167 ? 38.205 14.942  -12.150 1.00 33.62  ? 208 SER C CB  1 
ATOM   5475 O  OG  . SER C 1 167 ? 38.915 15.601  -13.182 1.00 36.12  ? 208 SER C OG  1 
ATOM   5476 N  N   . LEU C 1 168 ? 39.783 12.219  -13.589 1.00 35.53  ? 209 LEU C N   1 
ATOM   5477 C  CA  . LEU C 1 168 ? 39.721 11.280  -14.701 1.00 37.81  ? 209 LEU C CA  1 
ATOM   5478 C  C   . LEU C 1 168 ? 39.811 9.879   -14.126 1.00 40.35  ? 209 LEU C C   1 
ATOM   5479 O  O   . LEU C 1 168 ? 39.550 8.910   -14.828 1.00 41.62  ? 209 LEU C O   1 
ATOM   5480 C  CB  . LEU C 1 168 ? 40.873 11.512  -15.677 1.00 36.42  ? 209 LEU C CB  1 
ATOM   5481 C  CG  . LEU C 1 168 ? 40.793 12.905  -16.301 1.00 46.10  ? 209 LEU C CG  1 
ATOM   5482 C  CD1 . LEU C 1 168 ? 41.942 13.095  -17.290 1.00 45.14  ? 209 LEU C CD1 1 
ATOM   5483 C  CD2 . LEU C 1 168 ? 39.409 13.080  -16.980 1.00 39.34  ? 209 LEU C CD2 1 
ATOM   5484 N  N   . GLY C 1 169 ? 40.171 9.777   -12.843 1.00 38.14  ? 210 GLY C N   1 
ATOM   5485 C  CA  . GLY C 1 169 ? 40.305 8.473   -12.217 1.00 32.03  ? 210 GLY C CA  1 
ATOM   5486 C  C   . GLY C 1 169 ? 41.761 7.988   -12.159 1.00 36.36  ? 210 GLY C C   1 
ATOM   5487 O  O   . GLY C 1 169 ? 42.057 6.892   -11.685 1.00 34.42  ? 210 GLY C O   1 
ATOM   5488 N  N   . GLU C 1 170 ? 42.680 8.812   -12.641 1.00 34.21  ? 211 GLU C N   1 
ATOM   5489 C  CA  . GLU C 1 170 ? 44.089 8.457   -12.667 1.00 36.72  ? 211 GLU C CA  1 
ATOM   5490 C  C   . GLU C 1 170 ? 44.694 8.601   -11.287 1.00 40.02  ? 211 GLU C C   1 
ATOM   5491 O  O   . GLU C 1 170 ? 44.369 9.544   -10.566 1.00 37.01  ? 211 GLU C O   1 
ATOM   5492 C  CB  . GLU C 1 170 ? 44.823 9.358   -13.659 1.00 39.73  ? 211 GLU C CB  1 
ATOM   5493 C  CG  . GLU C 1 170 ? 44.203 9.348   -15.050 1.00 42.71  ? 211 GLU C CG  1 
ATOM   5494 C  CD  . GLU C 1 170 ? 44.772 10.440  -15.947 1.00 52.18  ? 211 GLU C CD  1 
ATOM   5495 O  OE1 . GLU C 1 170 ? 44.691 10.299  -17.193 1.00 58.11  ? 211 GLU C OE1 1 
ATOM   5496 O  OE2 . GLU C 1 170 ? 45.291 11.448  -15.405 1.00 47.41  ? 211 GLU C OE2 1 
ATOM   5497 N  N   . LEU C 1 171 ? 45.582 7.664   -10.943 1.00 35.99  ? 212 LEU C N   1 
ATOM   5498 C  CA  . LEU C 1 171 ? 46.257 7.613   -9.652  1.00 35.01  ? 212 LEU C CA  1 
ATOM   5499 C  C   . LEU C 1 171 ? 47.260 8.755   -9.474  1.00 38.06  ? 212 LEU C C   1 
ATOM   5500 O  O   . LEU C 1 171 ? 48.166 8.946   -10.287 1.00 33.49  ? 212 LEU C O   1 
ATOM   5501 C  CB  . LEU C 1 171 ? 46.991 6.277   -9.493  1.00 26.62  ? 212 LEU C CB  1 
ATOM   5502 C  CG  . LEU C 1 171 ? 47.700 6.055   -8.161  1.00 29.71  ? 212 LEU C CG  1 
ATOM   5503 C  CD1 . LEU C 1 171 ? 46.677 5.828   -7.008  1.00 24.16  ? 212 LEU C CD1 1 
ATOM   5504 C  CD2 . LEU C 1 171 ? 48.598 4.836   -8.309  1.00 36.44  ? 212 LEU C CD2 1 
HETATM 5505 N  N   . MSE C 1 172 ? 47.095 9.489   -8.379  1.00 32.44  ? 213 MSE C N   1 
HETATM 5506 C  CA  . MSE C 1 172 ? 47.956 10.608  -8.040  1.00 30.66  ? 213 MSE C CA  1 
HETATM 5507 C  C   . MSE C 1 172 ? 48.877 10.171  -6.918  1.00 32.07  ? 213 MSE C C   1 
HETATM 5508 O  O   . MSE C 1 172 ? 50.025 10.607  -6.820  1.00 30.34  ? 213 MSE C O   1 
HETATM 5509 C  CB  . MSE C 1 172 ? 47.089 11.786  -7.574  1.00 36.77  ? 213 MSE C CB  1 
HETATM 5510 C  CG  . MSE C 1 172 ? 46.249 12.364  -8.701  1.00 39.94  ? 213 MSE C CG  1 
HETATM 5511 SE SE  . MSE C 1 172 ? 47.343 13.288  -10.042 1.00 59.37  ? 213 MSE C SE  1 
HETATM 5512 C  CE  . MSE C 1 172 ? 46.681 15.083  -9.792  1.00 60.32  ? 213 MSE C CE  1 
ATOM   5513 N  N   . GLY C 1 173 ? 48.361 9.308   -6.053  1.00 29.25  ? 214 GLY C N   1 
ATOM   5514 C  CA  . GLY C 1 173 ? 49.181 8.850   -4.950  1.00 27.84  ? 214 GLY C CA  1 
ATOM   5515 C  C   . GLY C 1 173 ? 48.507 7.782   -4.119  1.00 30.19  ? 214 GLY C C   1 
ATOM   5516 O  O   . GLY C 1 173 ? 47.340 7.404   -4.376  1.00 28.89  ? 214 GLY C O   1 
ATOM   5517 N  N   . ILE C 1 174 ? 49.247 7.299   -3.125  1.00 30.66  ? 215 ILE C N   1 
ATOM   5518 C  CA  . ILE C 1 174 ? 48.757 6.293   -2.192  1.00 33.86  ? 215 ILE C CA  1 
ATOM   5519 C  C   . ILE C 1 174 ? 48.581 6.979   -0.830  1.00 33.87  ? 215 ILE C C   1 
ATOM   5520 O  O   . ILE C 1 174 ? 49.529 7.549   -0.285  1.00 30.96  ? 215 ILE C O   1 
ATOM   5521 C  CB  . ILE C 1 174 ? 49.788 5.115   -2.015  1.00 36.25  ? 215 ILE C CB  1 
ATOM   5522 C  CG1 . ILE C 1 174 ? 50.094 4.446   -3.370  1.00 34.00  ? 215 ILE C CG1 1 
ATOM   5523 C  CG2 . ILE C 1 174 ? 49.192 4.070   -1.066  1.00 22.66  ? 215 ILE C CG2 1 
ATOM   5524 C  CD1 . ILE C 1 174 ? 48.892 3.752   -3.969  1.00 30.91  ? 215 ILE C CD1 1 
ATOM   5525 N  N   . ASN C 1 175 ? 47.385 6.905   -0.262  1.00 36.48  ? 216 ASN C N   1 
ATOM   5526 C  CA  . ASN C 1 175 ? 47.156 7.553   1.026   1.00 42.91  ? 216 ASN C CA  1 
ATOM   5527 C  C   . ASN C 1 175 ? 47.935 6.849   2.129   1.00 46.75  ? 216 ASN C C   1 
ATOM   5528 O  O   . ASN C 1 175 ? 47.976 5.619   2.194   1.00 41.20  ? 216 ASN C O   1 
ATOM   5529 C  CB  . ASN C 1 175 ? 45.646 7.568   1.358   1.00 45.98  ? 216 ASN C CB  1 
ATOM   5530 C  CG  . ASN C 1 175 ? 44.783 8.106   0.194   1.00 48.81  ? 216 ASN C CG  1 
ATOM   5531 O  OD1 . ASN C 1 175 ? 43.782 7.489   -0.207  1.00 48.40  ? 216 ASN C OD1 1 
ATOM   5532 N  ND2 . ASN C 1 175 ? 45.172 9.252   -0.343  1.00 48.46  ? 216 ASN C ND2 1 
ATOM   5533 N  N   . THR C 1 176 ? 48.583 7.638   2.977   1.00 53.58  ? 217 THR C N   1 
ATOM   5534 C  CA  . THR C 1 176 ? 49.335 7.114   4.108   1.00 60.36  ? 217 THR C CA  1 
ATOM   5535 C  C   . THR C 1 176 ? 49.007 8.016   5.289   1.00 65.46  ? 217 THR C C   1 
ATOM   5536 O  O   . THR C 1 176 ? 48.872 9.215   5.122   1.00 64.90  ? 217 THR C O   1 
ATOM   5537 C  CB  . THR C 1 176 ? 50.850 7.153   3.861   1.00 63.60  ? 217 THR C CB  1 
ATOM   5538 O  OG1 . THR C 1 176 ? 51.538 6.673   5.028   1.00 67.45  ? 217 THR C OG1 1 
ATOM   5539 C  CG2 . THR C 1 176 ? 51.299 8.567   3.568   1.00 66.74  ? 217 THR C CG2 1 
ATOM   5540 N  N   . LEU C 1 177 ? 48.875 7.449   6.481   1.00 76.29  ? 218 LEU C N   1 
ATOM   5541 C  CA  . LEU C 1 177 ? 48.552 8.260   7.643   1.00 82.47  ? 218 LEU C CA  1 
ATOM   5542 C  C   . LEU C 1 177 ? 49.696 9.168   8.078   1.00 90.44  ? 218 LEU C C   1 
ATOM   5543 O  O   . LEU C 1 177 ? 49.519 10.388  8.174   1.00 93.57  ? 218 LEU C O   1 
ATOM   5544 C  CB  . LEU C 1 177 ? 48.075 7.369   8.787   1.00 80.21  ? 218 LEU C CB  1 
ATOM   5545 C  CG  . LEU C 1 177 ? 46.595 7.019   8.562   1.00 81.61  ? 218 LEU C CG  1 
ATOM   5546 C  CD1 . LEU C 1 177 ? 46.151 5.889   9.467   1.00 84.92  ? 218 LEU C CD1 1 
ATOM   5547 C  CD2 . LEU C 1 177 ? 45.751 8.261   8.803   1.00 78.77  ? 218 LEU C CD2 1 
ATOM   5548 N  N   . SER C 1 178 ? 50.868 8.598   8.327   1.00 96.34  ? 219 SER C N   1 
ATOM   5549 C  CA  . SER C 1 178 ? 52.012 9.412   8.728   1.00 101.00 ? 219 SER C CA  1 
ATOM   5550 C  C   . SER C 1 178 ? 53.209 8.567   9.083   1.00 103.99 ? 219 SER C C   1 
ATOM   5551 O  O   . SER C 1 178 ? 53.078 7.548   9.765   1.00 104.98 ? 219 SER C O   1 
ATOM   5552 C  CB  . SER C 1 178 ? 51.666 10.309  9.923   1.00 102.83 ? 219 SER C CB  1 
ATOM   5553 O  OG  . SER C 1 178 ? 51.189 11.571  9.494   1.00 102.81 ? 219 SER C OG  1 
ATOM   5554 N  N   . PHE C 1 179 ? 54.375 9.018   8.624   1.00 105.58 ? 220 PHE C N   1 
ATOM   5555 C  CA  . PHE C 1 179 ? 55.652 8.343   8.858   1.00 106.33 ? 220 PHE C CA  1 
ATOM   5556 C  C   . PHE C 1 179 ? 56.598 8.702   7.724   1.00 107.21 ? 220 PHE C C   1 
ATOM   5557 O  O   . PHE C 1 179 ? 56.637 8.025   6.696   1.00 105.10 ? 220 PHE C O   1 
ATOM   5558 C  CB  . PHE C 1 179 ? 55.470 6.812   8.919   1.00 105.46 ? 220 PHE C CB  1 
ATOM   5559 C  CG  . PHE C 1 179 ? 55.662 6.217   10.300  1.00 102.13 ? 220 PHE C CG  1 
ATOM   5560 C  CD1 . PHE C 1 179 ? 55.061 4.998   10.636  1.00 101.26 ? 220 PHE C CD1 1 
ATOM   5561 C  CD2 . PHE C 1 179 ? 56.454 6.861   11.254  1.00 99.69  ? 220 PHE C CD2 1 
ATOM   5562 C  CE1 . PHE C 1 179 ? 55.246 4.431   11.905  1.00 98.90  ? 220 PHE C CE1 1 
ATOM   5563 C  CE2 . PHE C 1 179 ? 56.646 6.304   12.523  1.00 99.86  ? 220 PHE C CE2 1 
ATOM   5564 C  CZ  . PHE C 1 179 ? 56.041 5.086   12.848  1.00 100.76 ? 220 PHE C CZ  1 
ATOM   5565 N  N   . ASP C 1 180 ? 57.348 9.780   7.924   1.00 109.48 ? 221 ASP C N   1 
ATOM   5566 C  CA  . ASP C 1 180 ? 58.320 10.261  6.947   1.00 110.50 ? 221 ASP C CA  1 
ATOM   5567 C  C   . ASP C 1 180 ? 59.006 9.111   6.206   1.00 109.68 ? 221 ASP C C   1 
ATOM   5568 O  O   . ASP C 1 180 ? 59.131 7.999   6.734   1.00 106.39 ? 221 ASP C O   1 
ATOM   5569 C  CB  . ASP C 1 180 ? 59.379 11.112  7.655   1.00 112.99 ? 221 ASP C CB  1 
ATOM   5570 C  CG  . ASP C 1 180 ? 60.380 10.276  8.441   1.00 114.83 ? 221 ASP C CG  1 
ATOM   5571 O  OD1 . ASP C 1 180 ? 59.950 9.388   9.212   1.00 116.21 ? 221 ASP C OD1 1 
ATOM   5572 O  OD2 . ASP C 1 180 ? 61.600 10.518  8.293   1.00 114.25 ? 221 ASP C OD2 1 
ATOM   5573 N  N   . GLU C 1 189 ? 45.912 17.844  11.045  1.00 95.28  ? 230 GLU C N   1 
ATOM   5574 C  CA  . GLU C 1 189 ? 44.606 18.473  11.213  1.00 95.50  ? 230 GLU C CA  1 
ATOM   5575 C  C   . GLU C 1 189 ? 44.210 19.208  9.926   1.00 94.58  ? 230 GLU C C   1 
ATOM   5576 O  O   . GLU C 1 189 ? 44.748 20.276  9.608   1.00 95.11  ? 230 GLU C O   1 
ATOM   5577 C  CB  . GLU C 1 189 ? 44.637 19.449  12.404  1.00 97.12  ? 230 GLU C CB  1 
ATOM   5578 C  CG  . GLU C 1 189 ? 45.313 20.801  12.129  1.00 97.81  ? 230 GLU C CG  1 
ATOM   5579 C  CD  . GLU C 1 189 ? 46.754 20.669  11.651  1.00 98.55  ? 230 GLU C CD  1 
ATOM   5580 O  OE1 . GLU C 1 189 ? 47.199 21.539  10.862  1.00 92.61  ? 230 GLU C OE1 1 
ATOM   5581 O  OE2 . GLU C 1 189 ? 47.439 19.705  12.071  1.00 94.60  ? 230 GLU C OE2 1 
ATOM   5582 N  N   . GLY C 1 190 ? 43.278 18.623  9.176   1.00 91.20  ? 231 GLY C N   1 
ATOM   5583 C  CA  . GLY C 1 190 ? 42.834 19.236  7.934   1.00 85.15  ? 231 GLY C CA  1 
ATOM   5584 C  C   . GLY C 1 190 ? 43.606 18.785  6.699   1.00 81.45  ? 231 GLY C C   1 
ATOM   5585 O  O   . GLY C 1 190 ? 43.060 18.788  5.592   1.00 82.17  ? 231 GLY C O   1 
ATOM   5586 N  N   . ILE C 1 191 ? 44.871 18.400  6.873   1.00 73.95  ? 232 ILE C N   1 
ATOM   5587 C  CA  . ILE C 1 191 ? 45.679 17.955  5.742   1.00 66.91  ? 232 ILE C CA  1 
ATOM   5588 C  C   . ILE C 1 191 ? 46.154 16.513  5.877   1.00 61.22  ? 232 ILE C C   1 
ATOM   5589 O  O   . ILE C 1 191 ? 46.602 16.070  6.941   1.00 58.84  ? 232 ILE C O   1 
ATOM   5590 C  CB  . ILE C 1 191 ? 46.901 18.907  5.495   1.00 67.73  ? 232 ILE C CB  1 
ATOM   5591 C  CG1 . ILE C 1 191 ? 46.789 19.546  4.100   1.00 71.54  ? 232 ILE C CG1 1 
ATOM   5592 C  CG2 . ILE C 1 191 ? 48.217 18.142  5.544   1.00 63.42  ? 232 ILE C CG2 1 
ATOM   5593 C  CD1 . ILE C 1 191 ? 45.601 20.473  3.899   1.00 66.53  ? 232 ILE C CD1 1 
ATOM   5594 N  N   . GLY C 1 192 ? 46.023 15.783  4.778   1.00 52.02  ? 233 GLY C N   1 
ATOM   5595 C  CA  . GLY C 1 192 ? 46.438 14.395  4.748   1.00 45.62  ? 233 GLY C CA  1 
ATOM   5596 C  C   . GLY C 1 192 ? 47.612 14.248  3.811   1.00 41.97  ? 233 GLY C C   1 
ATOM   5597 O  O   . GLY C 1 192 ? 47.872 15.118  2.977   1.00 39.58  ? 233 GLY C O   1 
ATOM   5598 N  N   . PHE C 1 193 ? 48.333 13.148  3.955   1.00 40.77  ? 234 PHE C N   1 
ATOM   5599 C  CA  . PHE C 1 193 ? 49.500 12.894  3.126   1.00 43.10  ? 234 PHE C CA  1 
ATOM   5600 C  C   . PHE C 1 193 ? 49.339 11.654  2.236   1.00 41.37  ? 234 PHE C C   1 
ATOM   5601 O  O   . PHE C 1 193 ? 48.605 10.729  2.559   1.00 36.00  ? 234 PHE C O   1 
ATOM   5602 C  CB  . PHE C 1 193 ? 50.718 12.732  4.017   1.00 37.36  ? 234 PHE C CB  1 
ATOM   5603 C  CG  . PHE C 1 193 ? 50.983 13.927  4.889   1.00 41.92  ? 234 PHE C CG  1 
ATOM   5604 C  CD1 . PHE C 1 193 ? 50.345 14.067  6.119   1.00 46.00  ? 234 PHE C CD1 1 
ATOM   5605 C  CD2 . PHE C 1 193 ? 51.878 14.912  4.481   1.00 39.55  ? 234 PHE C CD2 1 
ATOM   5606 C  CE1 . PHE C 1 193 ? 50.596 15.173  6.936   1.00 45.22  ? 234 PHE C CE1 1 
ATOM   5607 C  CE2 . PHE C 1 193 ? 52.133 16.020  5.293   1.00 43.19  ? 234 PHE C CE2 1 
ATOM   5608 C  CZ  . PHE C 1 193 ? 51.494 16.150  6.518   1.00 36.53  ? 234 PHE C CZ  1 
ATOM   5609 N  N   . ALA C 1 194 ? 50.021 11.658  1.105   1.00 37.21  ? 235 ALA C N   1 
ATOM   5610 C  CA  . ALA C 1 194 ? 49.965 10.523  0.210   1.00 38.89  ? 235 ALA C CA  1 
ATOM   5611 C  C   . ALA C 1 194 ? 51.328 10.406  -0.443  1.00 36.92  ? 235 ALA C C   1 
ATOM   5612 O  O   . ALA C 1 194 ? 52.031 11.409  -0.543  1.00 32.76  ? 235 ALA C O   1 
ATOM   5613 C  CB  . ALA C 1 194 ? 48.906 10.735  -0.827  1.00 38.34  ? 235 ALA C CB  1 
ATOM   5614 N  N   . ILE C 1 195 ? 51.743 9.198   -0.839  1.00 35.24  ? 236 ILE C N   1 
ATOM   5615 C  CA  . ILE C 1 195 ? 53.040 9.088   -1.531  1.00 30.39  ? 236 ILE C CA  1 
ATOM   5616 C  C   . ILE C 1 195 ? 52.760 9.399   -2.982  1.00 26.36  ? 236 ILE C C   1 
ATOM   5617 O  O   . ILE C 1 195 ? 51.856 8.822   -3.573  1.00 30.57  ? 236 ILE C O   1 
ATOM   5618 C  CB  . ILE C 1 195 ? 53.647 7.667   -1.420  1.00 36.09  ? 236 ILE C CB  1 
ATOM   5619 C  CG1 . ILE C 1 195 ? 54.015 7.393   0.033   1.00 33.71  ? 236 ILE C CG1 1 
ATOM   5620 C  CG2 . ILE C 1 195 ? 54.871 7.528   -2.337  1.00 33.35  ? 236 ILE C CG2 1 
ATOM   5621 C  CD1 . ILE C 1 195 ? 53.101 6.383   0.645   1.00 49.67  ? 236 ILE C CD1 1 
ATOM   5622 N  N   . PRO C 1 196 ? 53.502 10.329  -3.582  1.00 27.65  ? 237 PRO C N   1 
ATOM   5623 C  CA  . PRO C 1 196 ? 53.207 10.618  -4.998  1.00 32.58  ? 237 PRO C CA  1 
ATOM   5624 C  C   . PRO C 1 196 ? 53.263 9.323   -5.802  1.00 31.51  ? 237 PRO C C   1 
ATOM   5625 O  O   . PRO C 1 196 ? 54.124 8.462   -5.555  1.00 36.55  ? 237 PRO C O   1 
ATOM   5626 C  CB  . PRO C 1 196 ? 54.312 11.611  -5.409  1.00 26.41  ? 237 PRO C CB  1 
ATOM   5627 C  CG  . PRO C 1 196 ? 54.745 12.233  -4.091  1.00 34.29  ? 237 PRO C CG  1 
ATOM   5628 C  CD  . PRO C 1 196 ? 54.672 11.085  -3.098  1.00 33.29  ? 237 PRO C CD  1 
ATOM   5629 N  N   . PHE C 1 197 ? 52.390 9.197   -6.784  1.00 34.28  ? 238 PHE C N   1 
ATOM   5630 C  CA  . PHE C 1 197 ? 52.348 7.967   -7.545  1.00 39.93  ? 238 PHE C CA  1 
ATOM   5631 C  C   . PHE C 1 197 ? 53.642 7.627   -8.269  1.00 42.83  ? 238 PHE C C   1 
ATOM   5632 O  O   . PHE C 1 197 ? 53.912 6.457   -8.501  1.00 42.67  ? 238 PHE C O   1 
ATOM   5633 C  CB  . PHE C 1 197 ? 51.157 7.980   -8.512  1.00 40.96  ? 238 PHE C CB  1 
ATOM   5634 C  CG  . PHE C 1 197 ? 51.429 8.642   -9.841  1.00 50.95  ? 238 PHE C CG  1 
ATOM   5635 C  CD1 . PHE C 1 197 ? 51.982 7.910   -10.900 1.00 42.72  ? 238 PHE C CD1 1 
ATOM   5636 C  CD2 . PHE C 1 197 ? 51.073 9.984   -10.058 1.00 49.17  ? 238 PHE C CD2 1 
ATOM   5637 C  CE1 . PHE C 1 197 ? 52.171 8.503   -12.159 1.00 46.75  ? 238 PHE C CE1 1 
ATOM   5638 C  CE2 . PHE C 1 197 ? 51.256 10.592  -11.314 1.00 42.62  ? 238 PHE C CE2 1 
ATOM   5639 C  CZ  . PHE C 1 197 ? 51.806 9.852   -12.369 1.00 49.40  ? 238 PHE C CZ  1 
ATOM   5640 N  N   . GLN C 1 198 ? 54.453 8.629   -8.609  1.00 44.54  ? 239 GLN C N   1 
ATOM   5641 C  CA  . GLN C 1 198 ? 55.697 8.345   -9.319  1.00 43.56  ? 239 GLN C CA  1 
ATOM   5642 C  C   . GLN C 1 198 ? 56.686 7.673   -8.370  1.00 46.27  ? 239 GLN C C   1 
ATOM   5643 O  O   . GLN C 1 198 ? 57.458 6.821   -8.784  1.00 46.07  ? 239 GLN C O   1 
ATOM   5644 C  CB  . GLN C 1 198 ? 56.301 9.624   -9.919  1.00 41.55  ? 239 GLN C CB  1 
ATOM   5645 C  CG  . GLN C 1 198 ? 55.326 10.441  -10.795 1.00 43.59  ? 239 GLN C CG  1 
ATOM   5646 C  CD  . GLN C 1 198 ? 54.702 11.619  -10.035 1.00 49.91  ? 239 GLN C CD  1 
ATOM   5647 O  OE1 . GLN C 1 198 ? 54.876 12.781  -10.426 1.00 50.71  ? 239 GLN C OE1 1 
ATOM   5648 N  NE2 . GLN C 1 198 ? 53.993 11.324  -8.938  1.00 37.15  ? 239 GLN C NE2 1 
ATOM   5649 N  N   . LEU C 1 199 ? 56.651 8.054   -7.093  1.00 47.58  ? 240 LEU C N   1 
ATOM   5650 C  CA  . LEU C 1 199 ? 57.530 7.449   -6.102  1.00 46.83  ? 240 LEU C CA  1 
ATOM   5651 C  C   . LEU C 1 199 ? 57.005 6.041   -5.770  1.00 43.26  ? 240 LEU C C   1 
ATOM   5652 O  O   . LEU C 1 199 ? 57.792 5.121   -5.585  1.00 43.28  ? 240 LEU C O   1 
ATOM   5653 C  CB  . LEU C 1 199 ? 57.562 8.273   -4.806  1.00 40.46  ? 240 LEU C CB  1 
ATOM   5654 C  CG  . LEU C 1 199 ? 58.847 8.411   -3.975  1.00 53.67  ? 240 LEU C CG  1 
ATOM   5655 C  CD1 . LEU C 1 199 ? 58.520 8.606   -2.485  1.00 48.03  ? 240 LEU C CD1 1 
ATOM   5656 C  CD2 . LEU C 1 199 ? 59.728 7.205   -4.166  1.00 38.90  ? 240 LEU C CD2 1 
ATOM   5657 N  N   . ALA C 1 200 ? 55.682 5.883   -5.700  1.00 40.33  ? 241 ALA C N   1 
ATOM   5658 C  CA  . ALA C 1 200 ? 55.086 4.592   -5.360  1.00 40.06  ? 241 ALA C CA  1 
ATOM   5659 C  C   . ALA C 1 200 ? 55.446 3.565   -6.414  1.00 40.95  ? 241 ALA C C   1 
ATOM   5660 O  O   . ALA C 1 200 ? 55.765 2.426   -6.101  1.00 38.42  ? 241 ALA C O   1 
ATOM   5661 C  CB  . ALA C 1 200 ? 53.580 4.707   -5.246  1.00 37.70  ? 241 ALA C CB  1 
ATOM   5662 N  N   . THR C 1 201 ? 55.377 3.975   -7.668  1.00 36.71  ? 242 THR C N   1 
ATOM   5663 C  CA  . THR C 1 201 ? 55.736 3.113   -8.788  1.00 38.00  ? 242 THR C CA  1 
ATOM   5664 C  C   . THR C 1 201 ? 57.217 2.673   -8.714  1.00 40.98  ? 242 THR C C   1 
ATOM   5665 O  O   . THR C 1 201 ? 57.525 1.496   -8.890  1.00 38.89  ? 242 THR C O   1 
ATOM   5666 C  CB  . THR C 1 201 ? 55.470 3.853   -10.086 1.00 37.01  ? 242 THR C CB  1 
ATOM   5667 O  OG1 . THR C 1 201 ? 54.057 4.012   -10.223 1.00 48.28  ? 242 THR C OG1 1 
ATOM   5668 C  CG2 . THR C 1 201 ? 56.019 3.092   -11.288 1.00 47.90  ? 242 THR C CG2 1 
ATOM   5669 N  N   . LYS C 1 202 ? 58.122 3.611   -8.427  1.00 40.59  ? 243 LYS C N   1 
ATOM   5670 C  CA  . LYS C 1 202 ? 59.546 3.281   -8.329  1.00 45.37  ? 243 LYS C CA  1 
ATOM   5671 C  C   . LYS C 1 202 ? 59.828 2.352   -7.148  1.00 42.90  ? 243 LYS C C   1 
ATOM   5672 O  O   . LYS C 1 202 ? 60.673 1.471   -7.235  1.00 47.06  ? 243 LYS C O   1 
ATOM   5673 C  CB  . LYS C 1 202 ? 60.406 4.532   -8.145  1.00 43.62  ? 243 LYS C CB  1 
ATOM   5674 C  CG  . LYS C 1 202 ? 60.359 5.544   -9.265  1.00 59.52  ? 243 LYS C CG  1 
ATOM   5675 C  CD  . LYS C 1 202 ? 61.231 6.754   -8.911  1.00 69.01  ? 243 LYS C CD  1 
ATOM   5676 C  CE  . LYS C 1 202 ? 61.048 7.901   -9.907  1.00 73.97  ? 243 LYS C CE  1 
ATOM   5677 N  NZ  . LYS C 1 202 ? 61.861 9.100   -9.535  1.00 75.35  ? 243 LYS C NZ  1 
ATOM   5678 N  N   . ILE C 1 203 ? 59.139 2.583   -6.038  1.00 40.26  ? 244 ILE C N   1 
ATOM   5679 C  CA  . ILE C 1 203 ? 59.312 1.782   -4.836  1.00 38.92  ? 244 ILE C CA  1 
ATOM   5680 C  C   . ILE C 1 203 ? 58.815 0.365   -5.124  1.00 37.86  ? 244 ILE C C   1 
ATOM   5681 O  O   . ILE C 1 203 ? 59.495 -0.599  -4.839  1.00 41.30  ? 244 ILE C O   1 
ATOM   5682 C  CB  . ILE C 1 203 ? 58.498 2.377   -3.654  1.00 36.56  ? 244 ILE C CB  1 
ATOM   5683 C  CG1 . ILE C 1 203 ? 59.124 3.700   -3.215  1.00 42.38  ? 244 ILE C CG1 1 
ATOM   5684 C  CG2 . ILE C 1 203 ? 58.370 1.370   -2.504  1.00 35.18  ? 244 ILE C CG2 1 
ATOM   5685 C  CD1 . ILE C 1 203 ? 60.541 3.603   -2.665  1.00 41.14  ? 244 ILE C CD1 1 
HETATM 5686 N  N   . MSE C 1 204 ? 57.628 0.242   -5.696  1.00 37.02  ? 245 MSE C N   1 
HETATM 5687 C  CA  . MSE C 1 204 ? 57.081 -1.078  -5.984  1.00 42.20  ? 245 MSE C CA  1 
HETATM 5688 C  C   . MSE C 1 204 ? 58.041 -1.919  -6.855  1.00 40.06  ? 245 MSE C C   1 
HETATM 5689 O  O   . MSE C 1 204 ? 58.342 -3.060  -6.512  1.00 39.84  ? 245 MSE C O   1 
HETATM 5690 C  CB  . MSE C 1 204 ? 55.707 -0.949  -6.648  1.00 33.50  ? 245 MSE C CB  1 
HETATM 5691 C  CG  . MSE C 1 204 ? 55.293 -2.199  -7.367  1.00 49.45  ? 245 MSE C CG  1 
HETATM 5692 SE SE  . MSE C 1 204 ? 53.472 -2.148  -7.988  1.00 50.79  ? 245 MSE C SE  1 
HETATM 5693 C  CE  . MSE C 1 204 ? 53.730 -1.004  -9.545  1.00 51.54  ? 245 MSE C CE  1 
ATOM   5694 N  N   . ASP C 1 205 ? 58.548 -1.350  -7.947  1.00 41.69  ? 246 ASP C N   1 
ATOM   5695 C  CA  . ASP C 1 205 ? 59.479 -2.084  -8.815  1.00 39.35  ? 246 ASP C CA  1 
ATOM   5696 C  C   . ASP C 1 205 ? 60.753 -2.503  -8.086  1.00 40.79  ? 246 ASP C C   1 
ATOM   5697 O  O   . ASP C 1 205 ? 61.239 -3.599  -8.287  1.00 36.96  ? 246 ASP C O   1 
