data_1SOZ
# 
_entry.id   1SOZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SOZ         
RCSB  RCSB021887   
WWPDB D_1000021887 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1SOT 'DegS protease, inactive proteolytic site'                           unspecified 
PDB 1VCW 'Crystal structure of DegS after backsoaking the activating peptide' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SOZ 
_pdbx_database_status.recvd_initial_deposition_date   2004-03-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wilken, C.'    1 
'Kitzing, K.'   2 
'Kurzbauer, R.' 3 
'Ehrmann, M.'   4 
'Clausen, T.'   5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structure of the DegS stress sensor: How a PDZ domain recognizes misfolded protein and activates a protease' 
'Cell(Cambridge,Mass.)' 117 483 494 2004 CELLB5 US 0092-8674 0998 ? 15137941 '10.1016/S0092-8674(04)00454-4' 
1       
;OMP peptide signals initiate the envelope-stress response by activating DegS protease via relief of inhibition mediated by its PDZ domain
;
'Cell(Cambridge,Mass.)' 113 61  71  2003 CELLB5 US 0092-8674 0998 ? ?        '10.1016/S0092-8674(03)00203-4' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wilken, C.'    1  
primary 'Kitzing, K.'   2  
primary 'Kurzbauer, R.' 3  
primary 'Ehrmann, M.'   4  
primary 'Clausen, T.'   5  
1       'Walsh, N.P.'   6  
1       'Alba, B.M.'    7  
1       'Bose, B.'      8  
1       'Gross, C.A.'   9  
1       'Sauer, R.T.'   10 
# 
_cell.entry_id           1SOZ 
_cell.length_a           205.984 
_cell.length_b           142.710 
_cell.length_c           41.167 
_cell.angle_alpha        90.00 
_cell.angle_beta         89.24 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SOZ 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Protease degS'      33243.664 3   3.4.21.- ? ? ? 
2 polymer syn 'activating peptide' 1225.374  2   ?        ? ? ? 
3 water   nat water                18.015    224 ?        ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGS
DSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNS
GGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQG
IVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPATN
;
;MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGS
DSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNS
GGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQG
IVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPATN
;
A,B,C ? 
2 'polypeptide(L)' no no DNRLGLVYQF DNRLGLVYQF D,E   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   PRO n 
1 4   ALA n 
1 5   SER n 
1 6   TYR n 
1 7   ASN n 
1 8   LEU n 
1 9   ALA n 
1 10  VAL n 
1 11  ARG n 
1 12  ARG n 
1 13  ALA n 
1 14  ALA n 
1 15  PRO n 
1 16  ALA n 
1 17  VAL n 
1 18  VAL n 
1 19  ASN n 
1 20  VAL n 
1 21  TYR n 
1 22  ASN n 
1 23  ARG n 
1 24  GLY n 
1 25  LEU n 
1 26  ASN n 
1 27  THR n 
1 28  ASN n 
1 29  SER n 
1 30  HIS n 
1 31  ASN n 
1 32  GLN n 
1 33  LEU n 
1 34  GLU n 
1 35  ILE n 
1 36  ARG n 
1 37  THR n 
1 38  LEU n 
1 39  GLY n 
1 40  SER n 
1 41  GLY n 
1 42  VAL n 
1 43  ILE n 
1 44  MET n 
1 45  ASP n 
1 46  GLN n 
1 47  ARG n 
1 48  GLY n 
1 49  TYR n 
1 50  ILE n 
1 51  ILE n 
1 52  THR n 
1 53  ASN n 
1 54  LYS n 
1 55  HIS n 
1 56  VAL n 
1 57  ILE n 
1 58  ASN n 
1 59  ASP n 
1 60  ALA n 
1 61  ASP n 
1 62  GLN n 
1 63  ILE n 
1 64  ILE n 
1 65  VAL n 
1 66  ALA n 
1 67  LEU n 
1 68  GLN n 
1 69  ASP n 
1 70  GLY n 
1 71  ARG n 
1 72  VAL n 
1 73  PHE n 
1 74  GLU n 
1 75  ALA n 
1 76  LEU n 
1 77  LEU n 
1 78  VAL n 
1 79  GLY n 
1 80  SER n 
1 81  ASP n 
1 82  SER n 
1 83  LEU n 
1 84  THR n 
1 85  ASP n 
1 86  LEU n 
1 87  ALA n 
1 88  VAL n 
1 89  LEU n 
1 90  LYS n 
1 91  ILE n 
1 92  ASN n 
1 93  ALA n 
1 94  THR n 
1 95  GLY n 
1 96  GLY n 
1 97  LEU n 
1 98  PRO n 
1 99  THR n 
1 100 ILE n 
1 101 PRO n 
1 102 ILE n 
1 103 ASN n 
1 104 ALA n 
1 105 ARG n 
1 106 ARG n 
1 107 VAL n 
1 108 PRO n 
1 109 HIS n 
1 110 ILE n 
1 111 GLY n 
1 112 ASP n 
1 113 VAL n 
1 114 VAL n 
1 115 LEU n 
1 116 ALA n 
1 117 ILE n 
1 118 GLY n 
1 119 ASN n 
1 120 PRO n 
1 121 TYR n 
1 122 ASN n 
1 123 LEU n 
1 124 GLY n 
1 125 GLN n 
1 126 THR n 
1 127 ILE n 
1 128 THR n 
1 129 GLN n 
1 130 GLY n 
1 131 ILE n 
1 132 ILE n 
1 133 SER n 
1 134 ALA n 
1 135 THR n 
1 136 GLY n 
1 137 ARG n 
1 138 ILE n 
1 139 GLY n 
1 140 LEU n 
1 141 ASN n 
1 142 PRO n 
1 143 THR n 
1 144 GLY n 
1 145 ARG n 
1 146 GLN n 
1 147 ASN n 
1 148 PHE n 
1 149 LEU n 
1 150 GLN n 
1 151 THR n 
1 152 ASP n 
1 153 ALA n 
1 154 SER n 
1 155 ILE n 
1 156 ASN n 
1 157 HIS n 
1 158 GLY n 
1 159 ASN n 
1 160 SER n 
1 161 GLY n 
1 162 GLY n 
1 163 ALA n 
1 164 LEU n 
1 165 VAL n 
1 166 ASN n 
1 167 SER n 
1 168 LEU n 
1 169 GLY n 
1 170 GLU n 
1 171 LEU n 
1 172 MET n 
1 173 GLY n 
1 174 ILE n 
1 175 ASN n 
1 176 THR n 
1 177 LEU n 
1 178 SER n 
1 179 PHE n 
1 180 ASP n 
1 181 LYS n 
1 182 SER n 
1 183 ASN n 
1 184 ASP n 
1 185 GLY n 
1 186 GLU n 
1 187 THR n 
1 188 PRO n 
1 189 GLU n 
1 190 GLY n 
1 191 ILE n 
1 192 GLY n 
1 193 PHE n 
1 194 ALA n 
1 195 ILE n 
1 196 PRO n 
1 197 PHE n 
1 198 GLN n 
1 199 LEU n 
1 200 ALA n 
1 201 THR n 
1 202 LYS n 
1 203 ILE n 
1 204 MET n 
1 205 ASP n 
1 206 LYS n 
1 207 LEU n 
1 208 ILE n 
1 209 ARG n 
1 210 ASP n 
1 211 GLY n 
1 212 ARG n 
1 213 VAL n 
1 214 ILE n 
1 215 ARG n 
1 216 GLY n 
1 217 TYR n 
1 218 ILE n 
1 219 GLY n 
1 220 ILE n 
1 221 GLY n 
1 222 GLY n 
1 223 ARG n 
1 224 GLU n 
1 225 ILE n 
1 226 ALA n 
1 227 PRO n 
1 228 LEU n 
1 229 HIS n 
1 230 ALA n 
1 231 GLN n 
1 232 GLY n 
1 233 GLY n 
1 234 GLY n 
1 235 ILE n 
1 236 ASP n 
1 237 GLN n 
1 238 LEU n 
1 239 GLN n 
1 240 GLY n 
1 241 ILE n 
1 242 VAL n 
1 243 VAL n 
1 244 ASN n 
1 245 GLU n 
1 246 VAL n 
1 247 SER n 
1 248 PRO n 
1 249 ASP n 
1 250 GLY n 
1 251 PRO n 
1 252 ALA n 
1 253 ALA n 
1 254 ASN n 
1 255 ALA n 
1 256 GLY n 
1 257 ILE n 
1 258 GLN n 
1 259 VAL n 
1 260 ASN n 
1 261 ASP n 
1 262 LEU n 
1 263 ILE n 
1 264 ILE n 
1 265 SER n 
1 266 VAL n 
1 267 ASP n 
1 268 ASN n 
1 269 LYS n 
1 270 PRO n 
1 271 ALA n 
1 272 ILE n 
1 273 SER n 
1 274 ALA n 
1 275 LEU n 
1 276 GLU n 
1 277 THR n 
1 278 MET n 
1 279 ASP n 
1 280 GLN n 
1 281 VAL n 
1 282 ALA n 
1 283 GLU n 
1 284 ILE n 
1 285 ARG n 
1 286 PRO n 
1 287 GLY n 
1 288 SER n 
1 289 VAL n 
1 290 ILE n 
1 291 PRO n 
1 292 VAL n 
1 293 VAL n 
1 294 VAL n 
1 295 MET n 
1 296 ARG n 
1 297 ASP n 
1 298 ASP n 
1 299 LYS n 
1 300 GLN n 
1 301 LEU n 
1 302 THR n 
1 303 LEU n 
1 304 GLN n 
1 305 VAL n 
1 306 THR n 
1 307 ILE n 
1 308 GLN n 
1 309 GLU n 
1 310 TYR n 
1 311 PRO n 
1 312 ALA n 
1 313 THR n 
1 314 ASN n 
2 1   ASP n 
2 2   ASN n 
2 3   ARG n 
2 4   LEU n 
2 5   GLY n 
2 6   LEU n 
2 7   VAL n 
2 8   TYR n 
2 9   GLN n 
2 10  PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 'DEGS, HHOB, HTRH, B3235, Z4594, ECS4108' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET21b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DEGS_ECOLI P31137 1 
;TPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSD
SLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSG
GALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQGI
VVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPATN
;
43 ? 
2 PDB 1SOZ       1SOZ   2 ? ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1SOZ A 2 ? 314 ? P31137 43  ? 355 ? 43  355 
2 1 1SOZ B 2 ? 314 ? P31137 43  ? 355 ? 43  355 
3 1 1SOZ C 2 ? 314 ? P31137 43  ? 355 ? 43  355 
4 2 1SOZ D 1 ? 10  ? 1SOZ   401 ? 410 ? 401 410 
5 2 1SOZ E 1 ? 10  ? 1SOZ   401 ? 410 ? 401 410 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1SOZ MET A 1 ? UNP P31137 ? ? 'INITIATING METHIONINE' 42 1 
2 1SOZ MET B 1 ? UNP P31137 ? ? 'INITIATING METHIONINE' 42 2 
3 1SOZ MET C 1 ? UNP P31137 ? ? 'INITIATING METHIONINE' 42 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1SOZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   65.35 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      3.58 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'PEG 6000, MPD, HEPES, magnesium chloride, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2003-06-12 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9393 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9393 
# 
_reflns.entry_id                     1SOZ 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.4 
_reflns.d_resolution_low             15 
_reflns.number_all                   42509 
_reflns.number_obs                   42042 
_reflns.percent_possible_obs         91.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.4 
_reflns_shell.d_res_low              2.44 
_reflns_shell.percent_possible_all   94.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1SOZ 
_refine.ls_d_res_high                            2.4 
_refine.ls_d_res_low                             15 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_number_reflns_all                     42042 
_refine.ls_number_reflns_obs                     42042 
_refine.ls_number_reflns_R_free                  2079 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          0.214 
_refine.ls_R_factor_obs                          0.214 
_refine.ls_R_factor_R_work                       0.213 
_refine.ls_R_factor_R_free                       0.272 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'DegS, uncomplexed' 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6040 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             224 
_refine_hist.number_atoms_total               6264 
_refine_hist.d_res_high                       2.4 
_refine_hist.d_res_low                        15 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg 1.66  ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d    0.011 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1SOZ 
_struct.title                     'Crystal Structure of DegS protease in complex with an activating peptide' 
_struct.pdbx_descriptor           'Protease degS (E.C.3.4.21.-), activating peptide' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SOZ 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'stress response, protein quality control, PDZ, UPR, HtrA, hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 6   ? ALA A 14  ? TYR A 47  ALA A 55  1 ? 9  
HELX_P HELX_P2  2  LYS A 54  ? ASN A 58  ? LYS A 95  ASN A 99  1 ? 5  
HELX_P HELX_P3  3  ASN A 119 ? LEU A 123 ? ASN A 160 LEU A 164 5 ? 5  
HELX_P HELX_P4  4  PHE A 197 ? GLY A 211 ? PHE A 238 GLY A 252 1 ? 15 
HELX_P HELX_P5  5  THR A 277 ? ILE A 284 ? THR A 318 ILE A 325 1 ? 8  
HELX_P HELX_P6  6  TYR B 6   ? ALA B 14  ? TYR B 47  ALA B 55  1 ? 9  
HELX_P HELX_P7  7  LYS B 54  ? ASN B 58  ? LYS B 95  ASN B 99  1 ? 5  
HELX_P HELX_P8  8  ASN B 119 ? LEU B 123 ? ASN B 160 LEU B 164 5 ? 5  
HELX_P HELX_P9  9  PHE B 197 ? GLY B 211 ? PHE B 238 GLY B 252 1 ? 15 
HELX_P HELX_P10 10 ALA B 252 ? GLY B 256 ? ALA B 293 GLY B 297 5 ? 5  
HELX_P HELX_P11 11 ALA B 274 ? GLU B 283 ? ALA B 315 GLU B 324 1 ? 10 
HELX_P HELX_P12 12 TYR C 6   ? ALA C 14  ? TYR C 47  ALA C 55  1 ? 9  
HELX_P HELX_P13 13 HIS C 55  ? ILE C 57  ? HIS C 96  ILE C 98  5 ? 3  
HELX_P HELX_P14 14 ASN C 119 ? LEU C 123 ? ASN C 160 LEU C 164 5 ? 5  
HELX_P HELX_P15 15 PHE C 197 ? GLY C 211 ? PHE C 238 GLY C 252 1 ? 15 
HELX_P HELX_P16 16 ASP C 279 ? ILE C 284 ? ASP C 320 ILE C 325 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
C ? 2 ? 
D ? 2 ? 
E ? 7 ? 
F ? 7 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 7 ? 
K ? 7 ? 
L ? 2 ? 
M ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
E 6 7 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
F 5 6 ? anti-parallel 
F 6 7 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
J 4 5 ? anti-parallel 
J 5 6 ? anti-parallel 
J 6 7 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
K 4 5 ? anti-parallel 
K 5 6 ? anti-parallel 
K 6 7 ? anti-parallel 
L 1 2 ? anti-parallel 
M 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 17  ? GLY A 24  ? VAL A 58  GLY A 65  
A 2 GLU A 34  ? ILE A 43  ? GLU A 75  ILE A 84  
A 3 TYR A 49  ? ASN A 53  ? TYR A 90  ASN A 94  
A 4 LEU A 86  ? LYS A 90  ? LEU A 127 LYS A 131 
A 5 VAL A 72  ? ASP A 81  ? VAL A 113 ASP A 122 
A 6 GLN A 62  ? ALA A 66  ? GLN A 103 ALA A 107 
A 7 VAL A 17  ? GLY A 24  ? VAL A 58  GLY A 65  
B 1 VAL A 113 ? GLY A 118 ? VAL A 154 GLY A 159 
B 2 THR A 126 ? ARG A 137 ? THR A 167 ARG A 178 
B 3 PHE A 148 ? THR A 151 ? PHE A 189 THR A 192 
B 4 GLY A 192 ? PRO A 196 ? GLY A 233 PRO A 237 
B 5 LEU A 171 ? SER A 178 ? LEU A 212 SER A 219 
B 6 ALA A 163 ? VAL A 165 ? ALA A 204 VAL A 206 
B 7 VAL A 113 ? GLY A 118 ? VAL A 154 GLY A 159 
C 1 GLY A 221 ? GLY A 222 ? GLY A 262 GLY A 263 
C 2 TYR D 8   ? GLN D 9   ? TYR D 408 GLN D 409 
D 1 VAL A 289 ? PRO A 291 ? VAL A 330 PRO A 332 
D 2 GLN A 304 ? THR A 306 ? GLN A 345 THR A 347 
E 1 VAL B 17  ? GLY B 24  ? VAL B 58  GLY B 65  
E 2 GLU B 34  ? ASP B 45  ? GLU B 75  ASP B 86  
E 3 TYR B 49  ? ASN B 53  ? TYR B 90  ASN B 94  
E 4 LEU B 86  ? LYS B 90  ? LEU B 127 LYS B 131 
E 5 VAL B 72  ? ASP B 81  ? VAL B 113 ASP B 122 
E 6 GLN B 62  ? ALA B 66  ? GLN B 103 ALA B 107 
E 7 VAL B 17  ? GLY B 24  ? VAL B 58  GLY B 65  
F 1 VAL B 113 ? GLY B 118 ? VAL B 154 GLY B 159 
F 2 THR B 126 ? ALA B 134 ? THR B 167 ALA B 175 
F 3 LEU B 149 ? THR B 151 ? LEU B 190 THR B 192 
F 4 GLY B 192 ? PRO B 196 ? GLY B 233 PRO B 237 
F 5 LEU B 171 ? SER B 178 ? LEU B 212 SER B 219 
F 6 ALA B 163 ? ASN B 166 ? ALA B 204 ASN B 207 
F 7 VAL B 113 ? GLY B 118 ? VAL B 154 GLY B 159 
G 1 GLY B 216 ? TYR B 217 ? GLY B 257 TYR B 258 
G 2 GLN B 308 ? GLU B 309 ? GLN B 349 GLU B 350 
H 1 SER B 265 ? VAL B 266 ? SER B 306 VAL B 307 
H 2 LYS B 269 ? PRO B 270 ? LYS B 310 PRO B 311 
I 1 VAL B 289 ? ILE B 290 ? VAL B 330 ILE B 331 
I 2 VAL B 305 ? THR B 306 ? VAL B 346 THR B 347 
J 1 VAL C 17  ? GLY C 24  ? VAL C 58  GLY C 65  
J 2 GLU C 34  ? ILE C 43  ? GLU C 75  ILE C 84  
J 3 TYR C 49  ? ASN C 53  ? TYR C 90  ASN C 94  
J 4 LEU C 86  ? LYS C 90  ? LEU C 127 LYS C 131 
J 5 VAL C 72  ? ASP C 81  ? VAL C 113 ASP C 122 
J 6 GLN C 62  ? ALA C 66  ? GLN C 103 ALA C 107 
J 7 VAL C 17  ? GLY C 24  ? VAL C 58  GLY C 65  
K 1 VAL C 113 ? GLY C 118 ? VAL C 154 GLY C 159 
K 2 THR C 126 ? ARG C 137 ? THR C 167 ARG C 178 
K 3 PHE C 148 ? THR C 151 ? PHE C 189 THR C 192 
K 4 GLY C 192 ? PRO C 196 ? GLY C 233 PRO C 237 
K 5 LEU C 171 ? SER C 178 ? LEU C 212 SER C 219 
K 6 ALA C 163 ? ASN C 166 ? ALA C 204 ASN C 207 
K 7 VAL C 113 ? GLY C 118 ? VAL C 154 GLY C 159 
L 1 SER C 265 ? VAL C 266 ? SER C 306 VAL C 307 
L 2 LYS C 269 ? PRO C 270 ? LYS C 310 PRO C 311 
M 1 VAL C 289 ? ILE C 290 ? VAL C 330 ILE C 331 
M 2 VAL C 305 ? THR C 306 ? VAL C 346 THR C 347 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASN A 22  ? N ASN A 63  O THR A 37  ? O THR A 78  
A 2 3 N VAL A 42  ? N VAL A 83  O ILE A 51  ? O ILE A 92  
A 3 4 N THR A 52  ? N THR A 93  O ALA A 87  ? O ALA A 128 
A 4 5 O VAL A 88  ? O VAL A 129 N VAL A 78  ? N VAL A 119 
A 5 6 O PHE A 73  ? O PHE A 114 N VAL A 65  ? N VAL A 106 
A 6 7 O GLN A 62  ? O GLN A 103 N ARG A 23  ? N ARG A 64  
B 1 2 N GLY A 118 ? N GLY A 159 O THR A 126 ? O THR A 167 
B 2 3 N SER A 133 ? N SER A 174 O GLN A 150 ? O GLN A 191 
B 3 4 N THR A 151 ? N THR A 192 O GLY A 192 ? O GLY A 233 
B 4 5 O PHE A 193 ? O PHE A 234 N THR A 176 ? N THR A 217 
B 5 6 O GLY A 173 ? O GLY A 214 N LEU A 164 ? N LEU A 205 
B 6 7 O ALA A 163 ? O ALA A 204 N ILE A 117 ? N ILE A 158 
C 1 2 N GLY A 222 ? N GLY A 263 O TYR D 8   ? O TYR D 408 
D 1 2 N ILE A 290 ? N ILE A 331 O VAL A 305 ? O VAL A 346 
E 1 2 N GLY B 24  ? N GLY B 65  O GLU B 34  ? O GLU B 75  
E 2 3 N VAL B 42  ? N VAL B 83  O ILE B 51  ? O ILE B 92  
E 3 4 N ILE B 50  ? N ILE B 91  O LEU B 89  ? O LEU B 130 
E 4 5 O LEU B 86  ? O LEU B 127 N ASP B 81  ? N ASP B 122 
E 5 6 O ALA B 75  ? O ALA B 116 N ILE B 63  ? N ILE B 104 
E 6 7 O ILE B 64  ? O ILE B 105 N TYR B 21  ? N TYR B 62  
F 1 2 N GLY B 118 ? N GLY B 159 O THR B 126 ? O THR B 167 
F 2 3 N ALA B 134 ? N ALA B 175 O GLN B 150 ? O GLN B 191 
F 3 4 N THR B 151 ? N THR B 192 O GLY B 192 ? O GLY B 233 
F 4 5 O PHE B 193 ? O PHE B 234 N THR B 176 ? N THR B 217 
F 5 6 O MET B 172 ? O MET B 213 N LEU B 164 ? N LEU B 205 
F 6 7 O ALA B 163 ? O ALA B 204 N ILE B 117 ? N ILE B 158 
G 1 2 N TYR B 217 ? N TYR B 258 O GLN B 308 ? O GLN B 349 
H 1 2 N VAL B 266 ? N VAL B 307 O LYS B 269 ? O LYS B 310 
I 1 2 N ILE B 290 ? N ILE B 331 O VAL B 305 ? O VAL B 346 
J 1 2 N VAL C 20  ? N VAL C 61  O GLY C 39  ? O GLY C 80  
J 2 3 N VAL C 42  ? N VAL C 83  O ILE C 51  ? O ILE C 92  
J 3 4 N ILE C 50  ? N ILE C 91  O LEU C 89  ? O LEU C 130 
J 4 5 O LYS C 90  ? O LYS C 131 N LEU C 76  ? N LEU C 117 
J 5 6 O ALA C 75  ? O ALA C 116 N ILE C 63  ? N ILE C 104 
J 6 7 O GLN C 62  ? O GLN C 103 N ARG C 23  ? N ARG C 64  
K 1 2 N VAL C 114 ? N VAL C 155 O GLY C 130 ? O GLY C 171 
K 2 3 N ALA C 134 ? N ALA C 175 O GLN C 150 ? O GLN C 191 
K 3 4 N LEU C 149 ? N LEU C 190 O ALA C 194 ? O ALA C 235 
K 4 5 O PHE C 193 ? O PHE C 234 N LEU C 177 ? N LEU C 218 
K 5 6 O MET C 172 ? O MET C 213 N LEU C 164 ? N LEU C 205 
K 6 7 O ALA C 163 ? O ALA C 204 N ILE C 117 ? N ILE C 158 
L 1 2 N VAL C 266 ? N VAL C 307 O LYS C 269 ? O LYS C 310 
M 1 2 N ILE C 290 ? N ILE C 331 O VAL C 305 ? O VAL C 346 
# 
_database_PDB_matrix.entry_id          1SOZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SOZ 
_atom_sites.fract_transf_matrix[1][1]   0.004855 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   -0.000064 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007007 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.024293 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1   ? 35.292 35.944  -15.612 1.00 96.52  ? 42  MET A N   1 
ATOM   2    C CA  . MET A 1 1   ? 34.123 35.322  -16.297 1.00 91.76  ? 42  MET A CA  1 
ATOM   3    C C   . MET A 1 1   ? 33.058 35.094  -15.245 1.00 86.49  ? 42  MET A C   1 
ATOM   4    O O   . MET A 1 1   ? 32.555 36.044  -14.634 1.00 81.99  ? 42  MET A O   1 
ATOM   5    C CB  . MET A 1 1   ? 34.516 33.973  -16.921 1.00 100.51 ? 42  MET A CB  1 
ATOM   6    C CG  . MET A 1 1   ? 35.683 34.043  -17.895 1.00 105.57 ? 42  MET A CG  1 
ATOM   7    S SD  . MET A 1 1   ? 37.171 34.778  -17.150 1.00 117.62 ? 42  MET A SD  1 
ATOM   8    C CE  . MET A 1 1   ? 37.091 36.487  -17.829 1.00 112.55 ? 42  MET A CE  1 
ATOM   9    N N   . THR A 1 2   ? 32.741 33.816  -15.040 1.00 84.43  ? 43  THR A N   1 
ATOM   10   C CA  . THR A 1 2   ? 31.751 33.372  -14.057 1.00 77.24  ? 43  THR A CA  1 
ATOM   11   C C   . THR A 1 2   ? 32.427 32.454  -13.040 1.00 71.83  ? 43  THR A C   1 
ATOM   12   O O   . THR A 1 2   ? 33.062 31.459  -13.418 1.00 64.72  ? 43  THR A O   1 
ATOM   13   C CB  . THR A 1 2   ? 30.659 32.525  -14.696 1.00 79.51  ? 43  THR A CB  1 
ATOM   14   O OG1 . THR A 1 2   ? 30.399 33.005  -16.018 1.00 87.47  ? 43  THR A OG1 1 
ATOM   15   C CG2 . THR A 1 2   ? 29.395 32.569  -13.855 1.00 76.02  ? 43  THR A CG2 1 
ATOM   16   N N   . PRO A 1 3   ? 32.288 32.766  -11.736 1.00 65.68  ? 44  PRO A N   1 
ATOM   17   C CA  . PRO A 1 3   ? 32.893 31.937  -10.686 1.00 55.84  ? 44  PRO A CA  1 
ATOM   18   C C   . PRO A 1 3   ? 32.258 30.545  -10.587 1.00 48.66  ? 44  PRO A C   1 
ATOM   19   O O   . PRO A 1 3   ? 31.052 30.386  -10.781 1.00 46.64  ? 44  PRO A O   1 
ATOM   20   C CB  . PRO A 1 3   ? 32.624 32.743  -9.414  1.00 61.43  ? 44  PRO A CB  1 
ATOM   21   C CG  . PRO A 1 3   ? 32.508 34.144  -9.915  1.00 63.56  ? 44  PRO A CG  1 
ATOM   22   C CD  . PRO A 1 3   ? 31.701 33.988  -11.161 1.00 54.51  ? 44  PRO A CD  1 
ATOM   23   N N   . ALA A 1 4   ? 33.075 29.535  -10.321 1.00 42.18  ? 45  ALA A N   1 
ATOM   24   C CA  . ALA A 1 4   ? 32.566 28.188  -10.098 1.00 40.74  ? 45  ALA A CA  1 
ATOM   25   C C   . ALA A 1 4   ? 31.650 28.306  -8.846  1.00 49.49  ? 45  ALA A C   1 
ATOM   26   O O   . ALA A 1 4   ? 32.016 28.957  -7.833  1.00 39.62  ? 45  ALA A O   1 
ATOM   27   C CB  . ALA A 1 4   ? 33.738 27.216  -9.813  1.00 38.63  ? 45  ALA A CB  1 
ATOM   28   N N   . SER A 1 5   ? 30.478 27.671  -8.902  1.00 48.47  ? 46  SER A N   1 
ATOM   29   C CA  . SER A 1 5   ? 29.541 27.786  -7.819  1.00 48.91  ? 46  SER A CA  1 
ATOM   30   C C   . SER A 1 5   ? 28.413 26.760  -7.783  1.00 54.38  ? 46  SER A C   1 
ATOM   31   O O   . SER A 1 5   ? 27.911 26.335  -8.838  1.00 44.27  ? 46  SER A O   1 
ATOM   32   C CB  . SER A 1 5   ? 28.922 29.185  -7.882  1.00 49.40  ? 46  SER A CB  1 
ATOM   33   O OG  . SER A 1 5   ? 27.832 29.304  -6.964  1.00 62.40  ? 46  SER A OG  1 
ATOM   34   N N   . TYR A 1 6   ? 28.007 26.374  -6.564  1.00 47.74  ? 47  TYR A N   1 
ATOM   35   C CA  . TYR A 1 6   ? 26.875 25.462  -6.405  1.00 46.33  ? 47  TYR A CA  1 
ATOM   36   C C   . TYR A 1 6   ? 25.668 26.294  -5.897  1.00 43.77  ? 47  TYR A C   1 
ATOM   37   O O   . TYR A 1 6   ? 24.718 25.771  -5.321  1.00 48.91  ? 47  TYR A O   1 
ATOM   38   C CB  . TYR A 1 6   ? 27.211 24.321  -5.436  1.00 41.74  ? 47  TYR A CB  1 
ATOM   39   C CG  . TYR A 1 6   ? 28.387 23.493  -5.893  1.00 41.06  ? 47  TYR A CG  1 
ATOM   40   C CD1 . TYR A 1 6   ? 29.622 23.597  -5.261  1.00 43.89  ? 47  TYR A CD1 1 
ATOM   41   C CD2 . TYR A 1 6   ? 28.297 22.679  -7.020  1.00 46.27  ? 47  TYR A CD2 1 
ATOM   42   C CE1 . TYR A 1 6   ? 30.727 22.924  -5.733  1.00 42.48  ? 47  TYR A CE1 1 
ATOM   43   C CE2 . TYR A 1 6   ? 29.405 22.004  -7.508  1.00 44.77  ? 47  TYR A CE2 1 
ATOM   44   C CZ  . TYR A 1 6   ? 30.622 22.124  -6.857  1.00 46.84  ? 47  TYR A CZ  1 
ATOM   45   O OH  . TYR A 1 6   ? 31.730 21.426  -7.315  1.00 47.08  ? 47  TYR A OH  1 
ATOM   46   N N   . ASN A 1 7   ? 25.726 27.601  -6.123  1.00 35.36  ? 48  ASN A N   1 
ATOM   47   C CA  . ASN A 1 7   ? 24.654 28.468  -5.712  1.00 45.64  ? 48  ASN A CA  1 
ATOM   48   C C   . ASN A 1 7   ? 23.310 28.067  -6.322  1.00 54.14  ? 48  ASN A C   1 
ATOM   49   O O   . ASN A 1 7   ? 22.260 28.195  -5.680  1.00 56.71  ? 48  ASN A O   1 
ATOM   50   C CB  . ASN A 1 7   ? 24.979 29.905  -6.080  1.00 45.02  ? 48  ASN A CB  1 
ATOM   51   C CG  . ASN A 1 7   ? 23.942 30.883  -5.557  1.00 45.77  ? 48  ASN A CG  1 
ATOM   52   O OD1 . ASN A 1 7   ? 23.257 31.548  -6.327  1.00 52.79  ? 48  ASN A OD1 1 
ATOM   53   N ND2 . ASN A 1 7   ? 23.810 30.955  -4.243  1.00 51.26  ? 48  ASN A ND2 1 
ATOM   54   N N   . LEU A 1 8   ? 23.323 27.601  -7.568  1.00 56.04  ? 49  LEU A N   1 
ATOM   55   C CA  . LEU A 1 8   ? 22.083 27.176  -8.191  1.00 57.46  ? 49  LEU A CA  1 
ATOM   56   C C   . LEU A 1 8   ? 21.404 26.100  -7.294  1.00 57.78  ? 49  LEU A C   1 
ATOM   57   O O   . LEU A 1 8   ? 20.189 26.093  -7.110  1.00 59.95  ? 49  LEU A O   1 
ATOM   58   C CB  . LEU A 1 8   ? 22.372 26.615  -9.591  1.00 58.64  ? 49  LEU A CB  1 
ATOM   59   C CG  . LEU A 1 8   ? 21.199 25.943  -10.313 1.00 60.74  ? 49  LEU A CG  1 
ATOM   60   C CD1 . LEU A 1 8   ? 20.145 26.976  -10.722 1.00 60.71  ? 49  LEU A CD1 1 
ATOM   61   C CD2 . LEU A 1 8   ? 21.704 25.224  -11.513 1.00 58.56  ? 49  LEU A CD2 1 
ATOM   62   N N   . ALA A 1 9   ? 22.194 25.186  -6.747  1.00 51.15  ? 50  ALA A N   1 
ATOM   63   C CA  . ALA A 1 9   ? 21.644 24.158  -5.887  1.00 47.71  ? 50  ALA A CA  1 
ATOM   64   C C   . ALA A 1 9   ? 21.117 24.777  -4.605  1.00 48.13  ? 50  ALA A C   1 
ATOM   65   O O   . ALA A 1 9   ? 20.136 24.315  -4.053  1.00 45.58  ? 50  ALA A O   1 
ATOM   66   C CB  . ALA A 1 9   ? 22.690 23.139  -5.557  1.00 48.80  ? 50  ALA A CB  1 
ATOM   67   N N   . VAL A 1 10  ? 21.781 25.824  -4.134  1.00 46.89  ? 51  VAL A N   1 
ATOM   68   C CA  . VAL A 1 10  ? 21.383 26.501  -2.918  1.00 47.28  ? 51  VAL A CA  1 
ATOM   69   C C   . VAL A 1 10  ? 20.033 27.245  -3.079  1.00 48.43  ? 51  VAL A C   1 
ATOM   70   O O   . VAL A 1 10  ? 19.138 27.126  -2.253  1.00 51.61  ? 51  VAL A O   1 
ATOM   71   C CB  . VAL A 1 10  ? 22.504 27.471  -2.502  1.00 44.35  ? 51  VAL A CB  1 
ATOM   72   C CG1 . VAL A 1 10  ? 22.119 28.233  -1.193  1.00 45.60  ? 51  VAL A CG1 1 
ATOM   73   C CG2 . VAL A 1 10  ? 23.798 26.666  -2.289  1.00 38.19  ? 51  VAL A CG2 1 
ATOM   74   N N   . ARG A 1 11  ? 19.901 27.973  -4.173  1.00 46.29  ? 52  ARG A N   1 
ATOM   75   C CA  . ARG A 1 11  ? 18.717 28.752  -4.512  1.00 48.20  ? 52  ARG A CA  1 
ATOM   76   C C   . ARG A 1 11  ? 17.450 27.886  -4.647  1.00 46.77  ? 52  ARG A C   1 
ATOM   77   O O   . ARG A 1 11  ? 16.341 28.296  -4.280  1.00 49.58  ? 52  ARG A O   1 
ATOM   78   C CB  . ARG A 1 11  ? 19.019 29.494  -5.815  1.00 49.01  ? 52  ARG A CB  1 
ATOM   79   C CG  . ARG A 1 11  ? 18.046 30.556  -6.295  1.00 67.02  ? 52  ARG A CG  1 
ATOM   80   C CD  . ARG A 1 11  ? 17.833 30.441  -7.837  1.00 71.75  ? 52  ARG A CD  1 
ATOM   81   N NE  . ARG A 1 11  ? 19.090 30.182  -8.544  1.00 73.21  ? 52  ARG A NE  1 
ATOM   82   C CZ  . ARG A 1 11  ? 20.070 31.077  -8.680  1.00 76.74  ? 52  ARG A CZ  1 
ATOM   83   N NH1 . ARG A 1 11  ? 19.918 32.297  -8.163  1.00 74.64  ? 52  ARG A NH1 1 
ATOM   84   N NH2 . ARG A 1 11  ? 21.213 30.747  -9.299  1.00 64.12  ? 52  ARG A NH2 1 
ATOM   85   N N   . ARG A 1 12  ? 17.616 26.674  -5.129  1.00 46.02  ? 53  ARG A N   1 
ATOM   86   C CA  . ARG A 1 12  ? 16.480 25.782  -5.335  1.00 50.96  ? 53  ARG A CA  1 
ATOM   87   C C   . ARG A 1 12  ? 16.107 24.923  -4.144  1.00 47.59  ? 53  ARG A C   1 
ATOM   88   O O   . ARG A 1 12  ? 14.965 24.611  -3.958  1.00 56.57  ? 53  ARG A O   1 
ATOM   89   C CB  . ARG A 1 12  ? 16.766 24.821  -6.502  1.00 58.05  ? 53  ARG A CB  1 
ATOM   90   C CG  . ARG A 1 12  ? 17.068 25.455  -7.869  1.00 46.81  ? 53  ARG A CG  1 
ATOM   91   C CD  . ARG A 1 12  ? 17.410 24.356  -8.845  1.00 48.17  ? 53  ARG A CD  1 
ATOM   92   N NE  . ARG A 1 12  ? 17.462 24.792  -10.234 1.00 52.36  ? 53  ARG A NE  1 
ATOM   93   C CZ  . ARG A 1 12  ? 17.744 23.990  -11.263 1.00 52.51  ? 53  ARG A CZ  1 
ATOM   94   N NH1 . ARG A 1 12  ? 18.003 22.704  -11.074 1.00 49.38  ? 53  ARG A NH1 1 
ATOM   95   N NH2 . ARG A 1 12  ? 17.759 24.470  -12.495 1.00 51.42  ? 53  ARG A NH2 1 
ATOM   96   N N   . ALA A 1 13  ? 17.081 24.548  -3.336  1.00 45.68  ? 54  ALA A N   1 
ATOM   97   C CA  . ALA A 1 13  ? 16.851 23.647  -2.226  1.00 46.52  ? 54  ALA A CA  1 
ATOM   98   C C   . ALA A 1 13  ? 16.736 24.226  -0.822  1.00 48.30  ? 54  ALA A C   1 
ATOM   99   O O   . ALA A 1 13  ? 15.849 23.845  -0.064  1.00 50.64  ? 54  ALA A O   1 
ATOM   100  C CB  . ALA A 1 13  ? 17.956 22.575  -2.232  1.00 41.34  ? 54  ALA A CB  1 
ATOM   101  N N   . ALA A 1 14  ? 17.632 25.151  -0.499  1.00 46.90  ? 55  ALA A N   1 
ATOM   102  C CA  . ALA A 1 14  ? 17.737 25.739  0.827   1.00 42.81  ? 55  ALA A CA  1 
ATOM   103  C C   . ALA A 1 14  ? 16.494 26.343  1.458   1.00 41.66  ? 55  ALA A C   1 
ATOM   104  O O   . ALA A 1 14  ? 16.304 26.212  2.652   1.00 41.93  ? 55  ALA A O   1 
ATOM   105  C CB  . ALA A 1 14  ? 18.887 26.759  0.839   1.00 31.13  ? 55  ALA A CB  1 
ATOM   106  N N   . PRO A 1 15  ? 15.649 27.036  0.670   1.00 45.06  ? 56  PRO A N   1 
ATOM   107  C CA  . PRO A 1 15  ? 14.422 27.647  1.203   1.00 37.71  ? 56  PRO A CA  1 
ATOM   108  C C   . PRO A 1 15  ? 13.533 26.584  1.881   1.00 41.15  ? 56  PRO A C   1 
ATOM   109  O O   . PRO A 1 15  ? 12.724 26.896  2.731   1.00 41.04  ? 56  PRO A O   1 
ATOM   110  C CB  . PRO A 1 15  ? 13.755 28.209  -0.062  1.00 39.09  ? 56  PRO A CB  1 
ATOM   111  C CG  . PRO A 1 15  ? 14.925 28.556  -0.954  1.00 37.29  ? 56  PRO A CG  1 
ATOM   112  C CD  . PRO A 1 15  ? 15.815 27.351  -0.770  1.00 40.84  ? 56  PRO A CD  1 
ATOM   113  N N   . ALA A 1 16  ? 13.722 25.325  1.507   1.00 37.33  ? 57  ALA A N   1 
ATOM   114  C CA  . ALA A 1 16  ? 12.920 24.259  2.028   1.00 40.54  ? 57  ALA A CA  1 
ATOM   115  C C   . ALA A 1 16  ? 13.462 23.546  3.251   1.00 49.02  ? 57  ALA A C   1 
ATOM   116  O O   . ALA A 1 16  ? 12.770 22.670  3.834   1.00 41.81  ? 57  ALA A O   1 
ATOM   117  C CB  . ALA A 1 16  ? 12.623 23.245  0.930   1.00 40.22  ? 57  ALA A CB  1 
ATOM   118  N N   . VAL A 1 17  ? 14.685 23.852  3.651   1.00 41.29  ? 58  VAL A N   1 
ATOM   119  C CA  . VAL A 1 17  ? 15.099 23.179  4.848   1.00 44.62  ? 58  VAL A CA  1 
ATOM   120  C C   . VAL A 1 17  ? 14.976 24.145  6.007   1.00 47.57  ? 58  VAL A C   1 
ATOM   121  O O   . VAL A 1 17  ? 15.296 25.335  5.939   1.00 53.47  ? 58  VAL A O   1 
ATOM   122  C CB  . VAL A 1 17  ? 16.480 22.360  4.740   1.00 46.73  ? 58  VAL A CB  1 
ATOM   123  C CG1 . VAL A 1 17  ? 17.259 22.721  3.514   1.00 35.35  ? 58  VAL A CG1 1 
ATOM   124  C CG2 . VAL A 1 17  ? 17.255 22.438  6.054   1.00 33.05  ? 58  VAL A CG2 1 
ATOM   125  N N   . VAL A 1 18  ? 14.429 23.583  7.064   1.00 42.08  ? 59  VAL A N   1 
ATOM   126  C CA  . VAL A 1 18  ? 14.069 24.303  8.249   1.00 49.07  ? 59  VAL A CA  1 
ATOM   127  C C   . VAL A 1 18  ? 14.901 24.106  9.503   1.00 41.80  ? 59  VAL A C   1 
ATOM   128  O O   . VAL A 1 18  ? 15.644 23.147  9.648   1.00 48.42  ? 59  VAL A O   1 
ATOM   129  C CB  . VAL A 1 18  ? 12.598 23.930  8.589   1.00 53.12  ? 59  VAL A CB  1 
ATOM   130  C CG1 . VAL A 1 18  ? 12.138 24.707  9.776   1.00 67.74  ? 59  VAL A CG1 1 
ATOM   131  C CG2 . VAL A 1 18  ? 11.692 24.211  7.386   1.00 48.56  ? 59  VAL A CG2 1 
ATOM   132  N N   . ASN A 1 19  ? 14.760 25.061  10.405  1.00 43.57  ? 60  ASN A N   1 
ATOM   133  C CA  . ASN A 1 19  ? 15.393 24.982  11.712  1.00 50.51  ? 60  ASN A CA  1 
ATOM   134  C C   . ASN A 1 19  ? 14.329 24.358  12.604  1.00 50.20  ? 60  ASN A C   1 
ATOM   135  O O   . ASN A 1 19  ? 13.207 24.898  12.730  1.00 48.48  ? 60  ASN A O   1 
ATOM   136  C CB  . ASN A 1 19  ? 15.739 26.362  12.270  1.00 45.75  ? 60  ASN A CB  1 
ATOM   137  C CG  . ASN A 1 19  ? 16.773 27.085  11.441  1.00 53.35  ? 60  ASN A CG  1 
ATOM   138  O OD1 . ASN A 1 19  ? 17.252 28.135  11.834  1.00 66.28  ? 60  ASN A OD1 1 
ATOM   139  N ND2 . ASN A 1 19  ? 17.120 26.530  10.292  1.00 55.80  ? 60  ASN A ND2 1 
ATOM   140  N N   . VAL A 1 20  ? 14.668 23.201  13.158  1.00 44.45  ? 61  VAL A N   1 
ATOM   141  C CA  . VAL A 1 20  ? 13.801 22.491  14.087  1.00 46.24  ? 61  VAL A CA  1 
ATOM   142  C C   . VAL A 1 20  ? 14.286 22.660  15.538  1.00 50.56  ? 61  VAL A C   1 
ATOM   143  O O   . VAL A 1 20  ? 15.468 22.431  15.849  1.00 52.92  ? 61  VAL A O   1 
ATOM   144  C CB  . VAL A 1 20  ? 13.785 20.986  13.810  1.00 44.14  ? 61  VAL A CB  1 
ATOM   145  C CG1 . VAL A 1 20  ? 12.723 20.332  14.683  1.00 42.57  ? 61  VAL A CG1 1 
ATOM   146  C CG2 . VAL A 1 20  ? 13.537 20.703  12.343  1.00 42.93  ? 61  VAL A CG2 1 
ATOM   147  N N   . TYR A 1 21  ? 13.380 23.057  16.428  1.00 58.27  ? 62  TYR A N   1 
ATOM   148  C CA  . TYR A 1 21  ? 13.717 23.214  17.856  1.00 52.08  ? 62  TYR A CA  1 
ATOM   149  C C   . TYR A 1 21  ? 12.827 22.349  18.725  1.00 54.30  ? 62  TYR A C   1 
ATOM   150  O O   . TYR A 1 21  ? 11.612 22.262  18.524  1.00 54.85  ? 62  TYR A O   1 
ATOM   151  C CB  . TYR A 1 21  ? 13.573 24.656  18.304  1.00 50.29  ? 62  TYR A CB  1 
ATOM   152  C CG  . TYR A 1 21  ? 14.359 25.615  17.463  1.00 50.03  ? 62  TYR A CG  1 
ATOM   153  C CD1 . TYR A 1 21  ? 13.864 26.070  16.233  1.00 46.55  ? 62  TYR A CD1 1 
ATOM   154  C CD2 . TYR A 1 21  ? 15.594 26.085  17.892  1.00 47.80  ? 62  TYR A CD2 1 
ATOM   155  C CE1 . TYR A 1 21  ? 14.579 26.987  15.466  1.00 39.50  ? 62  TYR A CE1 1 
ATOM   156  C CE2 . TYR A 1 21  ? 16.327 26.997  17.117  1.00 52.71  ? 62  TYR A CE2 1 
ATOM   157  C CZ  . TYR A 1 21  ? 15.810 27.453  15.910  1.00 46.57  ? 62  TYR A CZ  1 
ATOM   158  O OH  . TYR A 1 21  ? 16.510 28.410  15.185  1.00 56.24  ? 62  TYR A OH  1 
ATOM   159  N N   . ASN A 1 22  ? 13.455 21.701  19.693  1.00 53.99  ? 63  ASN A N   1 
ATOM   160  C CA  . ASN A 1 22  ? 12.779 20.818  20.608  1.00 47.64  ? 63  ASN A CA  1 
ATOM   161  C C   . ASN A 1 22  ? 12.721 21.558  21.924  1.00 47.76  ? 63  ASN A C   1 
ATOM   162  O O   . ASN A 1 22  ? 13.740 21.861  22.522  1.00 50.38  ? 63  ASN A O   1 
ATOM   163  C CB  . ASN A 1 22  ? 13.581 19.521  20.688  1.00 54.96  ? 63  ASN A CB  1 
ATOM   164  C CG  . ASN A 1 22  ? 13.011 18.520  21.674  1.00 59.36  ? 63  ASN A CG  1 
ATOM   165  O OD1 . ASN A 1 22  ? 13.249 17.328  21.544  1.00 55.90  ? 63  ASN A OD1 1 
ATOM   166  N ND2 . ASN A 1 22  ? 12.275 18.999  22.670  1.00 65.57  ? 63  ASN A ND2 1 
ATOM   167  N N   . ARG A 1 23  ? 11.517 21.899  22.355  1.00 52.27  ? 64  ARG A N   1 
ATOM   168  C CA  . ARG A 1 23  ? 11.374 22.632  23.595  1.00 52.42  ? 64  ARG A CA  1 
ATOM   169  C C   . ARG A 1 23  ? 10.605 21.880  24.685  1.00 56.60  ? 64  ARG A C   1 
ATOM   170  O O   . ARG A 1 23  ? 9.591  21.239  24.423  1.00 58.99  ? 64  ARG A O   1 
ATOM   171  C CB  . ARG A 1 23  ? 10.752 23.995  23.292  1.00 52.05  ? 64  ARG A CB  1 
ATOM   172  C CG  . ARG A 1 23  ? 11.568 24.804  22.255  1.00 56.32  ? 64  ARG A CG  1 
ATOM   173  C CD  . ARG A 1 23  ? 11.320 26.320  22.306  1.00 51.02  ? 64  ARG A CD  1 
ATOM   174  N NE  . ARG A 1 23  ? 9.905  26.638  22.452  1.00 59.69  ? 64  ARG A NE  1 
ATOM   175  C CZ  . ARG A 1 23  ? 9.413  27.860  22.648  1.00 65.06  ? 64  ARG A CZ  1 
ATOM   176  N NH1 . ARG A 1 23  ? 10.216 28.923  22.718  1.00 57.03  ? 64  ARG A NH1 1 
ATOM   177  N NH2 . ARG A 1 23  ? 8.104  28.011  22.810  1.00 62.32  ? 64  ARG A NH2 1 
ATOM   178  N N   . GLY A 1 24  ? 11.105 21.937  25.917  1.00 61.76  ? 65  GLY A N   1 
ATOM   179  C CA  . GLY A 1 24  ? 10.429 21.235  26.996  1.00 60.85  ? 65  GLY A CA  1 
ATOM   180  C C   . GLY A 1 24  ? 9.781  22.098  28.060  1.00 55.97  ? 65  GLY A C   1 
ATOM   181  O O   . GLY A 1 24  ? 10.139 23.266  28.237  1.00 57.70  ? 65  GLY A O   1 
ATOM   182  N N   . LEU A 1 25  ? 8.839  21.501  28.786  1.00 57.38  ? 66  LEU A N   1 
ATOM   183  C CA  . LEU A 1 25  ? 8.110  22.177  29.869  1.00 60.87  ? 66  LEU A CA  1 
ATOM   184  C C   . LEU A 1 25  ? 8.697  21.886  31.259  1.00 60.66  ? 66  LEU A C   1 
ATOM   185  O O   . LEU A 1 25  ? 8.429  22.596  32.223  1.00 63.71  ? 66  LEU A O   1 
ATOM   186  C CB  . LEU A 1 25  ? 6.637  21.755  29.860  1.00 66.05  ? 66  LEU A CB  1 
ATOM   187  C CG  . LEU A 1 25  ? 5.788  22.405  28.776  1.00 64.05  ? 66  LEU A CG  1 
ATOM   188  C CD1 . LEU A 1 25  ? 4.434  21.741  28.734  1.00 58.82  ? 66  LEU A CD1 1 
ATOM   189  C CD2 . LEU A 1 25  ? 5.691  23.893  29.036  1.00 62.06  ? 66  LEU A CD2 1 
ATOM   190  N N   . ASN A 1 26  ? 9.477  20.826  31.364  1.00 53.93  ? 67  ASN A N   1 
ATOM   191  C CA  . ASN A 1 26  ? 10.107 20.497  32.618  1.00 50.20  ? 67  ASN A CA  1 
ATOM   192  C C   . ASN A 1 26  ? 11.622 20.573  32.393  1.00 45.79  ? 67  ASN A C   1 
ATOM   193  O O   . ASN A 1 26  ? 12.340 19.647  32.685  1.00 43.47  ? 67  ASN A O   1 
ATOM   194  C CB  . ASN A 1 26  ? 9.700  19.101  33.058  1.00 47.05  ? 67  ASN A CB  1 
ATOM   195  C CG  . ASN A 1 26  ? 10.187 18.790  34.451  1.00 63.02  ? 67  ASN A CG  1 
ATOM   196  O OD1 . ASN A 1 26  ? 10.000 19.591  35.365  1.00 54.52  ? 67  ASN A OD1 1 
ATOM   197  N ND2 . ASN A 1 26  ? 10.819 17.635  34.626  1.00 61.16  ? 67  ASN A ND2 1 
ATOM   198  N N   . THR A 1 27  ? 12.078 21.704  31.877  1.00 48.44  ? 68  THR A N   1 
ATOM   199  C CA  . THR A 1 27  ? 13.482 21.928  31.534  1.00 51.67  ? 68  THR A CA  1 
ATOM   200  C C   . THR A 1 27  ? 14.117 22.917  32.483  1.00 48.83  ? 68  THR A C   1 
ATOM   201  O O   . THR A 1 27  ? 15.300 22.823  32.774  1.00 54.33  ? 68  THR A O   1 
ATOM   202  C CB  . THR A 1 27  ? 13.580 22.396  30.019  1.00 56.20  ? 68  THR A CB  1 
ATOM   203  O OG1 . THR A 1 27  ? 13.176 21.295  29.190  1.00 51.40  ? 68  THR A OG1 1 
ATOM   204  C CG2 . THR A 1 27  ? 15.013 22.812  29.607  1.00 48.85  ? 68  THR A CG2 1 
ATOM   205  N N   . ASN A 1 28  ? 13.324 23.887  32.921  1.00 48.94  ? 69  ASN A N   1 
ATOM   206  C CA  . ASN A 1 28  ? 13.724 24.863  33.924  1.00 50.70  ? 69  ASN A CA  1 
ATOM   207  C C   . ASN A 1 28  ? 12.700 24.678  35.063  1.00 57.16  ? 69  ASN A C   1 
ATOM   208  O O   . ASN A 1 28  ? 11.722 23.923  34.906  1.00 58.36  ? 69  ASN A O   1 
ATOM   209  C CB  . ASN A 1 28  ? 13.758 26.315  33.390  1.00 49.79  ? 69  ASN A CB  1 
ATOM   210  C CG  . ASN A 1 28  ? 12.520 26.725  32.614  1.00 51.76  ? 69  ASN A CG  1 
ATOM   211  O OD1 . ASN A 1 28  ? 11.419 26.736  33.142  1.00 45.55  ? 69  ASN A OD1 1 
ATOM   212  N ND2 . ASN A 1 28  ? 12.714 27.096  31.340  1.00 53.55  ? 69  ASN A ND2 1 
ATOM   213  N N   . SER A 1 29  ? 12.898 25.318  36.208  1.00 51.45  ? 70  SER A N   1 
ATOM   214  C CA  . SER A 1 29  ? 11.953 25.080  37.288  1.00 57.77  ? 70  SER A CA  1 
ATOM   215  C C   . SER A 1 29  ? 10.680 25.911  37.195  1.00 59.07  ? 70  SER A C   1 
ATOM   216  O O   . SER A 1 29  ? 9.724  25.699  37.960  1.00 51.71  ? 70  SER A O   1 
ATOM   217  C CB  . SER A 1 29  ? 12.632 25.273  38.654  1.00 58.03  ? 70  SER A CB  1 
ATOM   218  O OG  . SER A 1 29  ? 13.185 26.562  38.798  1.00 60.15  ? 70  SER A OG  1 
ATOM   219  N N   . HIS A 1 30  ? 10.644 26.817  36.224  1.00 53.95  ? 71  HIS A N   1 
ATOM   220  C CA  . HIS A 1 30  ? 9.477  27.677  36.063  1.00 58.68  ? 71  HIS A CA  1 
ATOM   221  C C   . HIS A 1 30  ? 8.484  27.207  35.004  1.00 57.24  ? 71  HIS A C   1 
ATOM   222  O O   . HIS A 1 30  ? 7.502  27.879  34.707  1.00 59.56  ? 71  HIS A O   1 
ATOM   223  C CB  . HIS A 1 30  ? 9.951  29.108  35.802  1.00 44.57  ? 71  HIS A CB  1 
ATOM   224  C CG  . HIS A 1 30  ? 10.858 29.633  36.875  1.00 61.68  ? 71  HIS A CG  1 
ATOM   225  N ND1 . HIS A 1 30  ? 10.625 29.415  38.224  1.00 65.00  ? 71  HIS A ND1 1 
ATOM   226  C CD2 . HIS A 1 30  ? 11.997 30.367  36.804  1.00 53.62  ? 71  HIS A CD2 1 
ATOM   227  C CE1 . HIS A 1 30  ? 11.579 29.995  38.935  1.00 63.95  ? 71  HIS A CE1 1 
ATOM   228  N NE2 . HIS A 1 30  ? 12.423 30.580  38.097  1.00 71.97  ? 71  HIS A NE2 1 
ATOM   229  N N   . ASN A 1 31  ? 8.742  26.009  34.492  1.00 69.68  ? 72  ASN A N   1 
ATOM   230  C CA  . ASN A 1 31  ? 7.960  25.361  33.440  1.00 70.84  ? 72  ASN A CA  1 
ATOM   231  C C   . ASN A 1 31  ? 7.614  26.291  32.250  1.00 65.38  ? 72  ASN A C   1 
ATOM   232  O O   . ASN A 1 31  ? 6.505  26.324  31.737  1.00 70.64  ? 72  ASN A O   1 
ATOM   233  C CB  . ASN A 1 31  ? 6.729  24.615  34.042  1.00 73.21  ? 72  ASN A CB  1 
ATOM   234  C CG  . ASN A 1 31  ? 5.753  25.536  34.762  1.00 82.56  ? 72  ASN A CG  1 
ATOM   235  O OD1 . ASN A 1 31  ? 4.853  26.117  34.148  1.00 88.20  ? 72  ASN A OD1 1 
ATOM   236  N ND2 . ASN A 1 31  ? 5.926  25.674  36.072  1.00 91.32  ? 72  ASN A ND2 1 
ATOM   237  N N   . GLN A 1 32  ? 8.603  27.063  31.823  1.00 60.89  ? 73  GLN A N   1 
ATOM   238  C CA  . GLN A 1 32  ? 8.454  27.915  30.660  1.00 64.76  ? 73  GLN A CA  1 
ATOM   239  C C   . GLN A 1 32  ? 9.203  27.155  29.538  1.00 64.27  ? 73  GLN A C   1 
ATOM   240  O O   . GLN A 1 32  ? 10.204 26.483  29.806  1.00 59.47  ? 73  GLN A O   1 
ATOM   241  C CB  . GLN A 1 32  ? 9.097  29.275  30.909  1.00 70.76  ? 73  GLN A CB  1 
ATOM   242  C CG  . GLN A 1 32  ? 8.551  30.021  32.122  1.00 87.90  ? 73  GLN A CG  1 
ATOM   243  C CD  . GLN A 1 32  ? 9.470  31.172  32.562  1.00 99.48  ? 73  GLN A CD  1 
ATOM   244  O OE1 . GLN A 1 32  ? 9.199  31.861  33.552  1.00 103.57 ? 73  GLN A OE1 1 
ATOM   245  N NE2 . GLN A 1 32  ? 10.561 31.378  31.824  1.00 96.07  ? 73  GLN A NE2 1 
ATOM   246  N N   . LEU A 1 33  ? 8.723  27.242  28.298  1.00 62.94  ? 74  LEU A N   1 
ATOM   247  C CA  . LEU A 1 33  ? 9.372  26.535  27.190  1.00 61.29  ? 74  LEU A CA  1 
ATOM   248  C C   . LEU A 1 33  ? 10.843 26.926  26.944  1.00 60.62  ? 74  LEU A C   1 
ATOM   249  O O   . LEU A 1 33  ? 11.222 28.110  26.848  1.00 48.98  ? 74  LEU A O   1 
ATOM   250  C CB  . LEU A 1 33  ? 8.554  26.692  25.899  1.00 59.15  ? 74  LEU A CB  1 
ATOM   251  C CG  . LEU A 1 33  ? 7.119  26.143  26.007  1.00 64.73  ? 74  LEU A CG  1 
ATOM   252  C CD1 . LEU A 1 33  ? 6.266  26.811  24.921  1.00 50.10  ? 74  LEU A CD1 1 
ATOM   253  C CD2 . LEU A 1 33  ? 7.075  24.581  25.927  1.00 44.49  ? 74  LEU A CD2 1 
ATOM   254  N N   . GLU A 1 34  ? 11.677 25.898  26.869  1.00 59.12  ? 75  GLU A N   1 
ATOM   255  C CA  . GLU A 1 34  ? 13.083 26.110  26.638  1.00 58.74  ? 75  GLU A CA  1 
ATOM   256  C C   . GLU A 1 34  ? 13.586 24.997  25.738  1.00 56.17  ? 75  GLU A C   1 
ATOM   257  O O   . GLU A 1 34  ? 13.197 23.824  25.879  1.00 52.32  ? 75  GLU A O   1 
ATOM   258  C CB  . GLU A 1 34  ? 13.861 26.111  27.972  1.00 56.48  ? 75  GLU A CB  1 
ATOM   259  C CG  . GLU A 1 34  ? 15.299 26.660  27.880  1.00 62.18  ? 75  GLU A CG  1 
ATOM   260  C CD  . GLU A 1 34  ? 16.027 26.743  29.236  1.00 68.59  ? 75  GLU A CD  1 
ATOM   261  O OE1 . GLU A 1 34  ? 15.363 26.775  30.295  1.00 72.46  ? 75  GLU A OE1 1 
ATOM   262  O OE2 . GLU A 1 34  ? 17.273 26.802  29.243  1.00 65.72  ? 75  GLU A OE2 1 
ATOM   263  N N   . ILE A 1 35  ? 14.453 25.393  24.811  1.00 60.61  ? 76  ILE A N   1 
ATOM   264  C CA  . ILE A 1 35  ? 15.101 24.486  23.858  1.00 64.61  ? 76  ILE A CA  1 
ATOM   265  C C   . ILE A 1 35  ? 15.912 23.476  24.666  1.00 61.77  ? 76  ILE A C   1 
ATOM   266  O O   . ILE A 1 35  ? 16.676 23.853  25.568  1.00 58.99  ? 76  ILE A O   1 
ATOM   267  C CB  . ILE A 1 35  ? 16.088 25.266  22.936  1.00 63.02  ? 76  ILE A CB  1 
ATOM   268  C CG1 . ILE A 1 35  ? 15.309 26.198  22.017  1.00 56.47  ? 76  ILE A CG1 1 
ATOM   269  C CG2 . ILE A 1 35  ? 17.011 24.313  22.193  1.00 56.40  ? 76  ILE A CG2 1 
ATOM   270  C CD1 . ILE A 1 35  ? 16.124 27.402  21.614  1.00 50.84  ? 76  ILE A CD1 1 
ATOM   271  N N   . ARG A 1 36  ? 15.709 22.201  24.356  1.00 61.43  ? 77  ARG A N   1 
ATOM   272  C CA  . ARG A 1 36  ? 16.440 21.134  25.012  1.00 58.81  ? 77  ARG A CA  1 
ATOM   273  C C   . ARG A 1 36  ? 17.330 20.606  23.904  1.00 58.79  ? 77  ARG A C   1 
ATOM   274  O O   . ARG A 1 36  ? 18.357 19.994  24.169  1.00 54.18  ? 77  ARG A O   1 
ATOM   275  C CB  . ARG A 1 36  ? 15.533 19.977  25.481  1.00 57.51  ? 77  ARG A CB  1 
ATOM   276  C CG  . ARG A 1 36  ? 14.178 20.341  26.028  1.00 62.06  ? 77  ARG A CG  1 
ATOM   277  C CD  . ARG A 1 36  ? 13.444 19.107  26.595  1.00 54.71  ? 77  ARG A CD  1 
ATOM   278  N NE  . ARG A 1 36  ? 13.330 17.989  25.660  1.00 69.67  ? 77  ARG A NE  1 
ATOM   279  C CZ  . ARG A 1 36  ? 13.751 16.742  25.906  1.00 72.30  ? 77  ARG A CZ  1 
ATOM   280  N NH1 . ARG A 1 36  ? 14.327 16.448  27.066  1.00 75.28  ? 77  ARG A NH1 1 
ATOM   281  N NH2 . ARG A 1 36  ? 13.574 15.778  25.000  1.00 58.61  ? 77  ARG A NH2 1 
ATOM   282  N N   . THR A 1 37  ? 16.906 20.835  22.659  1.00 56.15  ? 78  THR A N   1 
ATOM   283  C CA  . THR A 1 37  ? 17.649 20.354  21.507  1.00 60.24  ? 78  THR A CA  1 
ATOM   284  C C   . THR A 1 37  ? 17.221 21.038  20.237  1.00 54.90  ? 78  THR A C   1 
ATOM   285  O O   . THR A 1 37  ? 16.158 21.615  20.155  1.00 51.58  ? 78  THR A O   1 
ATOM   286  C CB  . THR A 1 37  ? 17.446 18.841  21.281  1.00 72.42  ? 78  THR A CB  1 
ATOM   287  O OG1 . THR A 1 37  ? 17.231 18.187  22.539  1.00 84.11  ? 78  THR A OG1 1 
ATOM   288  C CG2 . THR A 1 37  ? 18.674 18.241  20.610  1.00 69.28  ? 78  THR A CG2 1 
ATOM   289  N N   . LEU A 1 38  ? 18.061 20.964  19.228  1.00 53.26  ? 79  LEU A N   1 
ATOM   290  C CA  . LEU A 1 38  ? 17.704 21.584  17.977  1.00 58.12  ? 79  LEU A CA  1 
ATOM   291  C C   . LEU A 1 38  ? 18.383 20.880  16.819  1.00 58.43  ? 79  LEU A C   1 
ATOM   292  O O   . LEU A 1 38  ? 19.379 20.202  16.996  1.00 56.40  ? 79  LEU A O   1 
ATOM   293  C CB  . LEU A 1 38  ? 18.054 23.073  18.007  1.00 60.51  ? 79  LEU A CB  1 
ATOM   294  C CG  . LEU A 1 38  ? 19.391 23.498  18.590  1.00 55.17  ? 79  LEU A CG  1 
ATOM   295  C CD1 . LEU A 1 38  ? 20.483 22.833  17.799  1.00 65.19  ? 79  LEU A CD1 1 
ATOM   296  C CD2 . LEU A 1 38  ? 19.538 25.004  18.549  1.00 52.71  ? 79  LEU A CD2 1 
ATOM   297  N N   . GLY A 1 39  ? 17.816 21.028  15.634  1.00 53.80  ? 80  GLY A N   1 
ATOM   298  C CA  . GLY A 1 39  ? 18.390 20.389  14.480  1.00 46.45  ? 80  GLY A CA  1 
ATOM   299  C C   . GLY A 1 39  ? 17.766 20.956  13.239  1.00 42.17  ? 80  GLY A C   1 
ATOM   300  O O   . GLY A 1 39  ? 17.345 22.103  13.201  1.00 37.84  ? 80  GLY A O   1 
ATOM   301  N N   . SER A 1 40  ? 17.696 20.159  12.197  1.00 46.11  ? 81  SER A N   1 
ATOM   302  C CA  . SER A 1 40  ? 17.120 20.685  10.961  1.00 51.79  ? 81  SER A CA  1 
ATOM   303  C C   . SER A 1 40  ? 15.982 19.801  10.482  1.00 46.59  ? 81  SER A C   1 
ATOM   304  O O   . SER A 1 40  ? 15.748 18.718  11.038  1.00 45.97  ? 81  SER A O   1 
ATOM   305  C CB  . SER A 1 40  ? 18.217 20.797  9.893   1.00 54.90  ? 81  SER A CB  1 
ATOM   306  O OG  . SER A 1 40  ? 19.328 21.564  10.374  1.00 57.14  ? 81  SER A OG  1 
ATOM   307  N N   . GLY A 1 41  ? 15.269 20.291  9.480   1.00 42.32  ? 82  GLY A N   1 
ATOM   308  C CA  . GLY A 1 41  ? 14.150 19.568  8.893   1.00 38.87  ? 82  GLY A CA  1 
ATOM   309  C C   . GLY A 1 41  ? 14.014 19.890  7.397   1.00 44.20  ? 82  GLY A C   1 
ATOM   310  O O   . GLY A 1 41  ? 14.603 20.853  6.869   1.00 38.79  ? 82  GLY A O   1 
ATOM   311  N N   . VAL A 1 42  ? 13.218 19.100  6.697   1.00 44.79  ? 83  VAL A N   1 
ATOM   312  C CA  . VAL A 1 42  ? 13.055 19.329  5.269   1.00 42.56  ? 83  VAL A CA  1 
ATOM   313  C C   . VAL A 1 42  ? 11.584 19.262  4.915   1.00 45.01  ? 83  VAL A C   1 
ATOM   314  O O   . VAL A 1 42  ? 10.918 18.257  5.152   1.00 47.50  ? 83  VAL A O   1 
ATOM   315  C CB  . VAL A 1 42  ? 13.889 18.265  4.446   1.00 42.79  ? 83  VAL A CB  1 
ATOM   316  C CG1 . VAL A 1 42  ? 13.862 18.577  2.938   1.00 43.02  ? 83  VAL A CG1 1 
ATOM   317  C CG2 . VAL A 1 42  ? 15.370 18.275  4.935   1.00 42.83  ? 83  VAL A CG2 1 
ATOM   318  N N   . ILE A 1 43  ? 11.064 20.346  4.362   1.00 43.04  ? 84  ILE A N   1 
ATOM   319  C CA  . ILE A 1 43  ? 9.669  20.366  3.964   1.00 40.77  ? 84  ILE A CA  1 
ATOM   320  C C   . ILE A 1 43  ? 9.580  19.561  2.674   1.00 46.21  ? 84  ILE A C   1 
ATOM   321  O O   . ILE A 1 43  ? 10.209 19.903  1.673   1.00 43.49  ? 84  ILE A O   1 
ATOM   322  C CB  . ILE A 1 43  ? 9.186  21.797  3.751   1.00 49.22  ? 84  ILE A CB  1 
ATOM   323  C CG1 . ILE A 1 43  ? 9.364  22.601  5.053   1.00 48.35  ? 84  ILE A CG1 1 
ATOM   324  C CG2 . ILE A 1 43  ? 7.726  21.800  3.369   1.00 45.97  ? 84  ILE A CG2 1 
ATOM   325  C CD1 . ILE A 1 43  ? 9.394  24.104  4.848   1.00 45.44  ? 84  ILE A CD1 1 
ATOM   326  N N   . MET A 1 44  ? 8.808  18.473  2.745   1.00 48.02  ? 85  MET A N   1 
ATOM   327  C CA  . MET A 1 44  ? 8.580  17.523  1.670   1.00 41.29  ? 85  MET A CA  1 
ATOM   328  C C   . MET A 1 44  ? 7.481  17.853  0.650   1.00 55.06  ? 85  MET A C   1 
ATOM   329  O O   . MET A 1 44  ? 7.666  17.643  -0.552  1.00 56.15  ? 85  MET A O   1 
ATOM   330  C CB  . MET A 1 44  ? 8.286  16.163  2.288   1.00 40.24  ? 85  MET A CB  1 
ATOM   331  C CG  . MET A 1 44  ? 9.372  15.647  3.207   1.00 48.51  ? 85  MET A CG  1 
ATOM   332  S SD  . MET A 1 44  ? 11.047 15.601  2.452   1.00 58.50  ? 85  MET A SD  1 
ATOM   333  C CE  . MET A 1 44  ? 10.726 14.472  1.054   1.00 55.04  ? 85  MET A CE  1 
ATOM   334  N N   . ASP A 1 45  ? 6.316  18.299  1.117   1.00 56.81  ? 86  ASP A N   1 
ATOM   335  C CA  . ASP A 1 45  ? 5.239  18.668  0.194   1.00 56.26  ? 86  ASP A CA  1 
ATOM   336  C C   . ASP A 1 45  ? 4.453  19.828  0.791   1.00 63.16  ? 86  ASP A C   1 
ATOM   337  O O   . ASP A 1 45  ? 4.689  20.249  1.952   1.00 52.24  ? 86  ASP A O   1 
ATOM   338  C CB  . ASP A 1 45  ? 4.292  17.478  -0.141  1.00 58.66  ? 86  ASP A CB  1 
ATOM   339  C CG  . ASP A 1 45  ? 3.440  17.004  1.055   1.00 61.28  ? 86  ASP A CG  1 
ATOM   340  O OD1 . ASP A 1 45  ? 3.597  15.838  1.455   1.00 64.21  ? 86  ASP A OD1 1 
ATOM   341  O OD2 . ASP A 1 45  ? 2.611  17.773  1.591   1.00 58.98  ? 86  ASP A OD2 1 
ATOM   342  N N   . GLN A 1 46  ? 3.505  20.350  0.025   1.00 57.31  ? 87  GLN A N   1 
ATOM   343  C CA  . GLN A 1 46  ? 2.784  21.474  0.553   1.00 54.72  ? 87  GLN A CA  1 
ATOM   344  C C   . GLN A 1 46  ? 1.745  21.271  1.653   1.00 52.72  ? 87  GLN A C   1 
ATOM   345  O O   . GLN A 1 46  ? 1.119  22.241  2.105   1.00 51.00  ? 87  GLN A O   1 
ATOM   346  C CB  . GLN A 1 46  ? 2.234  22.290  -0.611  1.00 50.84  ? 87  GLN A CB  1 
ATOM   347  C CG  . GLN A 1 46  ? 3.342  23.182  -1.103  1.00 50.50  ? 87  GLN A CG  1 
ATOM   348  C CD  . GLN A 1 46  ? 2.846  24.366  -1.845  1.00 62.87  ? 87  GLN A CD  1 
ATOM   349  O OE1 . GLN A 1 46  ? 2.629  24.300  -3.062  1.00 73.04  ? 87  GLN A OE1 1 
ATOM   350  N NE2 . GLN A 1 46  ? 2.651  25.477  -1.131  1.00 54.41  ? 87  GLN A NE2 1 
ATOM   351  N N   . ARG A 1 47  ? 1.576  20.042  2.126   1.00 42.92  ? 88  ARG A N   1 
ATOM   352  C CA  . ARG A 1 47  ? 0.587  19.826  3.174   1.00 48.74  ? 88  ARG A CA  1 
ATOM   353  C C   . ARG A 1 47  ? 1.171  20.176  4.532   1.00 53.25  ? 88  ARG A C   1 
ATOM   354  O O   . ARG A 1 47  ? 0.461  20.220  5.529   1.00 59.38  ? 88  ARG A O   1 
ATOM   355  C CB  . ARG A 1 47  ? 0.102  18.372  3.164   1.00 52.14  ? 88  ARG A CB  1 
ATOM   356  C CG  . ARG A 1 47  ? -0.523 17.957  1.846   1.00 45.16  ? 88  ARG A CG  1 
ATOM   357  C CD  . ARG A 1 47  ? -0.832 16.499  1.802   1.00 39.38  ? 88  ARG A CD  1 
ATOM   358  N NE  . ARG A 1 47  ? 0.386  15.705  1.681   1.00 47.69  ? 88  ARG A NE  1 
ATOM   359  C CZ  . ARG A 1 47  ? 0.380  14.386  1.547   1.00 41.20  ? 88  ARG A CZ  1 
ATOM   360  N NH1 . ARG A 1 47  ? -0.778 13.739  1.507   1.00 51.40  ? 88  ARG A NH1 1 
ATOM   361  N NH2 . ARG A 1 47  ? 1.516  13.714  1.508   1.00 41.37  ? 88  ARG A NH2 1 
ATOM   362  N N   . GLY A 1 48  ? 2.478  20.402  4.555   1.00 53.82  ? 89  GLY A N   1 
ATOM   363  C CA  . GLY A 1 48  ? 3.163  20.767  5.770   1.00 47.45  ? 89  GLY A CA  1 
ATOM   364  C C   . GLY A 1 48  ? 3.934  19.610  6.359   1.00 49.54  ? 89  GLY A C   1 
ATOM   365  O O   . GLY A 1 48  ? 4.358  19.661  7.527   1.00 51.25  ? 89  GLY A O   1 
ATOM   366  N N   . TYR A 1 49  ? 4.107  18.549  5.578   1.00 50.49  ? 90  TYR A N   1 
ATOM   367  C CA  . TYR A 1 49  ? 4.856  17.392  6.084   1.00 50.44  ? 90  TYR A CA  1 
ATOM   368  C C   . TYR A 1 49  ? 6.328  17.684  5.953   1.00 48.30  ? 90  TYR A C   1 
ATOM   369  O O   . TYR A 1 49  ? 6.822  18.063  4.895   1.00 48.53  ? 90  TYR A O   1 
ATOM   370  C CB  . TYR A 1 49  ? 4.471  16.104  5.340   1.00 50.82  ? 90  TYR A CB  1 
ATOM   371  C CG  . TYR A 1 49  ? 3.053  15.639  5.678   1.00 54.63  ? 90  TYR A CG  1 
ATOM   372  C CD1 . TYR A 1 49  ? 2.030  15.636  4.715   1.00 50.54  ? 90  TYR A CD1 1 
ATOM   373  C CD2 . TYR A 1 49  ? 2.739  15.224  6.977   1.00 52.86  ? 90  TYR A CD2 1 
ATOM   374  C CE1 . TYR A 1 49  ? 0.725  15.234  5.040   1.00 50.23  ? 90  TYR A CE1 1 
ATOM   375  C CE2 . TYR A 1 49  ? 1.461  14.821  7.319   1.00 53.01  ? 90  TYR A CE2 1 
ATOM   376  C CZ  . TYR A 1 49  ? 0.455  14.833  6.359   1.00 61.99  ? 90  TYR A CZ  1 
ATOM   377  O OH  . TYR A 1 49  ? -0.814 14.505  6.771   1.00 64.61  ? 90  TYR A OH  1 
ATOM   378  N N   . ILE A 1 50  ? 7.019  17.525  7.062   1.00 53.06  ? 91  ILE A N   1 
ATOM   379  C CA  . ILE A 1 50  ? 8.441  17.791  7.143   1.00 48.00  ? 91  ILE A CA  1 
ATOM   380  C C   . ILE A 1 50  ? 9.163  16.577  7.724   1.00 55.24  ? 91  ILE A C   1 
ATOM   381  O O   . ILE A 1 50  ? 8.743  16.043  8.755   1.00 63.35  ? 91  ILE A O   1 
ATOM   382  C CB  . ILE A 1 50  ? 8.687  18.954  8.114   1.00 47.96  ? 91  ILE A CB  1 
ATOM   383  C CG1 . ILE A 1 50  ? 7.927  20.198  7.654   1.00 50.63  ? 91  ILE A CG1 1 
ATOM   384  C CG2 . ILE A 1 50  ? 10.163 19.200  8.263   1.00 47.87  ? 91  ILE A CG2 1 
ATOM   385  C CD1 . ILE A 1 50  ? 7.707  21.261  8.767   1.00 44.60  ? 91  ILE A CD1 1 
ATOM   386  N N   . ILE A 1 51  ? 10.232 16.125  7.073   1.00 56.08  ? 92  ILE A N   1 
ATOM   387  C CA  . ILE A 1 51  ? 11.017 15.025  7.626   1.00 52.52  ? 92  ILE A CA  1 
ATOM   388  C C   . ILE A 1 51  ? 12.109 15.610  8.549   1.00 54.80  ? 92  ILE A C   1 
ATOM   389  O O   . ILE A 1 51  ? 12.570 16.748  8.360   1.00 53.77  ? 92  ILE A O   1 
ATOM   390  C CB  . ILE A 1 51  ? 11.710 14.191  6.527   1.00 55.90  ? 92  ILE A CB  1 
ATOM   391  C CG1 . ILE A 1 51  ? 10.753 13.135  5.983   1.00 55.57  ? 92  ILE A CG1 1 
ATOM   392  C CG2 . ILE A 1 51  ? 12.914 13.452  7.119   1.00 65.66  ? 92  ILE A CG2 1 
ATOM   393  C CD1 . ILE A 1 51  ? 11.114 12.618  4.621   1.00 60.93  ? 92  ILE A CD1 1 
ATOM   394  N N   . THR A 1 52  ? 12.473 14.857  9.582   1.00 54.14  ? 93  THR A N   1 
ATOM   395  C CA  . THR A 1 52  ? 13.558 15.262  10.474  1.00 50.92  ? 93  THR A CA  1 
ATOM   396  C C   . THR A 1 52  ? 14.056 14.016  11.171  1.00 54.13  ? 93  THR A C   1 
ATOM   397  O O   . THR A 1 52  ? 13.594 12.917  10.866  1.00 60.97  ? 93  THR A O   1 
ATOM   398  C CB  . THR A 1 52  ? 13.131 16.274  11.525  1.00 47.34  ? 93  THR A CB  1 
ATOM   399  O OG1 . THR A 1 52  ? 14.301 16.785  12.163  1.00 51.87  ? 93  THR A OG1 1 
ATOM   400  C CG2 . THR A 1 52  ? 12.249 15.632  12.576  1.00 44.85  ? 93  THR A CG2 1 
ATOM   401  N N   . ASN A 1 53  ? 15.003 14.175  12.091  1.00 60.85  ? 94  ASN A N   1 
ATOM   402  C CA  . ASN A 1 53  ? 15.535 13.035  12.862  1.00 59.08  ? 94  ASN A CA  1 
ATOM   403  C C   . ASN A 1 53  ? 14.743 12.807  14.144  1.00 50.37  ? 94  ASN A C   1 
ATOM   404  O O   . ASN A 1 53  ? 14.272 13.771  14.781  1.00 42.35  ? 94  ASN A O   1 
ATOM   405  C CB  . ASN A 1 53  ? 16.997 13.264  13.226  1.00 58.25  ? 94  ASN A CB  1 
ATOM   406  C CG  . ASN A 1 53  ? 17.913 12.879  12.129  1.00 60.11  ? 94  ASN A CG  1 
ATOM   407  O OD1 . ASN A 1 53  ? 19.119 13.105  12.200  1.00 65.83  ? 94  ASN A OD1 1 
ATOM   408  N ND2 . ASN A 1 53  ? 17.352 12.279  11.086  1.00 70.74  ? 94  ASN A ND2 1 
ATOM   409  N N   . LYS A 1 54  ? 14.623 11.542  14.534  1.00 52.19  ? 95  LYS A N   1 
ATOM   410  C CA  . LYS A 1 54  ? 13.871 11.202  15.745  1.00 56.19  ? 95  LYS A CA  1 
ATOM   411  C C   . LYS A 1 54  ? 14.565 11.745  16.981  1.00 53.27  ? 95  LYS A C   1 
ATOM   412  O O   . LYS A 1 54  ? 13.925 12.411  17.801  1.00 51.83  ? 95  LYS A O   1 
ATOM   413  C CB  . LYS A 1 54  ? 13.686 9.694   15.868  1.00 56.88  ? 95  LYS A CB  1 
ATOM   414  C CG  . LYS A 1 54  ? 12.821 9.267   17.042  1.00 60.41  ? 95  LYS A CG  1 
ATOM   415  C CD  . LYS A 1 54  ? 12.345 7.818   16.859  1.00 65.00  ? 95  LYS A CD  1 
ATOM   416  C CE  . LYS A 1 54  ? 11.602 7.293   18.090  1.00 69.80  ? 95  LYS A CE  1 
ATOM   417  N NZ  . LYS A 1 54  ? 12.486 7.342   19.297  1.00 73.39  ? 95  LYS A NZ  1 
ATOM   418  N N   . HIS A 1 55  ? 15.877 11.510  17.079  1.00 49.50  ? 96  HIS A N   1 
ATOM   419  C CA  . HIS A 1 55  ? 16.662 11.988  18.224  1.00 54.36  ? 96  HIS A CA  1 
ATOM   420  C C   . HIS A 1 55  ? 16.607 13.497  18.393  1.00 57.28  ? 96  HIS A C   1 
ATOM   421  O O   . HIS A 1 55  ? 17.073 14.023  19.394  1.00 66.61  ? 96  HIS A O   1 
ATOM   422  C CB  . HIS A 1 55  ? 18.155 11.550  18.138  1.00 45.14  ? 96  HIS A CB  1 
ATOM   423  C CG  . HIS A 1 55  ? 18.976 12.315  17.140  1.00 58.18  ? 96  HIS A CG  1 
ATOM   424  N ND1 . HIS A 1 55  ? 19.050 11.967  15.804  1.00 62.00  ? 96  HIS A ND1 1 
ATOM   425  C CD2 . HIS A 1 55  ? 19.764 13.407  17.286  1.00 53.39  ? 96  HIS A CD2 1 
ATOM   426  C CE1 . HIS A 1 55  ? 19.850 12.811  15.177  1.00 53.39  ? 96  HIS A CE1 1 
ATOM   427  N NE2 . HIS A 1 55  ? 20.295 13.694  16.051  1.00 51.11  ? 96  HIS A NE2 1 
ATOM   428  N N   . VAL A 1 56  ? 16.064 14.198  17.409  1.00 52.69  ? 97  VAL A N   1 
ATOM   429  C CA  . VAL A 1 56  ? 15.990 15.635  17.504  1.00 52.06  ? 97  VAL A CA  1 
ATOM   430  C C   . VAL A 1 56  ? 14.698 16.039  18.187  1.00 47.96  ? 97  VAL A C   1 
ATOM   431  O O   . VAL A 1 56  ? 14.643 17.013  18.920  1.00 53.80  ? 97  VAL A O   1 
ATOM   432  C CB  . VAL A 1 56  ? 16.032 16.300  16.076  1.00 58.12  ? 97  VAL A CB  1 
ATOM   433  C CG1 . VAL A 1 56  ? 15.866 17.824  16.173  1.00 51.14  ? 97  VAL A CG1 1 
ATOM   434  C CG2 . VAL A 1 56  ? 17.326 15.984  15.391  1.00 53.61  ? 97  VAL A CG2 1 
ATOM   435  N N   . ILE A 1 57  ? 13.642 15.293  17.929  1.00 55.94  ? 98  ILE A N   1 
ATOM   436  C CA  . ILE A 1 57  ? 12.351 15.659  18.497  1.00 55.62  ? 98  ILE A CA  1 
ATOM   437  C C   . ILE A 1 57  ? 11.904 14.771  19.647  1.00 49.30  ? 98  ILE A C   1 
ATOM   438  O O   . ILE A 1 57  ? 10.870 15.001  20.235  1.00 52.28  ? 98  ILE A O   1 
ATOM   439  C CB  . ILE A 1 57  ? 11.238 15.711  17.360  1.00 48.54  ? 98  ILE A CB  1 
ATOM   440  C CG1 . ILE A 1 57  ? 11.187 14.384  16.610  1.00 46.12  ? 98  ILE A CG1 1 
ATOM   441  C CG2 . ILE A 1 57  ? 11.537 16.850  16.371  1.00 44.91  ? 98  ILE A CG2 1 
ATOM   442  C CD1 . ILE A 1 57  ? 10.418 13.270  17.327  1.00 48.32  ? 98  ILE A CD1 1 
ATOM   443  N N   . ASN A 1 58  ? 12.690 13.757  19.967  1.00 51.91  ? 99  ASN A N   1 
ATOM   444  C CA  . ASN A 1 58  ? 12.338 12.867  21.060  1.00 58.87  ? 99  ASN A CA  1 
ATOM   445  C C   . ASN A 1 58  ? 11.924 13.553  22.371  1.00 56.52  ? 99  ASN A C   1 
ATOM   446  O O   . ASN A 1 58  ? 12.575 14.467  22.850  1.00 55.16  ? 99  ASN A O   1 
ATOM   447  C CB  . ASN A 1 58  ? 13.477 11.875  21.328  1.00 58.54  ? 99  ASN A CB  1 
ATOM   448  C CG  . ASN A 1 58  ? 13.202 10.528  20.707  1.00 62.10  ? 99  ASN A CG  1 
ATOM   449  O OD1 . ASN A 1 58  ? 12.036 10.185  20.505  1.00 64.28  ? 99  ASN A OD1 1 
ATOM   450  N ND2 . ASN A 1 58  ? 14.257 9.750   20.401  1.00 63.67  ? 99  ASN A ND2 1 
ATOM   451  N N   . ASP A 1 59  ? 10.801 13.104  22.918  1.00 64.05  ? 100 ASP A N   1 
ATOM   452  C CA  . ASP A 1 59  ? 10.262 13.608  24.180  1.00 67.97  ? 100 ASP A CA  1 
ATOM   453  C C   . ASP A 1 59  ? 10.077 15.103  24.261  1.00 66.45  ? 100 ASP A C   1 
ATOM   454  O O   . ASP A 1 59  ? 10.242 15.672  25.333  1.00 68.19  ? 100 ASP A O   1 
ATOM   455  C CB  . ASP A 1 59  ? 11.145 13.151  25.355  1.00 69.17  ? 100 ASP A CB  1 
ATOM   456  C CG  . ASP A 1 59  ? 11.119 11.640  25.552  1.00 82.69  ? 100 ASP A CG  1 
ATOM   457  O OD1 . ASP A 1 59  ? 10.059 11.113  25.957  1.00 89.48  ? 100 ASP A OD1 1 
ATOM   458  O OD2 . ASP A 1 59  ? 12.148 10.975  25.293  1.00 89.71  ? 100 ASP A OD2 1 
ATOM   459  N N   . ALA A 1 60  ? 9.708  15.748  23.159  1.00 58.05  ? 101 ALA A N   1 
ATOM   460  C CA  . ALA A 1 60  ? 9.544  17.207  23.198  1.00 58.79  ? 101 ALA A CA  1 
ATOM   461  C C   . ALA A 1 60  ? 8.146  17.608  23.650  1.00 54.14  ? 101 ALA A C   1 
ATOM   462  O O   . ALA A 1 60  ? 7.223  16.814  23.544  1.00 59.63  ? 101 ALA A O   1 
ATOM   463  C CB  . ALA A 1 60  ? 9.857  17.820  21.806  1.00 49.02  ? 101 ALA A CB  1 
ATOM   464  N N   . ASP A 1 61  ? 7.992  18.816  24.186  1.00 55.14  ? 102 ASP A N   1 
ATOM   465  C CA  . ASP A 1 61  ? 6.662  19.285  24.593  1.00 57.89  ? 102 ASP A CA  1 
ATOM   466  C C   . ASP A 1 61  ? 6.122  20.224  23.522  1.00 59.61  ? 102 ASP A C   1 
ATOM   467  O O   . ASP A 1 61  ? 4.919  20.452  23.396  1.00 60.55  ? 102 ASP A O   1 
ATOM   468  C CB  . ASP A 1 61  ? 6.717  20.001  25.954  1.00 67.59  ? 102 ASP A CB  1 
ATOM   469  C CG  . ASP A 1 61  ? 7.035  19.042  27.108  1.00 76.85  ? 102 ASP A CG  1 
ATOM   470  O OD1 . ASP A 1 61  ? 6.333  17.987  27.243  1.00 64.33  ? 102 ASP A OD1 1 
ATOM   471  O OD2 . ASP A 1 61  ? 7.989  19.350  27.866  1.00 76.61  ? 102 ASP A OD2 1 
ATOM   472  N N   . GLN A 1 62  ? 7.042  20.773  22.745  1.00 58.13  ? 103 GLN A N   1 
ATOM   473  C CA  . GLN A 1 62  ? 6.689  21.648  21.665  1.00 55.71  ? 103 GLN A CA  1 
ATOM   474  C C   . GLN A 1 62  ? 7.838  21.570  20.702  1.00 58.83  ? 103 GLN A C   1 
ATOM   475  O O   . GLN A 1 62  ? 8.994  21.579  21.121  1.00 65.14  ? 103 GLN A O   1 
ATOM   476  C CB  . GLN A 1 62  ? 6.521  23.087  22.146  1.00 54.83  ? 103 GLN A CB  1 
ATOM   477  C CG  . GLN A 1 62  ? 5.953  23.989  21.061  1.00 48.63  ? 103 GLN A CG  1 
ATOM   478  C CD  . GLN A 1 62  ? 6.186  25.436  21.341  1.00 56.34  ? 103 GLN A CD  1 
ATOM   479  O OE1 . GLN A 1 62  ? 7.315  25.855  21.598  1.00 68.32  ? 103 GLN A OE1 1 
ATOM   480  N NE2 . GLN A 1 62  ? 5.130  26.222  21.293  1.00 57.98  ? 103 GLN A NE2 1 
ATOM   481  N N   . ILE A 1 63  ? 7.517  21.442  19.420  1.00 57.13  ? 104 ILE A N   1 
ATOM   482  C CA  . ILE A 1 63  ? 8.514  21.390  18.359  1.00 54.40  ? 104 ILE A CA  1 
ATOM   483  C C   . ILE A 1 63  ? 8.226  22.636  17.542  1.00 54.50  ? 104 ILE A C   1 
ATOM   484  O O   . ILE A 1 63  ? 7.096  22.850  17.120  1.00 49.62  ? 104 ILE A O   1 
ATOM   485  C CB  . ILE A 1 63  ? 8.338  20.115  17.492  1.00 57.40  ? 104 ILE A CB  1 
ATOM   486  C CG1 . ILE A 1 63  ? 8.607  18.885  18.368  1.00 62.05  ? 104 ILE A CG1 1 
ATOM   487  C CG2 . ILE A 1 63  ? 9.282  20.128  16.250  1.00 47.23  ? 104 ILE A CG2 1 
ATOM   488  C CD1 . ILE A 1 63  ? 8.258  17.538  17.724  1.00 54.12  ? 104 ILE A CD1 1 
ATOM   489  N N   . ILE A 1 64  ? 9.238  23.484  17.396  1.00 51.68  ? 105 ILE A N   1 
ATOM   490  C CA  . ILE A 1 64  ? 9.138  24.718  16.614  1.00 52.42  ? 105 ILE A CA  1 
ATOM   491  C C   . ILE A 1 64  ? 9.871  24.575  15.275  1.00 52.48  ? 105 ILE A C   1 
ATOM   492  O O   . ILE A 1 64  ? 11.018 24.129  15.238  1.00 57.18  ? 105 ILE A O   1 
ATOM   493  C CB  . ILE A 1 64  ? 9.782  25.943  17.341  1.00 44.91  ? 105 ILE A CB  1 
ATOM   494  C CG1 . ILE A 1 64  ? 8.992  26.328  18.604  1.00 52.20  ? 105 ILE A CG1 1 
ATOM   495  C CG2 . ILE A 1 64  ? 9.836  27.130  16.389  1.00 45.97  ? 105 ILE A CG2 1 
ATOM   496  C CD1 . ILE A 1 64  ? 7.502  26.691  18.389  1.00 46.18  ? 105 ILE A CD1 1 
ATOM   497  N N   . VAL A 1 65  ? 9.214  24.956  14.184  1.00 57.32  ? 106 VAL A N   1 
ATOM   498  C CA  . VAL A 1 65  ? 9.819  24.906  12.838  1.00 49.39  ? 106 VAL A CA  1 
ATOM   499  C C   . VAL A 1 65  ? 9.939  26.374  12.389  1.00 54.12  ? 106 VAL A C   1 
ATOM   500  O O   . VAL A 1 65  ? 8.964  27.148  12.449  1.00 48.80  ? 106 VAL A O   1 
ATOM   501  C CB  . VAL A 1 65  ? 8.924  24.070  11.837  1.00 52.69  ? 106 VAL A CB  1 
ATOM   502  C CG1 . VAL A 1 65  ? 9.237  24.425  10.375  1.00 47.71  ? 106 VAL A CG1 1 
ATOM   503  C CG2 . VAL A 1 65  ? 9.147  22.572  12.053  1.00 44.58  ? 106 VAL A CG2 1 
ATOM   504  N N   . ALA A 1 66  ? 11.151 26.767  11.994  1.00 49.01  ? 107 ALA A N   1 
ATOM   505  C CA  . ALA A 1 66  ? 11.398 28.127  11.535  1.00 43.16  ? 107 ALA A CA  1 
ATOM   506  C C   . ALA A 1 66  ? 11.858 28.050  10.079  1.00 44.19  ? 107 ALA A C   1 
ATOM   507  O O   . ALA A 1 66  ? 12.750 27.270  9.777   1.00 40.54  ? 107 ALA A O   1 
ATOM   508  C CB  . ALA A 1 66  ? 12.475 28.764  12.375  1.00 38.43  ? 107 ALA A CB  1 
ATOM   509  N N   . LEU A 1 67  ? 11.241 28.830  9.181   1.00 43.32  ? 108 LEU A N   1 
ATOM   510  C CA  . LEU A 1 67  ? 11.651 28.808  7.778   1.00 46.57  ? 108 LEU A CA  1 
ATOM   511  C C   . LEU A 1 67  ? 12.642 29.950  7.453   1.00 53.24  ? 108 LEU A C   1 
ATOM   512  O O   . LEU A 1 67  ? 12.704 31.000  8.129   1.00 43.37  ? 108 LEU A O   1 
ATOM   513  C CB  . LEU A 1 67  ? 10.445 28.895  6.829   1.00 35.87  ? 108 LEU A CB  1 
ATOM   514  C CG  . LEU A 1 67  ? 9.134  28.159  7.147   1.00 50.32  ? 108 LEU A CG  1 
ATOM   515  C CD1 . LEU A 1 67  ? 8.322  27.865  5.868   1.00 39.65  ? 108 LEU A CD1 1 
ATOM   516  C CD2 . LEU A 1 67  ? 9.429  26.911  7.870   1.00 45.44  ? 108 LEU A CD2 1 
ATOM   517  N N   . GLN A 1 68  ? 13.422 29.752  6.401   1.00 48.96  ? 109 GLN A N   1 
ATOM   518  C CA  . GLN A 1 68  ? 14.365 30.782  6.046   1.00 45.56  ? 109 GLN A CA  1 
ATOM   519  C C   . GLN A 1 68  ? 13.648 32.059  5.720   1.00 48.04  ? 109 GLN A C   1 
ATOM   520  O O   . GLN A 1 68  ? 14.276 33.108  5.724   1.00 47.31  ? 109 GLN A O   1 
ATOM   521  C CB  . GLN A 1 68  ? 15.237 30.350  4.865   1.00 38.77  ? 109 GLN A CB  1 
ATOM   522  C CG  . GLN A 1 68  ? 16.153 29.183  5.181   1.00 34.54  ? 109 GLN A CG  1 
ATOM   523  C CD  . GLN A 1 68  ? 16.725 29.271  6.605   1.00 45.91  ? 109 GLN A CD  1 
ATOM   524  O OE1 . GLN A 1 68  ? 17.421 30.233  6.941   1.00 49.06  ? 109 GLN A OE1 1 
ATOM   525  N NE2 . GLN A 1 68  ? 16.439 28.249  7.438   1.00 42.74  ? 109 GLN A NE2 1 
ATOM   526  N N   . ASP A 1 69  ? 12.337 31.997  5.442   1.00 49.85  ? 110 ASP A N   1 
ATOM   527  C CA  . ASP A 1 69  ? 11.633 33.228  5.083   1.00 44.25  ? 110 ASP A CA  1 
ATOM   528  C C   . ASP A 1 69  ? 11.110 33.995  6.249   1.00 52.18  ? 110 ASP A C   1 
ATOM   529  O O   . ASP A 1 69  ? 10.471 35.041  6.066   1.00 55.03  ? 110 ASP A O   1 
ATOM   530  C CB  . ASP A 1 69  ? 10.494 33.002  4.072   1.00 48.66  ? 110 ASP A CB  1 
ATOM   531  C CG  . ASP A 1 69  ? 9.363  32.123  4.605   1.00 57.69  ? 110 ASP A CG  1 
ATOM   532  O OD1 . ASP A 1 69  ? 9.194  31.999  5.845   1.00 51.40  ? 110 ASP A OD1 1 
ATOM   533  O OD2 . ASP A 1 69  ? 8.621  31.571  3.749   1.00 49.29  ? 110 ASP A OD2 1 
ATOM   534  N N   . GLY A 1 70  ? 11.381 33.487  7.453   1.00 52.17  ? 111 GLY A N   1 
ATOM   535  C CA  . GLY A 1 70  ? 10.945 34.180  8.639   1.00 41.57  ? 111 GLY A CA  1 
ATOM   536  C C   . GLY A 1 70  ? 9.742  33.618  9.364   1.00 47.84  ? 111 GLY A C   1 
ATOM   537  O O   . GLY A 1 70  ? 9.535  33.927  10.543  1.00 49.72  ? 111 GLY A O   1 
ATOM   538  N N   . ARG A 1 71  ? 8.936  32.805  8.699   1.00 43.05  ? 112 ARG A N   1 
ATOM   539  C CA  . ARG A 1 71  ? 7.775  32.263  9.403   1.00 50.51  ? 112 ARG A CA  1 
ATOM   540  C C   . ARG A 1 71  ? 8.186  31.192  10.387  1.00 48.81  ? 112 ARG A C   1 
ATOM   541  O O   . ARG A 1 71  ? 9.171  30.491  10.168  1.00 56.64  ? 112 ARG A O   1 
ATOM   542  C CB  . ARG A 1 71  ? 6.733  31.706  8.431   1.00 43.73  ? 112 ARG A CB  1 
ATOM   543  C CG  . ARG A 1 71  ? 6.218  32.749  7.411   1.00 41.91  ? 112 ARG A CG  1 
ATOM   544  C CD  . ARG A 1 71  ? 5.310  32.074  6.415   1.00 42.20  ? 112 ARG A CD  1 
ATOM   545  N NE  . ARG A 1 71  ? 6.037  31.419  5.342   1.00 48.32  ? 112 ARG A NE  1 
ATOM   546  C CZ  . ARG A 1 71  ? 5.454  30.678  4.409   1.00 51.53  ? 112 ARG A CZ  1 
ATOM   547  N NH1 . ARG A 1 71  ? 4.140  30.492  4.427   1.00 51.40  ? 112 ARG A NH1 1 
ATOM   548  N NH2 . ARG A 1 71  ? 6.175  30.144  3.443   1.00 39.75  ? 112 ARG A NH2 1 
ATOM   549  N N   . VAL A 1 72  ? 7.437  31.104  11.484  1.00 50.76  ? 113 VAL A N   1 
ATOM   550  C CA  . VAL A 1 72  ? 7.655  30.131  12.560  1.00 40.92  ? 113 VAL A CA  1 
ATOM   551  C C   . VAL A 1 72  ? 6.344  29.373  12.813  1.00 44.63  ? 113 VAL A C   1 
ATOM   552  O O   . VAL A 1 72  ? 5.263  29.964  12.867  1.00 55.04  ? 113 VAL A O   1 
ATOM   553  C CB  . VAL A 1 72  ? 8.076  30.859  13.859  1.00 41.11  ? 113 VAL A CB  1 
ATOM   554  C CG1 . VAL A 1 72  ? 8.274  29.867  14.982  1.00 40.24  ? 113 VAL A CG1 1 
ATOM   555  C CG2 . VAL A 1 72  ? 9.354  31.688  13.616  1.00 37.27  ? 113 VAL A CG2 1 
ATOM   556  N N   . PHE A 1 73  ? 6.421  28.064  12.943  1.00 48.88  ? 114 PHE A N   1 
ATOM   557  C CA  . PHE A 1 73  ? 5.227  27.276  13.230  1.00 49.09  ? 114 PHE A CA  1 
ATOM   558  C C   . PHE A 1 73  ? 5.451  26.291  14.368  1.00 54.30  ? 114 PHE A C   1 
ATOM   559  O O   . PHE A 1 73  ? 6.574  25.882  14.668  1.00 53.09  ? 114 PHE A O   1 
ATOM   560  C CB  . PHE A 1 73  ? 4.804  26.428  12.034  1.00 52.51  ? 114 PHE A CB  1 
ATOM   561  C CG  . PHE A 1 73  ? 4.595  27.199  10.780  1.00 54.71  ? 114 PHE A CG  1 
ATOM   562  C CD1 . PHE A 1 73  ? 5.686  27.622  10.024  1.00 48.49  ? 114 PHE A CD1 1 
ATOM   563  C CD2 . PHE A 1 73  ? 3.298  27.465  10.326  1.00 47.72  ? 114 PHE A CD2 1 
ATOM   564  C CE1 . PHE A 1 73  ? 5.497  28.284  8.840   1.00 51.21  ? 114 PHE A CE1 1 
ATOM   565  C CE2 . PHE A 1 73  ? 3.098  28.130  9.138   1.00 53.62  ? 114 PHE A CE2 1 
ATOM   566  C CZ  . PHE A 1 73  ? 4.191  28.544  8.386   1.00 51.41  ? 114 PHE A CZ  1 
ATOM   567  N N   . GLU A 1 74  ? 4.356  25.904  14.994  1.00 58.41  ? 115 GLU A N   1 
ATOM   568  C CA  . GLU A 1 74  ? 4.423  24.897  16.014  1.00 59.51  ? 115 GLU A CA  1 
ATOM   569  C C   . GLU A 1 74  ? 4.197  23.669  15.141  1.00 56.79  ? 115 GLU A C   1 
ATOM   570  O O   . GLU A 1 74  ? 3.397  23.703  14.216  1.00 64.67  ? 115 GLU A O   1 
ATOM   571  C CB  . GLU A 1 74  ? 3.297  25.064  17.024  1.00 61.33  ? 115 GLU A CB  1 
ATOM   572  C CG  . GLU A 1 74  ? 3.119  23.826  17.892  1.00 78.26  ? 115 GLU A CG  1 
ATOM   573  C CD  . GLU A 1 74  ? 2.237  24.056  19.118  1.00 86.55  ? 115 GLU A CD  1 
ATOM   574  O OE1 . GLU A 1 74  ? 1.898  23.036  19.776  1.00 78.84  ? 115 GLU A OE1 1 
ATOM   575  O OE2 . GLU A 1 74  ? 1.904  25.241  19.413  1.00 79.81  ? 115 GLU A OE2 1 
ATOM   576  N N   . ALA A 1 75  ? 4.918  22.593  15.396  1.00 58.15  ? 116 ALA A N   1 
ATOM   577  C CA  . ALA A 1 75  ? 4.764  21.402  14.590  1.00 54.24  ? 116 ALA A CA  1 
ATOM   578  C C   . ALA A 1 75  ? 4.162  20.213  15.383  1.00 58.67  ? 116 ALA A C   1 
ATOM   579  O O   . ALA A 1 75  ? 4.355  20.084  16.596  1.00 57.50  ? 116 ALA A O   1 
ATOM   580  C CB  . ALA A 1 75  ? 6.111  21.032  13.998  1.00 43.19  ? 116 ALA A CB  1 
ATOM   581  N N   . LEU A 1 76  ? 3.416  19.365  14.680  1.00 57.34  ? 117 LEU A N   1 
ATOM   582  C CA  . LEU A 1 76  ? 2.798  18.191  15.271  1.00 56.66  ? 117 LEU A CA  1 
ATOM   583  C C   . LEU A 1 76  ? 3.659  17.014  14.874  1.00 57.35  ? 117 LEU A C   1 
ATOM   584  O O   . LEU A 1 76  ? 4.203  16.976  13.774  1.00 55.25  ? 117 LEU A O   1 
ATOM   585  C CB  . LEU A 1 76  ? 1.377  18.032  14.727  1.00 64.43  ? 117 LEU A CB  1 
ATOM   586  C CG  . LEU A 1 76  ? 0.437  16.885  15.139  1.00 76.79  ? 117 LEU A CG  1 
ATOM   587  C CD1 . LEU A 1 76  ? 0.424  15.816  14.047  1.00 79.87  ? 117 LEU A CD1 1 
ATOM   588  C CD2 . LEU A 1 76  ? 0.844  16.304  16.503  1.00 81.40  ? 117 LEU A CD2 1 
ATOM   589  N N   . LEU A 1 77  ? 3.809  16.059  15.780  1.00 60.70  ? 118 LEU A N   1 
ATOM   590  C CA  . LEU A 1 77  ? 4.616  14.876  15.505  1.00 57.89  ? 118 LEU A CA  1 
ATOM   591  C C   . LEU A 1 77  ? 3.664  13.817  14.963  1.00 61.40  ? 118 LEU A C   1 
ATOM   592  O O   . LEU A 1 77  ? 2.798  13.342  15.689  1.00 56.65  ? 118 LEU A O   1 
ATOM   593  C CB  . LEU A 1 77  ? 5.260  14.384  16.795  1.00 57.18  ? 118 LEU A CB  1 
ATOM   594  C CG  . LEU A 1 77  ? 6.485  13.481  16.687  1.00 61.62  ? 118 LEU A CG  1 
ATOM   595  C CD1 . LEU A 1 77  ? 6.711  12.810  18.031  1.00 62.88  ? 118 LEU A CD1 1 
ATOM   596  C CD2 . LEU A 1 77  ? 6.283  12.438  15.639  1.00 72.02  ? 118 LEU A CD2 1 
ATOM   597  N N   . VAL A 1 78  ? 3.800  13.452  13.691  1.00 61.58  ? 119 VAL A N   1 
ATOM   598  C CA  . VAL A 1 78  ? 2.898  12.445  13.154  1.00 61.63  ? 119 VAL A CA  1 
ATOM   599  C C   . VAL A 1 78  ? 3.393  11.014  13.364  1.00 61.88  ? 119 VAL A C   1 
ATOM   600  O O   . VAL A 1 78  ? 2.583  10.064  13.325  1.00 61.29  ? 119 VAL A O   1 
ATOM   601  C CB  . VAL A 1 78  ? 2.595  12.684  11.623  1.00 67.28  ? 119 VAL A CB  1 
ATOM   602  C CG1 . VAL A 1 78  ? 3.203  13.987  11.184  1.00 68.75  ? 119 VAL A CG1 1 
ATOM   603  C CG2 . VAL A 1 78  ? 3.086  11.514  10.763  1.00 52.74  ? 119 VAL A CG2 1 
ATOM   604  N N   . GLY A 1 79  ? 4.701  10.862  13.589  1.00 51.21  ? 120 GLY A N   1 
ATOM   605  C CA  . GLY A 1 79  ? 5.271  9.542   13.776  1.00 49.98  ? 120 GLY A CA  1 
ATOM   606  C C   . GLY A 1 79  ? 6.786  9.543   13.685  1.00 57.46  ? 120 GLY A C   1 
ATOM   607  O O   . GLY A 1 79  ? 7.376  10.474  13.136  1.00 63.49  ? 120 GLY A O   1 
ATOM   608  N N   . SER A 1 80  ? 7.431  8.517   14.233  1.00 57.36  ? 121 SER A N   1 
ATOM   609  C CA  . SER A 1 80  ? 8.891  8.428   14.173  1.00 61.53  ? 121 SER A CA  1 
ATOM   610  C C   . SER A 1 80  ? 9.281  6.964   14.061  1.00 61.41  ? 121 SER A C   1 
ATOM   611  O O   . SER A 1 80  ? 8.435  6.096   14.201  1.00 66.72  ? 121 SER A O   1 
ATOM   612  C CB  . SER A 1 80  ? 9.522  9.065   15.407  1.00 63.25  ? 121 SER A CB  1 
ATOM   613  O OG  . SER A 1 80  ? 9.179  8.344   16.563  1.00 72.90  ? 121 SER A OG  1 
ATOM   614  N N   . ASP A 1 81  ? 10.553 6.688   13.803  1.00 64.86  ? 122 ASP A N   1 
ATOM   615  C CA  . ASP A 1 81  ? 11.021 5.321   13.614  1.00 62.84  ? 122 ASP A CA  1 
ATOM   616  C C   . ASP A 1 81  ? 12.433 5.174   14.139  1.00 68.74  ? 122 ASP A C   1 
ATOM   617  O O   . ASP A 1 81  ? 13.380 5.705   13.561  1.00 78.42  ? 122 ASP A O   1 
ATOM   618  C CB  . ASP A 1 81  ? 10.967 4.979   12.115  1.00 71.32  ? 122 ASP A CB  1 
ATOM   619  C CG  . ASP A 1 81  ? 11.544 3.592   11.782  1.00 82.66  ? 122 ASP A CG  1 
ATOM   620  O OD1 . ASP A 1 81  ? 11.006 2.563   12.255  1.00 89.25  ? 122 ASP A OD1 1 
ATOM   621  O OD2 . ASP A 1 81  ? 12.535 3.533   11.024  1.00 79.35  ? 122 ASP A OD2 1 
ATOM   622  N N   . SER A 1 82  ? 12.576 4.445   15.238  1.00 75.37  ? 123 SER A N   1 
ATOM   623  C CA  . SER A 1 82  ? 13.880 4.226   15.854  1.00 73.46  ? 123 SER A CA  1 
ATOM   624  C C   . SER A 1 82  ? 14.872 3.644   14.874  1.00 73.56  ? 123 SER A C   1 
ATOM   625  O O   . SER A 1 82  ? 16.001 4.113   14.778  1.00 75.16  ? 123 SER A O   1 
ATOM   626  C CB  . SER A 1 82  ? 13.750 3.275   17.037  1.00 71.59  ? 123 SER A CB  1 
ATOM   627  O OG  . SER A 1 82  ? 12.879 3.804   18.012  1.00 80.62  ? 123 SER A OG  1 
ATOM   628  N N   . LEU A 1 83  ? 14.438 2.622   14.143  1.00 78.05  ? 124 LEU A N   1 
ATOM   629  C CA  . LEU A 1 83  ? 15.292 1.937   13.173  1.00 80.67  ? 124 LEU A CA  1 
ATOM   630  C C   . LEU A 1 83  ? 16.036 2.787   12.157  1.00 76.28  ? 124 LEU A C   1 
ATOM   631  O O   . LEU A 1 83  ? 17.177 2.493   11.835  1.00 83.31  ? 124 LEU A O   1 
ATOM   632  C CB  . LEU A 1 83  ? 14.487 0.872   12.432  1.00 89.05  ? 124 LEU A CB  1 
ATOM   633  C CG  . LEU A 1 83  ? 14.203 -0.388  13.248  1.00 95.32  ? 124 LEU A CG  1 
ATOM   634  C CD1 . LEU A 1 83  ? 13.486 -1.408  12.371  1.00 102.58 ? 124 LEU A CD1 1 
ATOM   635  C CD2 . LEU A 1 83  ? 15.518 -0.968  13.768  1.00 98.38  ? 124 LEU A CD2 1 
ATOM   636  N N   . THR A 1 84  ? 15.394 3.822   11.633  1.00 72.30  ? 125 THR A N   1 
ATOM   637  C CA  . THR A 1 84  ? 16.040 4.694   10.659  1.00 64.73  ? 125 THR A CA  1 
ATOM   638  C C   . THR A 1 84  ? 16.362 6.027   11.300  1.00 61.21  ? 125 THR A C   1 
ATOM   639  O O   . THR A 1 84  ? 17.137 6.810   10.762  1.00 60.00  ? 125 THR A O   1 
ATOM   640  C CB  . THR A 1 84  ? 15.124 4.980   9.439   1.00 74.61  ? 125 THR A CB  1 
ATOM   641  O OG1 . THR A 1 84  ? 13.761 5.145   9.875   1.00 77.07  ? 125 THR A OG1 1 
ATOM   642  C CG2 . THR A 1 84  ? 15.221 3.866   8.418   1.00 70.86  ? 125 THR A CG2 1 
ATOM   643  N N   . ASP A 1 85  ? 15.744 6.286   12.449  1.00 56.25  ? 126 ASP A N   1 
ATOM   644  C CA  . ASP A 1 85  ? 15.925 7.556   13.166  1.00 61.89  ? 126 ASP A CA  1 
ATOM   645  C C   . ASP A 1 85  ? 15.273 8.710   12.376  1.00 54.75  ? 126 ASP A C   1 
ATOM   646  O O   . ASP A 1 85  ? 15.754 9.835   12.346  1.00 52.35  ? 126 ASP A O   1 
ATOM   647  C CB  . ASP A 1 85  ? 17.422 7.844   13.418  1.00 52.77  ? 126 ASP A CB  1 
ATOM   648  C CG  . ASP A 1 85  ? 17.643 9.083   14.283  1.00 53.17  ? 126 ASP A CG  1 
ATOM   649  O OD1 . ASP A 1 85  ? 16.767 9.398   15.110  1.00 62.39  ? 126 ASP A OD1 1 
ATOM   650  O OD2 . ASP A 1 85  ? 18.695 9.754   14.152  1.00 60.47  ? 126 ASP A OD2 1 
ATOM   651  N N   . LEU A 1 86  ? 14.160 8.404   11.732  1.00 57.17  ? 127 LEU A N   1 
ATOM   652  C CA  . LEU A 1 86  ? 13.443 9.398   10.948  1.00 64.01  ? 127 LEU A CA  1 
ATOM   653  C C   . LEU A 1 86  ? 12.168 9.802   11.657  1.00 57.70  ? 127 LEU A C   1 
ATOM   654  O O   . LEU A 1 86  ? 11.507 8.965   12.259  1.00 58.98  ? 127 LEU A O   1 
ATOM   655  C CB  . LEU A 1 86  ? 13.079 8.840   9.563   1.00 58.94  ? 127 LEU A CB  1 
ATOM   656  C CG  . LEU A 1 86  ? 14.168 8.742   8.512   1.00 56.67  ? 127 LEU A CG  1 
ATOM   657  C CD1 . LEU A 1 86  ? 13.559 8.116   7.279   1.00 58.43  ? 127 LEU A CD1 1 
ATOM   658  C CD2 . LEU A 1 86  ? 14.730 10.130  8.184   1.00 42.81  ? 127 LEU A CD2 1 
ATOM   659  N N   . ALA A 1 87  ? 11.827 11.081  11.590  1.00 51.45  ? 128 ALA A N   1 
ATOM   660  C CA  . ALA A 1 87  ? 10.586 11.546  12.205  1.00 55.88  ? 128 ALA A CA  1 
ATOM   661  C C   . ALA A 1 87  ? 9.878  12.414  11.173  1.00 52.82  ? 128 ALA A C   1 
ATOM   662  O O   . ALA A 1 87  ? 10.518 12.983  10.286  1.00 51.27  ? 128 ALA A O   1 
ATOM   663  C CB  . ALA A 1 87  ? 10.875 12.364  13.504  1.00 50.26  ? 128 ALA A CB  1 
ATOM   664  N N   . VAL A 1 88  ? 8.565  12.524  11.291  1.00 48.22  ? 129 VAL A N   1 
ATOM   665  C CA  . VAL A 1 88  ? 7.819  13.329  10.356  1.00 47.75  ? 129 VAL A CA  1 
ATOM   666  C C   . VAL A 1 88  ? 6.895  14.265  11.116  1.00 52.35  ? 129 VAL A C   1 
ATOM   667  O O   . VAL A 1 88  ? 6.037  13.826  11.907  1.00 55.55  ? 129 VAL A O   1 
ATOM   668  C CB  . VAL A 1 88  ? 7.031  12.432  9.368   1.00 54.88  ? 129 VAL A CB  1 
ATOM   669  C CG1 . VAL A 1 88  ? 6.151  13.265  8.471   1.00 45.02  ? 129 VAL A CG1 1 
ATOM   670  C CG2 . VAL A 1 88  ? 8.011  11.624  8.514   1.00 46.69  ? 129 VAL A CG2 1 
ATOM   671  N N   . LEU A 1 89  ? 7.115  15.563  10.880  1.00 53.23  ? 130 LEU A N   1 
ATOM   672  C CA  . LEU A 1 89  ? 6.358  16.642  11.489  1.00 47.64  ? 130 LEU A CA  1 
ATOM   673  C C   . LEU A 1 89  ? 5.330  17.136  10.514  1.00 51.39  ? 130 LEU A C   1 
ATOM   674  O O   . LEU A 1 89  ? 5.356  16.798  9.317   1.00 53.48  ? 130 LEU A O   1 
ATOM   675  C CB  . LEU A 1 89  ? 7.252  17.824  11.813  1.00 42.46  ? 130 LEU A CB  1 
ATOM   676  C CG  . LEU A 1 89  ? 8.613  17.544  12.410  1.00 51.00  ? 130 LEU A CG  1 
ATOM   677  C CD1 . LEU A 1 89  ? 9.255  18.890  12.667  1.00 49.40  ? 130 LEU A CD1 1 
ATOM   678  C CD2 . LEU A 1 89  ? 8.500  16.696  13.687  1.00 51.75  ? 130 LEU A CD2 1 
ATOM   679  N N   . LYS A 1 90  ? 4.465  18.000  11.031  1.00 52.07  ? 131 LYS A N   1 
ATOM   680  C CA  . LYS A 1 90  ? 3.389  18.604  10.251  1.00 52.49  ? 131 LYS A CA  1 
ATOM   681  C C   . LYS A 1 90  ? 3.057  19.971  10.812  1.00 47.60  ? 131 LYS A C   1 
ATOM   682  O O   . LYS A 1 90  ? 2.652  20.105  11.977  1.00 53.90  ? 131 LYS A O   1 
ATOM   683  C CB  . LYS A 1 90  ? 2.125  17.718  10.288  1.00 55.77  ? 131 LYS A CB  1 
ATOM   684  C CG  . LYS A 1 90  ? 0.861  18.326  9.658   1.00 50.68  ? 131 LYS A CG  1 
ATOM   685  C CD  . LYS A 1 90  ? 0.568  17.689  8.325   1.00 63.29  ? 131 LYS A CD  1 
ATOM   686  C CE  . LYS A 1 90  ? -0.868 17.923  7.855   1.00 65.33  ? 131 LYS A CE  1 
ATOM   687  N NZ  . LYS A 1 90  ? -1.126 19.363  7.619   1.00 70.38  ? 131 LYS A NZ  1 
ATOM   688  N N   . ILE A 1 91  ? 3.257  20.982  9.978   1.00 47.98  ? 132 ILE A N   1 
ATOM   689  C CA  . ILE A 1 91  ? 2.942  22.355  10.331  1.00 47.68  ? 132 ILE A CA  1 
ATOM   690  C C   . ILE A 1 91  ? 1.696  22.649  9.524   1.00 48.97  ? 132 ILE A C   1 
ATOM   691  O O   . ILE A 1 91  ? 1.502  22.057  8.459   1.00 57.16  ? 132 ILE A O   1 
ATOM   692  C CB  . ILE A 1 91  ? 4.065  23.335  9.922   1.00 41.31  ? 132 ILE A CB  1 
ATOM   693  C CG1 . ILE A 1 91  ? 4.371  23.205  8.424   1.00 40.71  ? 132 ILE A CG1 1 
ATOM   694  C CG2 . ILE A 1 91  ? 5.280  23.087  10.774  1.00 38.39  ? 132 ILE A CG2 1 
ATOM   695  C CD1 . ILE A 1 91  ? 5.453  24.210  7.882   1.00 40.13  ? 132 ILE A CD1 1 
ATOM   696  N N   . ASN A 1 92  ? 0.843  23.534  10.022  1.00 52.83  ? 133 ASN A N   1 
ATOM   697  C CA  . ASN A 1 92  ? -0.382 23.884  9.308   1.00 56.85  ? 133 ASN A CA  1 
ATOM   698  C C   . ASN A 1 92  ? -0.134 25.240  8.713   1.00 60.26  ? 133 ASN A C   1 
ATOM   699  O O   . ASN A 1 92  ? -0.129 26.249  9.411   1.00 56.81  ? 133 ASN A O   1 
ATOM   700  C CB  . ASN A 1 92  ? -1.588 23.949  10.259  1.00 69.11  ? 133 ASN A CB  1 
ATOM   701  C CG  . ASN A 1 92  ? -2.860 24.504  9.579   1.00 72.07  ? 133 ASN A CG  1 
ATOM   702  O OD1 . ASN A 1 92  ? -3.289 25.632  9.854   1.00 60.47  ? 133 ASN A OD1 1 
ATOM   703  N ND2 . ASN A 1 92  ? -3.453 23.709  8.685   1.00 73.82  ? 133 ASN A ND2 1 
ATOM   704  N N   . ALA A 1 93  ? 0.071  25.280  7.408   1.00 64.05  ? 134 ALA A N   1 
ATOM   705  C CA  . ALA A 1 93  ? 0.346  26.562  6.807   1.00 64.41  ? 134 ALA A CA  1 
ATOM   706  C C   . ALA A 1 93  ? -0.655 27.002  5.781   1.00 65.19  ? 134 ALA A C   1 
ATOM   707  O O   . ALA A 1 93  ? -1.419 26.215  5.217   1.00 59.05  ? 134 ALA A O   1 
ATOM   708  C CB  . ALA A 1 93  ? 1.740  26.569  6.199   1.00 69.36  ? 134 ALA A CB  1 
ATOM   709  N N   . THR A 1 94  ? -0.651 28.306  5.567   1.00 69.83  ? 135 THR A N   1 
ATOM   710  C CA  . THR A 1 94  ? -1.517 28.891  4.590   1.00 70.05  ? 135 THR A CA  1 
ATOM   711  C C   . THR A 1 94  ? -0.608 29.836  3.821   1.00 63.45  ? 135 THR A C   1 
ATOM   712  O O   . THR A 1 94  ? 0.455  30.215  4.303   1.00 59.55  ? 135 THR A O   1 
ATOM   713  C CB  . THR A 1 94  ? -2.685 29.619  5.279   1.00 79.39  ? 135 THR A CB  1 
ATOM   714  O OG1 . THR A 1 94  ? -3.625 30.046  4.281   1.00 91.26  ? 135 THR A OG1 1 
ATOM   715  C CG2 . THR A 1 94  ? -2.179 30.805  6.085   1.00 73.98  ? 135 THR A CG2 1 
ATOM   716  N N   . GLY A 1 95  ? -0.994 30.192  2.608   1.00 62.96  ? 136 GLY A N   1 
ATOM   717  C CA  . GLY A 1 95  ? -0.137 31.075  1.847   1.00 55.88  ? 136 GLY A CA  1 
ATOM   718  C C   . GLY A 1 95  ? 1.004  30.354  1.156   1.00 53.85  ? 136 GLY A C   1 
ATOM   719  O O   . GLY A 1 95  ? 1.863  30.988  0.553   1.00 61.62  ? 136 GLY A O   1 
ATOM   720  N N   . GLY A 1 96  ? 1.030  29.031  1.250   1.00 49.96  ? 137 GLY A N   1 
ATOM   721  C CA  . GLY A 1 96  ? 2.070  28.288  0.571   1.00 54.38  ? 137 GLY A CA  1 
ATOM   722  C C   . GLY A 1 96  ? 3.342  28.037  1.344   1.00 48.92  ? 137 GLY A C   1 
ATOM   723  O O   . GLY A 1 96  ? 3.732  28.796  2.212   1.00 56.65  ? 137 GLY A O   1 
ATOM   724  N N   . LEU A 1 97  ? 3.978  26.938  0.996   1.00 45.02  ? 138 LEU A N   1 
ATOM   725  C CA  . LEU A 1 97  ? 5.208  26.491  1.608   1.00 47.72  ? 138 LEU A CA  1 
ATOM   726  C C   . LEU A 1 97  ? 6.202  26.092  0.541   1.00 51.55  ? 138 LEU A C   1 
ATOM   727  O O   . LEU A 1 97  ? 5.816  25.580  -0.520  1.00 48.38  ? 138 LEU A O   1 
ATOM   728  C CB  . LEU A 1 97  ? 4.966  25.229  2.431   1.00 43.15  ? 138 LEU A CB  1 
ATOM   729  C CG  . LEU A 1 97  ? 4.191  25.328  3.742   1.00 49.43  ? 138 LEU A CG  1 
ATOM   730  C CD1 . LEU A 1 97  ? 4.014  23.935  4.336   1.00 37.68  ? 138 LEU A CD1 1 
ATOM   731  C CD2 . LEU A 1 97  ? 4.950  26.256  4.697   1.00 40.75  ? 138 LEU A CD2 1 
ATOM   732  N N   . PRO A 1 98  ? 7.498  26.353  0.800   1.00 54.57  ? 139 PRO A N   1 
ATOM   733  C CA  . PRO A 1 98  ? 8.621  26.010  -0.084  1.00 48.22  ? 139 PRO A CA  1 
ATOM   734  C C   . PRO A 1 98  ? 8.808  24.520  0.142   1.00 41.54  ? 139 PRO A C   1 
ATOM   735  O O   . PRO A 1 98  ? 8.779  24.061  1.284   1.00 45.49  ? 139 PRO A O   1 
ATOM   736  C CB  . PRO A 1 98  ? 9.790  26.824  0.482   1.00 44.96  ? 139 PRO A CB  1 
ATOM   737  C CG  . PRO A 1 98  ? 9.351  27.183  1.861   1.00 48.01  ? 139 PRO A CG  1 
ATOM   738  C CD  . PRO A 1 98  ? 7.886  27.454  1.693   1.00 51.01  ? 139 PRO A CD  1 
ATOM   739  N N   . THR A 1 99  ? 8.967  23.761  -0.929  1.00 47.50  ? 140 THR A N   1 
ATOM   740  C CA  . THR A 1 99  ? 9.136  22.313  -0.826  1.00 46.89  ? 140 THR A CA  1 
ATOM   741  C C   . THR A 1 99  ? 10.419 21.815  -1.508  1.00 48.60  ? 140 THR A C   1 
ATOM   742  O O   . THR A 1 99  ? 10.800 22.285  -2.588  1.00 47.25  ? 140 THR A O   1 
ATOM   743  C CB  . THR A 1 99  ? 7.911  21.609  -1.432  1.00 48.17  ? 140 THR A CB  1 
ATOM   744  O OG1 . THR A 1 99  ? 7.692  22.095  -2.768  1.00 53.48  ? 140 THR A OG1 1 
ATOM   745  C CG2 . THR A 1 99  ? 6.675  21.904  -0.608  1.00 47.14  ? 140 THR A CG2 1 
ATOM   746  N N   . ILE A 1 100 ? 11.072 20.843  -0.882  1.00 51.26  ? 141 ILE A N   1 
ATOM   747  C CA  . ILE A 1 100 ? 12.330 20.299  -1.408  1.00 48.78  ? 141 ILE A CA  1 
ATOM   748  C C   . ILE A 1 100 ? 12.279 19.695  -2.828  1.00 50.95  ? 141 ILE A C   1 
ATOM   749  O O   . ILE A 1 100 ? 11.396 18.919  -3.147  1.00 49.91  ? 141 ILE A O   1 
ATOM   750  C CB  . ILE A 1 100 ? 12.902 19.240  -0.437  1.00 49.01  ? 141 ILE A CB  1 
ATOM   751  C CG1 . ILE A 1 100 ? 14.371 19.005  -0.746  1.00 47.60  ? 141 ILE A CG1 1 
ATOM   752  C CG2 . ILE A 1 100 ? 12.082 17.956  -0.473  1.00 45.46  ? 141 ILE A CG2 1 
ATOM   753  C CD1 . ILE A 1 100 ? 15.243 20.127  -0.219  1.00 39.65  ? 141 ILE A CD1 1 
ATOM   754  N N   . PRO A 1 101 ? 13.238 20.053  -3.697  1.00 50.11  ? 142 PRO A N   1 
ATOM   755  C CA  . PRO A 1 101 ? 13.226 19.492  -5.057  1.00 49.17  ? 142 PRO A CA  1 
ATOM   756  C C   . PRO A 1 101 ? 13.491 18.006  -5.049  1.00 51.09  ? 142 PRO A C   1 
ATOM   757  O O   . PRO A 1 101 ? 14.469 17.548  -4.451  1.00 49.65  ? 142 PRO A O   1 
ATOM   758  C CB  . PRO A 1 101 ? 14.366 20.236  -5.765  1.00 47.43  ? 142 PRO A CB  1 
ATOM   759  C CG  . PRO A 1 101 ? 14.389 21.549  -5.093  1.00 44.19  ? 142 PRO A CG  1 
ATOM   760  C CD  . PRO A 1 101 ? 14.182 21.184  -3.602  1.00 45.22  ? 142 PRO A CD  1 
ATOM   761  N N   . ILE A 1 102 ? 12.640 17.244  -5.722  1.00 51.64  ? 143 ILE A N   1 
ATOM   762  C CA  . ILE A 1 102 ? 12.843 15.805  -5.778  1.00 52.98  ? 143 ILE A CA  1 
ATOM   763  C C   . ILE A 1 102 ? 12.829 15.208  -7.174  1.00 56.01  ? 143 ILE A C   1 
ATOM   764  O O   . ILE A 1 102 ? 11.958 15.518  -7.973  1.00 60.83  ? 143 ILE A O   1 
ATOM   765  C CB  . ILE A 1 102 ? 11.792 15.045  -4.963  1.00 53.94  ? 143 ILE A CB  1 
ATOM   766  C CG1 . ILE A 1 102 ? 11.923 15.417  -3.486  1.00 48.94  ? 143 ILE A CG1 1 
ATOM   767  C CG2 . ILE A 1 102 ? 11.975 13.517  -5.200  1.00 53.01  ? 143 ILE A CG2 1 
ATOM   768  C CD1 . ILE A 1 102 ? 11.101 14.594  -2.593  1.00 47.22  ? 143 ILE A CD1 1 
ATOM   769  N N   . ASN A 1 103 ? 13.794 14.340  -7.464  1.00 59.09  ? 144 ASN A N   1 
ATOM   770  C CA  . ASN A 1 103 ? 13.841 13.676  -8.757  1.00 53.80  ? 144 ASN A CA  1 
ATOM   771  C C   . ASN A 1 103 ? 13.849 12.201  -8.485  1.00 55.84  ? 144 ASN A C   1 
ATOM   772  O O   . ASN A 1 103 ? 14.905 11.587  -8.392  1.00 59.56  ? 144 ASN A O   1 
ATOM   773  C CB  . ASN A 1 103 ? 15.091 14.047  -9.546  1.00 61.11  ? 144 ASN A CB  1 
ATOM   774  C CG  . ASN A 1 103 ? 15.106 13.414  -10.933 1.00 65.30  ? 144 ASN A CG  1 
ATOM   775  O OD1 . ASN A 1 103 ? 14.317 12.506  -11.219 1.00 65.05  ? 144 ASN A OD1 1 
ATOM   776  N ND2 . ASN A 1 103 ? 16.006 13.880  -11.795 1.00 58.02  ? 144 ASN A ND2 1 
ATOM   777  N N   . ALA A 1 104 ? 12.660 11.628  -8.353  1.00 59.49  ? 145 ALA A N   1 
ATOM   778  C CA  . ALA A 1 104 ? 12.518 10.207  -8.065  1.00 60.04  ? 145 ALA A CA  1 
ATOM   779  C C   . ALA A 1 104 ? 13.237 9.238   -9.020  1.00 63.08  ? 145 ALA A C   1 
ATOM   780  O O   . ALA A 1 104 ? 13.311 8.040   -8.752  1.00 62.97  ? 145 ALA A O   1 
ATOM   781  C CB  . ALA A 1 104 ? 11.060 9.870   -8.017  1.00 53.65  ? 145 ALA A CB  1 
ATOM   782  N N   . ARG A 1 105 ? 13.762 9.732   -10.133 1.00 64.99  ? 146 ARG A N   1 
ATOM   783  C CA  . ARG A 1 105 ? 14.429 8.832   -11.069 1.00 72.46  ? 146 ARG A CA  1 
ATOM   784  C C   . ARG A 1 105 ? 15.925 9.010   -11.106 1.00 72.34  ? 146 ARG A C   1 
ATOM   785  O O   . ARG A 1 105 ? 16.600 8.478   -11.987 1.00 81.12  ? 146 ARG A O   1 
ATOM   786  C CB  . ARG A 1 105 ? 13.846 8.989   -12.480 1.00 71.82  ? 146 ARG A CB  1 
ATOM   787  C CG  . ARG A 1 105 ? 12.406 8.502   -12.555 1.00 76.72  ? 146 ARG A CG  1 
ATOM   788  C CD  . ARG A 1 105 ? 11.912 8.388   -13.974 1.00 92.35  ? 146 ARG A CD  1 
ATOM   789  N NE  . ARG A 1 105 ? 10.714 7.551   -14.059 1.00 103.09 ? 146 ARG A NE  1 
ATOM   790  C CZ  . ARG A 1 105 ? 10.114 7.217   -15.200 1.00 107.15 ? 146 ARG A CZ  1 
ATOM   791  N NH1 . ARG A 1 105 ? 10.596 7.655   -16.361 1.00 108.49 ? 146 ARG A NH1 1 
ATOM   792  N NH2 . ARG A 1 105 ? 9.045  6.430   -15.183 1.00 106.36 ? 146 ARG A NH2 1 
ATOM   793  N N   . ARG A 1 106 ? 16.448 9.757   -10.145 1.00 67.21  ? 147 ARG A N   1 
ATOM   794  C CA  . ARG A 1 106 ? 17.876 9.984   -10.091 1.00 64.93  ? 147 ARG A CA  1 
ATOM   795  C C   . ARG A 1 106 ? 18.534 8.993   -9.156  1.00 63.12  ? 147 ARG A C   1 
ATOM   796  O O   . ARG A 1 106 ? 18.111 8.791   -8.031  1.00 59.41  ? 147 ARG A O   1 
ATOM   797  C CB  . ARG A 1 106 ? 18.188 11.389  -9.613  1.00 60.73  ? 147 ARG A CB  1 
ATOM   798  C CG  . ARG A 1 106 ? 19.645 11.701  -9.706  1.00 56.60  ? 147 ARG A CG  1 
ATOM   799  C CD  . ARG A 1 106 ? 19.796 12.963  -10.484 1.00 54.44  ? 147 ARG A CD  1 
ATOM   800  N NE  . ARG A 1 106 ? 20.210 12.724  -11.843 1.00 62.09  ? 147 ARG A NE  1 
ATOM   801  C CZ  . ARG A 1 106 ? 19.894 13.503  -12.866 1.00 56.43  ? 147 ARG A CZ  1 
ATOM   802  N NH1 . ARG A 1 106 ? 19.143 14.579  -12.684 1.00 50.25  ? 147 ARG A NH1 1 
ATOM   803  N NH2 . ARG A 1 106 ? 20.359 13.212  -14.071 1.00 70.28  ? 147 ARG A NH2 1 
ATOM   804  N N   . VAL A 1 107 ? 19.577 8.354   -9.634  1.00 63.59  ? 148 VAL A N   1 
ATOM   805  C CA  . VAL A 1 107 ? 20.247 7.403   -8.796  1.00 62.27  ? 148 VAL A CA  1 
ATOM   806  C C   . VAL A 1 107 ? 21.548 8.045   -8.327  1.00 57.32  ? 148 VAL A C   1 
ATOM   807  O O   . VAL A 1 107 ? 22.402 8.441   -9.141  1.00 59.17  ? 148 VAL A O   1 
ATOM   808  C CB  . VAL A 1 107 ? 20.465 6.046   -9.573  1.00 67.18  ? 148 VAL A CB  1 
ATOM   809  C CG1 . VAL A 1 107 ? 21.005 6.310   -10.972 1.00 74.62  ? 148 VAL A CG1 1 
ATOM   810  C CG2 . VAL A 1 107 ? 21.395 5.147   -8.812  1.00 65.47  ? 148 VAL A CG2 1 
ATOM   811  N N   . PRO A 1 108 ? 21.679 8.226   -7.002  1.00 50.20  ? 149 PRO A N   1 
ATOM   812  C CA  . PRO A 1 108 ? 22.869 8.816   -6.395  1.00 50.16  ? 149 PRO A CA  1 
ATOM   813  C C   . PRO A 1 108 ? 24.065 7.933   -6.776  1.00 53.52  ? 149 PRO A C   1 
ATOM   814  O O   . PRO A 1 108 ? 23.937 6.712   -6.871  1.00 56.24  ? 149 PRO A O   1 
ATOM   815  C CB  . PRO A 1 108 ? 22.579 8.718   -4.892  1.00 55.01  ? 149 PRO A CB  1 
ATOM   816  C CG  . PRO A 1 108 ? 21.094 8.698   -4.816  1.00 50.68  ? 149 PRO A CG  1 
ATOM   817  C CD  . PRO A 1 108 ? 20.700 7.848   -5.970  1.00 49.00  ? 149 PRO A CD  1 
ATOM   818  N N   . HIS A 1 109 ? 25.217 8.547   -7.000  1.00 50.58  ? 150 HIS A N   1 
ATOM   819  C CA  . HIS A 1 109 ? 26.403 7.802   -7.335  1.00 47.61  ? 150 HIS A CA  1 
ATOM   820  C C   . HIS A 1 109 ? 27.547 8.225   -6.441  1.00 52.47  ? 150 HIS A C   1 
ATOM   821  O O   . HIS A 1 109 ? 27.614 9.378   -5.999  1.00 50.97  ? 150 HIS A O   1 
ATOM   822  C CB  . HIS A 1 109 ? 26.790 8.033   -8.804  1.00 55.23  ? 150 HIS A CB  1 
ATOM   823  C CG  . HIS A 1 109 ? 25.782 7.520   -9.779  1.00 50.03  ? 150 HIS A CG  1 
ATOM   824  N ND1 . HIS A 1 109 ? 25.247 6.253   -9.704  1.00 59.88  ? 150 HIS A ND1 1 
ATOM   825  C CD2 . HIS A 1 109 ? 25.202 8.104   -10.851 1.00 58.09  ? 150 HIS A CD2 1 
ATOM   826  C CE1 . HIS A 1 109 ? 24.381 6.079   -10.679 1.00 55.35  ? 150 HIS A CE1 1 
ATOM   827  N NE2 . HIS A 1 109 ? 24.335 7.192   -11.391 1.00 56.54  ? 150 HIS A NE2 1 
ATOM   828  N N   . ILE A 1 110 ? 28.446 7.284   -6.177  1.00 51.85  ? 151 ILE A N   1 
ATOM   829  C CA  . ILE A 1 110 ? 29.615 7.556   -5.367  1.00 48.79  ? 151 ILE A CA  1 
ATOM   830  C C   . ILE A 1 110 ? 30.412 8.547   -6.174  1.00 51.90  ? 151 ILE A C   1 
ATOM   831  O O   . ILE A 1 110 ? 30.769 8.266   -7.327  1.00 65.66  ? 151 ILE A O   1 
ATOM   832  C CB  . ILE A 1 110 ? 30.431 6.261   -5.130  1.00 50.32  ? 151 ILE A CB  1 
ATOM   833  C CG1 . ILE A 1 110 ? 29.586 5.299   -4.279  1.00 47.23  ? 151 ILE A CG1 1 
ATOM   834  C CG2 . ILE A 1 110 ? 31.762 6.582   -4.445  1.00 44.76  ? 151 ILE A CG2 1 
ATOM   835  C CD1 . ILE A 1 110 ? 30.183 3.970   -4.102  1.00 51.79  ? 151 ILE A CD1 1 
ATOM   836  N N   . GLY A 1 111 ? 30.662 9.723   -5.615  1.00 48.73  ? 152 GLY A N   1 
ATOM   837  C CA  . GLY A 1 111 ? 31.414 10.713  -6.374  1.00 45.94  ? 152 GLY A CA  1 
ATOM   838  C C   . GLY A 1 111 ? 30.570 11.920  -6.734  1.00 43.79  ? 152 GLY A C   1 
ATOM   839  O O   . GLY A 1 111 ? 31.090 12.969  -7.134  1.00 45.00  ? 152 GLY A O   1 
ATOM   840  N N   . ASP A 1 112 ? 29.256 11.766  -6.637  1.00 44.55  ? 153 ASP A N   1 
ATOM   841  C CA  . ASP A 1 112 ? 28.363 12.905  -6.897  1.00 47.56  ? 153 ASP A CA  1 
ATOM   842  C C   . ASP A 1 112 ? 28.636 13.955  -5.843  1.00 44.34  ? 153 ASP A C   1 
ATOM   843  O O   . ASP A 1 112 ? 28.719 13.652  -4.630  1.00 47.66  ? 153 ASP A O   1 
ATOM   844  C CB  . ASP A 1 112 ? 26.880 12.524  -6.764  1.00 48.16  ? 153 ASP A CB  1 
ATOM   845  C CG  . ASP A 1 112 ? 26.346 11.778  -7.968  1.00 65.23  ? 153 ASP A CG  1 
ATOM   846  O OD1 . ASP A 1 112 ? 26.916 11.936  -9.079  1.00 64.80  ? 153 ASP A OD1 1 
ATOM   847  O OD2 . ASP A 1 112 ? 25.332 11.054  -7.798  1.00 64.79  ? 153 ASP A OD2 1 
ATOM   848  N N   . VAL A 1 113 ? 28.779 15.191  -6.297  1.00 49.91  ? 154 VAL A N   1 
ATOM   849  C CA  . VAL A 1 113 ? 28.994 16.303  -5.393  1.00 43.65  ? 154 VAL A CA  1 
ATOM   850  C C   . VAL A 1 113 ? 27.677 16.532  -4.651  1.00 44.44  ? 154 VAL A C   1 
ATOM   851  O O   . VAL A 1 113 ? 26.602 16.479  -5.218  1.00 40.20  ? 154 VAL A O   1 
ATOM   852  C CB  . VAL A 1 113 ? 29.401 17.573  -6.164  1.00 50.80  ? 154 VAL A CB  1 
ATOM   853  C CG1 . VAL A 1 113 ? 29.248 18.830  -5.261  1.00 42.79  ? 154 VAL A CG1 1 
ATOM   854  C CG2 . VAL A 1 113 ? 30.847 17.418  -6.648  1.00 47.35  ? 154 VAL A CG2 1 
ATOM   855  N N   . VAL A 1 114 ? 27.774 16.761  -3.359  1.00 43.53  ? 155 VAL A N   1 
ATOM   856  C CA  . VAL A 1 114 ? 26.594 16.986  -2.583  1.00 43.03  ? 155 VAL A CA  1 
ATOM   857  C C   . VAL A 1 114 ? 26.758 18.193  -1.654  1.00 41.15  ? 155 VAL A C   1 
ATOM   858  O O   . VAL A 1 114 ? 27.879 18.584  -1.285  1.00 42.68  ? 155 VAL A O   1 
ATOM   859  C CB  . VAL A 1 114 ? 26.247 15.721  -1.769  1.00 45.17  ? 155 VAL A CB  1 
ATOM   860  C CG1 . VAL A 1 114 ? 25.149 16.039  -0.869  1.00 61.94  ? 155 VAL A CG1 1 
ATOM   861  C CG2 . VAL A 1 114 ? 25.727 14.616  -2.669  1.00 41.90  ? 155 VAL A CG2 1 
ATOM   862  N N   . LEU A 1 115 ? 25.636 18.809  -1.308  1.00 45.91  ? 156 LEU A N   1 
ATOM   863  C CA  . LEU A 1 115 ? 25.636 19.960  -0.405  1.00 45.71  ? 156 LEU A CA  1 
ATOM   864  C C   . LEU A 1 115 ? 24.772 19.625  0.796   1.00 43.78  ? 156 LEU A C   1 
ATOM   865  O O   . LEU A 1 115 ? 23.624 19.176  0.626   1.00 44.44  ? 156 LEU A O   1 
ATOM   866  C CB  . LEU A 1 115 ? 25.054 21.171  -1.090  1.00 51.23  ? 156 LEU A CB  1 
ATOM   867  C CG  . LEU A 1 115 ? 25.687 21.749  -2.351  1.00 54.30  ? 156 LEU A CG  1 
ATOM   868  C CD1 . LEU A 1 115 ? 24.867 22.977  -2.740  1.00 57.92  ? 156 LEU A CD1 1 
ATOM   869  C CD2 . LEU A 1 115 ? 27.111 22.177  -2.114  1.00 50.90  ? 156 LEU A CD2 1 
ATOM   870  N N   . ALA A 1 116 ? 25.332 19.800  1.994   1.00 35.26  ? 157 ALA A N   1 
ATOM   871  C CA  . ALA A 1 116 ? 24.593 19.552  3.264   1.00 37.71  ? 157 ALA A CA  1 
ATOM   872  C C   . ALA A 1 116 ? 23.963 20.867  3.699   1.00 37.76  ? 157 ALA A C   1 
ATOM   873  O O   . ALA A 1 116 ? 24.664 21.877  3.808   1.00 40.92  ? 157 ALA A O   1 
ATOM   874  C CB  . ALA A 1 116 ? 25.561 19.028  4.387   1.00 35.60  ? 157 ALA A CB  1 
ATOM   875  N N   . ILE A 1 117 ? 22.650 20.867  3.921   1.00 43.69  ? 158 ILE A N   1 
ATOM   876  C CA  . ILE A 1 117 ? 21.923 22.085  4.333   1.00 40.60  ? 158 ILE A CA  1 
ATOM   877  C C   . ILE A 1 117 ? 21.345 21.945  5.753   1.00 45.28  ? 158 ILE A C   1 
ATOM   878  O O   . ILE A 1 117 ? 20.566 21.024  6.053   1.00 47.83  ? 158 ILE A O   1 
ATOM   879  C CB  . ILE A 1 117 ? 20.794 22.377  3.336   1.00 40.10  ? 158 ILE A CB  1 
ATOM   880  C CG1 . ILE A 1 117 ? 21.400 22.452  1.927   1.00 49.89  ? 158 ILE A CG1 1 
ATOM   881  C CG2 . ILE A 1 117 ? 20.088 23.686  3.679   1.00 23.60  ? 158 ILE A CG2 1 
ATOM   882  C CD1 . ILE A 1 117 ? 20.398 22.426  0.817   1.00 44.53  ? 158 ILE A CD1 1 
ATOM   883  N N   . GLY A 1 118 ? 21.741 22.863  6.621   1.00 46.38  ? 159 GLY A N   1 
ATOM   884  C CA  . GLY A 1 118 ? 21.312 22.813  8.011   1.00 46.88  ? 159 GLY A CA  1 
ATOM   885  C C   . GLY A 1 118 ? 21.707 23.978  8.906   1.00 43.98  ? 159 GLY A C   1 
ATOM   886  O O   . GLY A 1 118 ? 22.215 24.995  8.460   1.00 50.28  ? 159 GLY A O   1 
ATOM   887  N N   . ASN A 1 119 ? 21.494 23.806  10.200  1.00 50.94  ? 160 ASN A N   1 
ATOM   888  C CA  . ASN A 1 119 ? 21.742 24.864  11.177  1.00 46.48  ? 160 ASN A CA  1 
ATOM   889  C C   . ASN A 1 119 ? 22.829 24.479  12.153  1.00 51.92  ? 160 ASN A C   1 
ATOM   890  O O   . ASN A 1 119 ? 22.604 24.491  13.336  1.00 44.92  ? 160 ASN A O   1 
ATOM   891  C CB  . ASN A 1 119 ? 20.453 25.086  11.959  1.00 42.90  ? 160 ASN A CB  1 
ATOM   892  C CG  . ASN A 1 119 ? 20.439 26.376  12.742  1.00 50.53  ? 160 ASN A CG  1 
ATOM   893  O OD1 . ASN A 1 119 ? 19.553 26.577  13.578  1.00 56.53  ? 160 ASN A OD1 1 
ATOM   894  N ND2 . ASN A 1 119 ? 21.387 27.261  12.479  1.00 43.13  ? 160 ASN A ND2 1 
ATOM   895  N N   . PRO A 1 120 ? 24.031 24.156  11.682  1.00 54.11  ? 161 PRO A N   1 
ATOM   896  C CA  . PRO A 1 120 ? 25.037 23.784  12.694  1.00 57.25  ? 161 PRO A CA  1 
ATOM   897  C C   . PRO A 1 120 ? 25.171 24.775  13.869  1.00 54.77  ? 161 PRO A C   1 
ATOM   898  O O   . PRO A 1 120 ? 25.229 26.002  13.668  1.00 54.20  ? 161 PRO A O   1 
ATOM   899  C CB  . PRO A 1 120 ? 26.330 23.632  11.870  1.00 58.07  ? 161 PRO A CB  1 
ATOM   900  C CG  . PRO A 1 120 ? 26.129 24.596  10.740  1.00 65.26  ? 161 PRO A CG  1 
ATOM   901  C CD  . PRO A 1 120 ? 24.642 24.413  10.371  1.00 58.17  ? 161 PRO A CD  1 
ATOM   902  N N   . TYR A 1 121 ? 25.200 24.246  15.094  1.00 50.92  ? 162 TYR A N   1 
ATOM   903  C CA  . TYR A 1 121 ? 25.316 25.098  16.285  1.00 47.72  ? 162 TYR A CA  1 
ATOM   904  C C   . TYR A 1 121 ? 24.369 26.303  16.363  1.00 47.66  ? 162 TYR A C   1 
ATOM   905  O O   . TYR A 1 121 ? 24.629 27.268  17.093  1.00 45.70  ? 162 TYR A O   1 
ATOM   906  C CB  . TYR A 1 121 ? 26.736 25.617  16.428  1.00 44.42  ? 162 TYR A CB  1 
ATOM   907  C CG  . TYR A 1 121 ? 27.772 24.512  16.456  1.00 62.52  ? 162 TYR A CG  1 
ATOM   908  C CD1 . TYR A 1 121 ? 28.498 24.190  15.318  1.00 58.58  ? 162 TYR A CD1 1 
ATOM   909  C CD2 . TYR A 1 121 ? 28.002 23.767  17.612  1.00 58.97  ? 162 TYR A CD2 1 
ATOM   910  C CE1 . TYR A 1 121 ? 29.416 23.166  15.325  1.00 52.54  ? 162 TYR A CE1 1 
ATOM   911  C CE2 . TYR A 1 121 ? 28.925 22.732  17.624  1.00 57.82  ? 162 TYR A CE2 1 
ATOM   912  C CZ  . TYR A 1 121 ? 29.631 22.433  16.468  1.00 57.51  ? 162 TYR A CZ  1 
ATOM   913  O OH  . TYR A 1 121 ? 30.543 21.380  16.437  1.00 59.64  ? 162 TYR A OH  1 
ATOM   914  N N   . ASN A 1 122 ? 23.275 26.253  15.618  1.00 52.70  ? 163 ASN A N   1 
ATOM   915  C CA  . ASN A 1 122 ? 22.309 27.342  15.610  1.00 51.68  ? 163 ASN A CA  1 
ATOM   916  C C   . ASN A 1 122 ? 22.935 28.632  15.089  1.00 50.51  ? 163 ASN A C   1 
ATOM   917  O O   . ASN A 1 122 ? 22.557 29.733  15.489  1.00 50.52  ? 163 ASN A O   1 
ATOM   918  C CB  . ASN A 1 122 ? 21.765 27.567  17.018  1.00 53.03  ? 163 ASN A CB  1 
ATOM   919  C CG  . ASN A 1 122 ? 20.432 28.279  17.020  1.00 56.64  ? 163 ASN A CG  1 
ATOM   920  O OD1 . ASN A 1 122 ? 20.041 28.843  18.033  1.00 63.99  ? 163 ASN A OD1 1 
ATOM   921  N ND2 . ASN A 1 122 ? 19.717 28.249  15.895  1.00 45.43  ? 163 ASN A ND2 1 
ATOM   922  N N   . LEU A 1 123 ? 23.886 28.512  14.180  1.00 50.58  ? 164 LEU A N   1 
ATOM   923  C CA  . LEU A 1 123 ? 24.522 29.722  13.632  1.00 58.80  ? 164 LEU A CA  1 
ATOM   924  C C   . LEU A 1 123 ? 23.647 30.288  12.543  1.00 51.32  ? 164 LEU A C   1 
ATOM   925  O O   . LEU A 1 123 ? 23.863 31.406  12.077  1.00 49.42  ? 164 LEU A O   1 
ATOM   926  C CB  . LEU A 1 123 ? 25.892 29.400  13.006  1.00 59.77  ? 164 LEU A CB  1 
ATOM   927  C CG  . LEU A 1 123 ? 26.902 28.817  13.991  1.00 63.05  ? 164 LEU A CG  1 
ATOM   928  C CD1 . LEU A 1 123 ? 28.130 28.254  13.250  1.00 66.34  ? 164 LEU A CD1 1 
ATOM   929  C CD2 . LEU A 1 123 ? 27.264 29.910  14.981  1.00 50.97  ? 164 LEU A CD2 1 
ATOM   930  N N   . GLY A 1 124 ? 22.635 29.510  12.170  1.00 50.13  ? 165 GLY A N   1 
ATOM   931  C CA  . GLY A 1 124 ? 21.761 29.901  11.083  1.00 53.10  ? 165 GLY A CA  1 
ATOM   932  C C   . GLY A 1 124 ? 22.063 28.926  9.959   1.00 51.46  ? 165 GLY A C   1 
ATOM   933  O O   . GLY A 1 124 ? 23.052 28.186  10.008  1.00 53.49  ? 165 GLY A O   1 
ATOM   934  N N   . GLN A 1 125 ? 21.225 28.917  8.941   1.00 54.69  ? 166 GLN A N   1 
ATOM   935  C CA  . GLN A 1 125 ? 21.410 28.003  7.835   1.00 51.44  ? 166 GLN A CA  1 
ATOM   936  C C   . GLN A 1 125 ? 22.805 28.076  7.204   1.00 46.34  ? 166 GLN A C   1 
ATOM   937  O O   . GLN A 1 125 ? 23.283 29.145  6.863   1.00 43.47  ? 166 GLN A O   1 
ATOM   938  C CB  . GLN A 1 125 ? 20.312 28.253  6.801   1.00 46.15  ? 166 GLN A CB  1 
ATOM   939  C CG  . GLN A 1 125 ? 20.555 27.558  5.484   1.00 58.54  ? 166 GLN A CG  1 
ATOM   940  C CD  . GLN A 1 125 ? 19.330 27.533  4.592   1.00 53.68  ? 166 GLN A CD  1 
ATOM   941  O OE1 . GLN A 1 125 ? 18.421 26.712  4.774   1.00 44.61  ? 166 GLN A OE1 1 
ATOM   942  N NE2 . GLN A 1 125 ? 19.297 28.436  3.626   1.00 46.90  ? 166 GLN A NE2 1 
ATOM   943  N N   . THR A 1 126 ? 23.496 26.948  7.096   1.00 41.78  ? 167 THR A N   1 
ATOM   944  C CA  . THR A 1 126 ? 24.803 27.010  6.463   1.00 43.83  ? 167 THR A CA  1 
ATOM   945  C C   . THR A 1 126 ? 24.853 25.862  5.497   1.00 43.97  ? 167 THR A C   1 
ATOM   946  O O   . THR A 1 126 ? 24.152 24.863  5.682   1.00 38.68  ? 167 THR A O   1 
ATOM   947  C CB  . THR A 1 126 ? 25.974 26.904  7.450   1.00 47.35  ? 167 THR A CB  1 
ATOM   948  O OG1 . THR A 1 126 ? 26.382 25.536  7.593   1.00 52.70  ? 167 THR A OG1 1 
ATOM   949  C CG2 . THR A 1 126 ? 25.592 27.480  8.778   1.00 32.87  ? 167 THR A CG2 1 
ATOM   950  N N   . ILE A 1 127 ? 25.646 26.030  4.442   1.00 43.14  ? 168 ILE A N   1 
ATOM   951  C CA  . ILE A 1 127 ? 25.775 25.005  3.399   1.00 44.23  ? 168 ILE A CA  1 
ATOM   952  C C   . ILE A 1 127 ? 27.217 24.524  3.423   1.00 42.46  ? 168 ILE A C   1 
ATOM   953  O O   . ILE A 1 127 ? 28.120 25.336  3.551   1.00 44.10  ? 168 ILE A O   1 
ATOM   954  C CB  . ILE A 1 127 ? 25.563 25.602  1.964   1.00 42.51  ? 168 ILE A CB  1 
ATOM   955  C CG1 . ILE A 1 127 ? 24.359 26.565  1.939   1.00 41.95  ? 168 ILE A CG1 1 
ATOM   956  C CG2 . ILE A 1 127 ? 25.515 24.458  0.948   1.00 37.03  ? 168 ILE A CG2 1 
ATOM   957  C CD1 . ILE A 1 127 ? 22.990 25.925  1.695   1.00 39.03  ? 168 ILE A CD1 1 
ATOM   958  N N   . THR A 1 128 ? 27.436 23.224  3.297   1.00 47.48  ? 169 THR A N   1 
ATOM   959  C CA  . THR A 1 128 ? 28.805 22.692  3.230   1.00 47.70  ? 169 THR A CA  1 
ATOM   960  C C   . THR A 1 128 ? 28.838 21.738  2.046   1.00 42.34  ? 169 THR A C   1 
ATOM   961  O O   . THR A 1 128 ? 27.778 21.210  1.675   1.00 44.46  ? 169 THR A O   1 
ATOM   962  C CB  . THR A 1 128 ? 29.213 21.923  4.532   1.00 45.21  ? 169 THR A CB  1 
ATOM   963  O OG1 . THR A 1 128 ? 28.136 21.091  4.998   1.00 44.85  ? 169 THR A OG1 1 
ATOM   964  C CG2 . THR A 1 128 ? 29.614 22.894  5.611   1.00 42.35  ? 169 THR A CG2 1 
ATOM   965  N N   . GLN A 1 129 ? 29.993 21.555  1.390   1.00 44.56  ? 170 GLN A N   1 
ATOM   966  C CA  . GLN A 1 129 ? 30.015 20.560  0.308   1.00 43.68  ? 170 GLN A CA  1 
ATOM   967  C C   . GLN A 1 129 ? 31.105 19.512  0.335   1.00 42.68  ? 170 GLN A C   1 
ATOM   968  O O   . GLN A 1 129 ? 32.180 19.696  0.859   1.00 40.65  ? 170 GLN A O   1 
ATOM   969  C CB  . GLN A 1 129 ? 29.931 21.179  -1.106  1.00 47.37  ? 170 GLN A CB  1 
ATOM   970  C CG  . GLN A 1 129 ? 31.154 21.790  -1.775  1.00 50.72  ? 170 GLN A CG  1 
ATOM   971  C CD  . GLN A 1 129 ? 32.271 20.835  -2.262  1.00 42.95  ? 170 GLN A CD  1 
ATOM   972  O OE1 . GLN A 1 129 ? 32.060 19.683  -2.692  1.00 41.32  ? 170 GLN A OE1 1 
ATOM   973  N NE2 . GLN A 1 129 ? 33.490 21.361  -2.217  1.00 41.66  ? 170 GLN A NE2 1 
ATOM   974  N N   . GLY A 1 130 ? 30.752 18.365  -0.212  1.00 43.93  ? 171 GLY A N   1 
ATOM   975  C CA  . GLY A 1 130 ? 31.673 17.254  -0.326  1.00 45.11  ? 171 GLY A CA  1 
ATOM   976  C C   . GLY A 1 130 ? 31.120 16.421  -1.465  1.00 47.76  ? 171 GLY A C   1 
ATOM   977  O O   . GLY A 1 130 ? 30.602 16.946  -2.452  1.00 39.04  ? 171 GLY A O   1 
ATOM   978  N N   . ILE A 1 131 ? 31.195 15.114  -1.310  1.00 43.17  ? 172 ILE A N   1 
ATOM   979  C CA  . ILE A 1 131 ? 30.698 14.200  -2.317  1.00 47.36  ? 172 ILE A CA  1 
ATOM   980  C C   . ILE A 1 131 ? 30.023 13.028  -1.587  1.00 43.27  ? 172 ILE A C   1 
ATOM   981  O O   . ILE A 1 131 ? 30.037 12.956  -0.352  1.00 37.96  ? 172 ILE A O   1 
ATOM   982  C CB  . ILE A 1 131 ? 31.875 13.649  -3.161  1.00 42.04  ? 172 ILE A CB  1 
ATOM   983  C CG1 . ILE A 1 131 ? 32.867 12.962  -2.213  1.00 45.43  ? 172 ILE A CG1 1 
ATOM   984  C CG2 . ILE A 1 131 ? 32.594 14.785  -3.909  1.00 36.29  ? 172 ILE A CG2 1 
ATOM   985  C CD1 . ILE A 1 131 ? 33.766 11.952  -2.901  1.00 54.45  ? 172 ILE A CD1 1 
ATOM   986  N N   . ILE A 1 132 ? 29.394 12.156  -2.367  1.00 43.66  ? 173 ILE A N   1 
ATOM   987  C CA  . ILE A 1 132 ? 28.808 10.929  -1.827  1.00 49.81  ? 173 ILE A CA  1 
ATOM   988  C C   . ILE A 1 132 ? 30.044 9.998   -1.760  1.00 53.61  ? 173 ILE A C   1 
ATOM   989  O O   . ILE A 1 132 ? 30.643 9.663   -2.819  1.00 34.48  ? 173 ILE A O   1 
ATOM   990  C CB  . ILE A 1 132 ? 27.772 10.328  -2.794  1.00 47.42  ? 173 ILE A CB  1 
ATOM   991  C CG1 . ILE A 1 132 ? 26.560 11.258  -2.902  1.00 50.39  ? 173 ILE A CG1 1 
ATOM   992  C CG2 . ILE A 1 132 ? 27.384 8.953   -2.334  1.00 43.67  ? 173 ILE A CG2 1 
ATOM   993  C CD1 . ILE A 1 132 ? 25.393 10.674  -3.696  1.00 52.37  ? 173 ILE A CD1 1 
ATOM   994  N N   . SER A 1 133 ? 30.428 9.634   -0.523  1.00 51.68  ? 174 SER A N   1 
ATOM   995  C CA  . SER A 1 133 ? 31.614 8.796   -0.222  1.00 50.59  ? 174 SER A CA  1 
ATOM   996  C C   . SER A 1 133 ? 31.388 7.303   -0.361  1.00 51.48  ? 174 SER A C   1 
ATOM   997  O O   . SER A 1 133 ? 32.321 6.554   -0.688  1.00 44.05  ? 174 SER A O   1 
ATOM   998  C CB  . SER A 1 133 ? 32.078 9.012   1.223   1.00 56.52  ? 174 SER A CB  1 
ATOM   999  O OG  . SER A 1 133 ? 32.488 10.337  1.477   1.00 56.06  ? 174 SER A OG  1 
ATOM   1000 N N   . ALA A 1 134 ? 30.149 6.891   -0.065  1.00 50.92  ? 175 ALA A N   1 
ATOM   1001 C CA  . ALA A 1 134 ? 29.718 5.505   -0.094  1.00 41.73  ? 175 ALA A CA  1 
ATOM   1002 C C   . ALA A 1 134 ? 28.193 5.435   -0.079  1.00 46.52  ? 175 ALA A C   1 
ATOM   1003 O O   . ALA A 1 134 ? 27.524 6.434   0.172   1.00 49.94  ? 175 ALA A O   1 
ATOM   1004 C CB  . ALA A 1 134 ? 30.266 4.769   1.140   1.00 49.10  ? 175 ALA A CB  1 
ATOM   1005 N N   . THR A 1 135 ? 27.660 4.232   -0.301  1.00 49.79  ? 176 THR A N   1 
ATOM   1006 C CA  . THR A 1 135 ? 26.223 3.968   -0.327  1.00 57.78  ? 176 THR A CA  1 
ATOM   1007 C C   . THR A 1 135 ? 26.047 2.616   0.380   1.00 65.36  ? 176 THR A C   1 
ATOM   1008 O O   . THR A 1 135 ? 27.033 1.938   0.636   1.00 65.75  ? 176 THR A O   1 
ATOM   1009 C CB  . THR A 1 135 ? 25.723 3.896   -1.787  1.00 54.19  ? 176 THR A CB  1 
ATOM   1010 O OG1 . THR A 1 135 ? 26.555 2.997   -2.523  1.00 61.45  ? 176 THR A OG1 1 
ATOM   1011 C CG2 . THR A 1 135 ? 25.816 5.240   -2.457  1.00 48.27  ? 176 THR A CG2 1 
ATOM   1012 N N   . GLY A 1 136 ? 24.810 2.222   0.688   1.00 74.35  ? 177 GLY A N   1 
ATOM   1013 C CA  . GLY A 1 136 ? 24.578 0.973   1.418   1.00 79.10  ? 177 GLY A CA  1 
ATOM   1014 C C   . GLY A 1 136 ? 25.566 0.905   2.580   1.00 80.16  ? 177 GLY A C   1 
ATOM   1015 O O   . GLY A 1 136 ? 26.468 0.081   2.583   1.00 86.04  ? 177 GLY A O   1 
ATOM   1016 N N   . ARG A 1 137 ? 25.384 1.743   3.593   1.00 83.25  ? 178 ARG A N   1 
ATOM   1017 C CA  . ARG A 1 137 ? 26.348 1.779   4.683   1.00 87.43  ? 178 ARG A CA  1 
ATOM   1018 C C   . ARG A 1 137 ? 25.866 1.647   6.115   1.00 93.17  ? 178 ARG A C   1 
ATOM   1019 O O   . ARG A 1 137 ? 24.680 1.439   6.406   1.00 91.81  ? 178 ARG A O   1 
ATOM   1020 C CB  . ARG A 1 137 ? 27.188 3.069   4.566   1.00 82.21  ? 178 ARG A CB  1 
ATOM   1021 C CG  . ARG A 1 137 ? 28.592 3.032   5.175   1.00 80.55  ? 178 ARG A CG  1 
ATOM   1022 C CD  . ARG A 1 137 ? 29.545 2.145   4.362   1.00 81.74  ? 178 ARG A CD  1 
ATOM   1023 N NE  . ARG A 1 137 ? 30.847 2.783   4.213   1.00 81.22  ? 178 ARG A NE  1 
ATOM   1024 C CZ  . ARG A 1 137 ? 31.750 2.457   3.289   1.00 80.55  ? 178 ARG A CZ  1 
ATOM   1025 N NH1 . ARG A 1 137 ? 31.508 1.476   2.418   1.00 77.20  ? 178 ARG A NH1 1 
ATOM   1026 N NH2 . ARG A 1 137 ? 32.886 3.147   3.207   1.00 70.84  ? 178 ARG A NH2 1 
ATOM   1027 N N   . ILE A 1 138 ? 26.882 1.800   6.964   1.00 104.10 ? 179 ILE A N   1 
ATOM   1028 C CA  . ILE A 1 138 ? 26.868 1.754   8.408   1.00 111.89 ? 179 ILE A CA  1 
ATOM   1029 C C   . ILE A 1 138 ? 27.345 0.431   9.012   1.00 119.92 ? 179 ILE A C   1 
ATOM   1030 O O   . ILE A 1 138 ? 26.810 -0.641  8.740   1.00 119.18 ? 179 ILE A O   1 
ATOM   1031 C CB  . ILE A 1 138 ? 25.496 2.190   8.985   1.00 108.94 ? 179 ILE A CB  1 
ATOM   1032 C CG1 . ILE A 1 138 ? 25.729 3.308   10.043  1.00 103.22 ? 179 ILE A CG1 1 
ATOM   1033 C CG2 . ILE A 1 138 ? 24.742 1.016   9.553   1.00 102.01 ? 179 ILE A CG2 1 
ATOM   1034 C CD1 . ILE A 1 138 ? 26.955 3.121   10.985  1.00 89.47  ? 179 ILE A CD1 1 
ATOM   1035 N N   . GLY A 1 139 ? 28.403 0.558   9.813   1.00 126.76 ? 180 GLY A N   1 
ATOM   1036 C CA  . GLY A 1 139 ? 29.069 -0.553  10.488  1.00 132.22 ? 180 GLY A CA  1 
ATOM   1037 C C   . GLY A 1 139 ? 28.602 -1.992  10.345  1.00 136.62 ? 180 GLY A C   1 
ATOM   1038 O O   . GLY A 1 139 ? 27.456 -2.285  10.007  1.00 137.40 ? 180 GLY A O   1 
ATOM   1039 N N   . LEU A 1 140 ? 29.519 -2.913  10.622  1.00 140.06 ? 181 LEU A N   1 
ATOM   1040 C CA  . LEU A 1 140 ? 29.196 -4.334  10.564  1.00 141.83 ? 181 LEU A CA  1 
ATOM   1041 C C   . LEU A 1 140 ? 28.690 -4.731  11.947  1.00 143.16 ? 181 LEU A C   1 
ATOM   1042 O O   . LEU A 1 140 ? 28.547 -5.916  12.254  1.00 144.56 ? 181 LEU A O   1 
ATOM   1043 C CB  . LEU A 1 140 ? 30.432 -5.143  10.172  1.00 141.15 ? 181 LEU A CB  1 
ATOM   1044 C CG  . LEU A 1 140 ? 31.291 -4.549  9.043   1.00 140.66 ? 181 LEU A CG  1 
ATOM   1045 C CD1 . LEU A 1 140 ? 32.535 -5.397  8.954   1.00 137.90 ? 181 LEU A CD1 1 
ATOM   1046 C CD2 . LEU A 1 140 ? 30.580 -4.492  7.677   1.00 140.97 ? 181 LEU A CD2 1 
ATOM   1047 N N   . ASN A 1 141 ? 28.410 -3.712  12.767  1.00 144.08 ? 182 ASN A N   1 
ATOM   1048 C CA  . ASN A 1 141 ? 27.903 -3.881  14.142  1.00 143.96 ? 182 ASN A CA  1 
ATOM   1049 C C   . ASN A 1 141 ? 26.500 -3.302  14.283  1.00 144.80 ? 182 ASN A C   1 
ATOM   1050 O O   . ASN A 1 141 ? 26.286 -2.358  15.048  1.00 145.66 ? 182 ASN A O   1 
ATOM   1051 C CB  . ASN A 1 141 ? 28.814 -3.153  15.128  1.00 143.26 ? 182 ASN A CB  1 
ATOM   1052 C CG  . ASN A 1 141 ? 29.029 -1.701  14.747  1.00 143.02 ? 182 ASN A CG  1 
ATOM   1053 O OD1 . ASN A 1 141 ? 29.542 -1.409  13.669  1.00 143.07 ? 182 ASN A OD1 1 
ATOM   1054 N ND2 . ASN A 1 141 ? 28.635 -0.783  15.627  1.00 142.58 ? 182 ASN A ND2 1 
ATOM   1055 N N   . PRO A 1 142 ? 25.524 -3.860  13.552  1.00 145.19 ? 183 PRO A N   1 
ATOM   1056 C CA  . PRO A 1 142 ? 24.143 -3.381  13.606  1.00 146.21 ? 183 PRO A CA  1 
ATOM   1057 C C   . PRO A 1 142 ? 23.328 -3.894  14.802  1.00 147.32 ? 183 PRO A C   1 
ATOM   1058 O O   . PRO A 1 142 ? 23.872 -4.410  15.786  1.00 147.23 ? 183 PRO A O   1 
ATOM   1059 C CB  . PRO A 1 142 ? 23.567 -3.863  12.279  1.00 145.44 ? 183 PRO A CB  1 
ATOM   1060 C CG  . PRO A 1 142 ? 24.254 -5.174  12.092  1.00 144.45 ? 183 PRO A CG  1 
ATOM   1061 C CD  . PRO A 1 142 ? 25.680 -4.885  12.504  1.00 144.51 ? 183 PRO A CD  1 
ATOM   1062 N N   . THR A 1 143 ? 22.012 -3.730  14.687  1.00 149.85 ? 184 THR A N   1 
ATOM   1063 C CA  . THR A 1 143 ? 21.021 -4.124  15.691  1.00 152.28 ? 184 THR A CA  1 
ATOM   1064 C C   . THR A 1 143 ? 19.735 -4.282  14.886  1.00 151.85 ? 184 THR A C   1 
ATOM   1065 O O   . THR A 1 143 ? 19.192 -5.381  14.760  1.00 150.74 ? 184 THR A O   1 
ATOM   1066 C CB  . THR A 1 143 ? 20.836 -3.006  16.751  1.00 154.00 ? 184 THR A CB  1 
ATOM   1067 O OG1 . THR A 1 143 ? 21.858 -3.129  17.749  1.00 155.10 ? 184 THR A OG1 1 
ATOM   1068 C CG2 . THR A 1 143 ? 19.466 -3.094  17.404  1.00 154.68 ? 184 THR A CG2 1 
ATOM   1069 N N   . GLY A 1 144 ? 19.268 -3.152  14.356  1.00 151.62 ? 185 GLY A N   1 
ATOM   1070 C CA  . GLY A 1 144 ? 18.084 -3.091  13.516  1.00 149.66 ? 185 GLY A CA  1 
ATOM   1071 C C   . GLY A 1 144 ? 18.619 -2.430  12.260  1.00 148.84 ? 185 GLY A C   1 
ATOM   1072 O O   . GLY A 1 144 ? 19.152 -1.317  12.326  1.00 148.98 ? 185 GLY A O   1 
ATOM   1073 N N   . ARG A 1 145 ? 18.476 -3.090  11.114  1.00 147.06 ? 186 ARG A N   1 
ATOM   1074 C CA  . ARG A 1 145 ? 19.039 -2.548  9.882   1.00 143.31 ? 186 ARG A CA  1 
ATOM   1075 C C   . ARG A 1 145 ? 18.259 -1.569  9.019   1.00 141.61 ? 186 ARG A C   1 
ATOM   1076 O O   . ARG A 1 145 ? 17.066 -1.736  8.765   1.00 140.71 ? 186 ARG A O   1 
ATOM   1077 C CB  . ARG A 1 145 ? 19.520 -3.682  8.985   1.00 140.75 ? 186 ARG A CB  1 
ATOM   1078 C CG  . ARG A 1 145 ? 20.750 -3.292  8.200   1.00 137.54 ? 186 ARG A CG  1 
ATOM   1079 C CD  . ARG A 1 145 ? 21.987 -3.439  9.074   1.00 139.10 ? 186 ARG A CD  1 
ATOM   1080 N NE  . ARG A 1 145 ? 21.829 -2.837  10.398  1.00 141.98 ? 186 ARG A NE  1 
ATOM   1081 C CZ  . ARG A 1 145 ? 21.934 -1.535  10.658  1.00 144.40 ? 186 ARG A CZ  1 
ATOM   1082 N NH1 . ARG A 1 145 ? 22.199 -0.673  9.681   1.00 145.84 ? 186 ARG A NH1 1 
ATOM   1083 N NH2 . ARG A 1 145 ? 21.782 -1.095  11.904  1.00 143.18 ? 186 ARG A NH2 1 
ATOM   1084 N N   . GLN A 1 146 ? 19.002 -0.559  8.564   1.00 138.41 ? 187 GLN A N   1 
ATOM   1085 C CA  . GLN A 1 146 ? 18.555 0.530   7.692   1.00 132.57 ? 187 GLN A CA  1 
ATOM   1086 C C   . GLN A 1 146 ? 19.862 1.176   7.226   1.00 127.48 ? 187 GLN A C   1 
ATOM   1087 O O   . GLN A 1 146 ? 20.557 1.810   8.018   1.00 130.46 ? 187 GLN A O   1 
ATOM   1088 C CB  . GLN A 1 146 ? 17.708 1.539   8.468   1.00 134.06 ? 187 GLN A CB  1 
ATOM   1089 C CG  . GLN A 1 146 ? 16.367 0.982   8.931   1.00 141.36 ? 187 GLN A CG  1 
ATOM   1090 C CD  . GLN A 1 146 ? 15.473 0.571   7.764   1.00 145.13 ? 187 GLN A CD  1 
ATOM   1091 O OE1 . GLN A 1 146 ? 15.920 -0.099  6.832   1.00 141.64 ? 187 GLN A OE1 1 
ATOM   1092 N NE2 . GLN A 1 146 ? 14.200 0.964   7.818   1.00 148.97 ? 187 GLN A NE2 1 
ATOM   1093 N N   . ASN A 1 147 ? 20.202 1.006   5.950   1.00 117.47 ? 188 ASN A N   1 
ATOM   1094 C CA  . ASN A 1 147 ? 21.460 1.528   5.424   1.00 108.51 ? 188 ASN A CA  1 
ATOM   1095 C C   . ASN A 1 147 ? 21.484 2.988   4.985   1.00 99.51  ? 188 ASN A C   1 
ATOM   1096 O O   . ASN A 1 147 ? 20.494 3.541   4.516   1.00 97.06  ? 188 ASN A O   1 
ATOM   1097 C CB  . ASN A 1 147 ? 21.961 0.598   4.316   1.00 112.96 ? 188 ASN A CB  1 
ATOM   1098 C CG  . ASN A 1 147 ? 22.364 -0.778  4.858   1.00 115.29 ? 188 ASN A CG  1 
ATOM   1099 O OD1 . ASN A 1 147 ? 21.697 -1.329  5.738   1.00 120.21 ? 188 ASN A OD1 1 
ATOM   1100 N ND2 . ASN A 1 147 ? 23.450 -1.335  4.331   1.00 114.50 ? 188 ASN A ND2 1 
ATOM   1101 N N   . PHE A 1 148 ? 22.656 3.592   5.145   1.00 88.61  ? 189 PHE A N   1 
ATOM   1102 C CA  . PHE A 1 148 ? 22.867 4.995   4.861   1.00 74.43  ? 189 PHE A CA  1 
ATOM   1103 C C   . PHE A 1 148 ? 23.652 5.364   3.621   1.00 67.17  ? 189 PHE A C   1 
ATOM   1104 O O   . PHE A 1 148 ? 24.088 4.533   2.831   1.00 64.94  ? 189 PHE A O   1 
ATOM   1105 C CB  . PHE A 1 148 ? 23.606 5.640   6.024   1.00 72.32  ? 189 PHE A CB  1 
ATOM   1106 C CG  . PHE A 1 148 ? 22.923 5.494   7.340   1.00 81.89  ? 189 PHE A CG  1 
ATOM   1107 C CD1 . PHE A 1 148 ? 22.898 4.269   7.994   1.00 82.05  ? 189 PHE A CD1 1 
ATOM   1108 C CD2 . PHE A 1 148 ? 22.341 6.601   7.957   1.00 83.59  ? 189 PHE A CD2 1 
ATOM   1109 C CE1 . PHE A 1 148 ? 22.304 4.141   9.255   1.00 85.86  ? 189 PHE A CE1 1 
ATOM   1110 C CE2 . PHE A 1 148 ? 21.746 6.487   9.218   1.00 88.58  ? 189 PHE A CE2 1 
ATOM   1111 C CZ  . PHE A 1 148 ? 21.730 5.253   9.869   1.00 88.02  ? 189 PHE A CZ  1 
ATOM   1112 N N   . LEU A 1 149 ? 23.837 6.667   3.505   1.00 59.28  ? 190 LEU A N   1 
ATOM   1113 C CA  . LEU A 1 149 ? 24.629 7.286   2.462   1.00 56.04  ? 190 LEU A CA  1 
ATOM   1114 C C   . LEU A 1 149 ? 25.786 7.869   3.276   1.00 48.46  ? 190 LEU A C   1 
ATOM   1115 O O   . LEU A 1 149 ? 25.588 8.347   4.391   1.00 52.75  ? 190 LEU A O   1 
ATOM   1116 C CB  . LEU A 1 149 ? 23.831 8.412   1.821   1.00 55.59  ? 190 LEU A CB  1 
ATOM   1117 C CG  . LEU A 1 149 ? 23.890 8.635   0.312   1.00 59.46  ? 190 LEU A CG  1 
ATOM   1118 C CD1 . LEU A 1 149 ? 23.906 7.324   -0.469  1.00 69.21  ? 190 LEU A CD1 1 
ATOM   1119 C CD2 . LEU A 1 149 ? 22.683 9.441   -0.061  1.00 45.44  ? 190 LEU A CD2 1 
ATOM   1120 N N   . GLN A 1 150 ? 27.003 7.782   2.779   1.00 46.71  ? 191 GLN A N   1 
ATOM   1121 C CA  . GLN A 1 150 ? 28.106 8.387   3.520   1.00 38.99  ? 191 GLN A CA  1 
ATOM   1122 C C   . GLN A 1 150 ? 28.636 9.580   2.708   1.00 44.12  ? 191 GLN A C   1 
ATOM   1123 O O   . GLN A 1 150 ? 28.699 9.533   1.455   1.00 47.84  ? 191 GLN A O   1 
ATOM   1124 C CB  . GLN A 1 150 ? 29.184 7.358   3.746   1.00 51.18  ? 191 GLN A CB  1 
ATOM   1125 C CG  . GLN A 1 150 ? 30.096 7.697   4.869   1.00 52.04  ? 191 GLN A CG  1 
ATOM   1126 C CD  . GLN A 1 150 ? 31.148 6.661   5.004   1.00 50.85  ? 191 GLN A CD  1 
ATOM   1127 O OE1 . GLN A 1 150 ? 30.838 5.463   5.054   1.00 51.08  ? 191 GLN A OE1 1 
ATOM   1128 N NE2 . GLN A 1 150 ? 32.405 7.092   5.065   1.00 45.57  ? 191 GLN A NE2 1 
ATOM   1129 N N   . THR A 1 151 ? 29.010 10.654  3.403   1.00 40.97  ? 192 THR A N   1 
ATOM   1130 C CA  . THR A 1 151 ? 29.460 11.869  2.725   1.00 43.06  ? 192 THR A CA  1 
ATOM   1131 C C   . THR A 1 151 ? 30.526 12.573  3.526   1.00 46.99  ? 192 THR A C   1 
ATOM   1132 O O   . THR A 1 151 ? 30.602 12.400  4.744   1.00 48.64  ? 192 THR A O   1 
ATOM   1133 C CB  . THR A 1 151 ? 28.241 12.881  2.493   1.00 50.15  ? 192 THR A CB  1 
ATOM   1134 O OG1 . THR A 1 151 ? 28.717 14.106  1.922   1.00 52.54  ? 192 THR A OG1 1 
ATOM   1135 C CG2 . THR A 1 151 ? 27.539 13.214  3.819   1.00 44.31  ? 192 THR A CG2 1 
ATOM   1136 N N   . ASP A 1 152 ? 31.353 13.362  2.840   1.00 46.79  ? 193 ASP A N   1 
ATOM   1137 C CA  . ASP A 1 152 ? 32.403 14.114  3.517   1.00 39.74  ? 193 ASP A CA  1 
ATOM   1138 C C   . ASP A 1 152 ? 32.074 15.600  3.594   1.00 41.23  ? 193 ASP A C   1 
ATOM   1139 O O   . ASP A 1 152 ? 32.901 16.428  3.947   1.00 43.60  ? 193 ASP A O   1 
ATOM   1140 C CB  . ASP A 1 152 ? 33.781 13.851  2.880   1.00 48.33  ? 193 ASP A CB  1 
ATOM   1141 C CG  . ASP A 1 152 ? 33.931 14.425  1.479   1.00 56.52  ? 193 ASP A CG  1 
ATOM   1142 O OD1 . ASP A 1 152 ? 32.921 14.658  0.783   1.00 59.46  ? 193 ASP A OD1 1 
ATOM   1143 O OD2 . ASP A 1 152 ? 35.098 14.627  1.070   1.00 57.47  ? 193 ASP A OD2 1 
ATOM   1144 N N   . ALA A 1 153 ? 30.838 15.928  3.237   1.00 41.47  ? 194 ALA A N   1 
ATOM   1145 C CA  . ALA A 1 153 ? 30.324 17.292  3.394   1.00 39.99  ? 194 ALA A CA  1 
ATOM   1146 C C   . ALA A 1 153 ? 30.266 17.540  4.932   1.00 41.45  ? 194 ALA A C   1 
ATOM   1147 O O   . ALA A 1 153 ? 29.602 16.803  5.678   1.00 41.41  ? 194 ALA A O   1 
ATOM   1148 C CB  . ALA A 1 153 ? 28.942 17.361  2.829   1.00 31.30  ? 194 ALA A CB  1 
ATOM   1149 N N   . SER A 1 154 ? 30.940 18.565  5.417   1.00 43.05  ? 195 SER A N   1 
ATOM   1150 C CA  . SER A 1 154 ? 30.927 18.813  6.860   1.00 46.03  ? 195 SER A CA  1 
ATOM   1151 C C   . SER A 1 154 ? 29.552 18.840  7.527   1.00 39.44  ? 195 SER A C   1 
ATOM   1152 O O   . SER A 1 154 ? 28.746 19.710  7.262   1.00 40.81  ? 195 SER A O   1 
ATOM   1153 C CB  . SER A 1 154 ? 31.647 20.131  7.183   1.00 48.12  ? 195 SER A CB  1 
ATOM   1154 O OG  . SER A 1 154 ? 33.036 20.022  6.936   1.00 60.24  ? 195 SER A OG  1 
ATOM   1155 N N   . ILE A 1 155 ? 29.325 17.895  8.420   1.00 48.40  ? 196 ILE A N   1 
ATOM   1156 C CA  . ILE A 1 155 ? 28.091 17.806  9.207   1.00 52.50  ? 196 ILE A CA  1 
ATOM   1157 C C   . ILE A 1 155 ? 28.444 18.083  10.693  1.00 47.30  ? 196 ILE A C   1 
ATOM   1158 O O   . ILE A 1 155 ? 29.427 17.560  11.188  1.00 48.84  ? 196 ILE A O   1 
ATOM   1159 C CB  . ILE A 1 155 ? 27.496 16.385  9.075   1.00 58.04  ? 196 ILE A CB  1 
ATOM   1160 C CG1 . ILE A 1 155 ? 26.821 16.268  7.718   1.00 55.41  ? 196 ILE A CG1 1 
ATOM   1161 C CG2 . ILE A 1 155 ? 26.583 16.071  10.253  1.00 54.48  ? 196 ILE A CG2 1 
ATOM   1162 C CD1 . ILE A 1 155 ? 26.130 17.541  7.327   1.00 53.09  ? 196 ILE A CD1 1 
ATOM   1163 N N   . ASN A 1 156 ? 27.650 18.900  11.380  1.00 52.52  ? 197 ASN A N   1 
ATOM   1164 C CA  . ASN A 1 156 ? 27.864 19.253  12.800  1.00 50.58  ? 197 ASN A CA  1 
ATOM   1165 C C   . ASN A 1 156 ? 26.551 19.152  13.577  1.00 50.89  ? 197 ASN A C   1 
ATOM   1166 O O   . ASN A 1 156 ? 25.508 18.957  12.962  1.00 52.95  ? 197 ASN A O   1 
ATOM   1167 C CB  . ASN A 1 156 ? 28.348 20.690  12.935  1.00 50.70  ? 197 ASN A CB  1 
ATOM   1168 C CG  . ASN A 1 156 ? 29.719 20.903  12.349  1.00 61.33  ? 197 ASN A CG  1 
ATOM   1169 O OD1 . ASN A 1 156 ? 30.733 20.693  13.015  1.00 51.99  ? 197 ASN A OD1 1 
ATOM   1170 N ND2 . ASN A 1 156 ? 29.761 21.321  11.085  1.00 60.04  ? 197 ASN A ND2 1 
ATOM   1171 N N   . HIS A 1 157 ? 26.602 19.321  14.909  1.00 45.19  ? 198 HIS A N   1 
ATOM   1172 C CA  . HIS A 1 157 ? 25.402 19.264  15.749  1.00 48.71  ? 198 HIS A CA  1 
ATOM   1173 C C   . HIS A 1 157 ? 24.504 20.395  15.292  1.00 46.85  ? 198 HIS A C   1 
ATOM   1174 O O   . HIS A 1 157 ? 24.941 21.555  15.229  1.00 46.05  ? 198 HIS A O   1 
ATOM   1175 C CB  . HIS A 1 157 ? 25.706 19.470  17.241  1.00 55.17  ? 198 HIS A CB  1 
ATOM   1176 C CG  . HIS A 1 157 ? 24.480 19.772  18.044  1.00 63.94  ? 198 HIS A CG  1 
ATOM   1177 N ND1 . HIS A 1 157 ? 23.585 18.793  18.426  1.00 70.74  ? 198 HIS A ND1 1 
ATOM   1178 C CD2 . HIS A 1 157 ? 23.909 20.955  18.389  1.00 63.70  ? 198 HIS A CD2 1 
ATOM   1179 C CE1 . HIS A 1 157 ? 22.515 19.357  18.961  1.00 65.18  ? 198 HIS A CE1 1 
ATOM   1180 N NE2 . HIS A 1 157 ? 22.685 20.669  18.947  1.00 67.96  ? 198 HIS A NE2 1 
ATOM   1181 N N   . GLY A 1 158 ? 23.242 20.073  15.022  1.00 44.47  ? 199 GLY A N   1 
ATOM   1182 C CA  . GLY A 1 158 ? 22.341 21.079  14.485  1.00 46.44  ? 199 GLY A CA  1 
ATOM   1183 C C   . GLY A 1 158 ? 22.019 20.707  13.037  1.00 51.22  ? 199 GLY A C   1 
ATOM   1184 O O   . GLY A 1 158 ? 20.899 20.970  12.581  1.00 56.07  ? 199 GLY A O   1 
ATOM   1185 N N   . ASN A 1 159 ? 22.964 20.086  12.315  1.00 48.42  ? 200 ASN A N   1 
ATOM   1186 C CA  . ASN A 1 159 ? 22.715 19.657  10.909  1.00 51.80  ? 200 ASN A CA  1 
ATOM   1187 C C   . ASN A 1 159 ? 21.719 18.509  10.807  1.00 52.39  ? 200 ASN A C   1 
ATOM   1188 O O   . ASN A 1 159 ? 21.114 18.294  9.756   1.00 52.31  ? 200 ASN A O   1 
ATOM   1189 C CB  . ASN A 1 159 ? 23.981 19.169  10.215  1.00 46.81  ? 200 ASN A CB  1 
ATOM   1190 C CG  . ASN A 1 159 ? 24.744 20.279  9.537   1.00 44.92  ? 200 ASN A CG  1 
ATOM   1191 O OD1 . ASN A 1 159 ? 24.359 20.779  8.480   1.00 52.72  ? 200 ASN A OD1 1 
ATOM   1192 N ND2 . ASN A 1 159 ? 25.840 20.665  10.140  1.00 42.41  ? 200 ASN A ND2 1 
ATOM   1193 N N   . SER A 1 160 ? 21.560 17.764  11.895  1.00 49.54  ? 201 SER A N   1 
ATOM   1194 C CA  . SER A 1 160 ? 20.633 16.630  11.903  1.00 48.96  ? 201 SER A CA  1 
ATOM   1195 C C   . SER A 1 160 ? 19.209 16.936  11.427  1.00 47.62  ? 201 SER A C   1 
ATOM   1196 O O   . SER A 1 160 ? 18.572 17.896  11.870  1.00 41.64  ? 201 SER A O   1 
ATOM   1197 C CB  . SER A 1 160 ? 20.549 16.050  13.309  1.00 54.52  ? 201 SER A CB  1 
ATOM   1198 O OG  . SER A 1 160 ? 21.224 14.823  13.374  1.00 55.08  ? 201 SER A OG  1 
ATOM   1199 N N   . GLY A 1 161 ? 18.705 16.087  10.546  1.00 48.06  ? 202 GLY A N   1 
ATOM   1200 C CA  . GLY A 1 161 ? 17.355 16.255  10.046  1.00 44.07  ? 202 GLY A CA  1 
ATOM   1201 C C   . GLY A 1 161 ? 17.334 17.068  8.781   1.00 46.98  ? 202 GLY A C   1 
ATOM   1202 O O   . GLY A 1 161 ? 16.318 17.090  8.088   1.00 46.66  ? 202 GLY A O   1 
ATOM   1203 N N   . GLY A 1 162 ? 18.476 17.707  8.495   1.00 44.99  ? 203 GLY A N   1 
ATOM   1204 C CA  . GLY A 1 162 ? 18.648 18.576  7.348   1.00 39.89  ? 203 GLY A CA  1 
ATOM   1205 C C   . GLY A 1 162 ? 18.774 17.891  5.999   1.00 40.34  ? 203 GLY A C   1 
ATOM   1206 O O   . GLY A 1 162 ? 18.703 16.668  5.880   1.00 35.50  ? 203 GLY A O   1 
ATOM   1207 N N   . ALA A 1 163 ? 19.003 18.684  4.961   1.00 41.90  ? 204 ALA A N   1 
ATOM   1208 C CA  . ALA A 1 163 ? 19.110 18.097  3.614   1.00 43.61  ? 204 ALA A CA  1 
ATOM   1209 C C   . ALA A 1 163 ? 20.510 17.929  3.052   1.00 36.14  ? 204 ALA A C   1 
ATOM   1210 O O   . ALA A 1 163 ? 21.388 18.768  3.260   1.00 41.15  ? 204 ALA A O   1 
ATOM   1211 C CB  . ALA A 1 163 ? 18.331 18.920  2.657   1.00 29.74  ? 204 ALA A CB  1 
ATOM   1212 N N   . LEU A 1 164 ? 20.696 16.836  2.332   0.00 42.44  ? 205 LEU A N   1 
ATOM   1213 C CA  . LEU A 1 164 ? 21.946 16.574  1.614   0.00 50.90  ? 205 LEU A CA  1 
ATOM   1214 C C   . LEU A 1 164 ? 21.420 16.584  0.179   0.00 39.48  ? 205 LEU A C   1 
ATOM   1215 O O   . LEU A 1 164 ? 20.615 15.731  -0.158  0.00 44.11  ? 205 LEU A O   1 
ATOM   1216 C CB  . LEU A 1 164 ? 22.485 15.180  1.954   0.00 43.41  ? 205 LEU A CB  1 
ATOM   1217 C CG  . LEU A 1 164 ? 23.956 14.699  1.990   0.00 51.95  ? 205 LEU A CG  1 
ATOM   1218 C CD1 . LEU A 1 164 ? 24.058 13.527  1.042   0.00 39.13  ? 205 LEU A CD1 1 
ATOM   1219 C CD2 . LEU A 1 164 ? 25.015 15.774  1.704   0.00 26.89  ? 205 LEU A CD2 1 
ATOM   1220 N N   . VAL A 1 165 ? 21.810 17.564  -0.633  1.00 39.68  ? 206 VAL A N   1 
ATOM   1221 C CA  . VAL A 1 165 ? 21.356 17.625  -2.062  1.00 44.17  ? 206 VAL A CA  1 