ATOM   5698 C  CB  . ASP C 1 205 ? 59.837 -1.259  -10.038 1.00 42.71  ? 246 ASP C CB  1 
ATOM   5699 C  CG  . ASP C 1 205 ? 58.632 -0.998  -10.933 1.00 57.08  ? 246 ASP C CG  1 
ATOM   5700 O  OD1 . ASP C 1 205 ? 57.793 -1.928  -11.108 1.00 58.69  ? 246 ASP C OD1 1 
ATOM   5701 O  OD2 . ASP C 1 205 ? 58.537 0.133   -11.476 1.00 58.56  ? 246 ASP C OD2 1 
ATOM   5702 N  N   . LYS C 1 206 ? 61.301 -1.638  -7.236  1.00 40.32  ? 247 LYS C N   1 
ATOM   5703 C  CA  . LYS C 1 206 ? 62.494 -2.009  -6.500  1.00 40.97  ? 247 LYS C CA  1 
ATOM   5704 C  C   . LYS C 1 206 ? 62.215 -3.153  -5.525  1.00 39.40  ? 247 LYS C C   1 
ATOM   5705 O  O   . LYS C 1 206 ? 63.086 -3.999  -5.287  1.00 42.87  ? 247 LYS C O   1 
ATOM   5706 C  CB  . LYS C 1 206 ? 63.072 -0.801  -5.763  1.00 42.90  ? 247 LYS C CB  1 
ATOM   5707 C  CG  . LYS C 1 206 ? 63.627 0.244   -6.736  1.00 44.33  ? 247 LYS C CG  1 
ATOM   5708 C  CD  . LYS C 1 206 ? 64.247 1.414   -6.015  1.00 54.89  ? 247 LYS C CD  1 
ATOM   5709 C  CE  . LYS C 1 206 ? 65.059 2.257   -6.987  1.00 67.19  ? 247 LYS C CE  1 
ATOM   5710 N  NZ  . LYS C 1 206 ? 66.142 1.472   -7.669  1.00 68.98  ? 247 LYS C NZ  1 
ATOM   5711 N  N   . LEU C 1 207 ? 61.007 -3.184  -4.972  1.00 35.30  ? 248 LEU C N   1 
ATOM   5712 C  CA  . LEU C 1 207 ? 60.614 -4.243  -4.043  1.00 38.01  ? 248 LEU C CA  1 
ATOM   5713 C  C   . LEU C 1 207 ? 60.403 -5.570  -4.772  1.00 35.90  ? 248 LEU C C   1 
ATOM   5714 O  O   . LEU C 1 207 ? 60.619 -6.630  -4.207  1.00 37.03  ? 248 LEU C O   1 
ATOM   5715 C  CB  . LEU C 1 207 ? 59.317 -3.869  -3.323  1.00 33.91  ? 248 LEU C CB  1 
ATOM   5716 C  CG  . LEU C 1 207 ? 59.514 -2.842  -2.216  1.00 41.66  ? 248 LEU C CG  1 
ATOM   5717 C  CD1 . LEU C 1 207 ? 58.148 -2.497  -1.596  1.00 32.75  ? 248 LEU C CD1 1 
ATOM   5718 C  CD2 . LEU C 1 207 ? 60.486 -3.418  -1.163  1.00 31.31  ? 248 LEU C CD2 1 
ATOM   5719 N  N   . ILE C 1 208 ? 59.932 -5.500  -6.011  1.00 33.73  ? 249 ILE C N   1 
ATOM   5720 C  CA  . ILE C 1 208 ? 59.708 -6.687  -6.801  1.00 36.53  ? 249 ILE C CA  1 
ATOM   5721 C  C   . ILE C 1 208 ? 61.092 -7.249  -7.182  1.00 45.92  ? 249 ILE C C   1 
ATOM   5722 O  O   . ILE C 1 208 ? 61.325 -8.453  -7.085  1.00 47.64  ? 249 ILE C O   1 
ATOM   5723 C  CB  . ILE C 1 208 ? 58.914 -6.344  -8.096  1.00 38.48  ? 249 ILE C CB  1 
ATOM   5724 C  CG1 . ILE C 1 208 ? 57.432 -6.118  -7.756  1.00 31.29  ? 249 ILE C CG1 1 
ATOM   5725 C  CG2 . ILE C 1 208 ? 59.074 -7.469  -9.162  1.00 28.69  ? 249 ILE C CG2 1 
ATOM   5726 C  CD1 . ILE C 1 208 ? 56.581 -5.665  -8.975  1.00 33.90  ? 249 ILE C CD1 1 
ATOM   5727 N  N   . ARG C 1 209 ? 62.004 -6.360  -7.579  1.00 43.85  ? 250 ARG C N   1 
ATOM   5728 C  CA  . ARG C 1 209 ? 63.349 -6.739  -8.015  1.00 48.20  ? 250 ARG C CA  1 
ATOM   5729 C  C   . ARG C 1 209 ? 64.250 -7.288  -6.914  1.00 49.18  ? 250 ARG C C   1 
ATOM   5730 O  O   . ARG C 1 209 ? 64.884 -8.317  -7.101  1.00 48.87  ? 250 ARG C O   1 
ATOM   5731 C  CB  . ARG C 1 209 ? 64.085 -5.540  -8.622  1.00 49.60  ? 250 ARG C CB  1 
ATOM   5732 C  CG  . ARG C 1 209 ? 63.585 -5.014  -9.950  1.00 54.20  ? 250 ARG C CG  1 
ATOM   5733 C  CD  . ARG C 1 209 ? 64.368 -3.721  -10.289 1.00 61.53  ? 250 ARG C CD  1 
ATOM   5734 N  NE  . ARG C 1 209 ? 65.805 -3.962  -10.443 1.00 59.32  ? 250 ARG C NE  1 
ATOM   5735 C  CZ  . ARG C 1 209 ? 66.342 -4.604  -11.483 1.00 60.44  ? 250 ARG C CZ  1 
ATOM   5736 N  NH1 . ARG C 1 209 ? 65.553 -5.054  -12.455 1.00 58.60  ? 250 ARG C NH1 1 
ATOM   5737 N  NH2 . ARG C 1 209 ? 67.655 -4.817  -11.546 1.00 47.44  ? 250 ARG C NH2 1 
ATOM   5738 N  N   . ASP C 1 210 ? 64.310 -6.595  -5.779  1.00 44.37  ? 251 ASP C N   1 
ATOM   5739 C  CA  . ASP C 1 210 ? 65.191 -6.997  -4.688  1.00 45.69  ? 251 ASP C CA  1 
ATOM   5740 C  C   . ASP C 1 210 ? 64.534 -7.434  -3.394  1.00 45.66  ? 251 ASP C C   1 
ATOM   5741 O  O   . ASP C 1 210 ? 65.217 -7.943  -2.520  1.00 51.74  ? 251 ASP C O   1 
ATOM   5742 C  CB  . ASP C 1 210 ? 66.180 -5.868  -4.355  1.00 48.14  ? 251 ASP C CB  1 
ATOM   5743 C  CG  . ASP C 1 210 ? 66.811 -5.233  -5.602  1.00 57.11  ? 251 ASP C CG  1 
ATOM   5744 O  OD1 . ASP C 1 210 ? 67.375 -5.975  -6.443  1.00 62.33  ? 251 ASP C OD1 1 
ATOM   5745 O  OD2 . ASP C 1 210 ? 66.752 -3.987  -5.734  1.00 58.20  ? 251 ASP C OD2 1 
ATOM   5746 N  N   . GLY C 1 211 ? 63.229 -7.232  -3.239  1.00 42.38  ? 252 GLY C N   1 
ATOM   5747 C  CA  . GLY C 1 211 ? 62.597 -7.650  -2.000  1.00 37.79  ? 252 GLY C CA  1 
ATOM   5748 C  C   . GLY C 1 211 ? 62.725 -6.617  -0.895  1.00 40.48  ? 252 GLY C C   1 
ATOM   5749 O  O   . GLY C 1 211 ? 62.251 -6.821  0.220   1.00 46.38  ? 252 GLY C O   1 
ATOM   5750 N  N   . ARG C 1 212 ? 63.386 -5.509  -1.200  1.00 41.33  ? 253 ARG C N   1 
ATOM   5751 C  CA  . ARG C 1 212 ? 63.543 -4.413  -0.255  1.00 47.77  ? 253 ARG C CA  1 
ATOM   5752 C  C   . ARG C 1 212 ? 64.023 -3.230  -1.083  1.00 51.30  ? 253 ARG C C   1 
ATOM   5753 O  O   . ARG C 1 212 ? 64.498 -3.409  -2.218  1.00 49.29  ? 253 ARG C O   1 
ATOM   5754 C  CB  . ARG C 1 212 ? 64.552 -4.767  0.851   1.00 52.35  ? 253 ARG C CB  1 
ATOM   5755 C  CG  . ARG C 1 212 ? 66.007 -4.919  0.411   1.00 59.88  ? 253 ARG C CG  1 
ATOM   5756 C  CD  . ARG C 1 212 ? 66.882 -5.416  1.590   1.00 68.32  ? 253 ARG C CD  1 
ATOM   5757 N  NE  . ARG C 1 212 ? 68.299 -5.073  1.438   1.00 74.85  ? 253 ARG C NE  1 
ATOM   5758 C  CZ  . ARG C 1 212 ? 69.126 -5.646  0.566   1.00 79.28  ? 253 ARG C CZ  1 
ATOM   5759 N  NH1 . ARG C 1 212 ? 68.687 -6.604  -0.243  1.00 80.11  ? 253 ARG C NH1 1 
ATOM   5760 N  NH2 . ARG C 1 212 ? 70.391 -5.255  0.491   1.00 77.59  ? 253 ARG C NH2 1 
ATOM   5761 N  N   . VAL C 1 213 ? 63.871 -2.022  -0.555  1.00 49.43  ? 254 VAL C N   1 
ATOM   5762 C  CA  . VAL C 1 213 ? 64.305 -0.848  -1.300  1.00 50.54  ? 254 VAL C CA  1 
ATOM   5763 C  C   . VAL C 1 213 ? 65.760 -0.563  -0.955  1.00 54.54  ? 254 VAL C C   1 
ATOM   5764 O  O   . VAL C 1 213 ? 66.101 -0.335  0.210   1.00 51.50  ? 254 VAL C O   1 
ATOM   5765 C  CB  . VAL C 1 213 ? 63.444 0.391   -0.956  1.00 54.67  ? 254 VAL C CB  1 
ATOM   5766 C  CG1 . VAL C 1 213 ? 63.939 1.597   -1.722  1.00 56.15  ? 254 VAL C CG1 1 
ATOM   5767 C  CG2 . VAL C 1 213 ? 61.991 0.129   -1.290  1.00 48.09  ? 254 VAL C CG2 1 
ATOM   5768 N  N   . ILE C 1 214 ? 66.623 -0.614  -1.962  1.00 55.76  ? 255 ILE C N   1 
ATOM   5769 C  CA  . ILE C 1 214 ? 68.034 -0.347  -1.753  1.00 55.75  ? 255 ILE C CA  1 
ATOM   5770 C  C   . ILE C 1 214 ? 68.317 1.107   -2.122  1.00 54.27  ? 255 ILE C C   1 
ATOM   5771 O  O   . ILE C 1 214 ? 68.054 1.543   -3.241  1.00 50.01  ? 255 ILE C O   1 
ATOM   5772 C  CB  . ILE C 1 214 ? 68.920 -1.306  -2.590  1.00 57.90  ? 255 ILE C CB  1 
ATOM   5773 C  CG1 . ILE C 1 214 ? 68.780 -2.735  -2.052  1.00 53.73  ? 255 ILE C CG1 1 
ATOM   5774 C  CG2 . ILE C 1 214 ? 70.393 -0.875  -2.500  1.00 58.00  ? 255 ILE C CG2 1 
ATOM   5775 C  CD1 . ILE C 1 214 ? 69.341 -3.826  -2.976  1.00 47.49  ? 255 ILE C CD1 1 
ATOM   5776 N  N   . ARG C 1 215 ? 68.857 1.852   -1.163  1.00 58.77  ? 256 ARG C N   1 
ATOM   5777 C  CA  . ARG C 1 215 ? 69.150 3.269   -1.365  1.00 62.14  ? 256 ARG C CA  1 
ATOM   5778 C  C   . ARG C 1 215 ? 70.624 3.634   -1.241  1.00 65.35  ? 256 ARG C C   1 
ATOM   5779 O  O   . ARG C 1 215 ? 71.330 3.126   -0.369  1.00 60.61  ? 256 ARG C O   1 
ATOM   5780 C  CB  . ARG C 1 215 ? 68.372 4.120   -0.353  1.00 58.42  ? 256 ARG C CB  1 
ATOM   5781 C  CG  . ARG C 1 215 ? 66.855 4.081   -0.472  1.00 57.73  ? 256 ARG C CG  1 
ATOM   5782 C  CD  . ARG C 1 215 ? 66.219 5.037   0.535   1.00 54.79  ? 256 ARG C CD  1 
ATOM   5783 N  NE  . ARG C 1 215 ? 64.806 5.252   0.245   1.00 56.14  ? 256 ARG C NE  1 
ATOM   5784 C  CZ  . ARG C 1 215 ? 63.821 4.463   0.659   1.00 49.13  ? 256 ARG C CZ  1 
ATOM   5785 N  NH1 . ARG C 1 215 ? 64.083 3.397   1.408   1.00 51.53  ? 256 ARG C NH1 1 
ATOM   5786 N  NH2 . ARG C 1 215 ? 62.576 4.720   0.288   1.00 48.83  ? 256 ARG C NH2 1 
ATOM   5787 N  N   . GLY C 1 216 ? 71.073 4.537   -2.109  1.00 69.51  ? 257 GLY C N   1 
ATOM   5788 C  CA  . GLY C 1 216 ? 72.447 4.991   -2.049  1.00 78.14  ? 257 GLY C CA  1 
ATOM   5789 C  C   . GLY C 1 216 ? 72.564 5.955   -0.883  1.00 85.84  ? 257 GLY C C   1 
ATOM   5790 O  O   . GLY C 1 216 ? 71.632 6.716   -0.601  1.00 87.27  ? 257 GLY C O   1 
ATOM   5791 N  N   . TYR C 1 217 ? 73.700 5.925   -0.195  1.00 90.56  ? 258 TYR C N   1 
ATOM   5792 C  CA  . TYR C 1 217 ? 73.926 6.799   0.950   1.00 97.94  ? 258 TYR C CA  1 
ATOM   5793 C  C   . TYR C 1 217 ? 75.362 7.302   0.973   1.00 100.92 ? 258 TYR C C   1 
ATOM   5794 O  O   . TYR C 1 217 ? 76.306 6.515   1.064   1.00 100.96 ? 258 TYR C O   1 
ATOM   5795 C  CB  . TYR C 1 217 ? 73.611 6.047   2.248   1.00 101.58 ? 258 TYR C CB  1 
ATOM   5796 C  CG  . TYR C 1 217 ? 74.005 6.763   3.524   1.00 105.22 ? 258 TYR C CG  1 
ATOM   5797 C  CD1 . TYR C 1 217 ? 73.625 8.083   3.754   1.00 106.79 ? 258 TYR C CD1 1 
ATOM   5798 C  CD2 . TYR C 1 217 ? 74.728 6.103   4.521   1.00 106.47 ? 258 TYR C CD2 1 
ATOM   5799 C  CE1 . TYR C 1 217 ? 73.950 8.729   4.945   1.00 108.67 ? 258 TYR C CE1 1 
ATOM   5800 C  CE2 . TYR C 1 217 ? 75.058 6.739   5.716   1.00 107.42 ? 258 TYR C CE2 1 
ATOM   5801 C  CZ  . TYR C 1 217 ? 74.665 8.052   5.921   1.00 109.80 ? 258 TYR C CZ  1 
ATOM   5802 O  OH  . TYR C 1 217 ? 74.972 8.689   7.103   1.00 111.74 ? 258 TYR C OH  1 
ATOM   5803 N  N   . ILE C 1 218 ? 75.515 8.619   0.886   1.00 104.14 ? 259 ILE C N   1 
ATOM   5804 C  CA  . ILE C 1 218 ? 76.831 9.239   0.898   1.00 107.08 ? 259 ILE C CA  1 
ATOM   5805 C  C   . ILE C 1 218 ? 77.086 9.821   2.286   1.00 108.38 ? 259 ILE C C   1 
ATOM   5806 O  O   . ILE C 1 218 ? 78.183 9.701   2.821   1.00 108.67 ? 259 ILE C O   1 
ATOM   5807 C  CB  . ILE C 1 218 ? 76.927 10.346  -0.193  1.00 107.43 ? 259 ILE C CB  1 
ATOM   5808 C  CG1 . ILE C 1 218 ? 78.387 10.589  -0.571  1.00 107.29 ? 259 ILE C CG1 1 
ATOM   5809 C  CG2 . ILE C 1 218 ? 76.296 11.639  0.302   1.00 108.80 ? 259 ILE C CG2 1 
ATOM   5810 C  CD1 . ILE C 1 218 ? 78.556 11.405  -1.840  1.00 104.24 ? 259 ILE C CD1 1 
ATOM   5811 N  N   . GLY C 1 219 ? 76.060 10.434  2.870   1.00 112.06 ? 260 GLY C N   1 
ATOM   5812 C  CA  . GLY C 1 219 ? 76.188 11.013  4.199   1.00 115.93 ? 260 GLY C CA  1 
ATOM   5813 C  C   . GLY C 1 219 ? 76.722 12.434  4.249   1.00 117.30 ? 260 GLY C C   1 
ATOM   5814 O  O   . GLY C 1 219 ? 77.456 12.789  5.173   1.00 117.32 ? 260 GLY C O   1 
ATOM   5815 N  N   . ILE C 1 220 ? 76.350 13.253  3.269   1.00 118.06 ? 261 ILE C N   1 
ATOM   5816 C  CA  . ILE C 1 220 ? 76.807 14.637  3.213   1.00 118.53 ? 261 ILE C CA  1 
ATOM   5817 C  C   . ILE C 1 220 ? 75.646 15.622  3.222   1.00 120.13 ? 261 ILE C C   1 
ATOM   5818 O  O   . ILE C 1 220 ? 75.111 15.970  2.168   1.00 119.31 ? 261 ILE C O   1 
ATOM   5819 C  CB  . ILE C 1 220 ? 77.631 14.893  1.947   1.00 117.94 ? 261 ILE C CB  1 
ATOM   5820 C  CG1 . ILE C 1 220 ? 78.771 13.882  1.864   1.00 117.96 ? 261 ILE C CG1 1 
ATOM   5821 C  CG2 . ILE C 1 220 ? 78.176 16.312  1.962   1.00 118.08 ? 261 ILE C CG2 1 
ATOM   5822 C  CD1 . ILE C 1 220 ? 79.554 13.953  0.573   1.00 119.56 ? 261 ILE C CD1 1 
ATOM   5823 N  N   . GLY C 1 221 ? 75.266 16.075  4.413   1.00 122.61 ? 262 GLY C N   1 
ATOM   5824 C  CA  . GLY C 1 221 ? 74.175 17.027  4.528   1.00 124.99 ? 262 GLY C CA  1 
ATOM   5825 C  C   . GLY C 1 221 ? 74.568 18.409  4.034   1.00 126.29 ? 262 GLY C C   1 
ATOM   5826 O  O   . GLY C 1 221 ? 74.955 19.272  4.822   1.00 126.43 ? 262 GLY C O   1 
ATOM   5827 N  N   . GLY C 1 222 ? 74.465 18.619  2.724   1.00 127.10 ? 263 GLY C N   1 
ATOM   5828 C  CA  . GLY C 1 222 ? 74.824 19.901  2.145   1.00 127.63 ? 263 GLY C CA  1 
ATOM   5829 C  C   . GLY C 1 222 ? 73.741 20.959  2.240   1.00 128.36 ? 263 GLY C C   1 
ATOM   5830 O  O   . GLY C 1 222 ? 73.084 21.270  1.245   1.00 128.42 ? 263 GLY C O   1 
ATOM   5831 N  N   . ARG C 1 223 ? 73.557 21.516  3.435   1.00 128.41 ? 264 ARG C N   1 
ATOM   5832 C  CA  . ARG C 1 223 ? 72.555 22.552  3.661   1.00 127.90 ? 264 ARG C CA  1 
ATOM   5833 C  C   . ARG C 1 223 ? 73.006 23.876  3.045   1.00 127.80 ? 264 ARG C C   1 
ATOM   5834 O  O   . ARG C 1 223 ? 73.116 24.004  1.822   1.00 126.56 ? 264 ARG C O   1 
ATOM   5835 C  CB  . ARG C 1 223 ? 72.311 22.727  5.159   1.00 127.74 ? 264 ARG C CB  1 
ATOM   5836 N  N   . GLY C 1 240 ? 76.769 25.929  -6.040  1.00 113.86 ? 281 GLY C N   1 
ATOM   5837 C  CA  . GLY C 1 240 ? 77.430 24.853  -5.325  1.00 113.57 ? 281 GLY C CA  1 
ATOM   5838 C  C   . GLY C 1 240 ? 76.613 24.327  -4.159  1.00 113.54 ? 281 GLY C C   1 
ATOM   5839 O  O   . GLY C 1 240 ? 75.580 24.895  -3.805  1.00 113.16 ? 281 GLY C O   1 
ATOM   5840 N  N   . ILE C 1 241 ? 77.078 23.234  -3.561  1.00 113.81 ? 282 ILE C N   1 
ATOM   5841 C  CA  . ILE C 1 241 ? 76.391 22.623  -2.427  1.00 113.80 ? 282 ILE C CA  1 
ATOM   5842 C  C   . ILE C 1 241 ? 77.308 22.675  -1.207  1.00 114.81 ? 282 ILE C C   1 
ATOM   5843 O  O   . ILE C 1 241 ? 78.336 21.997  -1.156  1.00 114.98 ? 282 ILE C O   1 
ATOM   5844 C  CB  . ILE C 1 241 ? 76.032 21.154  -2.723  1.00 112.55 ? 282 ILE C CB  1 
ATOM   5845 C  CG1 . ILE C 1 241 ? 75.385 21.049  -4.106  1.00 110.78 ? 282 ILE C CG1 1 
ATOM   5846 C  CG2 . ILE C 1 241 ? 75.086 20.629  -1.658  1.00 109.21 ? 282 ILE C CG2 1 
ATOM   5847 C  CD1 . ILE C 1 241 ? 75.279 19.637  -4.626  1.00 110.66 ? 282 ILE C CD1 1 
ATOM   5848 N  N   . VAL C 1 242 ? 76.927 23.480  -0.223  1.00 115.31 ? 283 VAL C N   1 
ATOM   5849 C  CA  . VAL C 1 242 ? 77.728 23.638  0.984   1.00 116.43 ? 283 VAL C CA  1 
ATOM   5850 C  C   . VAL C 1 242 ? 77.573 22.509  1.998   1.00 116.24 ? 283 VAL C C   1 
ATOM   5851 O  O   . VAL C 1 242 ? 76.575 22.445  2.714   1.00 117.94 ? 283 VAL C O   1 
ATOM   5852 C  CB  . VAL C 1 242 ? 77.401 24.979  1.683   1.00 116.60 ? 283 VAL C CB  1 
ATOM   5853 C  CG1 . VAL C 1 242 ? 77.928 26.138  0.849   1.00 116.09 ? 283 VAL C CG1 1 
ATOM   5854 C  CG2 . VAL C 1 242 ? 75.894 25.115  1.869   1.00 116.72 ? 283 VAL C CG2 1 
ATOM   5855 N  N   . VAL C 1 243 ? 78.567 21.626  2.063   1.00 115.96 ? 284 VAL C N   1 
ATOM   5856 C  CA  . VAL C 1 243 ? 78.540 20.512  3.009   1.00 117.00 ? 284 VAL C CA  1 
ATOM   5857 C  C   . VAL C 1 243 ? 78.251 21.068  4.408   1.00 118.62 ? 284 VAL C C   1 
ATOM   5858 O  O   . VAL C 1 243 ? 78.305 22.282  4.611   1.00 119.26 ? 284 VAL C O   1 
ATOM   5859 C  CB  . VAL C 1 243 ? 79.891 19.749  3.000   1.00 115.33 ? 284 VAL C CB  1 
ATOM   5860 C  CG1 . VAL C 1 243 ? 79.882 18.636  4.040   1.00 114.01 ? 284 VAL C CG1 1 
ATOM   5861 C  CG2 . VAL C 1 243 ? 80.139 19.166  1.615   1.00 113.66 ? 284 VAL C CG2 1 
ATOM   5862 N  N   . ASN C 1 244 ? 77.939 20.199  5.368   1.00 120.58 ? 285 ASN C N   1 
ATOM   5863 C  CA  . ASN C 1 244 ? 77.628 20.667  6.718   1.00 121.88 ? 285 ASN C CA  1 
ATOM   5864 C  C   . ASN C 1 244 ? 77.748 19.611  7.821   1.00 122.55 ? 285 ASN C C   1 
ATOM   5865 O  O   . ASN C 1 244 ? 77.693 19.935  9.009   1.00 120.77 ? 285 ASN C O   1 
ATOM   5866 C  CB  . ASN C 1 244 ? 76.212 21.250  6.733   1.00 122.24 ? 285 ASN C CB  1 
ATOM   5867 C  CG  . ASN C 1 244 ? 75.808 21.762  8.096   1.00 123.27 ? 285 ASN C CG  1 
ATOM   5868 O  OD1 . ASN C 1 244 ? 76.291 22.798  8.548   1.00 124.96 ? 285 ASN C OD1 1 
ATOM   5869 N  ND2 . ASN C 1 244 ? 74.925 21.029  8.767   1.00 123.54 ? 285 ASN C ND2 1 
ATOM   5870 N  N   . GLU C 1 245 ? 77.913 18.352  7.434   1.00 124.69 ? 286 GLU C N   1 
ATOM   5871 C  CA  . GLU C 1 245 ? 78.016 17.275  8.413   1.00 127.62 ? 286 GLU C CA  1 
ATOM   5872 C  C   . GLU C 1 245 ? 78.412 15.951  7.765   1.00 129.27 ? 286 GLU C C   1 
ATOM   5873 O  O   . GLU C 1 245 ? 77.846 15.554  6.747   1.00 131.20 ? 286 GLU C O   1 
ATOM   5874 C  CB  . GLU C 1 245 ? 76.677 17.134  9.150   1.00 128.05 ? 286 GLU C CB  1 
ATOM   5875 C  CG  . GLU C 1 245 ? 76.475 15.823  9.898   1.00 130.07 ? 286 GLU C CG  1 
ATOM   5876 C  CD  . GLU C 1 245 ? 75.515 14.883  9.182   1.00 130.96 ? 286 GLU C CD  1 
ATOM   5877 O  OE1 . GLU C 1 245 ? 75.844 14.414  8.071   1.00 130.18 ? 286 GLU C OE1 1 
ATOM   5878 O  OE2 . GLU C 1 245 ? 74.424 14.617  9.730   1.00 131.77 ? 286 GLU C OE2 1 
ATOM   5879 N  N   . VAL C 1 246 ? 79.393 15.278  8.363   1.00 130.03 ? 287 VAL C N   1 
ATOM   5880 C  CA  . VAL C 1 246 ? 79.891 13.993  7.868   1.00 131.00 ? 287 VAL C CA  1 
ATOM   5881 C  C   . VAL C 1 246 ? 80.513 13.249  9.054   1.00 132.57 ? 287 VAL C C   1 
ATOM   5882 O  O   . VAL C 1 246 ? 81.491 12.513  8.903   1.00 133.65 ? 287 VAL C O   1 
ATOM   5883 C  CB  . VAL C 1 246 ? 80.986 14.196  6.784   1.00 129.81 ? 287 VAL C CB  1 
ATOM   5884 C  CG1 . VAL C 1 246 ? 81.369 12.859  6.172   1.00 129.85 ? 287 VAL C CG1 1 
ATOM   5885 C  CG2 . VAL C 1 246 ? 80.499 15.154  5.707   1.00 129.51 ? 287 VAL C CG2 1 
ATOM   5886 N  N   . SER C 1 247 ? 79.922 13.439  10.231  1.00 133.85 ? 288 SER C N   1 
ATOM   5887 C  CA  . SER C 1 247 ? 80.419 12.852  11.477  1.00 134.55 ? 288 SER C CA  1 
ATOM   5888 C  C   . SER C 1 247 ? 80.414 11.331  11.679  1.00 135.25 ? 288 SER C C   1 
ATOM   5889 O  O   . SER C 1 247 ? 81.393 10.770  12.176  1.00 134.89 ? 288 SER C O   1 
ATOM   5890 C  CB  . SER C 1 247 ? 79.706 13.516  12.663  1.00 133.92 ? 288 SER C CB  1 
ATOM   5891 O  OG  . SER C 1 247 ? 78.301 13.531  12.477  1.00 132.64 ? 288 SER C OG  1 
ATOM   5892 N  N   . PRO C 1 248 ? 79.322 10.643  11.308  1.00 135.94 ? 289 PRO C N   1 
ATOM   5893 C  CA  . PRO C 1 248 ? 79.288 9.188   11.498  1.00 136.40 ? 289 PRO C CA  1 
ATOM   5894 C  C   . PRO C 1 248 ? 80.217 8.391   10.583  1.00 137.17 ? 289 PRO C C   1 
ATOM   5895 O  O   . PRO C 1 248 ? 79.838 7.331   10.084  1.00 137.35 ? 289 PRO C O   1 
ATOM   5896 C  CB  . PRO C 1 248 ? 77.818 8.852   11.268  1.00 136.26 ? 289 PRO C CB  1 
ATOM   5897 C  CG  . PRO C 1 248 ? 77.428 9.844   10.210  1.00 136.97 ? 289 PRO C CG  1 
ATOM   5898 C  CD  . PRO C 1 248 ? 78.068 11.127  10.703  1.00 136.28 ? 289 PRO C CD  1 
ATOM   5899 N  N   . ASP C 1 249 ? 81.431 8.899   10.377  1.00 137.97 ? 290 ASP C N   1 
ATOM   5900 C  CA  . ASP C 1 249 ? 82.423 8.246   9.521   1.00 138.80 ? 290 ASP C CA  1 
ATOM   5901 C  C   . ASP C 1 249 ? 81.795 7.770   8.215   1.00 139.74 ? 290 ASP C C   1 
ATOM   5902 O  O   . ASP C 1 249 ? 82.281 6.828   7.587   1.00 140.16 ? 290 ASP C O   1 
ATOM   5903 C  CB  . ASP C 1 249 ? 83.062 7.053   10.249  1.00 137.97 ? 290 ASP C CB  1 
ATOM   5904 C  CG  . ASP C 1 249 ? 82.088 5.902   10.466  1.00 137.64 ? 290 ASP C CG  1 
ATOM   5905 O  OD1 . ASP C 1 249 ? 81.664 5.273   9.472   1.00 136.00 ? 290 ASP C OD1 1 
ATOM   5906 O  OD2 . ASP C 1 249 ? 81.743 5.628   11.635  1.00 137.64 ? 290 ASP C OD2 1 
ATOM   5907 N  N   . GLY C 1 250 ? 80.714 8.432   7.812   1.00 140.11 ? 291 GLY C N   1 
ATOM   5908 C  CA  . GLY C 1 250 ? 80.024 8.057   6.591   1.00 140.15 ? 291 GLY C CA  1 
ATOM   5909 C  C   . GLY C 1 250 ? 80.965 7.877   5.420   1.00 140.01 ? 291 GLY C C   1 
ATOM   5910 O  O   . GLY C 1 250 ? 82.109 8.325   5.482   1.00 140.24 ? 291 GLY C O   1 
ATOM   5911 N  N   . PRO C 1 251 ? 80.517 7.221   4.336   1.00 140.01 ? 292 PRO C N   1 
ATOM   5912 C  CA  . PRO C 1 251 ? 81.353 7.000   3.152   1.00 140.43 ? 292 PRO C CA  1 
ATOM   5913 C  C   . PRO C 1 251 ? 81.844 8.309   2.534   1.00 140.90 ? 292 PRO C C   1 
ATOM   5914 O  O   . PRO C 1 251 ? 82.397 8.328   1.431   1.00 141.17 ? 292 PRO C O   1 
ATOM   5915 C  CB  . PRO C 1 251 ? 80.433 6.209   2.220   1.00 140.15 ? 292 PRO C CB  1 
ATOM   5916 C  CG  . PRO C 1 251 ? 79.063 6.654   2.630   1.00 140.35 ? 292 PRO C CG  1 
ATOM   5917 C  CD  . PRO C 1 251 ? 79.168 6.667   4.131   1.00 139.75 ? 292 PRO C CD  1 
ATOM   5918 N  N   . ALA C 1 252 ? 81.628 9.402   3.259   1.00 141.36 ? 293 ALA C N   1 
ATOM   5919 C  CA  . ALA C 1 252 ? 82.058 10.723  2.827   1.00 142.38 ? 293 ALA C CA  1 
ATOM   5920 C  C   . ALA C 1 252 ? 83.310 11.074  3.623   1.00 143.00 ? 293 ALA C C   1 
ATOM   5921 O  O   . ALA C 1 252 ? 84.242 11.688  3.104   1.00 142.97 ? 293 ALA C O   1 