ATOM   1222 C C   . VAL A 1 165 ? 22.491 17.617  -3.100  1.00 39.20  ? 206 VAL A C   1 
ATOM   1223 O O   . VAL A 1 165 ? 23.601 17.977  -2.772  1.00 45.60  ? 206 VAL A O   1 
ATOM   1224 C CB  . VAL A 1 165 ? 20.559 18.913  -2.364  1.00 42.79  ? 206 VAL A CB  1 
ATOM   1225 C CG1 . VAL A 1 165 ? 19.385 19.068  -1.383  1.00 45.92  ? 206 VAL A CG1 1 
ATOM   1226 C CG2 . VAL A 1 165 ? 21.519 20.128  -2.348  1.00 33.63  ? 206 VAL A CG2 1 
ATOM   1227 N N   . ASN A 1 166 ? 22.216 17.231  -4.348  1.00 43.64  ? 207 ASN A N   1 
ATOM   1228 C CA  . ASN A 1 166 ? 23.262 17.275  -5.386  1.00 41.46  ? 207 ASN A CA  1 
ATOM   1229 C C   . ASN A 1 166 ? 23.405 18.656  -6.022  1.00 42.51  ? 207 ASN A C   1 
ATOM   1230 O O   . ASN A 1 166 ? 22.837 19.628  -5.555  1.00 50.47  ? 207 ASN A O   1 
ATOM   1231 C CB  . ASN A 1 166 ? 23.050 16.223  -6.480  1.00 49.36  ? 207 ASN A CB  1 
ATOM   1232 C CG  . ASN A 1 166 ? 21.749 16.400  -7.251  1.00 46.77  ? 207 ASN A CG  1 
ATOM   1233 O OD1 . ASN A 1 166 ? 21.270 17.511  -7.441  1.00 45.21  ? 207 ASN A OD1 1 
ATOM   1234 N ND2 . ASN A 1 166 ? 21.193 15.287  -7.726  1.00 41.56  ? 207 ASN A ND2 1 
ATOM   1235 N N   . SER A 1 167 ? 24.151 18.758  -7.107  1.00 47.29  ? 208 SER A N   1 
ATOM   1236 C CA  . SER A 1 167 ? 24.369 20.072  -7.699  1.00 42.92  ? 208 SER A CA  1 
ATOM   1237 C C   . SER A 1 167 ? 23.162 20.678  -8.389  1.00 42.58  ? 208 SER A C   1 
ATOM   1238 O O   . SER A 1 167 ? 23.127 21.874  -8.649  1.00 48.03  ? 208 SER A O   1 
ATOM   1239 C CB  . SER A 1 167 ? 25.580 20.051  -8.654  1.00 35.91  ? 208 SER A CB  1 
ATOM   1240 O OG  . SER A 1 167 ? 25.335 19.323  -9.851  1.00 46.45  ? 208 SER A OG  1 
ATOM   1241 N N   . LEU A 1 168 ? 22.191 19.854  -8.712  1.00 39.08  ? 209 LEU A N   1 
ATOM   1242 C CA  . LEU A 1 168 ? 20.979 20.334  -9.341  1.00 48.96  ? 209 LEU A CA  1 
ATOM   1243 C C   . LEU A 1 168 ? 19.982 20.662  -8.212  1.00 48.58  ? 209 LEU A C   1 
ATOM   1244 O O   . LEU A 1 168 ? 18.847 21.014  -8.454  1.00 51.39  ? 209 LEU A O   1 
ATOM   1245 C CB  . LEU A 1 168 ? 20.416 19.239  -10.265 1.00 47.41  ? 209 LEU A CB  1 
ATOM   1246 C CG  . LEU A 1 168 ? 21.393 18.712  -11.340 1.00 53.98  ? 209 LEU A CG  1 
ATOM   1247 C CD1 . LEU A 1 168 ? 20.694 17.685  -12.214 1.00 43.35  ? 209 LEU A CD1 1 
ATOM   1248 C CD2 . LEU A 1 168 ? 21.930 19.848  -12.202 1.00 39.33  ? 209 LEU A CD2 1 
ATOM   1249 N N   . GLY A 1 169 ? 20.431 20.528  -6.968  1.00 55.56  ? 210 GLY A N   1 
ATOM   1250 C CA  . GLY A 1 169 ? 19.579 20.817  -5.839  1.00 45.70  ? 210 GLY A CA  1 
ATOM   1251 C C   . GLY A 1 169 ? 18.577 19.718  -5.583  1.00 54.35  ? 210 GLY A C   1 
ATOM   1252 O O   . GLY A 1 169 ? 17.575 19.944  -4.912  1.00 50.53  ? 210 GLY A O   1 
ATOM   1253 N N   . GLU A 1 170 ? 18.844 18.521  -6.100  1.00 52.98  ? 211 GLU A N   1 
ATOM   1254 C CA  . GLU A 1 170 ? 17.915 17.417  -5.905  1.00 51.67  ? 211 GLU A CA  1 
ATOM   1255 C C   . GLU A 1 170 ? 18.185 16.733  -4.587  1.00 55.25  ? 211 GLU A C   1 
ATOM   1256 O O   . GLU A 1 170 ? 19.350 16.585  -4.186  1.00 56.74  ? 211 GLU A O   1 
ATOM   1257 C CB  . GLU A 1 170 ? 18.039 16.417  -7.041  1.00 55.10  ? 211 GLU A CB  1 
ATOM   1258 C CG  . GLU A 1 170 ? 17.508 16.906  -8.353  1.00 53.15  ? 211 GLU A CG  1 
ATOM   1259 C CD  . GLU A 1 170 ? 17.959 16.019  -9.488  1.00 66.23  ? 211 GLU A CD  1 
ATOM   1260 O OE1 . GLU A 1 170 ? 17.550 16.252  -10.657 1.00 68.31  ? 211 GLU A OE1 1 
ATOM   1261 O OE2 . GLU A 1 170 ? 18.747 15.091  -9.197  1.00 64.53  ? 211 GLU A OE2 1 
ATOM   1262 N N   . LEU A 1 171 ? 17.113 16.321  -3.909  1.00 50.53  ? 212 LEU A N   1 
ATOM   1263 C CA  . LEU A 1 171 ? 17.255 15.685  -2.626  1.00 45.47  ? 212 LEU A CA  1 
ATOM   1264 C C   . LEU A 1 171 ? 17.884 14.305  -2.673  1.00 52.20  ? 212 LEU A C   1 
ATOM   1265 O O   . LEU A 1 171 ? 17.276 13.362  -3.164  1.00 53.57  ? 212 LEU A O   1 
ATOM   1266 C CB  . LEU A 1 171 ? 15.917 15.575  -1.924  1.00 49.61  ? 212 LEU A CB  1 
ATOM   1267 C CG  . LEU A 1 171 ? 16.071 14.977  -0.505  1.00 55.29  ? 212 LEU A CG  1 
ATOM   1268 C CD1 . LEU A 1 171 ? 16.878 15.952  0.405   1.00 36.50  ? 212 LEU A CD1 1 
ATOM   1269 C CD2 . LEU A 1 171 ? 14.674 14.689  0.092   1.00 46.05  ? 212 LEU A CD2 1 
ATOM   1270 N N   . MET A 1 172 ? 19.097 14.183  -2.139  1.00 45.59  ? 213 MET A N   1 
ATOM   1271 C CA  . MET A 1 172 ? 19.784 12.898  -2.103  1.00 46.82  ? 213 MET A CA  1 
ATOM   1272 C C   . MET A 1 172 ? 19.572 12.166  -0.758  1.00 52.02  ? 213 MET A C   1 
ATOM   1273 O O   . MET A 1 172 ? 19.392 10.949  -0.709  1.00 51.65  ? 213 MET A O   1 
ATOM   1274 C CB  . MET A 1 172 ? 21.284 13.117  -2.350  1.00 44.14  ? 213 MET A CB  1 
ATOM   1275 C CG  . MET A 1 172 ? 21.619 13.551  -3.777  1.00 46.50  ? 213 MET A CG  1 
ATOM   1276 S SD  . MET A 1 172 ? 21.059 12.410  -5.058  1.00 57.70  ? 213 MET A SD  1 
ATOM   1277 C CE  . MET A 1 172 ? 22.252 12.939  -6.531  1.00 73.53  ? 213 MET A CE  1 
ATOM   1278 N N   . GLY A 1 173 ? 19.596 12.902  0.344   1.00 47.02  ? 214 GLY A N   1 
ATOM   1279 C CA  . GLY A 1 173 ? 19.410 12.241  1.619   1.00 46.28  ? 214 GLY A CA  1 
ATOM   1280 C C   . GLY A 1 173 ? 19.059 13.163  2.769   1.00 46.29  ? 214 GLY A C   1 
ATOM   1281 O O   . GLY A 1 173 ? 19.007 14.370  2.603   1.00 42.87  ? 214 GLY A O   1 
ATOM   1282 N N   . ILE A 1 174 ? 18.770 12.575  3.925   1.00 49.22  ? 215 ILE A N   1 
ATOM   1283 C CA  . ILE A 1 174 ? 18.469 13.343  5.127   1.00 50.52  ? 215 ILE A CA  1 
ATOM   1284 C C   . ILE A 1 174 ? 19.702 13.154  6.025   1.00 48.29  ? 215 ILE A C   1 
ATOM   1285 O O   . ILE A 1 174 ? 19.981 12.045  6.427   1.00 43.94  ? 215 ILE A O   1 
ATOM   1286 C CB  . ILE A 1 174 ? 17.238 12.785  5.869   1.00 48.08  ? 215 ILE A CB  1 
ATOM   1287 C CG1 . ILE A 1 174 ? 16.031 12.723  4.929   1.00 44.99  ? 215 ILE A CG1 1 
ATOM   1288 C CG2 . ILE A 1 174 ? 16.913 13.689  7.068   1.00 40.14  ? 215 ILE A CG2 1 
ATOM   1289 C CD1 . ILE A 1 174 ? 15.473 14.121  4.512   1.00 40.27  ? 215 ILE A CD1 1 
ATOM   1290 N N   . ASN A 1 175 ? 20.460 14.206  6.308   1.00 43.22  ? 216 ASN A N   1 
ATOM   1291 C CA  . ASN A 1 175 ? 21.623 14.019  7.159   1.00 47.95  ? 216 ASN A CA  1 
ATOM   1292 C C   . ASN A 1 175 ? 21.186 13.533  8.542   1.00 53.64  ? 216 ASN A C   1 
ATOM   1293 O O   . ASN A 1 175 ? 20.182 14.003  9.095   1.00 56.27  ? 216 ASN A O   1 
ATOM   1294 C CB  . ASN A 1 175 ? 22.430 15.318  7.243   1.00 48.07  ? 216 ASN A CB  1 
ATOM   1295 C CG  . ASN A 1 175 ? 22.903 15.812  5.868   1.00 55.72  ? 216 ASN A CG  1 
ATOM   1296 O OD1 . ASN A 1 175 ? 22.739 16.985  5.554   1.00 59.29  ? 216 ASN A OD1 1 
ATOM   1297 N ND2 . ASN A 1 175 ? 23.504 14.923  5.051   1.00 45.01  ? 216 ASN A ND2 1 
ATOM   1298 N N   . THR A 1 176 ? 21.937 12.579  9.099   1.00 59.04  ? 217 THR A N   1 
ATOM   1299 C CA  . THR A 1 176 ? 21.600 12.000  10.391  1.00 60.89  ? 217 THR A CA  1 
ATOM   1300 C C   . THR A 1 176 ? 22.621 12.118  11.484  1.00 66.81  ? 217 THR A C   1 
ATOM   1301 O O   . THR A 1 176 ? 22.268 12.130  12.649  1.00 72.16  ? 217 THR A O   1 
ATOM   1302 C CB  . THR A 1 176 ? 21.262 10.528  10.276  1.00 57.74  ? 217 THR A CB  1 
ATOM   1303 O OG1 . THR A 1 176 ? 20.083 10.372  9.482   1.00 68.19  ? 217 THR A OG1 1 
ATOM   1304 C CG2 . THR A 1 176 ? 20.981 9.956   11.645  1.00 58.46  ? 217 THR A CG2 1 
ATOM   1305 N N   . LEU A 1 177 ? 23.891 12.163  11.132  1.00 79.61  ? 218 LEU A N   1 
ATOM   1306 C CA  . LEU A 1 177 ? 24.929 12.303  12.149  1.00 84.25  ? 218 LEU A CA  1 
ATOM   1307 C C   . LEU A 1 177 ? 26.328 12.050  11.618  1.00 83.15  ? 218 LEU A C   1 
ATOM   1308 O O   . LEU A 1 177 ? 26.545 11.255  10.707  1.00 76.02  ? 218 LEU A O   1 
ATOM   1309 C CB  . LEU A 1 177 ? 24.674 11.384  13.352  1.00 85.06  ? 218 LEU A CB  1 
ATOM   1310 C CG  . LEU A 1 177 ? 24.736 12.045  14.746  1.00 87.38  ? 218 LEU A CG  1 
ATOM   1311 C CD1 . LEU A 1 177 ? 25.570 13.332  14.689  1.00 84.74  ? 218 LEU A CD1 1 
ATOM   1312 C CD2 . LEU A 1 177 ? 23.331 12.350  15.247  1.00 84.17  ? 218 LEU A CD2 1 
ATOM   1313 N N   . SER A 1 178 ? 27.273 12.757  12.217  1.00 88.27  ? 219 SER A N   1 
ATOM   1314 C CA  . SER A 1 178 ? 28.658 12.669  11.838  1.00 91.04  ? 219 SER A CA  1 
ATOM   1315 C C   . SER A 1 178 ? 29.370 11.661  12.728  1.00 95.69  ? 219 SER A C   1 
ATOM   1316 O O   . SER A 1 178 ? 29.469 11.847  13.942  1.00 98.41  ? 219 SER A O   1 
ATOM   1317 C CB  . SER A 1 178 ? 29.305 14.050  11.962  1.00 88.50  ? 219 SER A CB  1 
ATOM   1318 O OG  . SER A 1 178 ? 30.537 14.101  11.269  1.00 91.10  ? 219 SER A OG  1 
ATOM   1319 N N   . PHE A 1 179 ? 29.830 10.574  12.116  1.00 97.64  ? 220 PHE A N   1 
ATOM   1320 C CA  . PHE A 1 179 ? 30.565 9.542   12.823  1.00 96.85  ? 220 PHE A CA  1 
ATOM   1321 C C   . PHE A 1 179 ? 31.514 10.275  13.767  1.00 102.36 ? 220 PHE A C   1 
ATOM   1322 O O   . PHE A 1 179 ? 32.468 10.922  13.339  1.00 102.30 ? 220 PHE A O   1 
ATOM   1323 C CB  . PHE A 1 179 ? 31.321 8.685   11.788  1.00 96.42  ? 220 PHE A CB  1 
ATOM   1324 C CG  . PHE A 1 179 ? 32.338 7.727   12.368  1.00 91.50  ? 220 PHE A CG  1 
ATOM   1325 C CD1 . PHE A 1 179 ? 33.594 8.176   12.759  1.00 93.24  ? 220 PHE A CD1 1 
ATOM   1326 C CD2 . PHE A 1 179 ? 32.058 6.370   12.467  1.00 88.33  ? 220 PHE A CD2 1 
ATOM   1327 C CE1 . PHE A 1 179 ? 34.560 7.295   13.240  1.00 95.74  ? 220 PHE A CE1 1 
ATOM   1328 C CE2 . PHE A 1 179 ? 33.014 5.477   12.945  1.00 93.43  ? 220 PHE A CE2 1 
ATOM   1329 C CZ  . PHE A 1 179 ? 34.270 5.942   13.331  1.00 95.60  ? 220 PHE A CZ  1 
ATOM   1330 N N   . ASP A 1 180 ? 31.197 10.225  15.055  1.00 111.27 ? 221 ASP A N   1 
ATOM   1331 C CA  . ASP A 1 180 ? 32.025 10.856  16.073  1.00 118.22 ? 221 ASP A CA  1 
ATOM   1332 C C   . ASP A 1 180 ? 32.773 9.717   16.785  1.00 123.21 ? 221 ASP A C   1 
ATOM   1333 O O   . ASP A 1 180 ? 33.281 9.870   17.904  1.00 123.82 ? 221 ASP A O   1 
ATOM   1334 C CB  . ASP A 1 180 ? 31.154 11.676  17.045  1.00 118.01 ? 221 ASP A CB  1 
ATOM   1335 C CG  . ASP A 1 180 ? 30.869 13.110  16.535  1.00 117.33 ? 221 ASP A CG  1 
ATOM   1336 O OD1 . ASP A 1 180 ? 31.803 13.945  16.505  1.00 115.70 ? 221 ASP A OD1 1 
ATOM   1337 O OD2 . ASP A 1 180 ? 29.710 13.407  16.167  1.00 118.25 ? 221 ASP A OD2 1 
ATOM   1338 N N   . LYS A 1 181 ? 32.824 8.576   16.091  1.00 126.37 ? 222 LYS A N   1 
ATOM   1339 C CA  . LYS A 1 181 ? 33.511 7.364   16.537  1.00 129.40 ? 222 LYS A CA  1 
ATOM   1340 C C   . LYS A 1 181 ? 32.987 6.807   17.859  1.00 136.22 ? 222 LYS A C   1 
ATOM   1341 O O   . LYS A 1 181 ? 32.165 7.440   18.523  1.00 138.17 ? 222 LYS A O   1 
ATOM   1342 C CB  . LYS A 1 181 ? 35.006 7.649   16.643  1.00 124.69 ? 222 LYS A CB  1 
ATOM   1343 C CG  . LYS A 1 181 ? 35.887 6.436   16.828  1.00 118.20 ? 222 LYS A CG  1 
ATOM   1344 C CD  . LYS A 1 181 ? 37.285 6.880   17.180  1.00 117.05 ? 222 LYS A CD  1 
ATOM   1345 C CE  . LYS A 1 181 ? 37.249 7.824   18.371  1.00 117.46 ? 222 LYS A CE  1 
ATOM   1346 N NZ  . LYS A 1 181 ? 38.560 8.468   18.648  1.00 117.16 ? 222 LYS A NZ  1 
ATOM   1347 N N   . SER A 1 182 ? 33.476 5.625   18.237  1.00 142.59 ? 223 SER A N   1 
ATOM   1348 C CA  . SER A 1 182 ? 33.062 4.947   19.472  1.00 146.23 ? 223 SER A CA  1 
ATOM   1349 C C   . SER A 1 182 ? 33.812 5.340   20.759  1.00 148.25 ? 223 SER A C   1 
ATOM   1350 O O   . SER A 1 182 ? 33.287 5.163   21.865  1.00 146.11 ? 223 SER A O   1 
ATOM   1351 C CB  . SER A 1 182 ? 33.135 3.421   19.271  1.00 146.90 ? 223 SER A CB  1 
ATOM   1352 O OG  . SER A 1 182 ? 34.400 3.009   18.770  1.00 146.28 ? 223 SER A OG  1 
ATOM   1353 N N   . ASN A 1 183 ? 35.026 5.872   20.622  1.00 150.83 ? 224 ASN A N   1 
ATOM   1354 C CA  . ASN A 1 183 ? 35.799 6.276   21.793  1.00 153.53 ? 224 ASN A CA  1 
ATOM   1355 C C   . ASN A 1 183 ? 36.739 7.448   21.512  1.00 155.22 ? 224 ASN A C   1 
ATOM   1356 O O   . ASN A 1 183 ? 36.335 8.453   20.920  1.00 154.14 ? 224 ASN A O   1 
ATOM   1357 C CB  . ASN A 1 183 ? 36.600 5.087   22.329  1.00 153.57 ? 224 ASN A CB  1 
ATOM   1358 C CG  . ASN A 1 183 ? 37.775 4.730   21.445  1.00 156.02 ? 224 ASN A CG  1 
ATOM   1359 O OD1 . ASN A 1 183 ? 37.630 4.560   20.235  1.00 158.62 ? 224 ASN A OD1 1 
ATOM   1360 N ND2 . ASN A 1 183 ? 38.951 4.614   22.048  1.00 156.47 ? 224 ASN A ND2 1 
ATOM   1361 N N   . ASP A 1 184 ? 37.989 7.315   21.951  1.00 157.82 ? 225 ASP A N   1 
ATOM   1362 C CA  . ASP A 1 184 ? 38.995 8.354   21.763  1.00 159.09 ? 225 ASP A CA  1 
ATOM   1363 C C   . ASP A 1 184 ? 40.280 7.860   21.091  1.00 156.85 ? 225 ASP A C   1 
ATOM   1364 O O   . ASP A 1 184 ? 40.430 6.672   20.787  1.00 156.58 ? 225 ASP A O   1 
ATOM   1365 C CB  . ASP A 1 184 ? 39.344 8.993   23.108  1.00 164.25 ? 225 ASP A CB  1 
ATOM   1366 C CG  . ASP A 1 184 ? 40.519 9.943   23.009  1.00 170.95 ? 225 ASP A CG  1 
ATOM   1367 O OD1 . ASP A 1 184 ? 40.412 10.942  22.261  1.00 174.56 ? 225 ASP A OD1 1 
ATOM   1368 O OD2 . ASP A 1 184 ? 41.552 9.681   23.666  1.00 174.62 ? 225 ASP A OD2 1 
ATOM   1369 N N   . GLY A 1 185 ? 41.201 8.795   20.872  1.00 153.24 ? 226 GLY A N   1 
ATOM   1370 C CA  . GLY A 1 185 ? 42.469 8.497   20.233  1.00 147.26 ? 226 GLY A CA  1 
ATOM   1371 C C   . GLY A 1 185 ? 42.617 9.392   19.015  1.00 142.93 ? 226 GLY A C   1 
ATOM   1372 O O   . GLY A 1 185 ? 43.726 9.608   18.512  1.00 144.53 ? 226 GLY A O   1 
ATOM   1373 N N   . GLU A 1 186 ? 41.480 9.910   18.546  1.00 134.99 ? 227 GLU A N   1 
ATOM   1374 C CA  . GLU A 1 186 ? 41.417 10.791  17.380  1.00 125.23 ? 227 GLU A CA  1 
ATOM   1375 C C   . GLU A 1 186 ? 39.979 11.167  17.031  1.00 116.18 ? 227 GLU A C   1 
ATOM   1376 O O   . GLU A 1 186 ? 39.034 10.464  17.405  1.00 112.55 ? 227 GLU A O   1 
ATOM   1377 C CB  . GLU A 1 186 ? 42.074 10.129  16.154  1.00 129.50 ? 227 GLU A CB  1 
ATOM   1378 C CG  . GLU A 1 186 ? 42.146 8.577   16.140  1.00 136.50 ? 227 GLU A CG  1 
ATOM   1379 C CD  . GLU A 1 186 ? 40.790 7.872   16.174  1.00 138.81 ? 227 GLU A CD  1 
ATOM   1380 O OE1 . GLU A 1 186 ? 39.899 8.238   15.376  1.00 141.61 ? 227 GLU A OE1 1 
ATOM   1381 O OE2 . GLU A 1 186 ? 40.626 6.934   16.989  1.00 138.29 ? 227 GLU A OE2 1 
ATOM   1382 N N   . THR A 1 187 ? 39.812 12.287  16.329  1.00 102.99 ? 228 THR A N   1 
ATOM   1383 C CA  . THR A 1 187 ? 38.478 12.711  15.914  1.00 90.79  ? 228 THR A CA  1 
ATOM   1384 C C   . THR A 1 187 ? 38.331 12.452  14.428  1.00 81.44  ? 228 THR A C   1 
ATOM   1385 O O   . THR A 1 187 ? 39.110 12.957  13.624  1.00 75.86  ? 228 THR A O   1 
ATOM   1386 C CB  . THR A 1 187 ? 38.210 14.217  16.132  1.00 87.84  ? 228 THR A CB  1 
ATOM   1387 O OG1 . THR A 1 187 ? 39.013 14.978  15.230  1.00 85.93  ? 228 THR A OG1 1 
ATOM   1388 C CG2 . THR A 1 187 ? 38.530 14.626  17.541  1.00 95.80  ? 228 THR A CG2 1 
ATOM   1389 N N   . PRO A 1 188 ? 37.338 11.640  14.042  1.00 76.14  ? 229 PRO A N   1 
ATOM   1390 C CA  . PRO A 1 188 ? 37.146 11.363  12.619  1.00 70.84  ? 229 PRO A CA  1 
ATOM   1391 C C   . PRO A 1 188 ? 36.767 12.640  11.867  1.00 66.41  ? 229 PRO A C   1 
ATOM   1392 O O   . PRO A 1 188 ? 35.954 13.432  12.324  1.00 77.90  ? 229 PRO A O   1 
ATOM   1393 C CB  . PRO A 1 188 ? 36.055 10.284  12.620  1.00 63.93  ? 229 PRO A CB  1 
ATOM   1394 C CG  . PRO A 1 188 ? 35.339 10.509  13.883  1.00 67.15  ? 229 PRO A CG  1 
ATOM   1395 C CD  . PRO A 1 188 ? 36.421 10.835  14.863  1.00 68.34  ? 229 PRO A CD  1 
ATOM   1396 N N   . GLU A 1 189 ? 37.408 12.854  10.733  1.00 63.71  ? 230 GLU A N   1 
ATOM   1397 C CA  . GLU A 1 189 ? 37.164 14.023  9.909   1.00 60.02  ? 230 GLU A CA  1 
ATOM   1398 C C   . GLU A 1 189 ? 36.494 13.566  8.632   1.00 58.67  ? 230 GLU A C   1 
ATOM   1399 O O   . GLU A 1 189 ? 36.904 12.580  8.020   1.00 63.40  ? 230 GLU A O   1 
ATOM   1400 C CB  . GLU A 1 189 ? 38.478 14.730  9.574   1.00 59.47  ? 230 GLU A CB  1 
ATOM   1401 C CG  . GLU A 1 189 ? 38.322 15.872  8.570   1.00 74.15  ? 230 GLU A CG  1 
ATOM   1402 C CD  . GLU A 1 189 ? 39.656 16.534  8.147   1.00 78.17  ? 230 GLU A CD  1 
ATOM   1403 O OE1 . GLU A 1 189 ? 39.656 17.208  7.086   1.00 80.26  ? 230 GLU A OE1 1 
ATOM   1404 O OE2 . GLU A 1 189 ? 40.684 16.395  8.863   1.00 64.36  ? 230 GLU A OE2 1 
ATOM   1405 N N   . GLY A 1 190 ? 35.428 14.254  8.256   1.00 55.81  ? 231 GLY A N   1 
ATOM   1406 C CA  . GLY A 1 190 ? 34.735 13.926  7.027   1.00 43.35  ? 231 GLY A CA  1 
ATOM   1407 C C   . GLY A 1 190 ? 33.960 12.648  6.894   1.00 48.64  ? 231 GLY A C   1 
ATOM   1408 O O   . GLY A 1 190 ? 33.859 12.125  5.779   1.00 47.87  ? 231 GLY A O   1 
ATOM   1409 N N   . ILE A 1 191 ? 33.426 12.108  7.988   1.00 51.66  ? 232 ILE A N   1 
ATOM   1410 C CA  . ILE A 1 191 ? 32.617 10.895  7.859   1.00 48.66  ? 232 ILE A CA  1 
ATOM   1411 C C   . ILE A 1 191 ? 31.220 11.167  8.385   1.00 51.29  ? 232 ILE A C   1 
ATOM   1412 O O   . ILE A 1 191 ? 31.019 11.284  9.588   1.00 52.74  ? 232 ILE A O   1 
ATOM   1413 C CB  . ILE A 1 191 ? 33.257 9.719   8.577   1.00 51.97  ? 232 ILE A CB  1 
ATOM   1414 C CG1 . ILE A 1 191 ? 34.655 9.485   7.967   1.00 51.27  ? 232 ILE A CG1 1 
ATOM   1415 C CG2 . ILE A 1 191 ? 32.348 8.481   8.453   1.00 43.29  ? 232 ILE A CG2 1 
ATOM   1416 C CD1 . ILE A 1 191 ? 35.386 8.295   8.491   1.00 60.92  ? 232 ILE A CD1 1 
ATOM   1417 N N   . GLY A 1 192 ? 30.259 11.295  7.465   1.00 49.33  ? 233 GLY A N   1 
ATOM   1418 C CA  . GLY A 1 192 ? 28.896 11.612  7.858   1.00 42.52  ? 233 GLY A CA  1 
ATOM   1419 C C   . GLY A 1 192 ? 27.916 10.733  7.150   1.00 46.68  ? 233 GLY A C   1 
ATOM   1420 O O   . GLY A 1 192 ? 28.222 10.250  6.062   1.00 53.63  ? 233 GLY A O   1 
ATOM   1421 N N   . PHE A 1 193 ? 26.754 10.508  7.762   1.00 44.46  ? 234 PHE A N   1 
ATOM   1422 C CA  . PHE A 1 193 ? 25.738 9.636   7.173   1.00 49.42  ? 234 PHE A CA  1 
ATOM   1423 C C   . PHE A 1 193 ? 24.385 10.329  6.961   1.00 52.42  ? 234 PHE A C   1 
ATOM   1424 O O   . PHE A 1 193 ? 24.043 11.301  7.635   1.00 46.49  ? 234 PHE A O   1 
ATOM   1425 C CB  . PHE A 1 193 ? 25.560 8.369   8.036   1.00 56.01  ? 234 PHE A CB  1 
ATOM   1426 C CG  . PHE A 1 193 ? 26.848 7.609   8.275   1.00 54.73  ? 234 PHE A CG  1 
ATOM   1427 C CD1 . PHE A 1 193 ? 27.602 7.839   9.420   1.00 54.81  ? 234 PHE A CD1 1 
ATOM   1428 C CD2 . PHE A 1 193 ? 27.345 6.735   7.315   1.00 48.84  ? 234 PHE A CD2 1 
ATOM   1429 C CE1 . PHE A 1 193 ? 28.826 7.217   9.594   1.00 57.95  ? 234 PHE A CE1 1 
ATOM   1430 C CE2 . PHE A 1 193 ? 28.572 6.107   7.480   1.00 47.32  ? 234 PHE A CE2 1 
ATOM   1431 C CZ  . PHE A 1 193 ? 29.315 6.346   8.615   1.00 54.78  ? 234 PHE A CZ  1 
ATOM   1432 N N   . ALA A 1 194 ? 23.626 9.808   6.007   1.00 51.17  ? 235 ALA A N   1 
ATOM   1433 C CA  . ALA A 1 194 ? 22.325 10.352  5.646   1.00 52.58  ? 235 ALA A CA  1 
ATOM   1434 C C   . ALA A 1 194 ? 21.420 9.230   5.158   1.00 55.31  ? 235 ALA A C   1 
ATOM   1435 O O   . ALA A 1 194 ? 21.875 8.287   4.509   1.00 55.01  ? 235 ALA A O   1 
ATOM   1436 C CB  . ALA A 1 194 ? 22.488 11.393  4.524   1.00 53.94  ? 235 ALA A CB  1 
ATOM   1437 N N   . ILE A 1 195 ? 20.132 9.336   5.448   1.00 50.34  ? 236 ILE A N   1 
ATOM   1438 C CA  . ILE A 1 195 ? 19.219 8.322   4.983   1.00 48.09  ? 236 ILE A CA  1 
ATOM   1439 C C   . ILE A 1 195 ? 18.831 8.631   3.532   1.00 52.67  ? 236 ILE A C   1 
ATOM   1440 O O   . ILE A 1 195 ? 18.259 9.682   3.232   1.00 48.21  ? 236 ILE A O   1 
ATOM   1441 C CB  . ILE A 1 195 ? 18.034 8.279   5.894   1.00 46.63  ? 236 ILE A CB  1 
ATOM   1442 C CG1 . ILE A 1 195 ? 18.538 8.016   7.317   1.00 50.51  ? 236 ILE A CG1 1 
ATOM   1443 C CG2 . ILE A 1 195 ? 17.079 7.182   5.458   1.00 50.76  ? 236 ILE A CG2 1 
ATOM   1444 C CD1 . ILE A 1 195 ? 17.781 8.738   8.382   1.00 52.87  ? 236 ILE A CD1 1 
ATOM   1445 N N   . PRO A 1 196 ? 19.160 7.716   2.601   1.00 54.24  ? 237 PRO A N   1 
ATOM   1446 C CA  . PRO A 1 196 ? 18.853 7.897   1.166   1.00 52.53  ? 237 PRO A CA  1 
ATOM   1447 C C   . PRO A 1 196 ? 17.431 8.410   0.998   1.00 52.54  ? 237 PRO A C   1 
ATOM   1448 O O   . PRO A 1 196 ? 16.519 7.951   1.703   1.00 54.44  ? 237 PRO A O   1 
ATOM   1449 C CB  . PRO A 1 196 ? 19.050 6.496   0.587   1.00 50.01  ? 237 PRO A CB  1 
ATOM   1450 C CG  . PRO A 1 196 ? 20.097 5.886   1.502   1.00 50.13  ? 237 PRO A CG  1 
ATOM   1451 C CD  . PRO A 1 196 ? 19.621 6.344   2.871   1.00 50.80  ? 237 PRO A CD  1 
ATOM   1452 N N   . PHE A 1 197 ? 17.227 9.349   0.081   1.00 51.18  ? 238 PHE A N   1 
ATOM   1453 C CA  . PHE A 1 197 ? 15.890 9.905   -0.066  1.00 57.70  ? 238 PHE A CA  1 
ATOM   1454 C C   . PHE A 1 197 ? 14.802 8.884   -0.405  1.00 62.26  ? 238 PHE A C   1 
ATOM   1455 O O   . PHE A 1 197 ? 13.657 9.021   0.022   1.00 66.43  ? 238 PHE A O   1 
ATOM   1456 C CB  . PHE A 1 197 ? 15.908 11.058  -1.059  1.00 54.31  ? 238 PHE A CB  1 
ATOM   1457 C CG  . PHE A 1 197 ? 16.021 10.637  -2.497  1.00 57.60  ? 238 PHE A CG  1 
ATOM   1458 C CD1 . PHE A 1 197 ? 14.895 10.638  -3.324  1.00 48.26  ? 238 PHE A CD1 1 
ATOM   1459 C CD2 . PHE A 1 197 ? 17.250 10.260  -3.031  1.00 49.53  ? 238 PHE A CD2 1 
ATOM   1460 C CE1 . PHE A 1 197 ? 14.986 10.265  -4.668  1.00 53.84  ? 238 PHE A CE1 1 
ATOM   1461 C CE2 . PHE A 1 197 ? 17.354 9.881   -4.395  1.00 56.36  ? 238 PHE A CE2 1 
ATOM   1462 C CZ  . PHE A 1 197 ? 16.223 9.885   -5.210  1.00 51.64  ? 238 PHE A CZ  1 
ATOM   1463 N N   . GLN A 1 198 ? 15.152 7.841   -1.144  1.00 66.79  ? 239 GLN A N   1 
ATOM   1464 C CA  . GLN A 1 198 ? 14.163 6.829   -1.468  1.00 65.59  ? 239 GLN A CA  1 
ATOM   1465 C C   . GLN A 1 198 ? 13.618 6.186   -0.186  1.00 63.33  ? 239 GLN A C   1 
ATOM   1466 O O   . GLN A 1 198 ? 12.420 6.010   -0.025  1.00 64.67  ? 239 GLN A O   1 
ATOM   1467 C CB  . GLN A 1 198 ? 14.781 5.766   -2.371  1.00 70.14  ? 239 GLN A CB  1 
ATOM   1468 C CG  . GLN A 1 198 ? 15.134 6.238   -3.787  1.00 73.99  ? 239 GLN A CG  1 
ATOM   1469 C CD  . GLN A 1 198 ? 13.917 6.636   -4.615  1.00 82.26  ? 239 GLN A CD  1 
ATOM   1470 O OE1 . GLN A 1 198 ? 13.980 6.694   -5.847  1.00 84.49  ? 239 GLN A OE1 1 
ATOM   1471 N NE2 . GLN A 1 198 ? 12.807 6.926   -3.944  1.00 80.68  ? 239 GLN A NE2 1 
ATOM   1472 N N   . LEU A 1 199 ? 14.509 5.847   0.732   1.00 63.73  ? 240 LEU A N   1 
ATOM   1473 C CA  . LEU A 1 199 ? 14.119 5.225   1.991   1.00 62.03  ? 240 LEU A CA  1 
ATOM   1474 C C   . LEU A 1 199 ? 13.350 6.224   2.851   1.00 63.78  ? 240 LEU A C   1 
ATOM   1475 O O   . LEU A 1 199 ? 12.312 5.897   3.427   1.00 65.96  ? 240 LEU A O   1 
ATOM   1476 C CB  . LEU A 1 199 ? 15.366 4.766   2.755   1.00 56.06  ? 240 LEU A CB  1 
ATOM   1477 C CG  . LEU A 1 199 ? 15.336 3.596   3.752   1.00 58.42  ? 240 LEU A CG  1 
ATOM   1478 C CD1 . LEU A 1 199 ? 16.319 3.905   4.864   1.00 63.71  ? 240 LEU A CD1 1 
ATOM   1479 C CD2 . LEU A 1 199 ? 13.951 3.358   4.338   1.00 55.21  ? 240 LEU A CD2 1 
ATOM   1480 N N   . ALA A 1 200 ? 13.874 7.442   2.938   1.00 60.40  ? 241 ALA A N   1 
ATOM   1481 C CA  . ALA A 1 200 ? 13.245 8.490   3.736   1.00 57.79  ? 241 ALA A CA  1 
ATOM   1482 C C   . ALA A 1 200 ? 11.804 8.729   3.273   1.00 55.07  ? 241 ALA A C   1 
ATOM   1483 O O   . ALA A 1 200 ? 10.890 8.869   4.086   1.00 51.33  ? 241 ALA A O   1 
ATOM   1484 C CB  . ALA A 1 200 ? 14.068 9.791   3.641   1.00 54.44  ? 241 ALA A CB  1 
ATOM   1485 N N   . THR A 1 201 ? 11.619 8.784   1.960   1.00 50.30  ? 242 THR A N   1 
ATOM   1486 C CA  . THR A 1 201 ? 10.313 8.976   1.375   1.00 52.07  ? 242 THR A CA  1 
ATOM   1487 C C   . THR A 1 201 ? 9.293  7.852   1.699   1.00 57.00  ? 242 THR A C   1 
ATOM   1488 O O   . THR A 1 201 ? 8.160  8.139   2.109   1.00 56.48  ? 242 THR A O   1 
ATOM   1489 C CB  . THR A 1 201 ? 10.478 9.175   -0.144  1.00 58.48  ? 242 THR A CB  1 
ATOM   1490 O OG1 . THR A 1 201 ? 10.371 10.574  -0.414  1.00 63.11  ? 242 THR A OG1 1 
ATOM   1491 C CG2 . THR A 1 201 ? 9.415  8.401   -0.959  1.00 59.22  ? 242 THR A CG2 1 
ATOM   1492 N N   . LYS A 1 202 ? 9.693  6.592   1.520   1.00 56.07  ? 243 LYS A N   1 
ATOM   1493 C CA  . LYS A 1 202 ? 8.834  5.445   1.822   1.00 60.90  ? 243 LYS A CA  1 
ATOM   1494 C C   . LYS A 1 202 ? 8.421  5.450   3.284   1.00 62.23  ? 243 LYS A C   1 
ATOM   1495 O O   . LYS A 1 202 ? 7.243  5.271   3.614   1.00 69.66  ? 243 LYS A O   1 
ATOM   1496 C CB  . LYS A 1 202 ? 9.558  4.119   1.549   1.00 69.81  ? 243 LYS A CB  1 
ATOM   1497 C CG  . LYS A 1 202 ? 9.786  3.788   0.088   1.00 82.45  ? 243 LYS A CG  1 
ATOM   1498 C CD  . LYS A 1 202 ? 10.782 2.647   -0.069  1.00 88.50  ? 243 LYS A CD  1 
ATOM   1499 C CE  . LYS A 1 202 ? 11.366 2.628   -1.484  1.00 96.80  ? 243 LYS A CE  1 
ATOM   1500 N NZ  . LYS A 1 202 ? 12.658 1.880   -1.529  1.00 100.32 ? 243 LYS A NZ  1 
ATOM   1501 N N   . ILE A 1 203 ? 9.404  5.634   4.157   1.00 54.17  ? 244 ILE A N   1 
ATOM   1502 C CA  . ILE A 1 203 ? 9.159  5.666   5.589   1.00 55.16  ? 244 ILE A CA  1 
ATOM   1503 C C   . ILE A 1 203 ? 8.222  6.787   5.975   1.00 54.07  ? 244 ILE A C   1 
ATOM   1504 O O   . ILE A 1 203 ? 7.373  6.624   6.838   1.00 58.29  ? 244 ILE A O   1 
ATOM   1505 C CB  . ILE A 1 203 ? 10.499 5.777   6.352   1.00 61.20  ? 244 ILE A CB  1 
ATOM   1506 C CG1 . ILE A 1 203 ? 11.104 4.369   6.486   1.00 59.02  ? 244 ILE A CG1 1 
ATOM   1507 C CG2 . ILE A 1 203 ? 10.307 6.471   7.690   1.00 49.66  ? 244 ILE A CG2 1 
ATOM   1508 C CD1 . ILE A 1 203 ? 12.449 4.357   7.138   1.00 71.32  ? 244 ILE A CD1 1 
ATOM   1509 N N   . MET A 1 204 ? 8.362  7.931   5.324   1.00 58.96  ? 245 MET A N   1 
ATOM   1510 C CA  . MET A 1 204 ? 7.477  9.044   5.610   1.00 60.91  ? 245 MET A CA  1 
ATOM   1511 C C   . MET A 1 204 ? 6.037  8.702   5.262   1.00 61.97  ? 245 MET A C   1 
ATOM   1512 O O   . MET A 1 204 ? 5.148  8.933   6.067   1.00 68.17  ? 245 MET A O   1 
ATOM   1513 C CB  . MET A 1 204 ? 7.890  10.287  4.826   1.00 65.68  ? 245 MET A CB  1 
ATOM   1514 C CG  . MET A 1 204 ? 6.877  11.410  4.960   1.00 63.08  ? 245 MET A CG  1 
ATOM   1515 S SD  . MET A 1 204 ? 7.148  12.765  3.832   1.00 71.92  ? 245 MET A SD  1 
ATOM   1516 C CE  . MET A 1 204 ? 6.673  12.046  2.251   1.00 55.68  ? 245 MET A CE  1 
ATOM   1517 N N   . ASP A 1 205 ? 5.805  8.166   4.063   1.00 63.19  ? 246 ASP A N   1 
ATOM   1518 C CA  . ASP A 1 205 ? 4.447  7.812   3.647   1.00 66.51  ? 246 ASP A CA  1 
ATOM   1519 C C   . ASP A 1 205 ? 3.831  6.788   4.598   1.00 66.49  ? 246 ASP A C   1 
ATOM   1520 O O   . ASP A 1 205 ? 2.635  6.822   4.876   1.00 68.93  ? 246 ASP A O   1 
ATOM   1521 C CB  . ASP A 1 205 ? 4.426  7.277   2.212   1.00 62.43  ? 246 ASP A CB  1 
ATOM   1522 C CG  . ASP A 1 205 ? 4.809  8.337   1.185   1.00 72.85  ? 246 ASP A CG  1 
ATOM   1523 O OD1 . ASP A 1 205 ? 4.447  9.520   1.371   1.00 70.52  ? 246 ASP A OD1 1 
ATOM   1524 O OD2 . ASP A 1 205 ? 5.465  7.983   0.174   1.00 81.32  ? 246 ASP A OD2 1 
ATOM   1525 N N   . LYS A 1 206 ? 4.660  5.883   5.101   1.00 65.65  ? 247 LYS A N   1 
ATOM   1526 C CA  . LYS A 1 206 ? 4.197  4.889   6.047   1.00 64.06  ? 247 LYS A CA  1 
ATOM   1527 C C   . LYS A 1 206 ? 3.827  5.538   7.384   1.00 63.10  ? 247 LYS A C   1 
ATOM   1528 O O   . LYS A 1 206 ? 2.835  5.150   8.003   1.00 64.49  ? 247 LYS A O   1 
ATOM   1529 C CB  . LYS A 1 206 ? 5.263  3.825   6.248   1.00 60.48  ? 247 LYS A CB  1 
ATOM   1530 C CG  . LYS A 1 206 ? 5.458  2.964   5.025   1.00 60.51  ? 247 LYS A CG  1 
ATOM   1531 C CD  . LYS A 1 206 ? 6.535  1.911   5.270   1.00 69.04  ? 247 LYS A CD  1 
ATOM   1532 C CE  . LYS A 1 206 ? 6.650  0.983   4.077   1.00 69.36  ? 247 LYS A CE  1 
ATOM   1533 N NZ  . LYS A 1 206 ? 5.326  0.346   3.814   1.00 80.46  ? 247 LYS A NZ  1 
ATOM   1534 N N   . LEU A 1 207 ? 4.606  6.518   7.832   1.00 58.60  ? 248 LEU A N   1 
ATOM   1535 C CA  . LEU A 1 207 ? 4.275  7.203   9.083   1.00 62.62  ? 248 LEU A CA  1 
ATOM   1536 C C   . LEU A 1 207 ? 3.048  8.087   8.882   1.00 65.12  ? 248 LEU A C   1 
ATOM   1537 O O   . LEU A 1 207 ? 2.209  8.237   9.783   1.00 58.96  ? 248 LEU A O   1 
ATOM   1538 C CB  . LEU A 1 207 ? 5.430  8.071   9.541   1.00 59.30  ? 248 LEU A CB  1 
ATOM   1539 C CG  . LEU A 1 207 ? 6.657  7.262   9.909   1.00 60.02  ? 248 LEU A CG  1 
ATOM   1540 C CD1 . LEU A 1 207 ? 7.822  8.224   10.222  1.00 47.43  ? 248 LEU A CD1 1 
ATOM   1541 C CD2 . LEU A 1 207 ? 6.303  6.329   11.085  1.00 44.56  ? 248 LEU A CD2 1 
ATOM   1542 N N   . ILE A 1 208 ? 2.953  8.686   7.697   1.00 64.19  ? 249 ILE A N   1 
ATOM   1543 C CA  . ILE A 1 208 ? 1.816  9.533   7.411   1.00 67.10  ? 249 ILE A CA  1 
ATOM   1544 C C   . ILE A 1 208 ? 0.599  8.612   7.337   1.00 70.24  ? 249 ILE A C   1 
ATOM   1545 O O   . ILE A 1 208 ? -0.429 8.884   7.948   1.00 73.91  ? 249 ILE A O   1 
ATOM   1546 C CB  . ILE A 1 208 ? 2.007  10.335  6.081   1.00 66.76  ? 249 ILE A CB  1 
ATOM   1547 C CG1 . ILE A 1 208 ? 3.071  11.419  6.276   1.00 62.88  ? 249 ILE A CG1 1 
ATOM   1548 C CG2 . ILE A 1 208 ? 0.707  11.031  5.659   1.00 56.44  ? 249 ILE A CG2 1 
ATOM   1549 C CD1 . ILE A 1 208 ? 3.396  12.180  5.008   1.00 59.31  ? 249 ILE A CD1 1 
ATOM   1550 N N   . ARG A 1 209 ? 0.723  7.495   6.637   1.00 73.59  ? 250 ARG A N   1 
ATOM   1551 C CA  . ARG A 1 209 ? -0.417 6.607   6.518   1.00 73.45  ? 250 ARG A CA  1 
ATOM   1552 C C   . ARG A 1 209 ? -0.799 5.920   7.813   1.00 76.55  ? 250 ARG A C   1 
ATOM   1553 O O   . ARG A 1 209 ? -1.924 6.055   8.288   1.00 75.90  ? 250 ARG A O   1 
ATOM   1554 C CB  . ARG A 1 209 ? -0.181 5.545   5.453   1.00 75.94  ? 250 ARG A CB  1 
ATOM   1555 C CG  . ARG A 1 209 ? -1.416 4.687   5.251   1.00 83.26  ? 250 ARG A CG  1 
ATOM   1556 C CD  . ARG A 1 209 ? -1.212 3.581   4.251   1.00 90.25  ? 250 ARG A CD  1 
ATOM   1557 N NE  . ARG A 1 209 ? -0.180 2.635   4.666   1.00 101.53 ? 250 ARG A NE  1 
ATOM   1558 C CZ  . ARG A 1 209 ? 1.036  2.571   4.126   1.00 107.48 ? 250 ARG A CZ  1 
ATOM   1559 N NH1 . ARG A 1 209 ? 1.378  3.404   3.142   1.00 109.16 ? 250 ARG A NH1 1 
ATOM   1560 N NH2 . ARG A 1 209 ? 1.909  1.669   4.565   1.00 105.67 ? 250 ARG A NH2 1 
ATOM   1561 N N   . ASP A 1 210 ? 0.140  5.192   8.397   1.00 77.16  ? 251 ASP A N   1 
ATOM   1562 C CA  . ASP A 1 210 ? -0.152 4.457   9.613   1.00 77.09  ? 251 ASP A CA  1 
ATOM   1563 C C   . ASP A 1 210 ? 0.319  5.071   10.935  1.00 75.09  ? 251 ASP A C   1 
ATOM   1564 O O   . ASP A 1 210 ? 0.144  4.455   11.984  1.00 73.36  ? 251 ASP A O   1 
ATOM   1565 C CB  . ASP A 1 210 ? 0.425  3.041   9.493   1.00 83.93  ? 251 ASP A CB  1 
ATOM   1566 C CG  . ASP A 1 210 ? 0.056  2.365   8.183   1.00 90.87  ? 251 ASP A CG  1 
ATOM   1567 O OD1 . ASP A 1 210 ? -1.150 2.333   7.840   1.00 97.15  ? 251 ASP A OD1 1 
ATOM   1568 O OD2 . ASP A 1 210 ? 0.975  1.856   7.498   1.00 94.28  ? 251 ASP A OD2 1 
ATOM   1569 N N   . GLY A 1 211 ? 0.925  6.254   10.908  1.00 69.95  ? 252 GLY A N   1 
ATOM   1570 C CA  . GLY A 1 211 ? 1.382  6.844   12.160  1.00 62.63  ? 252 GLY A CA  1 
ATOM   1571 C C   . GLY A 1 211 ? 2.569  6.132   12.811  1.00 62.60  ? 252 GLY A C   1 
ATOM   1572 O O   . GLY A 1 211 ? 2.998  6.511   13.896  1.00 61.71  ? 252 GLY A O   1 
ATOM   1573 N N   . ARG A 1 212 ? 3.090  5.094   12.159  1.00 64.52  ? 253 ARG A N   1 
ATOM   1574 C CA  . ARG A 1 212 ? 4.255  4.337   12.641  1.00 65.23  ? 253 ARG A CA  1 
ATOM   1575 C C   . ARG A 1 212 ? 4.589  3.351   11.537  1.00 62.78  ? 253 ARG A C   1 
ATOM   1576 O O   . ARG A 1 212 ? 3.750  3.074   10.691  1.00 63.39  ? 253 ARG A O   1 
ATOM   1577 C CB  . ARG A 1 212 ? 3.951  3.599   13.953  1.00 70.89  ? 253 ARG A CB  1 
ATOM   1578 C CG  . ARG A 1 212 ? 2.843  2.564   13.842  1.00 84.22  ? 253 ARG A CG  1 
ATOM   1579 C CD  . ARG A 1 212 ? 1.910  2.566   15.059  1.00 89.54  ? 253 ARG A CD  1 
ATOM   1580 N NE  . ARG A 1 212 ? 0.839  1.584   14.885  1.00 95.26  ? 253 ARG A NE  1 
ATOM   1581 C CZ  . ARG A 1 212 ? 1.021  0.262   14.884  1.00 96.45  ? 253 ARG A CZ  1 
ATOM   1582 N NH1 . ARG A 1 212 ? 2.236  -0.252  15.063  1.00 88.97  ? 253 ARG A NH1 1 
ATOM   1583 N NH2 . ARG A 1 212 ? -0.010 -0.549  14.669  1.00 92.88  ? 253 ARG A NH2 1 
ATOM   1584 N N   . VAL A 1 213 ? 5.810  2.835   11.521  1.00 64.18  ? 254 VAL A N   1 
ATOM   1585 C CA  . VAL A 1 213 ? 6.193  1.903   10.470  1.00 70.39  ? 254 VAL A CA  1 
ATOM   1586 C C   . VAL A 1 213 ? 5.995  0.463   10.894  1.00 76.39  ? 254 VAL A C   1 
ATOM   1587 O O   . VAL A 1 213 ? 6.794  -0.091  11.659  1.00 76.48  ? 254 VAL A O   1 
ATOM   1588 C CB  . VAL A 1 213 ? 7.667  2.114   10.031  1.00 74.73  ? 254 VAL A CB  1 
ATOM   1589 C CG1 . VAL A 1 213 ? 8.554  2.219   11.241  1.00 87.42  ? 254 VAL A CG1 1 
ATOM   1590 C CG2 . VAL A 1 213 ? 8.134  0.957   9.171   1.00 70.77  ? 254 VAL A CG2 1 
ATOM   1591 N N   . ILE A 1 214 ? 4.912  -0.128  10.397  1.00 77.88  ? 255 ILE A N   1 
ATOM   1592 C CA  . ILE A 1 214 ? 4.573  -1.513  10.684  1.00 78.20  ? 255 ILE A CA  1 
ATOM   1593 C C   . ILE A 1 214 ? 5.524  -2.422  9.892   1.00 83.56  ? 255 ILE A C   1 
ATOM   1594 O O   . ILE A 1 214 ? 5.608  -2.320  8.668   1.00 87.45  ? 255 ILE A O   1 
ATOM   1595 C CB  . ILE A 1 214 ? 3.124  -1.817  10.254  1.00 72.51  ? 255 ILE A CB  1 
ATOM   1596 C CG1 . ILE A 1 214 ? 2.178  -0.748  10.793  1.00 73.52  ? 255 ILE A CG1 1 
ATOM   1597 C CG2 . ILE A 1 214 ? 2.709  -3.182  10.760  1.00 72.07  ? 255 ILE A CG2 1 
ATOM   1598 C CD1 . ILE A 1 214 ? 0.782  -0.785  10.159  1.00 67.16  ? 255 ILE A CD1 1 
ATOM   1599 N N   . ARG A 1 215 ? 6.246  -3.299  10.582  1.00 90.23  ? 256 ARG A N   1 
ATOM   1600 C CA  . ARG A 1 215 ? 7.173  -4.210  9.905   1.00 100.96 ? 256 ARG A CA  1 
ATOM   1601 C C   . ARG A 1 215 ? 6.763  -5.692  9.958   1.00 109.94 ? 256 ARG A C   1 
ATOM   1602 O O   . ARG A 1 215 ? 5.593  -6.019  10.141  1.00 112.21 ? 256 ARG A O   1 
ATOM   1603 C CB  . ARG A 1 215 ? 8.596  -4.032  10.463  1.00 94.73  ? 256 ARG A CB  1 
ATOM   1604 C CG  . ARG A 1 215 ? 9.247  -2.735  10.026  1.00 86.99  ? 256 ARG A CG  1 
ATOM   1605 C CD  . ARG A 1 215 ? 10.684 -2.665  10.445  1.00 84.37  ? 256 ARG A CD  1 
ATOM   1606 N NE  . ARG A 1 215 ? 11.341 -1.454  9.948   1.00 87.61  ? 256 ARG A NE  1 
ATOM   1607 C CZ  . ARG A 1 215 ? 11.244 -0.253  10.511  1.00 82.58  ? 256 ARG A CZ  1 
ATOM   1608 N NH1 . ARG A 1 215 ? 10.515 -0.083  11.603  1.00 83.34  ? 256 ARG A NH1 1 
ATOM   1609 N NH2 . ARG A 1 215 ? 11.887 0.778   9.988   1.00 76.02  ? 256 ARG A NH2 1 
ATOM   1610 N N   . GLY A 1 216 ? 7.729  -6.588  9.791   1.00 119.93 ? 257 GLY A N   1 
ATOM   1611 C CA  . GLY A 1 216 ? 7.417  -8.005  9.816   1.00 130.73 ? 257 GLY A CA  1 
ATOM   1612 C C   . GLY A 1 216 ? 8.236  -8.798  10.816  1.00 139.10 ? 257 GLY A C   1 
ATOM   1613 O O   . GLY A 1 216 ? 9.323  -9.286  10.499  1.00 139.95 ? 257 GLY A O   1 
ATOM   1614 N N   . TYR A 1 217 ? 7.703  -8.927  12.026  1.00 146.62 ? 258 TYR A N   1 
ATOM   1615 C CA  . TYR A 1 217 ? 8.361  -9.668  13.096  1.00 155.16 ? 258 TYR A CA  1 
ATOM   1616 C C   . TYR A 1 217 ? 7.789  -11.084 13.106  1.00 159.20 ? 258 TYR A C   1 
ATOM   1617 O O   . TYR A 1 217 ? 6.753  -11.330 13.726  1.00 161.29 ? 258 TYR A O   1 
ATOM   1618 C CB  . TYR A 1 217 ? 8.070  -8.994  14.436  1.00 158.12 ? 258 TYR A CB  1 
ATOM   1619 C CG  . TYR A 1 217 ? 8.978  -9.390  15.581  1.00 161.83 ? 258 TYR A CG  1 
ATOM   1620 C CD1 . TYR A 1 217 ? 10.321 -9.018  15.589  1.00 163.86 ? 258 TYR A CD1 1 
ATOM   1621 C CD2 . TYR A 1 217 ? 8.482  -10.093 16.682  1.00 162.85 ? 258 TYR A CD2 1 
ATOM   1622 C CE1 . TYR A 1 217 ? 11.150 -9.326  16.665  1.00 165.51 ? 258 TYR A CE1 1 
ATOM   1623 C CE2 . TYR A 1 217 ? 9.303  -10.409 17.766  1.00 164.17 ? 258 TYR A CE2 1 
ATOM   1624 C CZ  . TYR A 1 217 ? 10.635 -10.019 17.751  1.00 165.40 ? 258 TYR A CZ  1 
ATOM   1625 O OH  . TYR A 1 217 ? 11.451 -10.302 18.823  1.00 165.37 ? 258 TYR A OH  1 
ATOM   1626 N N   . ILE A 1 218 ? 8.448  -12.010 12.413  1.00 162.47 ? 259 ILE A N   1 
ATOM   1627 C CA  . ILE A 1 218 ? 7.969  -13.392 12.367  1.00 164.93 ? 259 ILE A CA  1 
ATOM   1628 C C   . ILE A 1 218 ? 8.345  -14.146 13.646  1.00 167.78 ? 259 ILE A C   1 
ATOM   1629 O O   . ILE A 1 218 ? 7.561  -14.956 14.149  1.00 168.45 ? 259 ILE A O   1 
ATOM   1630 C CB  . ILE A 1 218 ? 8.539  -14.156 11.143  1.00 162.73 ? 259 ILE A CB  1 
ATOM   1631 C CG1 . ILE A 1 218 ? 8.194  -13.409 9.852   1.00 160.84 ? 259 ILE A CG1 1 
ATOM   1632 C CG2 . ILE A 1 218 ? 7.950  -15.560 11.086  1.00 161.65 ? 259 ILE A CG2 1 
ATOM   1633 C CD1 . ILE A 1 218 ? 8.685  -14.093 8.601   1.00 158.01 ? 259 ILE A CD1 1 
ATOM   1634 N N   . GLY A 1 219 ? 9.542  -13.871 14.166  1.00 169.84 ? 260 GLY A N   1 
ATOM   1635 C CA  . GLY A 1 219 ? 9.999  -14.520 15.385  1.00 170.91 ? 260 GLY A CA  1 
ATOM   1636 C C   . GLY A 1 219 ? 11.152 -15.489 15.183  1.00 171.37 ? 260 GLY A C   1 
ATOM   1637 O O   . GLY A 1 219 ? 11.106 -16.626 15.657  1.00 172.39 ? 260 GLY A O   1 
ATOM   1638 N N   . ILE A 1 220 ? 12.190 -15.047 14.480  1.00 171.03 ? 261 ILE A N   1 
ATOM   1639 C CA  . ILE A 1 220 ? 13.353 -15.892 14.229  1.00 169.95 ? 261 ILE A CA  1 
ATOM   1640 C C   . ILE A 1 220 ? 14.666 -15.105 14.224  1.00 170.79 ? 261 ILE A C   1 
ATOM   1641 O O   . ILE A 1 220 ? 15.246 -14.846 13.167  1.00 169.79 ? 261 ILE A O   1 
ATOM   1642 C CB  . ILE A 1 220 ? 13.213 -16.651 12.885  1.00 167.77 ? 261 ILE A CB  1 
ATOM   1643 C CG1 . ILE A 1 220 ? 12.781 -15.687 11.778  1.00 166.96 ? 261 ILE A CG1 1 
ATOM   1644 C CG2 . ILE A 1 220 ? 12.216 -17.788 13.030  1.00 165.35 ? 261 ILE A CG2 1 
ATOM   1645 C CD1 . ILE A 1 220 ? 12.747 -16.312 10.399  1.00 166.14 ? 261 ILE A CD1 1 
ATOM   1646 N N   . GLY A 1 221 ? 15.131 -14.731 15.415  1.00 171.08 ? 262 GLY A N   1 
ATOM   1647 C CA  . GLY A 1 221 ? 16.375 -13.989 15.525  1.00 171.71 ? 262 GLY A CA  1 
ATOM   1648 C C   . GLY A 1 221 ? 17.588 -14.894 15.382  1.00 172.52 ? 262 GLY A C   1 
ATOM   1649 O O   . GLY A 1 221 ? 17.538 -16.070 15.751  1.00 173.57 ? 262 GLY A O   1 
ATOM   1650 N N   . GLY A 1 222 ? 18.680 -14.352 14.846  1.00 171.72 ? 263 GLY A N   1 
ATOM   1651 C CA  . GLY A 1 222 ? 19.889 -15.139 14.667  1.00 170.79 ? 263 GLY A CA  1 
ATOM   1652 C C   . GLY A 1 222 ? 21.173 -14.345 14.839  1.00 169.58 ? 263 GLY A C   1 
ATOM   1653 O O   . GLY A 1 222 ? 21.195 -13.321 15.521  1.00 168.68 ? 263 GLY A O   1 
ATOM   1654 N N   . ARG A 1 223 ? 22.250 -14.822 14.221  1.00 169.39 ? 264 ARG A N   1 
ATOM   1655 C CA  . ARG A 1 223 ? 23.544 -14.155 14.307  1.00 169.17 ? 264 ARG A CA  1 
ATOM   1656 C C   . ARG A 1 223 ? 24.401 -14.473 13.087  1.00 169.02 ? 264 ARG A C   1 
ATOM   1657 O O   . ARG A 1 223 ? 23.969 -14.293 11.948  1.00 169.38 ? 264 ARG A O   1 
ATOM   1658 C CB  . ARG A 1 223 ? 24.268 -14.581 15.576  1.00 169.35 ? 264 ARG A CB  1 
ATOM   1659 N N   . ILE A 1 241 ? 19.005 -18.462 3.453   1.00 173.90 ? 282 ILE A N   1 
ATOM   1660 C CA  . ILE A 1 241 ? 19.856 -18.603 4.628   1.00 175.59 ? 282 ILE A CA  1 
ATOM   1661 C C   . ILE A 1 241 ? 19.433 -19.800 5.478   1.00 177.37 ? 282 ILE A C   1 
ATOM   1662 O O   . ILE A 1 241 ? 18.799 -20.731 4.979   1.00 177.43 ? 282 ILE A O   1 
ATOM   1663 C CB  . ILE A 1 241 ? 19.818 -17.328 5.459   1.00 174.02 ? 282 ILE A CB  1 
ATOM   1664 N N   . VAL A 1 242 ? 19.783 -19.764 6.762   1.00 179.42 ? 283 VAL A N   1 
ATOM   1665 C CA  . VAL A 1 242 ? 19.473 -20.849 7.696   1.00 181.44 ? 283 VAL A CA  1 
ATOM   1666 C C   . VAL A 1 242 ? 19.209 -20.295 9.094   1.00 182.32 ? 283 VAL A C   1 
ATOM   1667 O O   . VAL A 1 242 ? 19.749 -19.251 9.456   1.00 182.77 ? 283 VAL A O   1 
ATOM   1668 C CB  . VAL A 1 242 ? 20.664 -21.831 7.814   1.00 182.16 ? 283 VAL A CB  1 
ATOM   1669 C CG1 . VAL A 1 242 ? 20.338 -22.945 8.790   1.00 181.56 ? 283 VAL A CG1 1 
ATOM   1670 C CG2 . VAL A 1 242 ? 21.023 -22.388 6.451   1.00 182.96 ? 283 VAL A CG2 1 
ATOM   1671 N N   . VAL A 1 243 ? 18.389 -20.993 9.878   1.00 182.66 ? 284 VAL A N   1 
ATOM   1672 C CA  . VAL A 1 243 ? 18.103 -20.557 11.245  1.00 183.45 ? 284 VAL A CA  1 
ATOM   1673 C C   . VAL A 1 243 ? 19.443 -20.551 11.980  1.00 184.79 ? 284 VAL A C   1 
ATOM   1674 O O   . VAL A 1 243 ? 20.148 -21.564 12.004  1.00 183.51 ? 284 VAL A O   1 
ATOM   1675 C CB  . VAL A 1 243 ? 17.126 -21.517 11.955  1.00 182.90 ? 284 VAL A CB  1 
ATOM   1676 C CG1 . VAL A 1 243 ? 16.819 -21.007 13.354  1.00 182.43 ? 284 VAL A CG1 1 
ATOM   1677 C CG2 . VAL A 1 243 ? 15.843 -21.639 11.148  1.00 182.47 ? 284 VAL A CG2 1 
ATOM   1678 N N   . ASN A 1 244 ? 19.788 -19.415 12.583  1.00 186.79 ? 285 ASN A N   1 
ATOM   1679 C CA  . ASN A 1 244 ? 21.071 -19.283 13.261  1.00 188.93 ? 285 ASN A CA  1 
ATOM   1680 C C   . ASN A 1 244 ? 21.207 -19.661 14.733  1.00 190.36 ? 285 ASN A C   1 
ATOM   1681 O O   . ASN A 1 244 ? 20.592 -20.627 15.190  1.00 190.99 ? 285 ASN A O   1 
ATOM   1682 C CB  . ASN A 1 244 ? 21.633 -17.880 13.036  1.00 189.01 ? 285 ASN A CB  1 
ATOM   1683 C CG  . ASN A 1 244 ? 22.199 -17.703 11.635  1.00 189.75 ? 285 ASN A CG  1 
ATOM   1684 O OD1 . ASN A 1 244 ? 22.735 -16.650 11.295  1.00 189.82 ? 285 ASN A OD1 1 
ATOM   1685 N ND2 . ASN A 1 244 ? 22.081 -18.745 10.814  1.00 189.81 ? 285 ASN A ND2 1 
ATOM   1686 N N   . GLU A 1 245 ? 22.005 -18.891 15.474  1.00 191.27 ? 286 GLU A N   1 
ATOM   1687 C CA  . GLU A 1 245 ? 22.304 -19.225 16.868  1.00 192.51 ? 286 GLU A CA  1 
ATOM   1688 C C   . GLU A 1 245 ? 22.322 -18.154 17.968  1.00 193.91 ? 286 GLU A C   1 
ATOM   1689 O O   . GLU A 1 245 ? 22.698 -18.460 19.102  1.00 194.69 ? 286 GLU A O   1 
ATOM   1690 C CB  . GLU A 1 245 ? 23.666 -19.918 16.883  1.00 191.17 ? 286 GLU A CB  1 
ATOM   1691 C CG  . GLU A 1 245 ? 24.736 -19.095 16.157  1.00 187.84 ? 286 GLU A CG  1 
ATOM   1692 C CD  . GLU A 1 245 ? 26.136 -19.653 16.309  1.00 186.74 ? 286 GLU A CD  1 
ATOM   1693 O OE1 . GLU A 1 245 ? 26.347 -20.837 15.981  1.00 185.66 ? 286 GLU A OE1 1 
ATOM   1694 O OE2 . GLU A 1 245 ? 27.028 -18.900 16.753  1.00 185.92 ? 286 GLU A OE2 1 
ATOM   1695 N N   . VAL A 1 246 ? 21.932 -16.921 17.671  1.00 194.71 ? 287 VAL A N   1 
ATOM   1696 C CA  . VAL A 1 246 ? 21.976 -15.874 18.694  1.00 195.11 ? 287 VAL A CA  1 
ATOM   1697 C C   . VAL A 1 246 ? 20.909 -15.953 19.791  1.00 195.66 ? 287 VAL A C   1 
ATOM   1698 O O   . VAL A 1 246 ? 21.234 -16.143 20.964  1.00 194.96 ? 287 VAL A O   1 
ATOM   1699 C CB  . VAL A 1 246 ? 21.927 -14.506 18.030  1.00 194.78 ? 287 VAL A CB  1 
ATOM   1700 N N   . SER A 1 247 ? 19.643 -15.797 19.408  1.00 196.90 ? 288 SER A N   1 
ATOM   1701 C CA  . SER A 1 247 ? 18.535 -15.823 20.363  1.00 197.58 ? 288 SER A CA  1 
ATOM   1702 C C   . SER A 1 247 ? 17.465 -16.866 20.012  1.00 198.49 ? 288 SER A C   1 
ATOM   1703 O O   . SER A 1 247 ? 17.484 -17.447 18.924  1.00 198.70 ? 288 SER A O   1 
ATOM   1704 C CB  . SER A 1 247 ? 17.905 -14.434 20.449  1.00 196.82 ? 288 SER A CB  1 
ATOM   1705 N N   . PRO A 1 248 ? 16.514 -17.116 20.937  1.00 198.89 ? 289 PRO A N   1 
ATOM   1706 C CA  . PRO A 1 248 ? 15.426 -18.086 20.744  1.00 198.63 ? 289 PRO A CA  1 
ATOM   1707 C C   . PRO A 1 248 ? 14.300 -17.565 19.843  1.00 197.91 ? 289 PRO A C   1 
ATOM   1708 O O   . PRO A 1 248 ? 14.108 -16.356 19.717  1.00 198.12 ? 289 PRO A O   1 
ATOM   1709 C CB  . PRO A 1 248 ? 14.945 -18.337 22.168  1.00 199.17 ? 289 PRO A CB  1 
ATOM   1710 C CG  . PRO A 1 248 ? 15.108 -16.995 22.795  1.00 198.90 ? 289 PRO A CG  1 
ATOM   1711 C CD  . PRO A 1 248 ? 16.488 -16.585 22.314  1.00 199.15 ? 289 PRO A CD  1 
ATOM   1712 N N   . ASP A 1 249 ? 13.558 -18.484 19.227  1.00 196.49 ? 290 ASP A N   1 
ATOM   1713 C CA  . ASP A 1 249 ? 12.455 -18.124 18.340  1.00 195.63 ? 290 ASP A CA  1 
ATOM   1714 C C   . ASP A 1 249 ? 11.159 -17.875 19.113  1.00 195.24 ? 290 ASP A C   1 
ATOM   1715 O O   . ASP A 1 249 ? 11.137 -17.943 20.343  1.00 194.80 ? 290 ASP A O   1 
ATOM   1716 C CB  . ASP A 1 249 ? 12.240 -19.226 17.298  1.00 194.82 ? 290 ASP A CB  1 
ATOM   1717 N N   . GLY A 1 250 ? 10.084 -17.579 18.382  1.00 195.14 ? 291 GLY A N   1 
ATOM   1718 C CA  . GLY A 1 250 ? 8.791  -17.322 19.004  1.00 194.88 ? 291 GLY A CA  1 
ATOM   1719 C C   . GLY A 1 250 ? 7.646  -17.773 18.114  1.00 195.06 ? 291 GLY A C   1 
ATOM   1720 O O   . GLY A 1 250 ? 7.619  -18.927 17.688  1.00 196.19 ? 291 GLY A O   1 
ATOM   1721 N N   . PRO A 1 251 ? 6.679  -16.892 17.814  1.00 194.73 ? 292 PRO A N   1 
ATOM   1722 C CA  . PRO A 1 251 ? 5.534  -17.232 16.961  1.00 195.08 ? 292 PRO A CA  1 
ATOM   1723 C C   . PRO A 1 251 ? 5.949  -17.768 15.589  1.00 194.87 ? 292 PRO A C   1 
ATOM   1724 O O   . PRO A 1 251 ? 5.121  -18.291 14.841  1.00 193.90 ? 292 PRO A O   1 
ATOM   1725 C CB  . PRO A 1 251 ? 4.782  -15.909 16.855  1.00 194.98 ? 292 PRO A CB  1 
ATOM   1726 C CG  . PRO A 1 251 ? 5.054  -15.273 18.178  1.00 194.51 ? 292 PRO A CG  1 
ATOM   1727 C CD  . PRO A 1 251 ? 6.532  -15.531 18.360  1.00 193.85 ? 292 PRO A CD  1 
ATOM   1728 N N   . ALA A 1 252 ? 7.233  -17.631 15.272  1.00 194.97 ? 293 ALA A N   1 
ATOM   1729 C CA  . ALA A 1 252 ? 7.772  -18.091 13.998  1.00 195.31 ? 293 ALA A CA  1 
ATOM   1730 C C   . ALA A 1 252 ? 7.993  -19.596 13.980  1.00 195.37 ? 293 ALA A C   1 
ATOM   1731 O O   . ALA A 1 252 ? 8.093  -20.203 12.914  1.00 196.16 ? 293 ALA A O   1 
ATOM   1732 C CB  . ALA A 1 252 ? 9.078  -17.379 13.698  1.00 195.72 ? 293 ALA A CB  1 
ATOM   1733 N N   . ALA A 1 253 ? 8.085  -20.194 15.164  1.00 194.64 ? 294 ALA A N   1 
ATOM   1734 C CA  . ALA A 1 253 ? 8.284  -21.635 15.277  1.00 192.70 ? 294 ALA A CA  1 
ATOM   1735 C C   . ALA A 1 253 ? 6.944  -22.307 15.558  1.00 190.97 ? 294 ALA A C   1 
ATOM   1736 O O   . ALA A 1 253 ? 6.832  -23.532 15.508  1.00 190.55 ? 294 ALA A O   1 
ATOM   1737 C CB  . ALA A 1 253 ? 9.274  -21.945 16.395  1.00 192.40 ? 294 ALA A CB  1 
ATOM   1738 N N   . ASN A 1 254 ? 5.931  -21.493 15.845  1.00 189.05 ? 295 ASN A N   1 
ATOM   1739 C CA  . ASN A 1 254 ? 4.590  -21.988 16.134  1.00 187.52 ? 295 ASN A CA  1 
ATOM   1740 C C   . ASN A 1 254 ? 3.881  -22.435 14.857  1.00 187.28 ? 295 ASN A C   1 
ATOM   1741 O O   . ASN A 1 254 ? 2.657  -22.564 14.827  1.00 187.65 ? 295 ASN A O   1 
ATOM   1742 C CB  . ASN A 1 254 ? 3.776  -20.903 16.833  1.00 186.05 ? 295 ASN A CB  1 
ATOM   1743 N N   . ALA A 1 255 ? 4.660  -22.671 13.805  1.00 187.21 ? 296 ALA A N   1 
ATOM   1744 C CA  . ALA A 1 255 ? 4.125  -23.111 12.520  1.00 187.30 ? 296 ALA A CA  1 
ATOM   1745 C C   . ALA A 1 255 ? 5.211  -23.828 11.722  1.00 187.53 ? 296 ALA A C   1 
ATOM   1746 O O   . ALA A 1 255 ? 4.922  -24.666 10.867  1.00 186.98 ? 296 ALA A O   1 
ATOM   1747 C CB  . ALA A 1 255 ? 3.599  -21.917 11.736  1.00 187.03 ? 296 ALA A CB  1 
ATOM   1748 N N   . GLY A 1 256 ? 6.461  -23.485 12.010  1.00 188.00 ? 297 GLY A N   1 
ATOM   1749 C CA  . GLY A 1 256 ? 7.583  -24.099 11.328  1.00 189.58 ? 297 GLY A CA  1 
ATOM   1750 C C   . GLY A 1 256 ? 8.669  -24.461 12.320  1.00 191.88 ? 297 GLY A C   1 
ATOM   1751 O O   . GLY A 1 256 ? 9.482  -23.617 12.701  1.00 191.59 ? 297 GLY A O   1 
ATOM   1752 N N   . ILE A 1 257 ? 8.675  -25.719 12.752  1.00 194.68 ? 298 ILE A N   1 
ATOM   1753 C CA  . ILE A 1 257 ? 9.667  -26.196 13.708  1.00 197.37 ? 298 ILE A CA  1 
ATOM   1754 C C   . ILE A 1 257 ? 11.059 -25.777 13.252  1.00 198.82 ? 298 ILE A C   1 
ATOM   1755 O O   . ILE A 1 257 ? 11.499 -26.148 12.163  1.00 199.61 ? 298 ILE A O   1 
ATOM   1756 C CB  . ILE A 1 257 ? 9.590  -27.717 13.828  1.00 196.64 ? 298 ILE A CB  1 
ATOM   1757 N N   . GLN A 1 258 ? 11.748 -25.001 14.084  1.00 199.71 ? 299 GLN A N   1 
ATOM   1758 C CA  . GLN A 1 258 ? 13.091 -24.543 13.746  1.00 199.52 ? 299 GLN A CA  1 
ATOM   1759 C C   . GLN A 1 258 ? 13.922 -24.147 14.963  1.00 199.12 ? 299 GLN A C   1 
ATOM   1760 O O   . GLN A 1 258 ? 13.453 -23.429 15.845  1.00 199.81 ? 299 GLN A O   1 
ATOM   1761 C CB  . GLN A 1 258 ? 13.009 -23.368 12.774  1.00 199.41 ? 299 GLN A CB  1 
ATOM   1762 N N   . VAL A 1 259 ? 15.159 -24.633 15.000  1.00 198.20 ? 300 VAL A N   1 
ATOM   1763 C CA  . VAL A 1 259 ? 16.103 -24.323 16.070  1.00 197.75 ? 300 VAL A CA  1 
ATOM   1764 C C   . VAL A 1 259 ? 17.496 -24.394 15.450  1.00 198.22 ? 300 VAL A C   1 
ATOM   1765 O O   . VAL A 1 259 ? 18.470 -23.878 16.002  1.00 198.41 ? 300 VAL A O   1 
ATOM   1766 C CB  . VAL A 1 259 ? 16.009 -25.327 17.252  1.00 196.83 ? 300 VAL A CB  1 
ATOM   1767 C CG1 . VAL A 1 259 ? 17.041 -24.976 18.318  1.00 196.33 ? 300 VAL A CG1 1 
ATOM   1768 C CG2 . VAL A 1 259 ? 14.616 -25.294 17.861  1.00 194.98 ? 300 VAL A CG2 1 
ATOM   1769 N N   . ASN A 1 260 ? 17.570 -25.031 14.284  1.00 198.17 ? 301 ASN A N   1 
ATOM   1770 C CA  . ASN A 1 260 ? 18.823 -25.180 13.553  1.00 197.70 ? 301 ASN A CA  1 
ATOM   1771 C C   . ASN A 1 260 ? 18.596 -25.810 12.176  1.00 197.38 ? 301 ASN A C   1 
ATOM   1772 O O   . ASN A 1 260 ? 19.033 -26.934 11.922  1.00 197.57 ? 301 ASN A O   1 
ATOM   1773 C CB  . ASN A 1 260 ? 19.799 -26.028 14.361  1.00 196.96 ? 301 ASN A CB  1 
ATOM   1774 N N   . ASP A 1 261 ? 17.907 -25.086 11.294  1.00 196.56 ? 302 ASP A N   1 
ATOM   1775 C CA  . ASP A 1 261 ? 17.635 -25.577 9.943   1.00 194.41 ? 302 ASP A CA  1 
ATOM   1776 C C   . ASP A 1 261 ? 17.651 -24.440 8.920   1.00 194.06 ? 302 ASP A C   1 
ATOM   1777 O O   . ASP A 1 261 ? 17.366 -23.287 9.245   1.00 193.70 ? 302 ASP A O   1 
ATOM   1778 C CB  . ASP A 1 261 ? 16.285 -26.306 9.890   1.00 191.32 ? 302 ASP A CB  1 
ATOM   1779 C CG  . ASP A 1 261 ? 15.106 -25.356 9.864   1.00 187.98 ? 302 ASP A CG  1 
ATOM   1780 O OD1 . ASP A 1 261 ? 14.904 -24.617 10.850  1.00 185.70 ? 302 ASP A OD1 1 
ATOM   1781 O OD2 . ASP A 1 261 ? 14.379 -25.350 8.849   1.00 185.56 ? 302 ASP A OD2 1 
ATOM   1782 N N   . LEU A 1 262 ? 17.989 -24.778 7.680   1.00 193.67 ? 303 LEU A N   1 
ATOM   1783 C CA  . LEU A 1 262 ? 18.063 -23.802 6.601   1.00 193.11 ? 303 LEU A CA  1 
ATOM   1784 C C   . LEU A 1 262 ? 16.698 -23.297 6.155   1.00 192.90 ? 303 LEU A C   1 
ATOM   1785 O O   . LEU A 1 262 ? 15.666 -23.688 6.701   1.00 193.94 ? 303 LEU A O   1 
ATOM   1786 C CB  . LEU A 1 262 ? 18.801 -24.405 5.414   1.00 193.52 ? 303 LEU A CB  1 
ATOM   1787 N N   . ILE A 1 263 ? 16.711 -22.424 5.154   1.00 191.14 ? 304 ILE A N   1 
ATOM   1788 C CA  . ILE A 1 263 ? 15.491 -21.854 4.600   1.00 188.93 ? 304 ILE A CA  1 
ATOM   1789 C C   . ILE A 1 263 ? 15.751 -21.489 3.136   1.00 187.69 ? 304 ILE A C   1 
ATOM   1790 O O   . ILE A 1 263 ? 16.601 -20.651 2.831   1.00 187.35 ? 304 ILE A O   1 
ATOM   1791 C CB  . ILE A 1 263 ? 15.050 -20.613 5.414   1.00 188.27 ? 304 ILE A CB  1 
ATOM   1792 C CG1 . ILE A 1 263 ? 13.756 -20.039 4.842   1.00 187.95 ? 304 ILE A CG1 1 
ATOM   1793 C CG2 . ILE A 1 263 ? 16.156 -19.577 5.431   1.00 188.76 ? 304 ILE A CG2 1 
ATOM   1794 C CD1 . ILE A 1 263 ? 13.187 -18.910 5.671   1.00 186.59 ? 304 ILE A CD1 1 
ATOM   1795 N N   . ILE A 1 264 ? 15.019 -22.142 2.236   1.00 186.67 ? 305 ILE A N   1 
ATOM   1796 C CA  . ILE A 1 264 ? 15.170 -21.939 0.796   1.00 185.88 ? 305 ILE A CA  1 
ATOM   1797 C C   . ILE A 1 264 ? 14.687 -20.590 0.276   1.00 184.98 ? 305 ILE A C   1 
ATOM   1798 O O   . ILE A 1 264 ? 15.483 -19.670 0.093   1.00 184.53 ? 305 ILE A O   1 
ATOM   1799 C CB  . ILE A 1 264 ? 14.465 -23.062 0.044   1.00 185.85 ? 305 ILE A CB  1 
ATOM   1800 N N   . SER A 1 265 ? 13.385 -20.486 0.017   1.00 184.08 ? 306 SER A N   1 
ATOM   1801 C CA  . SER A 1 265 ? 12.796 -19.249 -0.491  1.00 181.94 ? 306 SER A CA  1 
ATOM   1802 C C   . SER A 1 265 ? 11.528 -18.884 0.277   1.00 180.17 ? 306 SER A C   1 
ATOM   1803 O O   . SER A 1 265 ? 10.638 -19.716 0.463   1.00 180.07 ? 306 SER A O   1 
ATOM   1804 C CB  . SER A 1 265 ? 12.463 -19.386 -1.983  1.00 181.53 ? 306 SER A CB  1 
ATOM   1805 O OG  . SER A 1 265 ? 11.319 -20.198 -2.188  1.00 181.10 ? 306 SER A OG  1 
ATOM   1806 N N   . VAL A 1 266 ? 11.450 -17.633 0.717   1.00 177.66 ? 307 VAL A N   1 
ATOM   1807 C CA  . VAL A 1 266 ? 10.294 -17.163 1.464   1.00 174.63 ? 307 VAL A CA  1 
ATOM   1808 C C   . VAL A 1 266 ? 9.321  -16.410 0.563   1.00 173.33 ? 307 VAL A C   1 
ATOM   1809 O O   . VAL A 1 266 ? 9.710  -15.512 -0.184  1.00 173.62 ? 307 VAL A O   1 
ATOM   1810 C CB  . VAL A 1 266 ? 10.718 -16.236 2.622   1.00 173.83 ? 307 VAL A CB  1 
ATOM   1811 C CG1 . VAL A 1 266 ? 9.504  -15.827 3.431   1.00 172.86 ? 307 VAL A CG1 1 
ATOM   1812 C CG2 . VAL A 1 266 ? 11.726 -16.943 3.508   1.00 173.11 ? 307 VAL A CG2 1 
ATOM   1813 N N   . ASP A 1 267 ? 8.053  -16.793 0.638   1.00 171.20 ? 308 ASP A N   1 
ATOM   1814 C CA  . ASP A 1 267 ? 7.003  -16.167 -0.151  1.00 169.10 ? 308 ASP A CA  1 
ATOM   1815 C C   . ASP A 1 267 ? 7.237  -16.312 -1.656  1.00 168.74 ? 308 ASP A C   1 
ATOM   1816 O O   . ASP A 1 267 ? 7.037  -15.363 -2.414  1.00 169.62 ? 308 ASP A O   1 
ATOM   1817 C CB  . ASP A 1 267 ? 6.884  -14.681 0.210   1.00 168.58 ? 308 ASP A CB  1 
ATOM   1818 C CG  . ASP A 1 267 ? 5.444  -14.180 0.168   1.00 167.99 ? 308 ASP A CG  1 
ATOM   1819 O OD1 . ASP A 1 267 ? 4.766  -14.370 -0.864  1.00 167.41 ? 308 ASP A OD1 1 
ATOM   1820 O OD2 . ASP A 1 267 ? 4.988  -13.587 1.167   1.00 168.32 ? 308 ASP A OD2 1 
ATOM   1821 N N   . ASN A 1 268 ? 7.671  -17.493 -2.084  1.00 167.89 ? 309 ASN A N   1 
ATOM   1822 C CA  . ASN A 1 268 ? 7.892  -17.766 -3.503  1.00 168.36 ? 309 ASN A CA  1 
ATOM   1823 C C   . ASN A 1 268 ? 9.032  -16.984 -4.177  1.00 169.59 ? 309 ASN A C   1 
ATOM   1824 O O   . ASN A 1 268 ? 8.962  -16.687 -5.372  1.00 169.30 ? 309 ASN A O   1 
ATOM   1825 C CB  . ASN A 1 268 ? 6.587  -17.530 -4.276  1.00 166.66 ? 309 ASN A CB  1 
ATOM   1826 C CG  . ASN A 1 268 ? 6.233  -18.684 -5.199  1.00 165.01 ? 309 ASN A CG  1 
ATOM   1827 O OD1 . ASN A 1 268 ? 6.991  -19.028 -6.107  1.00 163.78 ? 309 ASN A OD1 1 
ATOM   1828 N ND2 . ASN A 1 268 ? 5.070  -19.286 -4.970  1.00 163.04 ? 309 ASN A ND2 1 
ATOM   1829 N N   . LYS A 1 269 ? 10.073 -16.645 -3.421  1.00 171.02 ? 310 LYS A N   1 
ATOM   1830 C CA  . LYS A 1 269 ? 11.225 -15.936 -3.986  1.00 172.31 ? 310 LYS A CA  1 
ATOM   1831 C C   . LYS A 1 269 ? 12.504 -16.386 -3.283  1.00 173.93 ? 310 LYS A C   1 
ATOM   1832 O O   . LYS A 1 269 ? 12.527 -16.532 -2.062  1.00 174.23 ? 310 LYS A O   1 
ATOM   1833 C CB  . LYS A 1 269 ? 11.083 -14.417 -3.844  1.00 171.35 ? 310 LYS A CB  1 
ATOM   1834 C CG  . LYS A 1 269 ? 12.185 -13.653 -4.584  1.00 171.33 ? 310 LYS A CG  1 
ATOM   1835 C CD  . LYS A 1 269 ? 12.749 -12.494 -3.776  1.00 169.56 ? 310 LYS A CD  1 
ATOM   1836 C CE  . LYS A 1 269 ? 11.843 -11.283 -3.827  1.00 167.23 ? 310 LYS A CE  1 
ATOM   1837 N NZ  . LYS A 1 269 ? 11.714 -10.785 -5.220  1.00 167.85 ? 310 LYS A NZ  1 
ATOM   1838 N N   . PRO A 1 270 ? 13.589 -16.600 -4.048  1.00 175.13 ? 311 PRO A N   1 
ATOM   1839 C CA  . PRO A 1 270 ? 14.881 -17.038 -3.507  1.00 175.09 ? 311 PRO A CA  1 
ATOM   1840 C C   . PRO A 1 270 ? 15.248 -16.393 -2.176  1.00 175.15 ? 311 PRO A C   1 
ATOM   1841 O O   . PRO A 1 270 ? 15.295 -15.167 -2.062  1.00 175.78 ? 311 PRO A O   1 
ATOM   1842 C CB  . PRO A 1 270 ? 15.856 -16.664 -4.615  1.00 175.46 ? 311 PRO A CB  1 
ATOM   1843 C CG  . PRO A 1 270 ? 15.054 -16.919 -5.840  1.00 176.07 ? 311 PRO A CG  1 
ATOM   1844 C CD  . PRO A 1 270 ? 13.699 -16.330 -5.494  1.00 175.65 ? 311 PRO A CD  1 
ATOM   1845 N N   . ALA A 1 271 ? 15.510 -17.229 -1.175  1.00 174.62 ? 312 ALA A N   1 
ATOM   1846 C CA  . ALA A 1 271 ? 15.880 -16.752 0.153   1.00 174.89 ? 312 ALA A CA  1 
ATOM   1847 C C   . ALA A 1 271 ? 17.218 -17.343 0.592   1.00 175.28 ? 312 ALA A C   1 
ATOM   1848 O O   . ALA A 1 271 ? 17.268 -18.338 1.317   1.00 175.60 ? 312 ALA A O   1 
ATOM   1849 C CB  . ALA A 1 271 ? 14.792 -17.112 1.157   1.00 174.04 ? 312 ALA A CB  1 
ATOM   1850 N N   . THR A 1 277 ? 16.991 -9.889  3.256   1.00 157.33 ? 318 THR A N   1 
ATOM   1851 C CA  . THR A 1 277 ? 15.739 -10.421 2.728   1.00 156.34 ? 318 THR A CA  1 
ATOM   1852 C C   . THR A 1 277 ? 14.573 -10.080 3.655   1.00 156.52 ? 318 THR A C   1 
ATOM   1853 O O   . THR A 1 277 ? 13.433 -10.471 3.401   1.00 156.08 ? 318 THR A O   1 
ATOM   1854 C CB  . THR A 1 277 ? 15.814 -11.957 2.568   1.00 155.46 ? 318 THR A CB  1 
ATOM   1855 O OG1 . THR A 1 277 ? 16.979 -12.302 1.808   1.00 153.12 ? 318 THR A OG1 1 
ATOM   1856 C CG2 . THR A 1 277 ? 14.577 -12.485 1.847   1.00 154.36 ? 318 THR A CG2 1 
ATOM   1857 N N   . MET A 1 278 ? 14.859 -9.345  4.726   1.00 156.49 ? 319 MET A N   1 
ATOM   1858 C CA  . MET A 1 278 ? 13.819 -8.973  5.677   1.00 157.03 ? 319 MET A CA  1 
ATOM   1859 C C   . MET A 1 278 ? 13.007 -7.766  5.229   1.00 156.34 ? 319 MET A C   1 
ATOM   1860 O O   . MET A 1 278 ? 12.090 -7.338  5.932   1.00 156.99 ? 319 MET A O   1 
ATOM   1861 C CB  . MET A 1 278 ? 14.415 -8.712  7.069   1.00 158.35 ? 319 MET A CB  1 
ATOM   1862 C CG  . MET A 1 278 ? 15.398 -7.555  7.170   1.00 158.69 ? 319 MET A CG  1 
ATOM   1863 S SD  . MET A 1 278 ? 16.041 -7.366  8.859   1.00 158.25 ? 319 MET A SD  1 
ATOM   1864 C CE  . MET A 1 278 ? 14.700 -6.431  9.650   1.00 156.12 ? 319 MET A CE  1 
ATOM   1865 N N   . ASP A 1 279 ? 13.339 -7.218  4.064   1.00 155.32 ? 320 ASP A N   1 
ATOM   1866 C CA  . ASP A 1 279 ? 12.612 -6.065  3.539   1.00 154.48 ? 320 ASP A CA  1 
ATOM   1867 C C   . ASP A 1 279 ? 11.181 -6.495  3.248   1.00 153.35 ? 320 ASP A C   1 
ATOM   1868 O O   . ASP A 1 279 ? 10.223 -5.819  3.628   1.00 152.45 ? 320 ASP A O   1 
ATOM   1869 C CB  . ASP A 1 279 ? 13.267 -5.554  2.258   1.00 155.86 ? 320 ASP A CB  1 
ATOM   1870 C CG  . ASP A 1 279 ? 14.730 -5.217  2.449   1.00 158.26 ? 320 ASP A CG  1 
ATOM   1871 O OD1 . ASP A 1 279 ? 15.047 -4.423  3.361   1.00 159.22 ? 320 ASP A OD1 1 
ATOM   1872 O OD2 . ASP A 1 279 ? 15.563 -5.745  1.685   1.00 160.53 ? 320 ASP A OD2 1 
ATOM   1873 N N   . GLN A 1 280 ? 11.048 -7.629  2.565   1.00 152.58 ? 321 GLN A N   1 
ATOM   1874 C CA  . GLN A 1 280 ? 9.740  -8.174  2.237   1.00 149.93 ? 321 GLN A CA  1 
ATOM   1875 C C   . GLN A 1 280 ? 9.119  -8.626  3.546   1.00 147.66 ? 321 GLN A C   1 
ATOM   1876 O O   . GLN A 1 280 ? 7.970  -8.310  3.839   1.00 148.04 ? 321 GLN A O   1 
ATOM   1877 C CB  . GLN A 1 280 ? 9.882  -9.353  1.285   1.00 150.26 ? 321 GLN A CB  1 
ATOM   1878 N N   . VAL A 1 281 ? 9.900  -9.358  4.336   1.00 144.51 ? 322 VAL A N   1 
ATOM   1879 C CA  . VAL A 1 281 ? 9.444  -9.853  5.629   1.00 142.02 ? 322 VAL A CA  1 
ATOM   1880 C C   . VAL A 1 281 ? 8.709  -8.738  6.377   1.00 140.51 ? 322 VAL A C   1 
ATOM   1881 O O   . VAL A 1 281 ? 7.551  -8.893  6.770   1.00 141.05 ? 322 VAL A O   1 
ATOM   1882 C CB  . VAL A 1 281 ? 10.640 -10.334 6.494   1.00 141.00 ? 322 VAL A CB  1 
ATOM   1883 C CG1 . VAL A 1 281 ? 10.137 -10.932 7.802   1.00 139.52 ? 322 VAL A CG1 1 
ATOM   1884 C CG2 . VAL A 1 281 ? 11.466 -11.346 5.723   1.00 136.70 ? 322 VAL A CG2 1 
ATOM   1885 N N   . ALA A 1 282 ? 9.390  -7.609  6.552   1.00 137.03 ? 323 ALA A N   1 
ATOM   1886 C CA  . ALA A 1 282 ? 8.829  -6.463  7.249   1.00 132.68 ? 323 ALA A CA  1 
ATOM   1887 C C   . ALA A 1 282 ? 7.705  -5.805  6.460   1.00 132.35 ? 323 ALA A C   1 
ATOM   1888 O O   . ALA A 1 282 ? 6.834  -5.146  7.029   1.00 132.78 ? 323 ALA A O   1 
ATOM   1889 C CB  . ALA A 1 282 ? 9.927  -5.450  7.535   1.00 129.76 ? 323 ALA A CB  1 
ATOM   1890 N N   . GLU A 1 283 ? 7.720  -6.005  5.148   1.00 132.03 ? 324 GLU A N   1 
ATOM   1891 C CA  . GLU A 1 283 ? 6.726  -5.412  4.265   1.00 132.22 ? 324 GLU A CA  1 
ATOM   1892 C C   . GLU A 1 283 ? 5.574  -6.337  3.883   1.00 134.66 ? 324 GLU A C   1 
ATOM   1893 O O   . GLU A 1 283 ? 4.654  -5.913  3.189   1.00 135.11 ? 324 GLU A O   1 
ATOM   1894 C CB  . GLU A 1 283 ? 7.418  -4.929  2.989   1.00 130.52 ? 324 GLU A CB  1 
ATOM   1895 C CG  . GLU A 1 283 ? 6.548  -4.090  2.077   1.00 131.51 ? 324 GLU A CG  1 
ATOM   1896 C CD  . GLU A 1 283 ? 6.220  -2.733  2.674   1.00 131.79 ? 324 GLU A CD  1 
ATOM   1897 O OE1 . GLU A 1 283 ? 7.168  -1.971  2.969   1.00 130.97 ? 324 GLU A OE1 1 
ATOM   1898 O OE2 . GLU A 1 283 ? 5.020  -2.428  2.845   1.00 126.58 ? 324 GLU A OE2 1 
ATOM   1899 N N   . ILE A 1 284 ? 5.609  -7.588  4.340   1.00 138.79 ? 325 ILE A N   1 
ATOM   1900 C CA  . ILE A 1 284 ? 4.568  -8.560  3.990   1.00 141.41 ? 325 ILE A CA  1 
ATOM   1901 C C   . ILE A 1 284 ? 3.169  -8.324  4.574   1.00 142.56 ? 325 ILE A C   1 
ATOM   1902 O O   . ILE A 1 284 ? 2.215  -8.997  4.177   1.00 145.33 ? 325 ILE A O   1 
ATOM   1903 C CB  . ILE A 1 284 ? 5.031  -10.013 4.324   1.00 139.90 ? 325 ILE A CB  1 
ATOM   1904 C CG1 . ILE A 1 284 ? 6.247  -10.373 3.467   1.00 139.10 ? 325 ILE A CG1 1 
ATOM   1905 C CG2 . ILE A 1 284 ? 3.922  -11.021 4.032   1.00 138.47 ? 325 ILE A CG2 1 
ATOM   1906 C CD1 . ILE A 1 284 ? 6.030  -10.198 1.968   1.00 136.67 ? 325 ILE A CD1 1 
ATOM   1907 N N   . ARG A 1 285 ? 3.039  -7.369  5.491   1.00 141.02 ? 326 ARG A N   1 
ATOM   1908 C CA  . ARG A 1 285 ? 1.741  -7.065  6.096   1.00 141.71 ? 326 ARG A CA  1 
ATOM   1909 C C   . ARG A 1 285 ? 1.365  -8.100  7.141   1.00 144.16 ? 326 ARG A C   1 
ATOM   1910 O O   . ARG A 1 285 ? 0.821  -9.150  6.813   1.00 145.34 ? 326 ARG A O   1 
ATOM   1911 C CB  . ARG A 1 285 ? 0.640  -7.010  5.022   1.00 139.32 ? 326 ARG A CB  1 
ATOM   1912 C CG  . ARG A 1 285 ? -0.786 -7.166  5.555   1.00 136.88 ? 326 ARG A CG  1 
ATOM   1913 C CD  . ARG A 1 285 ? -1.393 -5.848  6.016   1.00 136.37 ? 326 ARG A CD  1 
ATOM   1914 N NE  . ARG A 1 285 ? -2.060 -5.136  4.926   1.00 134.39 ? 326 ARG A NE  1 
ATOM   1915 C CZ  . ARG A 1 285 ? -2.638 -3.943  5.048   1.00 131.45 ? 326 ARG A CZ  1 
ATOM   1916 N NH1 . ARG A 1 285 ? -2.636 -3.314  6.214   1.00 129.82 ? 326 ARG A NH1 1 
ATOM   1917 N NH2 . ARG A 1 285 ? -3.226 -3.379  4.003   1.00 130.42 ? 326 ARG A NH2 1 
ATOM   1918 N N   . PRO A 1 286 ? 1.654  -7.819  8.420   1.00 147.53 ? 327 PRO A N   1 
ATOM   1919 C CA  . PRO A 1 286 ? 1.329  -8.748  9.503   1.00 149.52 ? 327 PRO A CA  1 
ATOM   1920 C C   . PRO A 1 286 ? -0.107 -9.249  9.401   1.00 152.10 ? 327 PRO A C   1 
ATOM   1921 O O   . PRO A 1 286 ? -1.052 -8.456  9.353   1.00 150.73 ? 327 PRO A O   1 
ATOM   1922 C CB  . PRO A 1 286 ? 1.570  -7.908  10.749  1.00 148.41 ? 327 PRO A CB  1 
ATOM   1923 C CG  . PRO A 1 286 ? 2.748  -7.099  10.350  1.00 147.86 ? 327 PRO A CG  1 
ATOM   1924 C CD  . PRO A 1 286 ? 2.374  -6.647  8.946   1.00 149.08 ? 327 PRO A CD  1 
ATOM   1925 N N   . GLY A 1 287 ? -0.255 -10.570 9.360   1.00 154.39 ? 328 GLY A N   1 
ATOM   1926 C CA  . GLY A 1 287 ? -1.573 -11.164 9.255   1.00 157.04 ? 328 GLY A CA  1 
ATOM   1927 C C   . GLY A 1 287 ? -1.821 -11.787 7.893   1.00 158.90 ? 328 GLY A C   1 
ATOM   1928 O O   . GLY A 1 287 ? -2.800 -11.452 7.221   1.00 158.62 ? 328 GLY A O   1 
ATOM   1929 N N   . SER A 1 288 ? -0.934 -12.692 7.487   1.00 159.87 ? 329 SER A N   1 
ATOM   1930 C CA  . SER A 1 288 ? -1.054 -13.375 6.200   1.00 161.70 ? 329 SER A CA  1 
ATOM   1931 C C   . SER A 1 288 ? -0.167 -14.626 6.137   1.00 161.91 ? 329 SER A C   1 
ATOM   1932 O O   . SER A 1 288 ? 1.060  -14.522 6.110   1.00 162.80 ? 329 SER A O   1 
ATOM   1933 C CB  . SER A 1 288 ? -0.681 -12.420 5.059   1.00 163.12 ? 329 SER A CB  1 
ATOM   1934 O OG  . SER A 1 288 ? -1.578 -11.321 4.985   1.00 164.74 ? 329 SER A OG  1 
ATOM   1935 N N   . VAL A 1 289 ? -0.794 -15.802 6.113   1.00 160.56 ? 330 VAL A N   1 
ATOM   1936 C CA  . VAL A 1 289 ? -0.072 -17.074 6.053   1.00 158.37 ? 330 VAL A CA  1 
ATOM   1937 C C   . VAL A 1 289 ? 0.888  -17.091 4.871   1.00 157.64 ? 330 VAL A C   1 
ATOM   1938 O O   . VAL A 1 289 ? 0.480  -16.923 3.723   1.00 155.02 ? 330 VAL A O   1 
ATOM   1939 C CB  . VAL A 1 289 ? -1.055 -18.227 5.941   1.00 157.36 ? 330 VAL A CB  1 
ATOM   1940 N N   . ILE A 1 290 ? 2.166  -17.306 5.159   1.00 159.74 ? 331 ILE A N   1 
ATOM   1941 C CA  . ILE A 1 290 ? 3.186  -17.318 4.120   1.00 162.67 ? 331 ILE A CA  1 
ATOM   1942 C C   . ILE A 1 290 ? 3.896  -18.658 3.962   1.00 164.03 ? 331 ILE A C   1 
ATOM   1943 O O   . ILE A 1 290 ? 4.306  -19.279 4.945   1.00 163.81 ? 331 ILE A O   1 
ATOM   1944 C CB  . ILE A 1 290 ? 4.265  -16.239 4.390   1.00 162.77 ? 331 ILE A CB  1 
ATOM   1945 C CG1 . ILE A 1 290 ? 5.257  -16.184 3.225   1.00 162.13 ? 331 ILE A CG1 1 
ATOM   1946 C CG2 . ILE A 1 290 ? 5.008  -16.554 5.685   1.00 161.69 ? 331 ILE A CG2 1 
ATOM   1947 C CD1 . ILE A 1 290 ? 6.350  -15.159 3.403   1.00 160.83 ? 331 ILE A CD1 1 
ATOM   1948 N N   . PRO A 1 291 ? 4.046  -19.119 2.711   1.00 165.04 ? 332 PRO A N   1 
ATOM   1949 C CA  . PRO A 1 291 ? 4.715  -20.388 2.417   1.00 165.81 ? 332 PRO A CA  1 
ATOM   1950 C C   . PRO A 1 291 ? 6.243  -20.243 2.406   1.00 166.20 ? 332 PRO A C   1 
ATOM   1951 O O   . PRO A 1 291 ? 6.817  -19.633 1.499   1.00 164.75 ? 332 PRO A O   1 
ATOM   1952 C CB  . PRO A 1 291 ? 4.150  -20.758 1.048   1.00 165.69 ? 332 PRO A CB  1 
ATOM   1953 C CG  . PRO A 1 291 ? 3.982  -19.420 0.400   1.00 166.09 ? 332 PRO A CG  1 
ATOM   1954 C CD  . PRO A 1 291 ? 3.365  -18.596 1.511   1.00 165.13 ? 332 PRO A CD  1 
ATOM   1955 N N   . VAL A 1 292 ? 6.892  -20.801 3.425   1.00 167.05 ? 333 VAL A N   1 
ATOM   1956 C CA  . VAL A 1 292 ? 8.345  -20.748 3.540   1.00 167.11 ? 333 VAL A CA  1 
ATOM   1957 C C   . VAL A 1 292 ? 8.954  -22.133 3.278   1.00 169.48 ? 333 VAL A C   1 
ATOM   1958 O O   . VAL A 1 292 ? 8.724  -23.082 4.036   1.00 170.22 ? 333 VAL A O   1 
ATOM   1959 C CB  . VAL A 1 292 ? 8.768  -20.239 4.943   1.00 164.85 ? 333 VAL A CB  1 
ATOM   1960 C CG1 . VAL A 1 292 ? 8.140  -21.098 6.032   1.00 162.55 ? 333 VAL A CG1 1 
ATOM   1961 C CG2 . VAL A 1 292 ? 10.279 -20.242 5.061   1.00 164.20 ? 333 VAL A CG2 1 
ATOM   1962 N N   . VAL A 1 293 ? 9.724  -22.239 2.195   1.00 169.85 ? 334 VAL A N   1 
ATOM   1963 C CA  . VAL A 1 293 ? 10.365 -23.495 1.802   1.00 168.12 ? 334 VAL A CA  1 
ATOM   1964 C C   . VAL A 1 293 ? 11.652 -23.770 2.579   1.00 167.60 ? 334 VAL A C   1 
ATOM   1965 O O   . VAL A 1 293 ? 12.563 -22.941 2.608   1.00 167.18 ? 334 VAL A O   1 
ATOM   1966 C CB  . VAL A 1 293 ? 10.692 -23.505 0.283   1.00 167.51 ? 334 VAL A CB  1 
ATOM   1967 C CG1 . VAL A 1 293 ? 11.491 -24.746 -0.075  1.00 167.36 ? 334 VAL A CG1 1 
ATOM   1968 C CG2 . VAL A 1 293 ? 9.406  -23.468 -0.527  1.00 167.22 ? 334 VAL A CG2 1 
ATOM   1969 N N   . VAL A 1 294 ? 11.711 -24.945 3.202   1.00 166.24 ? 335 VAL A N   1 
ATOM   1970 C CA  . VAL A 1 294 ? 12.869 -25.368 3.984   1.00 164.05 ? 335 VAL A CA  1 
ATOM   1971 C C   . VAL A 1 294 ? 13.079 -24.485 5.208   1.00 162.87 ? 335 VAL A C   1 
ATOM   1972 O O   . VAL A 1 294 ? 13.395 -24.977 6.291   1.00 160.85 ? 335 VAL A O   1 
ATOM   1973 C CB  . VAL A 1 294 ? 14.120 -25.364 3.110   1.00 163.82 ? 335 VAL A CB  1 
ATOM   1974 N N   . LEU A 1 303 ? 6.650  -24.730 5.675   1.00 188.17 ? 344 LEU A N   1 
ATOM   1975 C CA  . LEU A 1 303 ? 5.820  -24.349 6.813   1.00 188.60 ? 344 LEU A CA  1 
ATOM   1976 C C   . LEU A 1 303 ? 4.857  -23.227 6.432   1.00 188.74 ? 344 LEU A C   1 
ATOM   1977 O O   . LEU A 1 303 ? 5.131  -22.447 5.521   1.00 189.53 ? 344 LEU A O   1 
ATOM   1978 C CB  . LEU A 1 303 ? 6.703  -23.909 7.978   1.00 188.14 ? 344 LEU A CB  1 
ATOM   1979 N N   . GLN A 1 304 ? 3.730  -23.153 7.135   1.00 188.05 ? 345 GLN A N   1 
ATOM   1980 C CA  . GLN A 1 304 ? 2.725  -22.125 6.874   1.00 187.63 ? 345 GLN A CA  1 
ATOM   1981 C C   . GLN A 1 304 ? 2.634  -21.138 8.041   1.00 187.07 ? 345 GLN A C   1 
ATOM   1982 O O   . GLN A 1 304 ? 1.684  -21.175 8.828   1.00 187.54 ? 345 GLN A O   1 
ATOM   1983 C CB  . GLN A 1 304 ? 1.364  -22.774 6.625   1.00 187.33 ? 345 GLN A CB  1 
ATOM   1984 N N   . VAL A 1 305 ? 3.627  -20.256 8.141   1.00 185.05 ? 346 VAL A N   1 
ATOM   1985 C CA  . VAL A 1 305 ? 3.678  -19.258 9.205   1.00 181.07 ? 346 VAL A CA  1 
ATOM   1986 C C   . VAL A 1 305 ? 2.955  -17.986 8.773   1.00 178.83 ? 346 VAL A C   1 
ATOM   1987 O O   . VAL A 1 305 ? 3.017  -17.598 7.609   1.00 177.90 ? 346 VAL A O   1 
ATOM   1988 C CB  . VAL A 1 305 ? 5.140  -18.880 9.552   1.00 180.27 ? 346 VAL A CB  1 
ATOM   1989 C CG1 . VAL A 1 305 ? 5.184  -18.127 10.873  1.00 179.18 ? 346 VAL A CG1 1 
ATOM   1990 C CG2 . VAL A 1 305 ? 6.007  -20.127 9.607   1.00 179.53 ? 346 VAL A CG2 1 
ATOM   1991 N N   . THR A 1 306 ? 2.265  -17.346 9.712   1.00 177.17 ? 347 THR A N   1 
ATOM   1992 C CA  . THR A 1 306 ? 1.550  -16.105 9.425   1.00 175.12 ? 347 THR A CA  1 
ATOM   1993 C C   . THR A 1 306 ? 2.338  -14.946 10.039  1.00 174.18 ? 347 THR A C   1 
ATOM   1994 O O   . THR A 1 306 ? 2.547  -14.901 11.252  1.00 173.87 ? 347 THR A O   1 
ATOM   1995 C CB  . THR A 1 306 ? 0.112  -16.124 10.011  1.00 174.48 ? 347 THR A CB  1 
ATOM   1996 O OG1 . THR A 1 306 ? 0.169  -16.210 11.440  1.00 173.85 ? 347 THR A OG1 1 
ATOM   1997 C CG2 . THR A 1 306 ? -0.667 -17.315 9.473   1.00 172.53 ? 347 THR A CG2 1 
ATOM   1998 N N   . ILE A 1 307 ? 2.783  -14.017 9.196   1.00 172.75 ? 348 ILE A N   1 
ATOM   1999 C CA  . ILE A 1 307 ? 3.567  -12.872 9.652   1.00 171.09 ? 348 ILE A CA  1 
ATOM   2000 C C   . ILE A 1 307 ? 2.902  -12.096 10.786  1.00 169.81 ? 348 ILE A C   1 
ATOM   2001 O O   . ILE A 1 307 ? 1.674  -11.991 10.851  1.00 169.72 ? 348 ILE A O   1 
ATOM   2002 C CB  . ILE A 1 307 ? 3.858  -11.880 8.495   1.00 171.51 ? 348 ILE A CB  1 
ATOM   2003 C CG1 . ILE A 1 307 ? 4.643  -12.577 7.383   1.00 171.93 ? 348 ILE A CG1 1 
ATOM   2004 C CG2 . ILE A 1 307 ? 4.659  -10.691 9.010   1.00 170.54 ? 348 ILE A CG2 1 
ATOM   2005 C CD1 . ILE A 1 307 ? 3.815  -13.514 6.537   1.00 172.58 ? 348 ILE A CD1 1 
ATOM   2006 N N   . GLN A 1 308 ? 3.735  -11.557 11.674  1.00 167.31 ? 349 GLN A N   1 
ATOM   2007 C CA  . GLN A 1 308 ? 3.275  -10.770 12.813  1.00 163.83 ? 349 GLN A CA  1 
ATOM   2008 C C   . GLN A 1 308 ? 3.999  -9.424  12.825  1.00 161.31 ? 349 GLN A C   1 
ATOM   2009 O O   . GLN A 1 308 ? 5.027  -9.256  12.168  1.00 160.42 ? 349 GLN A O   1 
ATOM   2010 C CB  . GLN A 1 308 ? 3.542  -11.521 14.110  1.00 163.72 ? 349 GLN A CB  1 
ATOM   2011 N N   . GLU A 1 309 ? 3.461  -8.472  13.579  1.00 157.80 ? 350 GLU A N   1 
ATOM   2012 C CA  . GLU A 1 309 ? 4.044  -7.141  13.664  1.00 154.15 ? 350 GLU A CA  1 
ATOM   2013 C C   . GLU A 1 309 ? 5.187  -7.053  14.668  1.00 152.22 ? 350 GLU A C   1 
ATOM   2014 O O   . GLU A 1 309 ? 5.116  -7.619  15.756  1.00 150.47 ? 350 GLU A O   1 
ATOM   2015 C CB  . GLU A 1 309 ? 2.965  -6.129  14.019  1.00 154.50 ? 350 GLU A CB  1 
ATOM   2016 N N   . TYR A 1 310 ? 6.236  -6.331  14.285  1.00 151.49 ? 351 TYR A N   1 
ATOM   2017 C CA  . TYR A 1 310 ? 7.407  -6.125  15.132  1.00 151.45 ? 351 TYR A CA  1 
ATOM   2018 C C   . TYR A 1 310 ? 6.924  -5.672  16.508  1.00 150.27 ? 351 TYR A C   1 
ATOM   2019 O O   . TYR A 1 310 ? 5.843  -5.102  16.631  1.00 149.25 ? 351 TYR A O   1 
ATOM   2020 C CB  . TYR A 1 310 ? 8.303  -5.045  14.517  1.00 154.20 ? 351 TYR A CB  1 
ATOM   2021 C CG  . TYR A 1 310 ? 9.792  -5.303  14.627  1.00 158.19 ? 351 TYR A CG  1 
ATOM   2022 C CD1 . TYR A 1 310 ? 10.422 -6.230  13.798  1.00 159.55 ? 351 TYR A CD1 1 
ATOM   2023 C CD2 . TYR A 1 310 ? 10.573 -4.621  15.563  1.00 160.77 ? 351 TYR A CD2 1 
ATOM   2024 C CE1 . TYR A 1 310 ? 11.796 -6.470  13.898  1.00 160.14 ? 351 TYR A CE1 1 
ATOM   2025 C CE2 . TYR A 1 310 ? 11.945 -4.857  15.673  1.00 159.93 ? 351 TYR A CE2 1 
ATOM   2026 C CZ  . TYR A 1 310 ? 12.548 -5.782  14.838  1.00 159.86 ? 351 TYR A CZ  1 
ATOM   2027 O OH  . TYR A 1 310 ? 13.900 -6.021  14.944  1.00 160.26 ? 351 TYR A OH  1 
ATOM   2028 N N   . PRO A 1 311 ? 7.718  -5.920  17.561  1.00 150.23 ? 352 PRO A N   1 
ATOM   2029 C CA  . PRO A 1 311 ? 7.339  -5.522  18.919  1.00 150.42 ? 352 PRO A CA  1 
ATOM   2030 C C   . PRO A 1 311 ? 6.684  -4.143  18.997  1.00 150.12 ? 352 PRO A C   1 
ATOM   2031 O O   . PRO A 1 311 ? 5.489  -4.079  19.357  1.00 148.90 ? 352 PRO A O   1 
ATOM   2032 C CB  . PRO A 1 311 ? 8.666  -5.579  19.666  1.00 150.10 ? 352 PRO A CB  1 
ATOM   2033 C CG  . PRO A 1 311 ? 9.317  -6.762  19.044  1.00 150.58 ? 352 PRO A CG  1 
ATOM   2034 C CD  . PRO A 1 311 ? 9.044  -6.564  17.562  1.00 150.49 ? 352 PRO A CD  1 
ATOM   2035 N N   . MET B 1 1   ? 40.409 14.069  -22.031 1.00 95.60  ? 42  MET B N   1 
ATOM   2036 C CA  . MET B 1 1   ? 39.925 15.003  -20.982 1.00 88.35  ? 42  MET B CA  1 
ATOM   2037 C C   . MET B 1 1   ? 41.096 15.613  -20.224 1.00 84.32  ? 42  MET B C   1 
ATOM   2038 O O   . MET B 1 1   ? 42.247 15.184  -20.347 1.00 85.88  ? 42  MET B O   1 
ATOM   2039 C CB  . MET B 1 1   ? 39.013 14.272  -19.995 1.00 95.74  ? 42  MET B CB  1 
ATOM   2040 C CG  . MET B 1 1   ? 37.794 13.647  -20.627 1.00 98.88  ? 42  MET B CG  1 
ATOM   2041 S SD  . MET B 1 1   ? 37.019 12.465  -19.526 1.00 107.17 ? 42  MET B SD  1 
ATOM   2042 C CE  . MET B 1 1   ? 36.526 13.565  -18.158 1.00 106.45 ? 42  MET B CE  1 
ATOM   2043 N N   . THR B 1 2   ? 40.771 16.617  -19.423 1.00 77.05  ? 43  THR B N   1 
ATOM   2044 C CA  . THR B 1 2   ? 41.743 17.330  -18.623 1.00 71.72  ? 43  THR B CA  1 
ATOM   2045 C C   . THR B 1 2   ? 41.272 17.302  -17.147 1.00 65.65  ? 43  THR B C   1 
ATOM   2046 O O   . THR B 1 2   ? 40.060 17.295  -16.863 1.00 67.84  ? 43  THR B O   1 
ATOM   2047 C CB  . THR B 1 2   ? 41.848 18.760  -19.156 1.00 74.95  ? 43  THR B CB  1 
ATOM   2048 O OG1 . THR B 1 2   ? 42.678 19.543  -18.294 1.00 88.22  ? 43  THR B OG1 1 
ATOM   2049 C CG2 . THR B 1 2   ? 40.454 19.379  -19.255 1.00 72.30  ? 43  THR B CG2 1 
ATOM   2050 N N   . PRO B 1 3   ? 42.218 17.272  -16.193 1.00 57.09  ? 44  PRO B N   1 
ATOM   2051 C CA  . PRO B 1 3   ? 41.927 17.233  -14.744 1.00 60.02  ? 44  PRO B CA  1 
ATOM   2052 C C   . PRO B 1 3   ? 41.236 18.481  -14.166 1.00 57.54  ? 44  PRO B C   1 
ATOM   2053 O O   . PRO B 1 3   ? 41.763 19.581  -14.300 1.00 58.49  ? 44  PRO B O   1 
ATOM   2054 C CB  . PRO B 1 3   ? 43.303 17.026  -14.115 1.00 55.89  ? 44  PRO B CB  1 
ATOM   2055 C CG  . PRO B 1 3   ? 44.089 16.339  -15.211 1.00 62.74  ? 44  PRO B CG  1 
ATOM   2056 C CD  . PRO B 1 3   ? 43.652 17.076  -16.445 1.00 58.02  ? 44  PRO B CD  1 
ATOM   2057 N N   . ALA B 1 4   ? 40.080 18.304  -13.519 1.00 48.86  ? 45  ALA B N   1 
ATOM   2058 C CA  . ALA B 1 4   ? 39.375 19.434  -12.927 1.00 45.22  ? 45  ALA B CA  1 
ATOM   2059 C C   . ALA B 1 4   ? 40.364 20.007  -11.958 1.00 50.65  ? 45  ALA B C   1 
ATOM   2060 O O   . ALA B 1 4   ? 40.963 19.270  -11.168 1.00 60.67  ? 45  ALA B O   1 
ATOM   2061 C CB  . ALA B 1 4   ? 38.125 18.989  -12.196 1.00 41.79  ? 45  ALA B CB  1 
ATOM   2062 N N   . SER B 1 5   ? 40.551 21.322  -12.010 1.00 55.47  ? 46  SER B N   1 
ATOM   2063 C CA  . SER B 1 5   ? 41.531 21.952  -11.147 1.00 55.14  ? 46  SER B CA  1 
ATOM   2064 C C   . SER B 1 5   ? 41.307 23.426  -10.999 1.00 53.95  ? 46  SER B C   1 
ATOM   2065 O O   . SER B 1 5   ? 40.903 24.079  -11.955 1.00 61.00  ? 46  SER B O   1 
ATOM   2066 C CB  . SER B 1 5   ? 42.920 21.754  -11.730 1.00 42.39  ? 46  SER B CB  1 
ATOM   2067 O OG  . SER B 1 5   ? 43.830 22.642  -11.102 1.00 49.56  ? 46  SER B OG  1 
ATOM   2068 N N   . TYR B 1 6   ? 41.578 23.945  -9.804  1.00 49.74  ? 47  TYR B N   1 
ATOM   2069 C CA  . TYR B 1 6   ? 41.459 25.374  -9.542  1.00 47.47  ? 47  TYR B CA  1 
ATOM   2070 C C   . TYR B 1 6   ? 42.858 25.955  -9.526  1.00 47.45  ? 47  TYR B C   1 
ATOM   2071 O O   . TYR B 1 6   ? 43.079 27.002  -8.936  1.00 54.03  ? 47  TYR B O   1 
ATOM   2072 C CB  . TYR B 1 6   ? 40.770 25.658  -8.190  1.00 41.79  ? 47  TYR B CB  1 
ATOM   2073 C CG  . TYR B 1 6   ? 39.379 25.039  -8.085  1.00 41.23  ? 47  TYR B CG  1 
ATOM   2074 C CD1 . TYR B 1 6   ? 39.165 23.891  -7.335  1.00 44.18  ? 47  TYR B CD1 1 
ATOM   2075 C CD2 . TYR B 1 6   ? 38.318 25.545  -8.796  1.00 38.65  ? 47  TYR B CD2 1 
ATOM   2076 C CE1 . TYR B 1 6   ? 37.960 23.272  -7.308  1.00 41.92  ? 47  TYR B CE1 1 
ATOM   2077 C CE2 . TYR B 1 6   ? 37.087 24.926  -8.774  1.00 36.83  ? 47  TYR B CE2 1 
ATOM   2078 C CZ  . TYR B 1 6   ? 36.918 23.789  -8.036  1.00 38.32  ? 47  TYR B CZ  1 
ATOM   2079 O OH  . TYR B 1 6   ? 35.724 23.114  -8.062  1.00 46.96  ? 47  TYR B OH  1 
ATOM   2080 N N   . ASN B 1 7   ? 43.815 25.277  -10.155 1.00 51.16  ? 48  ASN B N   1 
ATOM   2081 C CA  . ASN B 1 7   ? 45.168 25.809  -10.147 1.00 58.67  ? 48  ASN B CA  1 
ATOM   2082 C C   . ASN B 1 7   ? 45.271 27.243  -10.706 1.00 59.72  ? 48  ASN B C   1 
ATOM   2083 O O   . ASN B 1 7   ? 46.126 28.018  -10.247 1.00 58.70  ? 48  ASN B O   1 
ATOM   2084 C CB  . ASN B 1 7   ? 46.130 24.868  -10.872 1.00 62.05  ? 48  ASN B CB  1 
ATOM   2085 C CG  . ASN B 1 7   ? 47.488 25.503  -11.102 1.00 57.06  ? 48  ASN B CG  1 
ATOM   2086 O OD1 . ASN B 1 7   ? 47.801 25.925  -12.211 1.00 62.31  ? 48  ASN B OD1 1 
ATOM   2087 N ND2 . ASN B 1 7   ? 48.287 25.599  -10.053 1.00 53.79  ? 48  ASN B ND2 1 
ATOM   2088 N N   . LEU B 1 8   ? 44.406 27.597  -11.671 1.00 59.64  ? 49  LEU B N   1 
ATOM   2089 C CA  . LEU B 1 8   ? 44.369 28.959  -12.243 1.00 60.74  ? 49  LEU B CA  1 
ATOM   2090 C C   . LEU B 1 8   ? 44.220 29.969  -11.088 1.00 62.47  ? 49  LEU B C   1 
ATOM   2091 O O   . LEU B 1 8   ? 45.084 30.829  -10.884 1.00 61.24  ? 49  LEU B O   1 
ATOM   2092 C CB  . LEU B 1 8   ? 43.186 29.131  -13.210 1.00 57.80  ? 49  LEU B CB  1 
ATOM   2093 C CG  . LEU B 1 8   ? 42.999 30.548  -13.810 1.00 65.49  ? 49  LEU B CG  1 
ATOM   2094 C CD1 . LEU B 1 8   ? 44.117 30.875  -14.816 1.00 53.81  ? 49  LEU B CD1 1 
ATOM   2095 C CD2 . LEU B 1 8   ? 41.675 30.648  -14.513 1.00 61.81  ? 49  LEU B CD2 1 
ATOM   2096 N N   . ALA B 1 9   ? 43.123 29.874  -10.337 1.00 59.75  ? 50  ALA B N   1 
ATOM   2097 C CA  . ALA B 1 9   ? 42.948 30.753  -9.181  1.00 54.70  ? 50  ALA B CA  1 
ATOM   2098 C C   . ALA B 1 9   ? 44.202 30.718  -8.301  1.00 47.68  ? 50  ALA B C   1 
ATOM   2099 O O   . ALA B 1 9   ? 44.533 31.705  -7.663  1.00 54.32  ? 50  ALA B O   1 
ATOM   2100 C CB  . ALA B 1 9   ? 41.758 30.327  -8.374  1.00 52.24  ? 50  ALA B CB  1 
ATOM   2101 N N   . VAL B 1 10  ? 44.899 29.588  -8.251  1.00 47.68  ? 51  VAL B N   1 
ATOM   2102 C CA  . VAL B 1 10  ? 46.112 29.509  -7.436  1.00 50.64  ? 51  VAL B CA  1 
ATOM   2103 C C   . VAL B 1 10  ? 47.219 30.382  -8.053  1.00 49.61  ? 51  VAL B C   1 
ATOM   2104 O O   . VAL B 1 10  ? 47.803 31.219  -7.386  1.00 49.62  ? 51  VAL B O   1 
ATOM   2105 C CB  . VAL B 1 10  ? 46.647 28.020  -7.285  1.00 52.67  ? 51  VAL B CB  1 
ATOM   2106 C CG1 . VAL B 1 10  ? 48.011 27.993  -6.466  1.00 34.96  ? 51  VAL B CG1 1 
ATOM   2107 C CG2 . VAL B 1 10  ? 45.611 27.155  -6.583  1.00 50.35  ? 51  VAL B CG2 1 
ATOM   2108 N N   . ARG B 1 11  ? 47.503 30.190  -9.332  1.00 51.16  ? 52  ARG B N   1 
ATOM   2109 C CA  . ARG B 1 11  ? 48.555 30.970  -9.967  1.00 56.41  ? 52  ARG B CA  1 
ATOM   2110 C C   . ARG B 1 11  ? 48.266 32.469  -9.845  1.00 63.27  ? 52  ARG B C   1 
ATOM   2111 O O   . ARG B 1 11  ? 49.165 33.273  -9.525  1.00 58.54  ? 52  ARG B O   1 
ATOM   2112 C CB  . ARG B 1 11  ? 48.677 30.557  -11.434 1.00 60.32  ? 52  ARG B CB  1 
ATOM   2113 C CG  . ARG B 1 11  ? 48.819 29.068  -11.617 1.00 66.77  ? 52  ARG B CG  1 
ATOM   2114 C CD  . ARG B 1 11  ? 49.327 28.716  -12.986 1.00 68.08  ? 52  ARG B CD  1 
ATOM   2115 N NE  . ARG B 1 11  ? 48.505 29.295  -14.046 1.00 76.76  ? 52  ARG B NE  1 
ATOM   2116 C CZ  . ARG B 1 11  ? 47.505 28.667  -14.653 1.00 78.08  ? 52  ARG B CZ  1 
ATOM   2117 N NH1 . ARG B 1 11  ? 47.182 27.429  -14.308 1.00 82.82  ? 52  ARG B NH1 1 
ATOM   2118 N NH2 . ARG B 1 11  ? 46.844 29.271  -15.630 1.00 83.93  ? 52  ARG B NH2 1 
ATOM   2119 N N   . ARG B 1 12  ? 46.999 32.832  -10.081 1.00 63.12  ? 53  ARG B N   1 
ATOM   2120 C CA  . ARG B 1 12  ? 46.557 34.224  -10.001 1.00 59.09  ? 53  ARG B CA  1 
ATOM   2121 C C   . ARG B 1 12  ? 46.609 34.884  -8.627  1.00 57.57  ? 53  ARG B C   1 
ATOM   2122 O O   . ARG B 1 12  ? 47.081 36.017  -8.484  1.00 63.68  ? 53  ARG B O   1 
ATOM   2123 C CB  . ARG B 1 12  ? 45.129 34.360  -10.528 1.00 57.12  ? 53  ARG B CB  1 
ATOM   2124 C CG  . ARG B 1 12  ? 45.011 34.309  -12.043 1.00 58.23  ? 53  ARG B CG  1 
ATOM   2125 C CD  . ARG B 1 12  ? 43.578 34.540  -12.449 1.00 60.94  ? 53  ARG B CD  1 
ATOM   2126 N NE  . ARG B 1 12  ? 43.401 34.556  -13.895 1.00 66.25  ? 53  ARG B NE  1 
ATOM   2127 C CZ  . ARG B 1 12  ? 42.220 34.482  -14.491 1.00 67.66  ? 53  ARG B CZ  1 
ATOM   2128 N NH1 . ARG B 1 12  ? 41.110 34.386  -13.762 1.00 65.27  ? 53  ARG B NH1 1 
ATOM   2129 N NH2 . ARG B 1 12  ? 42.149 34.494  -15.814 1.00 69.44  ? 53  ARG B NH2 1 
ATOM   2130 N N   . ALA B 1 13  ? 46.176 34.169  -7.607  1.00 51.56  ? 54  ALA B N   1 
ATOM   2131 C CA  . ALA B 1 13  ? 46.091 34.767  -6.288  1.00 55.76  ? 54  ALA B CA  1 
ATOM   2132 C C   . ALA B 1 13  ? 47.137 34.470  -5.216  1.00 53.75  ? 54  ALA B C   1 
ATOM   2133 O O   . ALA B 1 13  ? 47.447 35.315  -4.386  1.00 54.98  ? 54  ALA B O   1 
ATOM   2134 C CB  . ALA B 1 13  ? 44.701 34.454  -5.738  1.00 58.39  ? 54  ALA B CB  1 
ATOM   2135 N N   . ALA B 1 14  ? 47.673 33.262  -5.229  1.00 54.33  ? 55  ALA B N   1 
ATOM   2136 C CA  . ALA B 1 14  ? 48.617 32.848  -4.209  1.00 49.20  ? 55  ALA B CA  1 
ATOM   2137 C C   . ALA B 1 14  ? 49.938 33.625  -4.166  1.00 48.28  ? 55  ALA B C   1 
ATOM   2138 O O   . ALA B 1 14  ? 50.517 33.791  -3.100  1.00 57.45  ? 55  ALA B O   1 
ATOM   2139 C CB  . ALA B 1 14  ? 48.856 31.306  -4.323  1.00 41.07  ? 55  ALA B CB  1 
ATOM   2140 N N   . PRO B 1 15  ? 50.443 34.102  -5.319  1.00 53.72  ? 56  PRO B N   1 
ATOM   2141 C CA  . PRO B 1 15  ? 51.705 34.841  -5.203  1.00 50.93  ? 56  PRO B CA  1 
ATOM   2142 C C   . PRO B 1 15  ? 51.592 36.014  -4.243  1.00 56.33  ? 56  PRO B C   1 
ATOM   2143 O O   . PRO B 1 15  ? 52.581 36.394  -3.602  1.00 59.50  ? 56  PRO B O   1 
ATOM   2144 C CB  . PRO B 1 15  ? 51.954 35.306  -6.627  1.00 47.72  ? 56  PRO B CB  1 
ATOM   2145 C CG  . PRO B 1 15  ? 51.462 34.153  -7.416  1.00 38.08  ? 56  PRO B CG  1 
ATOM   2146 C CD  . PRO B 1 15  ? 50.123 33.848  -6.742  1.00 45.47  ? 56  PRO B CD  1 
ATOM   2147 N N   . ALA B 1 16  ? 50.380 36.566  -4.133  1.00 52.64  ? 57  ALA B N   1 
ATOM   2148 C CA  . ALA B 1 16  ? 50.128 37.719  -3.276  1.00 50.91  ? 57  ALA B CA  1 
ATOM   2149 C C   . ALA B 1 16  ? 49.856 37.462  -1.802  1.00 53.67  ? 57  ALA B C   1 
ATOM   2150 O O   . ALA B 1 16  ? 49.576 38.402  -1.065  1.00 58.07  ? 57  ALA B O   1 
ATOM   2151 C CB  . ALA B 1 16  ? 48.999 38.534  -3.853  1.00 51.08  ? 57  ALA B CB  1 
ATOM   2152 N N   . VAL B 1 17  ? 49.931 36.213  -1.355  1.00 56.16  ? 58  VAL B N   1 
ATOM   2153 C CA  . VAL B 1 17  ? 49.671 35.910  0.062   1.00 57.21  ? 58  VAL B CA  1 
ATOM   2154 C C   . VAL B 1 17  ? 51.005 35.601  0.735   1.00 58.08  ? 58  VAL B C   1 
ATOM   2155 O O   . VAL B 1 17  ? 51.800 34.787  0.267   1.00 61.86  ? 58  VAL B O   1 
ATOM   2156 C CB  . VAL B 1 17  ? 48.620 34.752  0.193   1.00 57.77  ? 58  VAL B CB  1 
ATOM   2157 C CG1 . VAL B 1 17  ? 48.324 34.447  1.631   1.00 52.50  ? 58  VAL B CG1 1 
ATOM   2158 C CG2 . VAL B 1 17  ? 47.317 35.180  -0.491  1.00 53.69  ? 58  VAL B CG2 1 
ATOM   2159 N N   . VAL B 1 18  ? 51.238 36.255  1.857   1.00 58.48  ? 59  VAL B N   1 
ATOM   2160 C CA  . VAL B 1 18  ? 52.512 36.158  2.533   1.00 59.08  ? 59  VAL B CA  1 
ATOM   2161 C C   . VAL B 1 18  ? 52.501 35.676  3.978   1.00 61.56  ? 59  VAL B C   1 
ATOM   2162 O O   . VAL B 1 18  ? 51.451 35.620  4.626   1.00 60.37  ? 59  VAL B O   1 
ATOM   2163 C CB  . VAL B 1 18  ? 53.191 37.567  2.484   1.00 68.19  ? 59  VAL B CB  1 
ATOM   2164 C CG1 . VAL B 1 18  ? 53.341 38.031  1.035   1.00 62.26  ? 59  VAL B CG1 1 
ATOM   2165 C CG2 . VAL B 1 18  ? 52.326 38.594  3.233   1.00 52.00  ? 59  VAL B CG2 1 
ATOM   2166 N N   . ASN B 1 19  ? 53.694 35.356  4.479   1.00 63.36  ? 60  ASN B N   1 
ATOM   2167 C CA  . ASN B 1 19  ? 53.867 34.883  5.850   1.00 64.52  ? 60  ASN B CA  1 
ATOM   2168 C C   . ASN B 1 19  ? 54.183 36.041  6.752   1.00 64.78  ? 60  ASN B C   1 
ATOM   2169 O O   . ASN B 1 19  ? 55.094 36.799  6.492   1.00 68.64  ? 60  ASN B O   1 
ATOM   2170 C CB  . ASN B 1 19  ? 55.014 33.890  5.953   1.00 70.72  ? 60  ASN B CB  1 
ATOM   2171 C CG  . ASN B 1 19  ? 54.656 32.529  5.422   1.00 76.75  ? 60  ASN B CG  1 
ATOM   2172 O OD1 . ASN B 1 19  ? 54.212 32.377  4.282   1.00 77.15  ? 60  ASN B OD1 1 
ATOM   2173 N ND2 . ASN B 1 19  ? 54.856 31.516  6.251   1.00 89.68  ? 60  ASN B ND2 1 
ATOM   2174 N N   . VAL B 1 20  ? 53.428 36.165  7.824   1.00 65.43  ? 61  VAL B N   1 
ATOM   2175 C CA  . VAL B 1 20  ? 53.636 37.236  8.759   1.00 69.90  ? 61  VAL B CA  1 
ATOM   2176 C C   . VAL B 1 20  ? 54.138 36.657  10.088  1.00 78.64  ? 61  VAL B C   1 
ATOM   2177 O O   . VAL B 1 20  ? 53.498 35.771  10.660  1.00 80.60  ? 61  VAL B O   1 
ATOM   2178 C CB  . VAL B 1 20  ? 52.315 37.976  8.989   1.00 69.57  ? 61  VAL B CB  1 
ATOM   2179 C CG1 . VAL B 1 20  ? 52.528 39.167  9.912   1.00 65.46  ? 61  VAL B CG1 1 
ATOM   2180 C CG2 . VAL B 1 20  ? 51.727 38.389  7.644   1.00 63.09  ? 61  VAL B CG2 1 
ATOM   2181 N N   . TYR B 1 21  ? 55.285 37.133  10.574  1.00 79.31  ? 62  TYR B N   1 
ATOM   2182 C CA  . TYR B 1 21  ? 55.788 36.643  11.853  1.00 83.95  ? 62  TYR B CA  1 
ATOM   2183 C C   . TYR B 1 21  ? 55.794 37.766  12.893  1.00 86.20  ? 62  TYR B C   1 
ATOM   2184 O O   . TYR B 1 21  ? 56.384 38.829  12.690  1.00 81.49  ? 62  TYR B O   1 
ATOM   2185 C CB  . TYR B 1 21  ? 57.186 36.034  11.697  1.00 79.34  ? 62  TYR B CB  1 
ATOM   2186 C CG  . TYR B 1 21  ? 57.306 35.101  10.506  1.00 78.53  ? 62  TYR B CG  1 
ATOM   2187 C CD1 . TYR B 1 21  ? 57.345 35.612  9.209   1.00 77.36  ? 62  TYR B CD1 1 
ATOM   2188 C CD2 . TYR B 1 21  ? 57.376 33.705  10.668  1.00 77.67  ? 62  TYR B CD2 1 
ATOM   2189 C CE1 . TYR B 1 21  ? 57.453 34.772  8.095   1.00 78.08  ? 62  TYR B CE1 1 
ATOM   2190 C CE2 . TYR B 1 21  ? 57.479 32.840  9.545   1.00 71.33  ? 62  TYR B CE2 1 
ATOM   2191 C CZ  . TYR B 1 21  ? 57.519 33.397  8.260   1.00 77.06  ? 62  TYR B CZ  1 
ATOM   2192 O OH  . TYR B 1 21  ? 57.632 32.617  7.125   1.00 74.56  ? 62  TYR B OH  1 
ATOM   2193 N N   . ASN B 1 22  ? 55.096 37.521  13.998  1.00 89.27  ? 63  ASN B N   1 
ATOM   2194 C CA  . ASN B 1 22  ? 54.997 38.476  15.092  1.00 91.90  ? 63  ASN B CA  1 
ATOM   2195 C C   . ASN B 1 22  ? 56.127 38.220  16.075  1.00 91.07  ? 63  ASN B C   1 
ATOM   2196 O O   . ASN B 1 22  ? 55.985 37.393  16.972  1.00 86.30  ? 63  ASN B O   1 
ATOM   2197 C CB  . ASN B 1 22  ? 53.642 38.324  15.803  1.00 96.89  ? 63  ASN B CB  1 
ATOM   2198 C CG  . ASN B 1 22  ? 53.507 39.224  17.039  1.00 100.58 ? 63  ASN B CG  1 
ATOM   2199 O OD1 . ASN B 1 22  ? 52.412 39.386  17.590  1.00 99.90  ? 63  ASN B OD1 1 
ATOM   2200 N ND2 . ASN B 1 22  ? 54.619 39.800  17.482  1.00 102.83 ? 63  ASN B ND2 1 
ATOM   2201 N N   . ARG B 1 23  ? 57.237 38.943  15.911  1.00 93.64  ? 64  ARG B N   1 
ATOM   2202 C CA  . ARG B 1 23  ? 58.396 38.787  16.785  1.00 96.72  ? 64  ARG B CA  1 
ATOM   2203 C C   . ARG B 1 23  ? 58.387 39.699  18.005  1.00 94.64  ? 64  ARG B C   1 
ATOM   2204 O O   . ARG B 1 23  ? 57.932 40.842  17.946  1.00 97.44  ? 64  ARG B O   1 
ATOM   2205 C CB  . ARG B 1 23  ? 59.696 39.007  16.005  1.00 100.31 ? 64  ARG B CB  1 
ATOM   2206 C CG  . ARG B 1 23  ? 59.955 37.967  14.938  1.00 102.18 ? 64  ARG B CG  1 
ATOM   2207 C CD  . ARG B 1 23  ? 61.430 37.664  14.838  1.00 108.14 ? 64  ARG B CD  1 
ATOM   2208 N NE  . ARG B 1 23  ? 62.220 38.815  14.410  1.00 112.85 ? 64  ARG B NE  1 
ATOM   2209 C CZ  . ARG B 1 23  ? 63.544 38.794  14.271  1.00 113.15 ? 64  ARG B CZ  1 
ATOM   2210 N NH1 . ARG B 1 23  ? 64.222 37.684  14.533  1.00 112.11 ? 64  ARG B NH1 1 
ATOM   2211 N NH2 . ARG B 1 23  ? 64.193 39.872  13.850  1.00 114.16 ? 64  ARG B NH2 1 
ATOM   2212 N N   . GLY B 1 24  ? 58.902 39.171  19.114  1.00 109.41 ? 65  GLY B N   1 
ATOM   2213 C CA  . GLY B 1 24  ? 58.968 39.923  20.356  1.00 117.17 ? 65  GLY B CA  1 
ATOM   2214 C C   . GLY B 1 24  ? 60.326 39.792  21.031  1.00 121.36 ? 65  GLY B C   1 
ATOM   2215 O O   . GLY B 1 24  ? 61.083 38.859  20.751  1.00 120.66 ? 65  GLY B O   1 
ATOM   2216 N N   . LEU B 1 25  ? 60.627 40.725  21.930  1.00 125.79 ? 66  LEU B N   1 
ATOM   2217 C CA  . LEU B 1 25  ? 61.900 40.733  22.647  1.00 130.36 ? 66  LEU B CA  1 
ATOM   2218 C C   . LEU B 1 25  ? 62.027 39.606  23.674  1.00 134.15 ? 66  LEU B C   1 
ATOM   2219 O O   . LEU B 1 25  ? 61.038 38.974  24.048  1.00 133.53 ? 66  LEU B O   1 
ATOM   2220 C CB  . LEU B 1 25  ? 62.111 42.096  23.335  1.00 129.38 ? 66  LEU B CB  1 
ATOM   2221 C CG  . LEU B 1 25  ? 62.243 43.354  22.456  1.00 126.79 ? 66  LEU B CG  1 
ATOM   2222 C CD1 . LEU B 1 25  ? 62.411 44.588  23.329  1.00 122.15 ? 66  LEU B CD1 1 
ATOM   2223 C CD2 . LEU B 1 25  ? 63.437 43.206  21.526  1.00 125.15 ? 66  LEU B CD2 1 
ATOM   2224 N N   . ASN B 1 26  ? 63.267 39.373  24.105  1.00 140.17 ? 67  ASN B N   1 
ATOM   2225 C CA  . ASN B 1 26  ? 63.645 38.354  25.090  1.00 146.95 ? 67  ASN B CA  1 
ATOM   2226 C C   . ASN B 1 26  ? 62.536 37.418  25.554  1.00 151.82 ? 67  ASN B C   1 
ATOM   2227 O O   . ASN B 1 26  ? 61.960 37.622  26.625  1.00 154.31 ? 67  ASN B O   1 
ATOM   2228 C CB  . ASN B 1 26  ? 64.277 39.031  26.305  1.00 145.91 ? 67  ASN B CB  1 
ATOM   2229 N N   . THR B 1 27  ? 62.254 36.386  24.760  1.00 155.27 ? 68  THR B N   1 
ATOM   2230 C CA  . THR B 1 27  ? 61.214 35.420  25.106  1.00 157.20 ? 68  THR B CA  1 
ATOM   2231 C C   . THR B 1 27  ? 61.777 34.260  25.923  1.00 158.67 ? 68  THR B C   1 
ATOM   2232 O O   . THR B 1 27  ? 61.050 33.331  26.282  1.00 158.56 ? 68  THR B O   1 
ATOM   2233 C CB  . THR B 1 27  ? 60.544 34.895  23.848  1.00 155.83 ? 68  THR B CB  1 
ATOM   2234 N N   . ASN B 1 28  ? 63.075 34.321  26.209  1.00 160.70 ? 69  ASN B N   1 
ATOM   2235 C CA  . ASN B 1 28  ? 63.747 33.289  26.997  1.00 162.15 ? 69  ASN B CA  1 
ATOM   2236 C C   . ASN B 1 28  ? 64.332 33.927  28.253  1.00 162.47 ? 69  ASN B C   1 
ATOM   2237 O O   . ASN B 1 28  ? 64.016 33.523  29.375  1.00 162.25 ? 69  ASN B O   1 
ATOM   2238 C CB  . ASN B 1 28  ? 64.859 32.636  26.175  1.00 161.80 ? 69  ASN B CB  1 
ATOM   2239 N N   . SER B 1 29  ? 65.179 34.931  28.049  1.00 163.00 ? 70  SER B N   1 
ATOM   2240 C CA  . SER B 1 29  ? 65.818 35.648  29.144  1.00 163.80 ? 70  SER B CA  1 
ATOM   2241 C C   . SER B 1 29  ? 66.602 36.847  28.610  1.00 164.41 ? 70  SER B C   1 
ATOM   2242 O O   . SER B 1 29  ? 66.529 37.943  29.171  1.00 164.43 ? 70  SER B O   1 
ATOM   2243 C CB  . SER B 1 29  ? 66.749 34.710  29.913  1.00 162.98 ? 70  SER B CB  1 
ATOM   2244 N N   . HIS B 1 30  ? 67.344 36.633  27.524  1.00 164.78 ? 71  HIS B N   1 
ATOM   2245 C CA  . HIS B 1 30  ? 68.156 37.687  26.915  1.00 164.05 ? 71  HIS B CA  1 
ATOM   2246 C C   . HIS B 1 30  ? 67.437 38.382  25.764  1.00 163.91 ? 71  HIS B C   1 
ATOM   2247 O O   . HIS B 1 30  ? 66.736 37.741  24.975  1.00 163.60 ? 71  HIS B O   1 
ATOM   2248 C CB  . HIS B 1 30  ? 69.485 37.111  26.427  1.00 162.24 ? 71  HIS B CB  1 
ATOM   2249 N N   . ASN B 1 31  ? 67.628 39.697  25.677  1.00 163.51 ? 72  ASN B N   1 
ATOM   2250 C CA  . ASN B 1 31  ? 67.008 40.518  24.637  1.00 162.37 ? 72  ASN B CA  1 
ATOM   2251 C C   . ASN B 1 31  ? 67.315 40.013  23.224  1.00 160.81 ? 72  ASN B C   1 
ATOM   2252 O O   . ASN B 1 31  ? 68.458 40.063  22.765  1.00 161.70 ? 72  ASN B O   1 
ATOM   2253 C CB  . ASN B 1 31  ? 67.461 41.975  24.786  1.00 160.66 ? 72  ASN B CB  1 
ATOM   2254 N N   . GLN B 1 32  ? 66.279 39.528  22.543  1.00 157.91 ? 73  GLN B N   1 
ATOM   2255 C CA  . GLN B 1 32  ? 66.401 39.015  21.183  1.00 153.46 ? 73  GLN B CA  1 
ATOM   2256 C C   . GLN B 1 32  ? 65.018 38.681  20.641  1.00 151.42 ? 73  GLN B C   1 
ATOM   2257 O O   . GLN B 1 32  ? 64.220 38.023  21.314  1.00 151.85 ? 73  GLN B O   1 
ATOM   2258 C CB  . GLN B 1 32  ? 67.273 37.760  21.157  1.00 152.03 ? 73  GLN B CB  1 
ATOM   2259 C CG  . GLN B 1 32  ? 67.410 37.141  19.778  1.00 148.21 ? 73  GLN B CG  1 
ATOM   2260 C CD  . GLN B 1 32  ? 68.141 35.819  19.809  1.00 147.39 ? 73  GLN B CD  1 
ATOM   2261 O OE1 . GLN B 1 32  ? 68.377 35.207  18.769  1.00 147.83 ? 73  GLN B OE1 1 
ATOM   2262 N NE2 . GLN B 1 32  ? 68.500 35.364  21.007  1.00 145.86 ? 73  GLN B NE2 1 
ATOM   2263 N N   . LEU B 1 33  ? 64.743 39.129  19.420  1.00 147.64 ? 74  LEU B N   1 
ATOM   2264 C CA  . LEU B 1 33  ? 63.450 38.889  18.792  1.00 144.33 ? 74  LEU B CA  1 
ATOM   2265 C C   . LEU B 1 33  ? 63.077 37.418  18.630  1.00 142.17 ? 74  LEU B C   1 
ATOM   2266 O O   . LEU B 1 33  ? 63.695 36.676  17.860  1.00 141.17 ? 74  LEU B O   1 
ATOM   2267 C CB  . LEU B 1 33  ? 63.398 39.585  17.434  1.00 143.65 ? 74  LEU B CB  1 
ATOM   2268 C CG  . LEU B 1 33  ? 63.345 41.109  17.513  1.00 142.64 ? 74  LEU B CG  1 
ATOM   2269 C CD1 . LEU B 1 33  ? 63.550 41.698  16.136  1.00 142.80 ? 74  LEU B CD1 1 
ATOM   2270 C CD2 . LEU B 1 33  ? 62.010 41.542  18.097  1.00 142.20 ? 74  LEU B CD2 1 
ATOM   2271 N N   . GLU B 1 34  ? 62.051 37.015  19.369  1.00 138.65 ? 75  GLU B N   1 
ATOM   2272 C CA  . GLU B 1 34  ? 61.544 35.653  19.335  1.00 135.99 ? 75  GLU B CA  1 
ATOM   2273 C C   . GLU B 1 34  ? 60.260 35.683  18.511  1.00 133.01 ? 75  GLU B C   1 
ATOM   2274 O O   . GLU B 1 34  ? 59.576 36.703  18.477  1.00 131.33 ? 75  GLU B O   1 
ATOM   2275 C CB  . GLU B 1 34  ? 61.236 35.181  20.759  1.00 136.97 ? 75  GLU B CB  1 
ATOM   2276 C CG  . GLU B 1 34  ? 60.771 33.729  20.881  1.00 139.49 ? 75  GLU B CG  1 
ATOM   2277 C CD  . GLU B 1 34  ? 61.911 32.723  20.788  1.00 141.08 ? 75  GLU B CD  1 
ATOM   2278 O OE1 . GLU B 1 34  ? 62.506 32.577  19.695  1.00 141.56 ? 75  GLU B OE1 1 
ATOM   2279 O OE2 . GLU B 1 34  ? 62.215 32.079  21.816  1.00 138.47 ? 75  GLU B OE2 1 
ATOM   2280 N N   . ILE B 1 35  ? 59.941 34.578  17.841  1.00 130.85 ? 76  ILE B N   1 
ATOM   2281 C CA  . ILE B 1 35  ? 58.722 34.494  17.037  1.00 127.33 ? 76  ILE B CA  1 
ATOM   2282 C C   . ILE B 1 35  ? 57.534 34.133  17.933  1.00 127.17 ? 76  ILE B C   1 
ATOM   2283 O O   . ILE B 1 35  ? 57.350 32.967  18.289  1.00 129.18 ? 76  ILE B O   1 
ATOM   2284 C CB  . ILE B 1 35  ? 58.852 33.424  15.928  1.00 123.29 ? 76  ILE B CB  1 
ATOM   2285 C CG1 . ILE B 1 35  ? 59.928 33.842  14.924  1.00 119.22 ? 76  ILE B CG1 1 
ATOM   2286 C CG2 . ILE B 1 35  ? 57.513 33.229  15.234  1.00 122.69 ? 76  ILE B CG2 1 
ATOM   2287 C CD1 . ILE B 1 35  ? 60.066 32.898  13.754  1.00 115.18 ? 76  ILE B CD1 1 
ATOM   2288 N N   . ARG B 1 36  ? 56.734 35.139  18.291  1.00 124.29 ? 77  ARG B N   1 
ATOM   2289 C CA  . ARG B 1 36  ? 55.571 34.946  19.157  1.00 122.52 ? 77  ARG B CA  1 
ATOM   2290 C C   . ARG B 1 36  ? 54.385 34.308  18.460  1.00 119.67 ? 77  ARG B C   1 
ATOM   2291 O O   . ARG B 1 36  ? 53.745 33.414  19.014  1.00 118.84 ? 77  ARG B O   1 
ATOM   2292 C CB  . ARG B 1 36  ? 55.130 36.279  19.769  1.00 125.47 ? 77  ARG B CB  1 
ATOM   2293 C CG  . ARG B 1 36  ? 56.060 36.790  20.844  1.00 130.02 ? 77  ARG B CG  1 
ATOM   2294 C CD  . ARG B 1 36  ? 55.613 38.139  21.350  1.00 134.26 ? 77  ARG B CD  1 
ATOM   2295 N NE  . ARG B 1 36  ? 54.227 38.126  21.807  1.00 140.86 ? 77  ARG B NE  1 
ATOM   2296 C CZ  . ARG B 1 36  ? 53.652 39.138  22.452  1.00 144.94 ? 77  ARG B CZ  1 
ATOM   2297 N NH1 . ARG B 1 36  ? 54.350 40.236  22.715  1.00 146.62 ? 77  ARG B NH1 1 
ATOM   2298 N NH2 . ARG B 1 36  ? 52.382 39.060  22.831  1.00 145.66 ? 77  ARG B NH2 1 
ATOM   2299 N N   . THR B 1 37  ? 54.078 34.772  17.254  1.00 110.88 ? 78  THR B N   1 
ATOM   2300 C CA  . THR B 1 37  ? 52.954 34.215  16.516  1.00 109.23 ? 78  THR B CA  1 
ATOM   2301 C C   . THR B 1 37  ? 53.156 34.286  15.007  1.00 105.56 ? 78  THR B C   1 
ATOM   2302 O O   . THR B 1 37  ? 53.946 35.086  14.504  1.00 106.02 ? 78  THR B O   1 
ATOM   2303 C CB  . THR B 1 37  ? 51.636 34.939  16.868  1.00 111.02 ? 78  THR B CB  1 
ATOM   2304 O OG1 . THR B 1 37  ? 51.667 35.357  18.239  1.00 116.12 ? 78  THR B OG1 1 
ATOM   2305 C CG2 . THR B 1 37  ? 50.450 33.994  16.669  1.00 108.88 ? 78  THR B CG2 1 
ATOM   2306 N N   . LEU B 1 38  ? 52.437 33.423  14.298  1.00 100.89 ? 79  LEU B N   1 
ATOM   2307 C CA  . LEU B 1 38  ? 52.491 33.357  12.847  1.00 92.17  ? 79  LEU B CA  1 
ATOM   2308 C C   . LEU B 1 38  ? 51.184 33.886  12.300  1.00 86.41  ? 79  LEU B C   1 
ATOM   2309 O O   . LEU B 1 38  ? 50.242 34.147  13.038  1.00 82.85  ? 79  LEU B O   1 
ATOM   2310 C CB  . LEU B 1 38  ? 52.666 31.910  12.363  1.00 94.17  ? 79  LEU B CB  1 
ATOM   2311 C CG  . LEU B 1 38  ? 54.024 31.240  12.542  1.00 91.90  ? 79  LEU B CG  1 
ATOM   2312 C CD1 . LEU B 1 38  ? 55.085 32.042  11.824  1.00 89.89  ? 79  LEU B CD1 1 
ATOM   2313 C CD2 . LEU B 1 38  ? 54.345 31.141  14.012  1.00 92.45  ? 79  LEU B CD2 1 
ATOM   2314 N N   . GLY B 1 39  ? 51.127 34.015  10.988  1.00 81.21  ? 80  GLY B N   1 
ATOM   2315 C CA  . GLY B 1 39  ? 49.931 34.507  10.369  1.00 71.30  ? 80  GLY B CA  1 
ATOM   2316 C C   . GLY B 1 39  ? 50.214 34.660  8.906   1.00 72.59  ? 80  GLY B C   1 
ATOM   2317 O O   . GLY B 1 39  ? 51.272 34.266  8.411   1.00 70.19  ? 80  GLY B O   1 
ATOM   2318 N N   . SER B 1 40  ? 49.256 35.248  8.211   1.00 70.65  ? 81  SER B N   1 
ATOM   2319 C CA  . SER B 1 40  ? 49.374 35.457  6.790   1.00 65.47  ? 81  SER B CA  1 
ATOM   2320 C C   . SER B 1 40  ? 48.929 36.882  6.560   1.00 62.29  ? 81  SER B C   1 
ATOM   2321 O O   . SER B 1 40  ? 48.522 37.581  7.490   1.00 60.52  ? 81  SER B O   1 
ATOM   2322 C CB  . SER B 1 40  ? 48.443 34.504  6.032   1.00 69.28  ? 81  SER B CB  1 
ATOM   2323 O OG  . SER B 1 40  ? 48.440 33.216  6.611   1.00 70.20  ? 81  SER B OG  1 
ATOM   2324 N N   . GLY B 1 41  ? 48.996 37.299  5.307   1.00 56.22  ? 82  GLY B N   1 
ATOM   2325 C CA  . GLY B 1 41  ? 48.603 38.644  4.965   1.00 51.16  ? 82  GLY B CA  1 
ATOM   2326 C C   . GLY B 1 41  ? 48.406 38.628  3.474   1.00 54.55  ? 82  GLY B C   1 
ATOM   2327 O O   . GLY B 1 41  ? 48.827 37.689  2.778   1.00 47.73  ? 82  GLY B O   1 
ATOM   2328 N N   . VAL B 1 42  ? 47.754 39.663  2.979   1.00 54.30  ? 83  VAL B N   1 
ATOM   2329 C CA  . VAL B 1 42  ? 47.509 39.749  1.556   1.00 60.91  ? 83  VAL B CA  1 
ATOM   2330 C C   . VAL B 1 42  ? 48.021 41.087  1.026   1.00 60.30  ? 83  VAL B C   1 
ATOM   2331 O O   . VAL B 1 42  ? 47.795 42.128  1.636   1.00 59.35  ? 83  VAL B O   1 
ATOM   2332 C CB  . VAL B 1 42  ? 45.983 39.613  1.256   1.00 59.56  ? 83  VAL B CB  1 
ATOM   2333 C CG1 . VAL B 1 42  ? 45.732 39.719  -0.251  1.00 60.64  ? 83  VAL B CG1 1 
ATOM   2334 C CG2 . VAL B 1 42  ? 45.444 38.280  1.829   1.00 51.37  ? 83  VAL B CG2 1 
ATOM   2335 N N   . ILE B 1 43  ? 48.738 41.058  -0.089  1.00 58.56  ? 84  ILE B N   1 
ATOM   2336 C CA  . ILE B 1 43  ? 49.201 42.303  -0.662  1.00 60.93  ? 84  ILE B CA  1 
ATOM   2337 C C   . ILE B 1 43  ? 48.043 42.824  -1.494  1.00 56.56  ? 84  ILE B C   1 
ATOM   2338 O O   . ILE B 1 43  ? 47.641 42.211  -2.464  1.00 48.38  ? 84  ILE B O   1 
ATOM   2339 C CB  . ILE B 1 43  ? 50.453 42.121  -1.529  1.00 63.84  ? 84  ILE B CB  1 
ATOM   2340 C CG1 . ILE B 1 43  ? 51.604 41.584  -0.668  1.00 57.44  ? 84  ILE B CG1 1 
ATOM   2341 C CG2 . ILE B 1 43  ? 50.866 43.474  -2.105  1.00 61.87  ? 84  ILE B CG2 1 
ATOM   2342 C CD1 . ILE B 1 43  ? 52.654 40.832  -1.453  1.00 59.73  ? 84  ILE B CD1 1 
ATOM   2343 N N   . MET B 1 44  ? 47.520 43.972  -1.070  1.00 60.82  ? 85  MET B N   1 
ATOM   2344 C CA  . MET B 1 44  ? 46.384 44.627  -1.683  1.00 60.82  ? 85  MET B CA  1 
ATOM   2345 C C   . MET B 1 44  ? 46.680 45.400  -2.956  1.00 67.93  ? 85  MET B C   1 
ATOM   2346 O O   . MET B 1 44  ? 45.988 45.232  -3.957  1.00 65.82  ? 85  MET B O   1 
ATOM   2347 C CB  . MET B 1 44  ? 45.741 45.540  -0.650  1.00 64.41  ? 85  MET B CB  1 
ATOM   2348 C CG  . MET B 1 44  ? 45.296 44.793  0.602   1.00 59.49  ? 85  MET B CG  1 
ATOM   2349 S SD  . MET B 1 44  ? 44.308 43.311  0.170   1.00 63.79  ? 85  MET B SD  1 
ATOM   2350 C CE  . MET B 1 44  ? 42.697 44.008  -0.083  1.00 66.62  ? 85  MET B CE  1 
ATOM   2351 N N   . ASP B 1 45  ? 47.710 46.243  -2.923  1.00 73.74  ? 86  ASP B N   1 
ATOM   2352 C CA  . ASP B 1 45  ? 48.088 47.031  -4.095  1.00 73.45  ? 86  ASP B CA  1 
ATOM   2353 C C   . ASP B 1 45  ? 49.592 47.254  -4.164  1.00 72.42  ? 86  ASP B C   1 
ATOM   2354 O O   . ASP B 1 45  ? 50.296 47.095  -3.163  1.00 71.10  ? 86  ASP B O   1 
ATOM   2355 C CB  . ASP B 1 45  ? 47.365 48.391  -4.102  1.00 75.80  ? 86  ASP B CB  1 
ATOM   2356 C CG  . ASP B 1 45  ? 47.663 49.223  -2.871  1.00 74.72  ? 86  ASP B CG  1 
ATOM   2357 O OD1 . ASP B 1 45  ? 46.731 49.436  -2.065  1.00 79.84  ? 86  ASP B OD1 1 
ATOM   2358 O OD2 . ASP B 1 45  ? 48.821 49.660  -2.706  1.00 69.16  ? 86  ASP B OD2 1 
ATOM   2359 N N   . GLN B 1 46  ? 50.056 47.640  -5.354  1.00 71.74  ? 87  GLN B N   1 
ATOM   2360 C CA  . GLN B 1 46  ? 51.469 47.893  -5.649  1.00 72.93  ? 87  GLN B CA  1 
ATOM   2361 C C   . GLN B 1 46  ? 52.303 48.759  -4.705  1.00 69.08  ? 87  GLN B C   1 
ATOM   2362 O O   . GLN B 1 46  ? 53.521 48.630  -4.676  1.00 73.24  ? 87  GLN B O   1 
ATOM   2363 C CB  . GLN B 1 46  ? 51.595 48.445  -7.069  1.00 71.76  ? 87  GLN B CB  1 
ATOM   2364 C CG  . GLN B 1 46  ? 51.893 47.363  -8.088  1.00 77.56  ? 87  GLN B CG  1 
ATOM   2365 C CD  . GLN B 1 46  ? 53.269 46.738  -7.880  1.00 80.90  ? 87  GLN B CD  1 
ATOM   2366 O OE1 . GLN B 1 46  ? 53.558 45.664  -8.405  1.00 87.68  ? 87  GLN B OE1 1 
ATOM   2367 N NE2 . GLN B 1 46  ? 54.131 47.421  -7.119  1.00 84.29  ? 87  GLN B NE2 1 
ATOM   2368 N N   . ARG B 1 47  ? 51.661 49.649  -3.956  1.00 69.45  ? 88  ARG B N   1 
ATOM   2369 C CA  . ARG B 1 47  ? 52.362 50.517  -3.015  1.00 64.05  ? 88  ARG B CA  1 
ATOM   2370 C C   . ARG B 1 47  ? 53.037 49.708  -1.928  1.00 66.20  ? 88  ARG B C   1 
ATOM   2371 O O   . ARG B 1 47  ? 53.966 50.183  -1.293  1.00 65.97  ? 88  ARG B O   1 
ATOM   2372 C CB  . ARG B 1 47  ? 51.388 51.495  -2.349  1.00 68.99  ? 88  ARG B CB  1 
ATOM   2373 C CG  . ARG B 1 47  ? 50.700 52.469  -3.308  1.00 75.18  ? 88  ARG B CG  1 
ATOM   2374 C CD  . ARG B 1 47  ? 49.614 53.259  -2.599  1.00 78.21  ? 88  ARG B CD  1 
ATOM   2375 N NE  . ARG B 1 47  ? 48.486 52.410  -2.205  1.00 84.76  ? 88  ARG B NE  1 
ATOM   2376 C CZ  . ARG B 1 47  ? 47.338 52.863  -1.699  1.00 81.71  ? 88  ARG B CZ  1 
ATOM   2377 N NH1 . ARG B 1 47  ? 47.155 54.164  -1.512  1.00 80.37  ? 88  ARG B NH1 1 
ATOM   2378 N NH2 . ARG B 1 47  ? 46.357 52.020  -1.405  1.00 76.23  ? 88  ARG B NH2 1 
ATOM   2379 N N   . GLY B 1 48  ? 52.555 48.488  -1.698  1.00 68.43  ? 89  GLY B N   1 
ATOM   2380 C CA  . GLY B 1 48  ? 53.136 47.652  -0.661  1.00 59.66  ? 89  GLY B CA  1 
ATOM   2381 C C   . GLY B 1 48  ? 52.260 47.520  0.579   1.00 58.88  ? 89  GLY B C   1 
ATOM   2382 O O   . GLY B 1 48  ? 52.751 47.123  1.628   1.00 60.81  ? 89  GLY B O   1 
ATOM   2383 N N   . TYR B 1 49  ? 50.979 47.875  0.480   1.00 58.76  ? 90  TYR B N   1 
ATOM   2384 C CA  . TYR B 1 49  ? 50.063 47.739  1.621   1.00 58.44  ? 90  TYR B CA  1 
ATOM   2385 C C   . TYR B 1 49  ? 49.589 46.304  1.725   1.00 57.20  ? 90  TYR B C   1 
ATOM   2386 O O   . TYR B 1 49  ? 49.275 45.646  0.733   1.00 57.60  ? 90  TYR B O   1 
ATOM   2387 C CB  . TYR B 1 49  ? 48.862 48.682  1.502   1.00 58.35  ? 90  TYR B CB  1 
ATOM   2388 C CG  . TYR B 1 49  ? 49.271 50.114  1.699   1.00 56.03  ? 90  TYR B CG  1 
ATOM   2389 C CD1 . TYR B 1 49  ? 49.374 50.993  0.619   1.00 57.84  ? 90  TYR B CD1 1 
ATOM   2390 C CD2 . TYR B 1 49  ? 49.635 50.569  2.966   1.00 61.08  ? 90  TYR B CD2 1 
ATOM   2391 C CE1 . TYR B 1 49  ? 49.833 52.284  0.799   1.00 57.53  ? 90  TYR B CE1 1 
ATOM   2392 C CE2 . TYR B 1 49  ? 50.098 51.847  3.160   1.00 61.56  ? 90  TYR B CE2 1 
ATOM   2393 C CZ  . TYR B 1 49  ? 50.197 52.699  2.078   1.00 62.78  ? 90  TYR B CZ  1 
ATOM   2394 O OH  . TYR B 1 49  ? 50.671 53.958  2.295   1.00 69.80  ? 90  TYR B OH  1 
ATOM   2395 N N   . ILE B 1 50  ? 49.548 45.820  2.953   1.00 60.50  ? 91  ILE B N   1 
ATOM   2396 C CA  . ILE B 1 50  ? 49.182 44.445  3.199   1.00 59.21  ? 91  ILE B CA  1 
ATOM   2397 C C   . ILE B 1 50  ? 48.172 44.331  4.308   1.00 57.68  ? 91  ILE B C   1 
ATOM   2398 O O   . ILE B 1 50  ? 48.359 44.917  5.377   1.00 60.78  ? 91  ILE B O   1 
ATOM   2399 C CB  . ILE B 1 50  ? 50.443 43.623  3.597   1.00 58.73  ? 91  ILE B CB  1 
ATOM   2400 C CG1 . ILE B 1 50  ? 51.433 43.601  2.423   1.00 59.98  ? 91  ILE B CG1 1 
ATOM   2401 C CG2 . ILE B 1 50  ? 50.051 42.211  4.037   1.00 51.95  ? 91  ILE B CG2 1 
ATOM   2402 C CD1 . ILE B 1 50  ? 52.637 42.705  2.642   1.00 53.65  ? 91  ILE B CD1 1 
ATOM   2403 N N   . ILE B 1 51  ? 47.087 43.605  4.041   1.00 58.66  ? 92  ILE B N   1 
ATOM   2404 C CA  . ILE B 1 51  ? 46.094 43.373  5.077   1.00 58.74  ? 92  ILE B CA  1 
ATOM   2405 C C   . ILE B 1 51  ? 46.422 42.047  5.750   1.00 55.84  ? 92  ILE B C   1 
ATOM   2406 O O   . ILE B 1 51  ? 46.882 41.098  5.107   1.00 49.46  ? 92  ILE B O   1 
ATOM   2407 C CB  . ILE B 1 51  ? 44.639 43.279  4.542   1.00 54.27  ? 92  ILE B CB  1 
ATOM   2408 C CG1 . ILE B 1 51  ? 44.013 44.663  4.454   1.00 52.56  ? 92  ILE B CG1 1 
ATOM   2409 C CG2 . ILE B 1 51  ? 43.769 42.522  5.537   1.00 53.02  ? 92  ILE B CG2 1 
ATOM   2410 C CD1 . ILE B 1 51  ? 42.848 44.738  3.471   1.00 50.56  ? 92  ILE B CD1 1 
ATOM   2411 N N   . THR B 1 52  ? 46.187 42.024  7.053   1.00 56.43  ? 93  THR B N   1 
ATOM   2412 C CA  . THR B 1 52  ? 46.362 40.855  7.889   1.00 59.10  ? 93  THR B CA  1 
ATOM   2413 C C   . THR B 1 52  ? 45.418 41.064  9.062   1.00 62.86  ? 93  THR B C   1 
ATOM   2414 O O   . THR B 1 52  ? 44.670 42.048  9.089   1.00 62.48  ? 93  THR B O   1 
ATOM   2415 C CB  . THR B 1 52  ? 47.760 40.744  8.464   1.00 60.46  ? 93  THR B CB  1 
ATOM   2416 O OG1 . THR B 1 52  ? 47.848 39.536  9.229   1.00 63.78  ? 93  THR B OG1 1 
ATOM   2417 C CG2 . THR B 1 52  ? 48.050 41.922  9.381   1.00 52.48  ? 93  THR B CG2 1 
ATOM   2418 N N   . ASN B 1 53  ? 45.473 40.156  10.038  1.00 68.40  ? 94  ASN B N   1 
ATOM   2419 C CA  . ASN B 1 53  ? 44.622 40.248  11.229  1.00 67.17  ? 94  ASN B CA  1 
ATOM   2420 C C   . ASN B 1 53  ? 45.334 40.965  12.363  1.00 65.41  ? 94  ASN B C   1 
ATOM   2421 O O   . ASN B 1 53  ? 46.540 40.782  12.577  1.00 62.65  ? 94  ASN B O   1 
ATOM   2422 C CB  . ASN B 1 53  ? 44.208 38.854  11.724  1.00 67.13  ? 94  ASN B CB  1 
ATOM   2423 C CG  . ASN B 1 53  ? 42.960 38.333  11.040  1.00 64.92  ? 94  ASN B CG  1 
ATOM   2424 O OD1 . ASN B 1 53  ? 42.741 37.123  10.953  1.00 70.36  ? 94  ASN B OD1 1 
ATOM   2425 N ND2 . ASN B 1 53  ? 42.134 39.239  10.564  1.00 64.91  ? 94  ASN B ND2 1 
ATOM   2426 N N   . LYS B 1 54  ? 44.573 41.776  13.087  1.00 63.65  ? 95  LYS B N   1 
ATOM   2427 C CA  . LYS B 1 54  ? 45.112 42.499  14.218  1.00 64.39  ? 95  LYS B CA  1 
ATOM   2428 C C   . LYS B 1 54  ? 45.639 41.508  15.244  1.00 65.85  ? 95  LYS B C   1 
ATOM   2429 O O   . LYS B 1 54  ? 46.776 41.612  15.680  1.00 69.18  ? 95  LYS B O   1 
ATOM   2430 C CB  . LYS B 1 54  ? 44.035 43.370  14.855  1.00 65.93  ? 95  LYS B CB  1 
ATOM   2431 C CG  . LYS B 1 54  ? 44.533 44.255  15.994  1.00 64.75  ? 95  LYS B CG  1 
ATOM   2432 C CD  . LYS B 1 54  ? 43.426 45.170  16.516  1.00 70.76  ? 95  LYS B CD  1 
ATOM   2433 C CE  . LYS B 1 54  ? 43.988 46.219  17.478  1.00 75.34  ? 95  LYS B CE  1 
ATOM   2434 N NZ  . LYS B 1 54  ? 44.830 45.583  18.523  1.00 81.51  ? 95  LYS B NZ  1 
ATOM   2435 N N   . HIS B 1 55  ? 44.829 40.526  15.616  1.00 71.37  ? 96  HIS B N   1 
ATOM   2436 C CA  . HIS B 1 55  ? 45.289 39.573  16.612  1.00 70.29  ? 96  HIS B CA  1 
ATOM   2437 C C   . HIS B 1 55  ? 46.636 38.958  16.248  1.00 70.73  ? 96  HIS B C   1 
ATOM   2438 O O   . HIS B 1 55  ? 47.337 38.437  17.124  1.00 70.86  ? 96  HIS B O   1 
ATOM   2439 C CB  . HIS B 1 55  ? 44.247 38.468  16.856  1.00 69.02  ? 96  HIS B CB  1 
ATOM   2440 C CG  . HIS B 1 55  ? 44.125 37.480  15.743  1.00 76.16  ? 96  HIS B CG  1 
ATOM   2441 N ND1 . HIS B 1 55  ? 43.260 37.651  14.682  1.00 71.89  ? 96  HIS B ND1 1 
ATOM   2442 C CD2 . HIS B 1 55  ? 44.734 36.284  15.547  1.00 75.22  ? 96  HIS B CD2 1 
ATOM   2443 C CE1 . HIS B 1 55  ? 43.338 36.601  13.884  1.00 77.18  ? 96  HIS B CE1 1 
ATOM   2444 N NE2 . HIS B 1 55  ? 44.224 35.756  14.388  1.00 79.28  ? 96  HIS B NE2 1 
ATOM   2445 N N   . VAL B 1 56  ? 47.017 39.051  14.974  1.00 67.91  ? 97  VAL B N   1 
ATOM   2446 C CA  . VAL B 1 56  ? 48.286 38.479  14.536  1.00 69.88  ? 97  VAL B CA  1 
ATOM   2447 C C   . VAL B 1 56  ? 49.490 39.360  14.790  1.00 69.52  ? 97  VAL B C   1 
ATOM   2448 O O   . VAL B 1 56  ? 50.587 38.851  14.990  1.00 71.42  ? 97  VAL B O   1 
ATOM   2449 C CB  . VAL B 1 56  ? 48.312 38.164  13.018  1.00 72.81  ? 97  VAL B CB  1 
ATOM   2450 C CG1 . VAL B 1 56  ? 49.563 37.367  12.683  1.00 62.80  ? 97  VAL B CG1 1 
ATOM   2451 C CG2 . VAL B 1 56  ? 47.075 37.374  12.614  1.00 79.37  ? 97  VAL B CG2 1 
ATOM   2452 N N   . ILE B 1 57  ? 49.303 40.673  14.775  1.00 69.64  ? 98  ILE B N   1 
ATOM   2453 C CA  . ILE B 1 57  ? 50.439 41.563  14.948  1.00 71.37  ? 98  ILE B CA  1 
ATOM   2454 C C   . ILE B 1 57  ? 50.436 42.327  16.238  1.00 79.71  ? 98  ILE B C   1 
ATOM   2455 O O   . ILE B 1 57  ? 51.191 43.286  16.389  1.00 87.62  ? 98  ILE B O   1 
ATOM   2456 C CB  . ILE B 1 57  ? 50.586 42.558  13.747  1.00 65.20  ? 98  ILE B CB  1 
ATOM   2457 C CG1 . ILE B 1 57  ? 49.278 43.318  13.492  1.00 55.86  ? 98  ILE B CG1 1 
ATOM   2458 C CG2 . ILE B 1 57  ? 50.963 41.780  12.463  1.00 64.07  ? 98  ILE B CG2 1 
ATOM   2459 C CD1 . ILE B 1 57  ? 48.907 44.315  14.550  1.00 48.05  ? 98  ILE B CD1 1 
ATOM   2460 N N   . ASN B 1 58  ? 49.601 41.904  17.179  1.00 84.88  ? 99  ASN B N   1 
ATOM   2461 C CA  . ASN B 1 58  ? 49.553 42.575  18.472  1.00 92.18  ? 99  ASN B CA  1 
ATOM   2462 C C   . ASN B 1 58  ? 50.851 42.319  19.242  1.00 97.30  ? 99  ASN B C   1 
ATOM   2463 O O   . ASN B 1 58  ? 51.440 41.230  19.157  1.00 95.35  ? 99  ASN B O   1 
ATOM   2464 C CB  . ASN B 1 58  ? 48.356 42.082  19.286  1.00 92.88  ? 99  ASN B CB  1 
ATOM   2465 C CG  . ASN B 1 58  ? 47.233 43.100  19.347  1.00 98.79  ? 99  ASN B CG  1 
ATOM   2466 O OD1 . ASN B 1 58  ? 47.328 44.102  20.055  1.00 104.35 ? 99  ASN B OD1 1 
ATOM   2467 N ND2 . ASN B 1 58  ? 46.164 42.852  18.600  1.00 101.14 ? 99  ASN B ND2 1 
ATOM   2468 N N   . ASP B 1 59  ? 51.295 43.333  19.982  1.00 100.81 ? 100 ASP B N   1 
ATOM   2469 C CA  . ASP B 1 59  ? 52.516 43.248  20.785  1.00 103.46 ? 100 ASP B CA  1 
ATOM   2470 C C   . ASP B 1 59  ? 53.722 42.794  19.978  1.00 102.15 ? 100 ASP B C   1 
ATOM   2471 O O   . ASP B 1 59  ? 54.639 42.173  20.516  1.00 102.30 ? 100 ASP B O   1 
ATOM   2472 C CB  . ASP B 1 59  ? 52.334 42.280  21.959  1.00 108.66 ? 100 ASP B CB  1 
ATOM   2473 C CG  . ASP B 1 59  ? 51.076 42.550  22.753  1.00 112.12 ? 100 ASP B CG  1 
ATOM   2474 O OD1 . ASP B 1 59  ? 50.830 43.728  23.092  1.00 113.75 ? 100 ASP B OD1 1 
ATOM   2475 O OD2 . ASP B 1 59  ? 50.343 41.579  23.043  1.00 114.03 ? 100 ASP B OD2 1 
ATOM   2476 N N   . ALA B 1 60  ? 53.726 43.076  18.685  1.00 100.80 ? 101 ALA B N   1 
ATOM   2477 C CA  . ALA B 1 60  ? 54.867 42.681  17.883  1.00 99.57  ? 101 ALA B CA  1 
ATOM   2478 C C   . ALA B 1 60  ? 55.917 43.761  18.050  1.00 101.07 ? 101 ALA B C   1 
ATOM   2479 O O   . ALA B 1 60  ? 55.621 44.954  17.954  1.00 99.77  ? 101 ALA B O   1 
ATOM   2480 C CB  . ALA B 1 60  ? 54.476 42.552  16.427  1.00 99.89  ? 101 ALA B CB  1 
ATOM   2481 N N   . ASP B 1 61  ? 57.142 43.350  18.334  1.00 103.40 ? 102 ASP B N   1 
ATOM   2482 C CA  . ASP B 1 61  ? 58.215 44.317  18.477  1.00 104.83 ? 102 ASP B CA  1 
ATOM   2483 C C   . ASP B 1 61  ? 58.808 44.516  17.085  1.00 102.69 ? 102 ASP B C   1 
ATOM   2484 O O   . ASP B 1 61  ? 59.305 45.589  16.758  1.00 104.28 ? 102 ASP B O   1 
ATOM   2485 C CB  . ASP B 1 61  ? 59.249 43.821  19.493  1.00 107.12 ? 102 ASP B CB  1 
ATOM   2486 C CG  . ASP B 1 61  ? 58.693 43.797  20.921  1.00 109.31 ? 102 ASP B CG  1 
ATOM   2487 O OD1 . ASP B 1 61  ? 58.229 44.858  21.401  1.00 104.00 ? 102 ASP B OD1 1 
ATOM   2488 O OD2 . ASP B 1 61  ? 58.710 42.721  21.558  1.00 111.15 ? 102 ASP B OD2 1 
ATOM   2489 N N   . GLN B 1 62  ? 58.729 43.472  16.266  1.00 100.60 ? 103 GLN B N   1 
ATOM   2490 C CA  . GLN B 1 62  ? 59.189 43.531  14.887  1.00 98.40  ? 103 GLN B CA  1 
ATOM   2491 C C   . GLN B 1 62  ? 58.323 42.601  14.045  1.00 95.98  ? 103 GLN B C   1 
ATOM   2492 O O   . GLN B 1 62  ? 58.198 41.415  14.338  1.00 99.90  ? 103 GLN B O   1 
ATOM   2493 C CB  . GLN B 1 62  ? 60.647 43.105  14.747  1.00 101.14 ? 103 GLN B CB  1 
ATOM   2494 C CG  . GLN B 1 62  ? 61.264 43.576  13.426  1.00 109.27 ? 103 GLN B CG  1 
ATOM   2495 C CD  . GLN B 1 62  ? 62.522 42.814  13.020  1.00 111.96 ? 103 GLN B CD  1 
ATOM   2496 O OE1 . GLN B 1 62  ? 62.461 41.636  12.655  1.00 110.33 ? 103 GLN B OE1 1 
ATOM   2497 N NE2 . GLN B 1 62  ? 63.669 43.488  13.078  1.00 111.24 ? 103 GLN B NE2 1 
ATOM   2498 N N   . ILE B 1 63  ? 57.718 43.156  13.003  1.00 90.14  ? 104 ILE B N   1 
ATOM   2499 C CA  . ILE B 1 63  ? 56.867 42.399  12.095  1.00 78.47  ? 104 ILE B CA  1 
ATOM   2500 C C   . ILE B 1 63  ? 57.649 42.138  10.815  1.00 77.54  ? 104 ILE B C   1 
ATOM   2501 O O   . ILE B 1 63  ? 58.164 43.064  10.193  1.00 80.36  ? 104 ILE B O   1 
ATOM   2502 C CB  . ILE B 1 63  ? 55.576 43.199  11.751  1.00 74.09  ? 104 ILE B CB  1 
ATOM   2503 C CG1 . ILE B 1 63  ? 54.779 43.476  13.040  1.00 69.19  ? 104 ILE B CG1 1 
ATOM   2504 C CG2 . ILE B 1 63  ? 54.739 42.440  10.722  1.00 66.75  ? 104 ILE B CG2 1 
ATOM   2505 C CD1 . ILE B 1 63  ? 53.799 44.654  12.952  1.00 60.83  ? 104 ILE B CD1 1 
ATOM   2506 N N   . ILE B 1 64  ? 57.750 40.874  10.427  1.00 79.83  ? 105 ILE B N   1 
ATOM   2507 C CA  . ILE B 1 64  ? 58.462 40.511  9.208   1.00 81.52  ? 105 ILE B CA  1 
ATOM   2508 C C   . ILE B 1 64  ? 57.502 39.868  8.223   1.00 78.85  ? 105 ILE B C   1 
ATOM   2509 O O   . ILE B 1 64  ? 56.649 39.072  8.614   1.00 82.35  ? 105 ILE B O   1 
ATOM   2510 C CB  . ILE B 1 64  ? 59.593 39.523  9.512   1.00 86.70  ? 105 ILE B CB  1 
ATOM   2511 C CG1 . ILE B 1 64  ? 60.627 40.205  10.414  1.00 86.49  ? 105 ILE B CG1 1 
ATOM   2512 C CG2 . ILE B 1 64  ? 60.218 39.029  8.206   1.00 83.96  ? 105 ILE B CG2 1 
ATOM   2513 C CD1 . ILE B 1 64  ? 61.649 39.266  10.975  1.00 89.43  ? 105 ILE B CD1 1 
ATOM   2514 N N   . VAL B 1 65  ? 57.648 40.215  6.949   1.00 72.85  ? 106 VAL B N   1 
ATOM   2515 C CA  . VAL B 1 65  ? 56.790 39.680  5.900   1.00 68.20  ? 106 VAL B CA  1 
ATOM   2516 C C   . VAL B 1 65  ? 57.659 38.887  4.947   1.00 68.50  ? 106 VAL B C   1 
ATOM   2517 O O   . VAL B 1 65  ? 58.744 39.319  4.601   1.00 71.42  ? 106 VAL B O   1 
ATOM   2518 C CB  . VAL B 1 65  ? 56.064 40.841  5.121   1.00 67.98  ? 106 VAL B CB  1 
ATOM   2519 C CG1 . VAL B 1 65  ? 55.400 40.325  3.859   1.00 65.15  ? 106 VAL B CG1 1 
ATOM   2520 C CG2 . VAL B 1 65  ? 54.996 41.464  5.995   1.00 63.52  ? 106 VAL B CG2 1 
ATOM   2521 N N   . ALA B 1 66  ? 57.196 37.715  4.534   1.00 70.65  ? 107 ALA B N   1 
ATOM   2522 C CA  . ALA B 1 66  ? 57.958 36.898  3.594   1.00 68.11  ? 107 ALA B CA  1 
ATOM   2523 C C   . ALA B 1 66  ? 57.096 36.571  2.378   1.00 67.52  ? 107 ALA B C   1 
ATOM   2524 O O   . ALA B 1 66  ? 56.016 36.008  2.502   1.00 68.77  ? 107 ALA B O   1 
ATOM   2525 C CB  . ALA B 1 66  ? 58.432 35.623  4.265   1.00 57.68  ? 107 ALA B CB  1 
ATOM   2526 N N   . LEU B 1 67  ? 57.587 36.950  1.208   1.00 67.67  ? 108 LEU B N   1 
ATOM   2527 C CA  . LEU B 1 67  ? 56.889 36.727  -0.040  1.00 71.03  ? 108 LEU B CA  1 
ATOM   2528 C C   . LEU B 1 67  ? 57.066 35.294  -0.460  1.00 75.74  ? 108 LEU B C   1 
ATOM   2529 O O   . LEU B 1 67  ? 58.042 34.647  -0.090  1.00 79.48  ? 108 LEU B O   1 
ATOM   2530 C CB  . LEU B 1 67  ? 57.450 37.634  -1.134  1.00 71.91  ? 108 LEU B CB  1 
ATOM   2531 C CG  . LEU B 1 67  ? 57.161 39.139  -1.097  1.00 72.26  ? 108 LEU B CG  1 
ATOM   2532 C CD1 . LEU B 1 67  ? 56.231 39.490  -2.252  1.00 81.28  ? 108 LEU B CD1 1 
ATOM   2533 C CD2 . LEU B 1 67  ? 56.554 39.542  0.241   1.00 65.20  ? 108 LEU B CD2 1 
ATOM   2534 N N   . GLN B 1 68  ? 56.134 34.801  -1.260  1.00 72.24  ? 109 GLN B N   1 
ATOM   2535 C CA  . GLN B 1 68  ? 56.223 33.434  -1.708  1.00 68.57  ? 109 GLN B CA  1 
ATOM   2536 C C   . GLN B 1 68  ? 57.382 33.313  -2.683  1.00 70.10  ? 109 GLN B C   1 
ATOM   2537 O O   . GLN B 1 68  ? 57.862 32.210  -2.950  1.00 67.73  ? 109 GLN B O   1 
ATOM   2538 C CB  . GLN B 1 68  ? 54.903 33.011  -2.361  1.00 65.87  ? 109 GLN B CB  1 
ATOM   2539 C CG  . GLN B 1 68  ? 54.458 31.618  -1.985  1.00 62.49  ? 109 GLN B CG  1 
ATOM   2540 C CD  . GLN B 1 68  ? 54.406 31.396  -0.479  1.00 61.07  ? 109 GLN B CD  1 
ATOM   2541 O OE1 . GLN B 1 68  ? 54.921 30.400  0.009   1.00 72.53  ? 109 GLN B OE1 1 
ATOM   2542 N NE2 . GLN B 1 68  ? 53.785 32.315  0.259   1.00 57.79  ? 109 GLN B NE2 1 
ATOM   2543 N N   . ASP B 1 69  ? 57.849 34.443  -3.213  1.00 70.59  ? 110 ASP B N   1 
ATOM   2544 C CA  . ASP B 1 69  ? 58.956 34.375  -4.159  1.00 72.63  ? 110 ASP B CA  1 
ATOM   2545 C C   . ASP B 1 69  ? 60.352 34.438  -3.542  1.00 75.09  ? 110 ASP B C   1 
ATOM   2546 O O   . ASP B 1 69  ? 61.346 34.459  -4.269  1.00 74.28  ? 110 ASP B O   1 
ATOM   2547 C CB  . ASP B 1 69  ? 58.829 35.431  -5.274  1.00 71.68  ? 110 ASP B CB  1 
ATOM   2548 C CG  . ASP B 1 69  ? 58.748 36.860  -4.758  1.00 72.28  ? 110 ASP B CG  1 
ATOM   2549 O OD1 . ASP B 1 69  ? 59.245 37.156  -3.651  1.00 73.43  ? 110 ASP B OD1 1 
ATOM   2550 O OD2 . ASP B 1 69  ? 58.192 37.703  -5.499  1.00 75.42  ? 110 ASP B OD2 1 
ATOM   2551 N N   . GLY B 1 70  ? 60.429 34.455  -2.211  1.00 76.39  ? 111 GLY B N   1 
ATOM   2552 C CA  . GLY B 1 70  ? 61.724 34.478  -1.556  1.00 74.67  ? 111 GLY B CA  1 
ATOM   2553 C C   . GLY B 1 70  ? 62.083 35.734  -0.799  1.00 79.93  ? 111 GLY B C   1 
ATOM   2554 O O   . GLY B 1 70  ? 62.817 35.676  0.187   1.00 79.26  ? 111 GLY B O   1 
ATOM   2555 N N   . ARG B 1 71  ? 61.570 36.878  -1.237  1.00 81.52  ? 112 ARG B N   1 
ATOM   2556 C CA  . ARG B 1 71  ? 61.898 38.123  -0.562  1.00 80.65  ? 112 ARG B CA  1 
ATOM   2557 C C   . ARG B 1 71  ? 61.335 38.160  0.855   1.00 80.33  ? 112 ARG B C   1 
ATOM   2558 O O   . ARG B 1 71  ? 60.367 37.474  1.174   1.00 88.54  ? 112 ARG B O   1 
ATOM   2559 C CB  . ARG B 1 71  ? 61.406 39.317  -1.389  1.00 80.05  ? 112 ARG B CB  1 
ATOM   2560 C CG  . ARG B 1 71  ? 62.035 39.380  -2.790  1.00 78.69  ? 112 ARG B CG  1 
ATOM   2561 C CD  . ARG B 1 71  ? 61.491 40.526  -3.649  1.00 80.51  ? 112 ARG B CD  1 
ATOM   2562 N NE  . ARG B 1 71  ? 60.178 40.264  -4.255  1.00 75.61  ? 112 ARG B NE  1 
ATOM   2563 C CZ  . ARG B 1 71  ? 59.502 41.170  -4.961  1.00 73.06  ? 112 ARG B CZ  1 
ATOM   2564 N NH1 . ARG B 1 71  ? 60.015 42.374  -5.138  1.00 71.69  ? 112 ARG B NH1 1 
ATOM   2565 N NH2 . ARG B 1 71  ? 58.321 40.884  -5.498  1.00 77.33  ? 112 ARG B NH2 1 
ATOM   2566 N N   . VAL B 1 72  ? 61.980 38.940  1.709   1.00 76.89  ? 113 VAL B N   1 
ATOM   2567 C CA  . VAL B 1 72  ? 61.570 39.098  3.098   1.00 74.75  ? 113 VAL B CA  1 
ATOM   2568 C C   . VAL B 1 72  ? 61.663 40.593  3.384   1.00 75.42  ? 113 VAL B C   1 
ATOM   2569 O O   . VAL B 1 72  ? 62.364 41.304  2.664   1.00 83.60  ? 113 VAL B O   1 
ATOM   2570 C CB  . VAL B 1 72  ? 62.500 38.322  4.046   1.00 68.48  ? 113 VAL B CB  1 
ATOM   2571 C CG1 . VAL B 1 72  ? 62.079 38.539  5.486   1.00 75.37  ? 113 VAL B CG1 1 
ATOM   2572 C CG2 . VAL B 1 72  ? 62.452 36.861  3.708   1.00 62.08  ? 113 VAL B CG2 1 
ATOM   2573 N N   . PHE B 1 73  ? 60.949 41.080  4.396   1.00 69.59  ? 114 PHE B N   1 
ATOM   2574 C CA  . PHE B 1 73  ? 60.969 42.501  4.700   1.00 65.23  ? 114 PHE B CA  1 
ATOM   2575 C C   . PHE B 1 73  ? 60.551 42.781  6.120   1.00 74.38  ? 114 PHE B C   1 
ATOM   2576 O O   . PHE B 1 73  ? 59.823 42.000  6.745   1.00 81.05  ? 114 PHE B O   1 
ATOM   2577 C CB  . PHE B 1 73  ? 59.992 43.308  3.844   1.00 62.66  ? 114 PHE B CB  1 
ATOM   2578 C CG  . PHE B 1 73  ? 60.094 43.084  2.358   1.00 67.57  ? 114 PHE B CG  1 
ATOM   2579 C CD1 . PHE B 1 73  ? 59.531 41.963  1.764   1.00 67.94  ? 114 PHE B CD1 1 
ATOM   2580 C CD2 . PHE B 1 73  ? 60.658 44.055  1.537   1.00 67.62  ? 114 PHE B CD2 1 
ATOM   2581 C CE1 . PHE B 1 73  ? 59.522 41.820  0.371   1.00 76.59  ? 114 PHE B CE1 1 
ATOM   2582 C CE2 . PHE B 1 73  ? 60.655 43.921  0.148   1.00 68.52  ? 114 PHE B CE2 1 
ATOM   2583 C CZ  . PHE B 1 73  ? 60.084 42.802  -0.436  1.00 72.01  ? 114 PHE B CZ  1 
ATOM   2584 N N   . GLU B 1 74  ? 61.025 43.909  6.635   1.00 76.84  ? 115 GLU B N   1 
ATOM   2585 C CA  . GLU B 1 74  ? 60.610 44.333  7.947   1.00 77.45  ? 115 GLU B CA  1 
ATOM   2586 C C   . GLU B 1 74  ? 59.459 45.229  7.521   1.00 75.16  ? 115 GLU B C   1 
ATOM   2587 O O   . GLU B 1 74  ? 59.610 46.061  6.622   1.00 72.28  ? 115 GLU B O   1 
ATOM   2588 C CB  . GLU B 1 74  ? 61.690 45.138  8.671   1.00 82.99  ? 115 GLU B CB  1 
ATOM   2589 C CG  . GLU B 1 74  ? 61.127 45.900  9.886   1.00 91.91  ? 115 GLU B CG  1 
ATOM   2590 C CD  . GLU B 1 74  ? 62.004 45.827  11.132  1.00 97.63  ? 115 GLU B CD  1 
ATOM   2591 O OE1 . GLU B 1 74  ? 61.589 46.404  12.161  1.00 95.10  ? 115 GLU B OE1 1 
ATOM   2592 O OE2 . GLU B 1 74  ? 63.090 45.200  11.087  1.00 98.71  ? 115 GLU B OE2 1 
ATOM   2593 N N   . ALA B 1 75  ? 58.297 45.028  8.122   1.00 73.26  ? 116 ALA B N   1 
ATOM   2594 C CA  . ALA B 1 75  ? 57.140 45.810  7.755   1.00 67.47  ? 116 ALA B CA  1 
ATOM   2595 C C   . ALA B 1 75  ? 56.782 46.760  8.860   1.00 70.15  ? 116 ALA B C   1 
ATOM   2596 O O   . ALA B 1 75  ? 57.014 46.483  10.046  1.00 66.33  ? 116 ALA B O   1 
ATOM   2597 C CB  . ALA B 1 75  ? 55.972 44.899  7.474   1.00 70.65  ? 116 ALA B CB  1 
ATOM   2598 N N   . LEU B 1 76  ? 56.200 47.880  8.447   1.00 71.43  ? 117 LEU B N   1 
ATOM   2599 C CA  . LEU B 1 76  ? 55.745 48.924  9.350   1.00 69.63  ? 117 LEU B CA  1 
ATOM   2600 C C   . LEU B 1 76  ? 54.239 48.741  9.590   1.00 72.17  ? 117 LEU B C   1 
ATOM   2601 O O   . LEU B 1 76  ? 53.460 48.493  8.657   1.00 68.33  ? 117 LEU B O   1 
ATOM   2602 C CB  . LEU B 1 76  ? 56.012 50.290  8.718   1.00 69.41  ? 117 LEU B CB  1 
ATOM   2603 C CG  . LEU B 1 76  ? 55.153 51.461  9.196   1.00 73.51  ? 117 LEU B CG  1 
ATOM   2604 C CD1 . LEU B 1 76  ? 55.597 51.875  10.594  1.00 77.67  ? 117 LEU B CD1 1 
ATOM   2605 C CD2 . LEU B 1 76  ? 55.258 52.633  8.213   1.00 72.51  ? 117 LEU B CD2 1 
ATOM   2606 N N   . LEU B 1 77  ? 53.838 48.871  10.845  1.00 67.53  ? 118 LEU B N   1 
ATOM   2607 C CA  . LEU B 1 77  ? 52.450 48.728  11.225  1.00 67.86  ? 118 LEU B CA  1 
ATOM   2608 C C   . LEU B 1 77  ? 51.751 50.052  10.981  1.00 70.94  ? 118 LEU B C   1 
ATOM   2609 O O   . LEU B 1 77  ? 51.823 50.944  11.823  1.00 75.93  ? 118 LEU B O   1 
ATOM   2610 C CB  . LEU B 1 77  ? 52.370 48.375  12.710  1.00 68.88  ? 118 LEU B CB  1 
ATOM   2611 C CG  . LEU B 1 77  ? 51.125 47.744  13.342  1.00 73.20  ? 118 LEU B CG  1 
ATOM   2612 C CD1 . LEU B 1 77  ? 50.671 48.584  14.529  1.00 68.05  ? 118 LEU B CD1 1 
ATOM   2613 C CD2 . LEU B 1 77  ? 50.027 47.595  12.301  1.00 70.40  ? 118 LEU B CD2 1 
ATOM   2614 N N   . VAL B 1 78  ? 51.065 50.209  9.852   1.00 70.00  ? 119 VAL B N   1 
ATOM   2615 C CA  . VAL B 1 78  ? 50.405 51.492  9.648   1.00 71.27  ? 119 VAL B CA  1 
ATOM   2616 C C   . VAL B 1 78  ? 49.177 51.664  10.550  1.00 71.30  ? 119 VAL B C   1 
ATOM   2617 O O   . VAL B 1 78  ? 48.814 52.783  10.901  1.00 80.22  ? 119 VAL B O   1 
ATOM   2618 C CB  . VAL B 1 78  ? 50.086 51.780  8.112   1.00 67.48  ? 119 VAL B CB  1 
ATOM   2619 C CG1 . VAL B 1 78  ? 50.778 50.774  7.227   1.00 60.82  ? 119 VAL B CG1 1 
ATOM   2620 C CG2 . VAL B 1 78  ? 48.625 51.838  7.854   1.00 68.57  ? 119 VAL B CG2 1 
ATOM   2621 N N   . GLY B 1 79  ? 48.562 50.564  10.965  1.00 76.10  ? 120 GLY B N   1 
ATOM   2622 C CA  . GLY B 1 79  ? 47.405 50.675  11.839  1.00 74.13  ? 120 GLY B CA  1 
ATOM   2623 C C   . GLY B 1 79  ? 46.622 49.389  12.023  1.00 74.54  ? 120 GLY B C   1 
ATOM   2624 O O   . GLY B 1 79  ? 46.911 48.391  11.374  1.00 75.90  ? 120 GLY B O   1 
ATOM   2625 N N   . SER B 1 80  ? 45.617 49.427  12.900  1.00 78.35  ? 121 SER B N   1 
ATOM   2626 C CA  . SER B 1 80  ? 44.772 48.265  13.193  1.00 77.17  ? 121 SER B CA  1 
ATOM   2627 C C   . SER B 1 80  ? 43.401 48.659  13.740  1.00 76.43  ? 121 SER B C   1 
ATOM   2628 O O   . SER B 1 80  ? 43.201 49.779  14.203  1.00 79.67  ? 121 SER B O   1 
ATOM   2629 C CB  . SER B 1 80  ? 45.457 47.377  14.214  1.00 72.24  ? 121 SER B CB  1 
ATOM   2630 O OG  . SER B 1 80  ? 45.674 48.111  15.398  1.00 78.49  ? 121 SER B OG  1 
ATOM   2631 N N   . ASP B 1 81  ? 42.459 47.725  13.685  1.00 75.00  ? 122 ASP B N   1 
ATOM   2632 C CA  . ASP B 1 81  ? 41.103 47.960  14.177  1.00 75.06  ? 122 ASP B CA  1 
ATOM   2633 C C   . ASP B 1 81  ? 40.682 46.728  14.958  1.00 76.73  ? 122 ASP B C   1 
ATOM   2634 O O   . ASP B 1 81  ? 40.643 45.620  14.416  1.00 81.46  ? 122 ASP B O   1 
ATOM   2635 C CB  . ASP B 1 81  ? 40.143 48.201  13.007  1.00 77.64  ? 122 ASP B CB  1 
ATOM   2636 C CG  . ASP B 1 81  ? 38.738 48.611  13.454  1.00 71.27  ? 122 ASP B CG  1 
ATOM   2637 O OD1 . ASP B 1 81  ? 38.591 49.564  14.253  1.00 67.49  ? 122 ASP B OD1 1 
ATOM   2638 O OD2 . ASP B 1 81  ? 37.772 47.987  12.975  1.00 70.99  ? 122 ASP B OD2 1 
ATOM   2639 N N   . SER B 1 82  ? 40.392 46.927  16.238  1.00 73.23  ? 123 SER B N   1 
ATOM   2640 C CA  . SER B 1 82  ? 39.986 45.840  17.118  1.00 74.08  ? 123 SER B CA  1 
ATOM   2641 C C   . SER B 1 82  ? 38.603 45.339  16.738  1.00 71.02  ? 123 SER B C   1 