ATOM   5922 C  CB  . ALA C 1 252 ? 80.963 11.741  3.093   1.00 142.44 ? 293 ALA C CB  1 
ATOM   5923 N  N   . ALA C 1 253 ? 83.321 10.674  4.890   1.00 143.74 ? 294 ALA C N   1 
ATOM   5924 C  CA  . ALA C 1 253 ? 84.459 10.921  5.762   1.00 144.52 ? 294 ALA C CA  1 
ATOM   5925 C  C   . ALA C 1 253 ? 85.623 10.055  5.291   1.00 145.25 ? 294 ALA C C   1 
ATOM   5926 O  O   . ALA C 1 253 ? 86.783 10.446  5.403   1.00 146.11 ? 294 ALA C O   1 
ATOM   5927 C  CB  . ALA C 1 253 ? 84.098 10.577  7.203   1.00 144.06 ? 294 ALA C CB  1 
ATOM   5928 N  N   . ASN C 1 254 ? 85.298 8.882   4.752   1.00 145.77 ? 295 ASN C N   1 
ATOM   5929 C  CA  . ASN C 1 254 ? 86.302 7.941   4.257   1.00 146.06 ? 295 ASN C CA  1 
ATOM   5930 C  C   . ASN C 1 254 ? 86.770 8.274   2.837   1.00 146.05 ? 295 ASN C C   1 
ATOM   5931 O  O   . ASN C 1 254 ? 87.301 7.415   2.130   1.00 145.82 ? 295 ASN C O   1 
ATOM   5932 C  CB  . ASN C 1 254 ? 85.747 6.510   4.287   1.00 146.08 ? 295 ASN C CB  1 
ATOM   5933 C  CG  . ASN C 1 254 ? 85.312 6.076   5.678   1.00 146.07 ? 295 ASN C CG  1 
ATOM   5934 O  OD1 . ASN C 1 254 ? 86.086 6.139   6.636   1.00 145.51 ? 295 ASN C OD1 1 
ATOM   5935 N  ND2 . ASN C 1 254 ? 84.066 5.625   5.793   1.00 145.58 ? 295 ASN C ND2 1 
ATOM   5936 N  N   . ALA C 1 255 ? 86.570 9.523   2.426   1.00 145.83 ? 296 ALA C N   1 
ATOM   5937 C  CA  . ALA C 1 255 ? 86.979 9.969   1.099   1.00 145.65 ? 296 ALA C CA  1 
ATOM   5938 C  C   . ALA C 1 255 ? 87.382 11.439  1.149   1.00 145.85 ? 296 ALA C C   1 
ATOM   5939 O  O   . ALA C 1 255 ? 87.458 12.033  2.228   1.00 145.66 ? 296 ALA C O   1 
ATOM   5940 C  CB  . ALA C 1 255 ? 85.844 9.767   0.101   1.00 145.32 ? 296 ALA C CB  1 
ATOM   5941 N  N   . GLY C 1 256 ? 87.635 12.023  -0.019  1.00 145.79 ? 297 GLY C N   1 
ATOM   5942 C  CA  . GLY C 1 256 ? 88.036 13.418  -0.079  1.00 145.94 ? 297 GLY C CA  1 
ATOM   5943 C  C   . GLY C 1 256 ? 86.927 14.394  0.260   1.00 145.83 ? 297 GLY C C   1 
ATOM   5944 O  O   . GLY C 1 256 ? 86.515 15.187  -0.585  1.00 145.54 ? 297 GLY C O   1 
ATOM   5945 N  N   . ILE C 1 257 ? 86.445 14.341  1.499   1.00 146.15 ? 298 ILE C N   1 
ATOM   5946 C  CA  . ILE C 1 257 ? 85.378 15.230  1.946   1.00 146.74 ? 298 ILE C CA  1 
ATOM   5947 C  C   . ILE C 1 257 ? 85.718 15.870  3.289   1.00 147.35 ? 298 ILE C C   1 
ATOM   5948 O  O   . ILE C 1 257 ? 86.093 15.181  4.242   1.00 146.67 ? 298 ILE C O   1 
ATOM   5949 C  CB  . ILE C 1 257 ? 84.065 14.463  2.048   1.00 146.44 ? 298 ILE C CB  1 
ATOM   5950 N  N   . GLN C 1 258 ? 85.579 17.193  3.348   1.00 147.98 ? 299 GLN C N   1 
ATOM   5951 C  CA  . GLN C 1 258 ? 85.869 17.968  4.551   1.00 148.24 ? 299 GLN C CA  1 
ATOM   5952 C  C   . GLN C 1 258 ? 84.672 17.960  5.502   1.00 148.20 ? 299 GLN C C   1 
ATOM   5953 O  O   . GLN C 1 258 ? 84.208 16.896  5.916   1.00 148.32 ? 299 GLN C O   1 
ATOM   5954 C  CB  . GLN C 1 258 ? 86.225 19.410  4.164   1.00 148.29 ? 299 GLN C CB  1 
ATOM   5955 C  CG  . GLN C 1 258 ? 86.704 20.295  5.311   1.00 148.36 ? 299 GLN C CG  1 
ATOM   5956 C  CD  . GLN C 1 258 ? 88.092 19.933  5.798   1.00 148.11 ? 299 GLN C CD  1 
ATOM   5957 O  OE1 . GLN C 1 258 ? 88.332 18.823  6.275   1.00 147.45 ? 299 GLN C OE1 1 
ATOM   5958 N  NE2 . GLN C 1 258 ? 89.019 20.877  5.680   1.00 148.82 ? 299 GLN C NE2 1 
ATOM   5959 N  N   . VAL C 1 259 ? 84.175 19.147  5.841   1.00 147.89 ? 300 VAL C N   1 
ATOM   5960 C  CA  . VAL C 1 259 ? 83.037 19.277  6.742   1.00 147.64 ? 300 VAL C CA  1 
ATOM   5961 C  C   . VAL C 1 259 ? 82.246 20.549  6.447   1.00 147.47 ? 300 VAL C C   1 
ATOM   5962 O  O   . VAL C 1 259 ? 81.129 20.719  6.937   1.00 147.18 ? 300 VAL C O   1 
ATOM   5963 C  CB  . VAL C 1 259 ? 83.497 19.294  8.222   1.00 148.15 ? 300 VAL C CB  1 
ATOM   5964 C  CG1 . VAL C 1 259 ? 84.388 20.497  8.477   1.00 149.15 ? 300 VAL C CG1 1 
ATOM   5965 C  CG2 . VAL C 1 259 ? 82.290 19.317  9.149   1.00 148.02 ? 300 VAL C CG2 1 
ATOM   5966 N  N   . ASN C 1 260 ? 82.824 21.442  5.648   1.00 147.44 ? 301 ASN C N   1 
ATOM   5967 C  CA  . ASN C 1 260 ? 82.145 22.685  5.301   1.00 147.54 ? 301 ASN C CA  1 
ATOM   5968 C  C   . ASN C 1 260 ? 82.589 23.246  3.954   1.00 146.59 ? 301 ASN C C   1 
ATOM   5969 O  O   . ASN C 1 260 ? 82.613 24.461  3.752   1.00 145.70 ? 301 ASN C O   1 
ATOM   5970 C  CB  . ASN C 1 260 ? 82.357 23.736  6.392   1.00 148.91 ? 301 ASN C CB  1 
ATOM   5971 C  CG  . ASN C 1 260 ? 83.789 24.209  6.474   1.00 150.46 ? 301 ASN C CG  1 
ATOM   5972 O  OD1 . ASN C 1 260 ? 84.707 23.415  6.682   1.00 151.48 ? 301 ASN C OD1 1 
ATOM   5973 N  ND2 . ASN C 1 260 ? 83.991 25.511  6.312   1.00 150.98 ? 301 ASN C ND2 1 
ATOM   5974 N  N   . ASP C 1 261 ? 82.947 22.354  3.038   1.00 146.36 ? 302 ASP C N   1 
ATOM   5975 C  CA  . ASP C 1 261 ? 83.358 22.758  1.699   1.00 146.71 ? 302 ASP C CA  1 
ATOM   5976 C  C   . ASP C 1 261 ? 82.169 22.518  0.771   1.00 146.70 ? 302 ASP C C   1 
ATOM   5977 O  O   . ASP C 1 261 ? 81.237 21.799  1.129   1.00 147.33 ? 302 ASP C O   1 
ATOM   5978 C  CB  . ASP C 1 261 ? 84.573 21.942  1.242   1.00 146.46 ? 302 ASP C CB  1 
ATOM   5979 C  CG  . ASP C 1 261 ? 84.341 20.445  1.324   1.00 146.29 ? 302 ASP C CG  1 
ATOM   5980 O  OD1 . ASP C 1 261 ? 84.014 19.955  2.425   1.00 146.17 ? 302 ASP C OD1 1 
ATOM   5981 O  OD2 . ASP C 1 261 ? 84.490 19.759  0.289   1.00 145.25 ? 302 ASP C OD2 1 
ATOM   5982 N  N   . LEU C 1 262 ? 82.188 23.119  -0.413  1.00 146.58 ? 303 LEU C N   1 
ATOM   5983 C  CA  . LEU C 1 262 ? 81.077 22.947  -1.342  1.00 147.15 ? 303 LEU C CA  1 
ATOM   5984 C  C   . LEU C 1 262 ? 81.250 21.717  -2.226  1.00 147.90 ? 303 LEU C C   1 
ATOM   5985 O  O   . LEU C 1 262 ? 82.244 20.998  -2.125  1.00 148.44 ? 303 LEU C O   1 
ATOM   5986 C  CB  . LEU C 1 262 ? 80.917 24.187  -2.225  1.00 146.61 ? 303 LEU C CB  1 
ATOM   5987 C  CG  . LEU C 1 262 ? 81.826 24.318  -3.450  1.00 146.57 ? 303 LEU C CG  1 
ATOM   5988 C  CD1 . LEU C 1 262 ? 81.489 25.601  -4.194  1.00 146.58 ? 303 LEU C CD1 1 
ATOM   5989 C  CD2 . LEU C 1 262 ? 83.280 24.313  -3.022  1.00 148.22 ? 303 LEU C CD2 1 
ATOM   5990 N  N   . ILE C 1 263 ? 80.266 21.486  -3.089  1.00 148.01 ? 304 ILE C N   1 
ATOM   5991 C  CA  . ILE C 1 263 ? 80.280 20.356  -4.012  1.00 147.87 ? 304 ILE C CA  1 
ATOM   5992 C  C   . ILE C 1 263 ? 79.932 20.891  -5.399  1.00 147.97 ? 304 ILE C C   1 
ATOM   5993 O  O   . ILE C 1 263 ? 78.776 21.220  -5.670  1.00 148.62 ? 304 ILE C O   1 
ATOM   5994 C  CB  . ILE C 1 263 ? 79.225 19.295  -3.620  1.00 148.04 ? 304 ILE C CB  1 
ATOM   5995 C  CG1 . ILE C 1 263 ? 79.319 18.975  -2.123  1.00 147.92 ? 304 ILE C CG1 1 
ATOM   5996 C  CG2 . ILE C 1 263 ? 79.421 18.043  -4.457  1.00 147.56 ? 304 ILE C CG2 1 
ATOM   5997 C  CD1 . ILE C 1 263 ? 80.648 18.401  -1.679  1.00 148.55 ? 304 ILE C CD1 1 
ATOM   5998 N  N   . ILE C 1 264 ? 80.927 20.979  -6.276  1.00 147.26 ? 305 ILE C N   1 
ATOM   5999 C  CA  . ILE C 1 264 ? 80.707 21.495  -7.624  1.00 147.31 ? 305 ILE C CA  1 
ATOM   6000 C  C   . ILE C 1 264 ? 80.079 20.477  -8.575  1.00 146.93 ? 305 ILE C C   1 
ATOM   6001 O  O   . ILE C 1 264 ? 79.252 20.834  -9.416  1.00 146.87 ? 305 ILE C O   1 
ATOM   6002 C  CB  . ILE C 1 264 ? 82.029 22.008  -8.247  1.00 147.49 ? 305 ILE C CB  1 
ATOM   6003 C  CG1 . ILE C 1 264 ? 82.592 23.155  -7.405  1.00 147.27 ? 305 ILE C CG1 1 
ATOM   6004 C  CG2 . ILE C 1 264 ? 81.789 22.478  -9.679  1.00 147.49 ? 305 ILE C CG2 1 
ATOM   6005 C  CD1 . ILE C 1 264 ? 81.695 24.378  -7.344  1.00 147.44 ? 305 ILE C CD1 1 
ATOM   6006 N  N   . SER C 1 265 ? 80.470 19.213  -8.443  1.00 146.14 ? 306 SER C N   1 
ATOM   6007 C  CA  . SER C 1 265 ? 79.939 18.162  -9.305  1.00 144.50 ? 306 SER C CA  1 
ATOM   6008 C  C   . SER C 1 265 ? 79.909 16.822  -8.576  1.00 143.63 ? 306 SER C C   1 
ATOM   6009 O  O   . SER C 1 265 ? 80.659 16.608  -7.623  1.00 143.07 ? 306 SER C O   1 
ATOM   6010 C  CB  . SER C 1 265 ? 80.796 18.046  -10.572 1.00 143.93 ? 306 SER C CB  1 
ATOM   6011 O  OG  . SER C 1 265 ? 80.257 17.100  -11.478 1.00 142.27 ? 306 SER C OG  1 
ATOM   6012 N  N   . VAL C 1 266 ? 79.029 15.930  -9.022  1.00 142.82 ? 307 VAL C N   1 
ATOM   6013 C  CA  . VAL C 1 266 ? 78.904 14.603  -8.426  1.00 142.08 ? 307 VAL C CA  1 
ATOM   6014 C  C   . VAL C 1 266 ? 78.613 13.581  -9.523  1.00 141.72 ? 307 VAL C C   1 
ATOM   6015 O  O   . VAL C 1 266 ? 77.798 13.828  -10.411 1.00 141.57 ? 307 VAL C O   1 
ATOM   6016 C  CB  . VAL C 1 266 ? 77.765 14.552  -7.381  1.00 141.46 ? 307 VAL C CB  1 
ATOM   6017 C  CG1 . VAL C 1 266 ? 77.788 13.240  -6.618  1.00 141.07 ? 307 VAL C CG1 1 
ATOM   6018 C  CG2 . VAL C 1 266 ? 77.884 15.717  -6.421  1.00 143.18 ? 307 VAL C CG2 1 
ATOM   6019 N  N   . ASP C 1 267 ? 79.287 12.437  -9.460  1.00 141.41 ? 308 ASP C N   1 
ATOM   6020 C  CA  . ASP C 1 267 ? 79.109 11.379  -10.449 1.00 140.97 ? 308 ASP C CA  1 
ATOM   6021 C  C   . ASP C 1 267 ? 79.286 11.924  -11.891 1.00 140.97 ? 308 ASP C C   1 
ATOM   6022 O  O   . ASP C 1 267 ? 78.824 11.306  -12.842 1.00 140.30 ? 308 ASP C O   1 
ATOM   6023 C  CB  . ASP C 1 267 ? 77.733 10.750  -10.302 1.00 141.20 ? 308 ASP C CB  1 
ATOM   6024 N  N   . ASN C 1 268 ? 79.913 13.080  -12.059 1.00 141.92 ? 309 ASN C N   1 
ATOM   6025 C  CA  . ASN C 1 268 ? 80.162 13.606  -13.415 1.00 142.47 ? 309 ASN C CA  1 
ATOM   6026 C  C   . ASN C 1 268 ? 79.073 14.599  -13.947 1.00 142.74 ? 309 ASN C C   1 
ATOM   6027 O  O   . ASN C 1 268 ? 79.251 15.173  -15.026 1.00 142.51 ? 309 ASN C O   1 
ATOM   6028 C  CB  . ASN C 1 268 ? 80.346 12.450  -14.385 1.00 141.73 ? 309 ASN C CB  1 
ATOM   6029 N  N   . LYS C 1 269 ? 77.932 14.835  -13.218 1.00 132.50 ? 310 LYS C N   1 
ATOM   6030 C  CA  . LYS C 1 269 ? 76.823 15.804  -13.616 1.00 132.74 ? 310 LYS C CA  1 
ATOM   6031 C  C   . LYS C 1 269 ? 76.883 17.158  -12.817 1.00 132.08 ? 310 LYS C C   1 
ATOM   6032 O  O   . LYS C 1 269 ? 77.698 17.226  -11.914 1.00 131.68 ? 310 LYS C O   1 
ATOM   6033 C  CB  . LYS C 1 269 ? 75.463 15.159  -13.430 1.00 133.02 ? 310 LYS C CB  1 
ATOM   6034 N  N   . PRO C 1 270 ? 76.076 18.239  -13.094 1.00 131.64 ? 311 PRO C N   1 
ATOM   6035 C  CA  . PRO C 1 270 ? 76.201 19.463  -12.253 1.00 131.18 ? 311 PRO C CA  1 
ATOM   6036 C  C   . PRO C 1 270 ? 75.715 19.247  -10.816 1.00 130.80 ? 311 PRO C C   1 
ATOM   6037 O  O   . PRO C 1 270 ? 74.995 18.290  -10.534 1.00 131.94 ? 311 PRO C O   1 
ATOM   6038 C  CB  . PRO C 1 270 ? 75.367 20.508  -12.990 1.00 130.56 ? 311 PRO C CB  1 
ATOM   6039 C  CG  . PRO C 1 270 ? 75.513 20.115  -14.419 1.00 130.66 ? 311 PRO C CG  1 
ATOM   6040 C  CD  . PRO C 1 270 ? 75.565 18.613  -14.427 1.00 131.23 ? 311 PRO C CD  1 
ATOM   6041 N  N   . ALA C 1 271 ? 76.115 20.137  -9.913  1.00 129.10 ? 312 ALA C N   1 
ATOM   6042 C  CA  . ALA C 1 271 ? 75.702 20.051  -8.515  1.00 126.74 ? 312 ALA C CA  1 
ATOM   6043 C  C   . ALA C 1 271 ? 74.872 21.283  -8.159  1.00 125.95 ? 312 ALA C C   1 
ATOM   6044 O  O   . ALA C 1 271 ? 75.195 22.014  -7.225  1.00 126.88 ? 312 ALA C O   1 
ATOM   6045 C  CB  . ALA C 1 271 ? 76.920 19.961  -7.614  1.00 125.92 ? 312 ALA C CB  1 
ATOM   6046 N  N   . ILE C 1 272 ? 73.797 21.496  -8.913  1.00 124.60 ? 313 ILE C N   1 
ATOM   6047 C  CA  . ILE C 1 272 ? 72.905 22.636  -8.718  1.00 122.47 ? 313 ILE C CA  1 
ATOM   6048 C  C   . ILE C 1 272 ? 72.301 22.717  -7.310  1.00 121.16 ? 313 ILE C C   1 
ATOM   6049 O  O   . ILE C 1 272 ? 72.762 23.505  -6.485  1.00 121.24 ? 313 ILE C O   1 
ATOM   6050 C  CB  . ILE C 1 272 ? 71.773 22.619  -9.775  1.00 122.94 ? 313 ILE C CB  1 
ATOM   6051 C  CG1 . ILE C 1 272 ? 72.386 22.524  -11.178 1.00 123.16 ? 313 ILE C CG1 1 
ATOM   6052 C  CG2 . ILE C 1 272 ? 70.927 23.881  -9.660  1.00 121.90 ? 313 ILE C CG2 1 
ATOM   6053 C  CD1 . ILE C 1 272 ? 71.374 22.407  -12.302 1.00 123.15 ? 313 ILE C CD1 1 
ATOM   6054 N  N   . SER C 1 273 ? 71.276 21.911  -7.032  1.00 119.13 ? 314 SER C N   1 
ATOM   6055 C  CA  . SER C 1 273 ? 70.633 21.919  -5.712  1.00 116.13 ? 314 SER C CA  1 
ATOM   6056 C  C   . SER C 1 273 ? 70.987 20.694  -4.855  1.00 114.09 ? 314 SER C C   1 
ATOM   6057 O  O   . SER C 1 273 ? 71.446 19.675  -5.375  1.00 114.08 ? 314 SER C O   1 
ATOM   6058 C  CB  . SER C 1 273 ? 69.109 22.037  -5.868  1.00 115.99 ? 314 SER C CB  1 
ATOM   6059 O  OG  . SER C 1 273 ? 68.598 21.097  -6.799  1.00 115.26 ? 314 SER C OG  1 
ATOM   6060 N  N   . ALA C 1 274 ? 70.765 20.801  -3.545  1.00 110.86 ? 315 ALA C N   1 
ATOM   6061 C  CA  . ALA C 1 274 ? 71.078 19.726  -2.600  1.00 108.56 ? 315 ALA C CA  1 
ATOM   6062 C  C   . ALA C 1 274 ? 70.108 18.542  -2.601  1.00 108.38 ? 315 ALA C C   1 
ATOM   6063 O  O   . ALA C 1 274 ? 70.532 17.386  -2.540  1.00 107.54 ? 315 ALA C O   1 
ATOM   6064 C  CB  . ALA C 1 274 ? 71.183 20.297  -1.187  1.00 106.44 ? 315 ALA C CB  1 
ATOM   6065 N  N   . LEU C 1 275 ? 68.811 18.828  -2.656  1.00 107.29 ? 316 LEU C N   1 
ATOM   6066 C  CA  . LEU C 1 275 ? 67.806 17.774  -2.647  1.00 105.06 ? 316 LEU C CA  1 
ATOM   6067 C  C   . LEU C 1 275 ? 67.736 17.004  -3.955  1.00 103.27 ? 316 LEU C C   1 
ATOM   6068 O  O   . LEU C 1 275 ? 67.244 15.879  -3.986  1.00 101.63 ? 316 LEU C O   1 
ATOM   6069 C  CB  . LEU C 1 275 ? 66.425 18.350  -2.322  1.00 105.73 ? 316 LEU C CB  1 
ATOM   6070 C  CG  . LEU C 1 275 ? 66.253 18.936  -0.919  1.00 106.16 ? 316 LEU C CG  1 
ATOM   6071 C  CD1 . LEU C 1 275 ? 64.803 19.364  -0.721  1.00 103.61 ? 316 LEU C CD1 1 
ATOM   6072 C  CD2 . LEU C 1 275 ? 66.662 17.901  0.126   1.00 103.53 ? 316 LEU C CD2 1 
ATOM   6073 N  N   . GLU C 1 276 ? 68.220 17.604  -5.035  1.00 101.35 ? 317 GLU C N   1 
ATOM   6074 C  CA  . GLU C 1 276 ? 68.194 16.929  -6.320  1.00 101.68 ? 317 GLU C CA  1 
ATOM   6075 C  C   . GLU C 1 276 ? 69.455 16.084  -6.478  1.00 101.86 ? 317 GLU C C   1 
ATOM   6076 O  O   . GLU C 1 276 ? 69.545 15.241  -7.372  1.00 102.18 ? 317 GLU C O   1 
ATOM   6077 C  CB  . GLU C 1 276 ? 68.091 17.949  -7.450  1.00 103.10 ? 317 GLU C CB  1 
ATOM   6078 C  CG  . GLU C 1 276 ? 67.642 17.349  -8.765  1.00 107.64 ? 317 GLU C CG  1 
ATOM   6079 C  CD  . GLU C 1 276 ? 66.342 16.571  -8.628  1.00 111.53 ? 317 GLU C CD  1 
ATOM   6080 O  OE1 . GLU C 1 276 ? 65.357 17.134  -8.101  1.00 112.17 ? 317 GLU C OE1 1 
ATOM   6081 O  OE2 . GLU C 1 276 ? 66.304 15.395  -9.049  1.00 112.44 ? 317 GLU C OE2 1 
ATOM   6082 N  N   . THR C 1 277 ? 70.425 16.321  -5.598  1.00 101.74 ? 318 THR C N   1 
ATOM   6083 C  CA  . THR C 1 277 ? 71.689 15.585  -5.605  1.00 101.45 ? 318 THR C CA  1 
ATOM   6084 C  C   . THR C 1 277 ? 71.578 14.410  -4.645  1.00 99.72  ? 318 THR C C   1 
ATOM   6085 O  O   . THR C 1 277 ? 72.187 13.366  -4.855  1.00 100.35 ? 318 THR C O   1 
ATOM   6086 C  CB  . THR C 1 277 ? 72.880 16.491  -5.181  1.00 101.00 ? 318 THR C CB  1 
ATOM   6087 O  OG1 . THR C 1 277 ? 73.312 17.264  -6.307  1.00 101.74 ? 318 THR C OG1 1 
ATOM   6088 C  CG2 . THR C 1 277 ? 74.050 15.658  -4.663  1.00 100.46 ? 318 THR C CG2 1 
HETATM 6089 N  N   . MSE C 1 278 ? 70.796 14.588  -3.590  1.00 98.97  ? 319 MSE C N   1 
HETATM 6090 C  CA  . MSE C 1 278 ? 70.596 13.526  -2.619  1.00 100.66 ? 319 MSE C CA  1 
HETATM 6091 C  C   . MSE C 1 278 ? 69.695 12.428  -3.185  1.00 98.08  ? 319 MSE C C   1 
HETATM 6092 O  O   . MSE C 1 278 ? 69.853 11.257  -2.840  1.00 96.86  ? 319 MSE C O   1 
HETATM 6093 C  CB  . MSE C 1 278 ? 69.999 14.094  -1.331  1.00 106.66 ? 319 MSE C CB  1 
HETATM 6094 C  CG  . MSE C 1 278 ? 70.954 15.005  -0.584  1.00 114.87 ? 319 MSE C CG  1 
HETATM 6095 SE SE  . MSE C 1 278 ? 72.645 14.120  -0.249  1.00 127.35 ? 319 MSE C SE  1 
HETATM 6096 C  CE  . MSE C 1 278 ? 72.187 13.230  1.411   1.00 121.11 ? 319 MSE C CE  1 
ATOM   6097 N  N   . ASP C 1 279 ? 68.749 12.807  -4.044  1.00 95.51  ? 320 ASP C N   1 
ATOM   6098 C  CA  . ASP C 1 279 ? 67.851 11.836  -4.667  1.00 93.74  ? 320 ASP C CA  1 
ATOM   6099 C  C   . ASP C 1 279 ? 68.690 11.092  -5.693  1.00 91.14  ? 320 ASP C C   1 
ATOM   6100 O  O   . ASP C 1 279 ? 68.479 9.910   -5.963  1.00 90.71  ? 320 ASP C O   1 
ATOM   6101 C  CB  . ASP C 1 279 ? 66.668 12.526  -5.380  1.00 94.18  ? 320 ASP C CB  1 
ATOM   6102 C  CG  . ASP C 1 279 ? 65.553 12.962  -4.419  1.00 94.05  ? 320 ASP C CG  1 
ATOM   6103 O  OD1 . ASP C 1 279 ? 65.250 12.223  -3.458  1.00 92.46  ? 320 ASP C OD1 1 
ATOM   6104 O  OD2 . ASP C 1 279 ? 64.960 14.040  -4.642  1.00 95.03  ? 320 ASP C OD2 1 
ATOM   6105 N  N   . GLN C 1 280 ? 69.649 11.819  -6.254  1.00 90.38  ? 321 GLN C N   1 
ATOM   6106 C  CA  . GLN C 1 280 ? 70.574 11.305  -7.259  1.00 89.55  ? 321 GLN C CA  1 
ATOM   6107 C  C   . GLN C 1 280 ? 71.537 10.294  -6.622  1.00 85.97  ? 321 GLN C C   1 
ATOM   6108 O  O   . GLN C 1 280 ? 71.813 9.238   -7.200  1.00 82.21  ? 321 GLN C O   1 
ATOM   6109 C  CB  . GLN C 1 280 ? 71.336 12.485  -7.861  1.00 94.59  ? 321 GLN C CB  1 
ATOM   6110 C  CG  . GLN C 1 280 ? 72.269 12.165  -8.999  1.00 100.92 ? 321 GLN C CG  1 
ATOM   6111 C  CD  . GLN C 1 280 ? 72.857 13.429  -9.605  1.00 105.83 ? 321 GLN C CD  1 
ATOM   6112 O  OE1 . GLN C 1 280 ? 73.368 14.299  -8.889  1.00 105.19 ? 321 GLN C OE1 1 
ATOM   6113 N  NE2 . GLN C 1 280 ? 72.788 13.539  -10.929 1.00 107.59 ? 321 GLN C NE2 1 
ATOM   6114 N  N   . VAL C 1 281 ? 72.039 10.622  -5.431  1.00 81.41  ? 322 VAL C N   1 
ATOM   6115 C  CA  . VAL C 1 281 ? 72.941 9.736   -4.693  1.00 79.40  ? 322 VAL C CA  1 
ATOM   6116 C  C   . VAL C 1 281 ? 72.213 8.444   -4.320  1.00 78.80  ? 322 VAL C C   1 
ATOM   6117 O  O   . VAL C 1 281 ? 72.758 7.353   -4.461  1.00 80.55  ? 322 VAL C O   1 
ATOM   6118 C  CB  . VAL C 1 281 ? 73.449 10.401  -3.392  1.00 78.60  ? 322 VAL C CB  1 
ATOM   6119 C  CG1 . VAL C 1 281 ? 74.135 9.368   -2.508  1.00 78.04  ? 322 VAL C CG1 1 
ATOM   6120 C  CG2 . VAL C 1 281 ? 74.422 11.521  -3.726  1.00 79.36  ? 322 VAL C CG2 1 
ATOM   6121 N  N   . ALA C 1 282 ? 70.979 8.577   -3.842  1.00 77.75  ? 323 ALA C N   1 
ATOM   6122 C  CA  . ALA C 1 282 ? 70.166 7.425   -3.451  1.00 76.92  ? 323 ALA C CA  1 
ATOM   6123 C  C   . ALA C 1 282 ? 69.808 6.516   -4.629  1.00 72.81  ? 323 ALA C C   1 
ATOM   6124 O  O   . ALA C 1 282 ? 69.390 5.383   -4.427  1.00 68.87  ? 323 ALA C O   1 
ATOM   6125 C  CB  . ALA C 1 282 ? 68.874 7.901   -2.753  1.00 75.35  ? 323 ALA C CB  1 
ATOM   6126 N  N   . GLU C 1 283 ? 69.981 7.009   -5.851  1.00 75.20  ? 324 GLU C N   1 
ATOM   6127 C  CA  . GLU C 1 283 ? 69.651 6.236   -7.041  1.00 80.22  ? 324 GLU C CA  1 
ATOM   6128 C  C   . GLU C 1 283 ? 70.780 5.345   -7.568  1.00 85.36  ? 324 GLU C C   1 
ATOM   6129 O  O   . GLU C 1 283 ? 70.545 4.493   -8.430  1.00 86.81  ? 324 GLU C O   1 
ATOM   6130 C  CB  . GLU C 1 283 ? 69.193 7.172   -8.158  1.00 84.17  ? 324 GLU C CB  1 
ATOM   6131 C  CG  . GLU C 1 283 ? 68.240 6.524   -9.132  1.00 89.54  ? 324 GLU C CG  1 
ATOM   6132 C  CD  . GLU C 1 283 ? 66.949 6.095   -8.456  1.00 94.79  ? 324 GLU C CD  1 
ATOM   6133 O  OE1 . GLU C 1 283 ? 66.195 6.985   -8.001  1.00 94.12  ? 324 GLU C OE1 1 
ATOM   6134 O  OE2 . GLU C 1 283 ? 66.694 4.870   -8.373  1.00 96.32  ? 324 GLU C OE2 1 
ATOM   6135 N  N   . ILE C 1 284 ? 72.003 5.549   -7.080  1.00 87.00  ? 325 ILE C N   1 
ATOM   6136 C  CA  . ILE C 1 284 ? 73.130 4.726   -7.519  1.00 89.87  ? 325 ILE C CA  1 
ATOM   6137 C  C   . ILE C 1 284 ? 73.335 3.631   -6.490  1.00 88.69  ? 325 ILE C C   1 
ATOM   6138 O  O   . ILE C 1 284 ? 73.275 3.885   -5.287  1.00 87.89  ? 325 ILE C O   1 
ATOM   6139 C  CB  . ILE C 1 284 ? 74.443 5.556   -7.686  1.00 93.62  ? 325 ILE C CB  1 
ATOM   6140 C  CG1 . ILE C 1 284 ? 74.675 6.443   -6.462  1.00 92.24  ? 325 ILE C CG1 1 
ATOM   6141 C  CG2 . ILE C 1 284 ? 74.378 6.384   -8.969  1.00 93.92  ? 325 ILE C CG2 1 
ATOM   6142 C  CD1 . ILE C 1 284 ? 75.800 7.436   -6.636  1.00 93.56  ? 325 ILE C CD1 1 
ATOM   6143 N  N   . ARG C 1 285 ? 73.571 2.414   -6.966  1.00 89.02  ? 326 ARG C N   1 
ATOM   6144 C  CA  . ARG C 1 285 ? 73.738 1.271   -6.074  1.00 91.25  ? 326 ARG C CA  1 