ATOM   2642 O O   . SER B 1 82  ? 38.359 44.142  16.585  1.00 70.56  ? 123 SER B O   1 
ATOM   2643 C CB  . SER B 1 82  ? 39.946 46.333  18.573  1.00 73.15  ? 123 SER B CB  1 
ATOM   2644 O OG  . SER B 1 82  ? 40.899 45.659  19.384  1.00 81.18  ? 123 SER B OG  1 
ATOM   2645 N N   . LEU B 1 83  ? 37.700 46.289  16.592  1.00 66.57  ? 124 LEU B N   1 
ATOM   2646 C CA  . LEU B 1 83  ? 36.327 45.988  16.283  1.00 69.38  ? 124 LEU B CA  1 
ATOM   2647 C C   . LEU B 1 83  ? 36.147 45.165  14.995  1.00 68.87  ? 124 LEU B C   1 
ATOM   2648 O O   . LEU B 1 83  ? 35.067 44.633  14.740  1.00 76.47  ? 124 LEU B O   1 
ATOM   2649 C CB  . LEU B 1 83  ? 35.561 47.309  16.269  1.00 65.37  ? 124 LEU B CB  1 
ATOM   2650 C CG  . LEU B 1 83  ? 34.053 47.392  16.099  1.00 76.42  ? 124 LEU B CG  1 
ATOM   2651 C CD1 . LEU B 1 83  ? 33.584 48.740  16.646  1.00 78.01  ? 124 LEU B CD1 1 
ATOM   2652 C CD2 . LEU B 1 83  ? 33.674 47.241  14.622  1.00 76.62  ? 124 LEU B CD2 1 
ATOM   2653 N N   . THR B 1 84  ? 37.202 45.036  14.199  1.00 61.97  ? 125 THR B N   1 
ATOM   2654 C CA  . THR B 1 84  ? 37.125 44.246  12.969  1.00 60.25  ? 125 THR B CA  1 
ATOM   2655 C C   . THR B 1 84  ? 38.279 43.246  12.920  1.00 59.58  ? 125 THR B C   1 
ATOM   2656 O O   . THR B 1 84  ? 38.344 42.394  12.045  1.00 56.58  ? 125 THR B O   1 
ATOM   2657 C CB  . THR B 1 84  ? 37.187 45.137  11.660  1.00 68.40  ? 125 THR B CB  1 
ATOM   2658 O OG1 . THR B 1 84  ? 38.403 45.907  11.626  1.00 68.99  ? 125 THR B OG1 1 
ATOM   2659 C CG2 . THR B 1 84  ? 35.987 46.081  11.576  1.00 61.91  ? 125 THR B CG2 1 
ATOM   2660 N N   . ASP B 1 85  ? 39.189 43.361  13.876  1.00 62.11  ? 126 ASP B N   1 
ATOM   2661 C CA  . ASP B 1 85  ? 40.371 42.508  13.936  1.00 63.96  ? 126 ASP B CA  1 
ATOM   2662 C C   . ASP B 1 85  ? 41.147 42.610  12.609  1.00 60.95  ? 126 ASP B C   1 
ATOM   2663 O O   . ASP B 1 85  ? 41.574 41.613  12.026  1.00 55.64  ? 126 ASP B O   1 
ATOM   2664 C CB  . ASP B 1 85  ? 39.956 41.059  14.255  1.00 60.84  ? 126 ASP B CB  1 
ATOM   2665 C CG  . ASP B 1 85  ? 41.151 40.144  14.551  1.00 65.30  ? 126 ASP B CG  1 
ATOM   2666 O OD1 . ASP B 1 85  ? 42.211 40.617  15.027  1.00 64.82  ? 126 ASP B OD1 1 
ATOM   2667 O OD2 . ASP B 1 85  ? 41.014 38.929  14.318  1.00 68.66  ? 126 ASP B OD2 1 
ATOM   2668 N N   . LEU B 1 86  ? 41.326 43.835  12.130  1.00 62.69  ? 127 LEU B N   1 
ATOM   2669 C CA  . LEU B 1 86  ? 42.075 44.036  10.885  1.00 67.76  ? 127 LEU B CA  1 
ATOM   2670 C C   . LEU B 1 86  ? 43.300 44.892  11.092  1.00 62.86  ? 127 LEU B C   1 
ATOM   2671 O O   . LEU B 1 86  ? 43.283 45.835  11.864  1.00 65.87  ? 127 LEU B O   1 
ATOM   2672 C CB  . LEU B 1 86  ? 41.215 44.693  9.819   1.00 63.47  ? 127 LEU B CB  1 
ATOM   2673 C CG  . LEU B 1 86  ? 40.244 43.769  9.113   1.00 63.37  ? 127 LEU B CG  1 
ATOM   2674 C CD1 . LEU B 1 86  ? 39.254 44.609  8.332   1.00 63.13  ? 127 LEU B CD1 1 
ATOM   2675 C CD2 . LEU B 1 86  ? 41.019 42.806  8.206   1.00 53.34  ? 127 LEU B CD2 1 
ATOM   2676 N N   . ALA B 1 87  ? 44.368 44.556  10.397  1.00 62.63  ? 128 ALA B N   1 
ATOM   2677 C CA  . ALA B 1 87  ? 45.576 45.337  10.507  1.00 65.07  ? 128 ALA B CA  1 
ATOM   2678 C C   . ALA B 1 87  ? 46.143 45.569  9.103   1.00 69.27  ? 128 ALA B C   1 
ATOM   2679 O O   . ALA B 1 87  ? 45.797 44.855  8.151   1.00 60.28  ? 128 ALA B O   1 
ATOM   2680 C CB  . ALA B 1 87  ? 46.578 44.614  11.374  1.00 67.04  ? 128 ALA B CB  1 
ATOM   2681 N N   . VAL B 1 88  ? 46.995 46.587  8.980   1.00 71.31  ? 129 VAL B N   1 
ATOM   2682 C CA  . VAL B 1 88  ? 47.628 46.907  7.705   1.00 69.47  ? 129 VAL B CA  1 
ATOM   2683 C C   . VAL B 1 88  ? 49.108 47.115  7.910   1.00 65.20  ? 129 VAL B C   1 
ATOM   2684 O O   . VAL B 1 88  ? 49.525 47.850  8.795   1.00 58.51  ? 129 VAL B O   1 
ATOM   2685 C CB  . VAL B 1 88  ? 47.084 48.207  7.055   1.00 67.88  ? 129 VAL B CB  1 
ATOM   2686 C CG1 . VAL B 1 88  ? 47.844 48.468  5.765   1.00 62.78  ? 129 VAL B CG1 1 
ATOM   2687 C CG2 . VAL B 1 88  ? 45.584 48.093  6.775   1.00 63.11  ? 129 VAL B CG2 1 
ATOM   2688 N N   . LEU B 1 89  ? 49.891 46.461  7.075   1.00 64.11  ? 130 LEU B N   1 
ATOM   2689 C CA  . LEU B 1 89  ? 51.332 46.589  7.121   1.00 67.45  ? 130 LEU B CA  1 
ATOM   2690 C C   . LEU B 1 89  ? 51.765 47.321  5.848   1.00 71.41  ? 130 LEU B C   1 
ATOM   2691 O O   . LEU B 1 89  ? 51.002 47.438  4.878   1.00 73.65  ? 130 LEU B O   1 
ATOM   2692 C CB  . LEU B 1 89  ? 51.987 45.207  7.167   1.00 59.55  ? 130 LEU B CB  1 
ATOM   2693 C CG  . LEU B 1 89  ? 51.420 44.261  8.223   1.00 58.79  ? 130 LEU B CG  1 
ATOM   2694 C CD1 . LEU B 1 89  ? 52.274 43.037  8.251   1.00 49.56  ? 130 LEU B CD1 1 
ATOM   2695 C CD2 . LEU B 1 89  ? 51.386 44.919  9.616   1.00 49.33  ? 130 LEU B CD2 1 
ATOM   2696 N N   . LYS B 1 90  ? 52.986 47.826  5.859   1.00 72.63  ? 131 LYS B N   1 
ATOM   2697 C CA  . LYS B 1 90  ? 53.522 48.519  4.696   1.00 72.35  ? 131 LYS B CA  1 
ATOM   2698 C C   . LYS B 1 90  ? 54.939 48.022  4.542   1.00 71.85  ? 131 LYS B C   1 
ATOM   2699 O O   . LYS B 1 90  ? 55.634 47.832  5.544   1.00 69.10  ? 131 LYS B O   1 
ATOM   2700 C CB  . LYS B 1 90  ? 53.524 50.028  4.935   1.00 74.00  ? 131 LYS B CB  1 
ATOM   2701 C CG  . LYS B 1 90  ? 54.112 50.852  3.829   1.00 69.77  ? 131 LYS B CG  1 
ATOM   2702 C CD  . LYS B 1 90  ? 53.313 50.722  2.552   1.00 80.10  ? 131 LYS B CD  1 
ATOM   2703 C CE  . LYS B 1 90  ? 53.848 51.663  1.473   1.00 84.17  ? 131 LYS B CE  1 
ATOM   2704 N NZ  . LYS B 1 90  ? 55.295 51.417  1.206   1.00 89.63  ? 131 LYS B NZ  1 
ATOM   2705 N N   . ILE B 1 91  ? 55.336 47.746  3.304   1.00 74.23  ? 132 ILE B N   1 
ATOM   2706 C CA  . ILE B 1 91  ? 56.702 47.308  3.017   1.00 85.28  ? 132 ILE B CA  1 
ATOM   2707 C C   . ILE B 1 91  ? 57.176 48.097  1.823   1.00 90.53  ? 132 ILE B C   1 
ATOM   2708 O O   . ILE B 1 91  ? 56.396 48.385  0.910   1.00 90.52  ? 132 ILE B O   1 
ATOM   2709 C CB  . ILE B 1 91  ? 56.835 45.815  2.632   1.00 82.79  ? 132 ILE B CB  1 
ATOM   2710 C CG1 . ILE B 1 91  ? 55.864 45.479  1.506   1.00 77.60  ? 132 ILE B CG1 1 
ATOM   2711 C CG2 . ILE B 1 91  ? 56.695 44.948  3.853   1.00 76.15  ? 132 ILE B CG2 1 
ATOM   2712 C CD1 . ILE B 1 91  ? 56.303 44.293  0.704   1.00 82.22  ? 132 ILE B CD1 1 
ATOM   2713 N N   . ASN B 1 92  ? 58.455 48.438  1.822   1.00 95.66  ? 133 ASN B N   1 
ATOM   2714 C CA  . ASN B 1 92  ? 59.000 49.203  0.715   1.00 100.82 ? 133 ASN B CA  1 
ATOM   2715 C C   . ASN B 1 92  ? 59.711 48.329  -0.290  1.00 97.69  ? 133 ASN B C   1 
ATOM   2716 O O   . ASN B 1 92  ? 60.859 47.940  -0.092  1.00 97.75  ? 133 ASN B O   1 
ATOM   2717 C CB  . ASN B 1 92  ? 59.932 50.299  1.233   1.00 104.78 ? 133 ASN B CB  1 
ATOM   2718 C CG  . ASN B 1 92  ? 59.166 51.455  1.848   1.00 109.65 ? 133 ASN B CG  1 
ATOM   2719 O OD1 . ASN B 1 92  ? 58.397 51.271  2.799   1.00 106.66 ? 133 ASN B OD1 1 
ATOM   2720 N ND2 . ASN B 1 92  ? 59.360 52.655  1.300   1.00 113.33 ? 133 ASN B ND2 1 
ATOM   2721 N N   . ALA B 1 93  ? 59.003 48.018  -1.367  1.00 97.11  ? 134 ALA B N   1 
ATOM   2722 C CA  . ALA B 1 93  ? 59.546 47.195  -2.433  1.00 98.65  ? 134 ALA B CA  1 
ATOM   2723 C C   . ALA B 1 93  ? 60.004 48.115  -3.546  1.00 97.67  ? 134 ALA B C   1 
ATOM   2724 O O   . ALA B 1 93  ? 59.652 49.290  -3.570  1.00 95.18  ? 134 ALA B O   1 
ATOM   2725 C CB  . ALA B 1 93  ? 58.479 46.247  -2.957  1.00 96.40  ? 134 ALA B CB  1 
ATOM   2726 N N   . THR B 1 94  ? 60.791 47.580  -4.470  1.00 101.06 ? 135 THR B N   1 
ATOM   2727 C CA  . THR B 1 94  ? 61.265 48.375  -5.595  1.00 103.68 ? 135 THR B CA  1 
ATOM   2728 C C   . THR B 1 94  ? 61.168 47.573  -6.891  1.00 103.31 ? 135 THR B C   1 
ATOM   2729 O O   . THR B 1 94  ? 60.960 48.141  -7.968  1.00 103.50 ? 135 THR B O   1 
ATOM   2730 C CB  . THR B 1 94  ? 62.727 48.823  -5.393  1.00 101.92 ? 135 THR B CB  1 
ATOM   2731 O OG1 . THR B 1 94  ? 63.592 47.681  -5.424  1.00 98.94  ? 135 THR B OG1 1 
ATOM   2732 C CG2 . THR B 1 94  ? 62.877 49.530  -4.055  1.00 103.34 ? 135 THR B CG2 1 
ATOM   2733 N N   . GLY B 1 95  ? 61.300 46.254  -6.779  1.00 99.43  ? 136 GLY B N   1 
ATOM   2734 C CA  . GLY B 1 95  ? 61.248 45.411  -7.956  1.00 97.82  ? 136 GLY B CA  1 
ATOM   2735 C C   . GLY B 1 95  ? 59.848 45.174  -8.465  1.00 96.75  ? 136 GLY B C   1 
ATOM   2736 O O   . GLY B 1 95  ? 59.654 44.600  -9.535  1.00 98.70  ? 136 GLY B O   1 
ATOM   2737 N N   . GLY B 1 96  ? 58.863 45.633  -7.711  1.00 93.82  ? 137 GLY B N   1 
ATOM   2738 C CA  . GLY B 1 96  ? 57.488 45.415  -8.115  1.00 91.90  ? 137 GLY B CA  1 
ATOM   2739 C C   . GLY B 1 96  ? 56.907 44.369  -7.181  1.00 89.67  ? 137 GLY B C   1 
ATOM   2740 O O   . GLY B 1 96  ? 57.656 43.641  -6.517  1.00 90.93  ? 137 GLY B O   1 
ATOM   2741 N N   . LEU B 1 97  ? 55.586 44.277  -7.109  1.00 79.71  ? 138 LEU B N   1 
ATOM   2742 C CA  . LEU B 1 97  ? 54.995 43.300  -6.209  1.00 73.03  ? 138 LEU B CA  1 
ATOM   2743 C C   . LEU B 1 97  ? 53.813 42.546  -6.770  1.00 68.41  ? 138 LEU B C   1 
ATOM   2744 O O   . LEU B 1 97  ? 53.108 43.039  -7.652  1.00 71.41  ? 138 LEU B O   1 
ATOM   2745 C CB  . LEU B 1 97  ? 54.540 43.985  -4.925  1.00 62.94  ? 138 LEU B CB  1 
ATOM   2746 C CG  . LEU B 1 97  ? 55.580 44.522  -3.951  1.00 64.63  ? 138 LEU B CG  1 
ATOM   2747 C CD1 . LEU B 1 97  ? 54.859 45.326  -2.859  1.00 57.61  ? 138 LEU B CD1 1 
ATOM   2748 C CD2 . LEU B 1 97  ? 56.386 43.366  -3.357  1.00 58.58  ? 138 LEU B CD2 1 
ATOM   2749 N N   . PRO B 1 98  ? 53.595 41.317  -6.277  1.00 67.72  ? 139 PRO B N   1 
ATOM   2750 C CA  . PRO B 1 98  ? 52.466 40.487  -6.709  1.00 65.16  ? 139 PRO B CA  1 
ATOM   2751 C C   . PRO B 1 98  ? 51.292 41.015  -5.868  1.00 58.51  ? 139 PRO B C   1 
ATOM   2752 O O   . PRO B 1 98  ? 51.412 41.117  -4.632  1.00 55.81  ? 139 PRO B O   1 
ATOM   2753 C CB  . PRO B 1 98  ? 52.879 39.098  -6.256  1.00 62.94  ? 139 PRO B CB  1 
ATOM   2754 C CG  . PRO B 1 98  ? 53.539 39.400  -4.940  1.00 64.36  ? 139 PRO B CG  1 
ATOM   2755 C CD  . PRO B 1 98  ? 54.433 40.579  -5.312  1.00 71.36  ? 139 PRO B CD  1 
ATOM   2756 N N   . THR B 1 99  ? 50.193 41.387  -6.518  1.00 56.03  ? 140 THR B N   1 
ATOM   2757 C CA  . THR B 1 99  ? 49.023 41.885  -5.784  1.00 59.74  ? 140 THR B CA  1 
ATOM   2758 C C   . THR B 1 99  ? 47.815 41.006  -6.017  1.00 60.44  ? 140 THR B C   1 
ATOM   2759 O O   . THR B 1 99  ? 47.664 40.406  -7.088  1.00 58.92  ? 140 THR B O   1 
ATOM   2760 C CB  . THR B 1 99  ? 48.634 43.291  -6.191  1.00 57.18  ? 140 THR B CB  1 
ATOM   2761 O OG1 . THR B 1 99  ? 48.483 43.341  -7.619  1.00 60.15  ? 140 THR B OG1 1 
ATOM   2762 C CG2 . THR B 1 99  ? 49.682 44.277  -5.717  1.00 60.58  ? 140 THR B CG2 1 
ATOM   2763 N N   . ILE B 1 100 ? 46.939 40.970  -5.016  1.00 59.54  ? 141 ILE B N   1 
ATOM   2764 C CA  . ILE B 1 100 ? 45.746 40.136  -5.051  1.00 61.60  ? 141 ILE B CA  1 
ATOM   2765 C C   . ILE B 1 100 ? 44.669 40.591  -6.033  1.00 61.94  ? 141 ILE B C   1 
ATOM   2766 O O   . ILE B 1 100 ? 44.267 41.748  -6.043  1.00 65.47  ? 141 ILE B O   1 
ATOM   2767 C CB  . ILE B 1 100 ? 45.106 40.030  -3.627  1.00 62.40  ? 141 ILE B CB  1 
ATOM   2768 C CG1 . ILE B 1 100 ? 43.998 38.976  -3.622  1.00 58.50  ? 141 ILE B CG1 1 
ATOM   2769 C CG2 . ILE B 1 100 ? 44.547 41.373  -3.188  1.00 62.72  ? 141 ILE B CG2 1 
ATOM   2770 C CD1 . ILE B 1 100 ? 44.530 37.579  -3.686  1.00 54.02  ? 141 ILE B CD1 1 
ATOM   2771 N N   . PRO B 1 101 ? 44.194 39.679  -6.886  1.00 61.24  ? 142 PRO B N   1 
ATOM   2772 C CA  . PRO B 1 101 ? 43.147 40.105  -7.819  1.00 57.18  ? 142 PRO B CA  1 
ATOM   2773 C C   . PRO B 1 101 ? 41.924 40.537  -7.019  1.00 62.89  ? 142 PRO B C   1 
ATOM   2774 O O   . PRO B 1 101 ? 41.437 39.784  -6.161  1.00 63.96  ? 142 PRO B O   1 
ATOM   2775 C CB  . PRO B 1 101 ? 42.853 38.846  -8.619  1.00 56.79  ? 142 PRO B CB  1 
ATOM   2776 C CG  . PRO B 1 101 ? 44.178 38.096  -8.588  1.00 58.16  ? 142 PRO B CG  1 
ATOM   2777 C CD  . PRO B 1 101 ? 44.673 38.316  -7.179  1.00 56.87  ? 142 PRO B CD  1 
ATOM   2778 N N   . ILE B 1 102 ? 41.443 41.752  -7.285  1.00 62.65  ? 143 ILE B N   1 
ATOM   2779 C CA  . ILE B 1 102 ? 40.243 42.267  -6.632  1.00 59.12  ? 143 ILE B CA  1 
ATOM   2780 C C   . ILE B 1 102 ? 39.238 42.736  -7.677  1.00 57.85  ? 143 ILE B C   1 
ATOM   2781 O O   . ILE B 1 102 ? 39.565 43.510  -8.563  1.00 59.99  ? 143 ILE B O   1 
ATOM   2782 C CB  . ILE B 1 102 ? 40.557 43.440  -5.680  1.00 60.01  ? 143 ILE B CB  1 
ATOM   2783 C CG1 . ILE B 1 102 ? 41.400 42.939  -4.502  1.00 60.76  ? 143 ILE B CG1 1 
ATOM   2784 C CG2 . ILE B 1 102 ? 39.259 44.050  -5.171  1.00 58.59  ? 143 ILE B CG2 1 
ATOM   2785 C CD1 . ILE B 1 102 ? 41.882 44.010  -3.596  1.00 55.95  ? 143 ILE B CD1 1 
ATOM   2786 N N   . ASN B 1 103 ? 38.011 42.243  -7.577  1.00 58.44  ? 144 ASN B N   1 
ATOM   2787 C CA  . ASN B 1 103 ? 36.955 42.635  -8.490  1.00 51.61  ? 144 ASN B CA  1 
ATOM   2788 C C   . ASN B 1 103 ? 35.840 43.197  -7.635  1.00 57.62  ? 144 ASN B C   1 
ATOM   2789 O O   . ASN B 1 103 ? 34.978 42.465  -7.165  1.00 62.31  ? 144 ASN B O   1 
ATOM   2790 C CB  . ASN B 1 103 ? 36.470 41.426  -9.255  1.00 54.15  ? 144 ASN B CB  1 
ATOM   2791 C CG  . ASN B 1 103 ? 35.329 41.737  -10.177 1.00 51.43  ? 144 ASN B CG  1 
ATOM   2792 O OD1 . ASN B 1 103 ? 34.579 42.697  -9.977  1.00 59.40  ? 144 ASN B OD1 1 
ATOM   2793 N ND2 . ASN B 1 103 ? 35.168 40.905  -11.181 1.00 45.65  ? 144 ASN B ND2 1 
ATOM   2794 N N   . ALA B 1 104 ? 35.870 44.508  -7.432  1.00 62.44  ? 145 ALA B N   1 
ATOM   2795 C CA  . ALA B 1 104 ? 34.891 45.208  -6.591  1.00 65.33  ? 145 ALA B CA  1 
ATOM   2796 C C   . ALA B 1 104 ? 33.433 45.120  -7.003  1.00 62.23  ? 145 ALA B C   1 
ATOM   2797 O O   . ALA B 1 104 ? 32.559 45.530  -6.244  1.00 61.40  ? 145 ALA B O   1 
ATOM   2798 C CB  . ALA B 1 104 ? 35.279 46.667  -6.467  1.00 62.32  ? 145 ALA B CB  1 
ATOM   2799 N N   . ARG B 1 105 ? 33.169 44.587  -8.191  1.00 62.96  ? 146 ARG B N   1 
ATOM   2800 C CA  . ARG B 1 105 ? 31.797 44.479  -8.673  1.00 63.12  ? 146 ARG B CA  1 
ATOM   2801 C C   . ARG B 1 105 ? 31.212 43.095  -8.413  1.00 61.64  ? 146 ARG B C   1 
ATOM   2802 O O   . ARG B 1 105 ? 29.996 42.875  -8.506  1.00 56.63  ? 146 ARG B O   1 
ATOM   2803 C CB  . ARG B 1 105 ? 31.751 44.790  -10.169 1.00 67.30  ? 146 ARG B CB  1 
ATOM   2804 C CG  . ARG B 1 105 ? 30.748 45.882  -10.510 1.00 82.66  ? 146 ARG B CG  1 
ATOM   2805 C CD  . ARG B 1 105 ? 31.177 46.669  -11.725 1.00 91.47  ? 146 ARG B CD  1 
ATOM   2806 N NE  . ARG B 1 105 ? 32.303 47.551  -11.435 1.00 99.64  ? 146 ARG B NE  1 
ATOM   2807 C CZ  . ARG B 1 105 ? 32.834 48.393  -12.317 1.00 107.23 ? 146 ARG B CZ  1 
ATOM   2808 N NH1 . ARG B 1 105 ? 32.345 48.469  -13.550 1.00 107.36 ? 146 ARG B NH1 1 
ATOM   2809 N NH2 . ARG B 1 105 ? 33.848 49.171  -11.964 1.00 112.07 ? 146 ARG B NH2 1 
ATOM   2810 N N   . ARG B 1 106 ? 32.091 42.169  -8.063  1.00 53.39  ? 147 ARG B N   1 
ATOM   2811 C CA  . ARG B 1 106 ? 31.675 40.825  -7.814  1.00 52.27  ? 147 ARG B CA  1 
ATOM   2812 C C   . ARG B 1 106 ? 30.965 40.701  -6.500  1.00 56.07  ? 147 ARG B C   1 
ATOM   2813 O O   . ARG B 1 106 ? 31.439 41.182  -5.465  1.00 59.40  ? 147 ARG B O   1 
ATOM   2814 C CB  . ARG B 1 106 ? 32.873 39.889  -7.821  1.00 54.50  ? 147 ARG B CB  1 
ATOM   2815 C CG  . ARG B 1 106 ? 32.461 38.434  -7.663  1.00 54.24  ? 147 ARG B CG  1 
ATOM   2816 C CD  . ARG B 1 106 ? 33.025 37.655  -8.798  1.00 58.32  ? 147 ARG B CD  1 
ATOM   2817 N NE  . ARG B 1 106 ? 32.210 37.711  -10.001 1.00 57.32  ? 147 ARG B NE  1 
ATOM   2818 C CZ  . ARG B 1 106 ? 32.704 37.689  -11.231 1.00 53.59  ? 147 ARG B CZ  1 
ATOM   2819 N NH1 . ARG B 1 106 ? 34.014 37.638  -11.437 1.00 53.78  ? 147 ARG B NH1 1 
ATOM   2820 N NH2 . ARG B 1 106 ? 31.883 37.648  -12.255 1.00 57.47  ? 147 ARG B NH2 1 
ATOM   2821 N N   . VAL B 1 107 ? 29.817 40.047  -6.528  1.00 53.46  ? 148 VAL B N   1 
ATOM   2822 C CA  . VAL B 1 107 ? 29.103 39.866  -5.296  1.00 57.46  ? 148 VAL B CA  1 
ATOM   2823 C C   . VAL B 1 107 ? 29.128 38.373  -4.978  1.00 56.15  ? 148 VAL B C   1 
ATOM   2824 O O   . VAL B 1 107 ? 28.638 37.553  -5.736  1.00 48.66  ? 148 VAL B O   1 
ATOM   2825 C CB  . VAL B 1 107 ? 27.658 40.493  -5.377  1.00 58.73  ? 148 VAL B CB  1 
ATOM   2826 C CG1 . VAL B 1 107 ? 27.164 40.491  -6.804  1.00 57.49  ? 148 VAL B CG1 1 
ATOM   2827 C CG2 . VAL B 1 107 ? 26.687 39.739  -4.456  1.00 56.23  ? 148 VAL B CG2 1 
ATOM   2828 N N   . PRO B 1 108 ? 29.781 38.006  -3.865  1.00 55.40  ? 149 PRO B N   1 
ATOM   2829 C CA  . PRO B 1 108 ? 29.915 36.627  -3.392  1.00 59.55  ? 149 PRO B CA  1 
ATOM   2830 C C   . PRO B 1 108 ? 28.558 35.980  -3.213  1.00 59.24  ? 149 PRO B C   1 
ATOM   2831 O O   . PRO B 1 108 ? 27.620 36.603  -2.733  1.00 67.89  ? 149 PRO B O   1 
ATOM   2832 C CB  . PRO B 1 108 ? 30.635 36.784  -2.055  1.00 59.25  ? 149 PRO B CB  1 
ATOM   2833 C CG  . PRO B 1 108 ? 31.485 38.010  -2.283  1.00 59.95  ? 149 PRO B CG  1 
ATOM   2834 C CD  . PRO B 1 108 ? 30.492 38.930  -2.964  1.00 60.38  ? 149 PRO B CD  1 
ATOM   2835 N N   . HIS B 1 109 ? 28.450 34.723  -3.583  1.00 55.62  ? 150 HIS B N   1 
ATOM   2836 C CA  . HIS B 1 109 ? 27.189 34.048  -3.439  1.00 52.30  ? 150 HIS B CA  1 
ATOM   2837 C C   . HIS B 1 109 ? 27.335 32.800  -2.583  1.00 50.20  ? 150 HIS B C   1 
ATOM   2838 O O   . HIS B 1 109 ? 28.376 32.121  -2.630  1.00 48.51  ? 150 HIS B O   1 
ATOM   2839 C CB  . HIS B 1 109 ? 26.664 33.688  -4.821  1.00 52.41  ? 150 HIS B CB  1 
ATOM   2840 C CG  . HIS B 1 109 ? 26.343 34.878  -5.679  1.00 61.63  ? 150 HIS B CG  1 
ATOM   2841 N ND1 . HIS B 1 109 ? 25.596 35.944  -5.224  1.00 61.81  ? 150 HIS B ND1 1 
ATOM   2842 C CD2 . HIS B 1 109 ? 26.587 35.125  -6.989  1.00 59.46  ? 150 HIS B CD2 1 
ATOM   2843 C CE1 . HIS B 1 109 ? 25.390 36.793  -6.216  1.00 56.80  ? 150 HIS B CE1 1 
ATOM   2844 N NE2 . HIS B 1 109 ? 25.979 36.318  -7.297  1.00 56.84  ? 150 HIS B NE2 1 
ATOM   2845 N N   . ILE B 1 110 ? 26.311 32.487  -1.790  1.00 45.75  ? 151 ILE B N   1 
ATOM   2846 C CA  . ILE B 1 110 ? 26.391 31.269  -0.991  1.00 46.13  ? 151 ILE B CA  1 
ATOM   2847 C C   . ILE B 1 110 ? 26.512 30.108  -1.959  1.00 52.71  ? 151 ILE B C   1 
ATOM   2848 O O   . ILE B 1 110 ? 25.684 29.952  -2.878  1.00 46.89  ? 151 ILE B O   1 
ATOM   2849 C CB  . ILE B 1 110 ? 25.175 31.070  -0.106  1.00 43.32  ? 151 ILE B CB  1 
ATOM   2850 C CG1 . ILE B 1 110 ? 25.154 32.127  0.998   1.00 40.43  ? 151 ILE B CG1 1 
ATOM   2851 C CG2 . ILE B 1 110 ? 25.238 29.747  0.566   1.00 36.35  ? 151 ILE B CG2 1 
ATOM   2852 C CD1 . ILE B 1 110 ? 23.724 32.387  1.573   1.00 39.75  ? 151 ILE B CD1 1 
ATOM   2853 N N   . GLY B 1 111 ? 27.575 29.313  -1.790  1.00 55.28  ? 152 GLY B N   1 
ATOM   2854 C CA  . GLY B 1 111 ? 27.772 28.192  -2.694  1.00 51.92  ? 152 GLY B CA  1 
ATOM   2855 C C   . GLY B 1 111 ? 28.905 28.417  -3.691  1.00 55.98  ? 152 GLY B C   1 
ATOM   2856 O O   . GLY B 1 111 ? 29.264 27.504  -4.452  1.00 59.20  ? 152 GLY B O   1 
ATOM   2857 N N   . ASP B 1 112 ? 29.445 29.636  -3.738  1.00 54.63  ? 153 ASP B N   1 
ATOM   2858 C CA  . ASP B 1 112 ? 30.591 29.891  -4.621  1.00 52.77  ? 153 ASP B CA  1 
ATOM   2859 C C   . ASP B 1 112 ? 31.794 29.110  -4.071  1.00 43.32  ? 153 ASP B C   1 
ATOM   2860 O O   . ASP B 1 112 ? 32.046 29.066  -2.865  1.00 45.54  ? 153 ASP B O   1 
ATOM   2861 C CB  . ASP B 1 112 ? 30.976 31.367  -4.650  1.00 46.84  ? 153 ASP B CB  1 
ATOM   2862 C CG  . ASP B 1 112 ? 29.974 32.232  -5.375  1.00 58.28  ? 153 ASP B CG  1 
ATOM   2863 O OD1 . ASP B 1 112 ? 28.935 31.706  -5.843  1.00 50.31  ? 153 ASP B OD1 1 
ATOM   2864 O OD2 . ASP B 1 112 ? 30.241 33.456  -5.454  1.00 52.99  ? 153 ASP B OD2 1 
ATOM   2865 N N   . VAL B 1 113 ? 32.528 28.481  -4.961  1.00 44.03  ? 154 VAL B N   1 
ATOM   2866 C CA  . VAL B 1 113 ? 33.696 27.728  -4.560  1.00 41.55  ? 154 VAL B CA  1 
ATOM   2867 C C   . VAL B 1 113 ? 34.767 28.719  -4.157  1.00 43.93  ? 154 VAL B C   1 
ATOM   2868 O O   . VAL B 1 113 ? 34.962 29.730  -4.820  1.00 43.35  ? 154 VAL B O   1 
ATOM   2869 C CB  . VAL B 1 113 ? 34.200 26.891  -5.733  1.00 48.45  ? 154 VAL B CB  1 
ATOM   2870 C CG1 . VAL B 1 113 ? 35.598 26.311  -5.456  1.00 40.30  ? 154 VAL B CG1 1 
ATOM   2871 C CG2 . VAL B 1 113 ? 33.195 25.821  -6.015  1.00 37.92  ? 154 VAL B CG2 1 
ATOM   2872 N N   . VAL B 1 114 ? 35.421 28.450  -3.036  1.00 39.95  ? 155 VAL B N   1 
ATOM   2873 C CA  . VAL B 1 114 ? 36.497 29.297  -2.562  1.00 38.44  ? 155 VAL B CA  1 
ATOM   2874 C C   . VAL B 1 114 ? 37.770 28.517  -2.197  1.00 42.31  ? 155 VAL B C   1 
ATOM   2875 O O   . VAL B 1 114 ? 37.761 27.284  -2.008  1.00 41.26  ? 155 VAL B O   1 
ATOM   2876 C CB  . VAL B 1 114 ? 36.086 30.125  -1.327  1.00 40.27  ? 155 VAL B CB  1 
ATOM   2877 C CG1 . VAL B 1 114 ? 35.211 31.284  -1.767  1.00 40.76  ? 155 VAL B CG1 1 
ATOM   2878 C CG2 . VAL B 1 114 ? 35.378 29.214  -0.259  1.00 39.54  ? 155 VAL B CG2 1 
ATOM   2879 N N   . LEU B 1 115 ? 38.862 29.271  -2.092  1.00 46.81  ? 156 LEU B N   1 
ATOM   2880 C CA  . LEU B 1 115 ? 40.165 28.725  -1.754  1.00 44.78  ? 156 LEU B CA  1 
ATOM   2881 C C   . LEU B 1 115 ? 40.741 29.520  -0.603  1.00 45.57  ? 156 LEU B C   1 
ATOM   2882 O O   . LEU B 1 115 ? 40.784 30.745  -0.632  1.00 50.93  ? 156 LEU B O   1 
ATOM   2883 C CB  . LEU B 1 115 ? 41.107 28.807  -2.937  1.00 43.90  ? 156 LEU B CB  1 
ATOM   2884 C CG  . LEU B 1 115 ? 40.722 28.005  -4.179  1.00 53.40  ? 156 LEU B CG  1 
ATOM   2885 C CD1 . LEU B 1 115 ? 41.878 28.062  -5.206  1.00 50.14  ? 156 LEU B CD1 1 
ATOM   2886 C CD2 . LEU B 1 115 ? 40.433 26.569  -3.770  1.00 44.83  ? 156 LEU B CD2 1 
ATOM   2887 N N   . ALA B 1 116 ? 41.144 28.814  0.440   1.00 43.89  ? 157 ALA B N   1 
ATOM   2888 C CA  . ALA B 1 116 ? 41.758 29.473  1.582   1.00 49.54  ? 157 ALA B CA  1 
ATOM   2889 C C   . ALA B 1 116 ? 43.234 29.316  1.253   1.00 44.96  ? 157 ALA B C   1 
ATOM   2890 O O   . ALA B 1 116 ? 43.673 28.207  0.866   1.00 45.55  ? 157 ALA B O   1 
ATOM   2891 C CB  . ALA B 1 116 ? 41.395 28.751  2.914   1.00 39.37  ? 157 ALA B CB  1 
ATOM   2892 N N   . ILE B 1 117 ? 43.949 30.441  1.318   1.00 50.31  ? 158 ILE B N   1 
ATOM   2893 C CA  . ILE B 1 117 ? 45.390 30.507  1.067   1.00 51.47  ? 158 ILE B CA  1 
ATOM   2894 C C   . ILE B 1 117 ? 46.081 31.056  2.315   1.00 53.93  ? 158 ILE B C   1 
ATOM   2895 O O   . ILE B 1 117 ? 45.773 32.147  2.765   1.00 61.83  ? 158 ILE B O   1 
ATOM   2896 C CB  . ILE B 1 117 ? 45.715 31.441  -0.073  1.00 52.74  ? 158 ILE B CB  1 
ATOM   2897 C CG1 . ILE B 1 117 ? 44.907 31.042  -1.311  1.00 50.47  ? 158 ILE B CG1 1 
ATOM   2898 C CG2 . ILE B 1 117 ? 47.242 31.412  -0.335  1.00 50.85  ? 158 ILE B CG2 1 
ATOM   2899 C CD1 . ILE B 1 117 ? 45.240 31.854  -2.532  1.00 52.07  ? 158 ILE B CD1 1 
ATOM   2900 N N   . GLY B 1 118 ? 47.007 30.304  2.884   1.00 54.03  ? 159 GLY B N   1 
ATOM   2901 C CA  . GLY B 1 118 ? 47.670 30.778  4.078   1.00 52.39  ? 159 GLY B CA  1 
ATOM   2902 C C   . GLY B 1 118 ? 48.795 29.854  4.492   1.00 53.74  ? 159 GLY B C   1 
ATOM   2903 O O   . GLY B 1 118 ? 49.134 28.932  3.771   1.00 56.37  ? 159 GLY B O   1 
ATOM   2904 N N   . ASN B 1 119 ? 49.358 30.109  5.670   1.00 64.76  ? 160 ASN B N   1 
ATOM   2905 C CA  . ASN B 1 119 ? 50.470 29.330  6.196   1.00 67.20  ? 160 ASN B CA  1 
ATOM   2906 C C   . ASN B 1 119 ? 50.172 28.593  7.511   1.00 68.31  ? 160 ASN B C   1 
ATOM   2907 O O   . ASN B 1 119 ? 50.687 28.943  8.575   1.00 62.65  ? 160 ASN B O   1 
ATOM   2908 C CB  . ASN B 1 119 ? 51.708 30.223  6.388   1.00 64.07  ? 160 ASN B CB  1 
ATOM   2909 C CG  . ASN B 1 119 ? 52.942 29.420  6.776   1.00 68.96  ? 160 ASN B CG  1 
ATOM   2910 O OD1 . ASN B 1 119 ? 53.721 29.809  7.659   1.00 68.38  ? 160 ASN B OD1 1 
ATOM   2911 N ND2 . ASN B 1 119 ? 53.126 28.289  6.110   1.00 66.47  ? 160 ASN B ND2 1 
ATOM   2912 N N   . PRO B 1 120 ? 49.344 27.545  7.435   1.00 68.90  ? 161 PRO B N   1 
ATOM   2913 C CA  . PRO B 1 120 ? 48.903 26.664  8.529   1.00 70.53  ? 161 PRO B CA  1 
ATOM   2914 C C   . PRO B 1 120 ? 50.095 26.014  9.247   1.00 69.89  ? 161 PRO B C   1 
ATOM   2915 O O   . PRO B 1 120 ? 50.922 25.331  8.622   1.00 70.12  ? 161 PRO B O   1 
ATOM   2916 C CB  . PRO B 1 120 ? 48.080 25.593  7.809   1.00 69.35  ? 161 PRO B CB  1 
ATOM   2917 C CG  . PRO B 1 120 ? 47.613 26.274  6.570   1.00 76.92  ? 161 PRO B CG  1 
ATOM   2918 C CD  . PRO B 1 120 ? 48.771 27.129  6.147   1.00 70.54  ? 161 PRO B CD  1 
ATOM   2919 N N   . TYR B 1 121 ? 50.174 26.207  10.553  1.00 70.53  ? 162 TYR B N   1 
ATOM   2920 C CA  . TYR B 1 121 ? 51.248 25.612  11.342  1.00 74.92  ? 162 TYR B CA  1 
ATOM   2921 C C   . TYR B 1 121 ? 52.654 25.807  10.781  1.00 77.07  ? 162 TYR B C   1 
ATOM   2922 O O   . TYR B 1 121 ? 53.564 25.023  11.072  1.00 76.43  ? 162 TYR B O   1 
ATOM   2923 C CB  . TYR B 1 121 ? 50.985 24.123  11.522  1.00 70.25  ? 162 TYR B CB  1 
ATOM   2924 C CG  . TYR B 1 121 ? 49.697 23.854  12.244  1.00 68.69  ? 162 TYR B CG  1 
ATOM   2925 C CD1 . TYR B 1 121 ? 48.611 23.287  11.577  1.00 64.55  ? 162 TYR B CD1 1 
ATOM   2926 C CD2 . TYR B 1 121 ? 49.558 24.164  13.599  1.00 65.71  ? 162 TYR B CD2 1 
ATOM   2927 C CE1 . TYR B 1 121 ? 47.426 23.029  12.238  1.00 59.50  ? 162 TYR B CE1 1 
ATOM   2928 C CE2 . TYR B 1 121 ? 48.369 23.912  14.270  1.00 58.78  ? 162 TYR B CE2 1 
ATOM   2929 C CZ  . TYR B 1 121 ? 47.310 23.343  13.582  1.00 64.32  ? 162 TYR B CZ  1 
ATOM   2930 O OH  . TYR B 1 121 ? 46.125 23.079  14.230  1.00 77.84  ? 162 TYR B OH  1 
ATOM   2931 N N   . ASN B 1 122 ? 52.818 26.843  9.967   1.00 75.71  ? 163 ASN B N   1 
ATOM   2932 C CA  . ASN B 1 122 ? 54.109 27.164  9.390   1.00 73.12  ? 163 ASN B CA  1 
ATOM   2933 C C   . ASN B 1 122 ? 54.691 26.026  8.570   1.00 70.37  ? 163 ASN B C   1 
ATOM   2934 O O   . ASN B 1 122 ? 55.896 25.819  8.558   1.00 73.42  ? 163 ASN B O   1 
ATOM   2935 C CB  . ASN B 1 122 ? 55.081 27.549  10.501  1.00 72.71  ? 163 ASN B CB  1 
ATOM   2936 C CG  . ASN B 1 122 ? 56.165 28.495  10.030  1.00 76.74  ? 163 ASN B CG  1 
ATOM   2937 O OD1 . ASN B 1 122 ? 57.018 28.895  10.812  1.00 83.33  ? 163 ASN B OD1 1 
ATOM   2938 N ND2 . ASN B 1 122 ? 56.133 28.865  8.756   1.00 72.11  ? 163 ASN B ND2 1 
ATOM   2939 N N   . LEU B 1 123 ? 53.834 25.291  7.881   1.00 70.45  ? 164 LEU B N   1 
ATOM   2940 C CA  . LEU B 1 123 ? 54.285 24.187  7.039   1.00 69.59  ? 164 LEU B CA  1 
ATOM   2941 C C   . LEU B 1 123 ? 54.606 24.743  5.679   1.00 61.55  ? 164 LEU B C   1 
ATOM   2942 O O   . LEU B 1 123 ? 55.023 24.010  4.792   1.00 68.38  ? 164 LEU B O   1 
ATOM   2943 C CB  . LEU B 1 123 ? 53.175 23.153  6.850   1.00 70.45  ? 164 LEU B CB  1 
ATOM   2944 C CG  . LEU B 1 123 ? 52.716 22.420  8.097   1.00 78.82  ? 164 LEU B CG  1 
ATOM   2945 C CD1 . LEU B 1 123 ? 51.436 21.651  7.802   1.00 71.75  ? 164 LEU B CD1 1 
ATOM   2946 C CD2 . LEU B 1 123 ? 53.842 21.502  8.559   1.00 73.66  ? 164 LEU B CD2 1 
ATOM   2947 N N   . GLY B 1 124 ? 54.403 26.040  5.520   1.00 56.84  ? 165 GLY B N   1 
ATOM   2948 C CA  . GLY B 1 124 ? 54.599 26.659  4.224   1.00 58.72  ? 165 GLY B CA  1 
ATOM   2949 C C   . GLY B 1 124 ? 53.201 26.915  3.668   1.00 62.86  ? 165 GLY B C   1 
ATOM   2950 O O   . GLY B 1 124 ? 52.222 26.321  4.148   1.00 63.65  ? 165 GLY B O   1 
ATOM   2951 N N   . GLN B 1 125 ? 53.101 27.780  2.662   1.00 64.99  ? 166 GLN B N   1 
ATOM   2952 C CA  . GLN B 1 125 ? 51.823 28.134  2.042   1.00 66.43  ? 166 GLN B CA  1 
ATOM   2953 C C   . GLN B 1 125 ? 50.962 26.950  1.601   1.00 64.60  ? 166 GLN B C   1 
ATOM   2954 O O   . GLN B 1 125 ? 51.437 26.073  0.885   1.00 65.78  ? 166 GLN B O   1 
ATOM   2955 C CB  . GLN B 1 125 ? 52.051 29.042  0.823   1.00 65.46  ? 166 GLN B CB  1 
ATOM   2956 C CG  . GLN B 1 125 ? 50.751 29.505  0.153   1.00 71.40  ? 166 GLN B CG  1 
ATOM   2957 C CD  . GLN B 1 125 ? 50.971 30.439  -1.028  1.00 69.30  ? 166 GLN B CD  1 
ATOM   2958 O OE1 . GLN B 1 125 ? 50.972 31.670  -0.879  1.00 69.18  ? 166 GLN B OE1 1 
ATOM   2959 N NE2 . GLN B 1 125 ? 51.158 29.858  -2.215  1.00 63.44  ? 166 GLN B NE2 1 
ATOM   2960 N N   . THR B 1 126 ? 49.698 26.929  2.025   1.00 57.23  ? 167 THR B N   1 
ATOM   2961 C CA  . THR B 1 126 ? 48.798 25.856  1.606   1.00 58.14  ? 167 THR B CA  1 
ATOM   2962 C C   . THR B 1 126 ? 47.452 26.423  1.154   1.00 53.88  ? 167 THR B C   1 
ATOM   2963 O O   . THR B 1 126 ? 47.020 27.507  1.566   1.00 54.92  ? 167 THR B O   1 
ATOM   2964 C CB  . THR B 1 126 ? 48.619 24.757  2.706   1.00 65.71  ? 167 THR B CB  1 
ATOM   2965 O OG1 . THR B 1 126 ? 47.261 24.716  3.169   1.00 68.58  ? 167 THR B OG1 1 
ATOM   2966 C CG2 . THR B 1 126 ? 49.575 24.998  3.854   1.00 69.11  ? 167 THR B CG2 1 
ATOM   2967 N N   . ILE B 1 127 ? 46.813 25.686  0.266   1.00 52.11  ? 168 ILE B N   1 
ATOM   2968 C CA  . ILE B 1 127 ? 45.541 26.084  -0.326  1.00 46.18  ? 168 ILE B CA  1 
ATOM   2969 C C   . ILE B 1 127 ? 44.522 25.040  0.060   1.00 46.90  ? 168 ILE B C   1 
ATOM   2970 O O   . ILE B 1 127 ? 44.839 23.856  0.085   1.00 41.09  ? 168 ILE B O   1 
ATOM   2971 C CB  . ILE B 1 127 ? 45.714 26.138  -1.876  1.00 47.07  ? 168 ILE B CB  1 
ATOM   2972 C CG1 . ILE B 1 127 ? 46.867 27.097  -2.178  1.00 42.22  ? 168 ILE B CG1 1 
ATOM   2973 C CG2 . ILE B 1 127 ? 44.407 26.611  -2.584  1.00 41.15  ? 168 ILE B CG2 1 
ATOM   2974 C CD1 . ILE B 1 127 ? 47.188 27.199  -3.618  1.00 70.00  ? 168 ILE B CD1 1 
ATOM   2975 N N   . THR B 1 128 ? 43.308 25.459  0.388   1.00 42.15  ? 169 THR B N   1 
ATOM   2976 C CA  . THR B 1 128 ? 42.296 24.465  0.764   1.00 38.43  ? 169 THR B CA  1 
ATOM   2977 C C   . THR B 1 128 ? 41.032 24.926  0.103   1.00 46.51  ? 169 THR B C   1 
ATOM   2978 O O   . THR B 1 128 ? 40.855 26.124  -0.088  1.00 52.99  ? 169 THR B O   1 
ATOM   2979 C CB  . THR B 1 128 ? 42.084 24.355  2.357   1.00 45.57  ? 169 THR B CB  1 
ATOM   2980 O OG1 . THR B 1 128 ? 41.971 25.655  2.963   1.00 40.80  ? 169 THR B OG1 1 
ATOM   2981 C CG2 . THR B 1 128 ? 43.230 23.600  3.002   1.00 33.02  ? 169 THR B CG2 1 
ATOM   2982 N N   . GLN B 1 129 ? 40.141 24.011  -0.261  1.00 47.74  ? 170 GLN B N   1 
ATOM   2983 C CA  . GLN B 1 129 ? 38.960 24.492  -0.915  1.00 44.99  ? 170 GLN B CA  1 
ATOM   2984 C C   . GLN B 1 129 ? 37.680 24.078  -0.277  1.00 43.77  ? 170 GLN B C   1 
ATOM   2985 O O   . GLN B 1 129 ? 37.564 22.987  0.261   1.00 31.93  ? 170 GLN B O   1 
ATOM   2986 C CB  . GLN B 1 129 ? 38.955 24.124  -2.413  1.00 49.67  ? 170 GLN B CB  1 
ATOM   2987 C CG  . GLN B 1 129 ? 38.452 22.738  -2.811  1.00 54.95  ? 170 GLN B CG  1 
ATOM   2988 C CD  . GLN B 1 129 ? 36.909 22.575  -2.774  1.00 52.64  ? 170 GLN B CD  1 
ATOM   2989 O OE1 . GLN B 1 129 ? 36.158 23.544  -2.699  1.00 54.99  ? 170 GLN B OE1 1 
ATOM   2990 N NE2 . GLN B 1 129 ? 36.456 21.337  -2.826  1.00 47.77  ? 170 GLN B NE2 1 
ATOM   2991 N N   . GLY B 1 130 ? 36.729 24.998  -0.353  1.00 39.27  ? 171 GLY B N   1 
ATOM   2992 C CA  . GLY B 1 130 ? 35.398 24.787  0.151   1.00 42.06  ? 171 GLY B CA  1 
ATOM   2993 C C   . GLY B 1 130 ? 34.463 25.641  -0.687  1.00 46.32  ? 171 GLY B C   1 
ATOM   2994 O O   . GLY B 1 130 ? 34.660 25.803  -1.916  1.00 43.07  ? 171 GLY B O   1 
ATOM   2995 N N   . ILE B 1 131 ? 33.446 26.173  -0.013  1.00 40.33  ? 172 ILE B N   1 
ATOM   2996 C CA  . ILE B 1 131 ? 32.444 27.064  -0.597  1.00 45.16  ? 172 ILE B CA  1 
ATOM   2997 C C   . ILE B 1 131 ? 32.097 28.138  0.458   1.00 48.57  ? 172 ILE B C   1 
ATOM   2998 O O   . ILE B 1 131 ? 32.545 28.092  1.616   1.00 47.74  ? 172 ILE B O   1 
ATOM   2999 C CB  . ILE B 1 131 ? 31.063 26.337  -0.978  1.00 42.83  ? 172 ILE B CB  1 
ATOM   3000 C CG1 . ILE B 1 131 ? 30.480 25.577  0.218   1.00 33.52  ? 172 ILE B CG1 1 
ATOM   3001 C CG2 . ILE B 1 131 ? 31.217 25.404  -2.163  1.00 32.72  ? 172 ILE B CG2 1 
ATOM   3002 C CD1 . ILE B 1 131 ? 29.003 25.136  -0.041  1.00 26.80  ? 172 ILE B CD1 1 
ATOM   3003 N N   . ILE B 1 132 ? 31.312 29.115  0.041   1.00 51.16  ? 173 ILE B N   1 
ATOM   3004 C CA  . ILE B 1 132 ? 30.836 30.135  0.951   1.00 51.29  ? 173 ILE B CA  1 
ATOM   3005 C C   . ILE B 1 132 ? 29.587 29.458  1.546   1.00 44.76  ? 173 ILE B C   1 
ATOM   3006 O O   . ILE B 1 132 ? 28.602 29.208  0.868   1.00 43.28  ? 173 ILE B O   1 
ATOM   3007 C CB  . ILE B 1 132 ? 30.496 31.446  0.173   1.00 55.85  ? 173 ILE B CB  1 
ATOM   3008 C CG1 . ILE B 1 132 ? 31.728 31.860  -0.646  1.00 58.15  ? 173 ILE B CG1 1 
ATOM   3009 C CG2 . ILE B 1 132 ? 30.079 32.550  1.134   1.00 53.02  ? 173 ILE B CG2 1 
ATOM   3010 C CD1 . ILE B 1 132 ? 31.716 33.279  -1.198  1.00 53.90  ? 173 ILE B CD1 1 
ATOM   3011 N N   . SER B 1 133 ? 29.681 29.125  2.822   1.00 47.76  ? 174 SER B N   1 
ATOM   3012 C CA  . SER B 1 133 ? 28.619 28.451  3.555   1.00 42.32  ? 174 SER B CA  1 
ATOM   3013 C C   . SER B 1 133 ? 27.471 29.392  3.960   1.00 46.72  ? 174 SER B C   1 
ATOM   3014 O O   . SER B 1 133 ? 26.325 28.945  4.107   1.00 44.76  ? 174 SER B O   1 
ATOM   3015 C CB  . SER B 1 133 ? 29.207 27.842  4.821   1.00 41.51  ? 174 SER B CB  1 
ATOM   3016 O OG  . SER B 1 133 ? 30.101 26.774  4.555   1.00 45.21  ? 174 SER B OG  1 
ATOM   3017 N N   . ALA B 1 134 ? 27.798 30.679  4.125   1.00 48.65  ? 175 ALA B N   1 
ATOM   3018 C CA  . ALA B 1 134 ? 26.860 31.699  4.570   1.00 46.34  ? 175 ALA B CA  1 
ATOM   3019 C C   . ALA B 1 134 ? 27.514 33.096  4.453   1.00 50.14  ? 175 ALA B C   1 
ATOM   3020 O O   . ALA B 1 134 ? 28.734 33.203  4.352   1.00 45.13  ? 175 ALA B O   1 
ATOM   3021 C CB  . ALA B 1 134 ? 26.459 31.415  6.055   1.00 41.49  ? 175 ALA B CB  1 
ATOM   3022 N N   . THR B 1 135 ? 26.689 34.153  4.475   1.00 50.59  ? 176 THR B N   1 
ATOM   3023 C CA  . THR B 1 135 ? 27.139 35.537  4.373   1.00 46.59  ? 176 THR B CA  1 
ATOM   3024 C C   . THR B 1 135 ? 26.359 36.288  5.461   1.00 51.99  ? 176 THR B C   1 
ATOM   3025 O O   . THR B 1 135 ? 25.445 35.728  6.053   1.00 55.34  ? 176 THR B O   1 
ATOM   3026 C CB  . THR B 1 135 ? 26.792 36.162  2.981   1.00 51.28  ? 176 THR B CB  1 
ATOM   3027 O OG1 . THR B 1 135 ? 25.384 36.101  2.793   1.00 49.29  ? 176 THR B OG1 1 
ATOM   3028 C CG2 . THR B 1 135 ? 27.433 35.408  1.822   1.00 36.28  ? 176 THR B CG2 1 
ATOM   3029 N N   . GLY B 1 136 ? 26.721 37.547  5.709   1.00 55.95  ? 177 GLY B N   1 
ATOM   3030 C CA  . GLY B 1 136 ? 26.088 38.352  6.747   1.00 60.27  ? 177 GLY B CA  1 
ATOM   3031 C C   . GLY B 1 136 ? 26.085 37.625  8.084   1.00 66.64  ? 177 GLY B C   1 
ATOM   3032 O O   . GLY B 1 136 ? 25.017 37.387  8.634   1.00 73.03  ? 177 GLY B O   1 
ATOM   3033 N N   . ARG B 1 137 ? 27.255 37.319  8.645   1.00 67.70  ? 178 ARG B N   1 
ATOM   3034 C CA  . ARG B 1 137 ? 27.289 36.512  9.870   1.00 75.67  ? 178 ARG B CA  1 
ATOM   3035 C C   . ARG B 1 137 ? 27.946 36.975  11.181  1.00 81.60  ? 178 ARG B C   1 
ATOM   3036 O O   . ARG B 1 137 ? 28.816 37.849  11.223  1.00 74.08  ? 178 ARG B O   1 
ATOM   3037 C CB  . ARG B 1 137 ? 27.863 35.131  9.509   1.00 77.03  ? 178 ARG B CB  1 
ATOM   3038 C CG  . ARG B 1 137 ? 27.352 33.957  10.333  1.00 72.98  ? 178 ARG B CG  1 
ATOM   3039 C CD  . ARG B 1 137 ? 25.918 33.631  9.976   1.00 69.17  ? 178 ARG B CD  1 
ATOM   3040 N NE  . ARG B 1 137 ? 25.755 32.199  9.829   1.00 67.02  ? 178 ARG B NE  1 
ATOM   3041 C CZ  . ARG B 1 137 ? 24.742 31.627  9.198   1.00 62.62  ? 178 ARG B CZ  1 
ATOM   3042 N NH1 . ARG B 1 137 ? 23.792 32.368  8.661   1.00 63.88  ? 178 ARG B NH1 1 
ATOM   3043 N NH2 . ARG B 1 137 ? 24.706 30.311  9.077   1.00 67.78  ? 178 ARG B NH2 1 
ATOM   3044 N N   . ILE B 1 138 ? 27.515 36.299  12.244  1.00 95.07  ? 179 ILE B N   1 
ATOM   3045 C CA  . ILE B 1 138 ? 27.950 36.498  13.623  1.00 107.81 ? 179 ILE B CA  1 
ATOM   3046 C C   . ILE B 1 138 ? 27.196 37.656  14.253  1.00 116.00 ? 179 ILE B C   1 
ATOM   3047 O O   . ILE B 1 138 ? 27.753 38.701  14.579  1.00 118.72 ? 179 ILE B O   1 
ATOM   3048 C CB  . ILE B 1 138 ? 29.501 36.663  13.739  1.00 107.33 ? 179 ILE B CB  1 
ATOM   3049 C CG1 . ILE B 1 138 ? 30.175 35.295  13.498  1.00 106.69 ? 179 ILE B CG1 1 
ATOM   3050 C CG2 . ILE B 1 138 ? 29.888 37.186  15.116  1.00 107.68 ? 179 ILE B CG2 1 
ATOM   3051 C CD1 . ILE B 1 138 ? 31.583 35.157  14.062  1.00 100.80 ? 179 ILE B CD1 1 
ATOM   3052 N N   . GLY B 1 139 ? 25.891 37.440  14.398  1.00 125.07 ? 180 GLY B N   1 
ATOM   3053 C CA  . GLY B 1 139 ? 25.011 38.422  15.004  1.00 133.70 ? 180 GLY B CA  1 
ATOM   3054 C C   . GLY B 1 139 ? 24.291 37.782  16.183  1.00 139.12 ? 180 GLY B C   1 
ATOM   3055 O O   . GLY B 1 139 ? 23.397 38.387  16.787  1.00 139.29 ? 180 GLY B O   1 
ATOM   3056 N N   . LEU B 1 140 ? 24.686 36.546  16.503  1.00 141.84 ? 181 LEU B N   1 
ATOM   3057 C CA  . LEU B 1 140 ? 24.099 35.800  17.615  1.00 143.24 ? 181 LEU B CA  1 
ATOM   3058 C C   . LEU B 1 140 ? 24.992 35.850  18.859  1.00 145.68 ? 181 LEU B C   1 
ATOM   3059 O O   . LEU B 1 140 ? 24.910 34.987  19.735  1.00 145.84 ? 181 LEU B O   1 
ATOM   3060 C CB  . LEU B 1 140 ? 23.830 34.335  17.214  1.00 140.48 ? 181 LEU B CB  1 
ATOM   3061 C CG  . LEU B 1 140 ? 24.925 33.440  16.610  1.00 138.88 ? 181 LEU B CG  1 
ATOM   3062 C CD1 . LEU B 1 140 ? 24.647 31.981  16.957  1.00 135.93 ? 181 LEU B CD1 1 
ATOM   3063 C CD2 . LEU B 1 140 ? 24.984 33.631  15.100  1.00 136.92 ? 181 LEU B CD2 1 
ATOM   3064 N N   . ASN B 1 141 ? 25.840 36.873  18.920  1.00 147.69 ? 182 ASN B N   1 
ATOM   3065 C CA  . ASN B 1 141 ? 26.756 37.089  20.038  1.00 149.87 ? 182 ASN B CA  1 
ATOM   3066 C C   . ASN B 1 141 ? 27.361 38.482  19.834  1.00 152.12 ? 182 ASN B C   1 
ATOM   3067 O O   . ASN B 1 141 ? 28.579 38.654  19.883  1.00 152.94 ? 182 ASN B O   1 
ATOM   3068 C CB  . ASN B 1 141 ? 27.865 36.031  20.016  1.00 149.85 ? 182 ASN B CB  1 
ATOM   3069 C CG  . ASN B 1 141 ? 28.647 35.972  21.315  1.00 151.04 ? 182 ASN B CG  1 
ATOM   3070 O OD1 . ASN B 1 141 ? 29.085 36.996  21.838  1.00 152.15 ? 182 ASN B OD1 1 
ATOM   3071 N ND2 . ASN B 1 141 ? 28.834 34.764  21.836  1.00 149.72 ? 182 ASN B ND2 1 
ATOM   3072 N N   . PRO B 1 142 ? 26.506 39.500  19.609  1.00 153.57 ? 183 PRO B N   1 
ATOM   3073 C CA  . PRO B 1 142 ? 26.948 40.880  19.384  1.00 154.40 ? 183 PRO B CA  1 
ATOM   3074 C C   . PRO B 1 142 ? 27.525 41.694  20.539  1.00 154.51 ? 183 PRO B C   1 
ATOM   3075 O O   . PRO B 1 142 ? 26.821 42.041  21.486  1.00 155.34 ? 183 PRO B O   1 
ATOM   3076 C CB  . PRO B 1 142 ? 25.705 41.540  18.792  1.00 153.73 ? 183 PRO B CB  1 
ATOM   3077 C CG  . PRO B 1 142 ? 24.605 40.858  19.517  1.00 154.75 ? 183 PRO B CG  1 
ATOM   3078 C CD  . PRO B 1 142 ? 25.038 39.405  19.484  1.00 154.26 ? 183 PRO B CD  1 
ATOM   3079 N N   . THR B 1 143 ? 28.815 42.001  20.438  1.00 155.88 ? 184 THR B N   1 
ATOM   3080 C CA  . THR B 1 143 ? 29.521 42.834  21.417  1.00 157.60 ? 184 THR B CA  1 
ATOM   3081 C C   . THR B 1 143 ? 30.046 43.986  20.556  1.00 158.64 ? 184 THR B C   1 
ATOM   3082 O O   . THR B 1 143 ? 29.468 45.080  20.526  1.00 157.41 ? 184 THR B O   1 
ATOM   3083 C CB  . THR B 1 143 ? 30.718 42.092  22.063  1.00 156.78 ? 184 THR B CB  1 
ATOM   3084 O OG1 . THR B 1 143 ? 30.256 40.881  22.681  1.00 154.92 ? 184 THR B OG1 1 
ATOM   3085 C CG2 . THR B 1 143 ? 31.377 42.968  23.126  1.00 154.77 ? 184 THR B CG2 1 
ATOM   3086 N N   . GLY B 1 144 ? 31.151 43.721  19.861  1.00 158.56 ? 185 GLY B N   1 
ATOM   3087 C CA  . GLY B 1 144 ? 31.730 44.686  18.942  1.00 156.21 ? 185 GLY B CA  1 
ATOM   3088 C C   . GLY B 1 144 ? 31.353 44.071  17.608  1.00 154.19 ? 185 GLY B C   1 
ATOM   3089 O O   . GLY B 1 144 ? 32.201 43.555  16.875  1.00 154.85 ? 185 GLY B O   1 
ATOM   3090 N N   . ARG B 1 145 ? 30.057 44.116  17.309  1.00 150.24 ? 186 ARG B N   1 
ATOM   3091 C CA  . ARG B 1 145 ? 29.517 43.514  16.101  1.00 146.10 ? 186 ARG B CA  1 
ATOM   3092 C C   . ARG B 1 145 ? 30.257 43.716  14.792  1.00 142.45 ? 186 ARG B C   1 
ATOM   3093 O O   . ARG B 1 145 ? 30.960 44.711  14.587  1.00 143.05 ? 186 ARG B O   1 
ATOM   3094 C CB  . ARG B 1 145 ? 28.063 43.920  15.892  1.00 146.22 ? 186 ARG B CB  1 
ATOM   3095 C CG  . ARG B 1 145 ? 27.344 42.964  14.960  1.00 146.09 ? 186 ARG B CG  1 
ATOM   3096 C CD  . ARG B 1 145 ? 27.033 41.649  15.668  1.00 149.20 ? 186 ARG B CD  1 
ATOM   3097 N NE  . ARG B 1 145 ? 28.103 41.204  16.565  1.00 150.13 ? 186 ARG B NE  1 
ATOM   3098 C CZ  . ARG B 1 145 ? 29.285 40.732  16.173  1.00 150.74 ? 186 ARG B CZ  1 
ATOM   3099 N NH1 . ARG B 1 145 ? 29.576 40.633  14.883  1.00 151.32 ? 186 ARG B NH1 1 
ATOM   3100 N NH2 . ARG B 1 145 ? 30.184 40.371  17.079  1.00 151.34 ? 186 ARG B NH2 1 
ATOM   3101 N N   . GLN B 1 146 ? 30.079 42.742  13.905  1.00 134.34 ? 187 GLN B N   1 
ATOM   3102 C CA  . GLN B 1 146 ? 30.693 42.775  12.595  1.00 123.94 ? 187 GLN B CA  1 
ATOM   3103 C C   . GLN B 1 146 ? 30.061 41.753  11.677  1.00 111.92 ? 187 GLN B C   1 
ATOM   3104 O O   . GLN B 1 146 ? 29.374 40.840  12.116  1.00 105.85 ? 187 GLN B O   1 
ATOM   3105 C CB  . GLN B 1 146 ? 32.198 42.534  12.694  1.00 128.18 ? 187 GLN B CB  1 
ATOM   3106 C CG  . GLN B 1 146 ? 32.960 43.118  11.513  1.00 133.14 ? 187 GLN B CG  1 
ATOM   3107 C CD  . GLN B 1 146 ? 32.482 44.527  11.160  1.00 136.07 ? 187 GLN B CD  1 
ATOM   3108 O OE1 . GLN B 1 146 ? 31.556 44.702  10.364  1.00 139.01 ? 187 GLN B OE1 1 
ATOM   3109 N NE2 . GLN B 1 146 ? 33.108 45.534  11.760  1.00 134.33 ? 187 GLN B NE2 1 
ATOM   3110 N N   . ASN B 1 147 ? 30.308 41.930  10.389  1.00 103.92 ? 188 ASN B N   1 
ATOM   3111 C CA  . ASN B 1 147 ? 29.764 41.059  9.368   1.00 96.91  ? 188 ASN B CA  1 
ATOM   3112 C C   . ASN B 1 147 ? 30.836 40.081  8.899   1.00 89.23  ? 188 ASN B C   1 
ATOM   3113 O O   . ASN B 1 147 ? 32.001 40.463  8.711   1.00 86.09  ? 188 ASN B O   1 
ATOM   3114 C CB  . ASN B 1 147 ? 29.254 41.916  8.208   1.00 102.90 ? 188 ASN B CB  1 
ATOM   3115 C CG  . ASN B 1 147 ? 28.639 41.098  7.109   1.00 107.99 ? 188 ASN B CG  1 
ATOM   3116 O OD1 . ASN B 1 147 ? 28.042 40.058  7.369   1.00 112.15 ? 188 ASN B OD1 1 
ATOM   3117 N ND2 . ASN B 1 147 ? 28.763 41.570  5.870   1.00 109.26 ? 188 ASN B ND2 1 
ATOM   3118 N N   . PHE B 1 148 ? 30.432 38.824  8.729   1.00 74.53  ? 189 PHE B N   1 
ATOM   3119 C CA  . PHE B 1 148 ? 31.336 37.760  8.305   1.00 70.30  ? 189 PHE B CA  1 
ATOM   3120 C C   . PHE B 1 148 ? 30.824 36.904  7.175   1.00 67.36  ? 189 PHE B C   1 
ATOM   3121 O O   . PHE B 1 148 ? 29.636 36.831  6.883   1.00 68.34  ? 189 PHE B O   1 
ATOM   3122 C CB  . PHE B 1 148 ? 31.651 36.818  9.451   1.00 68.09  ? 189 PHE B CB  1 
ATOM   3123 C CG  . PHE B 1 148 ? 32.677 37.330  10.398  1.00 79.56  ? 189 PHE B CG  1 
ATOM   3124 C CD1 . PHE B 1 148 ? 34.028 37.247  10.085  1.00 83.10  ? 189 PHE B CD1 1 
ATOM   3125 C CD2 . PHE B 1 148 ? 32.300 37.858  11.626  1.00 83.55  ? 189 PHE B CD2 1 
ATOM   3126 C CE1 . PHE B 1 148 ? 34.990 37.667  10.980  1.00 78.19  ? 189 PHE B CE1 1 
ATOM   3127 C CE2 . PHE B 1 148 ? 33.253 38.286  12.531  1.00 82.83  ? 189 PHE B CE2 1 
ATOM   3128 C CZ  . PHE B 1 148 ? 34.604 38.188  12.205  1.00 87.51  ? 189 PHE B CZ  1 
ATOM   3129 N N   . LEU B 1 149 ? 31.762 36.222  6.561   1.00 61.78  ? 190 LEU B N   1 
ATOM   3130 C CA  . LEU B 1 149 ? 31.466 35.332  5.465   1.00 56.29  ? 190 LEU B CA  1 
ATOM   3131 C C   . LEU B 1 149 ? 31.808 33.954  6.065   1.00 50.77  ? 190 LEU B C   1 
ATOM   3132 O O   . LEU B 1 149 ? 32.827 33.803  6.761   1.00 47.86  ? 190 LEU B O   1 
ATOM   3133 C CB  . LEU B 1 149 ? 32.369 35.745  4.310   1.00 53.97  ? 190 LEU B CB  1 
ATOM   3134 C CG  . LEU B 1 149 ? 32.271 35.118  2.951   1.00 66.29  ? 190 LEU B CG  1 
ATOM   3135 C CD1 . LEU B 1 149 ? 32.928 36.040  1.906   1.00 58.48  ? 190 LEU B CD1 1 
ATOM   3136 C CD2 . LEU B 1 149 ? 32.946 33.740  3.035   1.00 70.54  ? 190 LEU B CD2 1 
ATOM   3137 N N   . GLN B 1 150 ? 30.943 32.965  5.880   1.00 44.61  ? 191 GLN B N   1 
ATOM   3138 C CA  . GLN B 1 150 ? 31.237 31.645  6.437   1.00 44.72  ? 191 GLN B CA  1 
ATOM   3139 C C   . GLN B 1 150 ? 31.713 30.644  5.364   1.00 42.87  ? 191 GLN B C   1 
ATOM   3140 O O   . GLN B 1 150 ? 31.235 30.651  4.218   1.00 43.17  ? 191 GLN B O   1 
ATOM   3141 C CB  . GLN B 1 150 ? 30.010 31.113  7.182   1.00 41.81  ? 191 GLN B CB  1 
ATOM   3142 C CG  . GLN B 1 150 ? 30.357 30.114  8.292   1.00 48.27  ? 191 GLN B CG  1 
ATOM   3143 C CD  . GLN B 1 150 ? 29.145 29.684  9.100   1.00 52.74  ? 191 GLN B CD  1 
ATOM   3144 O OE1 . GLN B 1 150 ? 28.449 30.511  9.711   1.00 52.29  ? 191 GLN B OE1 1 
ATOM   3145 N NE2 . GLN B 1 150 ? 28.883 28.390  9.107   1.00 47.94  ? 191 GLN B NE2 1 
ATOM   3146 N N   . THR B 1 151 ? 32.659 29.782  5.727   1.00 45.14  ? 192 THR B N   1 
ATOM   3147 C CA  . THR B 1 151 ? 33.198 28.822  4.763   1.00 44.16  ? 192 THR B CA  1 
ATOM   3148 C C   . THR B 1 151 ? 33.645 27.510  5.362   1.00 41.61  ? 192 THR B C   1 
ATOM   3149 O O   . THR B 1 151 ? 34.018 27.446  6.521   1.00 45.96  ? 192 THR B O   1 
ATOM   3150 C CB  . THR B 1 151 ? 34.402 29.438  3.965   1.00 45.33  ? 192 THR B CB  1 
ATOM   3151 O OG1 . THR B 1 151 ? 34.869 28.488  3.012   1.00 51.45  ? 192 THR B OG1 1 
ATOM   3152 C CG2 . THR B 1 151 ? 35.551 29.794  4.871   1.00 40.39  ? 192 THR B CG2 1 
ATOM   3153 N N   . ASP B 1 152 ? 33.590 26.453  4.561   1.00 45.37  ? 193 ASP B N   1 
ATOM   3154 C CA  . ASP B 1 152 ? 34.012 25.148  5.034   1.00 46.99  ? 193 ASP B CA  1 
ATOM   3155 C C   . ASP B 1 152 ? 35.383 24.779  4.453   1.00 49.55  ? 193 ASP B C   1 
ATOM   3156 O O   . ASP B 1 152 ? 35.777 23.622  4.434   1.00 52.42  ? 193 ASP B O   1 
ATOM   3157 C CB  . ASP B 1 152 ? 32.974 24.077  4.691   1.00 50.08  ? 193 ASP B CB  1 
ATOM   3158 C CG  . ASP B 1 152 ? 32.789 23.898  3.198   1.00 59.81  ? 193 ASP B CG  1 
ATOM   3159 O OD1 . ASP B 1 152 ? 33.352 24.724  2.448   1.00 62.28  ? 193 ASP B OD1 1 
ATOM   3160 O OD2 . ASP B 1 152 ? 32.075 22.944  2.790   1.00 54.60  ? 193 ASP B OD2 1 
ATOM   3161 N N   . ALA B 1 153 ? 36.082 25.784  3.946   1.00 50.47  ? 194 ALA B N   1 
ATOM   3162 C CA  . ALA B 1 153 ? 37.428 25.617  3.449   1.00 42.70  ? 194 ALA B CA  1 
ATOM   3163 C C   . ALA B 1 153 ? 38.255 25.493  4.743   1.00 46.21  ? 194 ALA B C   1 
ATOM   3164 O O   . ALA B 1 153 ? 38.201 26.357  5.601   1.00 40.88  ? 194 ALA B O   1 
ATOM   3165 C CB  . ALA B 1 153 ? 37.853 26.856  2.700   1.00 39.03  ? 194 ALA B CB  1 
ATOM   3166 N N   . SER B 1 154 ? 39.013 24.422  4.878   1.00 45.60  ? 195 SER B N   1 
ATOM   3167 C CA  . SER B 1 154 ? 39.813 24.220  6.066   1.00 50.69  ? 195 SER B CA  1 
ATOM   3168 C C   . SER B 1 154 ? 40.656 25.413  6.515   1.00 52.78  ? 195 SER B C   1 
ATOM   3169 O O   . SER B 1 154 ? 41.607 25.813  5.844   1.00 49.74  ? 195 SER B O   1 
ATOM   3170 C CB  . SER B 1 154 ? 40.729 23.020  5.859   1.00 57.57  ? 195 SER B CB  1 
ATOM   3171 O OG  . SER B 1 154 ? 39.974 21.836  5.660   1.00 52.51  ? 195 SER B OG  1 
ATOM   3172 N N   . ILE B 1 155 ? 40.313 25.956  7.675   1.00 53.47  ? 196 ILE B N   1 
ATOM   3173 C CA  . ILE B 1 155 ? 41.042 27.075  8.262   1.00 61.11  ? 196 ILE B CA  1 
ATOM   3174 C C   . ILE B 1 155 ? 41.787 26.540  9.490   1.00 60.37  ? 196 ILE B C   1 
ATOM   3175 O O   . ILE B 1 155 ? 41.189 25.953  10.389  1.00 62.42  ? 196 ILE B O   1 
ATOM   3176 C CB  . ILE B 1 155 ? 40.064 28.198  8.674   1.00 61.37  ? 196 ILE B CB  1 
ATOM   3177 C CG1 . ILE B 1 155 ? 39.398 28.760  7.427   1.00 65.07  ? 196 ILE B CG1 1 
ATOM   3178 C CG2 . ILE B 1 155 ? 40.791 29.296  9.429   1.00 72.03  ? 196 ILE B CG2 1 
ATOM   3179 C CD1 . ILE B 1 155 ? 40.319 28.773  6.207   1.00 62.75  ? 196 ILE B CD1 1 
ATOM   3180 N N   . ASN B 1 156 ? 43.094 26.726  9.528   1.00 62.56  ? 197 ASN B N   1 
ATOM   3181 C CA  . ASN B 1 156 ? 43.883 26.206  10.652  1.00 65.33  ? 197 ASN B CA  1 
ATOM   3182 C C   . ASN B 1 156 ? 44.709 27.303  11.233  1.00 64.62  ? 197 ASN B C   1 
ATOM   3183 O O   . ASN B 1 156 ? 44.824 28.365  10.625  1.00 66.50  ? 197 ASN B O   1 
ATOM   3184 C CB  . ASN B 1 156 ? 44.820 25.083  10.201  1.00 51.55  ? 197 ASN B CB  1 
ATOM   3185 C CG  . ASN B 1 156 ? 44.111 23.764  10.036  1.00 58.35  ? 197 ASN B CG  1 
ATOM   3186 O OD1 . ASN B 1 156 ? 43.784 23.102  11.017  1.00 56.13  ? 197 ASN B OD1 1 
ATOM   3187 N ND2 . ASN B 1 156 ? 43.863 23.368  8.789   1.00 62.27  ? 197 ASN B ND2 1 
ATOM   3188 N N   . HIS B 1 157 ? 45.287 27.059  12.407  1.00 68.39  ? 198 HIS B N   1 
ATOM   3189 C CA  . HIS B 1 157 ? 46.129 28.079  13.011  1.00 72.28  ? 198 HIS B CA  1 
ATOM   3190 C C   . HIS B 1 157 ? 47.213 28.411  11.988  1.00 68.46  ? 198 HIS B C   1 
ATOM   3191 O O   . HIS B 1 157 ? 47.872 27.514  11.450  1.00 63.13  ? 198 HIS B O   1 
ATOM   3192 C CB  . HIS B 1 157 ? 46.783 27.596  14.299  1.00 78.80  ? 198 HIS B CB  1 
ATOM   3193 C CG  . HIS B 1 157 ? 47.655 28.630  14.939  1.00 88.49  ? 198 HIS B CG  1 
ATOM   3194 N ND1 . HIS B 1 157 ? 47.149 29.791  15.488  1.00 93.62  ? 198 HIS B ND1 1 
ATOM   3195 C CD2 . HIS B 1 157 ? 49.001 28.708  15.066  1.00 89.81  ? 198 HIS B CD2 1 
ATOM   3196 C CE1 . HIS B 1 157 ? 48.147 30.539  15.926  1.00 92.53  ? 198 HIS B CE1 1 
ATOM   3197 N NE2 . HIS B 1 157 ? 49.280 29.907  15.682  1.00 95.45  ? 198 HIS B NE2 1 
ATOM   3198 N N   . GLY B 1 158 ? 47.365 29.706  11.719  1.00 66.02  ? 199 GLY B N   1 
ATOM   3199 C CA  . GLY B 1 158 ? 48.341 30.160  10.756  1.00 64.65  ? 199 GLY B CA  1 
ATOM   3200 C C   . GLY B 1 158 ? 47.679 30.717  9.519   1.00 61.69  ? 199 GLY B C   1 
ATOM   3201 O O   . GLY B 1 158 ? 48.314 31.397  8.735   1.00 61.78  ? 199 GLY B O   1 
ATOM   3202 N N   . ASN B 1 159 ? 46.399 30.420  9.339   1.00 63.27  ? 200 ASN B N   1 
ATOM   3203 C CA  . ASN B 1 159 ? 45.660 30.920  8.183   1.00 60.00  ? 200 ASN B CA  1 
ATOM   3204 C C   . ASN B 1 159 ? 45.117 32.350  8.348   1.00 55.18  ? 200 ASN B C   1 
ATOM   3205 O O   . ASN B 1 159 ? 44.759 32.988  7.356   1.00 58.34  ? 200 ASN B O   1 
ATOM   3206 C CB  . ASN B 1 159 ? 44.512 29.959  7.835   1.00 60.59  ? 200 ASN B CB  1 
ATOM   3207 C CG  . ASN B 1 159 ? 44.969 28.783  6.976   1.00 54.88  ? 200 ASN B CG  1 
ATOM   3208 O OD1 . ASN B 1 159 ? 45.280 28.943  5.802   1.00 62.61  ? 200 ASN B OD1 1 
ATOM   3209 N ND2 . ASN B 1 159 ? 44.999 27.604  7.560   1.00 55.60  ? 200 ASN B ND2 1 
ATOM   3210 N N   . SER B 1 160 ? 45.055 32.859  9.577   1.00 48.92  ? 201 SER B N   1 
ATOM   3211 C CA  . SER B 1 160 ? 44.568 34.227  9.805   1.00 52.68  ? 201 SER B CA  1 
ATOM   3212 C C   . SER B 1 160 ? 45.353 35.307  9.019   1.00 56.51  ? 201 SER B C   1 
ATOM   3213 O O   . SER B 1 160 ? 46.582 35.267  8.935   1.00 53.66  ? 201 SER B O   1 
ATOM   3214 C CB  . SER B 1 160 ? 44.643 34.586  11.289  1.00 53.64  ? 201 SER B CB  1 
ATOM   3215 O OG  . SER B 1 160 ? 43.744 33.821  12.049  1.00 61.41  ? 201 SER B OG  1 
ATOM   3216 N N   . GLY B 1 161 ? 44.635 36.287  8.481   1.00 52.78  ? 202 GLY B N   1 
ATOM   3217 C CA  . GLY B 1 161 ? 45.284 37.343  7.741   1.00 51.19  ? 202 GLY B CA  1 
ATOM   3218 C C   . GLY B 1 161 ? 45.384 36.963  6.282   1.00 56.11  ? 202 GLY B C   1 
ATOM   3219 O O   . GLY B 1 161 ? 45.639 37.806  5.425   1.00 53.59  ? 202 GLY B O   1 
ATOM   3220 N N   . GLY B 1 162 ? 45.156 35.686  5.999   1.00 56.72  ? 203 GLY B N   1 
ATOM   3221 C CA  . GLY B 1 162 ? 45.223 35.211  4.629   1.00 58.29  ? 203 GLY B CA  1 
ATOM   3222 C C   . GLY B 1 162 ? 43.991 35.476  3.778   1.00 54.83  ? 203 GLY B C   1 
ATOM   3223 O O   . GLY B 1 162 ? 43.006 36.045  4.260   1.00 51.01  ? 203 GLY B O   1 
ATOM   3224 N N   . ALA B 1 163 ? 44.057 35.003  2.527   1.00 50.62  ? 204 ALA B N   1 
ATOM   3225 C CA  . ALA B 1 163 ? 43.026 35.174  1.514   1.00 47.72  ? 204 ALA B CA  1 
ATOM   3226 C C   . ALA B 1 163 ? 42.022 34.053  1.250   1.00 52.42  ? 204 ALA B C   1 
ATOM   3227 O O   . ALA B 1 163 ? 42.342 32.867  1.344   1.00 54.74  ? 204 ALA B O   1 
ATOM   3228 C CB  . ALA B 1 163 ? 43.693 35.539  0.174   1.00 49.98  ? 204 ALA B CB  1 
ATOM   3229 N N   . LEU B 1 164 ? 40.799 34.469  0.906   0.00 52.08  ? 205 LEU B N   1 
ATOM   3230 C CA  . LEU B 1 164 ? 39.720 33.574  0.531   0.00 47.72  ? 205 LEU B CA  1 
ATOM   3231 C C   . LEU B 1 164 ? 39.420 34.065  -0.893  0.00 41.66  ? 205 LEU B C   1 
ATOM   3232 O O   . LEU B 1 164 ? 38.979 35.197  -1.089  0.00 41.18  ? 205 LEU B O   1 
ATOM   3233 C CB  . LEU B 1 164 ? 38.507 33.787  1.440   0.00 52.21  ? 205 LEU B CB  1 
ATOM   3234 C CG  . LEU B 1 164 ? 37.576 32.623  1.875   0.00 55.91  ? 205 LEU B CG  1 
ATOM   3235 C CD1 . LEU B 1 164 ? 36.137 33.007  1.653   0.00 34.55  ? 205 LEU B CD1 1 
ATOM   3236 C CD2 . LEU B 1 164 ? 37.901 31.350  1.153   0.00 43.92  ? 205 LEU B CD2 1 
ATOM   3237 N N   . VAL B 1 165 ? 39.677 33.238  -1.895  1.00 47.77  ? 206 VAL B N   1 
ATOM   3238 C CA  . VAL B 1 165 ? 39.442 33.647  -3.291  1.00 47.80  ? 206 VAL B CA  1 
ATOM   3239 C C   . VAL B 1 165 ? 38.485 32.699  -4.024  1.00 46.94  ? 206 VAL B C   1 
ATOM   3240 O O   . VAL B 1 165 ? 38.331 31.559  -3.638  1.00 59.51  ? 206 VAL B O   1 
ATOM   3241 C CB  . VAL B 1 165 ? 40.791 33.711  -4.088  1.00 46.95  ? 206 VAL B CB  1 
ATOM   3242 C CG1 . VAL B 1 165 ? 41.751 34.704  -3.434  1.00 35.30  ? 206 VAL B CG1 1 
ATOM   3243 C CG2 . VAL B 1 165 ? 41.453 32.311  -4.150  1.00 42.94  ? 206 VAL B CG2 1 
ATOM   3244 N N   . ASN B 1 166 ? 37.827 33.169  -5.074  1.00 53.68  ? 207 ASN B N   1 
ATOM   3245 C CA  . ASN B 1 166 ? 36.934 32.289  -5.831  1.00 48.91  ? 207 ASN B CA  1 
ATOM   3246 C C   . ASN B 1 166 ? 37.725 31.606  -6.934  1.00 44.28  ? 207 ASN B C   1 
ATOM   3247 O O   . ASN B 1 166 ? 38.921 31.843  -7.079  1.00 41.85  ? 207 ASN B O   1 
ATOM   3248 C CB  . ASN B 1 166 ? 35.756 33.062  -6.437  1.00 41.21  ? 207 ASN B CB  1 
ATOM   3249 C CG  . ASN B 1 166 ? 36.191 34.166  -7.360  1.00 51.99  ? 207 ASN B CG  1 
ATOM   3250 O OD1 . ASN B 1 166 ? 37.337 34.194  -7.839  1.00 53.49  ? 207 ASN B OD1 1 
ATOM   3251 N ND2 . ASN B 1 166 ? 35.269 35.091  -7.634  1.00 46.86  ? 207 ASN B ND2 1 
ATOM   3252 N N   . SER B 1 167 ? 37.054 30.762  -7.711  1.00 46.06  ? 208 SER B N   1 
ATOM   3253 C CA  . SER B 1 167 ? 37.709 30.030  -8.791  1.00 49.40  ? 208 SER B CA  1 
ATOM   3254 C C   . SER B 1 167 ? 38.492 30.899  -9.778  1.00 49.86  ? 208 SER B C   1 
ATOM   3255 O O   . SER B 1 167 ? 39.404 30.402  -10.404 1.00 51.70  ? 208 SER B O   1 
ATOM   3256 C CB  . SER B 1 167 ? 36.694 29.210  -9.574  1.00 46.19  ? 208 SER B CB  1 
ATOM   3257 O OG  . SER B 1 167 ? 35.806 30.059  -10.272 1.00 54.68  ? 208 SER B OG  1 
ATOM   3258 N N   . LEU B 1 168 ? 38.110 32.169  -9.916  1.00 47.69  ? 209 LEU B N   1 
ATOM   3259 C CA  . LEU B 1 168 ? 38.749 33.133  -10.807 1.00 50.63  ? 209 LEU B CA  1 
ATOM   3260 C C   . LEU B 1 168 ? 39.964 33.772  -10.146 1.00 55.57  ? 209 LEU B C   1 
ATOM   3261 O O   . LEU B 1 168 ? 40.752 34.434  -10.804 1.00 56.53  ? 209 LEU B O   1 
ATOM   3262 C CB  . LEU B 1 168 ? 37.779 34.258  -11.168 1.00 49.75  ? 209 LEU B CB  1 
ATOM   3263 C CG  . LEU B 1 168 ? 36.460 33.932  -11.869 1.00 58.46  ? 209 LEU B CG  1 
ATOM   3264 C CD1 . LEU B 1 168 ? 35.750 35.238  -12.184 1.00 58.61  ? 209 LEU B CD1 1 
ATOM   3265 C CD2 . LEU B 1 168 ? 36.706 33.146  -13.161 1.00 59.09  ? 209 LEU B CD2 1 
ATOM   3266 N N   . GLY B 1 169 ? 40.079 33.617  -8.828  1.00 54.71  ? 210 GLY B N   1 
ATOM   3267 C CA  . GLY B 1 169 ? 41.210 34.177  -8.129  1.00 46.30  ? 210 GLY B CA  1 
ATOM   3268 C C   . GLY B 1 169 ? 40.952 35.483  -7.424  1.00 52.14  ? 210 GLY B C   1 
ATOM   3269 O O   . GLY B 1 169 ? 41.861 36.027  -6.770  1.00 49.53  ? 210 GLY B O   1 
ATOM   3270 N N   . GLU B 1 170 ? 39.728 35.991  -7.555  1.00 48.10  ? 211 GLU B N   1 
ATOM   3271 C CA  . GLU B 1 170 ? 39.350 37.247  -6.929  1.00 49.83  ? 211 GLU B CA  1 
ATOM   3272 C C   . GLU B 1 170 ? 39.265 37.127  -5.384  1.00 51.77  ? 211 GLU B C   1 
ATOM   3273 O O   . GLU B 1 170 ? 38.946 36.068  -4.840  1.00 52.53  ? 211 GLU B O   1 
ATOM   3274 C CB  . GLU B 1 170 ? 38.009 37.688  -7.507  1.00 55.54  ? 211 GLU B CB  1 
ATOM   3275 C CG  . GLU B 1 170 ? 38.012 37.805  -9.020  1.00 59.83  ? 211 GLU B CG  1 
ATOM   3276 C CD  . GLU B 1 170 ? 36.617 38.000  -9.606  1.00 66.34  ? 211 GLU B CD  1 
ATOM   3277 O OE1 . GLU B 1 170 ? 36.537 38.446  -10.778 1.00 59.85  ? 211 GLU B OE1 1 
ATOM   3278 O OE2 . GLU B 1 170 ? 35.615 37.703  -8.898  1.00 56.45  ? 211 GLU B OE2 1 
ATOM   3279 N N   . LEU B 1 171 ? 39.559 38.213  -4.679  1.00 51.65  ? 212 LEU B N   1 
ATOM   3280 C CA  . LEU B 1 171 ? 39.527 38.189  -3.221  1.00 51.49  ? 212 LEU B CA  1 
ATOM   3281 C C   . LEU B 1 171 ? 38.083 38.253  -2.732  1.00 56.33  ? 212 LEU B C   1 
ATOM   3282 O O   . LEU B 1 171 ? 37.330 39.166  -3.077  1.00 57.33  ? 212 LEU B O   1 
ATOM   3283 C CB  . LEU B 1 171 ? 40.323 39.360  -2.654  1.00 42.90  ? 212 LEU B CB  1 
ATOM   3284 C CG  . LEU B 1 171 ? 40.463 39.436  -1.123  1.00 50.26  ? 212 LEU B CG  1 
ATOM   3285 C CD1 . LEU B 1 171 ? 41.304 38.234  -0.568  1.00 38.10  ? 212 LEU B CD1 1 
ATOM   3286 C CD2 . LEU B 1 171 ? 41.117 40.790  -0.756  1.00 38.32  ? 212 LEU B CD2 1 
ATOM   3287 N N   . MET B 1 172 ? 37.713 37.274  -1.921  1.00 54.13  ? 213 MET B N   1 
ATOM   3288 C CA  . MET B 1 172 ? 36.377 37.183  -1.387  1.00 52.99  ? 213 MET B CA  1 
ATOM   3289 C C   . MET B 1 172 ? 36.393 37.588  0.081   1.00 52.62  ? 213 MET B C   1 
ATOM   3290 O O   . MET B 1 172 ? 35.422 38.132  0.605   1.00 57.21  ? 213 MET B O   1 
ATOM   3291 C CB  . MET B 1 172 ? 35.861 35.744  -1.551  1.00 59.08  ? 213 MET B CB  1 
ATOM   3292 C CG  . MET B 1 172 ? 35.445 35.372  -2.995  1.00 61.46  ? 213 MET B CG  1 
ATOM   3293 S SD  . MET B 1 172 ? 33.954 36.236  -3.605  1.00 63.80  ? 213 MET B SD  1 
ATOM   3294 C CE  . MET B 1 172 ? 34.688 37.620  -4.485  1.00 55.18  ? 213 MET B CE  1 
ATOM   3295 N N   . GLY B 1 173 ? 37.505 37.327  0.743   1.00 44.15  ? 214 GLY B N   1 
ATOM   3296 C CA  . GLY B 1 173 ? 37.597 37.684  2.134   1.00 43.15  ? 214 GLY B CA  1 
ATOM   3297 C C   . GLY B 1 173 ? 38.983 37.466  2.693   1.00 49.95  ? 214 GLY B C   1 
ATOM   3298 O O   . GLY B 1 173 ? 39.882 36.989  2.000   1.00 56.01  ? 214 GLY B O   1 
ATOM   3299 N N   . ILE B 1 174 ? 39.137 37.840  3.957   1.00 51.84  ? 215 ILE B N   1 
ATOM   3300 C CA  . ILE B 1 174 ? 40.372 37.694  4.716   1.00 48.05  ? 215 ILE B CA  1 
ATOM   3301 C C   . ILE B 1 174 ? 39.993 36.708  5.828   1.00 51.36  ? 215 ILE B C   1 
ATOM   3302 O O   . ILE B 1 174 ? 39.129 36.986  6.688   1.00 49.46  ? 215 ILE B O   1 
ATOM   3303 C CB  . ILE B 1 174 ? 40.850 39.063  5.391   1.00 51.16  ? 215 ILE B CB  1 
ATOM   3304 C CG1 . ILE B 1 174 ? 41.054 40.179  4.348   1.00 40.57  ? 215 ILE B CG1 1 
ATOM   3305 C CG2 . ILE B 1 174 ? 42.129 38.824  6.210   1.00 53.26  ? 215 ILE B CG2 1 
ATOM   3306 C CD1 . ILE B 1 174 ? 41.939 39.829  3.185   1.00 46.45  ? 215 ILE B CD1 1 
ATOM   3307 N N   . ASN B 1 175 ? 40.630 35.549  5.793   1.00 54.92  ? 216 ASN B N   1 
ATOM   3308 C CA  . ASN B 1 175 ? 40.393 34.505  6.782   1.00 56.51  ? 216 ASN B CA  1 
ATOM   3309 C C   . ASN B 1 175 ? 40.799 35.013  8.122   1.00 57.00  ? 216 ASN B C   1 
ATOM   3310 O O   . ASN B 1 175 ? 41.916 35.495  8.296   1.00 68.19  ? 216 ASN B O   1 
ATOM   3311 C CB  . ASN B 1 175 ? 41.195 33.260  6.408   1.00 52.78  ? 216 ASN B CB  1 
ATOM   3312 C CG  . ASN B 1 175 ? 40.805 32.739  5.042   1.00 52.54  ? 216 ASN B CG  1 
ATOM   3313 O OD1 . ASN B 1 175 ? 41.632 32.226  4.294   1.00 54.19  ? 216 ASN B OD1 1 
ATOM   3314 N ND2 . ASN B 1 175 ? 39.519 32.884  4.708   1.00 53.62  ? 216 ASN B ND2 1 
ATOM   3315 N N   . THR B 1 176 ? 39.879 34.929  9.068   1.00 68.55  ? 217 THR B N   1 
ATOM   3316 C CA  . THR B 1 176 ? 40.113 35.393  10.426  1.00 72.77  ? 217 THR B CA  1 
ATOM   3317 C C   . THR B 1 176 ? 40.117 34.155  11.299  1.00 75.83  ? 217 THR B C   1 
ATOM   3318 O O   . THR B 1 176 ? 40.687 33.140  10.901  1.00 79.43  ? 217 THR B O   1 
ATOM   3319 C CB  . THR B 1 176 ? 39.015 36.402  10.844  1.00 75.54  ? 217 THR B CB  1 
ATOM   3320 O OG1 . THR B 1 176 ? 39.226 36.823  12.195  1.00 80.96  ? 217 THR B OG1 1 
ATOM   3321 C CG2 . THR B 1 176 ? 37.639 35.781  10.711  1.00 78.79  ? 217 THR B CG2 1 
ATOM   3322 N N   . LEU B 1 177 ? 39.484 34.201  12.464  1.00 83.97  ? 218 LEU B N   1 
ATOM   3323 C CA  . LEU B 1 177 ? 39.473 33.024  13.336  1.00 94.37  ? 218 LEU B CA  1 
ATOM   3324 C C   . LEU B 1 177 ? 38.585 31.860  12.840  1.00 99.17  ? 218 LEU B C   1 
ATOM   3325 O O   . LEU B 1 177 ? 37.782 32.014  11.915  1.00 100.05 ? 218 LEU B O   1 
ATOM   3326 C CB  . LEU B 1 177 ? 39.042 33.410  14.751  1.00 97.70  ? 218 LEU B CB  1 
ATOM   3327 C CG  . LEU B 1 177 ? 39.380 32.303  15.758  1.00 103.76 ? 218 LEU B CG  1 
ATOM   3328 C CD1 . LEU B 1 177 ? 40.897 32.284  15.945  1.00 102.84 ? 218 LEU B CD1 1 
ATOM   3329 C CD2 . LEU B 1 177 ? 38.657 32.520  17.089  1.00 103.06 ? 218 LEU B CD2 1 
ATOM   3330 N N   . SER B 1 178 ? 38.750 30.689  13.459  1.00 103.13 ? 219 SER B N   1 
ATOM   3331 C CA  . SER B 1 178 ? 37.975 29.500  13.102  1.00 103.59 ? 219 SER B CA  1 
ATOM   3332 C C   . SER B 1 178 ? 37.170 29.103  14.329  1.00 104.54 ? 219 SER B C   1 
ATOM   3333 O O   . SER B 1 178 ? 37.669 29.188  15.446  1.00 104.26 ? 219 SER B O   1 
ATOM   3334 C CB  . SER B 1 178 ? 38.912 28.344  12.692  1.00 105.58 ? 219 SER B CB  1 
ATOM   3335 O OG  . SER B 1 178 ? 38.221 27.237  12.107  1.00 100.86 ? 219 SER B OG  1 
ATOM   3336 N N   . PHE B 1 179 ? 35.918 28.704  14.113  1.00 110.63 ? 220 PHE B N   1 
ATOM   3337 C CA  . PHE B 1 179 ? 35.031 28.271  15.192  1.00 115.00 ? 220 PHE B CA  1 
ATOM   3338 C C   . PHE B 1 179 ? 35.642 26.967  15.683  1.00 119.69 ? 220 PHE B C   1 
ATOM   3339 O O   . PHE B 1 179 ? 35.513 25.933  15.028  1.00 119.57 ? 220 PHE B O   1 
ATOM   3340 C CB  . PHE B 1 179 ? 33.629 28.001  14.637  1.00 114.31 ? 220 PHE B CB  1 
ATOM   3341 C CG  . PHE B 1 179 ? 32.547 27.918  15.686  1.00 113.97 ? 220 PHE B CG  1 
ATOM   3342 C CD1 . PHE B 1 179 ? 31.925 29.072  16.155  1.00 115.00 ? 220 PHE B CD1 1 
ATOM   3343 C CD2 . PHE B 1 179 ? 32.124 26.686  16.177  1.00 114.25 ? 220 PHE B CD2 1 
ATOM   3344 C CE1 . PHE B 1 179 ? 30.892 29.000  17.094  1.00 115.86 ? 220 PHE B CE1 1 
ATOM   3345 C CE2 . PHE B 1 179 ? 31.095 26.600  17.116  1.00 113.20 ? 220 PHE B CE2 1 
ATOM   3346 C CZ  . PHE B 1 179 ? 30.477 27.760  17.574  1.00 117.27 ? 220 PHE B CZ  1 
ATOM   3347 N N   . ASP B 1 180 ? 36.333 27.015  16.815  1.00 126.27 ? 221 ASP B N   1 
ATOM   3348 C CA  . ASP B 1 180 ? 36.959 25.814  17.353  1.00 133.96 ? 221 ASP B CA  1 
ATOM   3349 C C   . ASP B 1 180 ? 36.496 25.518  18.771  1.00 136.99 ? 221 ASP B C   1 
ATOM   3350 O O   . ASP B 1 180 ? 36.114 26.429  19.515  1.00 137.70 ? 221 ASP B O   1 
ATOM   3351 C CB  . ASP B 1 180 ? 38.489 25.936  17.316  1.00 136.54 ? 221 ASP B CB  1 