ATOM   6145 C  C   . ARG C 1 285 ? 74.968 1.314   -5.188  1.00 90.94  ? 326 ARG C C   1 
ATOM   6146 O  O   . ARG C 1 285 ? 76.008 1.821   -5.587  1.00 92.73  ? 326 ARG C O   1 
ATOM   6147 C  CB  . ARG C 1 285 ? 73.731 -0.026  -6.879  1.00 93.11  ? 326 ARG C CB  1 
ATOM   6148 C  CG  . ARG C 1 285 ? 74.734 -0.083  -8.010  1.00 94.21  ? 326 ARG C CG  1 
ATOM   6149 C  CD  . ARG C 1 285 ? 74.627 -1.427  -8.701  1.00 94.04  ? 326 ARG C CD  1 
ATOM   6150 N  NE  . ARG C 1 285 ? 74.856 -2.526  -7.770  1.00 93.80  ? 326 ARG C NE  1 
ATOM   6151 C  CZ  . ARG C 1 285 ? 74.535 -3.790  -8.019  1.00 94.46  ? 326 ARG C CZ  1 
ATOM   6152 N  NH1 . ARG C 1 285 ? 73.967 -4.109  -9.173  1.00 95.99  ? 326 ARG C NH1 1 
ATOM   6153 N  NH2 . ARG C 1 285 ? 74.784 -4.733  -7.122  1.00 90.92  ? 326 ARG C NH2 1 
ATOM   6154 N  N   . PRO C 1 286 ? 74.854 0.778   -3.958  1.00 91.71  ? 327 PRO C N   1 
ATOM   6155 C  CA  . PRO C 1 286 ? 75.938 0.731   -2.971  1.00 93.32  ? 327 PRO C CA  1 
ATOM   6156 C  C   . PRO C 1 286 ? 77.191 0.021   -3.481  1.00 96.10  ? 327 PRO C C   1 
ATOM   6157 O  O   . PRO C 1 286 ? 77.106 -0.929  -4.269  1.00 95.32  ? 327 PRO C O   1 
ATOM   6158 C  CB  . PRO C 1 286 ? 75.295 0.006   -1.796  1.00 91.62  ? 327 PRO C CB  1 
ATOM   6159 C  CG  . PRO C 1 286 ? 73.881 0.459   -1.882  1.00 89.73  ? 327 PRO C CG  1 
ATOM   6160 C  CD  . PRO C 1 286 ? 73.598 0.308   -3.355  1.00 89.50  ? 327 PRO C CD  1 
ATOM   6161 N  N   . GLY C 1 287 ? 78.347 0.497   -3.021  1.00 97.62  ? 328 GLY C N   1 
ATOM   6162 C  CA  . GLY C 1 287 ? 79.621 -0.066  -3.430  1.00 97.69  ? 328 GLY C CA  1 
ATOM   6163 C  C   . GLY C 1 287 ? 80.296 0.771   -4.506  1.00 99.35  ? 328 GLY C C   1 
ATOM   6164 O  O   . GLY C 1 287 ? 81.459 1.165   -4.364  1.00 98.83  ? 328 GLY C O   1 
ATOM   6165 N  N   . SER C 1 288 ? 79.552 1.058   -5.573  1.00 99.94  ? 329 SER C N   1 
ATOM   6166 C  CA  . SER C 1 288 ? 80.054 1.832   -6.707  1.00 100.91 ? 329 SER C CA  1 
ATOM   6167 C  C   . SER C 1 288 ? 80.895 3.045   -6.317  1.00 102.76 ? 329 SER C C   1 
ATOM   6168 O  O   . SER C 1 288 ? 80.609 3.735   -5.338  1.00 102.62 ? 329 SER C O   1 
ATOM   6169 C  CB  . SER C 1 288 ? 78.890 2.281   -7.598  1.00 99.19  ? 329 SER C CB  1 
ATOM   6170 O  OG  . SER C 1 288 ? 79.355 2.709   -8.870  1.00 97.58  ? 329 SER C OG  1 
ATOM   6171 N  N   . VAL C 1 289 ? 81.942 3.290   -7.099  1.00 105.90 ? 330 VAL C N   1 
ATOM   6172 C  CA  . VAL C 1 289 ? 82.845 4.409   -6.863  1.00 106.58 ? 330 VAL C CA  1 
ATOM   6173 C  C   . VAL C 1 289 ? 82.684 5.424   -7.991  1.00 107.20 ? 330 VAL C C   1 
ATOM   6174 O  O   . VAL C 1 289 ? 82.826 5.092   -9.169  1.00 106.78 ? 330 VAL C O   1 
ATOM   6175 C  CB  . VAL C 1 289 ? 84.314 3.946   -6.827  1.00 106.61 ? 330 VAL C CB  1 
ATOM   6176 C  CG1 . VAL C 1 289 ? 85.204 5.085   -6.375  1.00 107.92 ? 330 VAL C CG1 1 
ATOM   6177 C  CG2 . VAL C 1 289 ? 84.464 2.747   -5.909  1.00 105.18 ? 330 VAL C CG2 1 
ATOM   6178 N  N   . ILE C 1 290 ? 82.377 6.660   -7.620  1.00 108.13 ? 331 ILE C N   1 
ATOM   6179 C  CA  . ILE C 1 290 ? 82.192 7.728   -8.590  1.00 109.56 ? 331 ILE C CA  1 
ATOM   6180 C  C   . ILE C 1 290 ? 82.952 8.961   -8.114  1.00 111.10 ? 331 ILE C C   1 
ATOM   6181 O  O   . ILE C 1 290 ? 83.265 9.088   -6.927  1.00 109.91 ? 331 ILE C O   1 
ATOM   6182 C  CB  . ILE C 1 290 ? 80.701 8.048   -8.742  1.00 107.36 ? 331 ILE C CB  1 
ATOM   6183 N  N   . PRO C 1 291 ? 83.269 9.882   -9.040  1.00 113.61 ? 332 PRO C N   1 
ATOM   6184 C  CA  . PRO C 1 291 ? 83.998 11.116  -8.713  1.00 115.43 ? 332 PRO C CA  1 
ATOM   6185 C  C   . PRO C 1 291 ? 83.156 12.183  -7.991  1.00 117.01 ? 332 PRO C C   1 
ATOM   6186 O  O   . PRO C 1 291 ? 82.204 12.725  -8.559  1.00 117.42 ? 332 PRO C O   1 
ATOM   6187 C  CB  . PRO C 1 291 ? 84.494 11.589  -10.081 1.00 115.05 ? 332 PRO C CB  1 
ATOM   6188 C  CG  . PRO C 1 291 ? 83.404 11.122  -11.011 1.00 113.89 ? 332 PRO C CG  1 
ATOM   6189 C  CD  . PRO C 1 291 ? 83.115 9.727   -10.501 1.00 113.42 ? 332 PRO C CD  1 
ATOM   6190 N  N   . VAL C 1 292 ? 83.513 12.481  -6.741  1.00 116.60 ? 333 VAL C N   1 
ATOM   6191 C  CA  . VAL C 1 292 ? 82.795 13.482  -5.953  1.00 116.83 ? 333 VAL C CA  1 
ATOM   6192 C  C   . VAL C 1 292 ? 83.691 14.673  -5.618  1.00 118.35 ? 333 VAL C C   1 
ATOM   6193 O  O   . VAL C 1 292 ? 83.339 15.828  -5.876  1.00 119.53 ? 333 VAL C O   1 
ATOM   6194 C  CB  . VAL C 1 292 ? 82.265 12.854  -4.672  1.00 115.91 ? 333 VAL C CB  1 
ATOM   6195 N  N   . LEU C 1 301 ? 90.507 18.965  -6.944  1.00 128.22 ? 342 LEU C N   1 
ATOM   6196 C  CA  . LEU C 1 301 ? 90.663 17.617  -6.415  1.00 128.18 ? 342 LEU C CA  1 
ATOM   6197 C  C   . LEU C 1 301 ? 89.548 16.699  -6.923  1.00 128.68 ? 342 LEU C C   1 
ATOM   6198 O  O   . LEU C 1 301 ? 88.770 17.078  -7.802  1.00 128.22 ? 342 LEU C O   1 
ATOM   6199 C  CB  . LEU C 1 301 ? 90.661 17.657  -4.884  1.00 127.23 ? 342 LEU C CB  1 
ATOM   6200 N  N   . THR C 1 302 ? 89.486 15.491  -6.368  1.00 128.75 ? 343 THR C N   1 
ATOM   6201 C  CA  . THR C 1 302 ? 88.478 14.497  -6.737  1.00 129.08 ? 343 THR C CA  1 
ATOM   6202 C  C   . THR C 1 302 ? 88.867 13.142  -6.151  1.00 129.49 ? 343 THR C C   1 
ATOM   6203 O  O   . THR C 1 302 ? 89.621 12.385  -6.766  1.00 130.45 ? 343 THR C O   1 
ATOM   6204 C  CB  . THR C 1 302 ? 88.359 14.392  -8.261  1.00 127.89 ? 343 THR C CB  1 
ATOM   6205 N  N   . LEU C 1 303 ? 88.353 12.840  -4.960  1.00 129.25 ? 344 LEU C N   1 
ATOM   6206 C  CA  . LEU C 1 303 ? 88.657 11.574  -4.292  1.00 128.05 ? 344 LEU C CA  1 
ATOM   6207 C  C   . LEU C 1 303 ? 87.558 10.533  -4.504  1.00 126.06 ? 344 LEU C C   1 
ATOM   6208 O  O   . LEU C 1 303 ? 86.884 10.136  -3.551  1.00 125.18 ? 344 LEU C O   1 
ATOM   6209 C  CB  . LEU C 1 303 ? 88.872 11.812  -2.800  1.00 127.29 ? 344 LEU C CB  1 
ATOM   6210 N  N   . GLN C 1 304 ? 87.398 10.103  -5.757  1.00 123.91 ? 345 GLN C N   1 
ATOM   6211 C  CA  . GLN C 1 304 ? 86.396 9.112   -6.158  1.00 121.89 ? 345 GLN C CA  1 
ATOM   6212 C  C   . GLN C 1 304 ? 85.727 8.484   -4.939  1.00 120.82 ? 345 GLN C C   1 
ATOM   6213 O  O   . GLN C 1 304 ? 86.336 7.662   -4.254  1.00 122.44 ? 345 GLN C O   1 
ATOM   6214 C  CB  . GLN C 1 304 ? 87.060 8.010   -6.994  1.00 120.47 ? 345 GLN C CB  1 
ATOM   6215 C  CG  . GLN C 1 304 ? 88.119 8.499   -7.979  1.00 118.94 ? 345 GLN C CG  1 
ATOM   6216 C  CD  . GLN C 1 304 ? 87.544 9.268   -9.156  1.00 117.69 ? 345 GLN C CD  1 
ATOM   6217 O  OE1 . GLN C 1 304 ? 86.837 8.707   -9.995  1.00 116.33 ? 345 GLN C OE1 1 
ATOM   6218 N  NE2 . GLN C 1 304 ? 87.850 10.559  -9.224  1.00 116.75 ? 345 GLN C NE2 1 
ATOM   6219 N  N   . VAL C 1 305 ? 84.483 8.867   -4.660  1.00 118.37 ? 346 VAL C N   1 
ATOM   6220 C  CA  . VAL C 1 305 ? 83.781 8.326   -3.500  1.00 116.47 ? 346 VAL C CA  1 
ATOM   6221 C  C   . VAL C 1 305 ? 83.045 7.020   -3.799  1.00 115.22 ? 346 VAL C C   1 
ATOM   6222 O  O   . VAL C 1 305 ? 82.739 6.713   -4.953  1.00 112.67 ? 346 VAL C O   1 
ATOM   6223 C  CB  . VAL C 1 305 ? 82.776 9.353   -2.921  1.00 115.80 ? 346 VAL C CB  1 
ATOM   6224 C  CG1 . VAL C 1 305 ? 82.161 8.817   -1.632  1.00 114.72 ? 346 VAL C CG1 1 
ATOM   6225 C  CG2 . VAL C 1 305 ? 83.482 10.667  -2.648  1.00 114.71 ? 346 VAL C CG2 1 
ATOM   6226 N  N   . THR C 1 306 ? 82.784 6.252   -2.743  1.00 115.44 ? 347 THR C N   1 
ATOM   6227 C  CA  . THR C 1 306 ? 82.088 4.970   -2.843  1.00 115.20 ? 347 THR C CA  1 
ATOM   6228 C  C   . THR C 1 306 ? 80.770 5.026   -2.066  1.00 114.49 ? 347 THR C C   1 
ATOM   6229 O  O   . THR C 1 306 ? 80.764 5.159   -0.838  1.00 114.83 ? 347 THR C O   1 
ATOM   6230 C  CB  . THR C 1 306 ? 82.942 3.821   -2.265  1.00 115.25 ? 347 THR C CB  1 
ATOM   6231 O  OG1 . THR C 1 306 ? 83.171 4.049   -0.867  1.00 114.28 ? 347 THR C OG1 1 
ATOM   6232 C  CG2 . THR C 1 306 ? 84.278 3.739   -2.982  1.00 113.95 ? 347 THR C CG2 1 
ATOM   6233 N  N   . ILE C 1 307 ? 79.659 4.922   -2.791  1.00 112.15 ? 348 ILE C N   1 
ATOM   6234 C  CA  . ILE C 1 307 ? 78.325 4.967   -2.198  1.00 107.63 ? 348 ILE C CA  1 
ATOM   6235 C  C   . ILE C 1 307 ? 78.035 3.701   -1.400  1.00 106.05 ? 348 ILE C C   1 
ATOM   6236 O  O   . ILE C 1 307 ? 78.319 2.599   -1.857  1.00 104.65 ? 348 ILE C O   1 
ATOM   6237 C  CB  . ILE C 1 307 ? 77.252 5.112   -3.295  1.00 106.72 ? 348 ILE C CB  1 
ATOM   6238 C  CG1 . ILE C 1 307 ? 77.576 6.312   -4.186  1.00 105.95 ? 348 ILE C CG1 1 
ATOM   6239 C  CG2 . ILE C 1 307 ? 75.882 5.270   -2.665  1.00 107.31 ? 348 ILE C CG2 1 
ATOM   6240 C  CD1 . ILE C 1 307 ? 77.619 7.641   -3.455  1.00 105.72 ? 348 ILE C CD1 1 
ATOM   6241 N  N   . GLN C 1 308 ? 77.471 3.853   -0.206  1.00 105.17 ? 349 GLN C N   1 
ATOM   6242 C  CA  . GLN C 1 308 ? 77.152 2.691   0.614   1.00 105.77 ? 349 GLN C CA  1 
ATOM   6243 C  C   . GLN C 1 308 ? 75.698 2.706   1.078   1.00 105.16 ? 349 GLN C C   1 
ATOM   6244 O  O   . GLN C 1 308 ? 75.208 3.708   1.587   1.00 106.19 ? 349 GLN C O   1 
ATOM   6245 C  CB  . GLN C 1 308 ? 78.115 2.614   1.798   1.00 106.50 ? 349 GLN C CB  1 
ATOM   6246 C  CG  . GLN C 1 308 ? 79.555 2.392   1.342   1.00 111.39 ? 349 GLN C CG  1 
ATOM   6247 C  CD  . GLN C 1 308 ? 80.546 2.266   2.488   1.00 113.49 ? 349 GLN C CD  1 
ATOM   6248 O  OE1 . GLN C 1 308 ? 80.728 3.197   3.276   1.00 114.32 ? 349 GLN C OE1 1 
ATOM   6249 N  NE2 . GLN C 1 308 ? 81.198 1.109   2.580   1.00 111.50 ? 349 GLN C NE2 1 
ATOM   6250 N  N   . GLU C 1 309 ? 75.019 1.578   0.887   1.00 103.42 ? 350 GLU C N   1 
ATOM   6251 C  CA  . GLU C 1 309 ? 73.609 1.419   1.234   1.00 102.02 ? 350 GLU C CA  1 
ATOM   6252 C  C   . GLU C 1 309 ? 73.123 2.165   2.477   1.00 101.81 ? 350 GLU C C   1 
ATOM   6253 O  O   . GLU C 1 309 ? 73.692 2.042   3.563   1.00 99.46  ? 350 GLU C O   1 
ATOM   6254 C  CB  . GLU C 1 309 ? 73.278 -0.070  1.365   1.00 101.61 ? 350 GLU C CB  1 
ATOM   6255 C  CG  . GLU C 1 309 ? 71.790 -0.376  1.395   1.00 102.69 ? 350 GLU C CG  1 
ATOM   6256 C  CD  . GLU C 1 309 ? 71.498 -1.865  1.367   1.00 102.29 ? 350 GLU C CD  1 
ATOM   6257 O  OE1 . GLU C 1 309 ? 71.993 -2.552  0.448   1.00 101.93 ? 350 GLU C OE1 1 
ATOM   6258 O  OE2 . GLU C 1 309 ? 70.769 -2.347  2.259   1.00 102.45 ? 350 GLU C OE2 1 
ATOM   6259 N  N   . TYR C 1 310 ? 72.046 2.927   2.292   1.00 102.26 ? 351 TYR C N   1 
ATOM   6260 C  CA  . TYR C 1 310 ? 71.425 3.721   3.348   1.00 101.76 ? 351 TYR C CA  1 
ATOM   6261 C  C   . TYR C 1 310 ? 71.390 2.950   4.669   1.00 103.12 ? 351 TYR C C   1 
ATOM   6262 O  O   . TYR C 1 310 ? 71.215 1.732   4.682   1.00 100.81 ? 351 TYR C O   1 
ATOM   6263 C  CB  . TYR C 1 310 ? 70.003 4.102   2.924   1.00 100.44 ? 351 TYR C CB  1 
ATOM   6264 C  CG  . TYR C 1 310 ? 69.434 5.296   3.652   1.00 100.00 ? 351 TYR C CG  1 
ATOM   6265 C  CD1 . TYR C 1 310 ? 69.726 6.597   3.239   1.00 98.69  ? 351 TYR C CD1 1 
ATOM   6266 C  CD2 . TYR C 1 310 ? 68.623 5.127   4.775   1.00 100.26 ? 351 TYR C CD2 1 
ATOM   6267 C  CE1 . TYR C 1 310 ? 69.223 7.702   3.930   1.00 98.20  ? 351 TYR C CE1 1 
ATOM   6268 C  CE2 . TYR C 1 310 ? 68.117 6.221   5.472   1.00 99.58  ? 351 TYR C CE2 1 
ATOM   6269 C  CZ  . TYR C 1 310 ? 68.420 7.504   5.046   1.00 99.44  ? 351 TYR C CZ  1 
ATOM   6270 O  OH  . TYR C 1 310 ? 67.921 8.579   5.747   1.00 99.19  ? 351 TYR C OH  1 
ATOM   6271 N  N   . PRO C 1 311 ? 71.555 3.655   5.800   1.00 106.41 ? 352 PRO C N   1 
ATOM   6272 C  CA  . PRO C 1 311 ? 71.545 3.024   7.124   1.00 108.32 ? 352 PRO C CA  1 
ATOM   6273 C  C   . PRO C 1 311 ? 70.245 2.310   7.460   1.00 110.78 ? 352 PRO C C   1 
ATOM   6274 O  O   . PRO C 1 311 ? 69.175 2.918   7.463   1.00 110.54 ? 352 PRO C O   1 
ATOM   6275 C  CB  . PRO C 1 311 ? 71.823 4.195   8.065   1.00 107.69 ? 352 PRO C CB  1 
ATOM   6276 C  CG  . PRO C 1 311 ? 71.212 5.354   7.342   1.00 107.54 ? 352 PRO C CG  1 
ATOM   6277 C  CD  . PRO C 1 311 ? 71.687 5.118   5.928   1.00 107.30 ? 352 PRO C CD  1 
ATOM   6278 N  N   . ALA C 1 312 ? 70.347 1.016   7.747   1.00 113.59 ? 353 ALA C N   1 
ATOM   6279 C  CA  . ALA C 1 312 ? 69.181 0.215   8.094   1.00 115.84 ? 353 ALA C CA  1 
ATOM   6280 C  C   . ALA C 1 312 ? 68.407 0.910   9.205   1.00 117.56 ? 353 ALA C C   1 
ATOM   6281 O  O   . ALA C 1 312 ? 68.986 1.319   10.211  1.00 118.40 ? 353 ALA C O   1 
ATOM   6282 C  CB  . ALA C 1 312 ? 69.613 -1.175  8.546   1.00 116.40 ? 353 ALA C CB  1 
ATOM   6283 N  N   . THR C 1 313 ? 67.100 1.048   9.009   1.00 119.29 ? 354 THR C N   1 
ATOM   6284 C  CA  . THR C 1 313 ? 66.234 1.694   9.990   1.00 120.10 ? 354 THR C CA  1 
ATOM   6285 C  C   . THR C 1 313 ? 65.761 0.674   11.016  1.00 120.14 ? 354 THR C C   1 
ATOM   6286 O  O   . THR C 1 313 ? 66.302 -0.452  11.012  1.00 119.16 ? 354 THR C O   1 
ATOM   6287 C  CB  . THR C 1 313 ? 65.033 2.335   9.292   1.00 119.71 ? 354 THR C CB  1 
HETATM 6288 O  O   . HOH D 2 .   ? 12.018 31.306  3.351   1.00 32.30  ? 362 HOH A O   1 
HETATM 6289 O  O   . HOH D 2 .   ? 13.288 28.764  5.368   1.00 22.01  ? 363 HOH A O   1 
HETATM 6290 O  O   . HOH D 2 .   ? 34.828 30.631  -7.363  1.00 24.68  ? 364 HOH A O   1 
HETATM 6291 O  O   . HOH D 2 .   ? 14.040 29.420  36.826  1.00 25.89  ? 365 HOH A O   1 
HETATM 6292 O  O   . HOH D 2 .   ? 15.579 14.753  -5.666  1.00 30.09  ? 366 HOH A O   1 
HETATM 6293 O  O   . HOH D 2 .   ? -0.352 28.652  2.254   1.00 33.05  ? 367 HOH A O   1 
HETATM 6294 O  O   . HOH D 2 .   ? 3.979  22.556  19.139  1.00 35.08  ? 368 HOH A O   1 
HETATM 6295 O  O   . HOH D 2 .   ? 16.002 22.038  32.829  1.00 29.25  ? 369 HOH A O   1 
HETATM 6296 O  O   . HOH D 2 .   ? 10.111 25.877  31.457  1.00 38.28  ? 370 HOH A O   1 
HETATM 6297 O  O   . HOH D 2 .   ? 1.122  26.457  12.372  1.00 28.91  ? 371 HOH A O   1 
HETATM 6298 O  O   . HOH D 2 .   ? 6.390  31.431  0.290   1.00 30.08  ? 372 HOH A O   1 
HETATM 6299 O  O   . HOH D 2 .   ? 3.688  21.527  -2.695  1.00 31.99  ? 373 HOH A O   1 
HETATM 6300 O  O   . HOH D 2 .   ? 24.762 24.963  -8.332  1.00 32.15  ? 374 HOH A O   1 
HETATM 6301 O  O   . HOH D 2 .   ? 1.865  33.147  6.424   1.00 38.68  ? 375 HOH A O   1 
HETATM 6302 O  O   . HOH D 2 .   ? 1.810  29.371  14.518  1.00 38.31  ? 376 HOH A O   1 
HETATM 6303 O  O   . HOH D 2 .   ? 17.496 21.694  28.016  1.00 36.03  ? 377 HOH A O   1 
HETATM 6304 O  O   . HOH D 2 .   ? 16.521 32.162  -3.090  1.00 41.15  ? 378 HOH A O   1 
HETATM 6305 O  O   . HOH D 2 .   ? 25.657 23.415  6.511   1.00 33.87  ? 379 HOH A O   1 
HETATM 6306 O  O   . HOH D 2 .   ? 19.616 9.863   -1.800  1.00 37.98  ? 380 HOH A O   1 
HETATM 6307 O  O   . HOH D 2 .   ? 26.026 28.231  -9.542  1.00 38.82  ? 381 HOH A O   1 
HETATM 6308 O  O   . HOH D 2 .   ? 17.595 31.387  2.212   1.00 46.51  ? 382 HOH A O   1 
HETATM 6309 O  O   . HOH D 2 .   ? 9.572  23.448  36.339  1.00 46.93  ? 383 HOH A O   1 
HETATM 6310 O  O   . HOH D 2 .   ? 13.149 18.318  24.743  1.00 55.09  ? 384 HOH A O   1 
HETATM 6311 O  O   . HOH D 2 .   ? 34.604 17.648  0.092   1.00 52.41  ? 385 HOH A O   1 
HETATM 6312 O  O   . HOH D 2 .   ? 7.606  5.205   13.896  1.00 52.20  ? 386 HOH A O   1 
HETATM 6313 O  O   . HOH D 2 .   ? -3.134 31.193  2.772   1.00 52.46  ? 387 HOH A O   1 
HETATM 6314 O  O   . HOH D 2 .   ? 21.859 30.760  2.567   1.00 41.91  ? 388 HOH A O   1 
HETATM 6315 O  O   . HOH D 2 .   ? 21.579 7.838   -2.055  1.00 41.22  ? 389 HOH A O   1 
HETATM 6316 O  O   . HOH D 2 .   ? 9.150  19.411  -2.377  1.00 36.58  ? 390 HOH A O   1 
HETATM 6317 O  O   . HOH D 2 .   ? 25.321 12.195  -11.359 1.00 43.56  ? 391 HOH A O   1 
HETATM 6318 O  O   . HOH D 2 .   ? 22.912 11.720  -10.228 1.00 39.71  ? 392 HOH A O   1 
HETATM 6319 O  O   . HOH D 2 .   ? 20.140 21.697  20.766  1.00 63.14  ? 393 HOH A O   1 
HETATM 6320 O  O   . HOH D 2 .   ? 20.780 32.137  0.230   1.00 56.41  ? 394 HOH A O   1 
HETATM 6321 O  O   . HOH D 2 .   ? 25.189 21.809  -11.684 1.00 47.29  ? 395 HOH A O   1 
HETATM 6322 O  O   . HOH D 2 .   ? 8.618  32.968  0.634   1.00 59.34  ? 396 HOH A O   1 
HETATM 6323 O  O   . HOH D 2 .   ? 20.784 22.537  12.673  1.00 46.58  ? 397 HOH A O   1 
HETATM 6324 O  O   . HOH D 2 .   ? 21.317 5.923   -6.259  1.00 51.59  ? 398 HOH A O   1 
HETATM 6325 O  O   . HOH D 2 .   ? 19.571 10.298  -12.754 1.00 48.95  ? 399 HOH A O   1 
HETATM 6326 O  O   . HOH D 2 .   ? 36.844 15.726  2.231   1.00 47.57  ? 400 HOH A O   1 
HETATM 6327 O  O   . HOH D 2 .   ? 7.686  30.583  39.633  1.00 48.75  ? 401 HOH A O   1 
HETATM 6328 O  O   . HOH D 2 .   ? 5.433  30.335  28.745  1.00 46.22  ? 402 HOH A O   1 
HETATM 6329 O  O   . HOH D 2 .   ? 5.433  17.907  20.881  1.00 52.28  ? 403 HOH A O   1 
HETATM 6330 O  O   . HOH D 2 .   ? 5.386  8.372   15.845  1.00 47.21  ? 404 HOH A O   1 
HETATM 6331 O  O   . HOH D 2 .   ? 15.672 29.569  8.389   1.00 48.72  ? 405 HOH A O   1 
HETATM 6332 O  O   . HOH D 2 .   ? 2.489  18.186  18.604  1.00 44.66  ? 406 HOH A O   1 
HETATM 6333 O  O   . HOH D 2 .   ? 14.130 31.383  34.571  1.00 45.40  ? 407 HOH A O   1 
HETATM 6334 O  O   . HOH D 2 .   ? 18.335 32.083  -0.687  1.00 50.70  ? 408 HOH A O   1 
HETATM 6335 O  O   . HOH D 2 .   ? 32.459 16.970  10.194  1.00 48.77  ? 409 HOH A O   1 
HETATM 6336 O  O   . HOH D 2 .   ? 10.387 7.097   -2.372  1.00 38.62  ? 410 HOH A O   1 
HETATM 6337 O  O   . HOH D 2 .   ? 1.722  10.371  16.128  1.00 59.48  ? 411 HOH A O   1 
HETATM 6338 O  O   . HOH D 2 .   ? 7.107  36.574  4.135   1.00 61.74  ? 412 HOH A O   1 
HETATM 6339 O  O   . HOH D 2 .   ? 0.991  26.482  1.613   1.00 50.11  ? 413 HOH A O   1 
HETATM 6340 O  O   . HOH D 2 .   ? 10.738 11.431  -3.342  1.00 45.58  ? 414 HOH A O   1 
HETATM 6341 O  O   . HOH D 2 .   ? -2.242 22.192  10.032  1.00 52.20  ? 415 HOH A O   1 
HETATM 6342 O  O   . HOH D 2 .   ? 26.188 12.885  10.302  1.00 45.98  ? 416 HOH A O   1 
HETATM 6343 O  O   . HOH D 2 .   ? 25.535 3.628   -5.789  1.00 53.94  ? 417 HOH A O   1 
HETATM 6344 O  O   . HOH D 2 .   ? 3.455  2.951   8.769   1.00 54.97  ? 418 HOH A O   1 
HETATM 6345 O  O   . HOH D 2 .   ? 2.388  27.206  27.400  1.00 69.59  ? 419 HOH A O   1 
HETATM 6346 O  O   . HOH D 2 .   ? 11.210 9.057   -4.263  1.00 50.55  ? 420 HOH A O   1 
HETATM 6347 O  O   . HOH D 2 .   ? -0.375 22.362  12.088  1.00 45.24  ? 421 HOH A O   1 
HETATM 6348 O  O   . HOH D 2 .   ? 16.002 30.300  32.751  1.00 51.71  ? 422 HOH A O   1 
HETATM 6349 O  O   . HOH D 2 .   ? 19.470 4.262   4.175   1.00 46.72  ? 423 HOH A O   1 
HETATM 6350 O  O   . HOH D 2 .   ? 16.269 20.393  -10.776 1.00 42.52  ? 424 HOH A O   1 
HETATM 6351 O  O   . HOH D 2 .   ? 22.359 33.789  -2.319  1.00 57.96  ? 425 HOH A O   1 
HETATM 6352 O  O   . HOH D 2 .   ? 3.600  37.332  6.830   1.00 59.95  ? 426 HOH A O   1 
HETATM 6353 O  O   . HOH D 2 .   ? 17.456 35.446  6.844   1.00 62.92  ? 427 HOH A O   1 
HETATM 6354 O  O   . HOH D 2 .   ? 34.375 18.922  2.301   1.00 44.30  ? 428 HOH A O   1 
HETATM 6355 O  O   . HOH D 2 .   ? -2.949 17.376  9.831   1.00 65.38  ? 429 HOH A O   1 
HETATM 6356 O  O   . HOH D 2 .   ? 4.156  30.621  22.906  1.00 54.62  ? 430 HOH A O   1 
HETATM 6357 O  O   . HOH D 2 .   ? 8.050  9.827   -9.994  1.00 70.32  ? 431 HOH A O   1 
HETATM 6358 O  O   . HOH D 2 .   ? 31.889 28.124  -14.035 1.00 64.38  ? 432 HOH A O   1 
HETATM 6359 O  O   . HOH D 2 .   ? 31.829 20.906  -9.753  1.00 54.77  ? 433 HOH A O   1 
HETATM 6360 O  O   . HOH D 2 .   ? 12.028 31.538  29.275  1.00 63.64  ? 434 HOH A O   1 
HETATM 6361 O  O   . HOH D 2 .   ? 5.709  35.201  11.397  1.00 53.58  ? 435 HOH A O   1 
HETATM 6362 O  O   . HOH D 2 .   ? 1.472  35.277  4.901   1.00 71.92  ? 436 HOH A O   1 
HETATM 6363 O  O   . HOH D 2 .   ? 19.284 4.113   16.723  1.00 74.05  ? 437 HOH A O   1 
HETATM 6364 O  O   . HOH D 2 .   ? 6.919  10.205  -7.696  1.00 57.50  ? 438 HOH A O   1 
HETATM 6365 O  O   . HOH D 2 .   ? 20.153 6.344   -4.038  1.00 51.50  ? 439 HOH A O   1 
HETATM 6366 O  O   . HOH D 2 .   ? 8.911  7.214   17.208  1.00 56.85  ? 440 HOH A O   1 
HETATM 6367 O  O   . HOH D 2 .   ? 7.572  16.217  -1.186  1.00 60.20  ? 441 HOH A O   1 
HETATM 6368 O  O   . HOH D 2 .   ? 19.012 14.461  -6.152  1.00 51.83  ? 442 HOH A O   1 