ATOM   3352 C CG  . ASP B 1 180 ? 39.042 25.962  15.897  1.00 140.43 ? 221 ASP B CG  1 
ATOM   3353 O OD1 . ASP B 1 180 ? 38.683 25.068  15.092  1.00 139.04 ? 221 ASP B OD1 1 
ATOM   3354 O OD2 . ASP B 1 180 ? 39.845 26.874  15.593  1.00 141.79 ? 221 ASP B OD2 1 
ATOM   3355 N N   . LYS B 1 181 ? 36.539 24.236  19.132  1.00 139.71 ? 222 LYS B N   1 
ATOM   3356 C CA  . LYS B 1 181 ? 36.115 23.767  20.447  1.00 142.61 ? 222 LYS B CA  1 
ATOM   3357 C C   . LYS B 1 181 ? 34.973 24.618  20.985  1.00 144.13 ? 222 LYS B C   1 
ATOM   3358 O O   . LYS B 1 181 ? 35.191 25.509  21.811  1.00 145.13 ? 222 LYS B O   1 
ATOM   3359 C CB  . LYS B 1 181 ? 37.285 23.789  21.439  1.00 142.77 ? 222 LYS B CB  1 
ATOM   3360 C CG  . LYS B 1 181 ? 37.464 22.480  22.201  1.00 142.53 ? 222 LYS B CG  1 
ATOM   3361 C CD  . LYS B 1 181 ? 36.134 21.956  22.723  1.00 144.09 ? 222 LYS B CD  1 
ATOM   3362 C CE  . LYS B 1 181 ? 36.273 20.559  23.295  1.00 144.67 ? 222 LYS B CE  1 
ATOM   3363 N NZ  . LYS B 1 181 ? 34.941 19.967  23.582  1.00 145.49 ? 222 LYS B NZ  1 
ATOM   3364 N N   . SER B 1 182 ? 33.763 24.344  20.501  1.00 144.84 ? 223 SER B N   1 
ATOM   3365 C CA  . SER B 1 182 ? 32.570 25.074  20.920  1.00 145.14 ? 223 SER B CA  1 
ATOM   3366 C C   . SER B 1 182 ? 32.665 25.447  22.398  1.00 147.49 ? 223 SER B C   1 
ATOM   3367 O O   . SER B 1 182 ? 33.000 26.586  22.742  1.00 147.83 ? 223 SER B O   1 
ATOM   3368 C CB  . SER B 1 182 ? 31.326 24.217  20.670  1.00 142.59 ? 223 SER B CB  1 
ATOM   3369 O OG  . SER B 1 182 ? 31.448 22.953  21.316  1.00 140.24 ? 223 SER B OG  1 
ATOM   3370 N N   . ASN B 1 183 ? 32.373 24.481  23.265  1.00 148.83 ? 224 ASN B N   1 
ATOM   3371 C CA  . ASN B 1 183 ? 32.439 24.672  24.715  1.00 148.83 ? 224 ASN B CA  1 
ATOM   3372 C C   . ASN B 1 183 ? 33.259 23.517  25.290  1.00 147.39 ? 224 ASN B C   1 
ATOM   3373 O O   . ASN B 1 183 ? 34.475 23.615  25.469  1.00 146.40 ? 224 ASN B O   1 
ATOM   3374 C CB  . ASN B 1 183 ? 31.031 24.650  25.342  1.00 149.43 ? 224 ASN B CB  1 
ATOM   3375 C CG  . ASN B 1 183 ? 30.104 25.713  24.767  1.00 149.95 ? 224 ASN B CG  1 
ATOM   3376 O OD1 . ASN B 1 183 ? 30.443 26.898  24.728  1.00 149.29 ? 224 ASN B OD1 1 
ATOM   3377 N ND2 . ASN B 1 183 ? 28.918 25.291  24.329  1.00 149.23 ? 224 ASN B ND2 1 
ATOM   3378 N N   . ASP B 1 184 ? 32.564 22.421  25.572  1.00 145.91 ? 225 ASP B N   1 
ATOM   3379 C CA  . ASP B 1 184 ? 33.169 21.210  26.104  1.00 142.76 ? 225 ASP B CA  1 
ATOM   3380 C C   . ASP B 1 184 ? 32.606 20.104  25.215  1.00 140.11 ? 225 ASP B C   1 
ATOM   3381 O O   . ASP B 1 184 ? 33.014 18.942  25.296  1.00 137.39 ? 225 ASP B O   1 
ATOM   3382 C CB  . ASP B 1 184 ? 32.747 21.000  27.567  1.00 142.38 ? 225 ASP B CB  1 
ATOM   3383 C CG  . ASP B 1 184 ? 33.887 20.492  28.442  1.00 142.53 ? 225 ASP B CG  1 
ATOM   3384 O OD1 . ASP B 1 184 ? 34.953 21.149  28.461  1.00 141.36 ? 225 ASP B OD1 1 
ATOM   3385 O OD2 . ASP B 1 184 ? 33.714 19.445  29.111  1.00 139.77 ? 225 ASP B OD2 1 
ATOM   3386 N N   . GLY B 1 185 ? 31.668 20.501  24.355  1.00 138.64 ? 226 GLY B N   1 
ATOM   3387 C CA  . GLY B 1 185 ? 31.024 19.576  23.439  1.00 135.49 ? 226 GLY B CA  1 
ATOM   3388 C C   . GLY B 1 185 ? 31.993 18.785  22.579  1.00 132.43 ? 226 GLY B C   1 
ATOM   3389 O O   . GLY B 1 185 ? 32.375 17.665  22.932  1.00 132.87 ? 226 GLY B O   1 
ATOM   3390 N N   . GLU B 1 186 ? 32.393 19.361  21.450  1.00 125.70 ? 227 GLU B N   1 
ATOM   3391 C CA  . GLU B 1 186 ? 33.319 18.682  20.550  1.00 120.39 ? 227 GLU B CA  1 
ATOM   3392 C C   . GLU B 1 186 ? 34.062 19.665  19.645  1.00 112.99 ? 227 GLU B C   1 
ATOM   3393 O O   . GLU B 1 186 ? 34.096 20.870  19.907  1.00 112.18 ? 227 GLU B O   1 
ATOM   3394 C CB  . GLU B 1 186 ? 32.566 17.650  19.690  1.00 123.51 ? 227 GLU B CB  1 
ATOM   3395 C CG  . GLU B 1 186 ? 31.635 18.240  18.621  1.00 129.13 ? 227 GLU B CG  1 
ATOM   3396 C CD  . GLU B 1 186 ? 30.431 18.988  19.194  1.00 132.38 ? 227 GLU B CD  1 
ATOM   3397 O OE1 . GLU B 1 186 ? 29.568 18.341  19.827  1.00 133.90 ? 227 GLU B OE1 1 
ATOM   3398 O OE2 . GLU B 1 186 ? 30.346 20.224  19.005  1.00 129.04 ? 227 GLU B OE2 1 
ATOM   3399 N N   . THR B 1 187 ? 34.664 19.142  18.583  1.00 102.66 ? 228 THR B N   1 
ATOM   3400 C CA  . THR B 1 187 ? 35.389 19.988  17.648  1.00 94.64  ? 228 THR B CA  1 
ATOM   3401 C C   . THR B 1 187 ? 34.523 20.225  16.410  1.00 83.92  ? 228 THR B C   1 
ATOM   3402 O O   . THR B 1 187 ? 34.191 19.281  15.688  1.00 80.93  ? 228 THR B O   1 
ATOM   3403 C CB  . THR B 1 187 ? 36.745 19.341  17.214  1.00 97.83  ? 228 THR B CB  1 
ATOM   3404 O OG1 . THR B 1 187 ? 36.528 18.389  16.165  1.00 98.08  ? 228 THR B OG1 1 
ATOM   3405 C CG2 . THR B 1 187 ? 37.394 18.621  18.397  1.00 104.67 ? 228 THR B CG2 1 
ATOM   3406 N N   . PRO B 1 188 ? 34.110 21.485  16.173  1.00 74.55  ? 229 PRO B N   1 
ATOM   3407 C CA  . PRO B 1 188 ? 33.289 21.766  14.999  1.00 66.18  ? 229 PRO B CA  1 
ATOM   3408 C C   . PRO B 1 188 ? 34.140 21.562  13.768  1.00 65.04  ? 229 PRO B C   1 
ATOM   3409 O O   . PRO B 1 188 ? 35.310 21.929  13.747  1.00 63.77  ? 229 PRO B O   1 
ATOM   3410 C CB  . PRO B 1 188 ? 32.866 23.217  15.198  1.00 67.73  ? 229 PRO B CB  1 
ATOM   3411 C CG  . PRO B 1 188 ? 33.903 23.777  16.091  1.00 69.54  ? 229 PRO B CG  1 
ATOM   3412 C CD  . PRO B 1 188 ? 34.206 22.671  17.041  1.00 72.65  ? 229 PRO B CD  1 
ATOM   3413 N N   . GLU B 1 189 ? 33.550 20.957  12.752  1.00 61.50  ? 230 GLU B N   1 
ATOM   3414 C CA  . GLU B 1 189 ? 34.255 20.674  11.519  1.00 62.17  ? 230 GLU B CA  1 
ATOM   3415 C C   . GLU B 1 189 ? 33.757 21.596  10.413  1.00 61.71  ? 230 GLU B C   1 
ATOM   3416 O O   . GLU B 1 189 ? 32.543 21.807  10.257  1.00 62.87  ? 230 GLU B O   1 
ATOM   3417 C CB  . GLU B 1 189 ? 34.016 19.215  11.129  1.00 61.12  ? 230 GLU B CB  1 
ATOM   3418 C CG  . GLU B 1 189 ? 35.025 18.580  10.147  1.00 69.72  ? 230 GLU B CG  1 
ATOM   3419 C CD  . GLU B 1 189 ? 34.523 17.243  9.568   1.00 63.24  ? 230 GLU B CD  1 
ATOM   3420 O OE1 . GLU B 1 189 ? 33.849 17.265  8.517   1.00 69.73  ? 230 GLU B OE1 1 
ATOM   3421 O OE2 . GLU B 1 189 ? 34.775 16.182  10.166  1.00 63.22  ? 230 GLU B OE2 1 
ATOM   3422 N N   . GLY B 1 190 ? 34.700 22.163  9.666   1.00 57.42  ? 231 GLY B N   1 
ATOM   3423 C CA  . GLY B 1 190 ? 34.349 23.021  8.550   1.00 57.70  ? 231 GLY B CA  1 
ATOM   3424 C C   . GLY B 1 190 ? 33.564 24.295  8.809   1.00 61.64  ? 231 GLY B C   1 
ATOM   3425 O O   . GLY B 1 190 ? 32.701 24.661  8.008   1.00 59.71  ? 231 GLY B O   1 
ATOM   3426 N N   . ILE B 1 191 ? 33.825 24.960  9.930   1.00 58.64  ? 232 ILE B N   1 
ATOM   3427 C CA  . ILE B 1 191 ? 33.167 26.223  10.207  1.00 55.76  ? 232 ILE B CA  1 
ATOM   3428 C C   . ILE B 1 191 ? 34.287 27.267  10.336  1.00 59.79  ? 232 ILE B C   1 
ATOM   3429 O O   . ILE B 1 191 ? 35.020 27.295  11.323  1.00 60.10  ? 232 ILE B O   1 
ATOM   3430 C CB  . ILE B 1 191 ? 32.366 26.186  11.504  1.00 54.31  ? 232 ILE B CB  1 
ATOM   3431 C CG1 . ILE B 1 191 ? 31.397 24.999  11.519  1.00 58.34  ? 232 ILE B CG1 1 
ATOM   3432 C CG2 . ILE B 1 191 ? 31.617 27.464  11.644  1.00 41.59  ? 232 ILE B CG2 1 
ATOM   3433 C CD1 . ILE B 1 191 ? 30.250 25.108  10.568  1.00 40.93  ? 232 ILE B CD1 1 
ATOM   3434 N N   . GLY B 1 192 ? 34.434 28.101  9.311   1.00 56.77  ? 233 GLY B N   1 
ATOM   3435 C CA  . GLY B 1 192 ? 35.467 29.117  9.323   1.00 48.64  ? 233 GLY B CA  1 
ATOM   3436 C C   . GLY B 1 192 ? 34.954 30.453  8.852   1.00 50.61  ? 233 GLY B C   1 
ATOM   3437 O O   . GLY B 1 192 ? 34.047 30.524  8.036   1.00 56.42  ? 233 GLY B O   1 
ATOM   3438 N N   . PHE B 1 193 ? 35.544 31.523  9.363   1.00 52.35  ? 234 PHE B N   1 
ATOM   3439 C CA  . PHE B 1 193 ? 35.102 32.851  9.007   1.00 53.18  ? 234 PHE B CA  1 
ATOM   3440 C C   . PHE B 1 193 ? 36.148 33.742  8.363   1.00 55.81  ? 234 PHE B C   1 
ATOM   3441 O O   . PHE B 1 193 ? 37.354 33.558  8.560   1.00 56.69  ? 234 PHE B O   1 
ATOM   3442 C CB  . PHE B 1 193 ? 34.542 33.531  10.242  1.00 47.41  ? 234 PHE B CB  1 
ATOM   3443 C CG  . PHE B 1 193 ? 33.511 32.714  10.950  1.00 54.18  ? 234 PHE B CG  1 
ATOM   3444 C CD1 . PHE B 1 193 ? 33.880 31.843  11.970  1.00 52.94  ? 234 PHE B CD1 1 
ATOM   3445 C CD2 . PHE B 1 193 ? 32.174 32.784  10.573  1.00 60.34  ? 234 PHE B CD2 1 
ATOM   3446 C CE1 . PHE B 1 193 ? 32.946 31.055  12.614  1.00 57.35  ? 234 PHE B CE1 1 
ATOM   3447 C CE2 . PHE B 1 193 ? 31.211 31.993  11.213  1.00 64.26  ? 234 PHE B CE2 1 
ATOM   3448 C CZ  . PHE B 1 193 ? 31.597 31.127  12.237  1.00 62.02  ? 234 PHE B CZ  1 
ATOM   3449 N N   . ALA B 1 194 ? 35.665 34.703  7.581   1.00 51.01  ? 235 ALA B N   1 
ATOM   3450 C CA  . ALA B 1 194 ? 36.517 35.658  6.916   1.00 50.07  ? 235 ALA B CA  1 
ATOM   3451 C C   . ALA B 1 194 ? 35.797 37.008  6.874   1.00 56.54  ? 235 ALA B C   1 
ATOM   3452 O O   . ALA B 1 194 ? 34.554 37.052  6.857   1.00 56.60  ? 235 ALA B O   1 
ATOM   3453 C CB  . ALA B 1 194 ? 36.822 35.172  5.499   1.00 50.27  ? 235 ALA B CB  1 
ATOM   3454 N N   . ILE B 1 195 ? 36.571 38.100  6.866   1.00 51.42  ? 236 ILE B N   1 
ATOM   3455 C CA  . ILE B 1 195 ? 36.002 39.444  6.772   1.00 47.68  ? 236 ILE B CA  1 
ATOM   3456 C C   . ILE B 1 195 ? 35.775 39.593  5.266   1.00 51.94  ? 236 ILE B C   1 
ATOM   3457 O O   . ILE B 1 195 ? 36.676 39.310  4.470   1.00 44.07  ? 236 ILE B O   1 
ATOM   3458 C CB  . ILE B 1 195 ? 37.021 40.605  7.164   1.00 52.87  ? 236 ILE B CB  1 
ATOM   3459 C CG1 . ILE B 1 195 ? 37.712 40.339  8.509   1.00 52.16  ? 236 ILE B CG1 1 
ATOM   3460 C CG2 . ILE B 1 195 ? 36.295 41.962  7.185   1.00 43.59  ? 236 ILE B CG2 1 
ATOM   3461 C CD1 . ILE B 1 195 ? 36.782 39.974  9.626   1.00 58.15  ? 236 ILE B CD1 1 
ATOM   3462 N N   . PRO B 1 196 ? 34.581 40.055  4.854   1.00 50.59  ? 237 PRO B N   1 
ATOM   3463 C CA  . PRO B 1 196 ? 34.262 40.244  3.434   1.00 49.94  ? 237 PRO B CA  1 
ATOM   3464 C C   . PRO B 1 196 ? 35.228 41.294  2.844   1.00 53.83  ? 237 PRO B C   1 
ATOM   3465 O O   . PRO B 1 196 ? 35.484 42.321  3.476   1.00 56.01  ? 237 PRO B O   1 
ATOM   3466 C CB  . PRO B 1 196 ? 32.827 40.744  3.472   1.00 49.49  ? 237 PRO B CB  1 
ATOM   3467 C CG  . PRO B 1 196 ? 32.308 40.211  4.810   1.00 54.09  ? 237 PRO B CG  1 
ATOM   3468 C CD  . PRO B 1 196 ? 33.450 40.433  5.710   1.00 48.02  ? 237 PRO B CD  1 
ATOM   3469 N N   . PHE B 1 197 ? 35.730 41.051  1.636   1.00 49.40  ? 238 PHE B N   1 
ATOM   3470 C CA  . PHE B 1 197 ? 36.692 41.944  1.026   1.00 51.69  ? 238 PHE B CA  1 
ATOM   3471 C C   . PHE B 1 197 ? 36.289 43.397  0.993   1.00 56.07  ? 238 PHE B C   1 
ATOM   3472 O O   . PHE B 1 197 ? 37.114 44.276  1.248   1.00 54.19  ? 238 PHE B O   1 
ATOM   3473 C CB  . PHE B 1 197 ? 37.060 41.455  -0.382  1.00 56.57  ? 238 PHE B CB  1 
ATOM   3474 C CG  . PHE B 1 197 ? 36.062 41.812  -1.455  1.00 60.49  ? 238 PHE B CG  1 
ATOM   3475 C CD1 . PHE B 1 197 ? 36.233 42.967  -2.225  1.00 60.03  ? 238 PHE B CD1 1 
ATOM   3476 C CD2 . PHE B 1 197 ? 34.991 40.952  -1.753  1.00 58.94  ? 238 PHE B CD2 1 
ATOM   3477 C CE1 . PHE B 1 197 ? 35.362 43.267  -3.292  1.00 57.52  ? 238 PHE B CE1 1 
ATOM   3478 C CE2 . PHE B 1 197 ? 34.115 41.233  -2.810  1.00 60.55  ? 238 PHE B CE2 1 
ATOM   3479 C CZ  . PHE B 1 197 ? 34.302 42.397  -3.589  1.00 68.24  ? 238 PHE B CZ  1 
ATOM   3480 N N   . GLN B 1 198 ? 35.021 43.664  0.711   1.00 58.61  ? 239 GLN B N   1 
ATOM   3481 C CA  . GLN B 1 198 ? 34.559 45.043  0.643   1.00 60.06  ? 239 GLN B CA  1 
ATOM   3482 C C   . GLN B 1 198 ? 34.785 45.732  1.985   1.00 61.63  ? 239 GLN B C   1 
ATOM   3483 O O   . GLN B 1 198 ? 35.320 46.841  2.045   1.00 67.54  ? 239 GLN B O   1 
ATOM   3484 C CB  . GLN B 1 198 ? 33.082 45.093  0.233   1.00 61.19  ? 239 GLN B CB  1 
ATOM   3485 C CG  . GLN B 1 198 ? 32.801 44.478  -1.134  1.00 62.18  ? 239 GLN B CG  1 
ATOM   3486 C CD  . GLN B 1 198 ? 33.230 45.377  -2.281  1.00 74.21  ? 239 GLN B CD  1 
ATOM   3487 O OE1 . GLN B 1 198 ? 34.276 46.040  -2.208  1.00 89.34  ? 239 GLN B OE1 1 
ATOM   3488 N NE2 . GLN B 1 198 ? 32.438 45.398  -3.358  1.00 62.11  ? 239 GLN B NE2 1 
ATOM   3489 N N   . LEU B 1 199 ? 34.407 45.075  3.071   1.00 61.53  ? 240 LEU B N   1 
ATOM   3490 C CA  . LEU B 1 199 ? 34.620 45.687  4.378   1.00 59.97  ? 240 LEU B CA  1 
ATOM   3491 C C   . LEU B 1 199 ? 36.123 45.810  4.665   1.00 60.55  ? 240 LEU B C   1 
ATOM   3492 O O   . LEU B 1 199 ? 36.545 46.753  5.309   1.00 61.90  ? 240 LEU B O   1 
ATOM   3493 C CB  . LEU B 1 199 ? 33.939 44.859  5.471   1.00 56.03  ? 240 LEU B CB  1 
ATOM   3494 C CG  . LEU B 1 199 ? 33.684 45.350  6.903   1.00 60.76  ? 240 LEU B CG  1 
ATOM   3495 C CD1 . LEU B 1 199 ? 34.222 44.290  7.809   1.00 60.22  ? 240 LEU B CD1 1 
ATOM   3496 C CD2 . LEU B 1 199 ? 34.356 46.670  7.235   1.00 62.28  ? 240 LEU B CD2 1 
ATOM   3497 N N   . ALA B 1 200 ? 36.928 44.858  4.188   1.00 59.71  ? 241 ALA B N   1 
ATOM   3498 C CA  . ALA B 1 200 ? 38.375 44.900  4.431   1.00 60.59  ? 241 ALA B CA  1 
ATOM   3499 C C   . ALA B 1 200 ? 39.009 46.046  3.626   1.00 59.17  ? 241 ALA B C   1 
ATOM   3500 O O   . ALA B 1 200 ? 39.958 46.672  4.064   1.00 60.87  ? 241 ALA B O   1 
ATOM   3501 C CB  . ALA B 1 200 ? 39.015 43.550  4.054   1.00 54.20  ? 241 ALA B CB  1 
ATOM   3502 N N   . THR B 1 201 ? 38.452 46.313  2.450   1.00 57.88  ? 242 THR B N   1 
ATOM   3503 C CA  . THR B 1 201 ? 38.907 47.384  1.586   1.00 54.57  ? 242 THR B CA  1 
ATOM   3504 C C   . THR B 1 201 ? 38.530 48.754  2.206   1.00 57.74  ? 242 THR B C   1 
ATOM   3505 O O   . THR B 1 201 ? 39.348 49.668  2.190   1.00 56.29  ? 242 THR B O   1 
ATOM   3506 C CB  . THR B 1 201 ? 38.279 47.210  0.173   1.00 57.02  ? 242 THR B CB  1 
ATOM   3507 O OG1 . THR B 1 201 ? 39.109 46.332  -0.611  1.00 57.48  ? 242 THR B OG1 1 
ATOM   3508 C CG2 . THR B 1 201 ? 38.097 48.554  -0.518  1.00 57.88  ? 242 THR B CG2 1 
ATOM   3509 N N   . LYS B 1 202 ? 37.309 48.909  2.729   1.00 42.31  ? 243 LYS B N   1 
ATOM   3510 C CA  . LYS B 1 202 ? 36.949 50.154  3.370   1.00 55.82  ? 243 LYS B CA  1 
ATOM   3511 C C   . LYS B 1 202 ? 37.792 50.391  4.655   1.00 62.11  ? 243 LYS B C   1 
ATOM   3512 O O   . LYS B 1 202 ? 38.124 51.538  4.983   1.00 64.79  ? 243 LYS B O   1 
ATOM   3513 C CB  . LYS B 1 202 ? 35.456 50.168  3.728   1.00 57.87  ? 243 LYS B CB  1 
ATOM   3514 C CG  . LYS B 1 202 ? 34.557 50.115  2.511   1.00 74.98  ? 243 LYS B CG  1 
ATOM   3515 C CD  . LYS B 1 202 ? 33.073 50.232  2.876   1.00 84.51  ? 243 LYS B CD  1 
ATOM   3516 C CE  . LYS B 1 202 ? 32.150 50.132  1.640   1.00 86.67  ? 243 LYS B CE  1 
ATOM   3517 N NZ  . LYS B 1 202 ? 32.150 48.779  0.982   1.00 85.52  ? 243 LYS B NZ  1 
ATOM   3518 N N   . ILE B 1 203 ? 38.139 49.319  5.370   1.00 54.48  ? 244 ILE B N   1 
ATOM   3519 C CA  . ILE B 1 203 ? 38.913 49.454  6.600   1.00 60.09  ? 244 ILE B CA  1 
ATOM   3520 C C   . ILE B 1 203 ? 40.385 49.768  6.323   1.00 61.05  ? 244 ILE B C   1 
ATOM   3521 O O   . ILE B 1 203 ? 41.014 50.521  7.065   1.00 61.86  ? 244 ILE B O   1 
ATOM   3522 C CB  . ILE B 1 203 ? 38.817 48.163  7.493   1.00 57.33  ? 244 ILE B CB  1 
ATOM   3523 C CG1 . ILE B 1 203 ? 37.380 47.962  7.986   1.00 55.90  ? 244 ILE B CG1 1 
ATOM   3524 C CG2 . ILE B 1 203 ? 39.709 48.282  8.713   1.00 57.76  ? 244 ILE B CG2 1 
ATOM   3525 C CD1 . ILE B 1 203 ? 36.871 49.085  8.843   1.00 54.03  ? 244 ILE B CD1 1 
ATOM   3526 N N   . MET B 1 204 ? 40.936 49.186  5.265   1.00 61.33  ? 245 MET B N   1 
ATOM   3527 C CA  . MET B 1 204 ? 42.328 49.435  4.917   1.00 63.15  ? 245 MET B CA  1 
ATOM   3528 C C   . MET B 1 204 ? 42.517 50.909  4.560   1.00 65.47  ? 245 MET B C   1 
ATOM   3529 O O   . MET B 1 204 ? 43.427 51.554  5.041   1.00 66.63  ? 245 MET B O   1 
ATOM   3530 C CB  . MET B 1 204 ? 42.743 48.560  3.741   1.00 64.92  ? 245 MET B CB  1 
ATOM   3531 C CG  . MET B 1 204 ? 44.140 48.846  3.240   1.00 61.74  ? 245 MET B CG  1 
ATOM   3532 S SD  . MET B 1 204 ? 44.554 47.821  1.828   1.00 64.62  ? 245 MET B SD  1 
ATOM   3533 C CE  . MET B 1 204 ? 43.253 48.418  0.623   1.00 52.54  ? 245 MET B CE  1 
ATOM   3534 N N   . ASP B 1 205 ? 41.642 51.437  3.717   1.00 65.07  ? 246 ASP B N   1 
ATOM   3535 C CA  . ASP B 1 205 ? 41.716 52.832  3.319   1.00 68.65  ? 246 ASP B CA  1 
ATOM   3536 C C   . ASP B 1 205 ? 41.721 53.743  4.541   1.00 70.80  ? 246 ASP B C   1 
ATOM   3537 O O   . ASP B 1 205 ? 42.493 54.702  4.625   1.00 77.37  ? 246 ASP B O   1 
ATOM   3538 C CB  . ASP B 1 205 ? 40.530 53.182  2.414   1.00 66.38  ? 246 ASP B CB  1 
ATOM   3539 C CG  . ASP B 1 205 ? 40.629 52.519  1.066   1.00 59.67  ? 246 ASP B CG  1 
ATOM   3540 O OD1 . ASP B 1 205 ? 41.657 51.860  0.842   1.00 62.14  ? 246 ASP B OD1 1 
ATOM   3541 O OD2 . ASP B 1 205 ? 39.703 52.647  0.239   1.00 59.98  ? 246 ASP B OD2 1 
ATOM   3542 N N   . LYS B 1 206 ? 40.854 53.431  5.488   1.00 69.48  ? 247 LYS B N   1 
ATOM   3543 C CA  . LYS B 1 206 ? 40.762 54.203  6.705   1.00 64.46  ? 247 LYS B CA  1 
ATOM   3544 C C   . LYS B 1 206 ? 42.065 54.084  7.446   1.00 61.57  ? 247 LYS B C   1 
ATOM   3545 O O   . LYS B 1 206 ? 42.568 55.071  7.969   1.00 64.50  ? 247 LYS B O   1 
ATOM   3546 C CB  . LYS B 1 206 ? 39.584 53.712  7.571   1.00 54.60  ? 247 LYS B CB  1 
ATOM   3547 C CG  . LYS B 1 206 ? 38.254 54.338  7.120   1.00 52.47  ? 247 LYS B CG  1 
ATOM   3548 C CD  . LYS B 1 206 ? 37.035 53.682  7.763   1.00 61.31  ? 247 LYS B CD  1 
ATOM   3549 C CE  . LYS B 1 206 ? 35.742 53.975  6.988   1.00 55.51  ? 247 LYS B CE  1 
ATOM   3550 N NZ  . LYS B 1 206 ? 35.526 55.429  6.721   1.00 66.10  ? 247 LYS B NZ  1 
ATOM   3551 N N   . LEU B 1 207 ? 42.629 52.886  7.469   1.00 59.84  ? 248 LEU B N   1 
ATOM   3552 C CA  . LEU B 1 207 ? 43.871 52.703  8.188   1.00 64.06  ? 248 LEU B CA  1 
ATOM   3553 C C   . LEU B 1 207 ? 45.055 53.390  7.537   1.00 66.15  ? 248 LEU B C   1 
ATOM   3554 O O   . LEU B 1 207 ? 45.939 53.903  8.228   1.00 66.26  ? 248 LEU B O   1 
ATOM   3555 C CB  . LEU B 1 207 ? 44.156 51.219  8.405   1.00 55.44  ? 248 LEU B CB  1 
ATOM   3556 C CG  . LEU B 1 207 ? 43.270 50.654  9.524   1.00 64.97  ? 248 LEU B CG  1 
ATOM   3557 C CD1 . LEU B 1 207 ? 43.756 49.261  9.910   1.00 63.08  ? 248 LEU B CD1 1 
ATOM   3558 C CD2 . LEU B 1 207 ? 43.305 51.582  10.755  1.00 57.05  ? 248 LEU B CD2 1 
ATOM   3559 N N   . ILE B 1 208 ? 45.061 53.421  6.211   1.00 64.80  ? 249 ILE B N   1 
ATOM   3560 C CA  . ILE B 1 208 ? 46.142 54.050  5.488   1.00 63.67  ? 249 ILE B CA  1 
ATOM   3561 C C   . ILE B 1 208 ? 46.018 55.550  5.707   1.00 65.89  ? 249 ILE B C   1 
ATOM   3562 O O   . ILE B 1 208 ? 47.010 56.217  6.006   1.00 61.68  ? 249 ILE B O   1 
ATOM   3563 C CB  . ILE B 1 208 ? 46.088 53.662  3.980   1.00 67.91  ? 249 ILE B CB  1 
ATOM   3564 C CG1 . ILE B 1 208 ? 46.502 52.183  3.832   1.00 57.27  ? 249 ILE B CG1 1 
ATOM   3565 C CG2 . ILE B 1 208 ? 47.002 54.581  3.137   1.00 62.13  ? 249 ILE B CG2 1 
ATOM   3566 C CD1 . ILE B 1 208 ? 46.196 51.589  2.457   1.00 49.23  ? 249 ILE B CD1 1 
ATOM   3567 N N   . ARG B 1 209 ? 44.793 56.069  5.604   1.00 67.36  ? 250 ARG B N   1 
ATOM   3568 C CA  . ARG B 1 209 ? 44.543 57.500  5.810   1.00 64.98  ? 250 ARG B CA  1 
ATOM   3569 C C   . ARG B 1 209 ? 44.790 58.062  7.216   1.00 68.55  ? 250 ARG B C   1 
ATOM   3570 O O   . ARG B 1 209 ? 45.477 59.079  7.348   1.00 74.32  ? 250 ARG B O   1 
ATOM   3571 C CB  . ARG B 1 209 ? 43.121 57.858  5.435   1.00 56.85  ? 250 ARG B CB  1 
ATOM   3572 C CG  . ARG B 1 209 ? 42.972 58.432  4.069   1.00 67.28  ? 250 ARG B CG  1 
ATOM   3573 C CD  . ARG B 1 209 ? 41.515 58.728  3.818   1.00 64.68  ? 250 ARG B CD  1 
ATOM   3574 N NE  . ARG B 1 209 ? 41.134 60.076  4.197   1.00 70.27  ? 250 ARG B NE  1 
ATOM   3575 C CZ  . ARG B 1 209 ? 41.503 61.161  3.529   1.00 74.37  ? 250 ARG B CZ  1 
ATOM   3576 N NH1 . ARG B 1 209 ? 42.270 61.029  2.454   1.00 75.60  ? 250 ARG B NH1 1 
ATOM   3577 N NH2 . ARG B 1 209 ? 41.085 62.367  3.915   1.00 73.96  ? 250 ARG B NH2 1 
ATOM   3578 N N   . ASP B 1 210 ? 44.247 57.417  8.252   1.00 64.21  ? 251 ASP B N   1 
ATOM   3579 C CA  . ASP B 1 210 ? 44.393 57.933  9.612   1.00 63.32  ? 251 ASP B CA  1 
ATOM   3580 C C   . ASP B 1 210 ? 45.162 57.109  10.622  1.00 65.10  ? 251 ASP B C   1 
ATOM   3581 O O   . ASP B 1 210 ? 45.239 57.489  11.783  1.00 72.43  ? 251 ASP B O   1 
ATOM   3582 C CB  . ASP B 1 210 ? 43.023 58.219  10.207  1.00 62.83  ? 251 ASP B CB  1 
ATOM   3583 C CG  . ASP B 1 210 ? 42.099 58.916  9.235   1.00 70.05  ? 251 ASP B CG  1 
ATOM   3584 O OD1 . ASP B 1 210 ? 42.354 60.088  8.882   1.00 77.57  ? 251 ASP B OD1 1 
ATOM   3585 O OD2 . ASP B 1 210 ? 41.109 58.288  8.818   1.00 75.60  ? 251 ASP B OD2 1 
ATOM   3586 N N   . GLY B 1 211 ? 45.718 55.976  10.230  1.00 67.97  ? 252 GLY B N   1 
ATOM   3587 C CA  . GLY B 1 211 ? 46.467 55.210  11.213  1.00 65.60  ? 252 GLY B CA  1 
ATOM   3588 C C   . GLY B 1 211 ? 45.572 54.469  12.182  1.00 70.50  ? 252 GLY B C   1 
ATOM   3589 O O   . GLY B 1 211 ? 46.060 53.720  13.031  1.00 71.43  ? 252 GLY B O   1 
ATOM   3590 N N   . ARG B 1 212 ? 44.261 54.685  12.061  1.00 70.43  ? 253 ARG B N   1 
ATOM   3591 C CA  . ARG B 1 212 ? 43.261 54.002  12.885  1.00 70.04  ? 253 ARG B CA  1 
ATOM   3592 C C   . ARG B 1 212 ? 41.903 54.269  12.273  1.00 68.13  ? 253 ARG B C   1 
ATOM   3593 O O   . ARG B 1 212 ? 41.777 55.105  11.378  1.00 67.58  ? 253 ARG B O   1 
ATOM   3594 C CB  . ARG B 1 212 ? 43.269 54.493  14.344  1.00 65.21  ? 253 ARG B CB  1 
ATOM   3595 C CG  . ARG B 1 212 ? 42.554 55.815  14.576  1.00 74.30  ? 253 ARG B CG  1 
ATOM   3596 C CD  . ARG B 1 212 ? 42.799 56.357  15.993  1.00 81.76  ? 253 ARG B CD  1 
ATOM   3597 N NE  . ARG B 1 212 ? 42.285 57.723  16.135  1.00 91.97  ? 253 ARG B NE  1 
ATOM   3598 C CZ  . ARG B 1 212 ? 42.748 58.781  15.463  1.00 90.85  ? 253 ARG B CZ  1 
ATOM   3599 N NH1 . ARG B 1 212 ? 43.752 58.639  14.600  1.00 85.74  ? 253 ARG B NH1 1 
ATOM   3600 N NH2 . ARG B 1 212 ? 42.190 59.977  15.633  1.00 82.38  ? 253 ARG B NH2 1 
ATOM   3601 N N   . VAL B 1 213 ? 40.886 53.547  12.738  1.00 66.64  ? 254 VAL B N   1 
ATOM   3602 C CA  . VAL B 1 213 ? 39.556 53.761  12.214  1.00 64.85  ? 254 VAL B CA  1 
ATOM   3603 C C   . VAL B 1 213 ? 38.881 54.766  13.126  1.00 69.07  ? 254 VAL B C   1 
ATOM   3604 O O   . VAL B 1 213 ? 38.767 54.554  14.336  1.00 71.17  ? 254 VAL B O   1 
ATOM   3605 C CB  . VAL B 1 213 ? 38.733 52.456  12.167  1.00 66.77  ? 254 VAL B CB  1 
ATOM   3606 C CG1 . VAL B 1 213 ? 37.340 52.769  11.605  1.00 60.75  ? 254 VAL B CG1 1 
ATOM   3607 C CG2 . VAL B 1 213 ? 39.447 51.389  11.297  1.00 51.64  ? 254 VAL B CG2 1 
ATOM   3608 N N   . ILE B 1 214 ? 38.453 55.879  12.551  1.00 68.64  ? 255 ILE B N   1 
ATOM   3609 C CA  . ILE B 1 214 ? 37.805 56.905  13.337  1.00 72.53  ? 255 ILE B CA  1 
ATOM   3610 C C   . ILE B 1 214 ? 36.302 56.803  13.187  1.00 75.12  ? 255 ILE B C   1 
ATOM   3611 O O   . ILE B 1 214 ? 35.734 57.242  12.194  1.00 77.90  ? 255 ILE B O   1 
ATOM   3612 C CB  . ILE B 1 214 ? 38.286 58.291  12.921  1.00 69.81  ? 255 ILE B CB  1 
ATOM   3613 C CG1 . ILE B 1 214 ? 39.815 58.363  13.084  1.00 75.75  ? 255 ILE B CG1 1 
ATOM   3614 C CG2 . ILE B 1 214 ? 37.603 59.352  13.781  1.00 67.63  ? 255 ILE B CG2 1 
ATOM   3615 C CD1 . ILE B 1 214 ? 40.445 59.728  12.734  1.00 72.02  ? 255 ILE B CD1 1 
ATOM   3616 N N   . ARG B 1 215 ? 35.655 56.227  14.192  1.00 76.93  ? 256 ARG B N   1 
ATOM   3617 C CA  . ARG B 1 215 ? 34.217 56.054  14.135  1.00 78.86  ? 256 ARG B CA  1 
ATOM   3618 C C   . ARG B 1 215 ? 33.421 57.199  14.712  1.00 81.38  ? 256 ARG B C   1 
ATOM   3619 O O   . ARG B 1 215 ? 33.841 57.858  15.656  1.00 71.77  ? 256 ARG B O   1 
ATOM   3620 C CB  . ARG B 1 215 ? 33.835 54.744  14.817  1.00 78.29  ? 256 ARG B CB  1 
ATOM   3621 C CG  . ARG B 1 215 ? 34.463 53.540  14.109  1.00 81.48  ? 256 ARG B CG  1 
ATOM   3622 C CD  . ARG B 1 215 ? 33.824 52.215  14.485  1.00 75.67  ? 256 ARG B CD  1 
ATOM   3623 N NE  . ARG B 1 215 ? 34.264 51.118  13.624  1.00 67.97  ? 256 ARG B NE  1 
ATOM   3624 C CZ  . ARG B 1 215 ? 35.462 50.544  13.675  1.00 64.13  ? 256 ARG B CZ  1 
ATOM   3625 N NH1 . ARG B 1 215 ? 36.381 50.948  14.545  1.00 63.40  ? 256 ARG B NH1 1 
ATOM   3626 N NH2 . ARG B 1 215 ? 35.729 49.541  12.864  1.00 57.78  ? 256 ARG B NH2 1 
ATOM   3627 N N   . GLY B 1 216 ? 32.264 57.436  14.107  1.00 93.37  ? 257 GLY B N   1 
ATOM   3628 C CA  . GLY B 1 216 ? 31.378 58.489  14.564  1.00 106.47 ? 257 GLY B CA  1 
ATOM   3629 C C   . GLY B 1 216 ? 30.492 57.969  15.680  1.00 114.54 ? 257 GLY B C   1 
ATOM   3630 O O   . GLY B 1 216 ? 29.596 57.157  15.452  1.00 116.27 ? 257 GLY B O   1 
ATOM   3631 N N   . TYR B 1 217 ? 30.762 58.444  16.891  1.00 122.71 ? 258 TYR B N   1 
ATOM   3632 C CA  . TYR B 1 217 ? 30.027 58.050  18.087  1.00 131.01 ? 258 TYR B CA  1 
ATOM   3633 C C   . TYR B 1 217 ? 29.170 59.199  18.623  1.00 136.66 ? 258 TYR B C   1 
ATOM   3634 O O   . TYR B 1 217 ? 29.589 60.360  18.603  1.00 135.36 ? 258 TYR B O   1 
ATOM   3635 C CB  . TYR B 1 217 ? 31.026 57.592  19.154  1.00 132.14 ? 258 TYR B CB  1 
ATOM   3636 C CG  . TYR B 1 217 ? 30.524 57.666  20.576  1.00 133.28 ? 258 TYR B CG  1 
ATOM   3637 C CD1 . TYR B 1 217 ? 29.578 56.764  21.054  1.00 134.74 ? 258 TYR B CD1 1 
ATOM   3638 C CD2 . TYR B 1 217 ? 30.996 58.650  21.444  1.00 133.86 ? 258 TYR B CD2 1 
ATOM   3639 C CE1 . TYR B 1 217 ? 29.114 56.842  22.364  1.00 137.47 ? 258 TYR B CE1 1 
ATOM   3640 C CE2 . TYR B 1 217 ? 30.539 58.738  22.752  1.00 134.86 ? 258 TYR B CE2 1 
ATOM   3641 C CZ  . TYR B 1 217 ? 29.600 57.832  23.205  1.00 136.92 ? 258 TYR B CZ  1 
ATOM   3642 O OH  . TYR B 1 217 ? 29.142 57.926  24.495  1.00 139.79 ? 258 TYR B OH  1 
ATOM   3643 N N   . ILE B 1 218 ? 27.969 58.871  19.095  1.00 142.96 ? 259 ILE B N   1 
ATOM   3644 C CA  . ILE B 1 218 ? 27.058 59.876  19.645  1.00 149.30 ? 259 ILE B CA  1 
ATOM   3645 C C   . ILE B 1 218 ? 26.736 59.600  21.118  1.00 152.34 ? 259 ILE B C   1 
ATOM   3646 O O   . ILE B 1 218 ? 27.144 60.359  22.007  1.00 153.36 ? 259 ILE B O   1 
ATOM   3647 C CB  . ILE B 1 218 ? 25.730 59.946  18.841  1.00 149.40 ? 259 ILE B CB  1 
ATOM   3648 C CG1 . ILE B 1 218 ? 26.000 60.485  17.432  1.00 149.09 ? 259 ILE B CG1 1 
ATOM   3649 C CG2 . ILE B 1 218 ? 24.724 60.838  19.564  1.00 148.76 ? 259 ILE B CG2 1 
ATOM   3650 C CD1 . ILE B 1 218 ? 24.748 60.689  16.596  1.00 148.74 ? 259 ILE B CD1 1 
ATOM   3651 N N   . GLY B 1 219 ? 26.004 58.519  21.372  1.00 153.34 ? 260 GLY B N   1 
ATOM   3652 C CA  . GLY B 1 219 ? 25.655 58.176  22.738  1.00 154.13 ? 260 GLY B CA  1 
ATOM   3653 C C   . GLY B 1 219 ? 24.221 57.722  22.918  1.00 154.99 ? 260 GLY B C   1 
ATOM   3654 O O   . GLY B 1 219 ? 23.419 58.427  23.527  1.00 154.40 ? 260 GLY B O   1 
ATOM   3655 N N   . ILE B 1 220 ? 23.902 56.543  22.388  1.00 156.12 ? 261 ILE B N   1 
ATOM   3656 C CA  . ILE B 1 220 ? 22.562 55.967  22.488  1.00 158.15 ? 261 ILE B CA  1 
ATOM   3657 C C   . ILE B 1 220 ? 22.561 54.477  22.115  1.00 159.68 ? 261 ILE B C   1 
ATOM   3658 O O   . ILE B 1 220 ? 22.176 54.102  21.004  1.00 158.54 ? 261 ILE B O   1 
ATOM   3659 C CB  . ILE B 1 220 ? 21.539 56.720  21.577  1.00 157.87 ? 261 ILE B CB  1 
ATOM   3660 C CG1 . ILE B 1 220 ? 22.161 57.029  20.216  1.00 156.90 ? 261 ILE B CG1 1 
ATOM   3661 C CG2 . ILE B 1 220 ? 21.070 58.001  22.249  1.00 157.85 ? 261 ILE B CG2 1 
ATOM   3662 C CD1 . ILE B 1 220 ? 21.232 57.782  19.278  1.00 155.47 ? 261 ILE B CD1 1 
ATOM   3663 N N   . GLY B 1 221 ? 22.987 53.632  23.054  1.00 161.44 ? 262 GLY B N   1 
ATOM   3664 C CA  . GLY B 1 221 ? 23.030 52.198  22.809  1.00 161.89 ? 262 GLY B CA  1 
ATOM   3665 C C   . GLY B 1 221 ? 22.127 51.381  23.719  1.00 162.05 ? 262 GLY B C   1 
ATOM   3666 O O   . GLY B 1 221 ? 22.377 51.271  24.922  1.00 162.48 ? 262 GLY B O   1 
ATOM   3667 N N   . GLY B 1 222 ? 21.078 50.799  23.143  1.00 161.88 ? 263 GLY B N   1 
ATOM   3668 C CA  . GLY B 1 222 ? 20.147 50.005  23.928  1.00 160.98 ? 263 GLY B CA  1 
ATOM   3669 C C   . GLY B 1 222 ? 19.725 48.700  23.277  1.00 160.79 ? 263 GLY B C   1 
ATOM   3670 O O   . GLY B 1 222 ? 18.888 48.685  22.370  1.00 159.62 ? 263 GLY B O   1 
ATOM   3671 N N   . ARG B 1 223 ? 20.305 47.601  23.752  1.00 160.65 ? 264 ARG B N   1 
ATOM   3672 C CA  . ARG B 1 223 ? 20.002 46.270  23.238  1.00 159.33 ? 264 ARG B CA  1 
ATOM   3673 C C   . ARG B 1 223 ? 19.097 45.513  24.207  1.00 158.21 ? 264 ARG B C   1 
ATOM   3674 O O   . ARG B 1 223 ? 18.085 44.938  23.809  1.00 156.52 ? 264 ARG B O   1 
ATOM   3675 C CB  . ARG B 1 223 ? 21.295 45.491  23.014  1.00 157.92 ? 264 ARG B CB  1 
ATOM   3676 N N   . ILE B 1 241 ? 12.934 55.754  15.219  1.00 182.57 ? 282 ILE B N   1 
ATOM   3677 C CA  . ILE B 1 241 ? 14.134 55.358  15.947  1.00 183.38 ? 282 ILE B CA  1 
ATOM   3678 C C   . ILE B 1 241 ? 14.192 56.059  17.300  1.00 183.84 ? 282 ILE B C   1 
ATOM   3679 O O   . ILE B 1 241 ? 14.719 57.165  17.415  1.00 183.82 ? 282 ILE B O   1 
ATOM   3680 C CB  . ILE B 1 241 ? 15.373 55.694  15.128  1.00 182.77 ? 282 ILE B CB  1 
ATOM   3681 N N   . VAL B 1 242 ? 13.656 55.401  18.324  1.00 184.41 ? 283 VAL B N   1 
ATOM   3682 C CA  . VAL B 1 242 ? 13.624 55.958  19.671  1.00 185.32 ? 283 VAL B CA  1 
ATOM   3683 C C   . VAL B 1 242 ? 14.898 55.700  20.473  1.00 185.94 ? 283 VAL B C   1 
ATOM   3684 O O   . VAL B 1 242 ? 15.559 54.675  20.302  1.00 185.72 ? 283 VAL B O   1 
ATOM   3685 C CB  . VAL B 1 242 ? 12.424 55.408  20.421  1.00 185.26 ? 283 VAL B CB  1 
ATOM   3686 N N   . VAL B 1 243 ? 15.230 56.639  21.355  1.00 186.67 ? 284 VAL B N   1 
ATOM   3687 C CA  . VAL B 1 243 ? 16.413 56.533  22.205  1.00 188.25 ? 284 VAL B CA  1 
ATOM   3688 C C   . VAL B 1 243 ? 16.041 55.894  23.542  1.00 189.53 ? 284 VAL B C   1 
ATOM   3689 O O   . VAL B 1 243 ? 15.634 56.582  24.476  1.00 189.67 ? 284 VAL B O   1 
ATOM   3690 C CB  . VAL B 1 243 ? 17.013 57.915  22.432  1.00 187.02 ? 284 VAL B CB  1 
ATOM   3691 N N   . ASN B 1 244 ? 16.192 54.574  23.625  1.00 190.53 ? 285 ASN B N   1 
ATOM   3692 C CA  . ASN B 1 244 ? 15.855 53.813  24.829  1.00 191.18 ? 285 ASN B CA  1 
ATOM   3693 C C   . ASN B 1 244 ? 17.080 53.201  25.509  1.00 191.51 ? 285 ASN B C   1 
ATOM   3694 O O   . ASN B 1 244 ? 17.530 52.120  25.130  1.00 191.85 ? 285 ASN B O   1 
ATOM   3695 C CB  . ASN B 1 244 ? 14.864 52.711  24.452  1.00 191.85 ? 285 ASN B CB  1 
ATOM   3696 C CG  . ASN B 1 244 ? 15.270 51.976  23.184  1.00 193.65 ? 285 ASN B CG  1 
ATOM   3697 O OD1 . ASN B 1 244 ? 16.198 51.166  23.190  1.00 194.70 ? 285 ASN B OD1 1 
ATOM   3698 N ND2 . ASN B 1 244 ? 14.585 52.270  22.084  1.00 194.06 ? 285 ASN B ND2 1 
ATOM   3699 N N   . GLU B 1 245 ? 17.611 53.882  26.523  1.00 192.16 ? 286 GLU B N   1 
ATOM   3700 C CA  . GLU B 1 245 ? 18.792 53.382  27.226  1.00 192.45 ? 286 GLU B CA  1 
ATOM   3701 C C   . GLU B 1 245 ? 18.561 51.968  27.754  1.00 193.27 ? 286 GLU B C   1 
ATOM   3702 O O   . GLU B 1 245 ? 19.455 51.367  28.345  1.00 194.26 ? 286 GLU B O   1 
ATOM   3703 C CB  . GLU B 1 245 ? 19.171 54.306  28.394  1.00 191.37 ? 286 GLU B CB  1 
ATOM   3704 C CG  . GLU B 1 245 ? 18.266 54.210  29.615  1.00 190.31 ? 286 GLU B CG  1 
ATOM   3705 C CD  . GLU B 1 245 ? 17.250 55.330  29.689  1.00 189.45 ? 286 GLU B CD  1 
ATOM   3706 O OE1 . GLU B 1 245 ? 16.511 55.534  28.704  1.00 189.48 ? 286 GLU B OE1 1 
ATOM   3707 O OE2 . GLU B 1 245 ? 17.188 56.004  30.739  1.00 188.50 ? 286 GLU B OE2 1 
ATOM   3708 N N   . GLY B 1 250 ? 24.619 60.685  26.762  1.00 197.29 ? 291 GLY B N   1 
ATOM   3709 C CA  . GLY B 1 250 ? 26.069 60.700  26.716  1.00 198.06 ? 291 GLY B CA  1 
ATOM   3710 C C   . GLY B 1 250 ? 26.625 62.094  26.493  1.00 198.85 ? 291 GLY B C   1 
ATOM   3711 O O   . GLY B 1 250 ? 25.968 63.081  26.828  1.00 198.80 ? 291 GLY B O   1 
ATOM   3712 N N   . PRO B 1 251 ? 27.845 62.207  25.940  1.00 199.51 ? 292 PRO B N   1 
ATOM   3713 C CA  . PRO B 1 251 ? 28.497 63.494  25.669  1.00 199.56 ? 292 PRO B CA  1 
ATOM   3714 C C   . PRO B 1 251 ? 27.890 64.264  24.493  1.00 199.13 ? 292 PRO B C   1 
ATOM   3715 O O   . PRO B 1 251 ? 28.058 65.480  24.386  1.00 198.91 ? 292 PRO B O   1 
ATOM   3716 C CB  . PRO B 1 251 ? 29.950 63.098  25.399  1.00 199.92 ? 292 PRO B CB  1 
ATOM   3717 C CG  . PRO B 1 251 ? 30.111 61.827  26.171  1.00 199.33 ? 292 PRO B CG  1 
ATOM   3718 C CD  . PRO B 1 251 ? 28.826 61.112  25.851  1.00 199.55 ? 292 PRO B CD  1 
ATOM   3719 N N   . ALA B 1 252 ? 27.194 63.553  23.610  1.00 198.23 ? 293 ALA B N   1 
ATOM   3720 C CA  . ALA B 1 252 ? 26.571 64.176  22.447  1.00 197.06 ? 293 ALA B CA  1 
ATOM   3721 C C   . ALA B 1 252 ? 25.120 64.551  22.740  1.00 196.26 ? 293 ALA B C   1 
ATOM   3722 O O   . ALA B 1 252 ? 24.551 65.428  22.089  1.00 195.86 ? 293 ALA B O   1 
ATOM   3723 C CB  . ALA B 1 252 ? 26.639 63.232  21.257  1.00 196.99 ? 293 ALA B CB  1 
ATOM   3724 N N   . ALA B 1 253 ? 24.526 63.885  23.725  1.00 195.35 ? 294 ALA B N   1 
ATOM   3725 C CA  . ALA B 1 253 ? 23.145 64.153  24.107  1.00 194.16 ? 294 ALA B CA  1 
ATOM   3726 C C   . ALA B 1 253 ? 23.074 65.334  25.065  1.00 193.41 ? 294 ALA B C   1 
ATOM   3727 O O   . ALA B 1 253 ? 21.996 65.710  25.521  1.00 193.86 ? 294 ALA B O   1 
ATOM   3728 C CB  . ALA B 1 253 ? 22.536 62.919  24.761  1.00 193.37 ? 294 ALA B CB  1 
ATOM   3729 N N   . ASN B 1 254 ? 24.228 65.917  25.366  1.00 192.48 ? 295 ASN B N   1 
ATOM   3730 C CA  . ASN B 1 254 ? 24.293 67.042  26.287  1.00 191.77 ? 295 ASN B CA  1 
ATOM   3731 C C   . ASN B 1 254 ? 23.819 68.367  25.707  1.00 192.05 ? 295 ASN B C   1 
ATOM   3732 O O   . ASN B 1 254 ? 23.945 69.405  26.355  1.00 193.15 ? 295 ASN B O   1 
ATOM   3733 C CB  . ASN B 1 254 ? 25.719 67.209  26.817  1.00 190.60 ? 295 ASN B CB  1 
ATOM   3734 C CG  . ASN B 1 254 ? 26.105 66.126  27.802  1.00 190.10 ? 295 ASN B CG  1 
ATOM   3735 O OD1 . ASN B 1 254 ? 25.406 65.892  28.788  1.00 189.47 ? 295 ASN B OD1 1 
ATOM   3736 N ND2 . ASN B 1 254 ? 27.225 65.464  27.546  1.00 190.25 ? 295 ASN B ND2 1 
ATOM   3737 N N   . ALA B 1 255 ? 23.268 68.343  24.497  1.00 191.38 ? 296 ALA B N   1 
ATOM   3738 C CA  . ALA B 1 255 ? 22.795 69.577  23.879  1.00 190.64 ? 296 ALA B CA  1 
ATOM   3739 C C   . ALA B 1 255 ? 21.848 69.366  22.707  1.00 190.35 ? 296 ALA B C   1 
ATOM   3740 O O   . ALA B 1 255 ? 22.207 69.624  21.559  1.00 190.20 ? 296 ALA B O   1 
ATOM   3741 C CB  . ALA B 1 255 ? 23.985 70.416  23.434  1.00 189.39 ? 296 ALA B CB  1 
ATOM   3742 N N   . GLY B 1 256 ? 20.636 68.903  22.996  1.00 190.17 ? 297 GLY B N   1 
ATOM   3743 C CA  . GLY B 1 256 ? 19.681 68.700  21.927  1.00 190.67 ? 297 GLY B CA  1 
ATOM   3744 C C   . GLY B 1 256 ? 18.860 67.432  22.002  1.00 191.34 ? 297 GLY B C   1 
ATOM   3745 O O   . GLY B 1 256 ? 17.683 67.446  21.654  1.00 191.42 ? 297 GLY B O   1 
ATOM   3746 N N   . ILE B 1 257 ? 19.466 66.336  22.447  1.00 192.56 ? 298 ILE B N   1 
ATOM   3747 C CA  . ILE B 1 257 ? 18.754 65.062  22.540  1.00 194.26 ? 298 ILE B CA  1 
ATOM   3748 C C   . ILE B 1 257 ? 17.960 64.931  23.839  1.00 195.78 ? 298 ILE B C   1 
ATOM   3749 O O   . ILE B 1 257 ? 18.389 65.413  24.887  1.00 196.57 ? 298 ILE B O   1 
ATOM   3750 C CB  . ILE B 1 257 ? 19.741 63.906  22.411  1.00 193.27 ? 298 ILE B CB  1 
ATOM   3751 N N   . GLN B 1 258 ? 16.802 64.276  23.758  1.00 197.24 ? 299 GLN B N   1 
ATOM   3752 C CA  . GLN B 1 258 ? 15.935 64.071  24.918  1.00 198.48 ? 299 GLN B CA  1 
ATOM   3753 C C   . GLN B 1 258 ? 16.192 62.710  25.563  1.00 199.49 ? 299 GLN B C   1 
ATOM   3754 O O   . GLN B 1 258 ? 17.329 62.239  25.588  1.00 200.44 ? 299 GLN B O   1 
ATOM   3755 C CB  . GLN B 1 258 ? 14.472 64.192  24.507  1.00 198.15 ? 299 GLN B CB  1 
ATOM   3756 N N   . VAL B 1 259 ? 15.140 62.076  26.079  1.00 200.10 ? 300 VAL B N   1 
ATOM   3757 C CA  . VAL B 1 259 ? 15.286 60.777  26.735  1.00 200.04 ? 300 VAL B CA  1 
ATOM   3758 C C   . VAL B 1 259 ? 14.689 59.601  25.956  1.00 200.32 ? 300 VAL B C   1 
ATOM   3759 O O   . VAL B 1 259 ? 15.407 58.894  25.247  1.00 200.01 ? 300 VAL B O   1 
ATOM   3760 C CB  . VAL B 1 259 ? 14.681 60.810  28.171  1.00 199.75 ? 300 VAL B CB  1 
ATOM   3761 C CG1 . VAL B 1 259 ? 13.244 61.314  28.135  1.00 198.73 ? 300 VAL B CG1 1 
ATOM   3762 C CG2 . VAL B 1 259 ? 14.753 59.427  28.804  1.00 199.34 ? 300 VAL B CG2 1 
ATOM   3763 N N   . ASN B 1 260 ? 13.382 59.394  26.089  1.00 200.32 ? 301 ASN B N   1 
ATOM   3764 C CA  . ASN B 1 260 ? 12.702 58.294  25.410  1.00 199.62 ? 301 ASN B CA  1 
ATOM   3765 C C   . ASN B 1 260 ? 11.930 58.728  24.165  1.00 198.91 ? 301 ASN B C   1 
ATOM   3766 O O   . ASN B 1 260 ? 10.742 58.429  24.028  1.00 199.07 ? 301 ASN B O   1 
ATOM   3767 C CB  . ASN B 1 260 ? 11.748 57.598  26.386  1.00 199.07 ? 301 ASN B CB  1 
ATOM   3768 C CG  . ASN B 1 260 ? 12.475 56.943  27.545  1.00 199.17 ? 301 ASN B CG  1 
ATOM   3769 O OD1 . ASN B 1 260 ? 11.850 56.468  28.492  1.00 199.71 ? 301 ASN B OD1 1 
ATOM   3770 N ND2 . ASN B 1 260 ? 13.801 56.908  27.473  1.00 198.70 ? 301 ASN B ND2 1 
ATOM   3771 N N   . ASP B 1 261 ? 12.608 59.427  23.258  1.00 197.37 ? 302 ASP B N   1 
ATOM   3772 C CA  . ASP B 1 261 ? 11.980 59.889  22.025  1.00 195.61 ? 302 ASP B CA  1 
ATOM   3773 C C   . ASP B 1 261 ? 12.673 59.298  20.799  1.00 196.07 ? 302 ASP B C   1 
ATOM   3774 O O   . ASP B 1 261 ? 13.730 58.679  20.915  1.00 195.88 ? 302 ASP B O   1 
ATOM   3775 C CB  . ASP B 1 261 ? 12.005 61.419  21.957  1.00 192.27 ? 302 ASP B CB  1 
ATOM   3776 C CG  . ASP B 1 261 ? 13.397 61.986  22.113  1.00 189.53 ? 302 ASP B CG  1 
ATOM   3777 O OD1 . ASP B 1 261 ? 14.023 61.740  23.163  1.00 188.15 ? 302 ASP B OD1 1 
ATOM   3778 O OD2 . ASP B 1 261 ? 13.864 62.680  21.187  1.00 187.32 ? 302 ASP B OD2 1 
ATOM   3779 N N   . LEU B 1 262 ? 12.069 59.489  19.630  1.00 196.40 ? 303 LEU B N   1 
ATOM   3780 C CA  . LEU B 1 262 ? 12.619 58.970  18.381  1.00 197.22 ? 303 LEU B CA  1 
ATOM   3781 C C   . LEU B 1 262 ? 13.371 60.047  17.601  1.00 197.77 ? 303 LEU B C   1 
ATOM   3782 O O   . LEU B 1 262 ? 13.571 61.158  18.096  1.00 198.35 ? 303 LEU B O   1 
ATOM   3783 C CB  . LEU B 1 262 ? 11.498 58.390  17.522  1.00 196.22 ? 303 LEU B CB  1 
ATOM   3784 N N   . ILE B 1 263 ? 13.789 59.710  16.382  1.00 197.59 ? 304 ILE B N   1 
ATOM   3785 C CA  . ILE B 1 263 ? 14.517 60.647  15.528  1.00 196.36 ? 304 ILE B CA  1 
ATOM   3786 C C   . ILE B 1 263 ? 14.495 60.210  14.060  1.00 195.35 ? 304 ILE B C   1 
ATOM   3787 O O   . ILE B 1 263 ? 15.309 59.393  13.629  1.00 195.65 ? 304 ILE B O   1 
ATOM   3788 C CB  . ILE B 1 263 ? 15.986 60.808  16.008  1.00 196.87 ? 304 ILE B CB  1 
ATOM   3789 C CG1 . ILE B 1 263 ? 16.754 61.720  15.047  1.00 197.16 ? 304 ILE B CG1 1 
ATOM   3790 C CG2 . ILE B 1 263 ? 16.649 59.442  16.142  1.00 196.07 ? 304 ILE B CG2 1 
ATOM   3791 C CD1 . ILE B 1 263 ? 18.156 62.058  15.512  1.00 196.63 ? 304 ILE B CD1 1 
ATOM   3792 N N   . ILE B 1 264 ? 13.553 60.762  13.299  1.00 194.06 ? 305 ILE B N   1 
ATOM   3793 C CA  . ILE B 1 264 ? 13.413 60.432  11.882  1.00 193.04 ? 305 ILE B CA  1 
ATOM   3794 C C   . ILE B 1 264 ? 14.681 60.725  11.105  1.00 191.30 ? 305 ILE B C   1 
ATOM   3795 O O   . ILE B 1 264 ? 15.140 59.901  10.312  1.00 189.37 ? 305 ILE B O   1 
ATOM   3796 C CB  . ILE B 1 264 ? 12.266 61.239  11.212  1.00 194.41 ? 305 ILE B CB  1 
ATOM   3797 C CG1 . ILE B 1 264 ? 10.905 60.720  11.683  1.00 196.09 ? 305 ILE B CG1 1 
ATOM   3798 C CG2 . ILE B 1 264 ? 12.375 61.145  9.688   1.00 193.06 ? 305 ILE B CG2 1 
ATOM   3799 C CD1 . ILE B 1 264 ? 10.584 59.307  11.221  1.00 198.02 ? 305 ILE B CD1 1 
ATOM   3800 N N   . SER B 1 265 ? 15.247 61.902  11.341  1.00 190.53 ? 306 SER B N   1 
ATOM   3801 C CA  . SER B 1 265 ? 16.436 62.310  10.619  1.00 190.14 ? 306 SER B CA  1 
ATOM   3802 C C   . SER B 1 265 ? 17.637 62.765  11.435  1.00 189.30 ? 306 SER B C   1 
ATOM   3803 O O   . SER B 1 265 ? 17.578 63.763  12.158  1.00 188.05 ? 306 SER B O   1 
ATOM   3804 C CB  . SER B 1 265 ? 16.073 63.420  9.634   1.00 190.37 ? 306 SER B CB  1 
ATOM   3805 O OG  . SER B 1 265 ? 15.618 64.571  10.324  1.00 190.39 ? 306 SER B OG  1 
ATOM   3806 N N   . VAL B 1 266 ? 18.725 62.014  11.305  1.00 188.48 ? 307 VAL B N   1 
ATOM   3807 C CA  . VAL B 1 266 ? 19.987 62.347  11.950  1.00 186.95 ? 307 VAL B CA  1 
ATOM   3808 C C   . VAL B 1 266 ? 20.701 63.029  10.792  1.00 186.95 ? 307 VAL B C   1 
ATOM   3809 O O   . VAL B 1 266 ? 20.743 62.482  9.691   1.00 187.27 ? 307 VAL B O   1 
ATOM   3810 C CB  . VAL B 1 266 ? 20.779 61.088  12.356  1.00 185.07 ? 307 VAL B CB  1 
ATOM   3811 C CG1 . VAL B 1 266 ? 22.072 61.489  13.044  1.00 182.77 ? 307 VAL B CG1 1 
ATOM   3812 C CG2 . VAL B 1 266 ? 19.938 60.215  13.264  1.00 184.23 ? 307 VAL B CG2 1 
ATOM   3813 N N   . ASP B 1 267 ? 21.241 64.220  11.019  1.00 186.62 ? 308 ASP B N   1 
ATOM   3814 C CA  . ASP B 1 267 ? 21.905 64.956  9.946   1.00 186.31 ? 308 ASP B CA  1 
ATOM   3815 C C   . ASP B 1 267 ? 20.792 65.404  8.989   1.00 185.51 ? 308 ASP B C   1 
ATOM   3816 O O   . ASP B 1 267 ? 21.029 65.694  7.813   1.00 186.00 ? 308 ASP B O   1 
ATOM   3817 C CB  . ASP B 1 267 ? 22.915 64.060  9.216   1.00 186.29 ? 308 ASP B CB  1 
ATOM   3818 C CG  . ASP B 1 267 ? 23.838 64.841  8.295   1.00 185.69 ? 308 ASP B CG  1 
ATOM   3819 O OD1 . ASP B 1 267 ? 24.638 65.660  8.800   1.00 185.61 ? 308 ASP B OD1 1 
ATOM   3820 O OD2 . ASP B 1 267 ? 23.766 64.636  7.066   1.00 185.60 ? 308 ASP B OD2 1 
ATOM   3821 N N   . ASN B 1 268 ? 19.575 65.447  9.528   1.00 183.95 ? 309 ASN B N   1 
ATOM   3822 C CA  . ASN B 1 268 ? 18.369 65.853  8.811   1.00 182.21 ? 309 ASN B CA  1 
ATOM   3823 C C   . ASN B 1 268 ? 18.101 65.060  7.518   1.00 180.67 ? 309 ASN B C   1 
ATOM   3824 O O   . ASN B 1 268 ? 17.626 65.597  6.518   1.00 181.13 ? 309 ASN B O   1 
ATOM   3825 C CB  . ASN B 1 268 ? 18.404 67.379  8.574   1.00 182.17 ? 309 ASN B CB  1 
ATOM   3826 C CG  . ASN B 1 268 ? 18.587 67.760  7.120   1.00 182.48 ? 309 ASN B CG  1 
ATOM   3827 O OD1 . ASN B 1 268 ? 19.603 67.442  6.501   1.00 182.07 ? 309 ASN B OD1 1 
ATOM   3828 N ND2 . ASN B 1 268 ? 17.598 68.453  6.566   1.00 181.61 ? 309 ASN B ND2 1 
ATOM   3829 N N   . LYS B 1 269 ? 18.392 63.762  7.568   1.00 177.91 ? 310 LYS B N   1 
ATOM   3830 C CA  . LYS B 1 269 ? 18.169 62.847  6.447   1.00 175.20 ? 310 LYS B CA  1 
ATOM   3831 C C   . LYS B 1 269 ? 17.706 61.492  6.997   1.00 173.41 ? 310 LYS B C   1 
ATOM   3832 O O   . LYS B 1 269 ? 18.471 60.789  7.657   1.00 173.26 ? 310 LYS B O   1 
ATOM   3833 C CB  . LYS B 1 269 ? 19.453 62.681  5.627   1.00 174.88 ? 310 LYS B CB  1 
ATOM   3834 C CG  . LYS B 1 269 ? 19.555 63.616  4.434   1.00 173.04 ? 310 LYS B CG  1 
ATOM   3835 C CD  . LYS B 1 269 ? 18.547 63.231  3.363   1.00 171.98 ? 310 LYS B CD  1 
ATOM   3836 C CE  . LYS B 1 269 ? 18.702 64.088  2.124   1.00 171.50 ? 310 LYS B CE  1 
ATOM   3837 N NZ  . LYS B 1 269 ? 17.863 63.581  1.008   1.00 171.07 ? 310 LYS B NZ  1 
ATOM   3838 N N   . PRO B 1 270 ? 16.444 61.107  6.722   1.00 171.58 ? 311 PRO B N   1 
ATOM   3839 C CA  . PRO B 1 270 ? 15.881 59.839  7.199   1.00 168.96 ? 311 PRO B CA  1 
ATOM   3840 C C   . PRO B 1 270 ? 16.487 58.570  6.604   1.00 168.03 ? 311 PRO B C   1 
ATOM   3841 O O   . PRO B 1 270 ? 16.385 58.324  5.404   1.00 168.38 ? 311 PRO B O   1 
ATOM   3842 C CB  . PRO B 1 270 ? 14.402 59.982  6.862   1.00 169.18 ? 311 PRO B CB  1 
ATOM   3843 C CG  . PRO B 1 270 ? 14.443 60.738  5.574   1.00 169.89 ? 311 PRO B CG  1 
ATOM   3844 C CD  . PRO B 1 270 ? 15.472 61.817  5.867   1.00 171.53 ? 311 PRO B CD  1 
ATOM   3845 N N   . ALA B 1 271 ? 17.115 57.766  7.457   1.00 166.69 ? 312 ALA B N   1 
ATOM   3846 C CA  . ALA B 1 271 ? 17.716 56.508  7.027   1.00 164.43 ? 312 ALA B CA  1 
ATOM   3847 C C   . ALA B 1 271 ? 16.844 55.379  7.566   1.00 163.37 ? 312 ALA B C   1 
ATOM   3848 O O   . ALA B 1 271 ? 17.326 54.473  8.246   1.00 163.24 ? 312 ALA B O   1 
ATOM   3849 C CB  . ALA B 1 271 ? 19.137 56.387  7.564   1.00 164.38 ? 312 ALA B CB  1 
ATOM   3850 N N   . ILE B 1 272 ? 15.552 55.469  7.255   1.00 161.62 ? 313 ILE B N   1 
ATOM   3851 C CA  . ILE B 1 272 ? 14.525 54.510  7.658   1.00 158.68 ? 313 ILE B CA  1 
ATOM   3852 C C   . ILE B 1 272 ? 14.739 53.777  8.991   1.00 158.13 ? 313 ILE B C   1 
ATOM   3853 O O   . ILE B 1 272 ? 14.117 54.133  9.993   1.00 156.32 ? 313 ILE B O   1 
ATOM   3854 C CB  . ILE B 1 272 ? 14.254 53.485  6.507   1.00 158.22 ? 313 ILE B CB  1 
ATOM   3855 C CG1 . ILE B 1 272 ? 13.102 52.553  6.884   1.00 159.15 ? 313 ILE B CG1 1 
ATOM   3856 C CG2 . ILE B 1 272 ? 15.506 52.689  6.193   1.00 158.35 ? 313 ILE B CG2 1 
ATOM   3857 C CD1 . ILE B 1 272 ? 12.725 51.570  5.786   1.00 157.61 ? 313 ILE B CD1 1 
ATOM   3858 N N   . SER B 1 273 ? 15.616 52.772  9.012   1.00 158.68 ? 314 SER B N   1 
ATOM   3859 C CA  . SER B 1 273 ? 15.875 51.985  10.226  1.00 157.77 ? 314 SER B CA  1 
ATOM   3860 C C   . SER B 1 273 ? 16.889 52.583  11.207  1.00 157.41 ? 314 SER B C   1 
ATOM   3861 O O   . SER B 1 273 ? 16.995 53.804  11.345  1.00 158.64 ? 314 SER B O   1 
ATOM   3862 C CB  . SER B 1 273 ? 16.316 50.563  9.847   1.00 156.75 ? 314 SER B CB  1 
ATOM   3863 O OG  . SER B 1 273 ? 17.551 50.563  9.153   1.00 154.56 ? 314 SER B OG  1 
ATOM   3864 N N   . ALA B 1 274 ? 17.623 51.708  11.893  1.00 156.49 ? 315 ALA B N   1 
ATOM   3865 C CA  . ALA B 1 274 ? 18.620 52.128  12.874  1.00 157.19 ? 315 ALA B CA  1 
ATOM   3866 C C   . ALA B 1 274 ? 20.034 51.724  12.476  1.00 158.05 ? 315 ALA B C   1 
ATOM   3867 O O   . ALA B 1 274 ? 20.948 52.548  12.506  1.00 159.35 ? 315 ALA B O   1 
ATOM   3868 C CB  . ALA B 1 274 ? 18.284 51.543  14.239  1.00 155.37 ? 315 ALA B CB  1 
ATOM   3869 N N   . LEU B 1 275 ? 20.213 50.454  12.115  1.00 157.93 ? 316 LEU B N   1 
ATOM   3870 C CA  . LEU B 1 275 ? 21.524 49.948  11.713  1.00 156.69 ? 316 LEU B CA  1 
ATOM   3871 C C   . LEU B 1 275 ? 22.169 50.870  10.683  1.00 155.56 ? 316 LEU B C   1 
ATOM   3872 O O   . LEU B 1 275 ? 23.387 51.038  10.663  1.00 156.77 ? 316 LEU B O   1 
ATOM   3873 C CB  . LEU B 1 275 ? 21.405 48.540  11.117  1.00 156.13 ? 316 LEU B CB  1 
ATOM   3874 C CG  . LEU B 1 275 ? 22.208 47.418  11.787  1.00 157.25 ? 316 LEU B CG  1 
ATOM   3875 C CD1 . LEU B 1 275 ? 22.184 46.179  10.901  1.00 156.59 ? 316 LEU B CD1 1 
ATOM   3876 C CD2 . LEU B 1 275 ? 23.645 47.863  12.015  1.00 158.64 ? 316 LEU B CD2 1 
ATOM   3877 N N   . GLU B 1 276 ? 21.340 51.464  9.832   1.00 153.79 ? 317 GLU B N   1 
ATOM   3878 C CA  . GLU B 1 276 ? 21.814 52.370  8.793   1.00 152.89 ? 317 GLU B CA  1 
ATOM   3879 C C   . GLU B 1 276 ? 22.254 53.690  9.419   1.00 151.98 ? 317 GLU B C   1 
ATOM   3880 O O   . GLU B 1 276 ? 23.207 54.323  8.959   1.00 148.97 ? 317 GLU B O   1 
ATOM   3881 C CB  . GLU B 1 276 ? 20.697 52.619  7.786   1.00 153.93 ? 317 GLU B CB  1 
ATOM   3882 C CG  . GLU B 1 276 ? 19.950 51.359  7.394   1.00 154.73 ? 317 GLU B CG  1 
ATOM   3883 C CD  . GLU B 1 276 ? 18.706 51.657  6.592   1.00 155.88 ? 317 GLU B CD  1 
ATOM   3884 O OE1 . GLU B 1 276 ? 17.916 50.719  6.347   1.00 155.61 ? 317 GLU B OE1 1 
ATOM   3885 O OE2 . GLU B 1 276 ? 18.525 52.832  6.205   1.00 157.69 ? 317 GLU B OE2 1 
ATOM   3886 N N   . THR B 1 277 ? 21.548 54.101  10.468  1.00 151.87 ? 318 THR B N   1 
ATOM   3887 C CA  . THR B 1 277 ? 21.872 55.335  11.171  1.00 151.73 ? 318 THR B CA  1 
ATOM   3888 C C   . THR B 1 277 ? 23.120 55.081  12.013  1.00 150.58 ? 318 THR B C   1 
ATOM   3889 O O   . THR B 1 277 ? 23.891 55.996  12.301  1.00 151.85 ? 318 THR B O   1 
ATOM   3890 C CB  . THR B 1 277 ? 20.717 55.777  12.094  1.00 151.88 ? 318 THR B CB  1 
ATOM   3891 O OG1 . THR B 1 277 ? 19.507 55.877  11.332  1.00 152.66 ? 318 THR B OG1 1 
ATOM   3892 C CG2 . THR B 1 277 ? 21.019 57.134  12.710  1.00 150.56 ? 318 THR B CG2 1 
ATOM   3893 N N   . MET B 1 278 ? 23.310 53.825  12.400  1.00 148.17 ? 319 MET B N   1 
ATOM   3894 C CA  . MET B 1 278 ? 24.467 53.427  13.189  1.00 146.86 ? 319 MET B CA  1 
ATOM   3895 C C   . MET B 1 278 ? 25.740 53.663  12.379  1.00 146.12 ? 319 MET B C   1 
ATOM   3896 O O   . MET B 1 278 ? 26.654 54.361  12.827  1.00 146.52 ? 319 MET B O   1 
ATOM   3897 C CB  . MET B 1 278 ? 24.355 51.946  13.566  1.00 146.74 ? 319 MET B CB  1 
ATOM   3898 C CG  . MET B 1 278 ? 25.510 51.413  14.398  1.00 144.66 ? 319 MET B CG  1 
ATOM   3899 S SD  . MET B 1 278 ? 25.190 49.756  15.022  1.00 146.77 ? 319 MET B SD  1 
ATOM   3900 C CE  . MET B 1 278 ? 23.818 50.053  16.132  1.00 140.34 ? 319 MET B CE  1 
ATOM   3901 N N   . ASP B 1 279 ? 25.783 53.080  11.181  1.00 143.60 ? 320 ASP B N   1 
ATOM   3902 C CA  . ASP B 1 279 ? 26.930 53.203  10.283  1.00 140.80 ? 320 ASP B CA  1 
ATOM   3903 C C   . ASP B 1 279 ? 27.070 54.630  9.760   1.00 137.89 ? 320 ASP B C   1 
ATOM   3904 O O   . ASP B 1 279 ? 28.176 55.173  9.697   1.00 137.37 ? 320 ASP B O   1 
ATOM   3905 C CB  . ASP B 1 279 ? 26.786 52.242  9.099   1.00 142.25 ? 320 ASP B CB  1 
ATOM   3906 C CG  . ASP B 1 279 ? 26.457 50.822  9.530   1.00 142.60 ? 320 ASP B CG  1 
ATOM   3907 O OD1 . ASP B 1 279 ? 27.201 50.248  10.354  1.00 143.52 ? 320 ASP B OD1 1 
ATOM   3908 O OD2 . ASP B 1 279 ? 25.449 50.277  9.035   1.00 143.30 ? 320 ASP B OD2 1 
ATOM   3909 N N   . GLN B 1 280 ? 25.949 55.231  9.374   1.00 133.78 ? 321 GLN B N   1 
ATOM   3910 C CA  . GLN B 1 280 ? 25.970 56.598  8.874   1.00 130.07 ? 321 GLN B CA  1 
ATOM   3911 C C   . GLN B 1 280 ? 26.626 57.499  9.911   1.00 124.48 ? 321 GLN B C   1 
ATOM   3912 O O   . GLN B 1 280 ? 27.515 58.286  9.591   1.00 122.88 ? 321 GLN B O   1 
ATOM   3913 C CB  . GLN B 1 280 ? 24.546 57.080  8.570   1.00 132.54 ? 321 GLN B CB  1 
ATOM   3914 C CG  . GLN B 1 280 ? 24.188 57.042  7.083   1.00 135.81 ? 321 GLN B CG  1 
ATOM   3915 C CD  . GLN B 1 280 ? 24.201 55.638  6.492   1.00 138.14 ? 321 GLN B CD  1 
ATOM   3916 O OE1 . GLN B 1 280 ? 25.031 54.801  6.854   1.00 138.59 ? 321 GLN B OE1 1 
ATOM   3917 N NE2 . GLN B 1 280 ? 23.287 55.382  5.560   1.00 138.96 ? 321 GLN B NE2 1 
ATOM   3918 N N   . VAL B 1 281 ? 26.186 57.368  11.157  1.00 118.34 ? 322 VAL B N   1 
ATOM   3919 C CA  . VAL B 1 281 ? 26.740 58.158  12.248  1.00 112.01 ? 322 VAL B CA  1 
ATOM   3920 C C   . VAL B 1 281 ? 28.223 57.862  12.406  1.00 106.26 ? 322 VAL B C   1 
ATOM   3921 O O   . VAL B 1 281 ? 29.034 58.776  12.529  1.00 104.87 ? 322 VAL B O   1 
ATOM   3922 C CB  . VAL B 1 281 ? 26.006 57.864  13.584  1.00 111.91 ? 322 VAL B CB  1 
ATOM   3923 C CG1 . VAL B 1 281 ? 26.880 58.261  14.776  1.00 109.86 ? 322 VAL B CG1 1 
ATOM   3924 C CG2 . VAL B 1 281 ? 24.693 58.636  13.624  1.00 107.85 ? 322 VAL B CG2 1 
ATOM   3925 N N   . ALA B 1 282 ? 28.578 56.585  12.409  1.00 100.12 ? 323 ALA B N   1 
ATOM   3926 C CA  . ALA B 1 282 ? 29.975 56.207  12.545  1.00 95.63  ? 323 ALA B CA  1 
ATOM   3927 C C   . ALA B 1 282 ? 30.781 56.801  11.386  1.00 92.10  ? 323 ALA B C   1 
ATOM   3928 O O   . ALA B 1 282 ? 31.931 57.203  11.547  1.00 87.07  ? 323 ALA B O   1 
ATOM   3929 C CB  . ALA B 1 282 ? 30.101 54.698  12.556  1.00 92.68  ? 323 ALA B CB  1 
ATOM   3930 N N   . GLU B 1 283 ? 30.158 56.870  10.220  1.00 90.53  ? 324 GLU B N   1 
ATOM   3931 C CA  . GLU B 1 283 ? 30.817 57.400  9.041   1.00 92.59  ? 324 GLU B CA  1 
ATOM   3932 C C   . GLU B 1 283 ? 30.984 58.912  9.109   1.00 95.50  ? 324 GLU B C   1 
ATOM   3933 O O   . GLU B 1 283 ? 31.593 59.517  8.234   1.00 94.29  ? 324 GLU B O   1 
ATOM   3934 C CB  . GLU B 1 283 ? 30.015 57.040  7.797   1.00 92.05  ? 324 GLU B CB  1 
ATOM   3935 C CG  . GLU B 1 283 ? 30.828 57.079  6.534   1.00 96.46  ? 324 GLU B CG  1 
ATOM   3936 C CD  . GLU B 1 283 ? 32.016 56.144  6.611   1.00 101.45 ? 324 GLU B CD  1 
ATOM   3937 O OE1 . GLU B 1 283 ? 31.799 54.942  6.898   1.00 97.61  ? 324 GLU B OE1 1 
ATOM   3938 O OE2 . GLU B 1 283 ? 33.160 56.612  6.388   1.00 103.89 ? 324 GLU B OE2 1 
ATOM   3939 N N   . ILE B 1 284 ? 30.432 59.519  10.152  1.00 101.78 ? 325 ILE B N   1 
ATOM   3940 C CA  . ILE B 1 284 ? 30.508 60.966  10.330  1.00 102.36 ? 325 ILE B CA  1 
ATOM   3941 C C   . ILE B 1 284 ? 31.731 61.334  11.151  1.00 102.59 ? 325 ILE B C   1 
ATOM   3942 O O   . ILE B 1 284 ? 31.858 60.928  12.306  1.00 101.49 ? 325 ILE B O   1 
ATOM   3943 C CB  . ILE B 1 284 ? 29.232 61.505  11.026  1.00 103.38 ? 325 ILE B CB  1 
ATOM   3944 C CG1 . ILE B 1 284 ? 28.070 61.522  10.023  1.00 104.35 ? 325 ILE B CG1 1 
ATOM   3945 C CG2 . ILE B 1 284 ? 29.493 62.883  11.614  1.00 103.82 ? 325 ILE B CG2 1 
ATOM   3946 C CD1 . ILE B 1 284 ? 26.743 61.947  10.616  1.00 102.92 ? 325 ILE B CD1 1 
ATOM   3947 N N   . ARG B 1 285 ? 32.623 62.113  10.548  1.00 105.42 ? 326 ARG B N   1 
ATOM   3948 C CA  . ARG B 1 285 ? 33.852 62.529  11.209  1.00 105.05 ? 326 ARG B CA  1 
ATOM   3949 C C   . ARG B 1 285 ? 33.606 63.436  12.404  1.00 101.94 ? 326 ARG B C   1 
ATOM   3950 O O   . ARG B 1 285 ? 32.757 64.328  12.359  1.00 99.92  ? 326 ARG B O   1 
ATOM   3951 C CB  . ARG B 1 285 ? 34.778 63.231  10.216  1.00 111.64 ? 326 ARG B CB  1 
ATOM   3952 C CG  . ARG B 1 285 ? 36.085 63.697  10.847  1.00 120.65 ? 326 ARG B CG  1 
ATOM   3953 C CD  . ARG B 1 285 ? 37.319 63.177  10.102  1.00 126.25 ? 326 ARG B CD  1 
ATOM   3954 N NE  . ARG B 1 285 ? 37.322 61.723  9.955   1.00 125.08 ? 326 ARG B NE  1 
ATOM   3955 C CZ  . ARG B 1 285 ? 38.408 60.998  9.705   1.00 123.08 ? 326 ARG B CZ  1 
ATOM   3956 N NH1 . ARG B 1 285 ? 39.594 61.582  9.573   1.00 121.31 ? 326 ARG B NH1 1 
ATOM   3957 N NH2 . ARG B 1 285 ? 38.304 59.683  9.584   1.00 124.78 ? 326 ARG B NH2 1 
ATOM   3958 N N   . PRO B 1 286 ? 34.350 63.208  13.496  1.00 100.38 ? 327 PRO B N   1 
ATOM   3959 C CA  . PRO B 1 286 ? 34.269 63.967  14.746  1.00 103.63 ? 327 PRO B CA  1 
ATOM   3960 C C   . PRO B 1 286 ? 34.363 65.486  14.560  1.00 110.63 ? 327 PRO B C   1 
ATOM   3961 O O   . PRO B 1 286 ? 35.002 65.968  13.619  1.00 112.74 ? 327 PRO B O   1 
ATOM   3962 C CB  . PRO B 1 286 ? 35.441 63.414  15.546  1.00 99.35  ? 327 PRO B CB  1 
ATOM   3963 C CG  . PRO B 1 286 ? 35.490 62.008  15.116  1.00 94.59  ? 327 PRO B CG  1 
ATOM   3964 C CD  . PRO B 1 286 ? 35.314 62.104  13.628  1.00 94.61  ? 327 PRO B CD  1 
ATOM   3965 N N   . GLY B 1 287 ? 33.731 66.231  15.466  1.00 114.35 ? 328 GLY B N   1 
ATOM   3966 C CA  . GLY B 1 287 ? 33.763 67.683  15.400  1.00 119.41 ? 328 GLY B CA  1 
ATOM   3967 C C   . GLY B 1 287 ? 32.671 68.317  14.553  1.00 124.04 ? 328 GLY B C   1 
ATOM   3968 O O   . GLY B 1 287 ? 32.158 69.387  14.891  1.00 122.35 ? 328 GLY B O   1 
ATOM   3969 N N   . SER B 1 288 ? 32.318 67.660  13.451  1.00 130.09 ? 329 SER B N   1 
ATOM   3970 C CA  . SER B 1 288 ? 31.286 68.160  12.544  1.00 134.55 ? 329 SER B CA  1 
ATOM   3971 C C   . SER B 1 288 ? 29.935 68.298  13.224  1.00 137.91 ? 329 SER B C   1 
ATOM   3972 O O   . SER B 1 288 ? 29.313 67.304  13.607  1.00 137.82 ? 329 SER B O   1 
ATOM   3973 C CB  . SER B 1 288 ? 31.143 67.237  11.333  1.00 133.05 ? 329 SER B CB  1 
ATOM   3974 O OG  . SER B 1 288 ? 32.310 67.272  10.535  1.00 136.54 ? 329 SER B OG  1 
ATOM   3975 N N   . VAL B 1 289 ? 29.488 69.542  13.364  1.00 140.73 ? 330 VAL B N   1 
ATOM   3976 C CA  . VAL B 1 289 ? 28.206 69.835  13.990  1.00 142.99 ? 330 VAL B CA  1 
ATOM   3977 C C   . VAL B 1 289 ? 27.104 69.147  13.178  1.00 143.40 ? 330 VAL B C   1 
ATOM   3978 O O   . VAL B 1 289 ? 27.068 69.250  11.951  1.00 143.37 ? 330 VAL B O   1 
ATOM   3979 C CB  . VAL B 1 289 ? 27.956 71.362  14.026  1.00 143.87 ? 330 VAL B CB  1 
ATOM   3980 C CG1 . VAL B 1 289 ? 26.850 71.685  15.016  1.00 145.62 ? 330 VAL B CG1 1 
ATOM   3981 C CG2 . VAL B 1 289 ? 29.243 72.095  14.389  1.00 142.17 ? 330 VAL B CG2 1 
ATOM   3982 N N   . ILE B 1 290 ? 26.209 68.442  13.861  1.00 142.44 ? 331 ILE B N   1 
ATOM   3983 C CA  . ILE B 1 290 ? 25.136 67.738  13.175  1.00 143.44 ? 331 ILE B CA  1 
ATOM   3984 C C   . ILE B 1 290 ? 23.780 67.949  13.843  1.00 145.57 ? 331 ILE B C   1 
ATOM   3985 O O   . ILE B 1 290 ? 23.668 67.897  15.070  1.00 146.00 ? 331 ILE B O   1 
ATOM   3986 C CB  . ILE B 1 290 ? 25.416 66.221  13.124  1.00 142.21 ? 331 ILE B CB  1 
ATOM   3987 C CG1 . ILE B 1 290 ? 24.465 65.549  12.135  1.00 141.77 ? 331 ILE B CG1 1 
ATOM   3988 C CG2 . ILE B 1 290 ? 25.216 65.605  14.502  1.00 143.28 ? 331 ILE B CG2 1 
ATOM   3989 C CD1 . ILE B 1 290 ? 24.588 64.041  12.092  1.00 141.33 ? 331 ILE B CD1 1 
ATOM   3990 N N   . PRO B 1 291 ? 22.731 68.201  13.038  1.00 147.09 ? 332 PRO B N   1 
ATOM   3991 C CA  . PRO B 1 291 ? 21.373 68.414  13.554  1.00 147.09 ? 332 PRO B CA  1 
ATOM   3992 C C   . PRO B 1 291 ? 20.646 67.082  13.775  1.00 147.97 ? 332 PRO B C   1 
ATOM   3993 O O   . PRO B 1 291 ? 20.328 66.377  12.816  1.00 145.99 ? 332 PRO B O   1 
ATOM   3994 C CB  . PRO B 1 291 ? 20.727 69.255  12.459  1.00 146.50 ? 332 PRO B CB  1 
ATOM   3995 C CG  . PRO B 1 291 ? 21.348 68.696  11.215  1.00 144.95 ? 332 PRO B CG  1 
ATOM   3996 C CD  . PRO B 1 291 ? 22.808 68.552  11.606  1.00 145.64 ? 332 PRO B CD  1 
ATOM   3997 N N   . VAL B 1 292 ? 20.389 66.741  15.037  1.00 149.64 ? 333 VAL B N   1 
ATOM   3998 C CA  . VAL B 1 292 ? 19.707 65.490  15.365  1.00 150.59 ? 333 VAL B CA  1 
ATOM   3999 C C   . VAL B 1 292 ? 18.224 65.518  14.992  1.00 152.09 ? 333 VAL B C   1 
ATOM   4000 O O   . VAL B 1 292 ? 17.478 66.410  15.402  1.00 152.07 ? 333 VAL B O   1 
ATOM   4001 C CB  . VAL B 1 292 ? 19.838 65.148  16.874  1.00 149.66 ? 333 VAL B CB  1 
ATOM   4002 C CG1 . VAL B 1 292 ? 21.303 64.973  17.237  1.00 149.17 ? 333 VAL B CG1 1 
ATOM   4003 C CG2 . VAL B 1 292 ? 19.204 66.239  17.722  1.00 148.18 ? 333 VAL B CG2 1 
ATOM   4004 N N   . LEU B 1 303 ? 17.702 70.892  16.740  1.00 165.31 ? 344 LEU B N   1 
ATOM   4005 C CA  . LEU B 1 303 ? 18.827 70.663  17.641  1.00 167.13 ? 344 LEU B CA  1 
ATOM   4006 C C   . LEU B 1 303 ? 20.126 70.511  16.855  1.00 167.84 ? 344 LEU B C   1 
ATOM   4007 O O   . LEU B 1 303 ? 20.108 70.172  15.670  1.00 168.73 ? 344 LEU B O   1 
ATOM   4008 C CB  . LEU B 1 303 ? 18.577 69.414  18.485  1.00 165.74 ? 344 LEU B CB  1 
ATOM   4009 N N   . GLN B 1 304 ? 21.253 70.763  17.516  1.00 167.33 ? 345 GLN B N   1 
ATOM   4010 C CA  . GLN B 1 304 ? 22.552 70.649  16.864  1.00 167.08 ? 345 GLN B CA  1 
ATOM   4011 C C   . GLN B 1 304 ? 23.609 70.057  17.794  1.00 167.46 ? 345 GLN B C   1 
ATOM   4012 O O   . GLN B 1 304 ? 23.962 70.653  18.812  1.00 166.92 ? 345 GLN B O   1 
ATOM   4013 C CB  . GLN B 1 304 ? 23.005 72.016  16.357  1.00 165.48 ? 345 GLN B CB  1 
ATOM   4014 N N   . VAL B 1 305 ? 24.103 68.875  17.431  1.00 167.43 ? 346 VAL B N   1 
ATOM   4015 C CA  . VAL B 1 305 ? 25.128 68.177  18.203  1.00 165.12 ? 346 VAL B CA  1 
ATOM   4016 C C   . VAL B 1 305 ? 26.343 67.942  17.311  1.00 164.34 ? 346 VAL B C   1 
ATOM   4017 O O   . VAL B 1 305 ? 26.198 67.713  16.114  1.00 163.07 ? 346 VAL B O   1 
ATOM   4018 C CB  . VAL B 1 305 ? 24.632 66.796  18.691  1.00 163.43 ? 346 VAL B CB  1 
ATOM   4019 C CG1 . VAL B 1 305 ? 25.684 66.153  19.576  1.00 162.09 ? 346 VAL B CG1 1 
ATOM   4020 C CG2 . VAL B 1 305 ? 23.319 66.938  19.433  1.00 162.91 ? 346 VAL B CG2 1 
ATOM   4021 N N   . THR B 1 306 ? 27.539 68.006  17.888  1.00 163.69 ? 347 THR B N   1 
ATOM   4022 C CA  . THR B 1 306 ? 28.759 67.766  17.122  1.00 163.26 ? 347 THR B CA  1 
ATOM   4023 C C   . THR B 1 306 ? 29.253 66.354  17.449  1.00 162.81 ? 347 THR B C   1 
ATOM   4024 O O   . THR B 1 306 ? 29.152 65.903  18.594  1.00 162.09 ? 347 THR B O   1 
ATOM   4025 C CB  . THR B 1 306 ? 29.867 68.802  17.459  1.00 163.30 ? 347 THR B CB  1 
ATOM   4026 O OG1 . THR B 1 306 ? 30.147 68.772  18.862  1.00 165.09 ? 347 THR B OG1 1 
ATOM   4027 C CG2 . THR B 1 306 ? 29.426 70.204  17.073  1.00 161.70 ? 347 THR B CG2 1 
ATOM   4028 N N   . ILE B 1 307 ? 29.770 65.657  16.440  1.00 162.51 ? 348 ILE B N   1 
ATOM   4029 C CA  . ILE B 1 307 ? 30.260 64.289  16.609  1.00 161.56 ? 348 ILE B CA  1 
ATOM   4030 C C   . ILE B 1 307 ? 31.599 64.186  17.337  1.00 160.79 ? 348 ILE B C   1 
ATOM   4031 O O   . ILE B 1 307 ? 32.446 65.075  17.254  1.00 160.56 ? 348 ILE B O   1 
ATOM   4032 C CB  . ILE B 1 307 ? 30.373 63.558  15.231  1.00 162.20 ? 348 ILE B CB  1 
ATOM   4033 C CG1 . ILE B 1 307 ? 29.001 63.037  14.798  1.00 161.68 ? 348 ILE B CG1 1 
ATOM   4034 C CG2 . ILE B 1 307 ? 31.345 62.388  15.316  1.00 161.88 ? 348 ILE B CG2 1 
ATOM   4035 C CD1 . ILE B 1 307 ? 28.004 64.112  14.472  1.00 161.50 ? 348 ILE B CD1 1 
ATOM   4036 N N   . GLN B 1 308 ? 31.766 63.082  18.057  1.00 160.37 ? 349 GLN B N   1 
ATOM   4037 C CA  . GLN B 1 308 ? 32.983 62.799  18.806  1.00 159.95 ? 349 GLN B CA  1 
ATOM   4038 C C   . GLN B 1 308 ? 33.498 61.457  18.291  1.00 159.11 ? 349 GLN B C   1 
ATOM   4039 O O   . GLN B 1 308 ? 32.833 60.806  17.486  1.00 159.63 ? 349 GLN B O   1 
ATOM   4040 C CB  . GLN B 1 308 ? 32.661 62.701  20.297  1.00 160.48 ? 349 GLN B CB  1 
ATOM   4041 C CG  . GLN B 1 308 ? 31.959 63.930  20.856  1.00 161.35 ? 349 GLN B CG  1 
ATOM   4042 C CD  . GLN B 1 308 ? 31.329 63.677  22.212  1.00 162.27 ? 349 GLN B CD  1 
ATOM   4043 O OE1 . GLN B 1 308 ? 30.419 62.854  22.344  1.00 162.44 ? 349 GLN B OE1 1 
ATOM   4044 N NE2 . GLN B 1 308 ? 31.810 64.384  23.229  1.00 160.78 ? 349 GLN B NE2 1 
ATOM   4045 N N   . GLU B 1 309 ? 34.674 61.039  18.743  1.00 157.29 ? 350 GLU B N   1 
ATOM   4046 C CA  . GLU B 1 309 ? 35.218 59.767  18.292  1.00 156.20 ? 350 GLU B CA  1 
ATOM   4047 C C   . GLU B 1 309 ? 34.824 58.665  19.266  1.00 156.92 ? 350 GLU B C   1 
ATOM   4048 O O   . GLU B 1 309 ? 34.847 58.861  20.479  1.00 156.42 ? 350 GLU B O   1 
ATOM   4049 C CB  . GLU B 1 309 ? 36.744 59.841  18.169  1.00 154.57 ? 350 GLU B CB  1 
ATOM   4050 C CG  . GLU B 1 309 ? 37.345 58.698  17.353  1.00 154.56 ? 350 GLU B CG  1 
ATOM   4051 C CD  . GLU B 1 309 ? 38.858 58.763  17.251  1.00 152.97 ? 350 GLU B CD  1 
ATOM   4052 O OE1 . GLU B 1 309 ? 39.385 59.812  16.826  1.00 151.56 ? 350 GLU B OE1 1 
ATOM   4053 O OE2 . GLU B 1 309 ? 39.521 57.759  17.588  1.00 151.11 ? 350 GLU B OE2 1 
ATOM   4054 N N   . TYR B 1 310 ? 34.453 57.510  18.724  1.00 157.95 ? 351 TYR B N   1 
ATOM   4055 C CA  . TYR B 1 310 ? 34.052 56.369  19.538  1.00 159.28 ? 351 TYR B CA  1 
ATOM   4056 C C   . TYR B 1 310 ? 35.121 56.061  20.588  1.00 158.47 ? 351 TYR B C   1 
ATOM   4057 O O   . TYR B 1 310 ? 36.300 55.925  20.258  1.00 158.10 ? 351 TYR B O   1 
ATOM   4058 C CB  . TYR B 1 310 ? 33.827 55.152  18.637  1.00 163.38 ? 351 TYR B CB  1 
ATOM   4059 C CG  . TYR B 1 310 ? 33.342 53.919  19.366  1.00 167.64 ? 351 TYR B CG  1 
ATOM   4060 C CD1 . TYR B 1 310 ? 32.096 53.898  19.996  1.00 168.18 ? 351 TYR B CD1 1 
ATOM   4061 C CD2 . TYR B 1 310 ? 34.135 52.772  19.433  1.00 169.73 ? 351 TYR B CD2 1 