HETATM 6369 O  O   . HOH D 2 .   ? 19.674 31.501  -12.720 1.00 69.15  ? 443 HOH A O   1 
HETATM 6370 O  O   . HOH D 2 .   ? 20.827 20.256  16.525  1.00 52.85  ? 444 HOH A O   1 
HETATM 6371 O  O   . HOH D 2 .   ? 14.277 33.480  38.971  1.00 46.15  ? 445 HOH A O   1 
HETATM 6372 O  O   . HOH D 2 .   ? 7.281  16.586  27.310  1.00 61.18  ? 446 HOH A O   1 
HETATM 6373 O  O   . HOH D 2 .   ? 12.337 33.405  10.734  1.00 72.21  ? 447 HOH A O   1 
HETATM 6374 O  O   . HOH D 2 .   ? 13.691 30.871  24.856  1.00 36.18  ? 448 HOH A O   1 
HETATM 6375 O  O   . HOH D 2 .   ? 26.881 5.563   -7.671  1.00 46.71  ? 449 HOH A O   1 
HETATM 6376 O  O   . HOH D 2 .   ? 29.751 32.564  -10.722 1.00 43.02  ? 450 HOH A O   1 
HETATM 6377 O  O   . HOH D 2 .   ? 4.256  32.779  -0.217  1.00 62.06  ? 451 HOH A O   1 
HETATM 6378 O  O   . HOH D 2 .   ? -3.828 6.034   2.995   1.00 71.80  ? 452 HOH A O   1 
HETATM 6379 O  O   . HOH D 2 .   ? 10.132 21.123  30.005  1.00 41.05  ? 453 HOH A O   1 
HETATM 6380 O  O   . HOH D 2 .   ? 17.892 19.476  26.934  1.00 53.70  ? 454 HOH A O   1 
HETATM 6381 O  O   . HOH D 2 .   ? 29.819 27.385  -11.712 1.00 51.49  ? 455 HOH A O   1 
HETATM 6382 O  O   . HOH D 2 .   ? 4.826  19.421  -3.174  1.00 62.89  ? 456 HOH A O   1 
HETATM 6383 O  O   . HOH D 2 .   ? 18.175 35.126  0.419   1.00 65.12  ? 457 HOH A O   1 
HETATM 6384 O  O   . HOH D 2 .   ? 6.171  21.839  37.216  1.00 50.39  ? 458 HOH A O   1 
HETATM 6385 O  O   . HOH D 2 .   ? -1.375 15.249  9.446   1.00 45.27  ? 459 HOH A O   1 
HETATM 6386 O  O   . HOH D 2 .   ? 9.654  14.525  -8.635  1.00 47.22  ? 460 HOH A O   1 
HETATM 6387 O  O   . HOH D 2 .   ? 9.627  19.174  27.784  1.00 79.20  ? 461 HOH A O   1 
HETATM 6388 O  O   . HOH D 2 .   ? 6.572  6.013   16.400  1.00 54.59  ? 462 HOH A O   1 
HETATM 6389 O  O   . HOH D 2 .   ? 12.825 34.844  12.833  1.00 54.79  ? 463 HOH A O   1 
HETATM 6390 O  O   . HOH D 2 .   ? 6.061  31.967  24.064  1.00 59.66  ? 464 HOH A O   1 
HETATM 6391 O  O   . HOH D 2 .   ? 10.445 5.421   16.731  1.00 64.52  ? 465 HOH A O   1 
HETATM 6392 O  O   . HOH D 2 .   ? 0.651  9.965   3.313   1.00 60.97  ? 466 HOH A O   1 
HETATM 6393 O  O   . HOH D 2 .   ? 12.978 8.407   -5.974  1.00 56.67  ? 467 HOH A O   1 
HETATM 6394 O  O   . HOH D 2 .   ? 19.503 28.734  23.248  1.00 76.53  ? 468 HOH A O   1 
HETATM 6395 O  O   . HOH D 2 .   ? -0.126 11.777  13.199  1.00 53.52  ? 469 HOH A O   1 
HETATM 6396 O  O   . HOH D 2 .   ? 13.764 -6.984  0.591   1.00 62.88  ? 470 HOH A O   1 
HETATM 6397 O  O   . HOH D 2 .   ? 5.309  15.692  -0.417  1.00 50.84  ? 471 HOH A O   1 
HETATM 6398 O  O   . HOH D 2 .   ? 27.798 23.666  -10.516 1.00 51.26  ? 472 HOH A O   1 
HETATM 6399 O  O   . HOH D 2 .   ? 9.072  0.132   12.725  1.00 75.84  ? 473 HOH A O   1 
HETATM 6400 O  O   . HOH D 2 .   ? 19.122 30.461  12.817  1.00 65.86  ? 474 HOH A O   1 
HETATM 6401 O  O   . HOH D 2 .   ? 17.611 32.707  33.295  1.00 68.32  ? 475 HOH A O   1 
HETATM 6402 O  O   . HOH D 2 .   ? 13.926 2.463   19.271  1.00 54.46  ? 476 HOH A O   1 
HETATM 6403 O  O   . HOH D 2 .   ? 18.392 10.400  20.699  1.00 59.15  ? 477 HOH A O   1 
HETATM 6404 O  O   . HOH D 2 .   ? 4.926  15.452  2.152   1.00 51.66  ? 478 HOH A O   1 
HETATM 6405 O  O   . HOH D 2 .   ? 28.990 14.569  11.424  1.00 62.35  ? 479 HOH A O   1 
HETATM 6406 O  O   . HOH D 2 .   ? 7.971  36.834  15.038  1.00 65.11  ? 480 HOH A O   1 
HETATM 6407 O  O   . HOH D 2 .   ? 15.384 10.014  19.521  1.00 60.03  ? 481 HOH A O   1 
HETATM 6408 O  O   . HOH D 2 .   ? 4.060  15.743  21.135  1.00 55.29  ? 482 HOH A O   1 
HETATM 6409 O  O   . HOH D 2 .   ? -3.716 20.100  9.656   1.00 60.59  ? 483 HOH A O   1 
HETATM 6410 O  O   . HOH D 2 .   ? 16.880 12.153  -13.974 1.00 63.05  ? 484 HOH A O   1 
HETATM 6411 O  O   . HOH D 2 .   ? 16.660 9.274   17.467  1.00 55.06  ? 485 HOH A O   1 
HETATM 6412 O  O   . HOH D 2 .   ? 24.721 32.746  8.117   1.00 57.74  ? 486 HOH A O   1 
HETATM 6413 O  O   . HOH D 2 .   ? 21.335 12.206  -12.914 1.00 52.18  ? 487 HOH A O   1 
HETATM 6414 O  O   . HOH D 2 .   ? 13.802 32.971  2.260   1.00 47.54  ? 488 HOH A O   1 
HETATM 6415 O  O   . HOH D 2 .   ? 8.250  38.405  7.737   1.00 55.68  ? 489 HOH A O   1 
HETATM 6416 O  O   . HOH D 2 .   ? 25.097 24.118  16.203  1.00 54.16  ? 490 HOH A O   1 
HETATM 6417 O  O   . HOH D 2 .   ? 15.971 7.297   -6.548  1.00 57.67  ? 491 HOH A O   1 
HETATM 6418 O  O   . HOH D 2 .   ? 28.902 5.165   12.258  1.00 71.61  ? 492 HOH A O   1 
HETATM 6419 O  O   . HOH D 2 .   ? 7.003  17.916  -4.114  1.00 55.41  ? 493 HOH A O   1 
HETATM 6420 O  O   . HOH D 2 .   ? 10.112 8.242   22.119  1.00 64.84  ? 494 HOH A O   1 
HETATM 6421 O  O   . HOH D 2 .   ? 4.000  20.001  19.717  1.00 57.07  ? 495 HOH A O   1 
HETATM 6422 O  O   . HOH D 2 .   ? 7.529  36.747  12.131  1.00 58.22  ? 496 HOH A O   1 
HETATM 6423 O  O   . HOH D 2 .   ? -0.235 28.691  12.614  1.00 58.60  ? 497 HOH A O   1 
HETATM 6424 O  O   . HOH D 2 .   ? 9.479  32.055  27.321  1.00 52.85  ? 498 HOH A O   1 
HETATM 6425 O  O   . HOH D 2 .   ? -6.607 3.906   2.601   1.00 63.16  ? 499 HOH A O   1 
HETATM 6426 O  O   . HOH D 2 .   ? -2.382 7.997   13.724  1.00 63.10  ? 500 HOH A O   1 
HETATM 6427 O  O   . HOH E 2 .   ? 44.037 60.792  7.245   1.00 36.11  ? 362 HOH B O   1 
HETATM 6428 O  O   . HOH E 2 .   ? 37.958 40.481  -5.683  1.00 32.55  ? 363 HOH B O   1 
HETATM 6429 O  O   . HOH E 2 .   ? 24.942 35.274  -2.060  1.00 37.75  ? 364 HOH B O   1 
HETATM 6430 O  O   . HOH E 2 .   ? 33.365 35.326  -6.425  1.00 29.93  ? 365 HOH B O   1 
HETATM 6431 O  O   . HOH E 2 .   ? 51.225 54.650  10.105  1.00 36.10  ? 366 HOH B O   1 
HETATM 6432 O  O   . HOH E 2 .   ? 30.104 40.433  0.215   1.00 37.25  ? 367 HOH B O   1 
HETATM 6433 O  O   . HOH E 2 .   ? 30.740 35.924  -7.838  1.00 42.47  ? 368 HOH B O   1 
HETATM 6434 O  O   . HOH E 2 .   ? 32.762 20.690  3.823   1.00 40.44  ? 369 HOH B O   1 
HETATM 6435 O  O   . HOH E 2 .   ? 38.674 30.935  11.003  1.00 44.70  ? 370 HOH B O   1 
HETATM 6436 O  O   . HOH E 2 .   ? 49.983 56.122  8.629   1.00 34.16  ? 371 HOH B O   1 
HETATM 6437 O  O   . HOH E 2 .   ? 30.268 40.018  -9.936  1.00 41.20  ? 372 HOH B O   1 
HETATM 6438 O  O   . HOH E 2 .   ? 46.092 61.116  11.107  1.00 43.73  ? 373 HOH B O   1 
HETATM 6439 O  O   . HOH E 2 .   ? 38.967 53.645  3.538   1.00 44.67  ? 374 HOH B O   1 
HETATM 6440 O  O   . HOH E 2 .   ? 24.354 31.251  4.035   1.00 36.22  ? 375 HOH B O   1 
HETATM 6441 O  O   . HOH E 2 .   ? 36.552 29.571  -12.908 1.00 43.69  ? 376 HOH B O   1 
HETATM 6442 O  O   . HOH E 2 .   ? 41.424 58.644  6.722   1.00 44.71  ? 377 HOH B O   1 
HETATM 6443 O  O   . HOH E 2 .   ? 35.897 48.442  -0.579  1.00 39.71  ? 378 HOH B O   1 
HETATM 6444 O  O   . HOH E 2 .   ? 56.539 34.835  -4.471  1.00 49.02  ? 379 HOH B O   1 
HETATM 6445 O  O   . HOH E 2 .   ? 33.928 39.216  0.424   1.00 32.08  ? 380 HOH B O   1 
HETATM 6446 O  O   . HOH E 2 .   ? 34.332 22.206  0.897   1.00 47.42  ? 381 HOH B O   1 
HETATM 6447 O  O   . HOH E 2 .   ? 41.160 55.938  9.908   1.00 42.15  ? 382 HOH B O   1 
HETATM 6448 O  O   . HOH E 2 .   ? 29.411 33.575  -8.319  1.00 44.97  ? 383 HOH B O   1 
HETATM 6449 O  O   . HOH E 2 .   ? 51.596 25.550  -9.418  1.00 57.08  ? 384 HOH B O   1 
HETATM 6450 O  O   . HOH E 2 .   ? 48.426 37.254  -10.665 1.00 45.07  ? 385 HOH B O   1 
HETATM 6451 O  O   . HOH E 2 .   ? 34.513 46.652  -3.538  1.00 59.17  ? 386 HOH B O   1 
HETATM 6452 O  O   . HOH E 2 .   ? 38.102 52.238  15.505  1.00 54.34  ? 387 HOH B O   1 
HETATM 6453 O  O   . HOH E 2 .   ? 38.764 46.209  -3.098  1.00 47.46  ? 388 HOH B O   1 
HETATM 6454 O  O   . HOH E 2 .   ? 59.783 45.738  12.110  1.00 60.87  ? 389 HOH B O   1 
HETATM 6455 O  O   . HOH E 2 .   ? 47.260 50.847  14.754  1.00 43.33  ? 390 HOH B O   1 
HETATM 6456 O  O   . HOH E 2 .   ? 31.480 38.462  1.140   1.00 42.63  ? 391 HOH B O   1 
HETATM 6457 O  O   . HOH E 2 .   ? 42.957 25.836  -13.522 1.00 74.93  ? 392 HOH B O   1 
HETATM 6458 O  O   . HOH E 2 .   ? 48.370 39.870  -9.555  1.00 63.05  ? 393 HOH B O   1 
HETATM 6459 O  O   . HOH E 2 .   ? 54.796 34.831  -1.654  1.00 41.81  ? 394 HOH B O   1 
HETATM 6460 O  O   . HOH E 2 .   ? 42.615 50.777  14.515  1.00 44.89  ? 395 HOH B O   1 
HETATM 6461 O  O   . HOH E 2 .   ? 51.592 26.843  -3.622  1.00 53.65  ? 396 HOH B O   1 
HETATM 6462 O  O   . HOH E 2 .   ? 52.596 55.118  -0.146  1.00 53.34  ? 397 HOH B O   1 
HETATM 6463 O  O   . HOH E 2 .   ? 51.435 39.822  -9.132  1.00 59.77  ? 398 HOH B O   1 
HETATM 6464 O  O   . HOH E 2 .   ? 33.150 45.895  10.981  1.00 70.19  ? 399 HOH B O   1 
HETATM 6465 O  O   . HOH E 2 .   ? 46.726 37.462  -12.327 1.00 56.04  ? 400 HOH B O   1 
HETATM 6466 O  O   . HOH E 2 .   ? 31.975 43.896  -5.399  1.00 52.39  ? 401 HOH B O   1 
HETATM 6467 O  O   . HOH E 2 .   ? 37.977 26.679  10.662  1.00 64.40  ? 402 HOH B O   1 
HETATM 6468 O  O   . HOH E 2 .   ? 32.729 41.655  8.150   1.00 47.33  ? 403 HOH B O   1 
HETATM 6469 O  O   . HOH E 2 .   ? 61.201 46.349  3.083   1.00 48.45  ? 404 HOH B O   1 
HETATM 6470 O  O   . HOH E 2 .   ? 41.201 28.013  -10.899 1.00 49.25  ? 405 HOH B O   1 
HETATM 6471 O  O   . HOH E 2 .   ? 29.439 45.102  -9.193  1.00 50.56  ? 406 HOH B O   1 
HETATM 6472 O  O   . HOH E 2 .   ? 51.113 55.891  -2.172  1.00 49.12  ? 407 HOH B O   1 
HETATM 6473 O  O   . HOH E 2 .   ? 27.488 45.313  4.386   1.00 61.50  ? 408 HOH B O   1 
HETATM 6474 O  O   . HOH E 2 .   ? 45.911 49.218  -3.147  1.00 64.95  ? 409 HOH B O   1 
HETATM 6475 O  O   . HOH E 2 .   ? 64.745 44.912  4.037   1.00 66.26  ? 410 HOH B O   1 
HETATM 6476 O  O   . HOH E 2 .   ? 45.210 50.833  16.775  1.00 57.28  ? 411 HOH B O   1 
HETATM 6477 O  O   . HOH E 2 .   ? 43.414 40.740  17.120  1.00 57.78  ? 412 HOH B O   1 
HETATM 6478 O  O   . HOH E 2 .   ? 30.865 51.664  6.773   1.00 43.06  ? 413 HOH B O   1 
HETATM 6479 O  O   . HOH E 2 .   ? 32.142 52.352  4.453   1.00 47.80  ? 414 HOH B O   1 
HETATM 6480 O  O   . HOH E 2 .   ? 26.204 39.848  -8.662  1.00 62.14  ? 415 HOH B O   1 
HETATM 6481 O  O   . HOH E 2 .   ? 28.275 39.629  -1.783  1.00 50.26  ? 416 HOH B O   1 
HETATM 6482 O  O   . HOH E 2 .   ? 33.663 50.528  24.263  1.00 66.53  ? 417 HOH B O   1 
HETATM 6483 O  O   . HOH E 2 .   ? 36.586 47.491  -2.783  1.00 46.57  ? 418 HOH B O   1 
HETATM 6484 O  O   . HOH E 2 .   ? 36.372 21.455  2.187   1.00 57.46  ? 419 HOH B O   1 
HETATM 6485 O  O   . HOH E 2 .   ? 26.115 66.338  19.304  1.00 80.52  ? 420 HOH B O   1 
HETATM 6486 O  O   . HOH E 2 .   ? 45.146 26.565  3.500   1.00 45.55  ? 421 HOH B O   1 
HETATM 6487 O  O   . HOH E 2 .   ? 26.459 48.325  10.960  1.00 58.86  ? 422 HOH B O   1 
HETATM 6488 O  O   . HOH E 2 .   ? 61.231 33.089  14.782  1.00 66.86  ? 423 HOH B O   1 
HETATM 6489 O  O   . HOH E 2 .   ? 42.103 36.764  -12.068 1.00 77.62  ? 424 HOH B O   1 
HETATM 6490 O  O   . HOH E 2 .   ? 39.290 46.226  -9.426  1.00 50.11  ? 425 HOH B O   1 
HETATM 6491 O  O   . HOH E 2 .   ? 28.643 41.408  2.138   1.00 57.78  ? 426 HOH B O   1 
HETATM 6492 O  O   . HOH E 2 .   ? 45.250 55.267  2.003   1.00 50.09  ? 427 HOH B O   1 
HETATM 6493 O  O   . HOH E 2 .   ? 50.714 35.345  -11.341 1.00 56.40  ? 428 HOH B O   1 
HETATM 6494 O  O   . HOH E 2 .   ? 47.462 25.805  7.234   1.00 70.97  ? 429 HOH B O   1 
HETATM 6495 O  O   . HOH E 2 .   ? 32.186 65.398  7.886   1.00 63.08  ? 430 HOH B O   1 
HETATM 6496 O  O   . HOH E 2 .   ? 27.281 55.254  16.156  1.00 57.84  ? 431 HOH B O   1 
HETATM 6497 O  O   . HOH E 2 .   ? 33.356 48.874  -0.332  1.00 73.12  ? 432 HOH B O   1 
HETATM 6498 O  O   . HOH E 2 .   ? 27.477 30.586  7.086   1.00 64.24  ? 433 HOH B O   1 
HETATM 6499 O  O   . HOH E 2 .   ? 39.408 57.561  5.776   1.00 53.91  ? 434 HOH B O   1 
HETATM 6500 O  O   . HOH E 2 .   ? 25.287 34.992  4.035   1.00 58.95  ? 435 HOH B O   1 
HETATM 6501 O  O   . HOH E 2 .   ? 41.814 47.008  21.503  1.00 64.25  ? 436 HOH B O   1 
HETATM 6502 O  O   . HOH E 2 .   ? 30.719 27.015  7.737   1.00 53.71  ? 437 HOH B O   1 
HETATM 6503 O  O   . HOH E 2 .   ? 42.877 48.181  17.593  1.00 47.55  ? 438 HOH B O   1 
HETATM 6504 O  O   . HOH E 2 .   ? 40.470 56.018  3.522   1.00 56.72  ? 439 HOH B O   1 
HETATM 6505 O  O   . HOH E 2 .   ? 30.590 44.432  -2.678  1.00 54.10  ? 440 HOH B O   1 
HETATM 6506 O  O   . HOH E 2 .   ? 22.705 38.298  -8.818  1.00 66.55  ? 441 HOH B O   1 
HETATM 6507 O  O   . HOH E 2 .   ? 45.699 59.120  1.239   1.00 54.97  ? 442 HOH B O   1 
HETATM 6508 O  O   . HOH E 2 .   ? 57.494 48.865  12.340  1.00 60.58  ? 443 HOH B O   1 
HETATM 6509 O  O   . HOH E 2 .   ? 25.084 36.931  -0.194  1.00 44.97  ? 444 HOH B O   1 
HETATM 6510 O  O   . HOH E 2 .   ? 35.341 20.193  -1.040  1.00 53.86  ? 445 HOH B O   1 
HETATM 6511 O  O   . HOH E 2 .   ? 33.497 62.994  7.476   1.00 49.59  ? 446 HOH B O   1 
HETATM 6512 O  O   . HOH E 2 .   ? 27.809 41.101  -10.117 1.00 52.27  ? 447 HOH B O   1 
HETATM 6513 O  O   . HOH E 2 .   ? 46.821 34.294  -15.401 1.00 64.24  ? 448 HOH B O   1 
HETATM 6514 O  O   . HOH E 2 .   ? 45.552 48.428  17.177  1.00 55.05  ? 449 HOH B O   1 
HETATM 6515 O  O   . HOH E 2 .   ? 37.415 58.829  9.341   1.00 66.82  ? 450 HOH B O   1 
HETATM 6516 O  O   . HOH E 2 .   ? 37.300 42.300  21.958  1.00 62.07  ? 451 HOH B O   1 
HETATM 6517 O  O   . HOH E 2 .   ? 44.722 62.864  12.428  1.00 54.70  ? 452 HOH B O   1 
HETATM 6518 O  O   . HOH E 2 .   ? 52.047 37.086  -9.483  1.00 54.52  ? 453 HOH B O   1 
HETATM 6519 O  O   . HOH E 2 .   ? 46.550 56.639  19.296  1.00 57.27  ? 454 HOH B O   1 
HETATM 6520 O  O   . HOH E 2 .   ? 30.364 37.256  -10.542 1.00 55.83  ? 455 HOH B O   1 
HETATM 6521 O  O   . HOH E 2 .   ? 26.409 39.009  7.816   1.00 62.75  ? 456 HOH B O   1 
HETATM 6522 O  O   . HOH E 2 .   ? 52.447 31.096  -12.338 1.00 59.38  ? 457 HOH B O   1 
HETATM 6523 O  O   . HOH E 2 .   ? 37.484 29.385  19.584  1.00 95.23  ? 458 HOH B O   1 
HETATM 6524 O  O   . HOH E 2 .   ? 53.546 30.232  -4.720  1.00 62.64  ? 459 HOH B O   1 
HETATM 6525 O  O   . HOH F 2 .   ? 25.629 17.484  -7.875  1.00 21.75  ? 362 HOH C O   1 
HETATM 6526 O  O   . HOH F 2 .   ? 41.439 16.275  -11.101 1.00 34.45  ? 363 HOH C O   1 
HETATM 6527 O  O   . HOH F 2 .   ? 38.334 -3.824  -5.277  1.00 39.97  ? 364 HOH C O   1 
HETATM 6528 O  O   . HOH F 2 .   ? 46.067 15.175  -12.384 1.00 46.46  ? 365 HOH C O   1 
HETATM 6529 O  O   . HOH F 2 .   ? 54.042 -13.546 2.318   1.00 42.91  ? 366 HOH C O   1 
HETATM 6530 O  O   . HOH F 2 .   ? 39.316 22.250  3.055   1.00 49.85  ? 367 HOH C O   1 
HETATM 6531 O  O   . HOH F 2 .   ? 35.120 12.635  -12.414 1.00 52.23  ? 368 HOH C O   1 
HETATM 6532 O  O   . HOH F 2 .   ? 65.917 -1.909  -4.026  1.00 43.23  ? 369 HOH C O   1 
HETATM 6533 O  O   . HOH F 2 .   ? 44.786 -8.110  13.849  1.00 63.33  ? 370 HOH C O   1 
HETATM 6534 O  O   . HOH F 2 .   ? 57.166 -10.456 -6.711  1.00 37.65  ? 371 HOH C O   1 
HETATM 6535 O  O   . HOH F 2 .   ? 38.302 3.890   9.207   1.00 50.87  ? 372 HOH C O   1 
HETATM 6536 O  O   . HOH F 2 .   ? 49.846 -13.737 3.555   1.00 44.13  ? 373 HOH C O   1 
HETATM 6537 O  O   . HOH F 2 .   ? 42.275 -9.055  13.165  1.00 60.87  ? 374 HOH C O   1 
HETATM 6538 O  O   . HOH F 2 .   ? 50.027 -16.398 3.759   1.00 54.45  ? 375 HOH C O   1 
HETATM 6539 O  O   . HOH F 2 .   ? 46.024 -14.922 -4.372  1.00 38.93  ? 376 HOH C O   1 
HETATM 6540 O  O   . HOH F 2 .   ? 62.848 -1.405  2.145   1.00 56.59  ? 377 HOH C O   1 
HETATM 6541 O  O   . HOH F 2 .   ? 32.435 3.050   -4.013  1.00 50.94  ? 378 HOH C O   1 
HETATM 6542 O  O   . HOH F 2 .   ? 63.393 -10.558 -6.098  1.00 42.69  ? 379 HOH C O   1 
HETATM 6543 O  O   . HOH F 2 .   ? 60.948 -5.665  2.327   1.00 44.11  ? 380 HOH C O   1 
HETATM 6544 O  O   . HOH F 2 .   ? 30.155 17.196  -13.371 1.00 48.44  ? 381 HOH C O   1 
HETATM 6545 O  O   . HOH F 2 .   ? 51.185 -12.847 -12.501 1.00 54.45  ? 382 HOH C O   1 
HETATM 6546 O  O   . HOH F 2 .   ? 31.623 12.589  -13.320 1.00 49.35  ? 383 HOH C O   1 
HETATM 6547 O  O   . HOH F 2 .   ? 37.986 8.217   1.520   1.00 49.52  ? 384 HOH C O   1 
HETATM 6548 O  O   . HOH F 2 .   ? 41.574 1.718   4.647   1.00 52.91  ? 385 HOH C O   1 
HETATM 6549 O  O   . HOH F 2 .   ? 54.056 5.705   -12.715 1.00 45.73  ? 386 HOH C O   1 
HETATM 6550 O  O   . HOH F 2 .   ? 51.662 12.711  -7.335  1.00 40.25  ? 387 HOH C O   1 
HETATM 6551 O  O   . HOH F 2 .   ? 48.555 8.968   -13.073 1.00 42.98  ? 388 HOH C O   1 
HETATM 6552 O  O   . HOH F 2 .   ? 38.178 -7.965  -13.226 1.00 53.79  ? 389 HOH C O   1 
HETATM 6553 O  O   . HOH F 2 .   ? 31.394 2.217   -6.261  1.00 64.04  ? 390 HOH C O   1 
HETATM 6554 O  O   . HOH F 2 .   ? 50.469 16.622  -17.339 1.00 60.46  ? 391 HOH C O   1 
HETATM 6555 O  O   . HOH F 2 .   ? 62.056 7.851   -0.429  1.00 57.12  ? 392 HOH C O   1 
HETATM 6556 O  O   . HOH F 2 .   ? 52.570 14.984  -6.898  1.00 51.08  ? 393 HOH C O   1 
HETATM 6557 O  O   . HOH F 2 .   ? 37.701 18.527  1.874   1.00 54.06  ? 394 HOH C O   1 
HETATM 6558 O  O   . HOH F 2 .   ? 39.153 1.695   -15.083 1.00 48.84  ? 395 HOH C O   1 
HETATM 6559 O  O   . HOH F 2 .   ? 51.664 22.787  -9.459  1.00 53.52  ? 396 HOH C O   1 
HETATM 6560 O  O   . HOH F 2 .   ? 60.625 2.024   -11.739 1.00 62.82  ? 397 HOH C O   1 
HETATM 6561 O  O   . HOH F 2 .   ? 54.110 21.898  -7.952  1.00 61.93  ? 398 HOH C O   1 
HETATM 6562 O  O   . HOH F 2 .   ? 61.970 -2.887  -12.561 1.00 67.38  ? 399 HOH C O   1 
HETATM 6563 O  O   . HOH F 2 .   ? 58.216 6.665   -11.409 1.00 48.71  ? 400 HOH C O   1 
HETATM 6564 O  O   . HOH F 2 .   ? 36.337 -4.977  -7.746  1.00 57.34  ? 401 HOH C O   1 
HETATM 6565 O  O   . HOH F 2 .   ? 33.751 0.025   -6.161  1.00 69.97  ? 402 HOH C O   1 
HETATM 6566 O  O   . HOH F 2 .   ? 54.319 15.478  -8.927  1.00 50.90  ? 403 HOH C O   1 
HETATM 6567 O  O   . HOH F 2 .   ? 43.734 -17.141 -2.956  1.00 56.42  ? 404 HOH C O   1 
HETATM 6568 O  O   . HOH F 2 .   ? 62.495 1.766   -9.558  1.00 51.08  ? 405 HOH C O   1 
HETATM 6569 O  O   . HOH F 2 .   ? 54.361 23.927  -1.461  1.00 61.99  ? 406 HOH C O   1 
HETATM 6570 O  O   . HOH F 2 .   ? 60.783 -2.004  5.831   1.00 63.52  ? 407 HOH C O   1 
HETATM 6571 O  O   . HOH F 2 .   ? 37.208 15.500  -15.068 1.00 52.04  ? 408 HOH C O   1 
HETATM 6572 O  O   . HOH F 2 .   ? 47.050 17.488  -14.216 1.00 63.49  ? 409 HOH C O   1 
HETATM 6573 O  O   . HOH F 2 .   ? 40.685 -2.288  -14.961 1.00 64.74  ? 410 HOH C O   1 
HETATM 6574 O  O   . HOH F 2 .   ? 35.294 5.930   -18.735 1.00 63.06  ? 411 HOH C O   1 
HETATM 6575 O  O   . HOH F 2 .   ? 34.579 4.143   6.590   1.00 81.33  ? 412 HOH C O   1 
HETATM 6576 O  O   . HOH F 2 .   ? 50.973 5.068   -18.052 1.00 68.48  ? 413 HOH C O   1 
HETATM 6577 O  O   . HOH F 2 .   ? 33.940 -6.681  -0.198  1.00 63.68  ? 414 HOH C O   1 
HETATM 6578 O  O   . HOH F 2 .   ? 53.315 3.188   -14.618 1.00 59.97  ? 415 HOH C O   1 
HETATM 6579 O  O   . HOH F 2 .   ? 35.461 0.829   -14.732 1.00 74.76  ? 416 HOH C O   1 
HETATM 6580 O  O   . HOH F 2 .   ? 66.587 -10.690 -6.236  1.00 54.12  ? 417 HOH C O   1 
HETATM 6581 O  O   . HOH F 2 .   ? 48.361 -17.006 -4.193  1.00 46.44  ? 418 HOH C O   1 
HETATM 6582 O  O   . HOH F 2 .   ? 49.591 -16.050 -6.463  1.00 50.20  ? 419 HOH C O   1 
HETATM 6583 O  O   . HOH F 2 .   ? 40.349 -9.774  11.332  1.00 55.65  ? 420 HOH C O   1 
HETATM 6584 O  O   . HOH F 2 .   ? 31.328 4.292   -1.805  1.00 49.86  ? 421 HOH C O   1 
HETATM 6585 O  O   . HOH F 2 .   ? 53.824 -12.428 -12.290 1.00 54.94  ? 422 HOH C O   1 
HETATM 6586 O  O   . HOH F 2 .   ? 41.681 0.513   -15.325 1.00 55.79  ? 423 HOH C O   1 
HETATM 6587 O  O   . HOH F 2 .   ? 32.781 0.808   -12.106 1.00 51.67  ? 424 HOH C O   1 
HETATM 6588 O  O   . HOH F 2 .   ? 38.124 20.135  -0.240  1.00 42.98  ? 425 HOH C O   1 
HETATM 6589 O  O   . HOH F 2 .   ? 53.793 17.437  -10.297 1.00 60.91  ? 426 HOH C O   1 
HETATM 6590 O  O   . HOH F 2 .   ? 42.368 -13.776 -10.692 1.00 72.75  ? 427 HOH C O   1 
HETATM 6591 O  O   . HOH F 2 .   ? 39.684 -0.099  -11.973 1.00 42.11  ? 428 HOH C O   1 
HETATM 6592 O  O   . HOH F 2 .   ? 53.787 -9.875  7.552   1.00 61.49  ? 429 HOH C O   1 