ATOM   4062 C CE1 . TYR B 1 310 ? 31.654 52.761  20.677  1.00 171.02 ? 351 TYR B CE1 1 
ATOM   4063 C CE2 . TYR B 1 310 ? 33.705 51.633  20.109  1.00 170.27 ? 351 TYR B CE2 1 
ATOM   4064 C CZ  . TYR B 1 310 ? 32.466 51.632  20.729  1.00 171.38 ? 351 TYR B CZ  1 
ATOM   4065 O OH  . TYR B 1 310 ? 32.053 50.503  21.402  1.00 171.55 ? 351 TYR B OH  1 
ATOM   4066 N N   . PRO B 1 311 ? 34.717 55.950  21.871  1.00 158.66 ? 352 PRO B N   1 
ATOM   4067 C CA  . PRO B 1 311 ? 35.603 55.661  23.010  1.00 157.57 ? 352 PRO B CA  1 
ATOM   4068 C C   . PRO B 1 311 ? 36.344 54.323  22.956  1.00 156.30 ? 352 PRO B C   1 
ATOM   4069 O O   . PRO B 1 311 ? 35.790 53.302  22.546  1.00 154.11 ? 352 PRO B O   1 
ATOM   4070 C CB  . PRO B 1 311 ? 34.664 55.762  24.213  1.00 157.55 ? 352 PRO B CB  1 
ATOM   4071 C CG  . PRO B 1 311 ? 33.339 55.364  23.643  1.00 158.17 ? 352 PRO B CG  1 
ATOM   4072 C CD  . PRO B 1 311 ? 33.323 56.103  22.328  1.00 158.21 ? 352 PRO B CD  1 
ATOM   4073 N N   . ALA B 1 312 ? 37.602 54.345  23.389  1.00 156.34 ? 353 ALA B N   1 
ATOM   4074 C CA  . ALA B 1 312 ? 38.463 53.164  23.390  1.00 157.42 ? 353 ALA B CA  1 
ATOM   4075 C C   . ALA B 1 312 ? 37.941 52.011  24.239  1.00 157.27 ? 353 ALA B C   1 
ATOM   4076 O O   . ALA B 1 312 ? 36.846 52.144  24.824  1.00 157.56 ? 353 ALA B O   1 
ATOM   4077 C CB  . ALA B 1 312 ? 39.864 53.549  23.855  1.00 157.85 ? 353 ALA B CB  1 
ATOM   4078 N N   . MET C 1 1   ? 20.909 19.544  -17.757 1.00 80.25  ? 42  MET C N   1 
ATOM   4079 C CA  . MET C 1 1   ? 22.080 19.501  -16.840 1.00 76.55  ? 42  MET C CA  1 
ATOM   4080 C C   . MET C 1 1   ? 22.132 18.176  -16.083 1.00 75.12  ? 42  MET C C   1 
ATOM   4081 O O   . MET C 1 1   ? 21.086 17.575  -15.822 1.00 71.04  ? 42  MET C O   1 
ATOM   4082 C CB  . MET C 1 1   ? 21.966 20.621  -15.820 1.00 84.06  ? 42  MET C CB  1 
ATOM   4083 C CG  . MET C 1 1   ? 21.329 21.887  -16.335 1.00 91.46  ? 42  MET C CG  1 
ATOM   4084 S SD  . MET C 1 1   ? 20.644 22.788  -14.930 1.00 103.60 ? 42  MET C SD  1 
ATOM   4085 C CE  . MET C 1 1   ? 22.160 22.969  -13.915 1.00 99.36  ? 42  MET C CE  1 
ATOM   4086 N N   . THR C 1 2   ? 23.348 17.720  -15.753 1.00 71.18  ? 43  THR C N   1 
ATOM   4087 C CA  . THR C 1 2   ? 23.538 16.491  -14.970 1.00 63.57  ? 43  THR C CA  1 
ATOM   4088 C C   . THR C 1 2   ? 24.241 16.879  -13.669 1.00 57.92  ? 43  THR C C   1 
ATOM   4089 O O   . THR C 1 2   ? 24.963 17.878  -13.601 1.00 57.05  ? 43  THR C O   1 
ATOM   4090 C CB  . THR C 1 2   ? 24.413 15.384  -15.682 1.00 67.69  ? 43  THR C CB  1 
ATOM   4091 O OG1 . THR C 1 2   ? 25.665 15.932  -16.115 1.00 67.28  ? 43  THR C OG1 1 
ATOM   4092 C CG2 . THR C 1 2   ? 23.674 14.773  -16.833 1.00 67.83  ? 43  THR C CG2 1 
ATOM   4093 N N   . PRO C 1 3   ? 24.038 16.088  -12.618 1.00 50.74  ? 44  PRO C N   1 
ATOM   4094 C CA  . PRO C 1 3   ? 24.671 16.389  -11.324 1.00 54.42  ? 44  PRO C CA  1 
ATOM   4095 C C   . PRO C 1 3   ? 26.181 16.440  -11.495 1.00 50.80  ? 44  PRO C C   1 
ATOM   4096 O O   . PRO C 1 3   ? 26.730 15.612  -12.216 1.00 49.96  ? 44  PRO C O   1 
ATOM   4097 C CB  . PRO C 1 3   ? 24.241 15.216  -10.440 1.00 45.74  ? 44  PRO C CB  1 
ATOM   4098 C CG  . PRO C 1 3   ? 22.930 14.811  -11.025 1.00 55.72  ? 44  PRO C CG  1 
ATOM   4099 C CD  . PRO C 1 3   ? 23.157 14.913  -12.533 1.00 46.91  ? 44  PRO C CD  1 
ATOM   4100 N N   . ALA C 1 4   ? 26.842 17.412  -10.870 1.00 37.78  ? 45  ALA C N   1 
ATOM   4101 C CA  . ALA C 1 4   ? 28.299 17.479  -10.955 1.00 43.72  ? 45  ALA C CA  1 
ATOM   4102 C C   . ALA C 1 4   ? 28.846 16.208  -10.272 1.00 49.63  ? 45  ALA C C   1 
ATOM   4103 O O   . ALA C 1 4   ? 28.337 15.787  -9.222  1.00 55.62  ? 45  ALA C O   1 
ATOM   4104 C CB  . ALA C 1 4   ? 28.802 18.745  -10.271 1.00 37.44  ? 45  ALA C CB  1 
ATOM   4105 N N   . SER C 1 5   ? 29.864 15.571  -10.840 1.00 52.23  ? 46  SER C N   1 
ATOM   4106 C CA  . SER C 1 5   ? 30.321 14.316  -10.228 1.00 49.89  ? 46  SER C CA  1 
ATOM   4107 C C   . SER C 1 5   ? 31.689 13.811  -10.561 1.00 51.37  ? 46  SER C C   1 
ATOM   4108 O O   . SER C 1 5   ? 32.193 14.033  -11.660 1.00 63.69  ? 46  SER C O   1 
ATOM   4109 C CB  . SER C 1 5   ? 29.358 13.195  -10.587 1.00 45.14  ? 46  SER C CB  1 
ATOM   4110 O OG  . SER C 1 5   ? 29.756 11.964  -9.987  1.00 52.96  ? 46  SER C OG  1 
ATOM   4111 N N   . TYR C 1 6   ? 32.281 13.085  -9.625  1.00 49.05  ? 47  TYR C N   1 
ATOM   4112 C CA  . TYR C 1 6   ? 33.586 12.490  -9.874  1.00 46.46  ? 47  TYR C CA  1 
ATOM   4113 C C   . TYR C 1 6   ? 33.448 10.984  -9.958  1.00 44.09  ? 47  TYR C C   1 
ATOM   4114 O O   . TYR C 1 6   ? 34.412 10.254  -9.821  1.00 46.73  ? 47  TYR C O   1 
ATOM   4115 C CB  . TYR C 1 6   ? 34.589 12.855  -8.796  1.00 55.83  ? 47  TYR C CB  1 
ATOM   4116 C CG  . TYR C 1 6   ? 34.729 14.332  -8.614  1.00 51.49  ? 47  TYR C CG  1 
ATOM   4117 C CD1 . TYR C 1 6   ? 34.030 14.991  -7.604  1.00 49.46  ? 47  TYR C CD1 1 
ATOM   4118 C CD2 . TYR C 1 6   ? 35.505 15.087  -9.491  1.00 54.10  ? 47  TYR C CD2 1 
ATOM   4119 C CE1 . TYR C 1 6   ? 34.096 16.385  -7.472  1.00 49.88  ? 47  TYR C CE1 1 
ATOM   4120 C CE2 . TYR C 1 6   ? 35.575 16.490  -9.370  1.00 52.14  ? 47  TYR C CE2 1 
ATOM   4121 C CZ  . TYR C 1 6   ? 34.866 17.124  -8.358  1.00 50.80  ? 47  TYR C CZ  1 
ATOM   4122 O OH  . TYR C 1 6   ? 34.922 18.493  -8.227  1.00 65.16  ? 47  TYR C OH  1 
ATOM   4123 N N   . ASN C 1 7   ? 32.237 10.517  -10.205 1.00 41.78  ? 48  ASN C N   1 
ATOM   4124 C CA  . ASN C 1 7   ? 32.018 9.102   -10.342 1.00 47.69  ? 48  ASN C CA  1 
ATOM   4125 C C   . ASN C 1 7   ? 32.983 8.447   -11.352 1.00 56.91  ? 48  ASN C C   1 
ATOM   4126 O O   . ASN C 1 7   ? 33.408 7.299   -11.162 1.00 51.43  ? 48  ASN C O   1 
ATOM   4127 C CB  . ASN C 1 7   ? 30.594 8.855   -10.794 1.00 52.12  ? 48  ASN C CB  1 
ATOM   4128 C CG  . ASN C 1 7   ? 30.273 7.395   -10.864 1.00 48.90  ? 48  ASN C CG  1 
ATOM   4129 O OD1 . ASN C 1 7   ? 30.148 6.836   -11.945 1.00 56.88  ? 48  ASN C OD1 1 
ATOM   4130 N ND2 . ASN C 1 7   ? 30.152 6.755   -9.695  1.00 60.18  ? 48  ASN C ND2 1 
ATOM   4131 N N   . LEU C 1 8   ? 33.296 9.157   -12.439 1.00 56.03  ? 49  LEU C N   1 
ATOM   4132 C CA  . LEU C 1 8   ? 34.211 8.626   -13.425 1.00 57.21  ? 49  LEU C CA  1 
ATOM   4133 C C   . LEU C 1 8   ? 35.553 8.280   -12.758 1.00 59.06  ? 49  LEU C C   1 
ATOM   4134 O O   . LEU C 1 8   ? 36.096 7.202   -12.977 1.00 60.82  ? 49  LEU C O   1 
ATOM   4135 C CB  . LEU C 1 8   ? 34.443 9.627   -14.548 1.00 64.84  ? 49  LEU C CB  1 
ATOM   4136 C CG  . LEU C 1 8   ? 35.415 9.091   -15.608 1.00 69.75  ? 49  LEU C CG  1 
ATOM   4137 C CD1 . LEU C 1 8   ? 34.872 7.796   -16.175 1.00 71.55  ? 49  LEU C CD1 1 
ATOM   4138 C CD2 . LEU C 1 8   ? 35.607 10.102  -16.709 1.00 70.74  ? 49  LEU C CD2 1 
ATOM   4139 N N   . ALA C 1 9   ? 36.099 9.190   -11.958 1.00 53.46  ? 50  ALA C N   1 
ATOM   4140 C CA  . ALA C 1 9   ? 37.344 8.899   -11.270 1.00 53.80  ? 50  ALA C CA  1 
ATOM   4141 C C   . ALA C 1 9   ? 37.119 7.700   -10.313 1.00 56.51  ? 50  ALA C C   1 
ATOM   4142 O O   . ALA C 1 9   ? 38.043 6.911   -10.020 1.00 52.30  ? 50  ALA C O   1 
ATOM   4143 C CB  . ALA C 1 9   ? 37.811 10.117  -10.488 1.00 53.84  ? 50  ALA C CB  1 
ATOM   4144 N N   . VAL C 1 10  ? 35.888 7.535   -9.842  1.00 51.61  ? 51  VAL C N   1 
ATOM   4145 C CA  . VAL C 1 10  ? 35.626 6.433   -8.928  1.00 51.73  ? 51  VAL C CA  1 
ATOM   4146 C C   . VAL C 1 10  ? 35.593 5.109   -9.671  1.00 48.51  ? 51  VAL C C   1 
ATOM   4147 O O   . VAL C 1 10  ? 36.248 4.145   -9.287  1.00 56.68  ? 51  VAL C O   1 
ATOM   4148 C CB  . VAL C 1 10  ? 34.298 6.652   -8.129  1.00 47.73  ? 51  VAL C CB  1 
ATOM   4149 C CG1 . VAL C 1 10  ? 33.975 5.425   -7.256  1.00 44.04  ? 51  VAL C CG1 1 
ATOM   4150 C CG2 . VAL C 1 10  ? 34.442 7.878   -7.244  1.00 49.91  ? 51  VAL C CG2 1 
ATOM   4151 N N   . ARG C 1 11  ? 34.864 5.069   -10.762 1.00 53.14  ? 52  ARG C N   1 
ATOM   4152 C CA  . ARG C 1 11  ? 34.739 3.838   -11.515 1.00 51.76  ? 52  ARG C CA  1 
ATOM   4153 C C   . ARG C 1 11  ? 36.062 3.364   -12.051 1.00 46.76  ? 52  ARG C C   1 
ATOM   4154 O O   . ARG C 1 11  ? 36.367 2.158   -12.059 1.00 54.58  ? 52  ARG C O   1 
ATOM   4155 C CB  . ARG C 1 11  ? 33.737 4.025   -12.666 1.00 52.48  ? 52  ARG C CB  1 
ATOM   4156 C CG  . ARG C 1 11  ? 32.273 4.237   -12.185 1.00 56.77  ? 52  ARG C CG  1 
ATOM   4157 C CD  . ARG C 1 11  ? 31.318 4.271   -13.355 1.00 62.35  ? 52  ARG C CD  1 
ATOM   4158 N NE  . ARG C 1 11  ? 31.932 4.876   -14.544 1.00 72.04  ? 52  ARG C NE  1 
ATOM   4159 C CZ  . ARG C 1 11  ? 31.530 6.012   -15.119 1.00 80.66  ? 52  ARG C CZ  1 
ATOM   4160 N NH1 . ARG C 1 11  ? 30.502 6.701   -14.627 1.00 77.66  ? 52  ARG C NH1 1 
ATOM   4161 N NH2 . ARG C 1 11  ? 32.158 6.462   -16.201 1.00 86.44  ? 52  ARG C NH2 1 
ATOM   4162 N N   . ARG C 1 12  ? 36.858 4.317   -12.499 1.00 52.53  ? 53  ARG C N   1 
ATOM   4163 C CA  . ARG C 1 12  ? 38.151 4.019   -13.083 1.00 48.86  ? 53  ARG C CA  1 
ATOM   4164 C C   . ARG C 1 12  ? 39.180 3.545   -12.085 1.00 52.40  ? 53  ARG C C   1 
ATOM   4165 O O   . ARG C 1 12  ? 39.929 2.601   -12.353 1.00 58.02  ? 53  ARG C O   1 
ATOM   4166 C CB  . ARG C 1 12  ? 38.685 5.264   -13.799 1.00 52.40  ? 53  ARG C CB  1 
ATOM   4167 C CG  . ARG C 1 12  ? 38.573 5.217   -15.295 1.00 61.89  ? 53  ARG C CG  1 
ATOM   4168 C CD  . ARG C 1 12  ? 38.920 6.548   -15.955 1.00 70.68  ? 53  ARG C CD  1 
ATOM   4169 N NE  . ARG C 1 12  ? 40.349 6.872   -16.130 1.00 83.75  ? 53  ARG C NE  1 
ATOM   4170 C CZ  . ARG C 1 12  ? 41.295 6.052   -16.605 1.00 84.94  ? 53  ARG C CZ  1 
ATOM   4171 N NH1 . ARG C 1 12  ? 41.008 4.797   -16.952 1.00 79.60  ? 53  ARG C NH1 1 
ATOM   4172 N NH2 . ARG C 1 12  ? 42.529 6.518   -16.798 1.00 73.98  ? 53  ARG C NH2 1 
ATOM   4173 N N   . ALA C 1 13  ? 39.220 4.193   -10.928 1.00 54.83  ? 54  ALA C N   1 
ATOM   4174 C CA  . ALA C 1 13  ? 40.224 3.865   -9.939  1.00 52.04  ? 54  ALA C CA  1 
ATOM   4175 C C   . ALA C 1 13  ? 39.866 3.003   -8.736  1.00 54.60  ? 54  ALA C C   1 
ATOM   4176 O O   . ALA C 1 13  ? 40.610 2.109   -8.387  1.00 60.34  ? 54  ALA C O   1 
ATOM   4177 C CB  . ALA C 1 13  ? 40.850 5.139   -9.474  1.00 48.23  ? 54  ALA C CB  1 
ATOM   4178 N N   . ALA C 1 14  ? 38.732 3.250   -8.103  1.00 63.44  ? 55  ALA C N   1 
ATOM   4179 C CA  . ALA C 1 14  ? 38.356 2.524   -6.876  1.00 58.08  ? 55  ALA C CA  1 
ATOM   4180 C C   . ALA C 1 14  ? 38.492 0.991   -6.831  1.00 56.98  ? 55  ALA C C   1 
ATOM   4181 O O   . ALA C 1 14  ? 38.889 0.436   -5.808  1.00 59.77  ? 55  ALA C O   1 
ATOM   4182 C CB  . ALA C 1 14  ? 36.933 2.937   -6.455  1.00 51.23  ? 55  ALA C CB  1 
ATOM   4183 N N   . PRO C 1 15  ? 38.167 0.289   -7.936  1.00 59.06  ? 56  PRO C N   1 
ATOM   4184 C CA  . PRO C 1 15  ? 38.270 -1.186  -7.965  1.00 54.78  ? 56  PRO C CA  1 
ATOM   4185 C C   . PRO C 1 15  ? 39.661 -1.733  -7.623  1.00 55.57  ? 56  PRO C C   1 
ATOM   4186 O O   . PRO C 1 15  ? 39.806 -2.855  -7.100  1.00 50.71  ? 56  PRO C O   1 
ATOM   4187 C CB  . PRO C 1 15  ? 37.863 -1.526  -9.393  1.00 47.95  ? 56  PRO C CB  1 
ATOM   4188 C CG  . PRO C 1 15  ? 36.838 -0.439  -9.696  1.00 49.86  ? 56  PRO C CG  1 
ATOM   4189 C CD  . PRO C 1 15  ? 37.575 0.798   -9.193  1.00 45.07  ? 56  PRO C CD  1 
ATOM   4190 N N   . ALA C 1 16  ? 40.668 -0.919  -7.924  1.00 47.20  ? 57  ALA C N   1 
ATOM   4191 C CA  . ALA C 1 16  ? 42.044 -1.261  -7.683  1.00 43.48  ? 57  ALA C CA  1 
ATOM   4192 C C   . ALA C 1 16  ? 42.486 -0.871  -6.307  1.00 52.30  ? 57  ALA C C   1 
ATOM   4193 O O   . ALA C 1 16  ? 43.647 -1.114  -5.943  1.00 54.98  ? 57  ALA C O   1 
ATOM   4194 C CB  . ALA C 1 16  ? 42.918 -0.580  -8.669  1.00 46.25  ? 57  ALA C CB  1 
ATOM   4195 N N   . VAL C 1 17  ? 41.616 -0.230  -5.530  1.00 53.51  ? 58  VAL C N   1 
ATOM   4196 C CA  . VAL C 1 17  ? 42.074 0.115   -4.195  1.00 59.08  ? 58  VAL C CA  1 
ATOM   4197 C C   . VAL C 1 17  ? 41.557 -0.968  -3.312  1.00 57.02  ? 58  VAL C C   1 
ATOM   4198 O O   . VAL C 1 17  ? 40.373 -1.268  -3.322  1.00 65.21  ? 58  VAL C O   1 
ATOM   4199 C CB  . VAL C 1 17  ? 41.615 1.512   -3.739  1.00 52.92  ? 58  VAL C CB  1 
ATOM   4200 C CG1 . VAL C 1 17  ? 42.191 1.826   -2.344  1.00 55.35  ? 58  VAL C CG1 1 
ATOM   4201 C CG2 . VAL C 1 17  ? 42.167 2.548   -4.709  1.00 52.79  ? 58  VAL C CG2 1 
ATOM   4202 N N   . VAL C 1 18  ? 42.464 -1.578  -2.565  1.00 56.54  ? 59  VAL C N   1 
ATOM   4203 C CA  . VAL C 1 18  ? 42.105 -2.703  -1.705  1.00 53.97  ? 59  VAL C CA  1 
ATOM   4204 C C   . VAL C 1 18  ? 42.301 -2.439  -0.215  1.00 53.13  ? 59  VAL C C   1 
ATOM   4205 O O   . VAL C 1 18  ? 43.072 -1.543  0.194   1.00 50.23  ? 59  VAL C O   1 
ATOM   4206 C CB  . VAL C 1 18  ? 42.980 -3.947  -2.061  1.00 58.38  ? 59  VAL C CB  1 
ATOM   4207 C CG1 . VAL C 1 18  ? 43.005 -4.187  -3.602  1.00 41.13  ? 59  VAL C CG1 1 
ATOM   4208 C CG2 . VAL C 1 18  ? 44.407 -3.725  -1.534  1.00 48.52  ? 59  VAL C CG2 1 
ATOM   4209 N N   . ASN C 1 19  ? 41.626 -3.261  0.583   1.00 51.71  ? 60  ASN C N   1 
ATOM   4210 C CA  . ASN C 1 19  ? 41.733 -3.194  2.033   1.00 54.69  ? 60  ASN C CA  1 
ATOM   4211 C C   . ASN C 1 19  ? 42.873 -4.102  2.494   1.00 60.86  ? 60  ASN C C   1 
ATOM   4212 O O   . ASN C 1 19  ? 42.971 -5.260  2.079   1.00 64.78  ? 60  ASN C O   1 
ATOM   4213 C CB  . ASN C 1 19  ? 40.430 -3.648  2.685   1.00 53.99  ? 60  ASN C CB  1 
ATOM   4214 C CG  . ASN C 1 19  ? 39.265 -2.755  2.311   1.00 61.56  ? 60  ASN C CG  1 
ATOM   4215 O OD1 . ASN C 1 19  ? 39.454 -1.574  1.989   1.00 57.36  ? 60  ASN C OD1 1 
ATOM   4216 N ND2 . ASN C 1 19  ? 38.058 -3.302  2.351   1.00 60.14  ? 60  ASN C ND2 1 
ATOM   4217 N N   . VAL C 1 20  ? 43.738 -3.574  3.348   1.00 59.30  ? 61  VAL C N   1 
ATOM   4218 C CA  . VAL C 1 20  ? 44.846 -4.351  3.846   1.00 60.16  ? 61  VAL C CA  1 
ATOM   4219 C C   . VAL C 1 20  ? 44.772 -4.618  5.345   1.00 66.47  ? 61  VAL C C   1 
ATOM   4220 O O   . VAL C 1 20  ? 44.596 -3.712  6.153   1.00 69.26  ? 61  VAL C O   1 
ATOM   4221 C CB  . VAL C 1 20  ? 46.170 -3.661  3.524   1.00 58.08  ? 61  VAL C CB  1 
ATOM   4222 C CG1 . VAL C 1 20  ? 47.329 -4.362  4.271   1.00 51.63  ? 61  VAL C CG1 1 
ATOM   4223 C CG2 . VAL C 1 20  ? 46.390 -3.697  2.026   1.00 54.96  ? 61  VAL C CG2 1 
ATOM   4224 N N   . TYR C 1 21  ? 44.922 -5.883  5.707   1.00 72.43  ? 62  TYR C N   1 
ATOM   4225 C CA  . TYR C 1 21  ? 44.883 -6.288  7.100   1.00 70.33  ? 62  TYR C CA  1 
ATOM   4226 C C   . TYR C 1 21  ? 46.202 -6.916  7.569   1.00 69.11  ? 62  TYR C C   1 
ATOM   4227 O O   . TYR C 1 21  ? 46.626 -7.953  7.064   1.00 70.94  ? 62  TYR C O   1 
ATOM   4228 C CB  . TYR C 1 21  ? 43.738 -7.272  7.289   1.00 65.15  ? 62  TYR C CB  1 
ATOM   4229 C CG  . TYR C 1 21  ? 42.443 -6.768  6.707   1.00 76.53  ? 62  TYR C CG  1 
ATOM   4230 C CD1 . TYR C 1 21  ? 42.065 -7.102  5.410   1.00 70.96  ? 62  TYR C CD1 1 
ATOM   4231 C CD2 . TYR C 1 21  ? 41.590 -5.941  7.455   1.00 77.52  ? 62  TYR C CD2 1 
ATOM   4232 C CE1 . TYR C 1 21  ? 40.863 -6.633  4.869   1.00 74.48  ? 62  TYR C CE1 1 
ATOM   4233 C CE2 . TYR C 1 21  ? 40.386 -5.458  6.917   1.00 77.15  ? 62  TYR C CE2 1 
ATOM   4234 C CZ  . TYR C 1 21  ? 40.027 -5.812  5.624   1.00 75.68  ? 62  TYR C CZ  1 
ATOM   4235 O OH  . TYR C 1 21  ? 38.831 -5.363  5.088   1.00 76.04  ? 62  TYR C OH  1 
ATOM   4236 N N   . ASN C 1 22  ? 46.841 -6.281  8.538   1.00 65.40  ? 63  ASN C N   1 
ATOM   4237 C CA  . ASN C 1 22  ? 48.084 -6.779  9.109   1.00 62.49  ? 63  ASN C CA  1 
ATOM   4238 C C   . ASN C 1 22  ? 47.768 -7.632  10.351  1.00 66.88  ? 63  ASN C C   1 
ATOM   4239 O O   . ASN C 1 22  ? 47.502 -7.078  11.420  1.00 65.96  ? 63  ASN C O   1 
ATOM   4240 C CB  . ASN C 1 22  ? 48.958 -5.589  9.494   1.00 63.45  ? 63  ASN C CB  1 
ATOM   4241 C CG  . ASN C 1 22  ? 50.077 -5.953  10.448  1.00 65.83  ? 63  ASN C CG  1 
ATOM   4242 O OD1 . ASN C 1 22  ? 50.982 -5.153  10.687  1.00 70.78  ? 63  ASN C OD1 1 
ATOM   4243 N ND2 . ASN C 1 22  ? 50.025 -7.154  11.004  1.00 68.83  ? 63  ASN C ND2 1 
ATOM   4244 N N   . ARG C 1 23  ? 47.819 -8.966  10.207  1.00 70.32  ? 64  ARG C N   1 
ATOM   4245 C CA  . ARG C 1 23  ? 47.538 -9.914  11.302  1.00 70.57  ? 64  ARG C CA  1 
ATOM   4246 C C   . ARG C 1 23  ? 48.795 -10.462 11.969  1.00 68.76  ? 64  ARG C C   1 
ATOM   4247 O O   . ARG C 1 23  ? 49.713 -10.929 11.298  1.00 78.63  ? 64  ARG C O   1 
ATOM   4248 C CB  . ARG C 1 23  ? 46.706 -11.103 10.810  1.00 61.54  ? 64  ARG C CB  1 
ATOM   4249 C CG  . ARG C 1 23  ? 45.566 -10.717 9.913   1.00 73.73  ? 64  ARG C CG  1 
ATOM   4250 C CD  . ARG C 1 23  ? 44.341 -11.613 10.058  1.00 75.18  ? 64  ARG C CD  1 
ATOM   4251 N NE  . ARG C 1 23  ? 44.653 -13.034 10.027  1.00 83.69  ? 64  ARG C NE  1 
ATOM   4252 C CZ  . ARG C 1 23  ? 43.782 -13.984 9.695   1.00 91.23  ? 64  ARG C CZ  1 
ATOM   4253 N NH1 . ARG C 1 23  ? 42.538 -13.664 9.350   1.00 91.70  ? 64  ARG C NH1 1 
ATOM   4254 N NH2 . ARG C 1 23  ? 44.145 -15.263 9.732   1.00 92.15  ? 64  ARG C NH2 1 
ATOM   4255 N N   . GLY C 1 24  ? 48.822 -10.404 13.302  1.00 89.67  ? 65  GLY C N   1 
ATOM   4256 C CA  . GLY C 1 24  ? 49.960 -10.895 14.065  1.00 89.86  ? 65  GLY C CA  1 
ATOM   4257 C C   . GLY C 1 24  ? 49.537 -11.984 15.032  1.00 91.54  ? 65  GLY C C   1 
ATOM   4258 O O   . GLY C 1 24  ? 48.343 -12.264 15.161  1.00 90.88  ? 65  GLY C O   1 
ATOM   4259 N N   . LEU C 1 25  ? 50.516 -12.593 15.704  1.00 96.97  ? 66  LEU C N   1 
ATOM   4260 C CA  . LEU C 1 25  ? 50.295 -13.673 16.684  1.00 100.02 ? 66  LEU C CA  1 
ATOM   4261 C C   . LEU C 1 25  ? 50.200 -13.072 18.070  1.00 102.89 ? 66  LEU C C   1 
ATOM   4262 O O   . LEU C 1 25  ? 51.049 -12.266 18.455  1.00 104.74 ? 66  LEU C O   1 
ATOM   4263 C CB  . LEU C 1 25  ? 51.473 -14.649 16.702  1.00 96.93  ? 66  LEU C CB  1 
ATOM   4264 C CG  . LEU C 1 25  ? 51.857 -15.431 15.454  1.00 93.23  ? 66  LEU C CG  1 
ATOM   4265 C CD1 . LEU C 1 25  ? 53.316 -15.835 15.557  1.00 94.38  ? 66  LEU C CD1 1 
ATOM   4266 C CD2 . LEU C 1 25  ? 50.964 -16.636 15.305  1.00 87.23  ? 66  LEU C CD2 1 
ATOM   4267 N N   . ASN C 1 26  ? 49.204 -13.488 18.840  1.00 107.09 ? 67  ASN C N   1 
ATOM   4268 C CA  . ASN C 1 26  ? 49.035 -12.936 20.179  1.00 112.23 ? 67  ASN C CA  1 
ATOM   4269 C C   . ASN C 1 26  ? 48.930 -13.962 21.313  1.00 112.93 ? 67  ASN C C   1 
ATOM   4270 O O   . ASN C 1 26  ? 48.835 -15.166 21.066  1.00 107.32 ? 67  ASN C O   1 
ATOM   4271 C CB  . ASN C 1 26  ? 47.822 -11.994 20.154  1.00 114.12 ? 67  ASN C CB  1 
ATOM   4272 C CG  . ASN C 1 26  ? 47.121 -11.894 21.486  1.00 114.18 ? 67  ASN C CG  1 
ATOM   4273 O OD1 . ASN C 1 26  ? 46.255 -12.706 21.792  1.00 113.45 ? 67  ASN C OD1 1 
ATOM   4274 N ND2 . ASN C 1 26  ? 47.496 -10.899 22.291  1.00 112.71 ? 67  ASN C ND2 1 
ATOM   4275 N N   . THR C 1 27  ? 48.960 -13.465 22.553  1.00 119.25 ? 68  THR C N   1 
ATOM   4276 C CA  . THR C 1 27  ? 48.872 -14.297 23.763  1.00 125.04 ? 68  THR C CA  1 
ATOM   4277 C C   . THR C 1 27  ? 47.525 -14.202 24.509  1.00 126.67 ? 68  THR C C   1 
ATOM   4278 O O   . THR C 1 27  ? 47.491 -13.988 25.725  1.00 123.80 ? 68  THR C O   1 
ATOM   4279 C CB  . THR C 1 27  ? 50.012 -13.946 24.771  1.00 126.22 ? 68  THR C CB  1 
ATOM   4280 O OG1 . THR C 1 27  ? 49.849 -12.600 25.247  1.00 124.33 ? 68  THR C OG1 1 
ATOM   4281 C CG2 . THR C 1 27  ? 51.385 -14.093 24.100  1.00 125.73 ? 68  THR C CG2 1 
ATOM   4282 N N   . ASN C 1 28  ? 46.424 -14.358 23.775  1.00 130.24 ? 69  ASN C N   1 
ATOM   4283 C CA  . ASN C 1 28  ? 45.079 -14.308 24.355  1.00 135.17 ? 69  ASN C CA  1 
ATOM   4284 C C   . ASN C 1 28  ? 44.679 -15.758 24.557  1.00 138.16 ? 69  ASN C C   1 
ATOM   4285 O O   . ASN C 1 28  ? 43.692 -16.063 25.228  1.00 137.23 ? 69  ASN C O   1 
ATOM   4286 C CB  . ASN C 1 28  ? 44.086 -13.634 23.389  1.00 135.27 ? 69  ASN C CB  1 
ATOM   4287 C CG  . ASN C 1 28  ? 43.587 -12.273 23.885  1.00 132.69 ? 69  ASN C CG  1 
ATOM   4288 O OD1 . ASN C 1 28  ? 44.377 -11.372 24.193  1.00 130.98 ? 69  ASN C OD1 1 
ATOM   4289 N ND2 . ASN C 1 28  ? 42.266 -12.118 23.943  1.00 127.31 ? 69  ASN C ND2 1 
ATOM   4290 N N   . SER C 1 29  ? 45.474 -16.641 23.954  1.00 143.85 ? 70  SER C N   1 
ATOM   4291 C CA  . SER C 1 29  ? 45.280 -18.091 24.015  1.00 150.31 ? 70  SER C CA  1 
ATOM   4292 C C   . SER C 1 29  ? 46.188 -18.723 22.963  1.00 152.49 ? 70  SER C C   1 
ATOM   4293 O O   . SER C 1 29  ? 46.950 -19.651 23.251  1.00 152.76 ? 70  SER C O   1 
ATOM   4294 C CB  . SER C 1 29  ? 43.822 -18.460 23.716  1.00 150.95 ? 70  SER C CB  1 
ATOM   4295 O OG  . SER C 1 29  ? 43.450 -18.061 22.407  1.00 150.22 ? 70  SER C OG  1 
ATOM   4296 N N   . HIS C 1 30  ? 46.085 -18.198 21.744  1.00 153.62 ? 71  HIS C N   1 
ATOM   4297 C CA  . HIS C 1 30  ? 46.871 -18.639 20.595  1.00 154.50 ? 71  HIS C CA  1 
ATOM   4298 C C   . HIS C 1 30  ? 46.310 -17.892 19.390  1.00 153.75 ? 71  HIS C C   1 
ATOM   4299 O O   . HIS C 1 30  ? 46.486 -18.288 18.237  1.00 153.50 ? 71  HIS C O   1 
ATOM   4300 C CB  . HIS C 1 30  ? 46.747 -20.153 20.394  1.00 156.67 ? 71  HIS C CB  1 
ATOM   4301 C CG  . HIS C 1 30  ? 47.788 -20.731 19.486  1.00 161.11 ? 71  HIS C CG  1 
ATOM   4302 N ND1 . HIS C 1 30  ? 49.107 -20.320 19.509  1.00 163.21 ? 71  HIS C ND1 1 
ATOM   4303 C CD2 . HIS C 1 30  ? 47.720 -21.716 18.558  1.00 162.29 ? 71  HIS C CD2 1 
ATOM   4304 C CE1 . HIS C 1 30  ? 49.802 -21.030 18.635  1.00 164.09 ? 71  HIS C CE1 1 
ATOM   4305 N NE2 . HIS C 1 30  ? 48.984 -21.883 18.047  1.00 164.09 ? 71  HIS C NE2 1 
ATOM   4306 N N   . ASN C 1 31  ? 45.625 -16.795 19.685  1.00 152.30 ? 72  ASN C N   1 
ATOM   4307 C CA  . ASN C 1 31  ? 45.027 -15.959 18.659  1.00 150.61 ? 72  ASN C CA  1 
ATOM   4308 C C   . ASN C 1 31  ? 46.127 -15.449 17.729  1.00 149.07 ? 72  ASN C C   1 
ATOM   4309 O O   . ASN C 1 31  ? 46.948 -14.609 18.108  1.00 149.39 ? 72  ASN C O   1 
ATOM   4310 C CB  . ASN C 1 31  ? 44.295 -14.776 19.309  1.00 150.50 ? 72  ASN C CB  1 
ATOM   4311 C CG  . ASN C 1 31  ? 43.408 -15.203 20.464  1.00 148.95 ? 72  ASN C CG  1 
ATOM   4312 O OD1 . ASN C 1 31  ? 43.888 -15.753 21.455  1.00 150.25 ? 72  ASN C OD1 1 
ATOM   4313 N ND2 . ASN C 1 31  ? 42.109 -14.953 20.342  1.00 145.10 ? 72  ASN C ND2 1 
ATOM   4314 N N   . GLN C 1 32  ? 46.143 -15.970 16.509  1.00 146.11 ? 73  GLN C N   1 
ATOM   4315 C CA  . GLN C 1 32  ? 47.139 -15.563 15.528  1.00 144.08 ? 73  GLN C CA  1 
ATOM   4316 C C   . GLN C 1 32  ? 46.479 -14.949 14.304  1.00 138.51 ? 73  GLN C C   1 
ATOM   4317 O O   . GLN C 1 32  ? 47.131 -14.679 13.291  1.00 132.49 ? 73  GLN C O   1 
ATOM   4318 C CB  . GLN C 1 32  ? 48.001 -16.769 15.135  1.00 149.96 ? 73  GLN C CB  1 
ATOM   4319 C CG  . GLN C 1 32  ? 47.262 -18.105 15.017  1.00 152.27 ? 73  GLN C CG  1 
ATOM   4320 C CD  . GLN C 1 32  ? 48.216 -19.285 14.845  1.00 152.17 ? 73  GLN C CD  1 
ATOM   4321 O OE1 . GLN C 1 32  ? 49.007 -19.328 13.899  1.00 153.19 ? 73  GLN C OE1 1 
ATOM   4322 N NE2 . GLN C 1 32  ? 48.144 -20.246 15.760  1.00 150.27 ? 73  GLN C NE2 1 
ATOM   4323 N N   . LEU C 1 33  ? 45.176 -14.722 14.428  1.00 134.91 ? 74  LEU C N   1 
ATOM   4324 C CA  . LEU C 1 33  ? 44.369 -14.154 13.358  1.00 132.93 ? 74  LEU C CA  1 
ATOM   4325 C C   . LEU C 1 33  ? 43.687 -12.850 13.776  1.00 129.78 ? 74  LEU C C   1 
ATOM   4326 O O   . LEU C 1 33  ? 42.635 -12.467 13.243  1.00 132.42 ? 74  LEU C O   1 
ATOM   4327 C CB  . LEU C 1 33  ? 43.332 -15.185 12.900  1.00 134.00 ? 74  LEU C CB  1 
ATOM   4328 C CG  . LEU C 1 33  ? 43.068 -16.348 13.866  1.00 134.38 ? 74  LEU C CG  1 
ATOM   4329 C CD1 . LEU C 1 33  ? 42.378 -15.833 15.122  1.00 133.31 ? 74  LEU C CD1 1 
ATOM   4330 C CD2 . LEU C 1 33  ? 42.213 -17.394 13.170  1.00 133.92 ? 74  LEU C CD2 1 
ATOM   4331 N N   . GLU C 1 34  ? 44.306 -12.165 14.731  1.00 121.92 ? 75  GLU C N   1 
ATOM   4332 C CA  . GLU C 1 34  ? 43.797 -10.889 15.215  1.00 111.81 ? 75  GLU C CA  1 
ATOM   4333 C C   . GLU C 1 34  ? 44.382 -9.764  14.354  1.00 102.70 ? 75  GLU C C   1 
ATOM   4334 O O   . GLU C 1 34  ? 45.558 -9.803  13.979  1.00 97.95  ? 75  GLU C O   1 
ATOM   4335 C CB  . GLU C 1 34  ? 44.197 -10.692 16.691  1.00 110.80 ? 75  GLU C CB  1 
ATOM   4336 N N   . ILE C 1 35  ? 43.564 -8.772  14.025  1.00 92.20  ? 76  ILE C N   1 
ATOM   4337 C CA  . ILE C 1 35  ? 44.063 -7.652  13.240  1.00 84.27  ? 76  ILE C CA  1 
ATOM   4338 C C   . ILE C 1 35  ? 45.012 -6.903  14.169  1.00 81.21  ? 76  ILE C C   1 
ATOM   4339 O O   . ILE C 1 35  ? 44.819 -6.891  15.377  1.00 78.77  ? 76  ILE C O   1 
ATOM   4340 C CB  . ILE C 1 35  ? 42.938 -6.659  12.846  1.00 85.34  ? 76  ILE C CB  1 
ATOM   4341 C CG1 . ILE C 1 35  ? 41.683 -7.401  12.340  1.00 78.77  ? 76  ILE C CG1 1 
ATOM   4342 C CG2 . ILE C 1 35  ? 43.470 -5.663  11.826  1.00 88.16  ? 76  ILE C CG2 1 
ATOM   4343 C CD1 . ILE C 1 35  ? 41.807 -8.104  11.036  1.00 71.66  ? 76  ILE C CD1 1 
ATOM   4344 N N   . ARG C 1 36  ? 46.052 -6.295  13.622  1.00 83.56  ? 77  ARG C N   1 
ATOM   4345 C CA  . ARG C 1 36  ? 46.978 -5.526  14.443  1.00 85.98  ? 77  ARG C CA  1 
ATOM   4346 C C   . ARG C 1 36  ? 46.721 -4.081  14.043  1.00 85.84  ? 77  ARG C C   1 
ATOM   4347 O O   . ARG C 1 36  ? 46.566 -3.196  14.887  1.00 86.10  ? 77  ARG C O   1 
ATOM   4348 C CB  . ARG C 1 36  ? 48.422 -5.909  14.141  1.00 89.36  ? 77  ARG C CB  1 
ATOM   4349 C CG  . ARG C 1 36  ? 48.835 -7.273  14.656  1.00 94.90  ? 77  ARG C CG  1 
ATOM   4350 C CD  . ARG C 1 36  ? 50.228 -7.633  14.131  1.00 108.07 ? 77  ARG C CD  1 
ATOM   4351 N NE  . ARG C 1 36  ? 51.165 -6.506  14.217  1.00 118.25 ? 77  ARG C NE  1 
ATOM   4352 C CZ  . ARG C 1 36  ? 51.656 -6.010  15.354  1.00 122.88 ? 77  ARG C CZ  1 
ATOM   4353 N NH1 . ARG C 1 36  ? 51.310 -6.542  16.522  1.00 126.33 ? 77  ARG C NH1 1 
ATOM   4354 N NH2 . ARG C 1 36  ? 52.482 -4.969  15.325  1.00 120.23 ? 77  ARG C NH2 1 
ATOM   4355 N N   . THR C 1 37  ? 46.686 -3.858  12.733  1.00 76.62  ? 78  THR C N   1 
ATOM   4356 C CA  . THR C 1 37  ? 46.397 -2.549  12.158  1.00 77.82  ? 78  THR C CA  1 
ATOM   4357 C C   . THR C 1 37  ? 45.703 -2.908  10.873  1.00 78.76  ? 78  THR C C   1 
ATOM   4358 O O   . THR C 1 37  ? 45.553 -4.081  10.543  1.00 80.55  ? 78  THR C O   1 
ATOM   4359 C CB  . THR C 1 37  ? 47.649 -1.732  11.764  1.00 77.67  ? 78  THR C CB  1 
ATOM   4360 O OG1 . THR C 1 37  ? 48.778 -2.144  12.543  1.00 87.26  ? 78  THR C OG1 1 
ATOM   4361 C CG2 . THR C 1 37  ? 47.389 -0.241  12.004  1.00 74.83  ? 78  THR C CG2 1 
ATOM   4362 N N   . LEU C 1 38  ? 45.264 -1.900  10.147  1.00 76.47  ? 79  LEU C N   1 
ATOM   4363 C CA  . LEU C 1 38  ? 44.619 -2.155  8.886   1.00 71.04  ? 79  LEU C CA  1 
ATOM   4364 C C   . LEU C 1 38  ? 44.815 -0.909  8.042   1.00 69.54  ? 79  LEU C C   1 
ATOM   4365 O O   . LEU C 1 38  ? 45.177 0.148   8.563   1.00 66.24  ? 79  LEU C O   1 
ATOM   4366 C CB  . LEU C 1 38  ? 43.149 -2.530  9.107   1.00 68.88  ? 79  LEU C CB  1 
ATOM   4367 C CG  . LEU C 1 38  ? 42.318 -1.672  10.053  1.00 65.52  ? 79  LEU C CG  1 
ATOM   4368 C CD1 . LEU C 1 38  ? 41.860 -0.414  9.324   1.00 66.64  ? 79  LEU C CD1 1 
ATOM   4369 C CD2 . LEU C 1 38  ? 41.115 -2.481  10.516  1.00 62.37  ? 79  LEU C CD2 1 
ATOM   4370 N N   . GLY C 1 39  ? 44.636 -1.037  6.734   1.00 63.62  ? 80  GLY C N   1 
ATOM   4371 C CA  . GLY C 1 39  ? 44.854 0.109   5.890   1.00 59.25  ? 80  GLY C CA  1 
ATOM   4372 C C   . GLY C 1 39  ? 44.415 -0.166  4.483   1.00 63.43  ? 80  GLY C C   1 
ATOM   4373 O O   . GLY C 1 39  ? 43.549 -1.017  4.230   1.00 56.22  ? 80  GLY C O   1 
ATOM   4374 N N   . SER C 1 40  ? 45.024 0.551   3.551   1.00 60.95  ? 81  SER C N   1 
ATOM   4375 C CA  . SER C 1 40  ? 44.649 0.371   2.167   1.00 63.26  ? 81  SER C CA  1 
ATOM   4376 C C   . SER C 1 40  ? 45.862 0.130   1.306   1.00 62.68  ? 81  SER C C   1 
ATOM   4377 O O   . SER C 1 40  ? 47.006 0.296   1.760   1.00 59.80  ? 81  SER C O   1 
ATOM   4378 C CB  . SER C 1 40  ? 43.896 1.610   1.699   1.00 64.11  ? 81  SER C CB  1 
ATOM   4379 O OG  . SER C 1 40  ? 42.808 1.854   2.573   1.00 62.81  ? 81  SER C OG  1 
ATOM   4380 N N   . GLY C 1 41  ? 45.607 -0.290  0.072   1.00 53.75  ? 82  GLY C N   1 
ATOM   4381 C CA  . GLY C 1 41  ? 46.693 -0.507  -0.857  1.00 49.34  ? 82  GLY C CA  1 
ATOM   4382 C C   . GLY C 1 41  ? 46.231 -0.313  -2.283  1.00 53.04  ? 82  GLY C C   1 
ATOM   4383 O O   . GLY C 1 41  ? 45.021 -0.303  -2.567  1.00 56.01  ? 82  GLY C O   1 
ATOM   4384 N N   . VAL C 1 42  ? 47.188 -0.180  -3.197  1.00 56.98  ? 83  VAL C N   1 
ATOM   4385 C CA  . VAL C 1 42  ? 46.845 0.025   -4.600  1.00 58.45  ? 83  VAL C CA  1 
ATOM   4386 C C   . VAL C 1 42  ? 47.444 -1.027  -5.560  1.00 59.41  ? 83  VAL C C   1 
ATOM   4387 O O   . VAL C 1 42  ? 48.675 -1.200  -5.677  1.00 53.12  ? 83  VAL C O   1 
ATOM   4388 C CB  . VAL C 1 42  ? 47.275 1.470   -5.086  1.00 55.97  ? 83  VAL C CB  1 
ATOM   4389 C CG1 . VAL C 1 42  ? 46.669 1.772   -6.441  1.00 56.87  ? 83  VAL C CG1 1 
ATOM   4390 C CG2 . VAL C 1 42  ? 46.838 2.523   -4.094  1.00 49.04  ? 83  VAL C CG2 1 
ATOM   4391 N N   . ILE C 1 43  ? 46.554 -1.737  -6.234  1.00 55.47  ? 84  ILE C N   1 
ATOM   4392 C CA  . ILE C 1 43  ? 46.972 -2.703  -7.224  1.00 58.12  ? 84  ILE C CA  1 
ATOM   4393 C C   . ILE C 1 43  ? 47.613 -1.890  -8.349  1.00 57.29  ? 84  ILE C C   1 
ATOM   4394 O O   . ILE C 1 43  ? 46.932 -1.178  -9.068  1.00 63.47  ? 84  ILE C O   1 
ATOM   4395 C CB  . ILE C 1 43  ? 45.774 -3.503  -7.785  1.00 52.08  ? 84  ILE C CB  1 
ATOM   4396 C CG1 . ILE C 1 43  ? 45.053 -4.226  -6.640  1.00 45.82  ? 84  ILE C CG1 1 
ATOM   4397 C CG2 . ILE C 1 43  ? 46.262 -4.519  -8.805  1.00 52.93  ? 84  ILE C CG2 1 
ATOM   4398 C CD1 . ILE C 1 43  ? 43.878 -5.128  -7.090  1.00 39.37  ? 84  ILE C CD1 1 
ATOM   4399 N N   . MET C 1 44  ? 48.929 -1.994  -8.478  1.00 63.49  ? 85  MET C N   1 
ATOM   4400 C CA  . MET C 1 44  ? 49.677 -1.279  -9.505  1.00 64.92  ? 85  MET C CA  1 
ATOM   4401 C C   . MET C 1 44  ? 49.654 -1.943  -10.895 1.00 65.37  ? 85  MET C C   1 
ATOM   4402 O O   . MET C 1 44  ? 49.756 -1.249  -11.896 1.00 66.78  ? 85  MET C O   1 
ATOM   4403 C CB  . MET C 1 44  ? 51.135 -1.079  -9.059  1.00 60.51  ? 85  MET C CB  1 
ATOM   4404 C CG  . MET C 1 44  ? 51.312 -0.329  -7.735  1.00 64.87  ? 85  MET C CG  1 
ATOM   4405 S SD  . MET C 1 44  ? 50.633 1.395   -7.610  1.00 69.75  ? 85  MET C SD  1 
ATOM   4406 C CE  . MET C 1 44  ? 51.758 2.302   -8.663  1.00 63.01  ? 85  MET C CE  1 
ATOM   4407 N N   . ASP C 1 45  ? 49.517 -3.267  -10.975 1.00 67.61  ? 86  ASP C N   1 
ATOM   4408 C CA  . ASP C 1 45  ? 49.490 -3.929  -12.285 1.00 68.92  ? 86  ASP C CA  1 
ATOM   4409 C C   . ASP C 1 45  ? 48.934 -5.355  -12.340 1.00 70.33  ? 86  ASP C C   1 
ATOM   4410 O O   . ASP C 1 45  ? 48.546 -5.931  -11.333 1.00 70.93  ? 86  ASP C O   1 
ATOM   4411 C CB  . ASP C 1 45  ? 50.889 -3.908  -12.920 1.00 71.47  ? 86  ASP C CB  1 
ATOM   4412 C CG  . ASP C 1 45  ? 51.919 -4.711  -12.135 1.00 75.80  ? 86  ASP C CG  1 
ATOM   4413 O OD1 . ASP C 1 45  ? 53.101 -4.310  -12.171 1.00 82.56  ? 86  ASP C OD1 1 
ATOM   4414 O OD2 . ASP C 1 45  ? 51.573 -5.732  -11.501 1.00 75.89  ? 86  ASP C OD2 1 
ATOM   4415 N N   . GLN C 1 46  ? 48.907 -5.923  -13.539 1.00 73.52  ? 87  GLN C N   1 
ATOM   4416 C CA  . GLN C 1 46  ? 48.378 -7.262  -13.738 1.00 73.54  ? 87  GLN C CA  1 
ATOM   4417 C C   . GLN C 1 46  ? 49.221 -8.388  -13.128 1.00 69.35  ? 87  GLN C C   1 
ATOM   4418 O O   . GLN C 1 46  ? 48.766 -9.522  -13.000 1.00 69.65  ? 87  GLN C O   1 
ATOM   4419 C CB  . GLN C 1 46  ? 48.154 -7.492  -15.231 1.00 78.90  ? 87  GLN C CB  1 
ATOM   4420 C CG  . GLN C 1 46  ? 46.842 -6.910  -15.760 1.00 82.56  ? 87  GLN C CG  1 
ATOM   4421 C CD  . GLN C 1 46  ? 45.624 -7.746  -15.361 1.00 93.20  ? 87  GLN C CD  1 
ATOM   4422 O OE1 . GLN C 1 46  ? 44.514 -7.508  -15.842 1.00 92.57  ? 87  GLN C OE1 1 
ATOM   4423 N NE2 . GLN C 1 46  ? 45.830 -8.733  -14.482 1.00 89.78  ? 87  GLN C NE2 1 
ATOM   4424 N N   . ARG C 1 47  ? 50.440 -8.079  -12.728 1.00 64.60  ? 88  ARG C N   1 
ATOM   4425 C CA  . ARG C 1 47  ? 51.283 -9.092  -12.117 1.00 68.15  ? 88  ARG C CA  1 
ATOM   4426 C C   . ARG C 1 47  ? 50.934 -9.313  -10.648 1.00 69.39  ? 88  ARG C C   1 
ATOM   4427 O O   . ARG C 1 47  ? 51.430 -10.250 -10.028 1.00 74.43  ? 88  ARG C O   1 
ATOM   4428 C CB  . ARG C 1 47  ? 52.760 -8.706  -12.250 1.00 68.99  ? 88  ARG C CB  1 
ATOM   4429 C CG  . ARG C 1 47  ? 53.214 -8.629  -13.696 1.00 61.24  ? 88  ARG C CG  1 
ATOM   4430 C CD  . ARG C 1 47  ? 54.639 -8.233  -13.775 1.00 52.53  ? 88  ARG C CD  1 
ATOM   4431 N NE  . ARG C 1 47  ? 54.840 -6.938  -13.148 1.00 56.65  ? 88  ARG C NE  1 
ATOM   4432 C CZ  . ARG C 1 47  ? 56.029 -6.488  -12.764 1.00 54.10  ? 88  ARG C CZ  1 
ATOM   4433 N NH1 . ARG C 1 47  ? 57.106 -7.245  -12.945 1.00 51.41  ? 88  ARG C NH1 1 
ATOM   4434 N NH2 . ARG C 1 47  ? 56.144 -5.288  -12.211 1.00 50.80  ? 88  ARG C NH2 1 
ATOM   4435 N N   . GLY C 1 48  ? 50.105 -8.440  -10.083 1.00 67.15  ? 89  GLY C N   1 
ATOM   4436 C CA  . GLY C 1 48  ? 49.689 -8.606  -8.699  1.00 56.97  ? 89  GLY C CA  1 
ATOM   4437 C C   . GLY C 1 48  ? 50.388 -7.763  -7.652  1.00 58.68  ? 89  GLY C C   1 
ATOM   4438 O O   . GLY C 1 48  ? 50.171 -7.973  -6.459  1.00 59.32  ? 89  GLY C O   1 
ATOM   4439 N N   . TYR C 1 49  ? 51.234 -6.827  -8.073  1.00 57.43  ? 90  TYR C N   1 
ATOM   4440 C CA  . TYR C 1 49  ? 51.913 -5.965  -7.115  1.00 60.14  ? 90  TYR C CA  1 
ATOM   4441 C C   . TYR C 1 49  ? 50.993 -4.893  -6.529  1.00 59.39  ? 90  TYR C C   1 
ATOM   4442 O O   . TYR C 1 49  ? 50.139 -4.345  -7.212  1.00 51.06  ? 90  TYR C O   1 
ATOM   4443 C CB  . TYR C 1 49  ? 53.142 -5.330  -7.748  1.00 64.88  ? 90  TYR C CB  1 
ATOM   4444 C CG  . TYR C 1 49  ? 54.187 -6.374  -8.076  1.00 72.83  ? 90  TYR C CG  1 
ATOM   4445 C CD1 . TYR C 1 49  ? 54.339 -6.859  -9.381  1.00 74.43  ? 90  TYR C CD1 1 
ATOM   4446 C CD2 . TYR C 1 49  ? 55.000 -6.910  -7.071  1.00 68.42  ? 90  TYR C CD2 1 
ATOM   4447 C CE1 . TYR C 1 49  ? 55.281 -7.853  -9.672  1.00 73.04  ? 90  TYR C CE1 1 
ATOM   4448 C CE2 . TYR C 1 49  ? 55.936 -7.891  -7.349  1.00 67.31  ? 90  TYR C CE2 1 
ATOM   4449 C CZ  . TYR C 1 49  ? 56.072 -8.356  -8.651  1.00 70.23  ? 90  TYR C CZ  1 
ATOM   4450 O OH  . TYR C 1 49  ? 57.009 -9.310  -8.933  1.00 74.51  ? 90  TYR C OH  1 
ATOM   4451 N N   . ILE C 1 50  ? 51.178 -4.613  -5.241  1.00 60.49  ? 91  ILE C N   1 
ATOM   4452 C CA  . ILE C 1 50  ? 50.346 -3.662  -4.535  1.00 54.98  ? 91  ILE C CA  1 
ATOM   4453 C C   . ILE C 1 50  ? 51.185 -2.737  -3.683  1.00 61.35  ? 91  ILE C C   1 
ATOM   4454 O O   . ILE C 1 50  ? 52.076 -3.193  -2.966  1.00 70.07  ? 91  ILE C O   1 
ATOM   4455 C CB  . ILE C 1 50  ? 49.366 -4.417  -3.646  1.00 50.95  ? 91  ILE C CB  1 
ATOM   4456 C CG1 . ILE C 1 50  ? 48.404 -5.196  -4.529  1.00 46.31  ? 91  ILE C CG1 1 
ATOM   4457 C CG2 . ILE C 1 50  ? 48.628 -3.470  -2.695  1.00 54.11  ? 91  ILE C CG2 1 
ATOM   4458 C CD1 . ILE C 1 50  ? 47.643 -6.254  -3.759  1.00 51.77  ? 91  ILE C CD1 1 
ATOM   4459 N N   . ILE C 1 51  ? 50.931 -1.431  -3.768  1.00 60.64  ? 92  ILE C N   1 
ATOM   4460 C CA  . ILE C 1 51  ? 51.689 -0.507  -2.936  1.00 58.19  ? 92  ILE C CA  1 
ATOM   4461 C C   . ILE C 1 51  ? 50.918 -0.172  -1.676  1.00 57.36  ? 92  ILE C C   1 
ATOM   4462 O O   . ILE C 1 51  ? 49.693 -0.229  -1.653  1.00 62.63  ? 92  ILE C O   1 
ATOM   4463 C CB  . ILE C 1 51  ? 52.000 0.782   -3.654  1.00 54.84  ? 92  ILE C CB  1 
ATOM   4464 C CG1 . ILE C 1 51  ? 52.883 0.482   -4.861  1.00 56.59  ? 92  ILE C CG1 1 
ATOM   4465 C CG2 . ILE C 1 51  ? 52.670 1.756   -2.694  1.00 58.30  ? 92  ILE C CG2 1 
ATOM   4466 C CD1 . ILE C 1 51  ? 53.328 1.700   -5.638  1.00 64.16  ? 92  ILE C CD1 1 
ATOM   4467 N N   . THR C 1 52  ? 51.644 0.130   -0.614  1.00 56.15  ? 93  THR C N   1 
ATOM   4468 C CA  . THR C 1 52  ? 51.018 0.501   0.633   1.00 60.52  ? 93  THR C CA  1 
ATOM   4469 C C   . THR C 1 52  ? 52.085 1.039   1.548   1.00 61.72  ? 93  THR C C   1 
ATOM   4470 O O   . THR C 1 52  ? 53.257 1.025   1.194   1.00 63.03  ? 93  THR C O   1 
ATOM   4471 C CB  . THR C 1 52  ? 50.260 -0.671  1.308   1.00 63.10  ? 93  THR C CB  1 
ATOM   4472 O OG1 . THR C 1 52  ? 49.488 -0.147  2.401   1.00 63.44  ? 93  THR C OG1 1 
ATOM   4473 C CG2 . THR C 1 52  ? 51.234 -1.743  1.840   1.00 62.26  ? 93  THR C CG2 1 
ATOM   4474 N N   . ASN C 1 53  ? 51.672 1.540   2.708   1.00 62.83  ? 94  ASN C N   1 
ATOM   4475 C CA  . ASN C 1 53  ? 52.616 2.110   3.660   1.00 66.77  ? 94  ASN C CA  1 
ATOM   4476 C C   . ASN C 1 53  ? 53.320 1.031   4.468   1.00 64.84  ? 94  ASN C C   1 
ATOM   4477 O O   . ASN C 1 53  ? 52.739 0.004   4.810   1.00 63.17  ? 94  ASN C O   1 
ATOM   4478 C CB  . ASN C 1 53  ? 51.903 3.082   4.626   1.00 71.27  ? 94  ASN C CB  1 
ATOM   4479 C CG  . ASN C 1 53  ? 51.358 4.337   3.926   1.00 74.62  ? 94  ASN C CG  1 
ATOM   4480 O OD1 . ASN C 1 53  ? 50.524 5.050   4.483   1.00 75.97  ? 94  ASN C OD1 1 
ATOM   4481 N ND2 . ASN C 1 53  ? 51.835 4.610   2.718   1.00 66.42  ? 94  ASN C ND2 1 
ATOM   4482 N N   . LYS C 1 54  ? 54.581 1.277   4.775   1.00 63.88  ? 95  LYS C N   1 
ATOM   4483 C CA  . LYS C 1 54  ? 55.346 0.337   5.562   1.00 66.24  ? 95  LYS C CA  1 
ATOM   4484 C C   . LYS C 1 54  ? 54.697 0.136   6.950   1.00 69.13  ? 95  LYS C C   1 
ATOM   4485 O O   . LYS C 1 54  ? 54.415 -1.006  7.358   1.00 72.68  ? 95  LYS C O   1 
ATOM   4486 C CB  . LYS C 1 54  ? 56.785 0.854   5.701   1.00 67.46  ? 95  LYS C CB  1 
ATOM   4487 C CG  . LYS C 1 54  ? 57.757 -0.083  6.399   1.00 69.04  ? 95  LYS C CG  1 
ATOM   4488 C CD  . LYS C 1 54  ? 59.183 0.461   6.321   1.00 76.60  ? 95  LYS C CD  1 
ATOM   4489 C CE  . LYS C 1 54  ? 60.144 -0.395  7.139   1.00 77.91  ? 95  LYS C CE  1 
ATOM   4490 N NZ  . LYS C 1 54  ? 59.805 -0.414  8.599   1.00 81.37  ? 95  LYS C NZ  1 
ATOM   4491 N N   . HIS C 1 55  ? 54.425 1.233   7.660   1.00 67.92  ? 96  HIS C N   1 
ATOM   4492 C CA  . HIS C 1 55  ? 53.848 1.121   8.997   1.00 70.66  ? 96  HIS C CA  1 
ATOM   4493 C C   . HIS C 1 55  ? 52.556 0.297   9.070   1.00 70.88  ? 96  HIS C C   1 
ATOM   4494 O O   . HIS C 1 55  ? 52.136 -0.124  10.152  1.00 66.20  ? 96  HIS C O   1 
ATOM   4495 C CB  . HIS C 1 55  ? 53.656 2.514   9.640   1.00 71.40  ? 96  HIS C CB  1 
ATOM   4496 C CG  . HIS C 1 55  ? 52.517 3.308   9.077   1.00 82.32  ? 96  HIS C CG  1 
ATOM   4497 N ND1 . HIS C 1 55  ? 52.669 4.194   8.032   1.00 81.29  ? 96  HIS C ND1 1 
ATOM   4498 C CD2 . HIS C 1 55  ? 51.204 3.344   9.414   1.00 80.87  ? 96  HIS C CD2 1 
ATOM   4499 C CE1 . HIS C 1 55  ? 51.500 4.740   7.749   1.00 82.59  ? 96  HIS C CE1 1 
ATOM   4500 N NE2 . HIS C 1 55  ? 50.594 4.241   8.573   1.00 85.82  ? 96  HIS C NE2 1 
ATOM   4501 N N   . VAL C 1 56  ? 51.949 0.025   7.917   1.00 69.37  ? 97  VAL C N   1 
ATOM   4502 C CA  . VAL C 1 56  ? 50.720 -0.748  7.900   1.00 66.70  ? 97  VAL C CA  1 
ATOM   4503 C C   . VAL C 1 56  ? 50.981 -2.248  7.871   1.00 72.34  ? 97  VAL C C   1 
ATOM   4504 O O   . VAL C 1 56  ? 50.094 -3.056  8.204   1.00 68.63  ? 97  VAL C O   1 
ATOM   4505 C CB  . VAL C 1 56  ? 49.832 -0.377  6.683   1.00 70.66  ? 97  VAL C CB  1 
ATOM   4506 C CG1 . VAL C 1 56  ? 48.614 -1.312  6.620   1.00 67.47  ? 97  VAL C CG1 1 
ATOM   4507 C CG2 . VAL C 1 56  ? 49.382 1.096   6.786   1.00 62.46  ? 97  VAL C CG2 1 
ATOM   4508 N N   . ILE C 1 57  ? 52.183 -2.649  7.467   1.00 70.12  ? 98  ILE C N   1 
ATOM   4509 C CA  . ILE C 1 57  ? 52.440 -4.075  7.435   1.00 65.71  ? 98  ILE C CA  1 
ATOM   4510 C C   . ILE C 1 57  ? 53.607 -4.508  8.306   1.00 66.16  ? 98  ILE C C   1 
ATOM   4511 O O   . ILE C 1 57  ? 53.908 -5.695  8.415   1.00 66.34  ? 98  ILE C O   1 
ATOM   4512 C CB  . ILE C 1 57  ? 52.564 -4.590  5.967   1.00 64.51  ? 98  ILE C CB  1 
ATOM   4513 C CG1 . ILE C 1 57  ? 53.651 -3.842  5.185   1.00 57.83  ? 98  ILE C CG1 1 
ATOM   4514 C CG2 . ILE C 1 57  ? 51.201 -4.407  5.270   1.00 52.87  ? 98  ILE C CG2 1 
ATOM   4515 C CD1 . ILE C 1 57  ? 54.994 -3.778  5.847   1.00 57.05  ? 98  ILE C CD1 1 
ATOM   4516 N N   . ASN C 1 58  ? 54.235 -3.533  8.951   1.00 70.27  ? 99  ASN C N   1 
ATOM   4517 C CA  . ASN C 1 58  ? 55.345 -3.786  9.858   1.00 72.29  ? 99  ASN C CA  1 
ATOM   4518 C C   . ASN C 1 58  ? 54.968 -4.878  10.857  1.00 79.69  ? 99  ASN C C   1 
ATOM   4519 O O   . ASN C 1 58  ? 53.793 -5.019  11.220  1.00 80.19  ? 99  ASN C O   1 
ATOM   4520 C CB  . ASN C 1 58  ? 55.695 -2.516  10.629  1.00 70.35  ? 99  ASN C CB  1 
ATOM   4521 C CG  . ASN C 1 58  ? 57.153 -2.153  10.511  1.00 83.54  ? 99  ASN C CG  1 
ATOM   4522 O OD1 . ASN C 1 58  ? 57.633 -1.836  9.420   1.00 90.17  ? 99  ASN C OD1 1 
ATOM   4523 N ND2 . ASN C 1 58  ? 57.876 -2.197  11.633  1.00 87.72  ? 99  ASN C ND2 1 
ATOM   4524 N N   . ASP C 1 59  ? 55.976 -5.640  11.291  1.00 83.03  ? 100 ASP C N   1 
ATOM   4525 C CA  . ASP C 1 59  ? 55.827 -6.734  12.257  1.00 83.91  ? 100 ASP C CA  1 
ATOM   4526 C C   . ASP C 1 59  ? 54.607 -7.623  12.060  1.00 82.54  ? 100 ASP C C   1 
ATOM   4527 O O   . ASP C 1 59  ? 54.013 -8.082  13.038  1.00 85.76  ? 100 ASP C O   1 
ATOM   4528 C CB  . ASP C 1 59  ? 55.798 -6.199  13.699  1.00 84.73  ? 100 ASP C CB  1 
ATOM   4529 C CG  . ASP C 1 59  ? 56.991 -5.324  14.026  1.00 91.51  ? 100 ASP C CG  1 
ATOM   4530 O OD1 . ASP C 1 59  ? 58.130 -5.698  13.658  1.00 93.06  ? 100 ASP C OD1 1 
ATOM   4531 O OD2 . ASP C 1 59  ? 56.788 -4.264  14.667  1.00 95.96  ? 100 ASP C OD2 1 
ATOM   4532 N N   . ALA C 1 60  ? 54.235 -7.885  10.816  1.00 78.61  ? 101 ALA C N   1 
ATOM   4533 C CA  . ALA C 1 60  ? 53.076 -8.731  10.560  1.00 81.27  ? 101 ALA C CA  1 
ATOM   4534 C C   . ALA C 1 60  ? 53.463 -10.187 10.266  1.00 83.96  ? 101 ALA C C   1 
ATOM   4535 O O   . ALA C 1 60  ? 54.496 -10.456 9.648   1.00 85.97  ? 101 ALA C O   1 
ATOM   4536 C CB  . ALA C 1 60  ? 52.272 -8.158  9.394   1.00 76.03  ? 101 ALA C CB  1 
ATOM   4537 N N   . ASP C 1 61  ? 52.633 -11.127 10.706  1.00 83.01  ? 102 ASP C N   1 
ATOM   4538 C CA  . ASP C 1 61  ? 52.890 -12.540 10.450  1.00 79.49  ? 102 ASP C CA  1 
ATOM   4539 C C   . ASP C 1 61  ? 52.056 -12.902 9.233   1.00 77.25  ? 102 ASP C C   1 
ATOM   4540 O O   . ASP C 1 61  ? 52.333 -13.875 8.536   1.00 78.48  ? 102 ASP C O   1 
ATOM   4541 C CB  . ASP C 1 61  ? 52.459 -13.426 11.640  1.00 83.33  ? 102 ASP C CB  1 
ATOM   4542 C CG  . ASP C 1 61  ? 52.992 -12.923 12.992  1.00 90.21  ? 102 ASP C CG  1 
ATOM   4543 O OD1 . ASP C 1 61  ? 54.186 -12.539 13.113  1.00 83.89  ? 102 ASP C OD1 1 
ATOM   4544 O OD2 . ASP C 1 61  ? 52.196 -12.922 13.953  1.00 94.11  ? 102 ASP C OD2 1 
ATOM   4545 N N   . GLN C 1 62  ? 51.018 -12.113 8.991   1.00 74.26  ? 103 GLN C N   1 
ATOM   4546 C CA  . GLN C 1 62  ? 50.139 -12.345 7.858   1.00 67.99  ? 103 GLN C CA  1 
ATOM   4547 C C   . GLN C 1 62  ? 49.386 -11.102 7.372   1.00 71.46  ? 103 GLN C C   1 
ATOM   4548 O O   . GLN C 1 62  ? 48.761 -10.363 8.142   1.00 65.62  ? 103 GLN C O   1 
ATOM   4549 C CB  . GLN C 1 62  ? 49.142 -13.435 8.178   1.00 66.35  ? 103 GLN C CB  1 
ATOM   4550 C CG  . GLN C 1 62  ? 48.202 -13.664 7.039   1.00 69.33  ? 103 GLN C CG  1 
ATOM   4551 C CD  . GLN C 1 62  ? 47.170 -14.658 7.390   1.00 74.06  ? 103 GLN C CD  1 
ATOM   4552 O OE1 . GLN C 1 62  ? 46.498 -14.521 8.410   1.00 84.21  ? 103 GLN C OE1 1 
ATOM   4553 N NE2 . GLN C 1 62  ? 47.020 -15.678 6.560   1.00 78.40  ? 103 GLN C NE2 1 
ATOM   4554 N N   . ILE C 1 63  ? 49.430 -10.919 6.059   1.00 70.32  ? 104 ILE C N   1 
ATOM   4555 C CA  . ILE C 1 63  ? 48.828 -9.788  5.396   1.00 61.18  ? 104 ILE C CA  1 
ATOM   4556 C C   . ILE C 1 63  ? 47.694 -10.202 4.497   1.00 64.30  ? 104 ILE C C   1 
ATOM   4557 O O   . ILE C 1 63  ? 47.890 -10.961 3.555   1.00 66.53  ? 104 ILE C O   1 
ATOM   4558 C CB  . ILE C 1 63  ? 49.864 -9.105  4.562   1.00 57.78  ? 104 ILE C CB  1 
ATOM   4559 C CG1 . ILE C 1 63  ? 51.046 -8.714  5.458   1.00 57.12  ? 104 ILE C CG1 1 
ATOM   4560 C CG2 . ILE C 1 63  ? 49.244 -7.926  3.831   1.00 63.57  ? 104 ILE C CG2 1 
ATOM   4561 C CD1 . ILE C 1 63  ? 52.334 -8.356  4.669   1.00 52.49  ? 104 ILE C CD1 1 
ATOM   4562 N N   . ILE C 1 64  ? 46.491 -9.721  4.787   1.00 67.80  ? 105 ILE C N   1 
ATOM   4563 C CA  . ILE C 1 64  ? 45.360 -10.065 3.941   1.00 65.35  ? 105 ILE C CA  1 
ATOM   4564 C C   . ILE C 1 64  ? 45.055 -8.833  3.123   1.00 63.56  ? 105 ILE C C   1 
ATOM   4565 O O   . ILE C 1 64  ? 45.223 -7.709  3.593   1.00 59.90  ? 105 ILE C O   1 
ATOM   4566 C CB  . ILE C 1 64  ? 44.125 -10.472 4.750   1.00 68.97  ? 105 ILE C CB  1 
ATOM   4567 C CG1 . ILE C 1 64  ? 44.480 -11.661 5.641   1.00 73.13  ? 105 ILE C CG1 1 
ATOM   4568 C CG2 . ILE C 1 64  ? 42.987 -10.855 3.803   1.00 57.56  ? 105 ILE C CG2 1 
ATOM   4569 C CD1 . ILE C 1 64  ? 44.876 -12.897 4.848   1.00 77.52  ? 105 ILE C CD1 1 
ATOM   4570 N N   . VAL C 1 65  ? 44.636 -9.068  1.886   1.00 60.19  ? 106 VAL C N   1 
ATOM   4571 C CA  . VAL C 1 65  ? 44.335 -8.018  0.946   1.00 56.88  ? 106 VAL C CA  1 
ATOM   4572 C C   . VAL C 1 65  ? 42.953 -8.319  0.441   1.00 61.10  ? 106 VAL C C   1 
ATOM   4573 O O   . VAL C 1 65  ? 42.724 -9.411  -0.059  1.00 62.57  ? 106 VAL C O   1 
ATOM   4574 C CB  . VAL C 1 65  ? 45.297 -8.072  -0.255  1.00 54.17  ? 106 VAL C CB  1 
ATOM   4575 C CG1 . VAL C 1 65  ? 44.683 -7.356  -1.445  1.00 66.40  ? 106 VAL C CG1 1 
ATOM   4576 C CG2 . VAL C 1 65  ? 46.611 -7.458  0.095   1.00 48.42  ? 106 VAL C CG2 1 
ATOM   4577 N N   . ALA C 1 66  ? 42.027 -7.374  0.564   1.00 57.33  ? 107 ALA C N   1 
ATOM   4578 C CA  . ALA C 1 66  ? 40.685 -7.627  0.060   1.00 65.83  ? 107 ALA C CA  1 
ATOM   4579 C C   . ALA C 1 66  ? 40.359 -6.691  -1.113  1.00 65.15  ? 107 ALA C C   1 
ATOM   4580 O O   . ALA C 1 66  ? 40.772 -5.530  -1.104  1.00 72.93  ? 107 ALA C O   1 
ATOM   4581 C CB  . ALA C 1 66  ? 39.653 -7.474  1.193   1.00 58.44  ? 107 ALA C CB  1 
ATOM   4582 N N   . LEU C 1 67  ? 39.642 -7.209  -2.114  1.00 60.86  ? 108 LEU C N   1 
ATOM   4583 C CA  . LEU C 1 67  ? 39.249 -6.437  -3.295  1.00 62.39  ? 108 LEU C CA  1 
ATOM   4584 C C   . LEU C 1 67  ? 37.769 -6.099  -3.222  1.00 65.65  ? 108 LEU C C   1 
ATOM   4585 O O   . LEU C 1 67  ? 36.976 -6.845  -2.639  1.00 73.30  ? 108 LEU C O   1 
ATOM   4586 C CB  . LEU C 1 67  ? 39.486 -7.228  -4.591  1.00 62.21  ? 108 LEU C CB  1 
ATOM   4587 C CG  . LEU C 1 67  ? 40.876 -7.750  -4.961  1.00 57.28  ? 108 LEU C CG  1 
ATOM   4588 C CD1 . LEU C 1 67  ? 41.140 -7.525  -6.436  1.00 47.29  ? 108 LEU C CD1 1 
ATOM   4589 C CD2 . LEU C 1 67  ? 41.909 -7.059  -4.133  1.00 50.98  ? 108 LEU C CD2 1 
ATOM   4590 N N   . GLN C 1 68  ? 37.381 -5.004  -3.861  1.00 62.27  ? 109 GLN C N   1 
ATOM   4591 C CA  . GLN C 1 68  ? 35.993 -4.567  -3.815  1.00 59.07  ? 109 GLN C CA  1 
ATOM   4592 C C   . GLN C 1 68  ? 35.076 -5.491  -4.568  1.00 64.09  ? 109 GLN C C   1 
ATOM   4593 O O   . GLN C 1 68  ? 33.844 -5.356  -4.511  1.00 63.13  ? 109 GLN C O   1 
ATOM   4594 C CB  . GLN C 1 68  ? 35.886 -3.142  -4.352  1.00 47.29  ? 109 GLN C CB  1 
ATOM   4595 C CG  . GLN C 1 68  ? 36.944 -2.223  -3.741  1.00 47.51  ? 109 GLN C CG  1 
ATOM   4596 C CD  . GLN C 1 68  ? 36.876 -2.207  -2.199  1.00 54.57  ? 109 GLN C CD  1 
ATOM   4597 O OE1 . GLN C 1 68  ? 37.871 -1.908  -1.521  1.00 53.41  ? 109 GLN C OE1 1 
ATOM   4598 N NE2 . GLN C 1 68  ? 35.693 -2.512  -1.646  1.00 40.37  ? 109 GLN C NE2 1 
ATOM   4599 N N   . ASP C 1 69  ? 35.670 -6.445  -5.274  1.00 69.65  ? 110 ASP C N   1 
ATOM   4600 C CA  . ASP C 1 69  ? 34.880 -7.403  -6.040  1.00 68.93  ? 110 ASP C CA  1 
ATOM   4601 C C   . ASP C 1 69  ? 34.502 -8.601  -5.168  1.00 70.14  ? 110 ASP C C   1 
ATOM   4602 O O   . ASP C 1 69  ? 33.678 -9.424  -5.566  1.00 68.97  ? 110 ASP C O   1 
ATOM   4603 C CB  . ASP C 1 69  ? 35.682 -7.888  -7.216  1.00 67.85  ? 110 ASP C CB  1 
ATOM   4604 C CG  . ASP C 1 69  ? 36.868 -8.661  -6.785  1.00 71.57  ? 110 ASP C CG  1 
ATOM   4605 O OD1 . ASP C 1 69  ? 36.666 -9.732  -6.174  1.00 74.47  ? 110 ASP C OD1 1 
ATOM   4606 O OD2 . ASP C 1 69  ? 38.001 -8.192  -7.035  1.00 86.95  ? 110 ASP C OD2 1 
ATOM   4607 N N   . GLY C 1 70  ? 35.109 -8.693  -3.985  1.00 69.49  ? 111 GLY C N   1 
ATOM   4608 C CA  . GLY C 1 70  ? 34.821 -9.791  -3.082  1.00 67.89  ? 111 GLY C CA  1 
ATOM   4609 C C   . GLY C 1 70  ? 36.047 -10.638 -2.767  1.00 75.31  ? 111 GLY C C   1 
ATOM   4610 O O   . GLY C 1 70  ? 36.261 -11.055 -1.624  1.00 75.38  ? 111 GLY C O   1 
ATOM   4611 N N   . ARG C 1 71  ? 36.867 -10.889 -3.783  1.00 70.63  ? 112 ARG C N   1 
ATOM   4612 C CA  . ARG C 1 71  ? 38.058 -11.696 -3.611  1.00 68.57  ? 112 ARG C CA  1 
ATOM   4613 C C   . ARG C 1 71  ? 38.955 -11.262 -2.457  1.00 69.01  ? 112 ARG C C   1 
ATOM   4614 O O   . ARG C 1 71  ? 39.066 -10.079 -2.145  1.00 70.08  ? 112 ARG C O   1 
ATOM   4615 C CB  . ARG C 1 71  ? 38.857 -11.711 -4.915  1.00 74.56  ? 112 ARG C CB  1 
ATOM   4616 C CG  . ARG C 1 71  ? 38.152 -12.417 -6.077  1.00 71.01  ? 112 ARG C CG  1 
ATOM   4617 C CD  . ARG C 1 71  ? 39.013 -12.377 -7.337  1.00 81.58  ? 112 ARG C CD  1 
ATOM   4618 N NE  . ARG C 1 71  ? 38.821 -11.140 -8.087  1.00 87.84  ? 112 ARG C NE  1 
ATOM   4619 C CZ  . ARG C 1 71  ? 39.710 -10.618 -8.926  1.00 87.29  ? 112 ARG C CZ  1 
ATOM   4620 N NH1 . ARG C 1 71  ? 40.872 -11.226 -9.132  1.00 84.71  ? 112 ARG C NH1 1 
ATOM   4621 N NH2 . ARG C 1 71  ? 39.436 -9.481  -9.550  1.00 83.88  ? 112 ARG C NH2 1 
ATOM   4622 N N   . VAL C 1 72  ? 39.592 -12.251 -1.834  1.00 68.29  ? 113 VAL C N   1 
ATOM   4623 C CA  . VAL C 1 72  ? 40.508 -12.051 -0.710  1.00 65.54  ? 113 VAL C CA  1 
ATOM   4624 C C   . VAL C 1 72  ? 41.728 -12.925 -1.010  1.00 65.26  ? 113 VAL C C   1 
ATOM   4625 O O   . VAL C 1 72  ? 41.601 -13.978 -1.632  1.00 67.36  ? 113 VAL C O   1 
ATOM   4626 C CB  . VAL C 1 72  ? 39.866 -12.497 0.644   1.00 62.76  ? 113 VAL C CB  1 
ATOM   4627 C CG1 . VAL C 1 72  ? 40.801 -12.225 1.785   1.00 56.54  ? 113 VAL C CG1 1 
ATOM   4628 C CG2 . VAL C 1 72  ? 38.579 -11.774 0.866   1.00 58.25  ? 113 VAL C CG2 1 
ATOM   4629 N N   . PHE C 1 73  ? 42.901 -12.490 -0.567  1.00 61.96  ? 114 PHE C N   1 
ATOM   4630 C CA  . PHE C 1 73  ? 44.117 -13.211 -0.843  1.00 58.22  ? 114 PHE C CA  1 
ATOM   4631 C C   . PHE C 1 73  ? 45.119 -13.071 0.268   1.00 67.07  ? 114 PHE C C   1 
ATOM   4632 O O   . PHE C 1 73  ? 45.201 -12.034 0.936   1.00 69.31  ? 114 PHE C O   1 
ATOM   4633 C CB  . PHE C 1 73  ? 44.833 -12.661 -2.085  1.00 65.35  ? 114 PHE C CB  1 
ATOM   4634 C CG  . PHE C 1 73  ? 44.014 -12.634 -3.336  1.00 66.51  ? 114 PHE C CG  1 
ATOM   4635 C CD1 . PHE C 1 73  ? 43.303 -11.497 -3.689  1.00 59.44  ? 114 PHE C CD1 1 
ATOM   4636 C CD2 . PHE C 1 73  ? 44.023 -13.714 -4.214  1.00 68.50  ? 114 PHE C CD2 1 
ATOM   4637 C CE1 . PHE C 1 73  ? 42.615 -11.424 -4.915  1.00 62.95  ? 114 PHE C CE1 1 
ATOM   4638 C CE2 . PHE C 1 73  ? 43.334 -13.650 -5.447  1.00 69.51  ? 114 PHE C CE2 1 
ATOM   4639 C CZ  . PHE C 1 73  ? 42.630 -12.495 -5.791  1.00 65.12  ? 114 PHE C CZ  1 
ATOM   4640 N N   . GLU C 1 74  ? 45.923 -14.116 0.425   1.00 71.74  ? 115 GLU C N   1 
ATOM   4641 C CA  . GLU C 1 74  ? 47.007 -14.117 1.390   1.00 75.95  ? 115 GLU C CA  1 
ATOM   4642 C C   . GLU C 1 74  ? 48.076 -13.328 0.624   1.00 78.29  ? 115 GLU C C   1 
ATOM   4643 O O   . GLU C 1 74  ? 48.330 -13.625 -0.549  1.00 80.61  ? 115 GLU C O   1 
ATOM   4644 C CB  . GLU C 1 74  ? 47.457 -15.545 1.606   1.00 81.84  ? 115 GLU C CB  1 
ATOM   4645 C CG  . GLU C 1 74  ? 48.456 -15.732 2.698   1.00 85.45  ? 115 GLU C CG  1 
ATOM   4646 C CD  . GLU C 1 74  ? 48.550 -17.188 3.081   1.00 92.05  ? 115 GLU C CD  1 
ATOM   4647 O OE1 . GLU C 1 74  ? 48.909 -17.471 4.254   1.00 85.50  ? 115 GLU C OE1 1 
ATOM   4648 O OE2 . GLU C 1 74  ? 48.254 -18.039 2.198   1.00 89.32  ? 115 GLU C OE2 1 
ATOM   4649 N N   . ALA C 1 75  ? 48.700 -12.335 1.251   1.00 75.41  ? 116 ALA C N   1 
ATOM   4650 C CA  . ALA C 1 75  ? 49.687 -11.521 0.536   1.00 71.03  ? 116 ALA C CA  1 
ATOM   4651 C C   . ALA C 1 75  ? 51.159 -11.740 0.867   1.00 72.93  ? 116 ALA C C   1 
ATOM   4652 O O   . ALA C 1 75  ? 51.526 -12.013 2.012   1.00 74.16  ? 116 ALA C O   1 
ATOM   4653 C CB  . ALA C 1 75  ? 49.350 -10.047 0.703   1.00 63.38  ? 116 ALA C CB  1 
ATOM   4654 N N   . LEU C 1 76  ? 52.005 -11.578 -0.144  1.00 66.39  ? 117 LEU C N   1 
ATOM   4655 C CA  . LEU C 1 76  ? 53.434 -11.755 0.039   1.00 69.12  ? 117 LEU C CA  1 
ATOM   4656 C C   . LEU C 1 76  ? 54.154 -10.427 0.205   1.00 66.87  ? 117 LEU C C   1 
ATOM   4657 O O   . LEU C 1 76  ? 54.082 -9.563  -0.650  1.00 66.68  ? 117 LEU C O   1 
ATOM   4658 C CB  . LEU C 1 76  ? 54.014 -12.520 -1.166  1.00 75.65  ? 117 LEU C CB  1 
ATOM   4659 C CG  . LEU C 1 76  ? 55.535 -12.522 -1.357  1.00 80.37  ? 117 LEU C CG  1 
ATOM   4660 C CD1 . LEU C 1 76  ? 56.199 -13.370 -0.273  1.00 79.09  ? 117 LEU C CD1 1 
ATOM   4661 C CD2 . LEU C 1 76  ? 55.867 -13.036 -2.754  1.00 77.67  ? 117 LEU C CD2 1 
ATOM   4662 N N   . LEU C 1 77  ? 54.857 -10.254 1.310   1.00 68.73  ? 118 LEU C N   1 
ATOM   4663 C CA  . LEU C 1 77  ? 55.584 -9.011  1.507   1.00 68.06  ? 118 LEU C CA  1 
ATOM   4664 C C   . LEU C 1 77  ? 56.812 -9.062  0.611   1.00 69.10  ? 118 LEU C C   1 
ATOM   4665 O O   . LEU C 1 77  ? 57.733 -9.828  0.885   1.00 77.61  ? 118 LEU C O   1 
ATOM   4666 C CB  . LEU C 1 77  ? 56.022 -8.863  2.971   1.00 58.03  ? 118 LEU C CB  1 
ATOM   4667 C CG  . LEU C 1 77  ? 57.028 -7.721  3.131   1.00 63.61  ? 118 LEU C CG  1 
ATOM   4668 C CD1 . LEU C 1 77  ? 56.318 -6.391  2.940   1.00 65.94  ? 118 LEU C CD1 1 
ATOM   4669 C CD2 . LEU C 1 77  ? 57.672 -7.781  4.482   1.00 65.32  ? 118 LEU C CD2 1 
ATOM   4670 N N   . VAL C 1 78  ? 56.857 -8.263  -0.449  1.00 69.38  ? 119 VAL C N   1 
ATOM   4671 C CA  . VAL C 1 78  ? 58.035 -8.336  -1.301  1.00 66.96  ? 119 VAL C CA  1 
ATOM   4672 C C   . VAL C 1 78  ? 59.142 -7.362  -0.911  1.00 69.03  ? 119 VAL C C   1 
ATOM   4673 O O   . VAL C 1 78  ? 60.307 -7.562  -1.276  1.00 70.35  ? 119 VAL C O   1 
ATOM   4674 C CB  . VAL C 1 78  ? 57.701 -8.184  -2.844  1.00 61.71  ? 119 VAL C CB  1 
ATOM   4675 C CG1 . VAL C 1 78  ? 56.202 -8.321  -3.104  1.00 50.07  ? 119 VAL C CG1 1 
ATOM   4676 C CG2 . VAL C 1 78  ? 58.285 -6.898  -3.390  1.00 58.80  ? 119 VAL C CG2 1 
ATOM   4677 N N   . GLY C 1 79  ? 58.801 -6.320  -0.161  1.00 67.18  ? 120 GLY C N   1 
ATOM   4678 C CA  . GLY C 1 79  ? 59.828 -5.367  0.230   1.00 66.65  ? 120 GLY C CA  1 
ATOM   4679 C C   . GLY C 1 79  ? 59.258 -4.155  0.933   1.00 69.37  ? 120 GLY C C   1 
ATOM   4680 O O   . GLY C 1 79  ? 58.061 -3.944  0.902   1.00 65.67  ? 120 GLY C O   1 
ATOM   4681 N N   . SER C 1 80  ? 60.115 -3.357  1.560   1.00 71.66  ? 121 SER C N   1 
ATOM   4682 C CA  . SER C 1 80  ? 59.657 -2.173  2.273   1.00 76.13  ? 121 SER C CA  1 
ATOM   4683 C C   . SER C 1 80  ? 60.802 -1.186  2.464   1.00 78.09  ? 121 SER C C   1 
ATOM   4684 O O   . SER C 1 80  ? 61.972 -1.572  2.419   1.00 84.95  ? 121 SER C O   1 
ATOM   4685 C CB  . SER C 1 80  ? 59.117 -2.562  3.644   1.00 77.66  ? 121 SER C CB  1 
ATOM   4686 O OG  . SER C 1 80  ? 60.168 -2.574  4.594   1.00 82.94  ? 121 SER C OG  1 
ATOM   4687 N N   . ASP C 1 81  ? 60.472 0.086   2.671   1.00 75.33  ? 122 ASP C N   1 
ATOM   4688 C CA  . ASP C 1 81  ? 61.498 1.093   2.878   1.00 81.52  ? 122 ASP C CA  1 
ATOM   4689 C C   . ASP C 1 81  ? 61.103 2.022   4.011   1.00 87.56  ? 122 ASP C C   1 
ATOM   4690 O O   . ASP C 1 81  ? 60.032 2.628   4.003   1.00 90.63  ? 122 ASP C O   1 
ATOM   4691 C CB  . ASP C 1 81  ? 61.747 1.900   1.606   1.00 80.15  ? 122 ASP C CB  1 
ATOM   4692 C CG  . ASP C 1 81  ? 62.900 2.876   1.760   1.00 87.18  ? 122 ASP C CG  1 
ATOM   4693 O OD1 . ASP C 1 81  ? 64.033 2.421   2.011   1.00 93.56  ? 122 ASP C OD1 1 
ATOM   4694 O OD2 . ASP C 1 81  ? 62.683 4.099   1.638   1.00 88.34  ? 122 ASP C OD2 1 
ATOM   4695 N N   . SER C 1 82  ? 61.991 2.136   4.984   1.00 93.64  ? 123 SER C N   1 
ATOM   4696 C CA  . SER C 1 82  ? 61.746 2.961   6.154   1.00 97.75  ? 123 SER C CA  1 
ATOM   4697 C C   . SER C 1 82  ? 61.771 4.449   5.870   1.00 97.24  ? 123 SER C C   1 
ATOM   4698 O O   . SER C 1 82  ? 61.115 5.217   6.573   1.00 95.46  ? 123 SER C O   1 
ATOM   4699 C CB  . SER C 1 82  ? 62.780 2.642   7.237   1.00 100.67 ? 123 SER C CB  1 
ATOM   4700 O OG  . SER C 1 82  ? 62.770 1.260   7.559   1.00 105.75 ? 123 SER C OG  1 
ATOM   4701 N N   . LEU C 1 83  ? 62.526 4.858   4.852   1.00 97.32  ? 124 LEU C N   1 
ATOM   4702 C CA  . LEU C 1 83  ? 62.636 6.280   4.519   1.00 96.49  ? 124 LEU C CA  1 
ATOM   4703 C C   . LEU C 1 83  ? 61.417 6.900   3.835   1.00 92.50  ? 124 LEU C C   1 
ATOM   4704 O O   . LEU C 1 83  ? 61.165 8.093   3.987   1.00 91.99  ? 124 LEU C O   1 
ATOM   4705 C CB  . LEU C 1 83  ? 63.882 6.540   3.661   1.00 100.32 ? 124 LEU C CB  1 
ATOM   4706 C CG  . LEU C 1 83  ? 65.261 6.272   4.276   1.00 104.84 ? 124 LEU C CG  1 
ATOM   4707 C CD1 . LEU C 1 83  ? 66.300 7.043   3.471   1.00 103.09 ? 124 LEU C CD1 1 
ATOM   4708 C CD2 . LEU C 1 83  ? 65.303 6.720   5.734   1.00 103.08 ? 124 LEU C CD2 1 
ATOM   4709 N N   . THR C 1 84  ? 60.670 6.097   3.080   1.00 88.85  ? 125 THR C N   1 
ATOM   4710 C CA  . THR C 1 84  ? 59.479 6.585   2.391   1.00 85.07  ? 125 THR C CA  1 
ATOM   4711 C C   . THR C 1 84  ? 58.236 5.935   2.972   1.00 82.84  ? 125 THR C C   1 
ATOM   4712 O O   . THR C 1 84  ? 57.126 6.162   2.497   1.00 84.81  ? 125 THR C O   1 
ATOM   4713 C CB  . THR C 1 84  ? 59.512 6.259   0.878   1.00 87.06  ? 125 THR C CB  1 
ATOM   4714 O OG1 . THR C 1 84  ? 59.369 4.843   0.682   1.00 84.46  ? 125 THR C OG1 1 
ATOM   4715 C CG2 . THR C 1 84  ? 60.822 6.735   0.262   1.00 80.92  ? 125 THR C CG2 1 
ATOM   4716 N N   . ASP C 1 85  ? 58.428 5.119   4.000   1.00 78.95  ? 126 ASP C N   1 
ATOM   4717 C CA  . ASP C 1 85  ? 57.326 4.419   4.626   1.00 73.81  ? 126 ASP C CA  1 
ATOM   4718 C C   . ASP C 1 85  ? 56.462 3.768   3.541   1.00 70.98  ? 126 ASP C C   1 
ATOM   4719 O O   . ASP C 1 85  ? 55.238 3.770   3.597   1.00 71.63  ? 126 ASP C O   1 
ATOM   4720 C CB  . ASP C 1 85  ? 56.525 5.387   5.498   1.00 72.52  ? 126 ASP C CB  1 
ATOM   4721 C CG  . ASP C 1 85  ? 55.370 4.710   6.220   1.00 78.59  ? 126 ASP C CG  1 
ATOM   4722 O OD1 . ASP C 1 85  ? 55.598 3.674   6.869   1.00 80.42  ? 126 ASP C OD1 1 
ATOM   4723 O OD2 . ASP C 1 85  ? 54.230 5.218   6.146   1.00 85.21  ? 126 ASP C OD2 1 
ATOM   4724 N N   . LEU C 1 86  ? 57.137 3.204   2.546   1.00 74.07  ? 127 LEU C N   1 
ATOM   4725 C CA  . LEU C 1 86  ? 56.478 2.515   1.432   1.00 75.23  ? 127 LEU C CA  1 
ATOM   4726 C C   . LEU C 1 86  ? 56.640 0.997   1.555   1.00 72.75  ? 127 LEU C C   1 
ATOM   4727 O O   . LEU C 1 86  ? 57.519 0.518   2.259   1.00 73.53  ? 127 LEU C O   1 
ATOM   4728 C CB  . LEU C 1 86  ? 57.061 2.970   0.089   1.00 70.46  ? 127 LEU C CB  1 
ATOM   4729 C CG  . LEU C 1 86  ? 56.387 4.185   -0.549  1.00 79.47  ? 127 LEU C CG  1 
ATOM   4730 C CD1 . LEU C 1 86  ? 56.870 4.340   -1.988  1.00 79.92  ? 127 LEU C CD1 1 
ATOM   4731 C CD2 . LEU C 1 86  ? 54.868 3.993   -0.527  1.00 76.06  ? 127 LEU C CD2 1 
ATOM   4732 N N   . ALA C 1 87  ? 55.798 0.242   0.870   1.00 64.96  ? 128 ALA C N   1 
ATOM   4733 C CA  . ALA C 1 87  ? 55.919 -1.194  0.945   1.00 65.12  ? 128 ALA C CA  1 
ATOM   4734 C C   . ALA C 1 87  ? 55.172 -1.886  -0.179  1.00 67.18  ? 128 ALA C C   1 
ATOM   4735 O O   . ALA C 1 87  ? 54.024 -1.540  -0.475  1.00 67.26  ? 128 ALA C O   1 
ATOM   4736 C CB  . ALA C 1 87  ? 55.414 -1.686  2.290   1.00 61.39  ? 128 ALA C CB  1 
ATOM   4737 N N   . VAL C 1 88  ? 55.829 -2.867  -0.804  1.00 63.61  ? 129 VAL C N   1 
ATOM   4738 C CA  . VAL C 1 88  ? 55.216 -3.618  -1.878  1.00 59.33  ? 129 VAL C CA  1 
ATOM   4739 C C   . VAL C 1 88  ? 54.818 -5.013  -1.410  1.00 63.76  ? 129 VAL C C   1 
ATOM   4740 O O   . VAL C 1 88  ? 55.490 -5.631  -0.579  1.00 71.54  ? 129 VAL C O   1 
ATOM   4741 C CB  . VAL C 1 88  ? 56.150 -3.734  -3.094  1.00 59.91  ? 129 VAL C CB  1 
ATOM   4742 C CG1 . VAL C 1 88  ? 55.373 -4.295  -4.304  1.00 53.87  ? 129 VAL C CG1 1 
ATOM   4743 C CG2 . VAL C 1 88  ? 56.738 -2.365  -3.415  1.00 60.78  ? 129 VAL C CG2 1 
ATOM   4744 N N   . LEU C 1 89  ? 53.701 -5.484  -1.950  1.00 61.88  ? 130 LEU C N   1 
ATOM   4745 C CA  . LEU C 1 89  ? 53.132 -6.776  -1.652  1.00 55.13  ? 130 LEU C CA  1 
ATOM   4746 C C   . LEU C 1 89  ? 52.825 -7.397  -2.992  1.00 64.62  ? 130 LEU C C   1 
ATOM   4747 O O   . LEU C 1 89  ? 52.904 -6.717  -4.024  1.00 61.03  ? 130 LEU C O   1 
ATOM   4748 C CB  . LEU C 1 89  ? 51.808 -6.631  -0.914  1.00 57.03  ? 130 LEU C CB  1 
ATOM   4749 C CG  . LEU C 1 89  ? 51.747 -5.782  0.354   1.00 62.22  ? 130 LEU C CG  1 
ATOM   4750 C CD1 . LEU C 1 89  ? 50.319 -5.838  0.859   1.00 55.90  ? 130 LEU C CD1 1 
ATOM   4751 C CD2 . LEU C 1 89  ? 52.726 -6.287  1.420   1.00 52.20  ? 130 LEU C CD2 1 
ATOM   4752 N N   . LYS C 1 90  ? 52.461 -8.683  -2.967  1.00 65.79  ? 131 LYS C N   1 
ATOM   4753 C CA  . LYS C 1 90  ? 52.109 -9.406  -4.174  1.00 62.22  ? 131 LYS C CA  1 
ATOM   4754 C C   . LYS C 1 90  ? 51.038 -10.431 -3.906  1.00 59.58  ? 131 LYS C C   1 
ATOM   4755 O O   . LYS C 1 90  ? 51.095 -11.168 -2.923  1.00 60.15  ? 131 LYS C O   1 
ATOM   4756 C CB  . LYS C 1 90  ? 53.320 -10.100 -4.797  1.00 63.78  ? 131 LYS C CB  1 
ATOM   4757 C CG  . LYS C 1 90  ? 52.947 -10.715 -6.129  1.00 62.97  ? 131 LYS C CG  1 
ATOM   4758 C CD  . LYS C 1 90  ? 54.137 -10.927 -7.007  1.00 63.53  ? 131 LYS C CD  1 
ATOM   4759 C CE  . LYS C 1 90  ? 53.742 -11.677 -8.265  1.00 61.89  ? 131 LYS C CE  1 
ATOM   4760 N NZ  . LYS C 1 90  ? 54.953 -11.977 -9.094  1.00 76.91  ? 131 LYS C NZ  1 
ATOM   4761 N N   . ILE C 1 91  ? 50.048 -10.455 -4.790  1.00 63.43  ? 132 ILE C N   1 
ATOM   4762 C CA  . ILE C 1 91  ? 48.949 -11.373 -4.662  1.00 63.00  ? 132 ILE C CA  1 
ATOM   4763 C C   . ILE C 1 91  ? 48.838 -12.205 -5.903  1.00 74.02  ? 132 ILE C C   1 
ATOM   4764 O O   . ILE C 1 91  ? 48.690 -11.697 -7.021  1.00 73.68  ? 132 ILE C O   1 
ATOM   4765 C CB  . ILE C 1 91  ? 47.605 -10.657 -4.420  1.00 67.04  ? 132 ILE C CB  1 
ATOM   4766 C CG1 . ILE C 1 91  ? 47.324 -9.670  -5.543  1.00 65.16  ? 132 ILE C CG1 1 
ATOM   4767 C CG2 . ILE C 1 91  ? 47.614 -9.990  -3.032  1.00 65.20  ? 132 ILE C CG2 1 
ATOM   4768 C CD1 . ILE C 1 91  ? 45.812 -9.442  -5.802  1.00 66.86  ? 132 ILE C CD1 1 
ATOM   4769 N N   . ASN C 1 92  ? 48.904 -13.512 -5.687  1.00 82.66  ? 133 ASN C N   1 
ATOM   4770 C CA  . ASN C 1 92  ? 48.854 -14.460 -6.773  1.00 85.43  ? 133 ASN C CA  1 
ATOM   4771 C C   . ASN C 1 92  ? 47.449 -14.614 -7.306  1.00 85.13  ? 133 ASN C C   1 