HETATM 6593 O  O   . HOH F 2 .   ? 77.533 24.258  -8.238  1.00 64.16  ? 430 HOH C O   1 
HETATM 6594 O  O   . HOH F 2 .   ? 41.102 7.129   -16.703 1.00 56.06  ? 431 HOH C O   1 
HETATM 6595 O  O   . HOH F 2 .   ? 60.534 -4.232  -10.668 1.00 55.49  ? 432 HOH C O   1 
HETATM 6596 O  O   . HOH F 2 .   ? 66.704 0.347   -5.446  1.00 69.37  ? 433 HOH C O   1 
HETATM 6597 O  O   . HOH F 2 .   ? 44.791 2.979   -17.458 1.00 67.67  ? 434 HOH C O   1 
HETATM 6598 O  O   . HOH F 2 .   ? 57.576 12.363  -1.656  1.00 53.68  ? 435 HOH C O   1 
HETATM 6599 O  O   . HOH F 2 .   ? 56.949 -12.446 2.754   1.00 55.58  ? 436 HOH C O   1 
HETATM 6600 O  O   . HOH F 2 .   ? 37.982 -1.462  -13.430 1.00 49.91  ? 437 HOH C O   1 
HETATM 6601 O  O   . HOH F 2 .   ? 60.641 -5.464  7.563   1.00 65.61  ? 438 HOH C O   1 
HETATM 6602 O  O   . HOH F 2 .   ? 45.945 20.258  -13.932 1.00 64.59  ? 439 HOH C O   1 
HETATM 6603 O  O   . HOH F 2 .   ? 29.045 4.244   -9.196  1.00 50.88  ? 440 HOH C O   1 
HETATM 6604 O  O   . HOH F 2 .   ? 37.408 -15.352 -4.736  1.00 65.98  ? 441 HOH C O   1 
HETATM 6605 O  O   . HOH F 2 .   ? 40.555 4.782   -17.272 1.00 62.36  ? 442 HOH C O   1 
HETATM 6606 O  O   . HOH F 2 .   ? 35.198 20.431  -10.617 1.00 56.45  ? 443 HOH C O   1 
HETATM 6607 O  O   . HOH F 2 .   ? 33.288 -1.602  -13.041 1.00 61.12  ? 444 HOH C O   1 
HETATM 6608 O  O   . HOH F 2 .   ? 25.634 13.679  -13.115 1.00 55.54  ? 445 HOH C O   1 
HETATM 6609 O  O   . HOH F 2 .   ? 55.818 7.453   -13.037 1.00 57.37  ? 446 HOH C O   1 
HETATM 6610 O  O   . HOH F 2 .   ? 42.558 -19.665 -9.917  1.00 58.45  ? 447 HOH C O   1 
HETATM 6611 O  O   . HOH F 2 .   ? 51.387 24.637  -2.128  1.00 59.54  ? 448 HOH C O   1 
HETATM 6612 O  O   . HOH F 2 .   ? 55.803 0.240   10.327  1.00 58.83  ? 449 HOH C O   1 
HETATM 6613 O  O   . HOH F 2 .   ? 52.084 19.521  -17.212 1.00 58.88  ? 450 HOH C O   1 
HETATM 6614 O  O   . HOH F 2 .   ? 36.292 -10.888 6.020   1.00 56.88  ? 451 HOH C O   1 
HETATM 6615 O  O   . HOH F 2 .   ? 52.824 -15.096 -11.618 1.00 56.00  ? 452 HOH C O   1 
HETATM 6616 O  O   . HOH F 2 .   ? 28.034 19.025  -14.601 1.00 58.23  ? 453 HOH C O   1 
HETATM 6617 O  O   . HOH F 2 .   ? 47.499 11.497  6.435   1.00 62.49  ? 454 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MSE 1   42  42  MSE MSE A . n 
A 1 2   THR 2   43  43  THR THR A . n 
A 1 3   PRO 3   44  44  PRO PRO A . n 
A 1 4   ALA 4   45  45  ALA ALA A . n 
A 1 5   SER 5   46  46  SER SER A . n 
A 1 6   TYR 6   47  47  TYR TYR A . n 
A 1 7   ASN 7   48  48  ASN ASN A . n 
A 1 8   LEU 8   49  49  LEU LEU A . n 
A 1 9   ALA 9   50  50  ALA ALA A . n 
A 1 10  VAL 10  51  51  VAL VAL A . n 
A 1 11  ARG 11  52  52  ARG ARG A . n 
A 1 12  ARG 12  53  53  ARG ARG A . n 
A 1 13  ALA 13  54  54  ALA ALA A . n 
A 1 14  ALA 14  55  55  ALA ALA A . n 
A 1 15  PRO 15  56  56  PRO PRO A . n 
A 1 16  ALA 16  57  57  ALA ALA A . n 
A 1 17  VAL 17  58  58  VAL VAL A . n 
A 1 18  VAL 18  59  59  VAL VAL A . n 
A 1 19  ASN 19  60  60  ASN ASN A . n 
A 1 20  VAL 20  61  61  VAL VAL A . n 
A 1 21  TYR 21  62  62  TYR TYR A . n 
A 1 22  ASN 22  63  63  ASN ASN A . n 
A 1 23  ARG 23  64  64  ARG ARG A . n 
A 1 24  GLY 24  65  65  GLY GLY A . n 
A 1 25  LEU 25  66  66  LEU LEU A . n 
A 1 26  ASN 26  67  67  ASN ASN A . n 
A 1 27  THR 27  68  68  THR THR A . n 
A 1 28  ASN 28  69  69  ASN ASN A . n 
A 1 29  SER 29  70  70  SER SER A . n 
A 1 30  HIS 30  71  71  HIS HIS A . n 
A 1 31  ASN 31  72  72  ASN ASN A . n 
A 1 32  GLN 32  73  73  GLN GLN A . n 
A 1 33  LEU 33  74  74  LEU LEU A . n 
A 1 34  GLU 34  75  75  GLU GLU A . n 
A 1 35  ILE 35  76  76  ILE ILE A . n 
A 1 36  ARG 36  77  77  ARG ARG A . n 
A 1 37  THR 37  78  78  THR THR A . n 
A 1 38  LEU 38  79  79  LEU LEU A . n 
A 1 39  GLY 39  80  80  GLY GLY A . n 
A 1 40  SER 40  81  81  SER SER A . n 
A 1 41  GLY 41  82  82  GLY GLY A . n 
A 1 42  VAL 42  83  83  VAL VAL A . n 
A 1 43  ILE 43  84  84  ILE ILE A . n 
A 1 44  MSE 44  85  85  MSE MSE A . n 
A 1 45  ASP 45  86  86  ASP ASP A . n 
A 1 46  GLN 46  87  87  GLN GLN A . n 
A 1 47  ARG 47  88  88  ARG ARG A . n 
A 1 48  GLY 48  89  89  GLY GLY A . n 
A 1 49  TYR 49  90  90  TYR TYR A . n 
A 1 50  ILE 50  91  91  ILE ILE A . n 
A 1 51  ILE 51  92  92  ILE ILE A . n 
A 1 52  THR 52  93  93  THR THR A . n 
A 1 53  ASN 53  94  94  ASN ASN A . n 
A 1 54  LYS 54  95  95  LYS LYS A . n 
A 1 55  HIS 55  96  96  HIS HIS A . n 
A 1 56  VAL 56  97  97  VAL VAL A . n 
A 1 57  ILE 57  98  98  ILE ILE A . n 
A 1 58  ASN 58  99  99  ASN ASN A . n 
A 1 59  ASP 59  100 100 ASP ASP A . n 
A 1 60  ALA 60  101 101 ALA ALA A . n 
A 1 61  ASP 61  102 102 ASP ASP A . n 
A 1 62  GLN 62  103 103 GLN GLN A . n 
A 1 63  ILE 63  104 104 ILE ILE A . n 
A 1 64  ILE 64  105 105 ILE ILE A . n 
A 1 65  VAL 65  106 106 VAL VAL A . n 
A 1 66  ALA 66  107 107 ALA ALA A . n 
A 1 67  LEU 67  108 108 LEU LEU A . n 
A 1 68  GLN 68  109 109 GLN GLN A . n 
A 1 69  ASP 69  110 110 ASP ASP A . n 
A 1 70  GLY 70  111 111 GLY GLY A . n 
A 1 71  ARG 71  112 112 ARG ARG A . n 
A 1 72  VAL 72  113 113 VAL VAL A . n 
A 1 73  PHE 73  114 114 PHE PHE A . n 
A 1 74  GLU 74  115 115 GLU GLU A . n 
A 1 75  ALA 75  116 116 ALA ALA A . n 
A 1 76  LEU 76  117 117 LEU LEU A . n 
A 1 77  LEU 77  118 118 LEU LEU A . n 
A 1 78  VAL 78  119 119 VAL VAL A . n 
A 1 79  GLY 79  120 120 GLY GLY A . n 
A 1 80  SER 80  121 121 SER SER A . n 
A 1 81  ASP 81  122 122 ASP ASP A . n 
A 1 82  SER 82  123 123 SER SER A . n 
A 1 83  LEU 83  124 124 LEU LEU A . n 
A 1 84  THR 84  125 125 THR THR A . n 
A 1 85  ASP 85  126 126 ASP ASP A . n 
A 1 86  LEU 86  127 127 LEU LEU A . n 
A 1 87  ALA 87  128 128 ALA ALA A . n 
A 1 88  VAL 88  129 129 VAL VAL A . n 
A 1 89  LEU 89  130 130 LEU LEU A . n 
A 1 90  LYS 90  131 131 LYS LYS A . n 
A 1 91  ILE 91  132 132 ILE ILE A . n 
A 1 92  ASN 92  133 133 ASN ASN A . n 
A 1 93  ALA 93  134 134 ALA ALA A . n 
A 1 94  THR 94  135 135 THR THR A . n 
A 1 95  GLY 95  136 136 GLY GLY A . n 
A 1 96  GLY 96  137 137 GLY GLY A . n 
A 1 97  LEU 97  138 138 LEU LEU A . n 
A 1 98  PRO 98  139 139 PRO PRO A . n 
A 1 99  THR 99  140 140 THR THR A . n 
A 1 100 ILE 100 141 141 ILE ILE A . n 
A 1 101 PRO 101 142 142 PRO PRO A . n 
A 1 102 ILE 102 143 143 ILE ILE A . n 
A 1 103 ASN 103 144 144 ASN ASN A . n 
A 1 104 ALA 104 145 145 ALA ALA A . n 
A 1 105 ARG 105 146 146 ARG ARG A . n 
A 1 106 ARG 106 147 147 ARG ARG A . n 
A 1 107 VAL 107 148 148 VAL VAL A . n 
A 1 108 PRO 108 149 149 PRO PRO A . n 
A 1 109 HIS 109 150 150 HIS HIS A . n 
A 1 110 ILE 110 151 151 ILE ILE A . n 
A 1 111 GLY 111 152 152 GLY GLY A . n 
A 1 112 ASP 112 153 153 ASP ASP A . n 
A 1 113 VAL 113 154 154 VAL VAL A . n 
A 1 114 VAL 114 155 155 VAL VAL A . n 
A 1 115 LEU 115 156 156 LEU LEU A . n 
A 1 116 ALA 116 157 157 ALA ALA A . n 
A 1 117 ILE 117 158 158 ILE ILE A . n 
A 1 118 GLY 118 159 159 GLY GLY A . n 
A 1 119 ASN 119 160 160 ASN ASN A . n 
A 1 120 PRO 120 161 161 PRO PRO A . n 
A 1 121 TYR 121 162 162 TYR TYR A . n 
A 1 122 ASN 122 163 163 ASN ASN A . n 
A 1 123 LEU 123 164 164 LEU LEU A . n 
A 1 124 GLY 124 165 165 GLY GLY A . n 
A 1 125 GLN 125 166 166 GLN GLN A . n 
A 1 126 THR 126 167 167 THR THR A . n 
A 1 127 ILE 127 168 168 ILE ILE A . n 
A 1 128 THR 128 169 169 THR THR A . n 
A 1 129 GLN 129 170 170 GLN GLN A . n 
A 1 130 GLY 130 171 171 GLY GLY A . n 
A 1 131 ILE 131 172 172 ILE ILE A . n 
A 1 132 ILE 132 173 173 ILE ILE A . n 
A 1 133 SER 133 174 174 SER SER A . n 
A 1 134 ALA 134 175 175 ALA ALA A . n 
A 1 135 THR 135 176 176 THR THR A . n 
A 1 136 GLY 136 177 177 GLY GLY A . n 
A 1 137 ARG 137 178 178 ARG ARG A . n 
A 1 138 ILE 138 179 179 ILE ILE A . n 
A 1 139 GLY 139 180 180 GLY GLY A . n 
A 1 140 LEU 140 181 181 LEU LEU A . n 
A 1 141 ASN 141 182 182 ASN ASN A . n 
A 1 142 PRO 142 183 183 PRO PRO A . n 
A 1 143 THR 143 184 184 THR THR A . n 
A 1 144 GLY 144 185 185 GLY GLY A . n 
A 1 145 ARG 145 186 186 ARG ALA A . n 
A 1 146 GLN 146 187 187 GLN GLN A . n 
A 1 147 ASN 147 188 188 ASN ASN A . n 
A 1 148 PHE 148 189 189 PHE PHE A . n 
A 1 149 LEU 149 190 190 LEU LEU A . n 
A 1 150 GLN 150 191 191 GLN GLN A . n 
A 1 151 THR 151 192 192 THR THR A . n 
A 1 152 ASP 152 193 193 ASP ASP A . n 
A 1 153 ALA 153 194 194 ALA ALA A . n 
A 1 154 SER 154 195 195 SER SER A . n 
A 1 155 ILE 155 196 196 ILE ILE A . n 
A 1 156 ASN 156 197 197 ASN ASN A . n 
A 1 157 HIS 157 198 198 HIS HIS A . n 
A 1 158 GLY 158 199 199 GLY GLY A . n 
A 1 159 ASN 159 200 200 ASN ASN A . n 
A 1 160 SER 160 201 201 SER SER A . n 
A 1 161 GLY 161 202 202 GLY GLY A . n 
A 1 162 GLY 162 203 203 GLY GLY A . n 
A 1 163 ALA 163 204 204 ALA ALA A . n 
A 1 164 LEU 164 205 205 LEU LEU A . n 
A 1 165 VAL 165 206 206 VAL VAL A . n 
A 1 166 ASN 166 207 207 ASN ASN A . n 
A 1 167 SER 167 208 208 SER SER A . n 
A 1 168 LEU 168 209 209 LEU LEU A . n 
A 1 169 GLY 169 210 210 GLY GLY A . n 
A 1 170 GLU 170 211 211 GLU GLU A . n 
A 1 171 LEU 171 212 212 LEU LEU A . n 
A 1 172 MSE 172 213 213 MSE MSE A . n 
A 1 173 GLY 173 214 214 GLY GLY A . n 
A 1 174 ILE 174 215 215 ILE ILE A . n 
A 1 175 ASN 175 216 216 ASN ASN A . n 
A 1 176 THR 176 217 217 THR THR A . n 
A 1 177 LEU 177 218 218 LEU LEU A . n 
A 1 178 SER 178 219 219 SER SER A . n 
A 1 179 PHE 179 220 220 PHE PHE A . n 
A 1 180 ASP 180 221 221 ASP ASP A . n 
A 1 181 LYS 181 222 ?   ?   ?   A . n 
A 1 182 SER 182 223 ?   ?   ?   A . n 
A 1 183 ASN 183 224 ?   ?   ?   A . n 
A 1 184 ASP 184 225 ?   ?   ?   A . n 
A 1 185 GLY 185 226 ?   ?   ?   A . n 
A 1 186 GLU 186 227 ?   ?   ?   A . n 
A 1 187 THR 187 228 ?   ?   ?   A . n 
A 1 188 PRO 188 229 ?   ?   ?   A . n 
A 1 189 GLU 189 230 230 GLU ALA A . n 
A 1 190 GLY 190 231 231 GLY GLY A . n 
A 1 191 ILE 191 232 232 ILE ILE A . n 
A 1 192 GLY 192 233 233 GLY GLY A . n 
A 1 193 PHE 193 234 234 PHE PHE A . n 
A 1 194 ALA 194 235 235 ALA ALA A . n 
A 1 195 ILE 195 236 236 ILE ILE A . n 
A 1 196 PRO 196 237 237 PRO PRO A . n 
A 1 197 PHE 197 238 238 PHE PHE A . n 
A 1 198 GLN 198 239 239 GLN GLN A . n 
A 1 199 LEU 199 240 240 LEU LEU A . n 
A 1 200 ALA 200 241 241 ALA ALA A . n 
A 1 201 THR 201 242 242 THR THR A . n 
A 1 202 LYS 202 243 243 LYS LYS A . n 
A 1 203 ILE 203 244 244 ILE ILE A . n 
A 1 204 MSE 204 245 245 MSE MSE A . n 
A 1 205 ASP 205 246 246 ASP ASP A . n 
A 1 206 LYS 206 247 247 LYS LYS A . n 
A 1 207 LEU 207 248 248 LEU LEU A . n 
A 1 208 ILE 208 249 249 ILE ILE A . n 
A 1 209 ARG 209 250 250 ARG ARG A . n 
A 1 210 ASP 210 251 251 ASP ASP A . n 
A 1 211 GLY 211 252 252 GLY GLY A . n 
A 1 212 ARG 212 253 253 ARG ARG A . n 
A 1 213 VAL 213 254 254 VAL VAL A . n 
A 1 214 ILE 214 255 255 ILE ILE A . n 
A 1 215 ARG 215 256 256 ARG ARG A . n 
A 1 216 GLY 216 257 257 GLY GLY A . n 
A 1 217 TYR 217 258 258 TYR TYR A . n 
A 1 218 ILE 218 259 259 ILE ILE A . n 
A 1 219 GLY 219 260 260 GLY GLY A . n 
A 1 220 ILE 220 261 261 ILE ILE A . n 
A 1 221 GLY 221 262 262 GLY GLY A . n 
A 1 222 GLY 222 263 263 GLY GLY A . n 
A 1 223 ARG 223 264 264 ARG ARG A . n 
A 1 224 GLU 224 265 ?   ?   ?   A . n 
A 1 225 ILE 225 266 ?   ?   ?   A . n 
A 1 226 ALA 226 267 ?   ?   ?   A . n 
A 1 227 PRO 227 268 ?   ?   ?   A . n 
A 1 228 LEU 228 269 ?   ?   ?   A . n 
A 1 229 HIS 229 270 ?   ?   ?   A . n 
A 1 230 ALA 230 271 ?   ?   ?   A . n 
A 1 231 GLN 231 272 ?   ?   ?   A . n 
A 1 232 GLY 232 273 ?   ?   ?   A . n 
A 1 233 GLY 233 274 ?   ?   ?   A . n 
A 1 234 GLY 234 275 ?   ?   ?   A . n 
A 1 235 ILE 235 276 ?   ?   ?   A . n 
A 1 236 ASP 236 277 ?   ?   ?   A . n 
A 1 237 GLN 237 278 ?   ?   ?   A . n 
A 1 238 LEU 238 279 ?   ?   ?   A . n 
A 1 239 GLN 239 280 ?   ?   ?   A . n 
A 1 240 GLY 240 281 281 GLY GLY A . n 
A 1 241 ILE 241 282 282 ILE ILE A . n 
A 1 242 VAL 242 283 283 VAL VAL A . n 
A 1 243 VAL 243 284 284 VAL VAL A . n 
A 1 244 ASN 244 285 285 ASN ASN A . n 
A 1 245 GLU 245 286 286 GLU GLU A . n 
A 1 246 VAL 246 287 287 VAL ALA A . n 
A 1 247 SER 247 288 288 SER ALA A . n 
A 1 248 PRO 248 289 289 PRO PRO A . n 
A 1 249 ASP 249 290 290 ASP ASP A . n 
A 1 250 GLY 250 291 291 GLY GLY A . n 
A 1 251 PRO 251 292 292 PRO PRO A . n 
A 1 252 ALA 252 293 293 ALA ALA A . n 
A 1 253 ALA 253 294 294 ALA ALA A . n 
A 1 254 ASN 254 295 295 ASN ASN A . n 
A 1 255 ALA 255 296 296 ALA ALA A . n 
A 1 256 GLY 256 297 297 GLY GLY A . n 
A 1 257 ILE 257 298 298 ILE ALA A . n 
A 1 258 GLN 258 299 299 GLN GLN A . n 
A 1 259 VAL 259 300 300 VAL VAL A . n 
A 1 260 ASN 260 301 301 ASN ASN A . n 
A 1 261 ASP 261 302 302 ASP ASP A . n 
A 1 262 LEU 262 303 303 LEU LEU A . n 
A 1 263 ILE 263 304 304 ILE ILE A . n 
A 1 264 ILE 264 305 305 ILE ILE A . n 
A 1 265 SER 265 306 306 SER SER A . n 
A 1 266 VAL 266 307 307 VAL VAL A . n 
A 1 267 ASP 267 308 308 ASP ASP A . n 
A 1 268 ASN 268 309 309 ASN ASN A . n 
A 1 269 LYS 269 310 310 LYS LYS A . n 
A 1 270 PRO 270 311 311 PRO PRO A . n 
A 1 271 ALA 271 312 312 ALA ALA A . n 
A 1 272 ILE 272 313 313 ILE ILE A . n 
A 1 273 SER 273 314 314 SER SER A . n 
A 1 274 ALA 274 315 315 ALA ALA A . n 
A 1 275 LEU 275 316 316 LEU LEU A . n 
A 1 276 GLU 276 317 317 GLU GLU A . n 
A 1 277 THR 277 318 318 THR THR A . n 
A 1 278 MSE 278 319 319 MSE MSE A . n 
A 1 279 ASP 279 320 320 ASP ASP A . n 
A 1 280 GLN 280 321 321 GLN GLN A . n 
A 1 281 VAL 281 322 322 VAL VAL A . n 
A 1 282 ALA 282 323 323 ALA ALA A . n 
A 1 283 GLU 283 324 324 GLU GLU A . n 
A 1 284 ILE 284 325 325 ILE ILE A . n 
A 1 285 ARG 285 326 326 ARG ARG A . n 
A 1 286 PRO 286 327 327 PRO PRO A . n 
A 1 287 GLY 287 328 328 GLY GLY A . n 
A 1 288 SER 288 329 329 SER SER A . n 
A 1 289 VAL 289 330 330 VAL VAL A . n 
A 1 290 ILE 290 331 331 ILE ILE A . n 
A 1 291 PRO 291 332 332 PRO PRO A . n 
A 1 292 VAL 292 333 333 VAL VAL A . n 
A 1 293 VAL 293 334 334 VAL VAL A . n 
A 1 294 VAL 294 335 335 VAL VAL A . n 
A 1 295 MSE 295 336 ?   ?   ?   A . n 
A 1 296 ARG 296 337 ?   ?   ?   A . n 
A 1 297 ASP 297 338 ?   ?   ?   A . n 
A 1 298 ASP 298 339 ?   ?   ?   A . n 
A 1 299 LYS 299 340 ?   ?   ?   A . n 
A 1 300 GLN 300 341 341 GLN GLN A . n 
A 1 301 LEU 301 342 342 LEU LEU A . n 
A 1 302 THR 302 343 343 THR THR A . n 
A 1 303 LEU 303 344 344 LEU LEU A . n 
A 1 304 GLN 304 345 345 GLN GLN A . n 
A 1 305 VAL 305 346 346 VAL VAL A . n 
A 1 306 THR 306 347 347 THR THR A . n 
A 1 307 ILE 307 348 348 ILE ILE A . n 
A 1 308 GLN 308 349 349 GLN GLN A . n 
A 1 309 GLU 309 350 350 GLU GLU A . n 
A 1 310 TYR 310 351 351 TYR TYR A . n 
A 1 311 PRO 311 352 352 PRO PRO A . n 
A 1 312 ALA 312 353 353 ALA ALA A . n 
A 1 313 THR 313 354 ?   ?   ?   A . n 
A 1 314 ASN 314 355 ?   ?   ?   A . n 
A 1 315 HIS 315 356 ?   ?   ?   A . n 
A 1 316 HIS 316 357 ?   ?   ?   A . n 
A 1 317 HIS 317 358 ?   ?   ?   A . n 
A 1 318 HIS 318 359 ?   ?   ?   A . n 
A 1 319 HIS 319 360 ?   ?   ?   A . n 
A 1 320 HIS 320 361 ?   ?   ?   A . n 
B 1 1   MSE 1   42  42  MSE MSE B . n 
B 1 2   THR 2   43  43  THR THR B . n 
B 1 3   PRO 3   44  44  PRO PRO B . n 
B 1 4   ALA 4   45  45  ALA ALA B . n 
B 1 5   SER 5   46  46  SER SER B . n 
B 1 6   TYR 6   47  47  TYR TYR B . n 
B 1 7   ASN 7   48  48  ASN ASN B . n 
B 1 8   LEU 8   49  49  LEU LEU B . n 
B 1 9   ALA 9   50  50  ALA ALA B . n 
B 1 10  VAL 10  51  51  VAL VAL B . n 
B 1 11  ARG 11  52  52  ARG ARG B . n 
B 1 12  ARG 12  53  53  ARG ARG B . n 
B 1 13  ALA 13  54  54  ALA ALA B . n 
B 1 14  ALA 14  55  55  ALA ALA B . n 
B 1 15  PRO 15  56  56  PRO PRO B . n 
B 1 16  ALA 16  57  57  ALA ALA B . n 
B 1 17  VAL 17  58  58  VAL VAL B . n 
B 1 18  VAL 18  59  59  VAL VAL B . n 
B 1 19  ASN 19  60  60  ASN ASN B . n 
B 1 20  VAL 20  61  61  VAL VAL B . n 
B 1 21  TYR 21  62  62  TYR TYR B . n 
B 1 22  ASN 22  63  63  ASN ASN B . n 
B 1 23  ARG 23  64  64  ARG ARG B . n 
B 1 24  GLY 24  65  65  GLY GLY B . n 
B 1 25  LEU 25  66  66  LEU LEU B . n 
B 1 26  ASN 26  67  67  ASN ASN B . n 
B 1 27  THR 27  68  68  THR THR B . n 
B 1 28  ASN 28  69  69  ASN ASN B . n 
B 1 29  SER 29  70  70  SER SER B . n 
B 1 30  HIS 30  71  71  HIS HIS B . n 
B 1 31  ASN 31  72  72  ASN ASN B . n 
B 1 32  GLN 32  73  73  GLN GLN B . n 
B 1 33  LEU 33  74  74  LEU LEU B . n 
B 1 34  GLU 34  75  75  GLU GLU B . n 
B 1 35  ILE 35  76  76  ILE ILE B . n 
B 1 36  ARG 36  77  77  ARG ARG B . n 
B 1 37  THR 37  78  78  THR THR B . n 
B 1 38  LEU 38  79  79  LEU LEU B . n 
B 1 39  GLY 39  80  80  GLY GLY B . n 
B 1 40  SER 40  81  81  SER SER B . n 
B 1 41  GLY 41  82  82  GLY GLY B . n 
B 1 42  VAL 42  83  83  VAL VAL B . n 
B 1 43  ILE 43  84  84  ILE ILE B . n 
B 1 44  MSE 44  85  85  MSE MSE B . n 
B 1 45  ASP 45  86  86  ASP ASP B . n 
B 1 46  GLN 46  87  87  GLN GLN B . n 
B 1 47  ARG 47  88  88  ARG ARG B . n 
B 1 48  GLY 48  89  89  GLY GLY B . n 
B 1 49  TYR 49  90  90  TYR TYR B . n 
B 1 50  ILE 50  91  91  ILE ILE B . n 
B 1 51  ILE 51  92  92  ILE ILE B . n 
B 1 52  THR 52  93  93  THR THR B . n 
B 1 53  ASN 53  94  94  ASN ASN B . n 
B 1 54  LYS 54  95  95  LYS LYS B . n 
B 1 55  HIS 55  96  96  HIS HIS B . n 
B 1 56  VAL 56  97  97  VAL VAL B . n 
B 1 57  ILE 57  98  98  ILE ILE B . n 
B 1 58  ASN 58  99  99  ASN ASN B . n 
B 1 59  ASP 59  100 100 ASP ASP B . n 
B 1 60  ALA 60  101 101 ALA ALA B . n 
B 1 61  ASP 61  102 102 ASP ASP B . n 
B 1 62  GLN 62  103 103 GLN GLN B . n 
B 1 63  ILE 63  104 104 ILE ILE B . n 
B 1 64  ILE 64  105 105 ILE ILE B . n 
B 1 65  VAL 65  106 106 VAL VAL B . n 
B 1 66  ALA 66  107 107 ALA ALA B . n 
B 1 67  LEU 67  108 108 LEU LEU B . n 
B 1 68  GLN 68  109 109 GLN GLN B . n 
B 1 69  ASP 69  110 110 ASP ASP B . n 
B 1 70  GLY 70  111 111 GLY GLY B . n 
B 1 71  ARG 71  112 112 ARG ARG B . n 
B 1 72  VAL 72  113 113 VAL VAL B . n 
B 1 73  PHE 73  114 114 PHE PHE B . n 
B 1 74  GLU 74  115 115 GLU GLU B . n 
B 1 75  ALA 75  116 116 ALA ALA B . n 
B 1 76  LEU 76  117 117 LEU LEU B . n 
B 1 77  LEU 77  118 118 LEU LEU B . n 
B 1 78  VAL 78  119 119 VAL VAL B . n 
B 1 79  GLY 79  120 120 GLY GLY B . n 
B 1 80  SER 80  121 121 SER SER B . n 
B 1 81  ASP 81  122 122 ASP ASP B . n 
B 1 82  SER 82  123 123 SER SER B . n 
B 1 83  LEU 83  124 124 LEU LEU B . n 
B 1 84  THR 84  125 125 THR THR B . n 
B 1 85  ASP 85  126 126 ASP ASP B . n 
B 1 86  LEU 86  127 127 LEU LEU B . n 
B 1 87  ALA 87  128 128 ALA ALA B . n 
B 1 88  VAL 88  129 129 VAL VAL B . n 
B 1 89  LEU 89  130 130 LEU LEU B . n 
B 1 90  LYS 90  131 131 LYS LYS B . n 
B 1 91  ILE 91  132 132 ILE ILE B . n 
B 1 92  ASN 92  133 133 ASN ASN B . n 
B 1 93  ALA 93  134 134 ALA ALA B . n 
B 1 94  THR 94  135 135 THR THR B . n 
B 1 95  GLY 95  136 136 GLY GLY B . n 
B 1 96  GLY 96  137 137 GLY GLY B . n 
B 1 97  LEU 97  138 138 LEU LEU B . n 
B 1 98  PRO 98  139 139 PRO PRO B . n 
B 1 99  THR 99  140 140 THR THR B . n 
B 1 100 ILE 100 141 141 ILE ILE B . n 
B 1 101 PRO 101 142 142 PRO PRO B . n 
B 1 102 ILE 102 143 143 ILE ILE B . n 
B 1 103 ASN 103 144 144 ASN ASN B . n 
B 1 104 ALA 104 145 145 ALA ALA B . n 
B 1 105 ARG 105 146 146 ARG ARG B . n 
B 1 106 ARG 106 147 147 ARG ARG B . n 
B 1 107 VAL 107 148 148 VAL VAL B . n 
B 1 108 PRO 108 149 149 PRO PRO B . n 
B 1 109 HIS 109 150 150 HIS HIS B . n 
B 1 110 ILE 110 151 151 ILE ILE B . n 
B 1 111 GLY 111 152 152 GLY GLY B . n 
B 1 112 ASP 112 153 153 ASP ASP B . n 
B 1 113 VAL 113 154 154 VAL VAL B . n 
B 1 114 VAL 114 155 155 VAL VAL B . n 
B 1 115 LEU 115 156 156 LEU LEU B . n 
B 1 116 ALA 116 157 157 ALA ALA B . n 
B 1 117 ILE 117 158 158 ILE ILE B . n 
B 1 118 GLY 118 159 159 GLY GLY B . n 
B 1 119 ASN 119 160 160 ASN ASN B . n 
B 1 120 PRO 120 161 161 PRO PRO B . n 
B 1 121 TYR 121 162 162 TYR TYR B . n 
B 1 122 ASN 122 163 163 ASN ASN B . n 
B 1 123 LEU 123 164 164 LEU LEU B . n 
B 1 124 GLY 124 165 165 GLY GLY B . n 
B 1 125 GLN 125 166 166 GLN GLN B . n 
B 1 126 THR 126 167 167 THR THR B . n 
B 1 127 ILE 127 168 168 ILE ILE B . n 
B 1 128 THR 128 169 169 THR THR B . n 
B 1 129 GLN 129 170 170 GLN GLN B . n 
B 1 130 GLY 130 171 171 GLY GLY B . n 
B 1 131 ILE 131 172 172 ILE ILE B . n 
B 1 132 ILE 132 173 173 ILE ILE B . n 
B 1 133 SER 133 174 174 SER SER B . n 
B 1 134 ALA 134 175 175 ALA ALA B . n 
B 1 135 THR 135 176 176 THR THR B . n 
B 1 136 GLY 136 177 177 GLY GLY B . n 
B 1 137 ARG 137 178 178 ARG ARG B . n 
B 1 138 ILE 138 179 179 ILE ILE B . n 
B 1 139 GLY 139 180 180 GLY GLY B . n 
B 1 140 LEU 140 181 181 LEU LEU B . n 
B 1 141 ASN 141 182 182 ASN ASN B . n 
B 1 142 PRO 142 183 183 PRO PRO B . n 
B 1 143 THR 143 184 184 THR THR B . n 
B 1 144 GLY 144 185 185 GLY GLY B . n 
B 1 145 ARG 145 186 186 ARG ALA B . n 
B 1 146 GLN 146 187 187 GLN GLN B . n 
B 1 147 ASN 147 188 188 ASN ASN B . n 
B 1 148 PHE 148 189 189 PHE PHE B . n 
B 1 149 LEU 149 190 190 LEU LEU B . n 
B 1 150 GLN 150 191 191 GLN GLN B . n 
B 1 151 THR 151 192 192 THR THR B . n 
B 1 152 ASP 152 193 193 ASP ASP B . n 
B 1 153 ALA 153 194 194 ALA ALA B . n 
B 1 154 SER 154 195 195 SER SER B . n 
B 1 155 ILE 155 196 196 ILE ILE B . n 
B 1 156 ASN 156 197 197 ASN ASN B . n 
B 1 157 HIS 157 198 198 HIS HIS B . n 
B 1 158 GLY 158 199 199 GLY GLY B . n 
B 1 159 ASN 159 200 200 ASN ASN B . n 
B 1 160 SER 160 201 201 SER SER B . n 
B 1 161 GLY 161 202 202 GLY GLY B . n 
B 1 162 GLY 162 203 203 GLY GLY B . n 
B 1 163 ALA 163 204 204 ALA ALA B . n 
B 1 164 LEU 164 205 205 LEU LEU B . n 
B 1 165 VAL 165 206 206 VAL VAL B . n 
B 1 166 ASN 166 207 207 ASN ASN B . n 
B 1 167 SER 167 208 208 SER SER B . n 
B 1 168 LEU 168 209 209 LEU LEU B . n 
B 1 169 GLY 169 210 210 GLY GLY B . n 
B 1 170 GLU 170 211 211 GLU GLU B . n 
B 1 171 LEU 171 212 212 LEU LEU B . n 
B 1 172 MSE 172 213 213 MSE MSE B . n 
B 1 173 GLY 173 214 214 GLY GLY B . n 
B 1 174 ILE 174 215 215 ILE ILE B . n 
B 1 175 ASN 175 216 216 ASN ASN B . n 
B 1 176 THR 176 217 217 THR THR B . n 
B 1 177 LEU 177 218 218 LEU LEU B . n 
B 1 178 SER 178 219 219 SER SER B . n 
B 1 179 PHE 179 220 220 PHE PHE B . n 
B 1 180 ASP 180 221 221 ASP ASP B . n 
B 1 181 LYS 181 222 ?   ?   ?   B . n 
B 1 182 SER 182 223 ?   ?   ?   B . n 
B 1 183 ASN 183 224 ?   ?   ?   B . n 
B 1 184 ASP 184 225 ?   ?   ?   B . n 
B 1 185 GLY 185 226 ?   ?   ?   B . n 
B 1 186 GLU 186 227 ?   ?   ?   B . n 
B 1 187 THR 187 228 ?   ?   ?   B . n 
B 1 188 PRO 188 229 229 PRO PRO B . n 
B 1 189 GLU 189 230 230 GLU GLU B . n 
B 1 190 GLY 190 231 231 GLY GLY B . n 
B 1 191 ILE 191 232 232 ILE ILE B . n 
B 1 192 GLY 192 233 233 GLY GLY B . n 
B 1 193 PHE 193 234 234 PHE PHE B . n 
B 1 194 ALA 194 235 235 ALA ALA B . n 
B 1 195 ILE 195 236 236 ILE ILE B . n 
B 1 196 PRO 196 237 237 PRO PRO B . n 
B 1 197 PHE 197 238 238 PHE PHE B . n 
B 1 198 GLN 198 239 239 GLN GLN B . n 
B 1 199 LEU 199 240 240 LEU LEU B . n 
B 1 200 ALA 200 241 241 ALA ALA B . n 
B 1 201 THR 201 242 242 THR THR B . n 
B 1 202 LYS 202 243 243 LYS LYS B . n 
B 1 203 ILE 203 244 244 ILE ILE B . n 
B 1 204 MSE 204 245 245 MSE MSE B . n 
B 1 205 ASP 205 246 246 ASP ASP B . n 
B 1 206 LYS 206 247 247 LYS LYS B . n 
B 1 207 LEU 207 248 248 LEU LEU B . n 
B 1 208 ILE 208 249 249 ILE ILE B . n 
B 1 209 ARG 209 250 250 ARG ARG B . n 
B 1 210 ASP 210 251 251 ASP ASP B . n 
B 1 211 GLY 211 252 252 GLY GLY B . n 
B 1 212 ARG 212 253 253 ARG ARG B . n 
B 1 213 VAL 213 254 254 VAL VAL B . n 
B 1 214 ILE 214 255 255 ILE ILE B . n 
B 1 215 ARG 215 256 256 ARG ARG B . n 
B 1 216 GLY 216 257 257 GLY GLY B . n 
B 1 217 TYR 217 258 258 TYR TYR B . n 
B 1 218 ILE 218 259 259 ILE ILE B . n 
B 1 219 GLY 219 260 260 GLY GLY B . n 
B 1 220 ILE 220 261 261 ILE ILE B . n 
B 1 221 GLY 221 262 262 GLY GLY B . n 
B 1 222 GLY 222 263 263 GLY GLY B . n 
B 1 223 ARG 223 264 264 ARG ARG B . n 
B 1 224 GLU 224 265 ?   ?   ?   B . n 
B 1 225 ILE 225 266 ?   ?   ?   B . n 
B 1 226 ALA 226 267 ?   ?   ?   B . n 
B 1 227 PRO 227 268 ?   ?   ?   B . n 
B 1 228 LEU 228 269 ?   ?   ?   B . n 
B 1 229 HIS 229 270 ?   ?   ?   B . n 
B 1 230 ALA 230 271 ?   ?   ?   B . n 
B 1 231 GLN 231 272 ?   ?   ?   B . n 
B 1 232 GLY 232 273 ?   ?   ?   B . n 
B 1 233 GLY 233 274 ?   ?   ?   B . n 
B 1 234 GLY 234 275 ?   ?   ?   B . n 
B 1 235 ILE 235 276 ?   ?   ?   B . n 
B 1 236 ASP 236 277 ?   ?   ?   B . n 
B 1 237 GLN 237 278 ?   ?   ?   B . n 
B 1 238 LEU 238 279 ?   ?   ?   B . n 
B 1 239 GLN 239 280 280 GLN GLN B . n 
B 1 240 GLY 240 281 281 GLY GLY B . n 
B 1 241 ILE 241 282 282 ILE ILE B . n 
B 1 242 VAL 242 283 283 VAL VAL B . n 
B 1 243 VAL 243 284 284 VAL VAL B . n 
B 1 244 ASN 244 285 285 ASN ASN B . n 
B 1 245 GLU 245 286 286 GLU GLU B . n 
B 1 246 VAL 246 287 287 VAL VAL B . n 
B 1 247 SER 247 288 288 SER SER B . n 
B 1 248 PRO 248 289 289 PRO PRO B . n 
B 1 249 ASP 249 290 290 ASP ALA B . n 
B 1 250 GLY 250 291 291 GLY GLY B . n 
B 1 251 PRO 251 292 292 PRO PRO B . n 
B 1 252 ALA 252 293 293 ALA ALA B . n 
B 1 253 ALA 253 294 294 ALA ALA B . n 
B 1 254 ASN 254 295 295 ASN ASN B . n 
B 1 255 ALA 255 296 296 ALA ALA B . n 
B 1 256 GLY 256 297 297 GLY GLY B . n 
B 1 257 ILE 257 298 298 ILE ALA B . n 
B 1 258 GLN 258 299 299 GLN GLN B . n 
B 1 259 VAL 259 300 300 VAL VAL B . n 
B 1 260 ASN 260 301 301 ASN ASN B . n 
B 1 261 ASP 261 302 302 ASP ASP B . n 
B 1 262 LEU 262 303 303 LEU LEU B . n 
B 1 263 ILE 263 304 304 ILE ILE B . n 
B 1 264 ILE 264 305 305 ILE ILE B . n 
B 1 265 SER 265 306 306 SER SER B . n 
B 1 266 VAL 266 307 307 VAL VAL B . n 
B 1 267 ASP 267 308 308 ASP ASP B . n 
B 1 268 ASN 268 309 309 ASN ASN B . n 
B 1 269 LYS 269 310 310 LYS LYS B . n 
B 1 270 PRO 270 311 311 PRO PRO B . n 
B 1 271 ALA 271 312 312 ALA ALA B . n 
B 1 272 ILE 272 313 313 ILE ILE B . n 
B 1 273 SER 273 314 314 SER SER B . n 
B 1 274 ALA 274 315 315 ALA ALA B . n 
B 1 275 LEU 275 316 316 LEU LEU B . n 
B 1 276 GLU 276 317 317 GLU GLU B . n 
B 1 277 THR 277 318 318 THR THR B . n 
B 1 278 MSE 278 319 319 MSE MSE B . n 
B 1 279 ASP 279 320 320 ASP ASP B . n 
B 1 280 GLN 280 321 321 GLN GLN B . n 
B 1 281 VAL 281 322 322 VAL VAL B . n 
B 1 282 ALA 282 323 323 ALA ALA B . n 
B 1 283 GLU 283 324 324 GLU GLU B . n 
B 1 284 ILE 284 325 325 ILE ILE B . n 
B 1 285 ARG 285 326 326 ARG ARG B . n 
B 1 286 PRO 286 327 327 PRO PRO B . n 
B 1 287 GLY 287 328 328 GLY GLY B . n 
B 1 288 SER 288 329 329 SER SER B . n 
B 1 289 VAL 289 330 330 VAL VAL B . n 
B 1 290 ILE 290 331 331 ILE ILE B . n 
B 1 291 PRO 291 332 332 PRO PRO B . n 
B 1 292 VAL 292 333 333 VAL VAL B . n 
B 1 293 VAL 293 334 334 VAL VAL B . n 
B 1 294 VAL 294 335 335 VAL VAL B . n 
B 1 295 MSE 295 336 336 MSE MSE B . n 
B 1 296 ARG 296 337 ?   ?   ?   B . n 
B 1 297 ASP 297 338 ?   ?   ?   B . n 
B 1 298 ASP 298 339 ?   ?   ?   B . n 
B 1 299 LYS 299 340 ?   ?   ?   B . n 
B 1 300 GLN 300 341 341 GLN ALA B . n 
B 1 301 LEU 301 342 342 LEU LEU B . n 
B 1 302 THR 302 343 343 THR THR B . n 
B 1 303 LEU 303 344 344 LEU LEU B . n 
B 1 304 GLN 304 345 345 GLN GLN B . n 
B 1 305 VAL 305 346 346 VAL VAL B . n 
B 1 306 THR 306 347 347 THR THR B . n 
B 1 307 ILE 307 348 348 ILE ILE B . n 
B 1 308 GLN 308 349 349 GLN GLN B . n 
B 1 309 GLU 309 350 350 GLU GLU B . n 
B 1 310 TYR 310 351 351 TYR TYR B . n 
B 1 311 PRO 311 352 352 PRO PRO B . n 
B 1 312 ALA 312 353 353 ALA ALA B . n 
B 1 313 THR 313 354 354 THR THR B . n 
B 1 314 ASN 314 355 355 ASN ASN B . n 
B 1 315 HIS 315 356 356 HIS HIS B . n 
B 1 316 HIS 316 357 357 HIS HIS B . n 
B 1 317 HIS 317 358 358 HIS HIS B . n 
B 1 318 HIS 318 359 359 HIS HIS B . n 
B 1 319 HIS 319 360 360 HIS HIS B . n 
B 1 320 HIS 320 361 361 HIS HIS B . n 
C 1 1   MSE 1   42  42  MSE MSE C . n 
C 1 2   THR 2   43  43  THR THR C . n 
C 1 3   PRO 3   44  44  PRO PRO C . n 
C 1 4   ALA 4   45  45  ALA ALA C . n 
C 1 5   SER 5   46  46  SER SER C . n 
C 1 6   TYR 6   47  47  TYR TYR C . n 
C 1 7   ASN 7   48  48  ASN ASN C . n 
C 1 8   LEU 8   49  49  LEU LEU C . n 
C 1 9   ALA 9   50  50  ALA ALA C . n 
C 1 10  VAL 10  51  51  VAL VAL C . n 
C 1 11  ARG 11  52  52  ARG ARG C . n 
C 1 12  ARG 12  53  53  ARG ARG C . n 
C 1 13  ALA 13  54  54  ALA ALA C . n 
C 1 14  ALA 14  55  55  ALA ALA C . n 
C 1 15  PRO 15  56  56  PRO PRO C . n 
C 1 16  ALA 16  57  57  ALA ALA C . n 
C 1 17  VAL 17  58  58  VAL VAL C . n 
C 1 18  VAL 18  59  59  VAL VAL C . n 
C 1 19  ASN 19  60  60  ASN ASN C . n 
C 1 20  VAL 20  61  61  VAL VAL C . n 
C 1 21  TYR 21  62  62  TYR TYR C . n 
C 1 22  ASN 22  63  63  ASN ASN C . n 
C 1 23  ARG 23  64  64  ARG ARG C . n 
C 1 24  GLY 24  65  65  GLY GLY C . n 
C 1 25  LEU 25  66  66  LEU LEU C . n 
C 1 26  ASN 26  67  67  ASN ASN C . n 
C 1 27  THR 27  68  68  THR THR C . n 
C 1 28  ASN 28  69  69  ASN ASN C . n 
C 1 29  SER 29  70  70  SER SER C . n 
C 1 30  HIS 30  71  71  HIS HIS C . n 
C 1 31  ASN 31  72  72  ASN ASN C . n 
C 1 32  GLN 32  73  73  GLN GLN C . n 
C 1 33  LEU 33  74  74  LEU LEU C . n 
C 1 34  GLU 34  75  75  GLU GLU C . n 
C 1 35  ILE 35  76  76  ILE ILE C . n 
C 1 36  ARG 36  77  77  ARG ARG C . n 
C 1 37  THR 37  78  78  THR THR C . n 
C 1 38  LEU 38  79  79  LEU LEU C . n 
C 1 39  GLY 39  80  80  GLY GLY C . n 
C 1 40  SER 40  81  81  SER SER C . n 
C 1 41  GLY 41  82  82  GLY GLY C . n 
C 1 42  VAL 42  83  83  VAL VAL C . n 
C 1 43  ILE 43  84  84  ILE ILE C . n 
C 1 44  MSE 44  85  85  MSE MSE C . n 
C 1 45  ASP 45  86  86  ASP ASP C . n 
C 1 46  GLN 46  87  87  GLN GLN C . n 
C 1 47  ARG 47  88  88  ARG ARG C . n 
C 1 48  GLY 48  89  89  GLY GLY C . n 
C 1 49  TYR 49  90  90  TYR TYR C . n 
C 1 50  ILE 50  91  91  ILE ILE C . n 
C 1 51  ILE 51  92  92  ILE ILE C . n 
C 1 52  THR 52  93  93  THR THR C . n 
C 1 53  ASN 53  94  94  ASN ASN C . n 
C 1 54  LYS 54  95  95  LYS LYS C . n 
C 1 55  HIS 55  96  96  HIS HIS C . n 
C 1 56  VAL 56  97  97  VAL VAL C . n 
C 1 57  ILE 57  98  98  ILE ILE C . n 
C 1 58  ASN 58  99  99  ASN ASN C . n 
C 1 59  ASP 59  100 100 ASP ASP C . n 
C 1 60  ALA 60  101 101 ALA ALA C . n 
C 1 61  ASP 61  102 102 ASP ASP C . n 
C 1 62  GLN 62  103 103 GLN GLN C . n 
C 1 63  ILE 63  104 104 ILE ILE C . n 
C 1 64  ILE 64  105 105 ILE ILE C . n 
C 1 65  VAL 65  106 106 VAL VAL C . n 
C 1 66  ALA 66  107 107 ALA ALA C . n 
C 1 67  LEU 67  108 108 LEU LEU C . n 
C 1 68  GLN 68  109 109 GLN GLN C . n 
C 1 69  ASP 69  110 110 ASP ASP C . n 
C 1 70  GLY 70  111 111 GLY GLY C . n 
C 1 71  ARG 71  112 112 ARG ARG C . n 
C 1 72  VAL 72  113 113 VAL VAL C . n 
C 1 73  PHE 73  114 114 PHE PHE C . n 
C 1 74  GLU 74  115 115 GLU GLU C . n 
C 1 75  ALA 75  116 116 ALA ALA C . n 
C 1 76  LEU 76  117 117 LEU LEU C . n 
C 1 77  LEU 77  118 118 LEU LEU C . n 
C 1 78  VAL 78  119 119 VAL VAL C . n 
C 1 79  GLY 79  120 120 GLY GLY C . n 
C 1 80  SER 80  121 121 SER SER C . n 
C 1 81  ASP 81  122 122 ASP ASP C . n 
C 1 82  SER 82  123 123 SER SER C . n 
C 1 83  LEU 83  124 124 LEU LEU C . n 
C 1 84  THR 84  125 125 THR THR C . n 
C 1 85  ASP 85  126 126 ASP ASP C . n 
C 1 86  LEU 86  127 127 LEU LEU C . n 
C 1 87  ALA 87  128 128 ALA ALA C . n 
C 1 88  VAL 88  129 129 VAL VAL C . n 
C 1 89  LEU 89  130 130 LEU LEU C . n 
C 1 90  LYS 90  131 131 LYS LYS C . n 
C 1 91  ILE 91  132 132 ILE ILE C . n 
C 1 92  ASN 92  133 133 ASN ASN C . n 
C 1 93  ALA 93  134 134 ALA ALA C . n 
C 1 94  THR 94  135 135 THR THR C . n 
C 1 95  GLY 95  136 136 GLY GLY C . n 
C 1 96  GLY 96  137 137 GLY GLY C . n 
C 1 97  LEU 97  138 138 LEU LEU C . n 
C 1 98  PRO 98  139 139 PRO PRO C . n 
C 1 99  THR 99  140 140 THR THR C . n 
C 1 100 ILE 100 141 141 ILE ILE C . n 
C 1 101 PRO 101 142 142 PRO PRO C . n 
C 1 102 ILE 102 143 143 ILE ILE C . n 
C 1 103 ASN 103 144 144 ASN ASN C . n 
C 1 104 ALA 104 145 145 ALA ALA C . n 
C 1 105 ARG 105 146 146 ARG ARG C . n 
C 1 106 ARG 106 147 147 ARG ARG C . n 
C 1 107 VAL 107 148 148 VAL VAL C . n 
C 1 108 PRO 108 149 149 PRO PRO C . n 
C 1 109 HIS 109 150 150 HIS HIS C . n 
C 1 110 ILE 110 151 151 ILE ILE C . n 
C 1 111 GLY 111 152 152 GLY GLY C . n 
C 1 112 ASP 112 153 153 ASP ASP C . n 
C 1 113 VAL 113 154 154 VAL VAL C . n 
C 1 114 VAL 114 155 155 VAL VAL C . n 
C 1 115 LEU 115 156 156 LEU LEU C . n 
C 1 116 ALA 116 157 157 ALA ALA C . n 
C 1 117 ILE 117 158 158 ILE ILE C . n 
C 1 118 GLY 118 159 159 GLY GLY C . n 
C 1 119 ASN 119 160 160 ASN ASN C . n 
C 1 120 PRO 120 161 161 PRO PRO C . n 
C 1 121 TYR 121 162 162 TYR TYR C . n 
C 1 122 ASN 122 163 163 ASN ASN C . n 
C 1 123 LEU 123 164 164 LEU LEU C . n 
C 1 124 GLY 124 165 165 GLY GLY C . n 
C 1 125 GLN 125 166 166 GLN GLN C . n 
C 1 126 THR 126 167 167 THR THR C . n 
C 1 127 ILE 127 168 168 ILE ILE C . n 
C 1 128 THR 128 169 169 THR THR C . n 
C 1 129 GLN 129 170 170 GLN GLN C . n 
C 1 130 GLY 130 171 171 GLY GLY C . n 
C 1 131 ILE 131 172 172 ILE ILE C . n 
C 1 132 ILE 132 173 173 ILE ILE C . n 
C 1 133 SER 133 174 174 SER SER C . n 
C 1 134 ALA 134 175 175 ALA ALA C . n 
C 1 135 THR 135 176 176 THR THR C . n 
C 1 136 GLY 136 177 177 GLY GLY C . n 
C 1 137 ARG 137 178 178 ARG ARG C . n 
C 1 138 ILE 138 179 179 ILE ILE C . n 
C 1 139 GLY 139 180 180 GLY GLY C . n 
C 1 140 LEU 140 181 181 LEU LEU C . n 
C 1 141 ASN 141 182 182 ASN ASN C . n 
C 1 142 PRO 142 183 183 PRO PRO C . n 
C 1 143 THR 143 184 184 THR THR C . n 
C 1 144 GLY 144 185 185 GLY GLY C . n 
C 1 145 ARG 145 186 186 ARG ALA C . n 
C 1 146 GLN 146 187 187 GLN GLN C . n 
C 1 147 ASN 147 188 188 ASN ASN C . n 
C 1 148 PHE 148 189 189 PHE PHE C . n 
C 1 149 LEU 149 190 190 LEU LEU C . n 
C 1 150 GLN 150 191 191 GLN GLN C . n 
C 1 151 THR 151 192 192 THR THR C . n 
C 1 152 ASP 152 193 193 ASP ASP C . n 
C 1 153 ALA 153 194 194 ALA ALA C . n 
C 1 154 SER 154 195 195 SER SER C . n 
C 1 155 ILE 155 196 196 ILE ILE C . n 
C 1 156 ASN 156 197 197 ASN ASN C . n 
C 1 157 HIS 157 198 198 HIS HIS C . n 
C 1 158 GLY 158 199 199 GLY GLY C . n 
C 1 159 ASN 159 200 200 ASN ASN C . n 
C 1 160 SER 160 201 201 SER SER C . n 
C 1 161 GLY 161 202 202 GLY GLY C . n 
C 1 162 GLY 162 203 203 GLY GLY C . n 
C 1 163 ALA 163 204 204 ALA ALA C . n 
C 1 164 LEU 164 205 205 LEU LEU C . n 
C 1 165 VAL 165 206 206 VAL VAL C . n 
C 1 166 ASN 166 207 207 ASN ASN C . n 
C 1 167 SER 167 208 208 SER SER C . n 
C 1 168 LEU 168 209 209 LEU LEU C . n 
C 1 169 GLY 169 210 210 GLY GLY C . n 
C 1 170 GLU 170 211 211 GLU GLU C . n 
C 1 171 LEU 171 212 212 LEU LEU C . n 
C 1 172 MSE 172 213 213 MSE MSE C . n 
C 1 173 GLY 173 214 214 GLY GLY C . n 
C 1 174 ILE 174 215 215 ILE ILE C . n 
C 1 175 ASN 175 216 216 ASN ASN C . n 
C 1 176 THR 176 217 217 THR THR C . n 
C 1 177 LEU 177 218 218 LEU LEU C . n 
C 1 178 SER 178 219 219 SER SER C . n 
C 1 179 PHE 179 220 220 PHE PHE C . n 
C 1 180 ASP 180 221 221 ASP ASP C . n 
C 1 181 LYS 181 222 ?   ?   ?   C . n 
C 1 182 SER 182 223 ?   ?   ?   C . n 
C 1 183 ASN 183 224 ?   ?   ?   C . n 
C 1 184 ASP 184 225 ?   ?   ?   C . n 
C 1 185 GLY 185 226 ?   ?   ?   C . n 
C 1 186 GLU 186 227 ?   ?   ?   C . n 
C 1 187 THR 187 228 ?   ?   ?   C . n 
C 1 188 PRO 188 229 ?   ?   ?   C . n 
C 1 189 GLU 189 230 230 GLU GLU C . n 
C 1 190 GLY 190 231 231 GLY GLY C . n 
C 1 191 ILE 191 232 232 ILE ILE C . n 
C 1 192 GLY 192 233 233 GLY GLY C . n 
C 1 193 PHE 193 234 234 PHE PHE C . n 
C 1 194 ALA 194 235 235 ALA ALA C . n 
C 1 195 ILE 195 236 236 ILE ILE C . n 
C 1 196 PRO 196 237 237 PRO PRO C . n 
C 1 197 PHE 197 238 238 PHE PHE C . n 
C 1 198 GLN 198 239 239 GLN GLN C . n 
C 1 199 LEU 199 240 240 LEU LEU C . n 
C 1 200 ALA 200 241 241 ALA ALA C . n 
C 1 201 THR 201 242 242 THR THR C . n 
C 1 202 LYS 202 243 243 LYS LYS C . n 
C 1 203 ILE 203 244 244 ILE ILE C . n 
C 1 204 MSE 204 245 245 MSE MSE C . n 
C 1 205 ASP 205 246 246 ASP ASP C . n 
C 1 206 LYS 206 247 247 LYS LYS C . n 
C 1 207 LEU 207 248 248 LEU LEU C . n 
C 1 208 ILE 208 249 249 ILE ILE C . n 
C 1 209 ARG 209 250 250 ARG ARG C . n 
C 1 210 ASP 210 251 251 ASP ASP C . n 
C 1 211 GLY 211 252 252 GLY GLY C . n 
C 1 212 ARG 212 253 253 ARG ARG C . n 
C 1 213 VAL 213 254 254 VAL VAL C . n 
C 1 214 ILE 214 255 255 ILE ILE C . n 
C 1 215 ARG 215 256 256 ARG ARG C . n 
C 1 216 GLY 216 257 257 GLY GLY C . n 
C 1 217 TYR 217 258 258 TYR TYR C . n 
C 1 218 ILE 218 259 259 ILE ILE C . n 
C 1 219 GLY 219 260 260 GLY GLY C . n 
C 1 220 ILE 220 261 261 ILE ILE C . n 
C 1 221 GLY 221 262 262 GLY GLY C . n 
C 1 222 GLY 222 263 263 GLY GLY C . n 
C 1 223 ARG 223 264 264 ARG ARG C . n 
C 1 224 GLU 224 265 ?   ?   ?   C . n 
C 1 225 ILE 225 266 ?   ?   ?   C . n 
C 1 226 ALA 226 267 ?   ?   ?   C . n 
C 1 227 PRO 227 268 ?   ?   ?   C . n 
C 1 228 LEU 228 269 ?   ?   ?   C . n 
C 1 229 HIS 229 270 ?   ?   ?   C . n 
C 1 230 ALA 230 271 ?   ?   ?   C . n 
C 1 231 GLN 231 272 ?   ?   ?   C . n 
C 1 232 GLY 232 273 ?   ?   ?   C . n 
C 1 233 GLY 233 274 ?   ?   ?   C . n 
C 1 234 GLY 234 275 ?   ?   ?   C . n 
C 1 235 ILE 235 276 ?   ?   ?   C . n 
C 1 236 ASP 236 277 ?   ?   ?   C . n 
C 1 237 GLN 237 278 ?   ?   ?   C . n 
C 1 238 LEU 238 279 ?   ?   ?   C . n 
C 1 239 GLN 239 280 ?   ?   ?   C . n 
C 1 240 GLY 240 281 281 GLY GLY C . n 
C 1 241 ILE 241 282 282 ILE ILE C . n 
C 1 242 VAL 242 283 283 VAL VAL C . n 
C 1 243 VAL 243 284 284 VAL VAL C . n 
C 1 244 ASN 244 285 285 ASN ASN C . n 
C 1 245 GLU 245 286 286 GLU GLU C . n 
C 1 246 VAL 246 287 287 VAL VAL C . n 
C 1 247 SER 247 288 288 SER SER C . n 
C 1 248 PRO 248 289 289 PRO PRO C . n 
C 1 249 ASP 249 290 290 ASP ASP C . n 
C 1 250 GLY 250 291 291 GLY GLY C . n 
C 1 251 PRO 251 292 292 PRO PRO C . n 
C 1 252 ALA 252 293 293 ALA ALA C . n 
C 1 253 ALA 253 294 294 ALA ALA C . n 
C 1 254 ASN 254 295 295 ASN ASN C . n 
C 1 255 ALA 255 296 296 ALA ALA C . n 
C 1 256 GLY 256 297 297 GLY GLY C . n 
C 1 257 ILE 257 298 298 ILE ALA C . n 
C 1 258 GLN 258 299 299 GLN GLN C . n 
C 1 259 VAL 259 300 300 VAL VAL C . n 
C 1 260 ASN 260 301 301 ASN ASN C . n 
C 1 261 ASP 261 302 302 ASP ASP C . n 
C 1 262 LEU 262 303 303 LEU LEU C . n 
C 1 263 ILE 263 304 304 ILE ILE C . n 
C 1 264 ILE 264 305 305 ILE ILE C . n 
C 1 265 SER 265 306 306 SER SER C . n 
C 1 266 VAL 266 307 307 VAL VAL C . n 
C 1 267 ASP 267 308 308 ASP ALA C . n 
C 1 268 ASN 268 309 309 ASN ALA C . n 
C 1 269 LYS 269 310 310 LYS ALA C . n 
C 1 270 PRO 270 311 311 PRO PRO C . n 
C 1 271 ALA 271 312 312 ALA ALA C . n 
C 1 272 ILE 272 313 313 ILE ILE C . n 
C 1 273 SER 273 314 314 SER SER C . n 
C 1 274 ALA 274 315 315 ALA ALA C . n 
C 1 275 LEU 275 316 316 LEU LEU C . n 
C 1 276 GLU 276 317 317 GLU GLU C . n 
C 1 277 THR 277 318 318 THR THR C . n 
C 1 278 MSE 278 319 319 MSE MSE C . n 
C 1 279 ASP 279 320 320 ASP ASP C . n 
C 1 280 GLN 280 321 321 GLN GLN C . n 
C 1 281 VAL 281 322 322 VAL VAL C . n 
C 1 282 ALA 282 323 323 ALA ALA C . n 
C 1 283 GLU 283 324 324 GLU GLU C . n 
C 1 284 ILE 284 325 325 ILE ILE C . n 
C 1 285 ARG 285 326 326 ARG ARG C . n 
C 1 286 PRO 286 327 327 PRO PRO C . n 
C 1 287 GLY 287 328 328 GLY GLY C . n 
C 1 288 SER 288 329 329 SER SER C . n 
C 1 289 VAL 289 330 330 VAL VAL C . n 
C 1 290 ILE 290 331 331 ILE ALA C . n 
C 1 291 PRO 291 332 332 PRO PRO C . n 
C 1 292 VAL 292 333 333 VAL VAL C . n 
C 1 293 VAL 293 334 ?   ?   ?   C . n 
C 1 294 VAL 294 335 ?   ?   ?   C . n 
C 1 295 MSE 295 336 ?   ?   ?   C . n 
C 1 296 ARG 296 337 ?   ?   ?   C . n 
C 1 297 ASP 297 338 ?   ?   ?   C . n 
C 1 298 ASP 298 339 ?   ?   ?   C . n 
C 1 299 LYS 299 340 ?   ?   ?   C . n 
C 1 300 GLN 300 341 ?   ?   ?   C . n 
C 1 301 LEU 301 342 342 LEU LEU C . n 
C 1 302 THR 302 343 343 THR THR C . n 
C 1 303 LEU 303 344 344 LEU LEU C . n 
C 1 304 GLN 304 345 345 GLN GLN C . n 
C 1 305 VAL 305 346 346 VAL VAL C . n 
C 1 306 THR 306 347 347 THR THR C . n 
C 1 307 ILE 307 348 348 ILE ILE C . n 
C 1 308 GLN 308 349 349 GLN GLN C . n 
C 1 309 GLU 309 350 350 GLU GLU C . n 
C 1 310 TYR 310 351 351 TYR TYR C . n 
C 1 311 PRO 311 352 352 PRO PRO C . n 
C 1 312 ALA 312 353 353 ALA ALA C . n 
C 1 313 THR 313 354 354 THR THR C . n 
C 1 314 ASN 314 355 ?   ?   ?   C . n 
C 1 315 HIS 315 356 ?   ?   ?   C . n 
C 1 316 HIS 316 357 ?   ?   ?   C . n 
C 1 317 HIS 317 358 ?   ?   ?   C . n 
C 1 318 HIS 318 359 ?   ?   ?   C . n 
C 1 319 HIS 319 360 ?   ?   ?   C . n 
C 1 320 HIS 320 361 ?   ?   ?   C . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1  A MSE 1   A MSE 42  ? MET SELENOMETHIONINE 
2  A MSE 44  A MSE 85  ? MET SELENOMETHIONINE 
3  A MSE 172 A MSE 213 ? MET SELENOMETHIONINE 
4  A MSE 204 A MSE 245 ? MET SELENOMETHIONINE 
5  A MSE 278 A MSE 319 ? MET SELENOMETHIONINE 
6  B MSE 1   B MSE 42  ? MET SELENOMETHIONINE 
7  B MSE 44  B MSE 85  ? MET SELENOMETHIONINE 
8  B MSE 172 B MSE 213 ? MET SELENOMETHIONINE 
9  B MSE 204 B MSE 245 ? MET SELENOMETHIONINE 
10 B MSE 278 B MSE 319 ? MET SELENOMETHIONINE 
11 B MSE 295 B MSE 336 ? MET SELENOMETHIONINE 
12 C MSE 1   C MSE 42  ? MET SELENOMETHIONINE 
13 C MSE 44  C MSE 85  ? MET SELENOMETHIONINE 
14 C MSE 172 C MSE 213 ? MET SELENOMETHIONINE 
15 C MSE 204 C MSE 245 ? MET SELENOMETHIONINE 
16 C MSE 278 C MSE 319 ? MET SELENOMETHIONINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4660  ? 
1 MORE         -27   ? 
1 'SSA (A^2)'  37000 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-06-08 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
AMoRE     phasing          .   ? 3 
CNS       refinement       1.0 ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 C   C ILE 76 ? ? O   C HOH 374 ? ? 0.20 
2  1 CB  B ILE 76 ? ? O   B HOH 423 ? ? 0.36 
3  1 CB  C ILE 76 ? ? O   C HOH 420 ? ? 0.47 
4  1 CA  C ARG 77 ? ? O   C HOH 370 ? ? 0.59 
5  1 O   C ARG 64 ? ? N   C GLY 65  ? ? 0.61 
6  1 CB  C ARG 77 ? ? O   C HOH 370 ? ? 1.04 
7  1 CG1 C ILE 76 ? ? O   C HOH 420 ? ? 1.08 
8  1 O   C ARG 64 ? ? CA  C GLY 65  ? ? 1.18 
9  1 O   C ILE 76 ? ? O   C HOH 374 ? ? 1.21 
10 1 CG1 B ILE 76 ? ? O   B HOH 423 ? ? 1.30 
11 1 CA  C ILE 76 ? ? O   C HOH 374 ? ? 1.44 
12 1 N   C ARG 77 ? ? O   C HOH 374 ? ? 1.47 
13 1 CA  B ILE 76 ? ? O   B HOH 423 ? ? 1.49 
14 1 N   C ARG 77 ? ? O   C HOH 370 ? ? 1.51 
15 1 CG2 C ILE 76 ? ? O   C HOH 420 ? ? 1.62 
16 1 CG2 B ILE 76 ? ? O   B HOH 423 ? ? 1.63 
17 1 NH2 B ARG 64 ? ? CB  B LEU 74  ? ? 1.64 
18 1 CA  C ILE 76 ? ? O   C HOH 420 ? ? 1.82 
19 1 C   C ARG 77 ? ? O   C HOH 370 ? ? 1.96 
20 1 CG  C ARG 77 ? ? O   C HOH 370 ? ? 2.01 
21 1 CA  B GLY 65 ? ? OD2 B ASP 102 ? ? 2.08 
22 1 NH2 B ARG 64 ? ? CD1 B LEU 74  ? ? 2.12 
23 1 CD1 C ILE 76 ? ? O   C HOH 420 ? ? 2.13 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    ND2 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    ASN 
_pdbx_validate_symm_contact.auth_seq_id_1     144 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    NE2 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HIS 
_pdbx_validate_symm_contact.auth_seq_id_2     361 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   1_554 
_pdbx_validate_symm_contact.dist              2.17 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C B ARG 77  ? ? N   B THR 78  ? ? 0.930 1.336 -0.406 0.023 Y 
2 1 C B HIS 361 ? ? OXT B HIS 361 ? ? 1.360 1.229 0.131  0.019 N 
3 1 C C ARG 77  ? ? N   C THR 78  ? ? 1.113 1.336 -0.223 0.023 Y 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 O  B ARG 77 ? ? C B ARG 77 ? ? N  B THR 78 ? ? 110.52 122.70 -12.18 1.60 Y 
2 1 C  B ARG 77 ? ? N B THR 78 ? ? CA B THR 78 ? ? 141.34 121.70 19.64  2.50 Y 
3 1 CA C ARG 64 ? ? C C ARG 64 ? ? N  C GLY 65 ? ? 96.33  116.20 -19.87 2.00 Y 
4 1 O  C ARG 64 ? ? C C ARG 64 ? ? N  C GLY 65 ? ? 28.57  123.20 -94.63 1.70 Y 
5 1 O  C ARG 77 ? ? C C ARG 77 ? ? N  C THR 78 ? ? 110.93 122.70 -11.77 1.60 Y 
6 1 C  C ARG 77 ? ? N C THR 78 ? ? CA C THR 78 ? ? 137.11 121.70 15.41  2.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 160 ? ? -107.57 64.36   
2  1 LEU A 164 ? ? -156.89 20.38   
3  1 LEU A 218 ? ? -56.61  104.54  
4  1 SER A 219 ? ? 37.32   -176.81 
5  1 PHE A 220 ? ? 177.22  -178.09 
6  1 ARG A 250 ? ? -60.55  -70.06  
7  1 ILE A 259 ? ? -147.67 -8.83   
8  1 VAL A 284 ? ? -66.69  85.05   
9  1 ASN A 285 ? ? -60.66  -71.07  
10 1 ASN A 295 ? ? -69.81  45.18   
11 1 ALA A 296 ? ? -174.63 -175.42 
12 1 ILE A 298 ? ? -167.72 120.00  
13 1 ASN A 301 ? ? -171.52 54.21   
14 1 ILE A 305 ? ? -120.96 -74.89  
15 1 ASP A 308 ? ? -155.18 -63.91  
16 1 PRO A 311 ? ? -35.19  145.25  
17 1 ALA A 312 ? ? -110.50 64.04   
18 1 ILE A 313 ? ? -46.16  -81.39  
19 1 VAL A 334 ? ? -48.31  -88.94  
20 1 THR A 343 ? ? -53.84  95.96   
21 1 TYR A 351 ? ? -15.97  128.69  
22 1 PRO A 352 ? ? -49.16  152.64  
23 1 ASN B 69  ? ? -105.36 -150.23 
24 1 LEU B 74  ? ? -59.73  95.95   
25 1 ARG B 77  ? ? -98.78  -68.75  
26 1 ASN B 160 ? ? -105.56 76.25   
27 1 TYR B 162 ? ? -102.11 67.26   
28 1 ASN B 163 ? ? -157.52 -29.67  
29 1 THR B 184 ? ? -145.13 -38.11  
30 1 ARG B 186 ? ? -23.26  -43.29  
31 1 SER B 219 ? ? 38.60   -172.52 
32 1 PHE B 220 ? ? 169.48  -169.14 
33 1 GLU B 230 ? ? -89.55  -96.79  
34 1 SER B 288 ? ? -30.66  142.63  
35 1 ASN B 295 ? ? -83.95  47.61   
36 1 ALA B 296 ? ? -176.92 -172.33 
37 1 ILE B 298 ? ? 178.45  123.31  
38 1 GLN B 299 ? ? -129.07 -52.54  
39 1 VAL B 300 ? ? -169.45 -50.25  
40 1 ILE B 313 ? ? -63.09  -73.59  
41 1 PRO B 352 ? ? -39.63  113.92  
42 1 THR B 354 ? ? -170.94 123.36  
43 1 HIS B 360 ? ? 87.01   -7.19   
44 1 ASN C 67  ? ? -79.80  39.99   
45 1 HIS C 71  ? ? -160.18 -10.28  
46 1 LEU C 74  ? ? -53.23  101.42  
47 1 ASP C 102 ? ? 77.77   -6.99   
48 1 GLN C 103 ? ? 177.40  119.88  
49 1 ASN C 160 ? ? -105.20 75.94   
50 1 ASN C 163 ? ? -147.86 -39.54  
51 1 SER C 195 ? ? -29.52  115.21  
52 1 SER C 201 ? ? -39.84  117.47  
53 1 SER C 219 ? ? 174.84  137.72  
54 1 PHE C 220 ? ? 153.53  90.45   
55 1 ASN C 285 ? ? -160.32 -10.12  
56 1 GLU C 286 ? ? -171.31 132.44  
57 1 VAL C 287 ? ? -155.41 34.53   
58 1 PRO C 289 ? ? -69.93  41.12   
59 1 ASP C 290 ? ? 45.00   25.91   
60 1 PRO C 292 ? ? -58.99  10.13   
61 1 GLN C 299 ? ? -83.54  -122.62 
62 1 VAL C 300 ? ? -151.70 -12.80  
63 1 ASN C 301 ? ? -152.96 31.54   
64 1 ASP C 308 ? ? 52.62   18.50   
65 1 ASN C 309 ? ? 93.93   -5.53   
66 1 ALA C 312 ? ? -116.76 56.65   
67 1 ILE C 313 ? ? -57.48  -78.53  
68 1 THR C 343 ? ? 167.75  93.18   
69 1 GLN C 345 ? ? -9.08   105.54  
70 1 GLU C 350 ? ? -34.64  127.73  
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 ARG B 64 ? ? -15.75 
2 1 ARG C 64 ? ? 30.87  
# 
loop_
_pdbx_validate_polymer_linkage.id 
_pdbx_validate_polymer_linkage.PDB_model_num 
_pdbx_validate_polymer_linkage.auth_atom_id_1 
_pdbx_validate_polymer_linkage.auth_asym_id_1 
_pdbx_validate_polymer_linkage.auth_comp_id_1 
_pdbx_validate_polymer_linkage.auth_seq_id_1 
_pdbx_validate_polymer_linkage.PDB_ins_code_1 
_pdbx_validate_polymer_linkage.label_alt_id_1 
_pdbx_validate_polymer_linkage.auth_atom_id_2 
_pdbx_validate_polymer_linkage.auth_asym_id_2 
_pdbx_validate_polymer_linkage.auth_comp_id_2 
_pdbx_validate_polymer_linkage.auth_seq_id_2 
_pdbx_validate_polymer_linkage.PDB_ins_code_2 
_pdbx_validate_polymer_linkage.label_alt_id_2 
_pdbx_validate_polymer_linkage.dist 
1 1 C B ARG 77 ? ? N B THR 78 ? ? 0.93 
2 1 C C ARG 77 ? ? N C THR 78 ? ? 1.11 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A ARG 186 ? CG  ? A ARG 145 CG  
2   1 Y 1 A ARG 186 ? CD  ? A ARG 145 CD  
3   1 Y 1 A ARG 186 ? NE  ? A ARG 145 NE  
4   1 Y 1 A ARG 186 ? CZ  ? A ARG 145 CZ  
5   1 Y 1 A ARG 186 ? NH1 ? A ARG 145 NH1 
6   1 Y 1 A ARG 186 ? NH2 ? A ARG 145 NH2 
7   1 Y 1 A GLU 230 ? CG  ? A GLU 189 CG  
8   1 Y 1 A GLU 230 ? CD  ? A GLU 189 CD  
9   1 Y 1 A GLU 230 ? OE1 ? A GLU 189 OE1 
10  1 Y 1 A GLU 230 ? OE2 ? A GLU 189 OE2 
11  1 Y 1 A ARG 264 ? CG  ? A ARG 223 CG  
12  1 Y 1 A ARG 264 ? CD  ? A ARG 223 CD  
13  1 Y 1 A ARG 264 ? NE  ? A ARG 223 NE  
14  1 Y 1 A ARG 264 ? CZ  ? A ARG 223 CZ  
15  1 Y 1 A ARG 264 ? NH1 ? A ARG 223 NH1 
16  1 Y 1 A ARG 264 ? NH2 ? A ARG 223 NH2 
17  1 Y 1 A VAL 287 ? CG1 ? A VAL 246 CG1 
18  1 Y 1 A VAL 287 ? CG2 ? A VAL 246 CG2 
19  1 Y 1 A SER 288 ? OG  ? A SER 247 OG  
20  1 Y 1 A ILE 298 ? CG1 ? A ILE 257 CG1 
21  1 Y 1 A ILE 298 ? CG2 ? A ILE 257 CG2 
22  1 Y 1 A ILE 298 ? CD1 ? A ILE 257 CD1 
23  1 Y 1 A VAL 335 ? CG1 ? A VAL 294 CG1 
24  1 Y 1 A VAL 335 ? CG2 ? A VAL 294 CG2 
25  1 Y 1 A GLN 341 ? CG  ? A GLN 300 CG  
26  1 Y 1 A GLN 341 ? CD  ? A GLN 300 CD  
27  1 Y 1 A GLN 341 ? OE1 ? A GLN 300 OE1 
28  1 Y 1 A GLN 341 ? NE2 ? A GLN 300 NE2 
29  1 Y 1 A LEU 342 ? CG  ? A LEU 301 CG  
30  1 Y 1 A LEU 342 ? CD1 ? A LEU 301 CD1 
31  1 Y 1 A LEU 342 ? CD2 ? A LEU 301 CD2 
32  1 Y 1 A THR 343 ? OG1 ? A THR 302 OG1 
33  1 Y 1 A THR 343 ? CG2 ? A THR 302 CG2 
34  1 Y 1 A LEU 344 ? CG  ? A LEU 303 CG  
35  1 Y 1 A LEU 344 ? CD1 ? A LEU 303 CD1 
36  1 Y 1 A LEU 344 ? CD2 ? A LEU 303 CD2 
37  1 Y 1 B ARG 186 ? CG  ? B ARG 145 CG  
38  1 Y 1 B ARG 186 ? CD  ? B ARG 145 CD  
39  1 Y 1 B ARG 186 ? NE  ? B ARG 145 NE  
40  1 Y 1 B ARG 186 ? CZ  ? B ARG 145 CZ  
41  1 Y 1 B ARG 186 ? NH1 ? B ARG 145 NH1 
42  1 Y 1 B ARG 186 ? NH2 ? B ARG 145 NH2 
43  1 Y 1 B ARG 264 ? CG  ? B ARG 223 CG  
44  1 Y 1 B ARG 264 ? CD  ? B ARG 223 CD  
45  1 Y 1 B ARG 264 ? NE  ? B ARG 223 NE  
46  1 Y 1 B ARG 264 ? CZ  ? B ARG 223 CZ  
47  1 Y 1 B ARG 264 ? NH1 ? B ARG 223 NH1 
48  1 Y 1 B ARG 264 ? NH2 ? B ARG 223 NH2 
49  1 Y 1 B ASP 290 ? CG  ? B ASP 249 CG  
50  1 Y 1 B ASP 290 ? OD1 ? B ASP 249 OD1 
51  1 Y 1 B ASP 290 ? OD2 ? B ASP 249 OD2 
52  1 Y 1 B ILE 298 ? CG1 ? B ILE 257 CG1 
53  1 Y 1 B ILE 298 ? CG2 ? B ILE 257 CG2 
54  1 Y 1 B ILE 298 ? CD1 ? B ILE 257 CD1 
55  1 Y 1 B GLN 341 ? CG  ? B GLN 300 CG  
56  1 Y 1 B GLN 341 ? CD  ? B GLN 300 CD  
57  1 Y 1 B GLN 341 ? OE1 ? B GLN 300 OE1 
58  1 Y 1 B GLN 341 ? NE2 ? B GLN 300 NE2 
59  1 Y 1 B THR 354 ? OG1 ? B THR 313 OG1 
60  1 Y 1 B THR 354 ? CG2 ? B THR 313 CG2 
61  1 Y 1 B ASN 355 ? CG  ? B ASN 314 CG  
62  1 Y 1 B ASN 355 ? OD1 ? B ASN 314 OD1 
63  1 Y 1 B ASN 355 ? ND2 ? B ASN 314 ND2 
64  1 Y 1 C ARG 186 ? CG  ? C ARG 145 CG  
65  1 Y 1 C ARG 186 ? CD  ? C ARG 145 CD  
66  1 Y 1 C ARG 186 ? NE  ? C ARG 145 NE  
67  1 Y 1 C ARG 186 ? CZ  ? C ARG 145 CZ  
68  1 Y 1 C ARG 186 ? NH1 ? C ARG 145 NH1 
69  1 Y 1 C ARG 186 ? NH2 ? C ARG 145 NH2 
70  1 Y 1 C ARG 264 ? CG  ? C ARG 223 CG  
71  1 Y 1 C ARG 264 ? CD  ? C ARG 223 CD  
72  1 Y 1 C ARG 264 ? NE  ? C ARG 223 NE  
73  1 Y 1 C ARG 264 ? CZ  ? C ARG 223 CZ  
74  1 Y 1 C ARG 264 ? NH1 ? C ARG 223 NH1 
75  1 Y 1 C ARG 264 ? NH2 ? C ARG 223 NH2 
76  1 Y 1 C ILE 298 ? CG1 ? C ILE 257 CG1 
77  1 Y 1 C ILE 298 ? CG2 ? C ILE 257 CG2 
78  1 Y 1 C ILE 298 ? CD1 ? C ILE 257 CD1 
79  1 Y 1 C ASP 308 ? CG  ? C ASP 267 CG  
80  1 Y 1 C ASP 308 ? OD1 ? C ASP 267 OD1 
81  1 Y 1 C ASP 308 ? OD2 ? C ASP 267 OD2 
82  1 Y 1 C ASN 309 ? CG  ? C ASN 268 CG  
83  1 Y 1 C ASN 309 ? OD1 ? C ASN 268 OD1 
84  1 Y 1 C ASN 309 ? ND2 ? C ASN 268 ND2 
85  1 Y 1 C LYS 310 ? CG  ? C LYS 269 CG  
86  1 Y 1 C LYS 310 ? CD  ? C LYS 269 CD  
87  1 Y 1 C LYS 310 ? CE  ? C LYS 269 CE  
88  1 Y 1 C LYS 310 ? NZ  ? C LYS 269 NZ  
89  1 Y 1 C ILE 331 ? CG1 ? C ILE 290 CG1 
90  1 Y 1 C ILE 331 ? CG2 ? C ILE 290 CG2 
91  1 Y 1 C ILE 331 ? CD1 ? C ILE 290 CD1 
92  1 Y 1 C VAL 333 ? CG1 ? C VAL 292 CG1 
93  1 Y 1 C VAL 333 ? CG2 ? C VAL 292 CG2 
94  1 Y 1 C LEU 342 ? CG  ? C LEU 301 CG  
95  1 Y 1 C LEU 342 ? CD1 ? C LEU 301 CD1 
96  1 Y 1 C LEU 342 ? CD2 ? C LEU 301 CD2 
97  1 Y 1 C THR 343 ? OG1 ? C THR 302 OG1 
98  1 Y 1 C THR 343 ? CG2 ? C THR 302 CG2 
99  1 Y 1 C LEU 344 ? CG  ? C LEU 303 CG  
100 1 Y 1 C LEU 344 ? CD1 ? C LEU 303 CD1 
101 1 Y 1 C LEU 344 ? CD2 ? C LEU 303 CD2 
102 1 Y 1 C THR 354 ? OG1 ? C THR 313 OG1 
103 1 Y 1 C THR 354 ? CG2 ? C THR 313 CG2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A LYS 222 ? A LYS 181 
2   1 Y 1 A SER 223 ? A SER 182 
3   1 Y 1 A ASN 224 ? A ASN 183 
4   1 Y 1 A ASP 225 ? A ASP 184 
5   1 Y 1 A GLY 226 ? A GLY 185 
6   1 Y 1 A GLU 227 ? A GLU 186 
7   1 Y 1 A THR 228 ? A THR 187 
8   1 Y 1 A PRO 229 ? A PRO 188 
9   1 Y 1 A GLU 265 ? A GLU 224 
10  1 Y 1 A ILE 266 ? A ILE 225 
11  1 Y 1 A ALA 267 ? A ALA 226 
12  1 Y 1 A PRO 268 ? A PRO 227 
13  1 Y 1 A LEU 269 ? A LEU 228 
14  1 Y 1 A HIS 270 ? A HIS 229 
15  1 Y 1 A ALA 271 ? A ALA 230 
16  1 Y 1 A GLN 272 ? A GLN 231 
17  1 Y 1 A GLY 273 ? A GLY 232 
18  1 Y 1 A GLY 274 ? A GLY 233 
19  1 Y 1 A GLY 275 ? A GLY 234 
20  1 Y 1 A ILE 276 ? A ILE 235 
21  1 Y 1 A ASP 277 ? A ASP 236 
22  1 Y 1 A GLN 278 ? A GLN 237 
23  1 Y 1 A LEU 279 ? A LEU 238 
24  1 Y 1 A GLN 280 ? A GLN 239 
25  1 Y 1 A MSE 336 ? A MSE 295 
26  1 Y 1 A ARG 337 ? A ARG 296 
27  1 Y 1 A ASP 338 ? A ASP 297 
28  1 Y 1 A ASP 339 ? A ASP 298 
29  1 Y 1 A LYS 340 ? A LYS 299 
30  1 Y 1 A THR 354 ? A THR 313 
31  1 Y 1 A ASN 355 ? A ASN 314 
32  1 Y 1 A HIS 356 ? A HIS 315 
33  1 Y 1 A HIS 357 ? A HIS 316 
34  1 Y 1 A HIS 358 ? A HIS 317 
35  1 Y 1 A HIS 359 ? A HIS 318 
36  1 Y 1 A HIS 360 ? A HIS 319 
37  1 Y 1 A HIS 361 ? A HIS 320 
38  1 Y 0 B THR 68  ? B THR 27  
39  1 Y 0 B ASN 69  ? B ASN 28  
40  1 Y 0 B SER 70  ? B SER 29  
41  1 Y 0 B HIS 71  ? B HIS 30  
42  1 Y 0 B ASN 72  ? B ASN 31  
43  1 Y 0 B GLN 73  ? B GLN 32  
44  1 Y 0 B LEU 74  ? B LEU 33  
45  1 Y 0 B GLU 75  ? B GLU 34  
46  1 Y 0 B ILE 76  ? B ILE 35  
47  1 Y 0 B ARG 77  ? B ARG 36  
48  1 Y 0 B THR 78  ? B THR 37  
49  1 Y 1 B LYS 222 ? B LYS 181 
50  1 Y 1 B SER 223 ? B SER 182 
51  1 Y 1 B ASN 224 ? B ASN 183 
52  1 Y 1 B ASP 225 ? B ASP 184 
53  1 Y 1 B GLY 226 ? B GLY 185 
54  1 Y 1 B GLU 227 ? B GLU 186 
55  1 Y 1 B THR 228 ? B THR 187 
56  1 Y 1 B GLU 265 ? B GLU 224 
57  1 Y 1 B ILE 266 ? B ILE 225 
58  1 Y 1 B ALA 267 ? B ALA 226 
59  1 Y 1 B PRO 268 ? B PRO 227 
60  1 Y 1 B LEU 269 ? B LEU 228 
61  1 Y 1 B HIS 270 ? B HIS 229 
62  1 Y 1 B ALA 271 ? B ALA 230 
63  1 Y 1 B GLN 272 ? B GLN 231 
64  1 Y 1 B GLY 273 ? B GLY 232 
65  1 Y 1 B GLY 274 ? B GLY 233 
66  1 Y 1 B GLY 275 ? B GLY 234 
67  1 Y 1 B ILE 276 ? B ILE 235 
68  1 Y 1 B ASP 277 ? B ASP 236 
69  1 Y 1 B GLN 278 ? B GLN 237 
70  1 Y 1 B LEU 279 ? B LEU 238 
71  1 Y 1 B ARG 337 ? B ARG 296 
72  1 Y 1 B ASP 338 ? B ASP 297 
73  1 Y 1 B ASP 339 ? B ASP 298 
74  1 Y 1 B LYS 340 ? B LYS 299 
75  1 Y 0 C THR 68  ? C THR 27  
76  1 Y 0 C ASN 69  ? C ASN 28  
77  1 Y 0 C SER 70  ? C SER 29  
78  1 Y 0 C HIS 71  ? C HIS 30  
79  1 Y 0 C ASN 72  ? C ASN 31  
80  1 Y 0 C GLN 73  ? C GLN 32  
81  1 Y 0 C LEU 74  ? C LEU 33  
82  1 Y 0 C GLU 75  ? C GLU 34  
83  1 Y 0 C ILE 76  ? C ILE 35  
84  1 Y 0 C ARG 77  ? C ARG 36  
85  1 Y 0 C THR 78  ? C THR 37  
86  1 Y 1 C LYS 222 ? C LYS 181 
87  1 Y 1 C SER 223 ? C SER 182 
88  1 Y 1 C ASN 224 ? C ASN 183 
89  1 Y 1 C ASP 225 ? C ASP 184 
90  1 Y 1 C GLY 226 ? C GLY 185 
91  1 Y 1 C GLU 227 ? C GLU 186 
92  1 Y 1 C THR 228 ? C THR 187 
93  1 Y 1 C PRO 229 ? C PRO 188 
94  1 Y 1 C GLU 265 ? C GLU 224 
95  1 Y 1 C ILE 266 ? C ILE 225 
96  1 Y 1 C ALA 267 ? C ALA 226 
97  1 Y 1 C PRO 268 ? C PRO 227 
98  1 Y 1 C LEU 269 ? C LEU 228 
99  1 Y 1 C HIS 270 ? C HIS 229 
100 1 Y 1 C ALA 271 ? C ALA 230 
101 1 Y 1 C GLN 272 ? C GLN 231 
102 1 Y 1 C GLY 273 ? C GLY 232 
103 1 Y 1 C GLY 274 ? C GLY 233 
104 1 Y 1 C GLY 275 ? C GLY 234 
105 1 Y 1 C ILE 276 ? C ILE 235 
106 1 Y 1 C ASP 277 ? C ASP 236 
107 1 Y 1 C GLN 278 ? C GLN 237 
108 1 Y 1 C LEU 279 ? C LEU 238 
109 1 Y 1 C GLN 280 ? C GLN 239 
110 1 Y 1 C VAL 334 ? C VAL 293 
111 1 Y 1 C VAL 335 ? C VAL 294 
112 1 Y 1 C MSE 336 ? C MSE 295 
113 1 Y 1 C ARG 337 ? C ARG 296 
114 1 Y 1 C ASP 338 ? C ASP 297 
115 1 Y 1 C ASP 339 ? C ASP 298 
116 1 Y 1 C LYS 340 ? C LYS 299 
117 1 Y 1 C GLN 341 ? C GLN 300 
118 1 Y 1 C ASN 355 ? C ASN 314 
119 1 Y 1 C HIS 356 ? C HIS 315 
120 1 Y 1 C HIS 357 ? C HIS 316 
121 1 Y 1 C HIS 358 ? C HIS 317 
122 1 Y 1 C HIS 359 ? C HIS 318 
123 1 Y 1 C HIS 360 ? C HIS 319 
124 1 Y 1 C HIS 361 ? C HIS 320 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 HOH 1   362 2   HOH HOH A . 
D 2 HOH 2   363 3   HOH HOH A . 
D 2 HOH 3   364 4   HOH HOH A . 
D 2 HOH 4   365 5   HOH HOH A . 
D 2 HOH 5   366 7   HOH HOH A . 
D 2 HOH 6   367 9   HOH HOH A . 
D 2 HOH 7   368 10  HOH HOH A . 
D 2 HOH 8   369 11  HOH HOH A . 
D 2 HOH 9   370 13  HOH HOH A . 
D 2 HOH 10  371 15  HOH HOH A . 
D 2 HOH 11  372 17  HOH HOH A . 
D 2 HOH 12  373 18  HOH HOH A . 
D 2 HOH 13  374 19  HOH HOH A . 
D 2 HOH 14  375 20  HOH HOH A . 
D 2 HOH 15  376 21  HOH HOH A . 
D 2 HOH 16  377 22  HOH HOH A . 
D 2 HOH 17  378 23  HOH HOH A . 
D 2 HOH 18  379 24  HOH HOH A . 
D 2 HOH 19  380 27  HOH HOH A . 
D 2 HOH 20  381 29  HOH HOH A . 
D 2 HOH 21  382 35  HOH HOH A . 
D 2 HOH 22  383 36  HOH HOH A . 
D 2 HOH 23  384 37  HOH HOH A . 
D 2 HOH 24  385 41  HOH HOH A . 
D 2 HOH 25  386 46  HOH HOH A . 
D 2 HOH 26  387 47  HOH HOH A . 
D 2 HOH 27  388 50  HOH HOH A . 
D 2 HOH 28  389 53  HOH HOH A . 
D 2 HOH 29  390 57  HOH HOH A . 
D 2 HOH 30  391 58  HOH HOH A . 
D 2 HOH 31  392 59  HOH HOH A . 
D 2 HOH 32  393 61  HOH HOH A . 
D 2 HOH 33  394 62  HOH HOH A . 
D 2 HOH 34  395 65  HOH HOH A . 
D 2 HOH 35  396 67  HOH HOH A . 
D 2 HOH 36  397 69  HOH HOH A . 
D 2 HOH 37  398 70  HOH HOH A . 
D 2 HOH 38  399 71  HOH HOH A . 
D 2 HOH 39  400 72  HOH HOH A . 
D 2 HOH 40  401 73  HOH HOH A . 
D 2 HOH 41  402 79  HOH HOH A . 
D 2 HOH 42  403 80  HOH HOH A . 
D 2 HOH 43  404 81  HOH HOH A . 
D 2 HOH 44  405 84  HOH HOH A . 
D 2 HOH 45  406 87  HOH HOH A . 
D 2 HOH 46  407 88  HOH HOH A . 
D 2 HOH 47  408 92  HOH HOH A . 
D 2 HOH 48  409 95  HOH HOH A . 
D 2 HOH 49  410 100 HOH HOH A . 
D 2 HOH 50  411 107 HOH HOH A . 
D 2 HOH 51  412 108 HOH HOH A . 
D 2 HOH 52  413 109 HOH HOH A . 
D 2 HOH 53  414 111 HOH HOH A . 
D 2 HOH 54  415 112 HOH HOH A . 
D 2 HOH 55  416 117 HOH HOH A . 
D 2 HOH 56  417 118 HOH HOH A . 
D 2 HOH 57  418 121 HOH HOH A . 
D 2 HOH 58  419 123 HOH HOH A . 
D 2 HOH 59  420 124 HOH HOH A . 
D 2 HOH 60  421 125 HOH HOH A . 
D 2 HOH 61  422 126 HOH HOH A . 
D 2 HOH 62  423 127 HOH HOH A . 
D 2 HOH 63  424 135 HOH HOH A . 
D 2 HOH 64  425 138 HOH HOH A . 
D 2 HOH 65  426 143 HOH HOH A . 
D 2 HOH 66  427 144 HOH HOH A . 
D 2 HOH 67  428 147 HOH HOH A . 
D 2 HOH 68  429 153 HOH HOH A . 
D 2 HOH 69  430 155 HOH HOH A . 
D 2 HOH 70  431 157 HOH HOH A . 
D 2 HOH 71  432 158 HOH HOH A . 
D 2 HOH 72  433 161 HOH HOH A . 
D 2 HOH 73  434 162 HOH HOH A . 
D 2 HOH 74  435 163 HOH HOH A . 
D 2 HOH 75  436 168 HOH HOH A . 
D 2 HOH 76  437 169 HOH HOH A . 
D 2 HOH 77  438 171 HOH HOH A . 
D 2 HOH 78  439 174 HOH HOH A . 
D 2 HOH 79  440 176 HOH HOH A . 
D 2 HOH 80  441 181 HOH HOH A . 
D 2 HOH 81  442 182 HOH HOH A . 
D 2 HOH 82  443 185 HOH HOH A . 
D 2 HOH 83  444 188 HOH HOH A . 
D 2 HOH 84  445 191 HOH HOH A . 
D 2 HOH 85  446 192 HOH HOH A . 
D 2 HOH 86  447 194 HOH HOH A . 
D 2 HOH 87  448 198 HOH HOH A . 
D 2 HOH 88  449 209 HOH HOH A . 
D 2 HOH 89  450 210 HOH HOH A . 
D 2 HOH 90  451 212 HOH HOH A . 
D 2 HOH 91  452 213 HOH HOH A . 
D 2 HOH 92  453 214 HOH HOH A . 
D 2 HOH 93  454 217 HOH HOH A . 
D 2 HOH 94  455 219 HOH HOH A . 
D 2 HOH 95  456 220 HOH HOH A . 
D 2 HOH 96  457 221 HOH HOH A . 
D 2 HOH 97  458 223 HOH HOH A . 
D 2 HOH 98  459 224 HOH HOH A . 
D 2 HOH 99  460 225 HOH HOH A . 
D 2 HOH 100 461 227 HOH HOH A . 
D 2 HOH 101 462 228 HOH HOH A . 
D 2 HOH 102 463 229 HOH HOH A . 
D 2 HOH 103 464 231 HOH HOH A . 
D 2 HOH 104 465 236 HOH HOH A . 
D 2 HOH 105 466 240 HOH HOH A . 
D 2 HOH 106 467 246 HOH HOH A . 
D 2 HOH 107 468 252 HOH HOH A . 
D 2 HOH 108 469 254 HOH HOH A . 
D 2 HOH 109 470 257 HOH HOH A . 
D 2 HOH 110 471 260 HOH HOH A . 
D 2 HOH 111 472 264 HOH HOH A . 
D 2 HOH 112 473 265 HOH HOH A . 
D 2 HOH 113 474 266 HOH HOH A . 
D 2 HOH 114 475 269 HOH HOH A . 
D 2 HOH 115 476 271 HOH HOH A . 
D 2 HOH 116 477 272 HOH HOH A . 
D 2 HOH 117 478 278 HOH HOH A . 
D 2 HOH 118 479 281 HOH HOH A . 
D 2 HOH 119 480 282 HOH HOH A . 
D 2 HOH 120 481 283 HOH HOH A . 
D 2 HOH 121 482 284 HOH HOH A . 
D 2 HOH 122 483 287 HOH HOH A . 
D 2 HOH 123 484 288 HOH HOH A . 
D 2 HOH 124 485 291 HOH HOH A . 
D 2 HOH 125 486 294 HOH HOH A . 
D 2 HOH 126 487 295 HOH HOH A . 
D 2 HOH 127 488 300 HOH HOH A . 
D 2 HOH 128 489 301 HOH HOH A . 
D 2 HOH 129 490 302 HOH HOH A . 
D 2 HOH 130 491 306 HOH HOH A . 
D 2 HOH 131 492 309 HOH HOH A . 
D 2 HOH 132 493 316 HOH HOH A . 
D 2 HOH 133 494 317 HOH HOH A . 
D 2 HOH 134 495 318 HOH HOH A . 
D 2 HOH 135 496 319 HOH HOH A . 
D 2 HOH 136 497 321 HOH HOH A . 
D 2 HOH 137 498 322 HOH HOH A . 
D 2 HOH 138 499 323 HOH HOH A . 
D 2 HOH 139 500 330 HOH HOH A . 
E 2 HOH 1   362 6   HOH HOH B . 
E 2 HOH 2   363 12  HOH HOH B . 
E 2 HOH 3   364 25  HOH HOH B . 
E 2 HOH 4   365 26  HOH HOH B . 
E 2 HOH 5   366 30  HOH HOH B . 
E 2 HOH 6   367 32  HOH HOH B . 
E 2 HOH 7   368 34  HOH HOH B . 
E 2 HOH 8   369 40  HOH HOH B . 
E 2 HOH 9   370 42  HOH HOH B . 
E 2 HOH 10  371 44  HOH HOH B . 
E 2 HOH 11  372 48  HOH HOH B . 
E 2 HOH 12  373 52  HOH HOH B . 
E 2 HOH 13  374 54  HOH HOH B . 
E 2 HOH 14  375 55  HOH HOH B . 
E 2 HOH 15  376 63  HOH HOH B . 
E 2 HOH 16  377 64  HOH HOH B . 
E 2 HOH 17  378 68  HOH HOH B . 
E 2 HOH 18  379 74  HOH HOH B . 
E 2 HOH 19  380 75  HOH HOH B . 
E 2 HOH 20  381 76  HOH HOH B . 
E 2 HOH 21  382 83  HOH HOH B . 
E 2 HOH 22  383 90  HOH HOH B . 
E 2 HOH 23  384 94  HOH HOH B . 
E 2 HOH 24  385 99  HOH HOH B . 
E 2 HOH 25  386 101 HOH HOH B . 
E 2 HOH 26  387 103 HOH HOH B . 
E 2 HOH 27  388 105 HOH HOH B . 
E 2 HOH 28  389 106 HOH HOH B . 
E 2 HOH 29  390 110 HOH HOH B . 
E 2 HOH 30  391 113 HOH HOH B . 
E 2 HOH 31  392 114 HOH HOH B . 
E 2 HOH 32  393 115 HOH HOH B . 
E 2 HOH 33  394 116 HOH HOH B . 
E 2 HOH 34  395 128 HOH HOH B . 
E 2 HOH 35  396 131 HOH HOH B . 
E 2 HOH 36  397 132 HOH HOH B . 
E 2 HOH 37  398 133 HOH HOH B . 
E 2 HOH 38  399 134 HOH HOH B . 
E 2 HOH 39  400 141 HOH HOH B . 
E 2 HOH 40  401 146 HOH HOH B . 
E 2 HOH 41  402 148 HOH HOH B . 
E 2 HOH 42  403 149 HOH HOH B . 
E 2 HOH 43  404 150 HOH HOH B . 
E 2 HOH 44  405 152 HOH HOH B . 
E 2 HOH 45  406 160 HOH HOH B . 
E 2 HOH 46  407 164 HOH HOH B . 
E 2 HOH 47  408 165 HOH HOH B . 
E 2 HOH 48  409 172 HOH HOH B . 
E 2 HOH 49  410 175 HOH HOH B . 
E 2 HOH 50  411 177 HOH HOH B . 
E 2 HOH 51  412 180 HOH HOH B . 
E 2 HOH 52  413 184 HOH HOH B . 
E 2 HOH 53  414 187 HOH HOH B . 
E 2 HOH 54  415 193 HOH HOH B . 
E 2 HOH 55  416 196 HOH HOH B . 
E 2 HOH 56  417 201 HOH HOH B . 
E 2 HOH 57  418 203 HOH HOH B . 
E 2 HOH 58  419 204 HOH HOH B . 
E 2 HOH 59  420 207 HOH HOH B . 
E 2 HOH 60  421 211 HOH HOH B . 
E 2 HOH 61  422 215 HOH HOH B . 
E 2 HOH 62  423 226 HOH HOH B . 
E 2 HOH 63  424 232 HOH HOH B . 
E 2 HOH 64  425 233 HOH HOH B . 
E 2 HOH 65  426 235 HOH HOH B . 
E 2 HOH 66  427 237 HOH HOH B . 
E 2 HOH 67  428 238 HOH HOH B . 
E 2 HOH 68  429 239 HOH HOH B . 
E 2 HOH 69  430 242 HOH HOH B . 
E 2 HOH 70  431 243 HOH HOH B . 
E 2 HOH 71  432 244 HOH HOH B . 
E 2 HOH 72  433 247 HOH HOH B . 
E 2 HOH 73  434 251 HOH HOH B . 
E 2 HOH 74  435 255 HOH HOH B . 
E 2 HOH 75  436 258 HOH HOH B . 
E 2 HOH 76  437 263 HOH HOH B . 
E 2 HOH 77  438 268 HOH HOH B . 
E 2 HOH 78  439 273 HOH HOH B . 
E 2 HOH 79  440 275 HOH HOH B . 
E 2 HOH 80  441 277 HOH HOH B . 
E 2 HOH 81  442 279 HOH HOH B . 
E 2 HOH 82  443 280 HOH HOH B . 
E 2 HOH 83  444 285 HOH HOH B . 
E 2 HOH 84  445 286 HOH HOH B . 
E 2 HOH 85  446 290 HOH HOH B . 
E 2 HOH 86  447 298 HOH HOH B . 
E 2 HOH 87  448 299 HOH HOH B . 
E 2 HOH 88  449 303 HOH HOH B . 
E 2 HOH 89  450 304 HOH HOH B . 
E 2 HOH 90  451 305 HOH HOH B . 
E 2 HOH 91  452 307 HOH HOH B . 
E 2 HOH 92  453 308 HOH HOH B . 
E 2 HOH 93  454 311 HOH HOH B . 
E 2 HOH 94  455 315 HOH HOH B . 
E 2 HOH 95  456 320 HOH HOH B . 
E 2 HOH 96  457 324 HOH HOH B . 
E 2 HOH 97  458 325 HOH HOH B . 
E 2 HOH 98  459 327 HOH HOH B . 
F 2 HOH 1   362 1   HOH HOH C . 
F 2 HOH 2   363 8   HOH HOH C . 
F 2 HOH 3   364 14  HOH HOH C . 
F 2 HOH 4   365 16  HOH HOH C . 
F 2 HOH 5   366 28  HOH HOH C . 
F 2 HOH 6   367 31  HOH HOH C . 
F 2 HOH 7   368 33  HOH HOH C . 
F 2 HOH 8   369 38  HOH HOH C . 
F 2 HOH 9   370 39  HOH HOH C . 
F 2 HOH 10  371 43  HOH HOH C . 
F 2 HOH 11  372 45  HOH HOH C . 
F 2 HOH 12  373 49  HOH HOH C . 
F 2 HOH 13  374 51  HOH HOH C . 
F 2 HOH 14  375 56  HOH HOH C . 
F 2 HOH 15  376 60  HOH HOH C . 
F 2 HOH 16  377 66  HOH HOH C . 
F 2 HOH 17  378 77  HOH HOH C . 
F 2 HOH 18  379 78  HOH HOH C . 
F 2 HOH 19  380 82  HOH HOH C . 
F 2 HOH 20  381 85  HOH HOH C . 
F 2 HOH 21  382 86  HOH HOH C . 
F 2 HOH 22  383 89  HOH HOH C . 
F 2 HOH 23  384 91  HOH HOH C . 
F 2 HOH 24  385 93  HOH HOH C . 
F 2 HOH 25  386 96  HOH HOH C . 
F 2 HOH 26  387 97  HOH HOH C . 
F 2 HOH 27  388 98  HOH HOH C . 
F 2 HOH 28  389 102 HOH HOH C . 
F 2 HOH 29  390 104 HOH HOH C . 
F 2 HOH 30  391 119 HOH HOH C . 
F 2 HOH 31  392 120 HOH HOH C . 
F 2 HOH 32  393 122 HOH HOH C . 
F 2 HOH 33  394 129 HOH HOH C . 
F 2 HOH 34  395 130 HOH HOH C . 
F 2 HOH 35  396 136 HOH HOH C . 
F 2 HOH 36  397 137 HOH HOH C . 
F 2 HOH 37  398 139 HOH HOH C . 
F 2 HOH 38  399 140 HOH HOH C . 
F 2 HOH 39  400 142 HOH HOH C . 
F 2 HOH 40  401 145 HOH HOH C . 
F 2 HOH 41  402 151 HOH HOH C . 
F 2 HOH 42  403 154 HOH HOH C . 
F 2 HOH 43  404 156 HOH HOH C . 
F 2 HOH 44  405 159 HOH HOH C . 
F 2 HOH 45  406 166 HOH HOH C . 
F 2 HOH 46  407 167 HOH HOH C . 
F 2 HOH 47  408 170 HOH HOH C . 
F 2 HOH 48  409 173 HOH HOH C . 
F 2 HOH 49  410 178 HOH HOH C . 
F 2 HOH 50  411 179 HOH HOH C . 
F 2 HOH 51  412 183 HOH HOH C . 
F 2 HOH 52  413 186 HOH HOH C . 
F 2 HOH 53  414 189 HOH HOH C . 
F 2 HOH 54  415 190 HOH HOH C . 
F 2 HOH 55  416 195 HOH HOH C . 
F 2 HOH 56  417 197 HOH HOH C . 
F 2 HOH 57  418 199 HOH HOH C . 
F 2 HOH 58  419 200 HOH HOH C . 
F 2 HOH 59  420 202 HOH HOH C . 
F 2 HOH 60  421 205 HOH HOH C . 
F 2 HOH 61  422 206 HOH HOH C . 
F 2 HOH 62  423 208 HOH HOH C . 
F 2 HOH 63  424 216 HOH HOH C . 
F 2 HOH 64  425 218 HOH HOH C . 
F 2 HOH 65  426 222 HOH HOH C . 
F 2 HOH 66  427 230 HOH HOH C . 
F 2 HOH 67  428 234 HOH HOH C . 
F 2 HOH 68  429 241 HOH HOH C . 
F 2 HOH 69  430 245 HOH HOH C . 
F 2 HOH 70  431 248 HOH HOH C . 
F 2 HOH 71  432 249 HOH HOH C . 
F 2 HOH 72  433 250 HOH HOH C . 
F 2 HOH 73  434 253 HOH HOH C . 
F 2 HOH 74  435 256 HOH HOH C . 
F 2 HOH 75  436 259 HOH HOH C . 
F 2 HOH 76  437 261 HOH HOH C . 
F 2 HOH 77  438 262 HOH HOH C . 
F 2 HOH 78  439 267 HOH HOH C . 
F 2 HOH 79  440 270 HOH HOH C . 
F 2 HOH 80  441 274 HOH HOH C . 
F 2 HOH 81  442 276 HOH HOH C . 
F 2 HOH 82  443 289 HOH HOH C . 
F 2 HOH 83  444 292 HOH HOH C . 
F 2 HOH 84  445 293 HOH HOH C . 
F 2 HOH 85  446 296 HOH HOH C . 
F 2 HOH 86  447 297 HOH HOH C . 
F 2 HOH 87  448 310 HOH HOH C . 
F 2 HOH 88  449 312 HOH HOH C . 
F 2 HOH 89  450 313 HOH HOH C . 
F 2 HOH 90  451 314 HOH HOH C . 
F 2 HOH 91  452 326 HOH HOH C . 
F 2 HOH 92  453 328 HOH HOH C . 
F 2 HOH 93  454 329 HOH HOH C . 
#