ATOM   4772 O O   . ASN C 1 92  ? 46.731 -15.552 -6.959  1.00 80.32  ? 133 ASN C O   1 
ATOM   4773 C CB  . ASN C 1 92  ? 49.446 -15.795 -6.312  1.00 82.54  ? 133 ASN C CB  1 
ATOM   4774 C CG  . ASN C 1 92  ? 50.791 -15.615 -5.627  1.00 85.38  ? 133 ASN C CG  1 
ATOM   4775 O OD1 . ASN C 1 92  ? 51.717 -15.015 -6.182  1.00 82.02  ? 133 ASN C OD1 1 
ATOM   4776 N ND2 . ASN C 1 92  ? 50.899 -16.118 -4.405  1.00 87.62  ? 133 ASN C ND2 1 
ATOM   4777 N N   . ALA C 1 93  ? 47.074 -13.668 -8.163  1.00 87.67  ? 134 ALA C N   1 
ATOM   4778 C CA  . ALA C 1 93  ? 45.762 -13.689 -8.774  1.00 96.13  ? 134 ALA C CA  1 
ATOM   4779 C C   . ALA C 1 93  ? 45.761 -13.681 -10.299 1.00 102.08 ? 134 ALA C C   1 
ATOM   4780 O O   . ALA C 1 93  ? 46.176 -12.718 -10.966 1.00 101.19 ? 134 ALA C O   1 
ATOM   4781 C CB  . ALA C 1 93  ? 44.923 -12.542 -8.255  1.00 94.26  ? 134 ALA C CB  1 
ATOM   4782 N N   . THR C 1 94  ? 45.301 -14.799 -10.838 1.00 105.86 ? 135 THR C N   1 
ATOM   4783 C CA  . THR C 1 94  ? 45.139 -14.973 -12.267 1.00 106.17 ? 135 THR C CA  1 
ATOM   4784 C C   . THR C 1 94  ? 43.667 -14.603 -12.399 1.00 105.50 ? 135 THR C C   1 
ATOM   4785 O O   . THR C 1 94  ? 43.065 -14.135 -11.432 1.00 108.28 ? 135 THR C O   1 
ATOM   4786 C CB  . THR C 1 94  ? 45.355 -16.444 -12.669 1.00 108.65 ? 135 THR C CB  1 
ATOM   4787 O OG1 . THR C 1 94  ? 44.761 -17.295 -11.674 1.00 105.22 ? 135 THR C OG1 1 
ATOM   4788 C CG2 . THR C 1 94  ? 46.855 -16.754 -12.800 1.00 107.47 ? 135 THR C CG2 1 
ATOM   4789 N N   . GLY C 1 95  ? 43.066 -14.819 -13.559 1.00 104.52 ? 136 GLY C N   1 
ATOM   4790 C CA  . GLY C 1 95  ? 41.667 -14.456 -13.693 1.00 98.70  ? 136 GLY C CA  1 
ATOM   4791 C C   . GLY C 1 95  ? 41.517 -12.955 -13.878 1.00 92.99  ? 136 GLY C C   1 
ATOM   4792 O O   . GLY C 1 95  ? 40.414 -12.466 -14.124 1.00 95.94  ? 136 GLY C O   1 
ATOM   4793 N N   . GLY C 1 96  ? 42.630 -12.230 -13.751 1.00 84.81  ? 137 GLY C N   1 
ATOM   4794 C CA  . GLY C 1 96  ? 42.620 -10.790 -13.939 1.00 73.73  ? 137 GLY C CA  1 
ATOM   4795 C C   . GLY C 1 96  ? 42.449 -9.929  -12.700 1.00 69.53  ? 137 GLY C C   1 
ATOM   4796 O O   . GLY C 1 96  ? 41.664 -10.249 -11.816 1.00 68.79  ? 137 GLY C O   1 
ATOM   4797 N N   . LEU C 1 97  ? 43.201 -8.834  -12.646 1.00 64.34  ? 138 LEU C N   1 
ATOM   4798 C CA  . LEU C 1 97  ? 43.129 -7.895  -11.542 1.00 66.09  ? 138 LEU C CA  1 
ATOM   4799 C C   . LEU C 1 97  ? 42.800 -6.486  -12.035 1.00 68.16  ? 138 LEU C C   1 
ATOM   4800 O O   . LEU C 1 97  ? 43.260 -6.057  -13.098 1.00 68.33  ? 138 LEU C O   1 
ATOM   4801 C CB  . LEU C 1 97  ? 44.451 -7.864  -10.770 1.00 61.10  ? 138 LEU C CB  1 
ATOM   4802 C CG  . LEU C 1 97  ? 44.818 -9.094  -9.933  1.00 64.96  ? 138 LEU C CG  1 
ATOM   4803 C CD1 . LEU C 1 97  ? 46.055 -8.778  -9.107  1.00 64.80  ? 138 LEU C CD1 1 
ATOM   4804 C CD2 . LEU C 1 97  ? 43.660 -9.484  -9.005  1.00 64.07  ? 138 LEU C CD2 1 
ATOM   4805 N N   . PRO C 1 98  ? 41.984 -5.743  -11.272 1.00 67.80  ? 139 PRO C N   1 
ATOM   4806 C CA  . PRO C 1 98  ? 41.642 -4.384  -11.687 1.00 60.89  ? 139 PRO C CA  1 
ATOM   4807 C C   . PRO C 1 98  ? 42.870 -3.575  -11.342 1.00 56.71  ? 139 PRO C C   1 
ATOM   4808 O O   . PRO C 1 98  ? 43.473 -3.800  -10.304 1.00 57.12  ? 139 PRO C O   1 
ATOM   4809 C CB  . PRO C 1 98  ? 40.452 -4.058  -10.800 1.00 61.81  ? 139 PRO C CB  1 
ATOM   4810 C CG  . PRO C 1 98  ? 40.841 -4.690  -9.538  1.00 67.63  ? 139 PRO C CG  1 
ATOM   4811 C CD  . PRO C 1 98  ? 41.360 -6.057  -9.976  1.00 70.84  ? 139 PRO C CD  1 
ATOM   4812 N N   . THR C 1 99  ? 43.254 -2.651  -12.213 1.00 59.63  ? 140 THR C N   1 
ATOM   4813 C CA  . THR C 1 99  ? 44.456 -1.852  -11.993 1.00 62.67  ? 140 THR C CA  1 
ATOM   4814 C C   . THR C 1 99  ? 44.206 -0.343  -11.873 1.00 57.84  ? 140 THR C C   1 
ATOM   4815 O O   . THR C 1 99  ? 43.207 0.166   -12.359 1.00 62.29  ? 140 THR C O   1 
ATOM   4816 C CB  . THR C 1 99  ? 45.462 -2.127  -13.132 1.00 67.12  ? 140 THR C CB  1 
ATOM   4817 O OG1 . THR C 1 99  ? 45.667 -3.544  -13.237 1.00 75.41  ? 140 THR C OG1 1 
ATOM   4818 C CG2 . THR C 1 99  ? 46.806 -1.471  -12.834 1.00 77.69  ? 140 THR C CG2 1 
ATOM   4819 N N   . ILE C 1 100 ? 45.136 0.363   -11.244 1.00 52.49  ? 141 ILE C N   1 
ATOM   4820 C CA  . ILE C 1 100 ? 45.012 1.794   -11.032 1.00 53.63  ? 141 ILE C CA  1 
ATOM   4821 C C   . ILE C 1 100 ? 45.502 2.615   -12.191 1.00 58.43  ? 141 ILE C C   1 
ATOM   4822 O O   . ILE C 1 100 ? 46.630 2.454   -12.643 1.00 61.99  ? 141 ILE C O   1 
ATOM   4823 C CB  . ILE C 1 100 ? 45.803 2.258   -9.775  1.00 59.75  ? 141 ILE C CB  1 
ATOM   4824 C CG1 . ILE C 1 100 ? 45.241 3.585   -9.274  1.00 52.73  ? 141 ILE C CG1 1 
ATOM   4825 C CG2 . ILE C 1 100 ? 47.312 2.379   -10.086 1.00 48.75  ? 141 ILE C CG2 1 
ATOM   4826 C CD1 . ILE C 1 100 ? 44.031 3.418   -8.426  1.00 57.55  ? 141 ILE C CD1 1 
ATOM   4827 N N   . PRO C 1 101 ? 44.654 3.519   -12.692 1.00 61.38  ? 142 PRO C N   1 
ATOM   4828 C CA  . PRO C 1 101 ? 45.078 4.348   -13.806 1.00 57.74  ? 142 PRO C CA  1 
ATOM   4829 C C   . PRO C 1 101 ? 46.362 5.091   -13.469 1.00 62.45  ? 142 PRO C C   1 
ATOM   4830 O O   . PRO C 1 101 ? 46.477 5.769   -12.444 1.00 64.22  ? 142 PRO C O   1 
ATOM   4831 C CB  . PRO C 1 101 ? 43.889 5.267   -14.003 1.00 57.74  ? 142 PRO C CB  1 
ATOM   4832 C CG  . PRO C 1 101 ? 42.729 4.329   -13.723 1.00 57.98  ? 142 PRO C CG  1 
ATOM   4833 C CD  . PRO C 1 101 ? 43.200 3.653   -12.463 1.00 64.85  ? 142 PRO C CD  1 
ATOM   4834 N N   . ILE C 1 102 ? 47.343 4.947   -14.340 1.00 65.13  ? 143 ILE C N   1 
ATOM   4835 C CA  . ILE C 1 102 ? 48.614 5.605   -14.138 1.00 69.75  ? 143 ILE C CA  1 
ATOM   4836 C C   . ILE C 1 102 ? 48.855 6.464   -15.383 1.00 71.93  ? 143 ILE C C   1 
ATOM   4837 O O   . ILE C 1 102 ? 48.415 6.117   -16.480 1.00 74.39  ? 143 ILE C O   1 
ATOM   4838 C CB  . ILE C 1 102 ? 49.734 4.554   -14.001 1.00 72.27  ? 143 ILE C CB  1 
ATOM   4839 C CG1 . ILE C 1 102 ? 50.900 5.131   -13.220 1.00 68.17  ? 143 ILE C CG1 1 
ATOM   4840 C CG2 . ILE C 1 102 ? 50.173 4.066   -15.384 1.00 81.16  ? 143 ILE C CG2 1 
ATOM   4841 C CD1 . ILE C 1 102 ? 50.911 4.646   -11.805 1.00 65.38  ? 143 ILE C CD1 1 
ATOM   4842 N N   . ASN C 1 103 ? 49.526 7.594   -15.203 1.00 68.19  ? 144 ASN C N   1 
ATOM   4843 C CA  . ASN C 1 103 ? 49.855 8.485   -16.306 1.00 59.74  ? 144 ASN C CA  1 
ATOM   4844 C C   . ASN C 1 103 ? 51.126 9.201   -15.882 1.00 59.82  ? 144 ASN C C   1 
ATOM   4845 O O   . ASN C 1 103 ? 51.083 10.257  -15.236 1.00 53.85  ? 144 ASN C O   1 
ATOM   4846 C CB  . ASN C 1 103 ? 48.751 9.490   -16.549 1.00 60.65  ? 144 ASN C CB  1 
ATOM   4847 C CG  . ASN C 1 103 ? 49.072 10.432  -17.699 1.00 69.03  ? 144 ASN C CG  1 
ATOM   4848 O OD1 . ASN C 1 103 ? 50.247 10.624  -18.049 1.00 64.73  ? 144 ASN C OD1 1 
ATOM   4849 N ND2 . ASN C 1 103 ? 48.029 11.046  -18.283 1.00 58.93  ? 144 ASN C ND2 1 
ATOM   4850 N N   . ALA C 1 104 ? 52.261 8.597   -16.235 1.00 57.74  ? 145 ALA C N   1 
ATOM   4851 C CA  . ALA C 1 104 ? 53.570 9.133   -15.884 1.00 58.03  ? 145 ALA C CA  1 
ATOM   4852 C C   . ALA C 1 104 ? 53.853 10.494  -16.503 1.00 56.48  ? 145 ALA C C   1 
ATOM   4853 O O   . ALA C 1 104 ? 54.722 11.198  -16.026 1.00 57.38  ? 145 ALA C O   1 
ATOM   4854 C CB  . ALA C 1 104 ? 54.667 8.139   -16.277 1.00 52.30  ? 145 ALA C CB  1 
ATOM   4855 N N   . ARG C 1 105 ? 53.135 10.867  -17.560 1.00 59.99  ? 146 ARG C N   1 
ATOM   4856 C CA  . ARG C 1 105 ? 53.369 12.165  -18.191 1.00 67.68  ? 146 ARG C CA  1 
ATOM   4857 C C   . ARG C 1 105 ? 52.597 13.320  -17.529 1.00 71.73  ? 146 ARG C C   1 
ATOM   4858 O O   . ARG C 1 105 ? 52.669 14.465  -17.983 1.00 74.55  ? 146 ARG C O   1 
ATOM   4859 C CB  . ARG C 1 105 ? 53.010 12.110  -19.675 1.00 73.52  ? 146 ARG C CB  1 
ATOM   4860 C CG  . ARG C 1 105 ? 53.923 11.235  -20.532 1.00 84.61  ? 146 ARG C CG  1 
ATOM   4861 C CD  . ARG C 1 105 ? 54.030 11.801  -21.943 1.00 90.70  ? 146 ARG C CD  1 
ATOM   4862 N NE  . ARG C 1 105 ? 54.585 13.158  -21.901 1.00 100.12 ? 146 ARG C NE  1 
ATOM   4863 C CZ  . ARG C 1 105 ? 54.300 14.123  -22.774 1.00 101.77 ? 146 ARG C CZ  1 
ATOM   4864 N NH1 . ARG C 1 105 ? 53.461 13.892  -23.781 1.00 103.59 ? 146 ARG C NH1 1 
ATOM   4865 N NH2 . ARG C 1 105 ? 54.826 15.333  -22.619 1.00 96.50  ? 146 ARG C NH2 1 
ATOM   4866 N N   . ARG C 1 106 ? 51.881 13.032  -16.445 1.00 69.69  ? 147 ARG C N   1 
ATOM   4867 C CA  . ARG C 1 106 ? 51.097 14.059  -15.772 1.00 61.02  ? 147 ARG C CA  1 
ATOM   4868 C C   . ARG C 1 106 ? 51.773 14.741  -14.612 1.00 63.18  ? 147 ARG C C   1 
ATOM   4869 O O   . ARG C 1 106 ? 52.265 14.094  -13.696 1.00 63.77  ? 147 ARG C O   1 
ATOM   4870 C CB  . ARG C 1 106 ? 49.785 13.467  -15.271 1.00 60.99  ? 147 ARG C CB  1 
ATOM   4871 C CG  . ARG C 1 106 ? 48.792 14.479  -14.728 1.00 51.92  ? 147 ARG C CG  1 
ATOM   4872 C CD  . ARG C 1 106 ? 47.435 14.235  -15.376 1.00 54.26  ? 147 ARG C CD  1 
ATOM   4873 N NE  . ARG C 1 106 ? 47.181 15.129  -16.495 1.00 55.36  ? 147 ARG C NE  1 
ATOM   4874 C CZ  . ARG C 1 106 ? 46.523 14.794  -17.598 1.00 54.88  ? 147 ARG C CZ  1 
ATOM   4875 N NH1 . ARG C 1 106 ? 46.041 13.573  -17.770 1.00 52.01  ? 147 ARG C NH1 1 
ATOM   4876 N NH2 . ARG C 1 106 ? 46.338 15.701  -18.533 1.00 60.00  ? 147 ARG C NH2 1 
ATOM   4877 N N   . VAL C 1 107 ? 51.781 16.067  -14.644 1.00 66.26  ? 148 VAL C N   1 
ATOM   4878 C CA  . VAL C 1 107 ? 52.354 16.832  -13.555 1.00 62.64  ? 148 VAL C CA  1 
ATOM   4879 C C   . VAL C 1 107 ? 51.191 17.305  -12.699 1.00 68.73  ? 148 VAL C C   1 
ATOM   4880 O O   . VAL C 1 107 ? 50.280 17.990  -13.170 1.00 69.35  ? 148 VAL C O   1 
ATOM   4881 C CB  . VAL C 1 107 ? 53.118 18.043  -14.065 1.00 64.37  ? 148 VAL C CB  1 
ATOM   4882 C CG1 . VAL C 1 107 ? 53.641 18.868  -12.880 1.00 53.67  ? 148 VAL C CG1 1 
ATOM   4883 C CG2 . VAL C 1 107 ? 54.249 17.578  -14.963 1.00 59.33  ? 148 VAL C CG2 1 
ATOM   4884 N N   . PRO C 1 108 ? 51.177 16.897  -11.437 1.00 68.31  ? 149 PRO C N   1 
ATOM   4885 C CA  . PRO C 1 108 ? 50.086 17.317  -10.553 1.00 66.11  ? 149 PRO C CA  1 
ATOM   4886 C C   . PRO C 1 108 ? 50.324 18.759  -10.151 1.00 65.30  ? 149 PRO C C   1 
ATOM   4887 O O   . PRO C 1 108 ? 51.428 19.110  -9.751  1.00 68.23  ? 149 PRO C O   1 
ATOM   4888 C CB  . PRO C 1 108 ? 50.215 16.362  -9.373  1.00 69.18  ? 149 PRO C CB  1 
ATOM   4889 C CG  . PRO C 1 108 ? 50.811 15.131  -10.006 1.00 72.62  ? 149 PRO C CG  1 
ATOM   4890 C CD  . PRO C 1 108 ? 51.859 15.705  -10.918 1.00 70.27  ? 149 PRO C CD  1 
ATOM   4891 N N   . HIS C 1 109 ? 49.299 19.596  -10.263 1.00 63.16  ? 150 HIS C N   1 
ATOM   4892 C CA  . HIS C 1 109 ? 49.439 21.001  -9.894  1.00 57.74  ? 150 HIS C CA  1 
ATOM   4893 C C   . HIS C 1 109 ? 48.687 21.309  -8.629  1.00 53.02  ? 150 HIS C C   1 
ATOM   4894 O O   . HIS C 1 109 ? 47.738 20.613  -8.267  1.00 57.04  ? 150 HIS C O   1 
ATOM   4895 C CB  . HIS C 1 109 ? 48.882 21.919  -10.966 1.00 58.43  ? 150 HIS C CB  1 
ATOM   4896 C CG  . HIS C 1 109 ? 49.368 21.617  -12.342 1.00 65.30  ? 150 HIS C CG  1 
ATOM   4897 N ND1 . HIS C 1 109 ? 50.705 21.570  -12.666 1.00 64.28  ? 150 HIS C ND1 1 
ATOM   4898 C CD2 . HIS C 1 109 ? 48.691 21.407  -13.494 1.00 60.71  ? 150 HIS C CD2 1 
ATOM   4899 C CE1 . HIS C 1 109 ? 50.832 21.349  -13.961 1.00 64.43  ? 150 HIS C CE1 1 
ATOM   4900 N NE2 . HIS C 1 109 ? 49.625 21.247  -14.487 1.00 65.61  ? 150 HIS C NE2 1 
ATOM   4901 N N   . ILE C 1 110 ? 49.096 22.372  -7.954  1.00 54.48  ? 151 ILE C N   1 
ATOM   4902 C CA  . ILE C 1 110 ? 48.391 22.760  -6.752  1.00 58.07  ? 151 ILE C CA  1 
ATOM   4903 C C   . ILE C 1 110 ? 47.001 23.273  -7.167  1.00 53.68  ? 151 ILE C C   1 
ATOM   4904 O O   . ILE C 1 110 ? 46.860 23.993  -8.149  1.00 55.76  ? 151 ILE C O   1 
ATOM   4905 C CB  . ILE C 1 110 ? 49.142 23.838  -6.006  1.00 53.17  ? 151 ILE C CB  1 
ATOM   4906 C CG1 . ILE C 1 110 ? 50.549 23.333  -5.674  1.00 54.68  ? 151 ILE C CG1 1 
ATOM   4907 C CG2 . ILE C 1 110 ? 48.373 24.203  -4.733  1.00 47.33  ? 151 ILE C CG2 1 
ATOM   4908 C CD1 . ILE C 1 110 ? 51.439 24.355  -4.973  1.00 48.58  ? 151 ILE C CD1 1 
ATOM   4909 N N   . GLY C 1 111 ? 45.968 22.873  -6.441  1.00 53.68  ? 152 GLY C N   1 
ATOM   4910 C CA  . GLY C 1 111 ? 44.644 23.322  -6.803  1.00 53.25  ? 152 GLY C CA  1 
ATOM   4911 C C   . GLY C 1 111 ? 43.923 22.239  -7.563  1.00 55.43  ? 152 GLY C C   1 
ATOM   4912 O O   . GLY C 1 111 ? 42.706 22.320  -7.757  1.00 57.69  ? 152 GLY C O   1 
ATOM   4913 N N   . ASP C 1 112 ? 44.672 21.232  -8.007  1.00 49.05  ? 153 ASP C N   1 
ATOM   4914 C CA  . ASP C 1 112 ? 44.069 20.109  -8.697  1.00 48.10  ? 153 ASP C CA  1 
ATOM   4915 C C   . ASP C 1 112 ? 43.143 19.404  -7.738  1.00 50.94  ? 153 ASP C C   1 
ATOM   4916 O O   . ASP C 1 112 ? 43.503 19.150  -6.566  1.00 44.53  ? 153 ASP C O   1 
ATOM   4917 C CB  . ASP C 1 112 ? 45.116 19.092  -9.122  1.00 60.16  ? 153 ASP C CB  1 
ATOM   4918 C CG  . ASP C 1 112 ? 45.765 19.419  -10.441 1.00 69.57  ? 153 ASP C CG  1 
ATOM   4919 O OD1 . ASP C 1 112 ? 45.196 20.218  -11.217 1.00 73.03  ? 153 ASP C OD1 1 
ATOM   4920 O OD2 . ASP C 1 112 ? 46.851 18.844  -10.703 1.00 78.99  ? 153 ASP C OD2 1 
ATOM   4921 N N   . VAL C 1 113 ? 41.960 19.065  -8.235  1.00 52.53  ? 154 VAL C N   1 
ATOM   4922 C CA  . VAL C 1 113 ? 40.965 18.359  -7.433  1.00 44.64  ? 154 VAL C CA  1 
ATOM   4923 C C   . VAL C 1 113 ? 41.415 16.915  -7.244  1.00 47.10  ? 154 VAL C C   1 
ATOM   4924 O O   . VAL C 1 113 ? 41.824 16.277  -8.193  1.00 53.29  ? 154 VAL C O   1 
ATOM   4925 C CB  . VAL C 1 113 ? 39.572 18.364  -8.149  1.00 49.64  ? 154 VAL C CB  1 
ATOM   4926 C CG1 . VAL C 1 113 ? 38.543 17.530  -7.374  1.00 50.05  ? 154 VAL C CG1 1 
ATOM   4927 C CG2 . VAL C 1 113 ? 39.080 19.771  -8.291  1.00 45.66  ? 154 VAL C CG2 1 
ATOM   4928 N N   . VAL C 1 114 ? 41.354 16.390  -6.025  1.00 51.49  ? 155 VAL C N   1 
ATOM   4929 C CA  . VAL C 1 114 ? 41.730 14.997  -5.814  1.00 49.20  ? 155 VAL C CA  1 
ATOM   4930 C C   . VAL C 1 114 ? 40.733 14.232  -4.963  1.00 50.29  ? 155 VAL C C   1 
ATOM   4931 O O   . VAL C 1 114 ? 39.874 14.804  -4.315  1.00 58.75  ? 155 VAL C O   1 
ATOM   4932 C CB  . VAL C 1 114 ? 43.115 14.866  -5.161  1.00 47.02  ? 155 VAL C CB  1 
ATOM   4933 C CG1 . VAL C 1 114 ? 44.193 15.394  -6.119  1.00 49.39  ? 155 VAL C CG1 1 
ATOM   4934 C CG2 . VAL C 1 114 ? 43.149 15.618  -3.853  1.00 37.10  ? 155 VAL C CG2 1 
ATOM   4935 N N   . LEU C 1 115 ? 40.859 12.920  -4.991  1.00 49.88  ? 156 LEU C N   1 
ATOM   4936 C CA  . LEU C 1 115 ? 39.995 12.040  -4.231  1.00 50.43  ? 156 LEU C CA  1 
ATOM   4937 C C   . LEU C 1 115 ? 40.873 10.982  -3.586  1.00 53.34  ? 156 LEU C C   1 
ATOM   4938 O O   . LEU C 1 115 ? 41.688 10.326  -4.276  1.00 44.32  ? 156 LEU C O   1 
ATOM   4939 C CB  . LEU C 1 115 ? 38.992 11.340  -5.143  1.00 50.40  ? 156 LEU C CB  1 
ATOM   4940 C CG  . LEU C 1 115 ? 38.244 12.186  -6.177  1.00 54.74  ? 156 LEU C CG  1 
ATOM   4941 C CD1 . LEU C 1 115 ? 37.484 11.244  -7.094  1.00 53.75  ? 156 LEU C CD1 1 
ATOM   4942 C CD2 . LEU C 1 115 ? 37.260 13.166  -5.490  1.00 42.70  ? 156 LEU C CD2 1 
ATOM   4943 N N   . ALA C 1 116 ? 40.710 10.841  -2.263  1.00 53.24  ? 157 ALA C N   1 
ATOM   4944 C CA  . ALA C 1 116 ? 41.422 9.836   -1.476  1.00 43.96  ? 157 ALA C CA  1 
ATOM   4945 C C   . ALA C 1 116 ? 40.493 8.629   -1.448  1.00 45.47  ? 157 ALA C C   1 
ATOM   4946 O O   . ALA C 1 116 ? 39.302 8.754   -1.162  1.00 51.92  ? 157 ALA C O   1 
ATOM   4947 C CB  . ALA C 1 116 ? 41.694 10.341  -0.067  1.00 44.69  ? 157 ALA C CB  1 
ATOM   4948 N N   . ILE C 1 117 ? 41.034 7.471   -1.815  1.00 48.00  ? 158 ILE C N   1 
ATOM   4949 C CA  . ILE C 1 117 ? 40.298 6.216   -1.819  1.00 46.18  ? 158 ILE C CA  1 
ATOM   4950 C C   . ILE C 1 117 ? 40.916 5.329   -0.732  1.00 46.69  ? 158 ILE C C   1 
ATOM   4951 O O   . ILE C 1 117 ? 42.109 5.085   -0.750  1.00 50.76  ? 158 ILE C O   1 
ATOM   4952 C CB  . ILE C 1 117 ? 40.387 5.548   -3.181  1.00 40.12  ? 158 ILE C CB  1 
ATOM   4953 C CG1 . ILE C 1 117 ? 39.755 6.466   -4.246  1.00 45.29  ? 158 ILE C CG1 1 
ATOM   4954 C CG2 . ILE C 1 117 ? 39.665 4.234   -3.128  1.00 33.21  ? 158 ILE C CG2 1 
ATOM   4955 C CD1 . ILE C 1 117 ? 39.726 5.904   -5.669  1.00 32.52  ? 158 ILE C CD1 1 
ATOM   4956 N N   . GLY C 1 118 ? 40.106 4.888   0.228   1.00 48.92  ? 159 GLY C N   1 
ATOM   4957 C CA  . GLY C 1 118 ? 40.618 4.108   1.342   1.00 47.16  ? 159 GLY C CA  1 
ATOM   4958 C C   . GLY C 1 118 ? 39.610 3.320   2.155   1.00 45.66  ? 159 GLY C C   1 
ATOM   4959 O O   . GLY C 1 118 ? 38.517 3.020   1.689   1.00 55.22  ? 159 GLY C O   1 
ATOM   4960 N N   . ASN C 1 119 ? 39.982 2.970   3.381   1.00 56.63  ? 160 ASN C N   1 
ATOM   4961 C CA  . ASN C 1 119 ? 39.105 2.179   4.249   1.00 60.58  ? 160 ASN C CA  1 
ATOM   4962 C C   . ASN C 1 119 ? 39.200 2.656   5.690   1.00 62.58  ? 160 ASN C C   1 
ATOM   4963 O O   . ASN C 1 119 ? 39.648 1.937   6.574   1.00 69.17  ? 160 ASN C O   1 
ATOM   4964 C CB  . ASN C 1 119 ? 39.492 0.709   4.136   1.00 61.68  ? 160 ASN C CB  1 
ATOM   4965 C CG  . ASN C 1 119 ? 38.610 -0.209  4.956   1.00 60.75  ? 160 ASN C CG  1 
ATOM   4966 O OD1 . ASN C 1 119 ? 37.386 -0.118  4.949   1.00 62.24  ? 160 ASN C OD1 1 
ATOM   4967 N ND2 . ASN C 1 119 ? 39.242 -1.130  5.644   1.00 68.36  ? 160 ASN C ND2 1 
ATOM   4968 N N   . PRO C 1 120 ? 38.729 3.882   5.949   1.00 67.88  ? 161 PRO C N   1 
ATOM   4969 C CA  . PRO C 1 120 ? 38.767 4.466   7.291   1.00 66.79  ? 161 PRO C CA  1 
ATOM   4970 C C   . PRO C 1 120 ? 37.941 3.672   8.289   1.00 61.12  ? 161 PRO C C   1 
ATOM   4971 O O   . PRO C 1 120 ? 36.841 3.207   7.971   1.00 58.35  ? 161 PRO C O   1 
ATOM   4972 C CB  . PRO C 1 120 ? 38.210 5.867   7.054   1.00 62.77  ? 161 PRO C CB  1 
ATOM   4973 C CG  . PRO C 1 120 ? 37.180 5.619   6.060   1.00 58.62  ? 161 PRO C CG  1 
ATOM   4974 C CD  . PRO C 1 120 ? 37.838 4.672   5.078   1.00 67.26  ? 161 PRO C CD  1 
ATOM   4975 N N   . TYR C 1 121 ? 38.482 3.531   9.494   1.00 57.86  ? 162 TYR C N   1 
ATOM   4976 C CA  . TYR C 1 121 ? 37.812 2.804   10.569  1.00 56.02  ? 162 TYR C CA  1 
ATOM   4977 C C   . TYR C 1 121 ? 37.123 1.567   10.032  1.00 63.01  ? 162 TYR C C   1 
ATOM   4978 O O   . TYR C 1 121 ? 36.022 1.222   10.463  1.00 68.03  ? 162 TYR C O   1 
ATOM   4979 C CB  . TYR C 1 121 ? 36.806 3.723   11.279  1.00 47.90  ? 162 TYR C CB  1 
ATOM   4980 C CG  . TYR C 1 121 ? 37.438 5.033   11.690  1.00 53.34  ? 162 TYR C CG  1 
ATOM   4981 C CD1 . TYR C 1 121 ? 37.372 6.142   10.857  1.00 55.80  ? 162 TYR C CD1 1 
ATOM   4982 C CD2 . TYR C 1 121 ? 38.171 5.147   12.882  1.00 53.72  ? 162 TYR C CD2 1 
ATOM   4983 C CE1 . TYR C 1 121 ? 38.009 7.323   11.177  1.00 54.53  ? 162 TYR C CE1 1 
ATOM   4984 C CE2 . TYR C 1 121 ? 38.821 6.339   13.218  1.00 57.22  ? 162 TYR C CE2 1 
ATOM   4985 C CZ  . TYR C 1 121 ? 38.734 7.424   12.351  1.00 61.91  ? 162 TYR C CZ  1 
ATOM   4986 O OH  . TYR C 1 121 ? 39.392 8.612   12.618  1.00 75.19  ? 162 TYR C OH  1 
ATOM   4987 N N   . ASN C 1 122 ? 37.766 0.924   9.055   1.00 66.99  ? 163 ASN C N   1 
ATOM   4988 C CA  . ASN C 1 122 ? 37.249 -0.305  8.465   1.00 60.18  ? 163 ASN C CA  1 
ATOM   4989 C C   . ASN C 1 122 ? 35.743 -0.230  8.197   1.00 57.93  ? 163 ASN C C   1 
ATOM   4990 O O   . ASN C 1 122 ? 35.028 -1.228  8.325   1.00 58.40  ? 163 ASN C O   1 
ATOM   4991 C CB  . ASN C 1 122 ? 37.553 -1.462  9.418   1.00 65.30  ? 163 ASN C CB  1 
ATOM   4992 C CG  . ASN C 1 122 ? 37.545 -2.824  8.742   1.00 71.93  ? 163 ASN C CG  1 
ATOM   4993 O OD1 . ASN C 1 122 ? 37.751 -3.828  9.410   1.00 81.56  ? 163 ASN C OD1 1 
ATOM   4994 N ND2 . ASN C 1 122 ? 37.313 -2.871  7.433   1.00 73.99  ? 163 ASN C ND2 1 
ATOM   4995 N N   . LEU C 1 123 ? 35.260 0.952   7.831   1.00 55.95  ? 164 LEU C N   1 
ATOM   4996 C CA  . LEU C 1 123 ? 33.837 1.126   7.541   1.00 57.70  ? 164 LEU C CA  1 
ATOM   4997 C C   . LEU C 1 123 ? 33.512 0.608   6.160   1.00 55.02  ? 164 LEU C C   1 
ATOM   4998 O O   . LEU C 1 123 ? 32.341 0.405   5.828   1.00 56.23  ? 164 LEU C O   1 
ATOM   4999 C CB  . LEU C 1 123 ? 33.436 2.609   7.604   1.00 57.75  ? 164 LEU C CB  1 
ATOM   5000 C CG  . LEU C 1 123 ? 33.414 3.255   8.999   1.00 59.43  ? 164 LEU C CG  1 
ATOM   5001 C CD1 . LEU C 1 123 ? 33.119 4.723   8.857   1.00 55.70  ? 164 LEU C CD1 1 
ATOM   5002 C CD2 . LEU C 1 123 ? 32.378 2.585   9.895   1.00 56.06  ? 164 LEU C CD2 1 
ATOM   5003 N N   . GLY C 1 124 ? 34.552 0.354   5.370   1.00 52.50  ? 165 GLY C N   1 
ATOM   5004 C CA  . GLY C 1 124 ? 34.345 -0.087  3.997   1.00 54.89  ? 165 GLY C CA  1 
ATOM   5005 C C   . GLY C 1 124 ? 35.026 0.931   3.092   1.00 56.77  ? 165 GLY C C   1 
ATOM   5006 O O   . GLY C 1 124 ? 35.450 1.984   3.567   1.00 61.08  ? 165 GLY C O   1 
ATOM   5007 N N   . GLN C 1 125 ? 35.159 0.645   1.804   1.00 60.94  ? 166 GLN C N   1 
ATOM   5008 C CA  . GLN C 1 125 ? 35.836 1.583   0.906   1.00 54.78  ? 166 GLN C CA  1 
ATOM   5009 C C   . GLN C 1 125 ? 35.131 2.927   0.823   1.00 55.93  ? 166 GLN C C   1 
ATOM   5010 O O   . GLN C 1 125 ? 33.921 2.999   0.550   1.00 54.06  ? 166 GLN C O   1 
ATOM   5011 C CB  . GLN C 1 125 ? 35.953 1.016   -0.507  1.00 53.20  ? 166 GLN C CB  1 
ATOM   5012 C CG  . GLN C 1 125 ? 36.370 2.090   -1.477  1.00 61.31  ? 166 GLN C CG  1 
ATOM   5013 C CD  . GLN C 1 125 ? 36.731 1.577   -2.844  1.00 66.44  ? 166 GLN C CD  1 
ATOM   5014 O OE1 . GLN C 1 125 ? 37.907 1.277   -3.110  1.00 64.49  ? 166 GLN C OE1 1 
ATOM   5015 N NE2 . GLN C 1 125 ? 35.728 1.467   -3.729  1.00 47.63  ? 166 GLN C NE2 1 
ATOM   5016 N N   . THR C 1 126 ? 35.872 4.006   1.034   1.00 50.37  ? 167 THR C N   1 
ATOM   5017 C CA  . THR C 1 126 ? 35.214 5.290   0.944   1.00 53.60  ? 167 THR C CA  1 
ATOM   5018 C C   . THR C 1 126 ? 36.021 6.312   0.171   1.00 54.48  ? 167 THR C C   1 
ATOM   5019 O O   . THR C 1 126 ? 37.282 6.319   0.178   1.00 46.94  ? 167 THR C O   1 
ATOM   5020 C CB  . THR C 1 126 ? 34.786 5.867   2.387   1.00 57.45  ? 167 THR C CB  1 
ATOM   5021 O OG1 . THR C 1 126 ? 35.528 7.046   2.710   1.00 59.82  ? 167 THR C OG1 1 
ATOM   5022 C CG2 . THR C 1 126 ? 35.014 4.877   3.454   1.00 51.67  ? 167 THR C CG2 1 
ATOM   5023 N N   . ILE C 1 127 ? 35.272 7.170   -0.511  1.00 49.71  ? 168 ILE C N   1 
ATOM   5024 C CA  . ILE C 1 127 ? 35.865 8.234   -1.304  1.00 47.25  ? 168 ILE C CA  1 
ATOM   5025 C C   . ILE C 1 127 ? 35.713 9.602   -0.648  1.00 44.04  ? 168 ILE C C   1 
ATOM   5026 O O   . ILE C 1 127 ? 34.615 9.964   -0.205  1.00 50.76  ? 168 ILE C O   1 
ATOM   5027 C CB  . ILE C 1 127 ? 35.194 8.349   -2.714  1.00 43.77  ? 168 ILE C CB  1 
ATOM   5028 C CG1 . ILE C 1 127 ? 34.941 6.970   -3.311  1.00 41.04  ? 168 ILE C CG1 1 
ATOM   5029 C CG2 . ILE C 1 127 ? 36.079 9.210   -3.637  1.00 30.44  ? 168 ILE C CG2 1 
ATOM   5030 C CD1 . ILE C 1 127 ? 36.193 6.103   -3.436  1.00 56.56  ? 168 ILE C CD1 1 
ATOM   5031 N N   . THR C 1 128 ? 36.799 10.366  -0.585  1.00 43.15  ? 169 THR C N   1 
ATOM   5032 C CA  . THR C 1 128 ? 36.714 11.727  -0.068  1.00 44.37  ? 169 THR C CA  1 
ATOM   5033 C C   . THR C 1 128 ? 37.302 12.686  -1.095  1.00 48.29  ? 169 THR C C   1 
ATOM   5034 O O   . THR C 1 128 ? 38.185 12.316  -1.865  1.00 53.35  ? 169 THR C O   1 
ATOM   5035 C CB  . THR C 1 128 ? 37.350 11.896  1.362   1.00 53.37  ? 169 THR C CB  1 
ATOM   5036 O OG1 . THR C 1 128 ? 38.744 11.559  1.369   1.00 52.44  ? 169 THR C OG1 1 
ATOM   5037 C CG2 . THR C 1 128 ? 36.597 11.019  2.343   1.00 41.72  ? 169 THR C CG2 1 
ATOM   5038 N N   . GLN C 1 129 ? 36.767 13.906  -1.131  1.00 51.45  ? 170 GLN C N   1 
ATOM   5039 C CA  . GLN C 1 129 ? 37.166 14.916  -2.097  1.00 49.41  ? 170 GLN C CA  1 
ATOM   5040 C C   . GLN C 1 129 ? 37.921 16.122  -1.526  1.00 50.67  ? 170 GLN C C   1 
ATOM   5041 O O   . GLN C 1 129 ? 37.588 16.634  -0.454  1.00 50.18  ? 170 GLN C O   1 
ATOM   5042 C CB  . GLN C 1 129 ? 35.902 15.367  -2.837  1.00 55.55  ? 170 GLN C CB  1 
ATOM   5043 C CG  . GLN C 1 129 ? 36.119 16.318  -4.017  1.00 53.60  ? 170 GLN C CG  1 
ATOM   5044 C CD  . GLN C 1 129 ? 36.133 17.774  -3.621  1.00 49.69  ? 170 GLN C CD  1 
ATOM   5045 O OE1 . GLN C 1 129 ? 37.131 18.471  -3.817  1.00 51.52  ? 170 GLN C OE1 1 
ATOM   5046 N NE2 . GLN C 1 129 ? 35.012 18.255  -3.074  1.00 52.22  ? 170 GLN C NE2 1 
ATOM   5047 N N   . GLY C 1 130 ? 38.944 16.564  -2.258  1.00 46.17  ? 171 GLY C N   1 
ATOM   5048 C CA  . GLY C 1 130 ? 39.756 17.693  -1.838  1.00 40.31  ? 171 GLY C CA  1 
ATOM   5049 C C   . GLY C 1 130 ? 40.527 18.238  -3.036  1.00 51.58  ? 171 GLY C C   1 
ATOM   5050 O O   . GLY C 1 130 ? 40.100 18.052  -4.196  1.00 49.89  ? 171 GLY C O   1 
ATOM   5051 N N   . ILE C 1 131 ? 41.637 18.935  -2.771  1.00 46.31  ? 172 ILE C N   1 
ATOM   5052 C CA  . ILE C 1 131 ? 42.499 19.473  -3.833  1.00 47.85  ? 172 ILE C CA  1 
ATOM   5053 C C   . ILE C 1 131 ? 43.967 19.295  -3.464  1.00 50.23  ? 172 ILE C C   1 
ATOM   5054 O O   . ILE C 1 131 ? 44.313 19.032  -2.311  1.00 46.93  ? 172 ILE C O   1 
ATOM   5055 C CB  . ILE C 1 131 ? 42.333 21.001  -4.056  1.00 47.68  ? 172 ILE C CB  1 
ATOM   5056 C CG1 . ILE C 1 131 ? 42.462 21.730  -2.719  1.00 39.16  ? 172 ILE C CG1 1 
ATOM   5057 C CG2 . ILE C 1 131 ? 41.047 21.301  -4.819  1.00 47.32  ? 172 ILE C CG2 1 
ATOM   5058 C CD1 . ILE C 1 131 ? 42.901 23.226  -2.842  1.00 45.15  ? 172 ILE C CD1 1 
ATOM   5059 N N   . ILE C 1 132 ? 44.849 19.452  -4.434  1.00 49.91  ? 173 ILE C N   1 
ATOM   5060 C CA  . ILE C 1 132 ? 46.243 19.366  -4.070  1.00 51.97  ? 173 ILE C CA  1 
ATOM   5061 C C   . ILE C 1 132 ? 46.588 20.682  -3.370  1.00 54.31  ? 173 ILE C C   1 
ATOM   5062 O O   . ILE C 1 132 ? 46.605 21.748  -3.991  1.00 55.42  ? 173 ILE C O   1 
ATOM   5063 C CB  . ILE C 1 132 ? 47.139 19.114  -5.297  1.00 51.86  ? 173 ILE C CB  1 
ATOM   5064 C CG1 . ILE C 1 132 ? 46.828 17.712  -5.829  1.00 48.24  ? 173 ILE C CG1 1 
ATOM   5065 C CG2 . ILE C 1 132 ? 48.619 19.256  -4.898  1.00 47.83  ? 173 ILE C CG2 1 
ATOM   5066 C CD1 . ILE C 1 132 ? 47.775 17.162  -6.905  1.00 60.05  ? 173 ILE C CD1 1 
ATOM   5067 N N   . SER C 1 133 ? 46.842 20.601  -2.068  1.00 47.80  ? 174 SER C N   1 
ATOM   5068 C CA  . SER C 1 133 ? 47.142 21.782  -1.272  1.00 50.96  ? 174 SER C CA  1 
ATOM   5069 C C   . SER C 1 133 ? 48.547 22.327  -1.401  1.00 53.37  ? 174 SER C C   1 
ATOM   5070 O O   . SER C 1 133 ? 48.759 23.526  -1.231  1.00 57.27  ? 174 SER C O   1 
ATOM   5071 C CB  . SER C 1 133 ? 46.886 21.511  0.215   1.00 50.57  ? 174 SER C CB  1 
ATOM   5072 O OG  . SER C 1 133 ? 45.512 21.306  0.492   1.00 45.96  ? 174 SER C OG  1 
ATOM   5073 N N   . ALA C 1 134 ? 49.507 21.443  -1.659  1.00 57.94  ? 175 ALA C N   1 
ATOM   5074 C CA  . ALA C 1 134 ? 50.907 21.832  -1.784  1.00 57.02  ? 175 ALA C CA  1 
ATOM   5075 C C   . ALA C 1 134 ? 51.725 20.668  -2.288  1.00 61.11  ? 175 ALA C C   1 
ATOM   5076 O O   . ALA C 1 134 ? 51.267 19.535  -2.270  1.00 64.29  ? 175 ALA C O   1 
ATOM   5077 C CB  . ALA C 1 134 ? 51.442 22.312  -0.434  1.00 55.19  ? 175 ALA C CB  1 
ATOM   5078 N N   . THR C 1 135 ? 52.939 20.961  -2.745  1.00 66.99  ? 176 THR C N   1 
ATOM   5079 C CA  . THR C 1 135 ? 53.848 19.945  -3.278  1.00 65.56  ? 176 THR C CA  1 
ATOM   5080 C C   . THR C 1 135 ? 55.261 20.179  -2.712  1.00 71.98  ? 176 THR C C   1 
ATOM   5081 O O   . THR C 1 135 ? 55.616 21.305  -2.351  1.00 68.36  ? 176 THR C O   1 
ATOM   5082 C CB  . THR C 1 135 ? 53.965 20.036  -4.828  1.00 59.90  ? 176 THR C CB  1 
ATOM   5083 O OG1 . THR C 1 135 ? 54.506 21.307  -5.170  1.00 64.42  ? 176 THR C OG1 1 
ATOM   5084 C CG2 . THR C 1 135 ? 52.631 19.904  -5.518  1.00 49.64  ? 176 THR C CG2 1 
ATOM   5085 N N   . GLY C 1 136 ? 56.055 19.110  -2.641  1.00 76.18  ? 177 GLY C N   1 
ATOM   5086 C CA  . GLY C 1 136 ? 57.421 19.214  -2.159  1.00 79.71  ? 177 GLY C CA  1 
ATOM   5087 C C   . GLY C 1 136 ? 57.562 19.537  -0.690  1.00 86.36  ? 177 GLY C C   1 
ATOM   5088 O O   . GLY C 1 136 ? 58.351 20.395  -0.303  1.00 87.71  ? 177 GLY C O   1 
ATOM   5089 N N   . ARG C 1 137 ? 56.803 18.835  0.138   1.00 94.93  ? 178 ARG C N   1 
ATOM   5090 C CA  . ARG C 1 137 ? 56.846 19.054  1.575   1.00 101.22 ? 178 ARG C CA  1 
ATOM   5091 C C   . ARG C 1 137 ? 57.493 17.910  2.334   1.00 107.65 ? 178 ARG C C   1 
ATOM   5092 O O   . ARG C 1 137 ? 57.627 16.802  1.816   1.00 107.88 ? 178 ARG C O   1 
ATOM   5093 C CB  . ARG C 1 137 ? 55.437 19.282  2.113   1.00 96.72  ? 178 ARG C CB  1 
ATOM   5094 C CG  . ARG C 1 137 ? 54.991 20.711  2.012   1.00 98.41  ? 178 ARG C CG  1 
ATOM   5095 C CD  . ARG C 1 137 ? 53.663 20.889  2.692   1.00 102.86 ? 178 ARG C CD  1 
ATOM   5096 N NE  . ARG C 1 137 ? 53.420 22.259  3.147   1.00 95.32  ? 178 ARG C NE  1 
ATOM   5097 C CZ  . ARG C 1 137 ? 53.600 23.350  2.411   1.00 90.73  ? 178 ARG C CZ  1 
ATOM   5098 N NH1 . ARG C 1 137 ? 54.045 23.278  1.166   1.00 92.43  ? 178 ARG C NH1 1 
ATOM   5099 N NH2 . ARG C 1 137 ? 53.289 24.523  2.917   1.00 95.61  ? 178 ARG C NH2 1 
ATOM   5100 N N   . ILE C 1 138 ? 57.892 18.195  3.569   1.00 113.80 ? 179 ILE C N   1 
ATOM   5101 C CA  . ILE C 1 138 ? 58.516 17.203  4.429   1.00 121.78 ? 179 ILE C CA  1 
ATOM   5102 C C   . ILE C 1 138 ? 57.407 16.484  5.221   1.00 128.39 ? 179 ILE C C   1 
ATOM   5103 O O   . ILE C 1 138 ? 57.554 15.321  5.620   1.00 129.37 ? 179 ILE C O   1 
ATOM   5104 C CB  . ILE C 1 138 ? 59.508 17.877  5.400   1.00 122.88 ? 179 ILE C CB  1 
ATOM   5105 C CG1 . ILE C 1 138 ? 60.416 18.842  4.633   1.00 124.71 ? 179 ILE C CG1 1 
ATOM   5106 C CG2 . ILE C 1 138 ? 60.355 16.825  6.098   1.00 122.86 ? 179 ILE C CG2 1 
ATOM   5107 C CD1 . ILE C 1 138 ? 59.750 20.156  4.240   1.00 125.14 ? 179 ILE C CD1 1 
ATOM   5108 N N   . GLY C 1 139 ? 56.293 17.188  5.425   1.00 133.01 ? 180 GLY C N   1 
ATOM   5109 C CA  . GLY C 1 139 ? 55.157 16.635  6.143   1.00 136.93 ? 180 GLY C CA  1 
ATOM   5110 C C   . GLY C 1 139 ? 55.363 16.559  7.642   1.00 141.17 ? 180 GLY C C   1 
ATOM   5111 O O   . GLY C 1 139 ? 55.626 17.562  8.308   1.00 136.90 ? 180 GLY C O   1 
ATOM   5112 N N   . LEU C 1 140 ? 55.216 15.349  8.169   1.00 148.71 ? 181 LEU C N   1 
ATOM   5113 C CA  . LEU C 1 140 ? 55.399 15.074  9.589   1.00 155.89 ? 181 LEU C CA  1 
ATOM   5114 C C   . LEU C 1 140 ? 56.774 14.427  9.723   1.00 159.52 ? 181 LEU C C   1 
ATOM   5115 O O   . LEU C 1 140 ? 56.909 13.208  9.604   1.00 159.37 ? 181 LEU C O   1 
ATOM   5116 C CB  . LEU C 1 140 ? 54.299 14.121  10.084  1.00 158.27 ? 181 LEU C CB  1 
ATOM   5117 C CG  . LEU C 1 140 ? 53.970 12.846  9.292   1.00 159.36 ? 181 LEU C CG  1 
ATOM   5118 C CD1 . LEU C 1 140 ? 54.571 11.621  9.977   1.00 160.61 ? 181 LEU C CD1 1 
ATOM   5119 C CD2 . LEU C 1 140 ? 52.460 12.692  9.201   1.00 155.70 ? 181 LEU C CD2 1 
ATOM   5120 N N   . ASN C 1 141 ? 57.804 15.230  9.964   1.00 163.27 ? 182 ASN C N   1 
ATOM   5121 C CA  . ASN C 1 141 ? 59.132 14.651  10.051  1.00 167.25 ? 182 ASN C CA  1 
ATOM   5122 C C   . ASN C 1 141 ? 60.198 15.505  10.698  1.00 169.64 ? 182 ASN C C   1 
ATOM   5123 O O   . ASN C 1 141 ? 60.122 16.737  10.688  1.00 169.02 ? 182 ASN C O   1 
ATOM   5124 C CB  . ASN C 1 141 ? 59.612 14.270  8.650   1.00 167.86 ? 182 ASN C CB  1 
ATOM   5125 C CG  . ASN C 1 141 ? 59.805 12.780  8.487   1.00 167.99 ? 182 ASN C CG  1 
ATOM   5126 O OD1 . ASN C 1 141 ? 59.216 11.983  9.217   1.00 166.71 ? 182 ASN C OD1 1 
ATOM   5127 N ND2 . ASN C 1 141 ? 60.627 12.394  7.521   1.00 168.30 ? 182 ASN C ND2 1 
ATOM   5128 N N   . PRO C 1 142 ? 61.224 14.843  11.266  1.00 171.43 ? 183 PRO C N   1 
ATOM   5129 C CA  . PRO C 1 142 ? 62.359 15.489  11.932  1.00 171.82 ? 183 PRO C CA  1 
ATOM   5130 C C   . PRO C 1 142 ? 63.244 16.046  10.826  1.00 171.43 ? 183 PRO C C   1 
ATOM   5131 O O   . PRO C 1 142 ? 64.329 16.566  11.083  1.00 172.11 ? 183 PRO C O   1 
ATOM   5132 C CB  . PRO C 1 142 ? 63.057 14.333  12.655  1.00 171.87 ? 183 PRO C CB  1 
ATOM   5133 C CG  . PRO C 1 142 ? 62.009 13.288  12.781  1.00 171.64 ? 183 PRO C CG  1 
ATOM   5134 C CD  . PRO C 1 142 ? 61.269 13.386  11.480  1.00 171.64 ? 183 PRO C CD  1 
ATOM   5135 N N   . THR C 1 143 ? 62.757 15.893  9.596   1.00 169.96 ? 184 THR C N   1 
ATOM   5136 C CA  . THR C 1 143 ? 63.415 16.335  8.372   1.00 168.11 ? 184 THR C CA  1 
ATOM   5137 C C   . THR C 1 143 ? 64.256 15.219  7.751   1.00 166.86 ? 184 THR C C   1 
ATOM   5138 O O   . THR C 1 143 ? 65.439 15.063  8.062   1.00 167.24 ? 184 THR C O   1 
ATOM   5139 C CB  . THR C 1 143 ? 64.309 17.584  8.598   1.00 167.77 ? 184 THR C CB  1 
ATOM   5140 O OG1 . THR C 1 143 ? 63.568 18.591  9.299   1.00 165.94 ? 184 THR C OG1 1 
ATOM   5141 C CG2 . THR C 1 143 ? 64.758 18.158  7.263   1.00 166.31 ? 184 THR C CG2 1 
ATOM   5142 N N   . GLY C 1 144 ? 63.622 14.438  6.879   1.00 164.69 ? 185 GLY C N   1 
ATOM   5143 C CA  . GLY C 1 144 ? 64.304 13.348  6.199   1.00 160.88 ? 185 GLY C CA  1 
ATOM   5144 C C   . GLY C 1 144 ? 64.522 13.714  4.742   1.00 158.73 ? 185 GLY C C   1 
ATOM   5145 O O   . GLY C 1 144 ? 64.702 14.890  4.425   1.00 158.50 ? 185 GLY C O   1 
ATOM   5146 N N   . ARG C 1 145 ? 64.495 12.729  3.849   1.00 155.32 ? 186 ARG C N   1 
ATOM   5147 C CA  . ARG C 1 145 ? 64.699 13.003  2.428   1.00 151.49 ? 186 ARG C CA  1 
ATOM   5148 C C   . ARG C 1 145 ? 63.572 12.475  1.538   1.00 148.76 ? 186 ARG C C   1 
ATOM   5149 O O   . ARG C 1 145 ? 63.634 11.350  1.041   1.00 149.91 ? 186 ARG C O   1 
ATOM   5150 C CB  . ARG C 1 145 ? 66.035 12.423  1.974   1.00 150.90 ? 186 ARG C CB  1 
ATOM   5151 N N   . GLN C 1 146 ? 62.548 13.300  1.334   1.00 143.15 ? 187 GLN C N   1 
ATOM   5152 C CA  . GLN C 1 146 ? 61.401 12.941  0.499   1.00 134.19 ? 187 GLN C CA  1 
ATOM   5153 C C   . GLN C 1 146 ? 60.399 14.096  0.500   1.00 127.19 ? 187 GLN C C   1 
ATOM   5154 O O   . GLN C 1 146 ? 60.313 14.850  1.471   1.00 124.52 ? 187 GLN C O   1 
ATOM   5155 C CB  . GLN C 1 146 ? 60.735 11.657  1.023   1.00 132.91 ? 187 GLN C CB  1 
ATOM   5156 N N   . ASN C 1 147 ? 59.660 14.247  -0.596  1.00 119.92 ? 188 ASN C N   1 
ATOM   5157 C CA  . ASN C 1 147 ? 58.664 15.308  -0.696  1.00 112.19 ? 188 ASN C CA  1 
ATOM   5158 C C   . ASN C 1 147 ? 57.266 14.702  -0.779  1.00 104.60 ? 188 ASN C C   1 
ATOM   5159 O O   . ASN C 1 147 ? 57.046 13.724  -1.490  1.00 105.16 ? 188 ASN C O   1 
ATOM   5160 C CB  . ASN C 1 147 ? 58.929 16.203  -1.920  1.00 115.51 ? 188 ASN C CB  1 
ATOM   5161 C CG  . ASN C 1 147 ? 58.617 15.517  -3.238  1.00 118.03 ? 188 ASN C CG  1 
ATOM   5162 O OD1 . ASN C 1 147 ? 59.334 14.618  -3.668  1.00 119.82 ? 188 ASN C OD1 1 
ATOM   5163 N ND2 . ASN C 1 147 ? 57.538 15.943  -3.887  1.00 121.25 ? 188 ASN C ND2 1 
ATOM   5164 N N   . PHE C 1 148 ? 56.330 15.277  -0.033  1.00 97.36  ? 189 PHE C N   1 
ATOM   5165 C CA  . PHE C 1 148 ? 54.951 14.789  -0.007  1.00 90.13  ? 189 PHE C CA  1 
ATOM   5166 C C   . PHE C 1 148 ? 53.973 15.740  -0.696  1.00 80.78  ? 189 PHE C C   1 
ATOM   5167 O O   . PHE C 1 148 ? 54.236 16.929  -0.821  1.00 78.18  ? 189 PHE C O   1 
ATOM   5168 C CB  . PHE C 1 148 ? 54.420 14.662  1.434   1.00 89.36  ? 189 PHE C CB  1 
ATOM   5169 C CG  . PHE C 1 148 ? 54.987 13.521  2.246   1.00 88.88  ? 189 PHE C CG  1 
ATOM   5170 C CD1 . PHE C 1 148 ? 56.153 13.687  2.993   1.00 92.00  ? 189 PHE C CD1 1 
ATOM   5171 C CD2 . PHE C 1 148 ? 54.268 12.333  2.389   1.00 86.23  ? 189 PHE C CD2 1 
ATOM   5172 C CE1 . PHE C 1 148 ? 56.586 12.696  3.875   1.00 88.33  ? 189 PHE C CE1 1 
ATOM   5173 C CE2 . PHE C 1 148 ? 54.693 11.344  3.266   1.00 80.42  ? 189 PHE C CE2 1 
ATOM   5174 C CZ  . PHE C 1 148 ? 55.852 11.530  4.011   1.00 85.67  ? 189 PHE C CZ  1 
ATOM   5175 N N   . LEU C 1 149 ? 52.844 15.198  -1.136  1.00 75.14  ? 190 LEU C N   1 
ATOM   5176 C CA  . LEU C 1 149 ? 51.772 16.023  -1.675  1.00 66.85  ? 190 LEU C CA  1 
ATOM   5177 C C   . LEU C 1 149 ? 50.951 16.302  -0.415  1.00 64.14  ? 190 LEU C C   1 
ATOM   5178 O O   . LEU C 1 149 ? 50.810 15.427  0.435   1.00 58.27  ? 190 LEU C O   1 
ATOM   5179 C CB  . LEU C 1 149 ? 50.861 15.259  -2.609  1.00 61.08  ? 190 LEU C CB  1 
ATOM   5180 C CG  . LEU C 1 149 ? 51.236 15.041  -4.055  1.00 65.82  ? 190 LEU C CG  1 
ATOM   5181 C CD1 . LEU C 1 149 ? 50.020 14.429  -4.776  1.00 63.35  ? 190 LEU C CD1 1 
ATOM   5182 C CD2 . LEU C 1 149 ? 51.612 16.370  -4.695  1.00 65.32  ? 190 LEU C CD2 1 
ATOM   5183 N N   . GLN C 1 150 ? 50.436 17.519  -0.284  1.00 66.20  ? 191 GLN C N   1 
ATOM   5184 C CA  . GLN C 1 150 ? 49.581 17.885  0.846   1.00 61.83  ? 191 GLN C CA  1 
ATOM   5185 C C   . GLN C 1 150 ? 48.165 17.955  0.258   1.00 60.59  ? 191 GLN C C   1 
ATOM   5186 O O   . GLN C 1 150 ? 47.973 18.450  -0.852  1.00 64.80  ? 191 GLN C O   1 
ATOM   5187 C CB  . GLN C 1 150 ? 49.986 19.256  1.419   1.00 59.17  ? 191 GLN C CB  1 
ATOM   5188 C CG  . GLN C 1 150 ? 49.291 19.590  2.732   1.00 62.97  ? 191 GLN C CG  1 
ATOM   5189 C CD  . GLN C 1 150 ? 49.786 20.869  3.356   1.00 67.08  ? 191 GLN C CD  1 
ATOM   5190 O OE1 . GLN C 1 150 ? 50.986 21.054  3.542   1.00 69.72  ? 191 GLN C OE1 1 
ATOM   5191 N NE2 . GLN C 1 150 ? 48.860 21.761  3.701   1.00 68.42  ? 191 GLN C NE2 1 
ATOM   5192 N N   . THR C 1 151 ? 47.175 17.449  0.973   1.00 55.69  ? 192 THR C N   1 
ATOM   5193 C CA  . THR C 1 151 ? 45.814 17.499  0.451   1.00 55.24  ? 192 THR C CA  1 
ATOM   5194 C C   . THR C 1 151 ? 44.795 17.787  1.542   1.00 54.27  ? 192 THR C C   1 
ATOM   5195 O O   . THR C 1 151 ? 45.049 17.531  2.722   1.00 54.83  ? 192 THR C O   1 
ATOM   5196 C CB  . THR C 1 151 ? 45.424 16.175  -0.253  1.00 50.21  ? 192 THR C CB  1 
ATOM   5197 O OG1 . THR C 1 151 ? 44.033 16.208  -0.581  1.00 60.84  ? 192 THR C OG1 1 
ATOM   5198 C CG2 . THR C 1 151 ? 45.644 14.987  0.659   1.00 52.09  ? 192 THR C CG2 1 
ATOM   5199 N N   . ASP C 1 152 ? 43.645 18.335  1.169   1.00 49.11  ? 193 ASP C N   1 
ATOM   5200 C CA  . ASP C 1 152 ? 42.648 18.587  2.189   1.00 49.28  ? 193 ASP C CA  1 
ATOM   5201 C C   . ASP C 1 152 ? 41.568 17.525  2.106   1.00 49.60  ? 193 ASP C C   1 
ATOM   5202 O O   . ASP C 1 152 ? 40.604 17.552  2.859   1.00 49.92  ? 193 ASP C O   1 
ATOM   5203 C CB  . ASP C 1 152 ? 42.071 20.001  2.101   1.00 56.12  ? 193 ASP C CB  1 
ATOM   5204 C CG  . ASP C 1 152 ? 41.514 20.341  0.728   1.00 57.20  ? 193 ASP C CG  1 
ATOM   5205 O OD1 . ASP C 1 152 ? 41.971 19.766  -0.282  1.00 57.92  ? 193 ASP C OD1 1 
ATOM   5206 O OD2 . ASP C 1 152 ? 40.624 21.215  0.671   1.00 54.49  ? 193 ASP C OD2 1 
ATOM   5207 N N   . ALA C 1 153 ? 41.743 16.578  1.190   1.00 46.37  ? 194 ALA C N   1 
ATOM   5208 C CA  . ALA C 1 153 ? 40.802 15.468  1.093   1.00 52.89  ? 194 ALA C CA  1 
ATOM   5209 C C   . ALA C 1 153 ? 40.916 14.811  2.470   1.00 54.36  ? 194 ALA C C   1 
ATOM   5210 O O   . ALA C 1 153 ? 42.014 14.671  3.001   1.00 51.05  ? 194 ALA C O   1 
ATOM   5211 C CB  . ALA C 1 153 ? 41.228 14.488  0.010   1.00 47.42  ? 194 ALA C CB  1 
ATOM   5212 N N   . SER C 1 154 ? 39.794 14.407  3.044   1.00 53.58  ? 195 SER C N   1 
ATOM   5213 C CA  . SER C 1 154 ? 39.822 13.831  4.378   1.00 54.01  ? 195 SER C CA  1 
ATOM   5214 C C   . SER C 1 154 ? 40.320 12.429  4.383   1.00 51.94  ? 195 SER C C   1 
ATOM   5215 O O   . SER C 1 154 ? 39.814 11.581  3.661   1.00 51.93  ? 195 SER C O   1 
ATOM   5216 C CB  . SER C 1 154 ? 38.427 13.878  5.035   1.00 49.71  ? 195 SER C CB  1 
ATOM   5217 O OG  . SER C 1 154 ? 38.071 15.217  5.342   1.00 54.75  ? 195 SER C OG  1 
ATOM   5218 N N   . ILE C 1 155 ? 41.335 12.198  5.195   1.00 50.05  ? 196 ILE C N   1 
ATOM   5219 C CA  . ILE C 1 155 ? 41.897 10.866  5.331   1.00 59.62  ? 196 ILE C CA  1 
ATOM   5220 C C   . ILE C 1 155 ? 41.897 10.578  6.841   1.00 62.68  ? 196 ILE C C   1 
ATOM   5221 O O   . ILE C 1 155 ? 42.093 11.476  7.662   1.00 60.79  ? 196 ILE C O   1 
ATOM   5222 C CB  . ILE C 1 155 ? 43.333 10.784  4.743   1.00 61.03  ? 196 ILE C CB  1 
ATOM   5223 C CG1 . ILE C 1 155 ? 44.258 11.781  5.450   1.00 60.79  ? 196 ILE C CG1 1 
ATOM   5224 C CG2 . ILE C 1 155 ? 43.294 11.051  3.229   1.00 53.03  ? 196 ILE C CG2 1 
ATOM   5225 C CD1 . ILE C 1 155 ? 45.695 11.709  5.005   1.00 66.63  ? 196 ILE C CD1 1 
ATOM   5226 N N   . ASN C 1 156 ? 41.621 9.340   7.207   1.00 62.53  ? 197 ASN C N   1 
ATOM   5227 C CA  . ASN C 1 156 ? 41.576 8.970   8.612   1.00 63.64  ? 197 ASN C CA  1 
ATOM   5228 C C   . ASN C 1 156 ? 42.367 7.677   8.810   1.00 65.13  ? 197 ASN C C   1 
ATOM   5229 O O   . ASN C 1 156 ? 42.954 7.147   7.854   1.00 65.05  ? 197 ASN C O   1 
ATOM   5230 C CB  . ASN C 1 156 ? 40.125 8.752   9.023   1.00 63.01  ? 197 ASN C CB  1 
ATOM   5231 C CG  . ASN C 1 156 ? 39.277 9.999   8.860   1.00 61.98  ? 197 ASN C CG  1 
ATOM   5232 O OD1 . ASN C 1 156 ? 39.227 10.844  9.742   1.00 61.73  ? 197 ASN C OD1 1 
ATOM   5233 N ND2 . ASN C 1 156 ? 38.612 10.116  7.729   1.00 56.00  ? 197 ASN C ND2 1 
ATOM   5234 N N   . HIS C 1 157 ? 42.400 7.173   10.039  1.00 60.95  ? 198 HIS C N   1 
ATOM   5235 C CA  . HIS C 1 157 ? 43.095 5.924   10.268  1.00 58.89  ? 198 HIS C CA  1 
ATOM   5236 C C   . HIS C 1 157 ? 42.403 4.877   9.393   1.00 59.35  ? 198 HIS C C   1 
ATOM   5237 O O   . HIS C 1 157 ? 41.156 4.728   9.422   1.00 55.70  ? 198 HIS C O   1 
ATOM   5238 C CB  . HIS C 1 157 ? 43.034 5.504   11.732  1.00 69.13  ? 198 HIS C CB  1 
ATOM   5239 C CG  . HIS C 1 157 ? 43.781 4.234   12.004  1.00 81.15  ? 198 HIS C CG  1 
ATOM   5240 N ND1 . HIS C 1 157 ? 43.202 2.986   11.877  1.00 78.35  ? 198 HIS C ND1 1 
ATOM   5241 C CD2 . HIS C 1 157 ? 45.089 4.016   12.290  1.00 78.39  ? 198 HIS C CD2 1 
ATOM   5242 C CE1 . HIS C 1 157 ? 44.122 2.057   12.071  1.00 80.03  ? 198 HIS C CE1 1 
ATOM   5243 N NE2 . HIS C 1 157 ? 45.274 2.654   12.322  1.00 81.63  ? 198 HIS C NE2 1 
ATOM   5244 N N   . GLY C 1 158 ? 43.206 4.155   8.615   1.00 50.05  ? 199 GLY C N   1 
ATOM   5245 C CA  . GLY C 1 158 ? 42.633 3.182   7.714   1.00 49.43  ? 199 GLY C CA  1 
ATOM   5246 C C   . GLY C 1 158 ? 42.801 3.627   6.268   1.00 49.32  ? 199 GLY C C   1 
ATOM   5247 O O   . GLY C 1 158 ? 42.569 2.852   5.352   1.00 48.43  ? 199 GLY C O   1 
ATOM   5248 N N   . ASN C 1 159 ? 43.191 4.881   6.061   1.00 51.42  ? 200 ASN C N   1 
ATOM   5249 C CA  . ASN C 1 159 ? 43.399 5.425   4.710   1.00 55.78  ? 200 ASN C CA  1 
ATOM   5250 C C   . ASN C 1 159 ? 44.828 5.204   4.229   1.00 55.72  ? 200 ASN C C   1 
ATOM   5251 O O   . ASN C 1 159 ? 45.104 5.252   3.024   1.00 55.31  ? 200 ASN C O   1 
ATOM   5252 C CB  . ASN C 1 159 ? 43.123 6.941   4.675   1.00 50.93  ? 200 ASN C CB  1 
ATOM   5253 C CG  . ASN C 1 159 ? 41.703 7.282   4.225   1.00 58.57  ? 200 ASN C CG  1 
ATOM   5254 O OD1 . ASN C 1 159 ? 41.369 7.198   3.027   1.00 53.55  ? 200 ASN C OD1 1 
ATOM   5255 N ND2 . ASN C 1 159 ? 40.858 7.671   5.188   1.00 46.18  ? 200 ASN C ND2 1 
ATOM   5256 N N   . SER C 1 160 ? 45.732 5.005   5.187   1.00 59.51  ? 201 SER C N   1 
ATOM   5257 C CA  . SER C 1 160 ? 47.150 4.806   4.909   1.00 55.33  ? 201 SER C CA  1 
ATOM   5258 C C   . SER C 1 160 ? 47.426 3.707   3.907   1.00 53.94  ? 201 SER C C   1 
ATOM   5259 O O   . SER C 1 160 ? 47.059 2.533   4.098   1.00 51.20  ? 201 SER C O   1 
ATOM   5260 C CB  . SER C 1 160 ? 47.905 4.495   6.195   1.00 61.47  ? 201 SER C CB  1 
ATOM   5261 O OG  . SER C 1 160 ? 48.091 5.654   6.975   1.00 69.84  ? 201 SER C OG  1 
ATOM   5262 N N   . GLY C 1 161 ? 48.059 4.103   2.817   1.00 53.42  ? 202 GLY C N   1 
ATOM   5263 C CA  . GLY C 1 161 ? 48.413 3.136   1.803   1.00 59.72  ? 202 GLY C CA  1 
ATOM   5264 C C   . GLY C 1 161 ? 47.510 3.171   0.615   1.00 58.02  ? 202 GLY C C   1 
ATOM   5265 O O   . GLY C 1 161 ? 47.831 2.573   -0.419  1.00 58.32  ? 202 GLY C O   1 
ATOM   5266 N N   . GLY C 1 162 ? 46.383 3.866   0.772   1.00 57.75  ? 203 GLY C N   1 
ATOM   5267 C CA  . GLY C 1 162 ? 45.409 3.994   -0.302  1.00 46.97  ? 203 GLY C CA  1 
ATOM   5268 C C   . GLY C 1 162 ? 45.772 5.058   -1.317  1.00 42.13  ? 203 GLY C C   1 
ATOM   5269 O O   . GLY C 1 162 ? 46.750 5.814   -1.177  1.00 42.84  ? 203 GLY C O   1 
ATOM   5270 N N   . ALA C 1 163 ? 44.954 5.120   -2.355  1.00 51.50  ? 204 ALA C N   1 
ATOM   5271 C CA  . ALA C 1 163 ? 45.156 6.034   -3.466  1.00 52.18  ? 204 ALA C CA  1 
ATOM   5272 C C   . ALA C 1 163 ? 44.530 7.426   -3.349  1.00 57.28  ? 204 ALA C C   1 
ATOM   5273 O O   . ALA C 1 163 ? 43.476 7.622   -2.752  1.00 55.87  ? 204 ALA C O   1 
ATOM   5274 C CB  . ALA C 1 163 ? 44.683 5.377   -4.734  1.00 48.21  ? 204 ALA C CB  1 
ATOM   5275 N N   . LEU C 1 164 ? 45.238 8.383   -3.938  0.00 58.27  ? 205 LEU C N   1 
ATOM   5276 C CA  . LEU C 1 164 ? 44.848 9.773   -4.021  0.00 54.85  ? 205 LEU C CA  1 
ATOM   5277 C C   . LEU C 1 164 ? 44.871 9.931   -5.570  0.00 56.53  ? 205 LEU C C   1 
ATOM   5278 O O   . LEU C 1 164 ? 45.943 9.940   -6.194  0.00 52.48  ? 205 LEU C O   1 
ATOM   5279 C CB  . LEU C 1 164 ? 45.905 10.656  -3.338  0.00 51.13  ? 205 LEU C CB  1 
ATOM   5280 C CG  . LEU C 1 164 ? 45.528 12.008  -2.687  0.00 52.23  ? 205 LEU C CG  1 
ATOM   5281 C CD1 . LEU C 1 164 ? 46.368 13.104  -3.244  0.00 47.46  ? 205 LEU C CD1 1 
ATOM   5282 C CD2 . LEU C 1 164 ? 44.050 12.311  -2.857  0.00 51.11  ? 205 LEU C CD2 1 
ATOM   5283 N N   . VAL C 1 165 ? 43.684 10.005  -6.178  1.00 52.02  ? 206 VAL C N   1 
ATOM   5284 C CA  . VAL C 1 165 ? 43.557 10.117  -7.624  1.00 49.41  ? 206 VAL C CA  1 
ATOM   5285 C C   . VAL C 1 165 ? 42.971 11.453  -8.068  1.00 55.09  ? 206 VAL C C   1 
ATOM   5286 O O   . VAL C 1 165 ? 42.371 12.172  -7.251  1.00 52.85  ? 206 VAL C O   1 
ATOM   5287 C CB  . VAL C 1 165 ? 42.672 8.993   -8.175  1.00 51.05  ? 206 VAL C CB  1 
ATOM   5288 C CG1 . VAL C 1 165 ? 43.270 7.653   -7.810  1.00 60.63  ? 206 VAL C CG1 1 
ATOM   5289 C CG2 . VAL C 1 165 ? 41.279 9.105   -7.613  1.00 46.30  ? 206 VAL C CG2 1 
ATOM   5290 N N   . ASN C 1 166 ? 43.160 11.812  -9.345  1.00 48.18  ? 207 ASN C N   1 
ATOM   5291 C CA  . ASN C 1 166 ? 42.592 13.067  -9.786  1.00 47.71  ? 207 ASN C CA  1 
ATOM   5292 C C   . ASN C 1 166 ? 41.218 12.811  -10.338 1.00 40.90  ? 207 ASN C C   1 
ATOM   5293 O O   . ASN C 1 166 ? 40.694 11.717  -10.213 1.00 45.04  ? 207 ASN C O   1 
ATOM   5294 C CB  . ASN C 1 166 ? 43.501 13.853  -10.781 1.00 47.06  ? 207 ASN C CB  1 
ATOM   5295 C CG  . ASN C 1 166 ? 43.725 13.150  -12.130 1.00 55.59  ? 207 ASN C CG  1 
ATOM   5296 O OD1 . ASN C 1 166 ? 42.844 12.447  -12.705 1.00 46.18  ? 207 ASN C OD1 1 
ATOM   5297 N ND2 . ASN C 1 166 ? 44.915 13.385  -12.669 1.00 40.45  ? 207 ASN C ND2 1 
ATOM   5298 N N   . SER C 1 167 ? 40.600 13.831  -10.903 1.00 51.77  ? 208 SER C N   1 
ATOM   5299 C CA  . SER C 1 167 ? 39.253 13.662  -11.449 1.00 56.42  ? 208 SER C CA  1 
ATOM   5300 C C   . SER C 1 167 ? 39.232 12.721  -12.642 1.00 50.86  ? 208 SER C C   1 
ATOM   5301 O O   . SER C 1 167 ? 38.164 12.334  -13.095 1.00 54.38  ? 208 SER C O   1 
ATOM   5302 C CB  . SER C 1 167 ? 38.634 15.028  -11.832 1.00 56.02  ? 208 SER C CB  1 
ATOM   5303 O OG  . SER C 1 167 ? 39.149 15.555  -13.055 1.00 61.89  ? 208 SER C OG  1 
ATOM   5304 N N   . LEU C 1 168 ? 40.397 12.357  -13.172 1.00 54.62  ? 209 LEU C N   1 
ATOM   5305 C CA  . LEU C 1 168 ? 40.405 11.421  -14.306 1.00 58.76  ? 209 LEU C CA  1 
ATOM   5306 C C   . LEU C 1 168 ? 40.622 9.982   -13.817 1.00 59.05  ? 209 LEU C C   1 
ATOM   5307 O O   . LEU C 1 168 ? 40.427 9.021   -14.560 1.00 63.01  ? 209 LEU C O   1 
ATOM   5308 C CB  . LEU C 1 168 ? 41.483 11.793  -15.333 1.00 56.39  ? 209 LEU C CB  1 
ATOM   5309 C CG  . LEU C 1 168 ? 41.295 13.135  -16.050 1.00 56.33  ? 209 LEU C CG  1 
ATOM   5310 C CD1 . LEU C 1 168 ? 42.454 13.364  -17.008 1.00 55.00  ? 209 LEU C CD1 1 
ATOM   5311 C CD2 . LEU C 1 168 ? 39.970 13.146  -16.801 1.00 56.84  ? 209 LEU C CD2 1 
ATOM   5312 N N   . GLY C 1 169 ? 41.013 9.845   -12.555 1.00 55.06  ? 210 GLY C N   1 
ATOM   5313 C CA  . GLY C 1 169 ? 41.224 8.533   -11.982 1.00 51.76  ? 210 GLY C CA  1 
ATOM   5314 C C   . GLY C 1 169 ? 42.688 8.153   -11.883 1.00 58.95  ? 210 GLY C C   1 
ATOM   5315 O O   . GLY C 1 169 ? 43.005 7.067   -11.397 1.00 63.26  ? 210 GLY C O   1 
ATOM   5316 N N   . GLU C 1 170 ? 43.561 9.060   -12.330 1.00 56.24  ? 211 GLU C N   1 
ATOM   5317 C CA  . GLU C 1 170 ? 45.008 8.880   -12.368 1.00 55.53  ? 211 GLU C CA  1 
ATOM   5318 C C   . GLU C 1 170 ? 45.700 8.983   -11.029 1.00 52.66  ? 211 GLU C C   1 
ATOM   5319 O O   . GLU C 1 170 ? 45.613 10.008  -10.370 1.00 57.92  ? 211 GLU C O   1 
ATOM   5320 C CB  . GLU C 1 170 ? 45.641 9.904   -13.334 1.00 57.48  ? 211 GLU C CB  1 
ATOM   5321 C CG  . GLU C 1 170 ? 45.120 9.798   -14.781 1.00 57.85  ? 211 GLU C CG  1 
ATOM   5322 C CD  . GLU C 1 170 ? 45.539 10.969  -15.678 1.00 65.79  ? 211 GLU C CD  1 
ATOM   5323 O OE1 . GLU C 1 170 ? 45.201 10.943  -16.890 1.00 60.62  ? 211 GLU C OE1 1 
ATOM   5324 O OE2 . GLU C 1 170 ? 46.200 11.909  -15.178 1.00 60.02  ? 211 GLU C OE2 1 
ATOM   5325 N N   . LEU C 1 171 ? 46.429 7.935   -10.644 1.00 55.82  ? 212 LEU C N   1 
ATOM   5326 C CA  . LEU C 1 171 ? 47.117 7.970   -9.371  1.00 49.94  ? 212 LEU C CA  1 
ATOM   5327 C C   . LEU C 1 171 ? 48.022 9.193   -9.247  1.00 53.12  ? 212 LEU C C   1 
ATOM   5328 O O   . LEU C 1 171 ? 48.895 9.451   -10.068 1.00 56.14  ? 212 LEU C O   1 
ATOM   5329 C CB  . LEU C 1 171 ? 47.921 6.687   -9.133  1.00 52.12  ? 212 LEU C CB  1 
ATOM   5330 C CG  . LEU C 1 171 ? 48.497 6.603   -7.704  1.00 53.29  ? 212 LEU C CG  1 
ATOM   5331 C CD1 . LEU C 1 171 ? 47.394 6.306   -6.721  1.00 53.86  ? 212 LEU C CD1 1 
ATOM   5332 C CD2 . LEU C 1 171 ? 49.535 5.540   -7.613  1.00 51.55  ? 212 LEU C CD2 1 
ATOM   5333 N N   . MET C 1 172 ? 47.793 9.948   -8.185  1.00 55.32  ? 213 MET C N   1 
ATOM   5334 C CA  . MET C 1 172 ? 48.553 11.149  -7.907  1.00 56.19  ? 213 MET C CA  1 
ATOM   5335 C C   . MET C 1 172 ? 49.490 10.887  -6.744  1.00 53.31  ? 213 MET C C   1 
ATOM   5336 O O   . MET C 1 172 ? 50.552 11.526  -6.621  1.00 50.71  ? 213 MET C O   1 
ATOM   5337 C CB  . MET C 1 172 ? 47.591 12.295  -7.521  1.00 59.60  ? 213 MET C CB  1 
ATOM   5338 C CG  . MET C 1 172 ? 46.853 12.935  -8.678  1.00 62.18  ? 213 MET C CG  1 
ATOM   5339 S SD  . MET C 1 172 ? 48.003 13.898  -9.732  1.00 74.44  ? 213 MET C SD  1 
ATOM   5340 C CE  . MET C 1 172 ? 48.083 12.887  -11.234 1.00 65.33  ? 213 MET C CE  1 
ATOM   5341 N N   . GLY C 1 173 ? 49.062 9.977   -5.868  1.00 51.03  ? 214 GLY C N   1 
ATOM   5342 C CA  . GLY C 1 173 ? 49.853 9.659   -4.700  1.00 50.68  ? 214 GLY C CA  1 
ATOM   5343 C C   . GLY C 1 173 ? 49.324 8.532   -3.832  1.00 49.68  ? 214 GLY C C   1 
ATOM   5344 O O   . GLY C 1 173 ? 48.242 8.018   -4.059  1.00 48.53  ? 214 GLY C O   1 
ATOM   5345 N N   . ILE C 1 174 ? 50.124 8.129   -2.848  1.00 52.56  ? 215 ILE C N   1 
ATOM   5346 C CA  . ILE C 1 174 ? 49.742 7.072   -1.918  1.00 58.01  ? 215 ILE C CA  1 
ATOM   5347 C C   . ILE C 1 174 ? 49.566 7.792   -0.604  1.00 54.05  ? 215 ILE C C   1 
ATOM   5348 O O   . ILE C 1 174 ? 50.524 8.312   -0.044  1.00 53.25  ? 215 ILE C O   1 
ATOM   5349 C CB  . ILE C 1 174 ? 50.856 6.009   -1.772  1.00 57.76  ? 215 ILE C CB  1 
ATOM   5350 C CG1 . ILE C 1 174 ? 51.166 5.388   -3.143  1.00 46.98  ? 215 ILE C CG1 1 
ATOM   5351 C CG2 . ILE C 1 174 ? 50.426 4.944   -0.765  1.00 51.83  ? 215 ILE C CG2 1 
ATOM   5352 C CD1 . ILE C 1 174 ? 49.997 4.640   -3.774  1.00 46.00  ? 215 ILE C CD1 1 
ATOM   5353 N N   . ASN C 1 175 ? 48.332 7.843   -0.129  1.00 58.19  ? 216 ASN C N   1 
ATOM   5354 C CA  . ASN C 1 175 ? 48.042 8.555   1.111   1.00 63.86  ? 216 ASN C CA  1 
ATOM   5355 C C   . ASN C 1 175 ? 48.793 7.956   2.274   1.00 62.18  ? 216 ASN C C   1 
ATOM   5356 O O   . ASN C 1 175 ? 48.661 6.781   2.579   1.00 62.72  ? 216 ASN C O   1 
ATOM   5357 C CB  . ASN C 1 175 ? 46.527 8.553   1.419   1.00 55.21  ? 216 ASN C CB  1 
ATOM   5358 C CG  . ASN C 1 175 ? 45.700 9.205   0.318   1.00 48.29  ? 216 ASN C CG  1 
ATOM   5359 O OD1 . ASN C 1 175 ? 44.660 8.683   -0.042  1.00 42.96  ? 216 ASN C OD1 1 
ATOM   5360 N ND2 . ASN C 1 175 ? 46.166 10.349  -0.216  1.00 32.32  ? 216 ASN C ND2 1 
ATOM   5361 N N   . THR C 1 176 ? 49.579 8.780   2.934   1.00 65.22  ? 217 THR C N   1 
ATOM   5362 C CA  . THR C 1 176 ? 50.329 8.297   4.056   1.00 74.21  ? 217 THR C CA  1 
ATOM   5363 C C   . THR C 1 176 ? 49.685 8.778   5.336   1.00 76.84  ? 217 THR C C   1 
ATOM   5364 O O   . THR C 1 176 ? 48.796 8.112   5.847   1.00 81.13  ? 217 THR C O   1 
ATOM   5365 C CB  . THR C 1 176 ? 51.774 8.738   3.949   1.00 69.06  ? 217 THR C CB  1 
ATOM   5366 O OG1 . THR C 1 176 ? 52.258 8.355   2.655   1.00 74.14  ? 217 THR C OG1 1 
ATOM   5367 C CG2 . THR C 1 176 ? 52.624 8.052   5.010   1.00 70.96  ? 217 THR C CG2 1 
ATOM   5368 N N   . LEU C 1 177 ? 50.088 9.928   5.858   1.00 82.26  ? 218 LEU C N   1 
ATOM   5369 C CA  . LEU C 1 177 ? 49.461 10.367  7.093   1.00 86.88  ? 218 LEU C CA  1 
ATOM   5370 C C   . LEU C 1 177 ? 48.657 11.675  7.093   1.00 85.41  ? 218 LEU C C   1 
ATOM   5371 O O   . LEU C 1 177 ? 48.483 12.336  6.062   1.00 76.72  ? 218 LEU C O   1 
ATOM   5372 C CB  . LEU C 1 177 ? 50.491 10.360  8.227   1.00 95.94  ? 218 LEU C CB  1 
ATOM   5373 C CG  . LEU C 1 177 ? 50.858 8.952   8.732   1.00 97.66  ? 218 LEU C CG  1 
ATOM   5374 C CD1 . LEU C 1 177 ? 51.883 9.057   9.859   1.00 101.03 ? 218 LEU C CD1 1 
ATOM   5375 C CD2 . LEU C 1 177 ? 49.609 8.228   9.217   1.00 94.58  ? 218 LEU C CD2 1 
ATOM   5376 N N   . SER C 1 178 ? 48.149 12.010  8.275   1.00 85.92  ? 219 SER C N   1 
ATOM   5377 C CA  . SER C 1 178 ? 47.302 13.174  8.477   1.00 91.24  ? 219 SER C CA  1 
ATOM   5378 C C   . SER C 1 178 ? 47.829 13.988  9.656   1.00 93.21  ? 219 SER C C   1 
ATOM   5379 O O   . SER C 1 178 ? 47.596 13.622  10.803  1.00 101.10 ? 219 SER C O   1 
ATOM   5380 C CB  . SER C 1 178 ? 45.871 12.669  8.749   1.00 91.48  ? 219 SER C CB  1 
ATOM   5381 O OG  . SER C 1 178 ? 44.873 13.660  8.579   1.00 97.22  ? 219 SER C OG  1 
ATOM   5382 N N   . PHE C 1 179 ? 48.533 15.083  9.365   1.00 97.52  ? 220 PHE C N   1 
ATOM   5383 C CA  . PHE C 1 179 ? 49.131 15.973  10.376  1.00 101.63 ? 220 PHE C CA  1 
ATOM   5384 C C   . PHE C 1 179 ? 48.598 15.794  11.806  1.00 109.85 ? 220 PHE C C   1 
ATOM   5385 O O   . PHE C 1 179 ? 47.688 16.501  12.248  1.00 105.32 ? 220 PHE C O   1 
ATOM   5386 C CB  . PHE C 1 179 ? 48.974 17.429  9.937   1.00 94.86  ? 220 PHE C CB  1 
ATOM   5387 C CG  . PHE C 1 179 ? 49.861 18.379  10.672  1.00 91.19  ? 220 PHE C CG  1 
ATOM   5388 C CD1 . PHE C 1 179 ? 49.388 19.082  11.774  1.00 91.39  ? 220 PHE C CD1 1 
ATOM   5389 C CD2 . PHE C 1 179 ? 51.187 18.550  10.281  1.00 90.30  ? 220 PHE C CD2 1 
ATOM   5390 C CE1 . PHE C 1 179 ? 50.220 19.954  12.476  1.00 91.93  ? 220 PHE C CE1 1 
ATOM   5391 C CE2 . PHE C 1 179 ? 52.031 19.416  10.972  1.00 92.59  ? 220 PHE C CE2 1 
ATOM   5392 C CZ  . PHE C 1 179 ? 51.549 20.119  12.077  1.00 95.26  ? 220 PHE C CZ  1 
ATOM   5393 N N   . ASP C 1 180 ? 49.214 14.842  12.508  1.00 118.06 ? 221 ASP C N   1 
ATOM   5394 C CA  . ASP C 1 180 ? 48.885 14.434  13.877  1.00 126.25 ? 221 ASP C CA  1 
ATOM   5395 C C   . ASP C 1 180 ? 48.244 15.440  14.834  1.00 129.28 ? 221 ASP C C   1 
ATOM   5396 O O   . ASP C 1 180 ? 47.068 15.776  14.717  1.00 127.57 ? 221 ASP C O   1 
ATOM   5397 C CB  . ASP C 1 180 ? 50.138 13.861  14.560  1.00 130.55 ? 221 ASP C CB  1 
ATOM   5398 C CG  . ASP C 1 180 ? 50.812 12.769  13.744  1.00 134.60 ? 221 ASP C CG  1 
ATOM   5399 O OD1 . ASP C 1 180 ? 50.124 11.810  13.335  1.00 136.62 ? 221 ASP C OD1 1 
ATOM   5400 O OD2 . ASP C 1 180 ? 52.038 12.870  13.517  1.00 136.57 ? 221 ASP C OD2 1 
ATOM   5401 N N   . LYS C 1 181 ? 49.032 15.878  15.811  1.00 134.14 ? 222 LYS C N   1 
ATOM   5402 C CA  . LYS C 1 181 ? 48.587 16.823  16.827  1.00 137.46 ? 222 LYS C CA  1 
ATOM   5403 C C   . LYS C 1 181 ? 48.908 18.273  16.473  1.00 138.83 ? 222 LYS C C   1 
ATOM   5404 O O   . LYS C 1 181 ? 49.428 18.567  15.397  1.00 138.38 ? 222 LYS C O   1 
ATOM   5405 C CB  . LYS C 1 181 ? 49.236 16.477  18.176  1.00 139.01 ? 222 LYS C CB  1 
ATOM   5406 C CG  . LYS C 1 181 ? 48.402 15.595  19.095  1.00 137.97 ? 222 LYS C CG  1 
ATOM   5407 C CD  . LYS C 1 181 ? 48.016 14.277  18.449  1.00 138.08 ? 222 LYS C CD  1 
ATOM   5408 C CE  . LYS C 1 181 ? 47.119 13.477  19.379  1.00 135.93 ? 222 LYS C CE  1 
ATOM   5409 N NZ  . LYS C 1 181 ? 46.599 12.257  18.722  1.00 133.68 ? 222 LYS C NZ  1 
ATOM   5410 N N   . SER C 1 182 ? 48.594 19.167  17.405  1.00 141.18 ? 223 SER C N   1 
ATOM   5411 C CA  . SER C 1 182 ? 48.825 20.597  17.250  1.00 142.02 ? 223 SER C CA  1 
ATOM   5412 C C   . SER C 1 182 ? 49.512 21.099  18.515  1.00 143.35 ? 223 SER C C   1 
ATOM   5413 O O   . SER C 1 182 ? 49.898 20.305  19.376  1.00 143.64 ? 223 SER C O   1 
ATOM   5414 C CB  . SER C 1 182 ? 47.496 21.324  17.086  1.00 142.57 ? 223 SER C CB  1 
ATOM   5415 O OG  . SER C 1 182 ? 46.730 21.209  18.273  1.00 141.73 ? 223 SER C OG  1 
ATOM   5416 N N   . ASN C 1 183 ? 49.649 22.415  18.637  1.00 142.58 ? 224 ASN C N   1 
ATOM   5417 C CA  . ASN C 1 183 ? 50.303 22.990  19.802  1.00 142.30 ? 224 ASN C CA  1 
ATOM   5418 C C   . ASN C 1 183 ? 49.305 23.354  20.888  1.00 140.35 ? 224 ASN C C   1 
ATOM   5419 O O   . ASN C 1 183 ? 49.254 22.708  21.940  1.00 141.67 ? 224 ASN C O   1 
ATOM   5420 C CB  . ASN C 1 183 ? 51.115 24.214  19.387  1.00 144.73 ? 224 ASN C CB  1 
ATOM   5421 C CG  . ASN C 1 183 ? 52.321 23.847  18.538  1.00 146.82 ? 224 ASN C CG  1 
ATOM   5422 O OD1 . ASN C 1 183 ? 53.222 23.136  18.993  1.00 142.88 ? 224 ASN C OD1 1 
ATOM   5423 N ND2 . ASN C 1 183 ? 52.338 24.321  17.294  1.00 149.97 ? 224 ASN C ND2 1 
ATOM   5424 N N   . ASP C 1 184 ? 48.514 24.391  20.641  1.00 135.61 ? 225 ASP C N   1 
ATOM   5425 C CA  . ASP C 1 184 ? 47.509 24.800  21.609  1.00 133.02 ? 225 ASP C CA  1 
ATOM   5426 C C   . ASP C 1 184 ? 46.328 23.859  21.411  1.00 129.50 ? 225 ASP C C   1 
ATOM   5427 O O   . ASP C 1 184 ? 46.378 22.979  20.554  1.00 133.12 ? 225 ASP C O   1 
ATOM   5428 C CB  . ASP C 1 184 ? 47.092 26.253  21.358  1.00 135.76 ? 225 ASP C CB  1 
ATOM   5429 C CG  . ASP C 1 184 ? 46.125 26.780  22.412  1.00 137.99 ? 225 ASP C CG  1 
ATOM   5430 O OD1 . ASP C 1 184 ? 44.997 26.246  22.515  1.00 139.96 ? 225 ASP C OD1 1 
ATOM   5431 O OD2 . ASP C 1 184 ? 46.489 27.736  23.136  1.00 135.08 ? 225 ASP C OD2 1 
ATOM   5432 N N   . GLY C 1 185 ? 45.272 24.029  22.195  1.00 122.92 ? 226 GLY C N   1 
ATOM   5433 C CA  . GLY C 1 185 ? 44.120 23.161  22.046  1.00 118.86 ? 226 GLY C CA  1 
ATOM   5434 C C   . GLY C 1 185 ? 43.357 23.351  20.742  1.00 115.73 ? 226 GLY C C   1 
ATOM   5435 O O   . GLY C 1 185 ? 42.439 24.175  20.670  1.00 122.11 ? 226 GLY C O   1 
ATOM   5436 N N   . GLU C 1 186 ? 43.730 22.603  19.706  1.00 104.39 ? 227 GLU C N   1 
ATOM   5437 C CA  . GLU C 1 186 ? 43.044 22.699  18.417  1.00 97.54  ? 227 GLU C CA  1 
ATOM   5438 C C   . GLU C 1 186 ? 43.390 21.484  17.562  1.00 90.42  ? 227 GLU C C   1 
ATOM   5439 O O   . GLU C 1 186 ? 44.551 21.102  17.463  1.00 86.57  ? 227 GLU C O   1 
ATOM   5440 C CB  . GLU C 1 186 ? 43.451 23.972  17.660  1.00 95.83  ? 227 GLU C CB  1 
ATOM   5441 C CG  . GLU C 1 186 ? 44.740 23.819  16.851  1.00 92.65  ? 227 GLU C CG  1 
ATOM   5442 C CD  . GLU C 1 186 ? 45.930 24.494  17.496  1.00 91.22  ? 227 GLU C CD  1 
ATOM   5443 O OE1 . GLU C 1 186 ? 47.080 24.161  17.126  1.00 82.18  ? 227 GLU C OE1 1 
ATOM   5444 O OE2 . GLU C 1 186 ? 45.712 25.370  18.363  1.00 92.06  ? 227 GLU C OE2 1 
ATOM   5445 N N   . THR C 1 187 ? 42.389 20.866  16.949  1.00 82.08  ? 228 THR C N   1 
ATOM   5446 C CA  . THR C 1 187 ? 42.685 19.714  16.119  1.00 81.10  ? 228 THR C CA  1 
ATOM   5447 C C   . THR C 1 187 ? 42.804 20.222  14.691  1.00 75.67  ? 228 THR C C   1 
ATOM   5448 O O   . THR C 1 187 ? 41.891 20.882  14.186  1.00 69.59  ? 228 THR C O   1 
ATOM   5449 C CB  . THR C 1 187 ? 41.572 18.591  16.226  1.00 84.52  ? 228 THR C CB  1 
ATOM   5450 O OG1 . THR C 1 187 ? 40.709 18.624  15.083  1.00 77.59  ? 228 THR C OG1 1 
ATOM   5451 C CG2 . THR C 1 187 ? 40.740 18.777  17.485  1.00 78.60  ? 228 THR C CG2 1 
ATOM   5452 N N   . PRO C 1 188 ? 43.959 19.983  14.045  1.00 75.10  ? 229 PRO C N   1 
ATOM   5453 C CA  . PRO C 1 188 ? 44.083 20.463  12.667  1.00 72.00  ? 229 PRO C CA  1 
ATOM   5454 C C   . PRO C 1 188 ? 43.038 19.789  11.795  1.00 67.85  ? 229 PRO C C   1 
ATOM   5455 O O   . PRO C 1 188 ? 42.614 18.683  12.071  1.00 65.75  ? 229 PRO C O   1 
ATOM   5456 C CB  . PRO C 1 188 ? 45.535 20.116  12.285  1.00 68.49  ? 229 PRO C CB  1 
ATOM   5457 C CG  . PRO C 1 188 ? 45.952 19.109  13.297  1.00 75.95  ? 229 PRO C CG  1 
ATOM   5458 C CD  . PRO C 1 188 ? 45.267 19.543  14.559  1.00 77.14  ? 229 PRO C CD  1 
ATOM   5459 N N   . GLU C 1 189 ? 42.631 20.478  10.742  1.00 68.75  ? 230 GLU C N   1 
ATOM   5460 C CA  . GLU C 1 189 ? 41.606 19.997  9.850   1.00 67.46  ? 230 GLU C CA  1 
ATOM   5461 C C   . GLU C 1 189 ? 42.056 20.166  8.402   1.00 66.38  ? 230 GLU C C   1 
ATOM   5462 O O   . GLU C 1 189 ? 42.546 21.229  8.002   1.00 65.96  ? 230 GLU C O   1 
ATOM   5463 C CB  . GLU C 1 189 ? 40.343 20.816  10.124  1.00 69.86  ? 230 GLU C CB  1 
ATOM   5464 C CG  . GLU C 1 189 ? 39.086 20.459  9.340   1.00 79.03  ? 230 GLU C CG  1 
ATOM   5465 C CD  . GLU C 1 189 ? 37.900 21.365  9.737   1.00 88.94  ? 230 GLU C CD  1 
ATOM   5466 O OE1 . GLU C 1 189 ? 36.734 20.961  9.544   1.00 90.67  ? 230 GLU C OE1 1 
ATOM   5467 O OE2 . GLU C 1 189 ? 38.130 22.489  10.246  1.00 88.66  ? 230 GLU C OE2 1 
ATOM   5468 N N   . GLY C 1 190 ? 41.901 19.112  7.618   1.00 62.60  ? 231 GLY C N   1 
ATOM   5469 C CA  . GLY C 1 190 ? 42.270 19.185  6.217   1.00 60.61  ? 231 GLY C CA  1 
ATOM   5470 C C   . GLY C 1 190 ? 43.744 19.154  5.855   1.00 63.79  ? 231 GLY C C   1 
ATOM   5471 O O   . GLY C 1 190 ? 44.110 19.598  4.762   1.00 69.39  ? 231 GLY C O   1 
ATOM   5472 N N   . ILE C 1 191 ? 44.599 18.646  6.738   1.00 58.76  ? 232 ILE C N   1 
ATOM   5473 C CA  . ILE C 1 191 ? 46.024 18.577  6.419   1.00 60.01  ? 232 ILE C CA  1 
ATOM   5474 C C   . ILE C 1 191 ? 46.476 17.114  6.377   1.00 59.95  ? 232 ILE C C   1 
ATOM   5475 O O   . ILE C 1 191 ? 46.759 16.496  7.392   1.00 61.78  ? 232 ILE C O   1 
ATOM   5476 C CB  . ILE C 1 191 ? 46.870 19.391  7.444   1.00 66.07  ? 232 ILE C CB  1 
ATOM   5477 C CG1 . ILE C 1 191 ? 46.361 20.845  7.481   1.00 59.32  ? 232 ILE C CG1 1 
ATOM   5478 C CG2 . ILE C 1 191 ? 48.371 19.351  7.062   1.00 58.65  ? 232 ILE C CG2 1 
ATOM   5479 C CD1 . ILE C 1 191 ? 46.967 21.666  8.568   1.00 60.40  ? 232 ILE C CD1 1 
ATOM   5480 N N   . GLY C 1 192 ? 46.512 16.562  5.177   1.00 57.57  ? 233 GLY C N   1 
ATOM   5481 C CA  . GLY C 1 192 ? 46.924 15.191  4.994   1.00 54.85  ? 233 GLY C CA  1 
ATOM   5482 C C   . GLY C 1 192 ? 48.094 15.172  4.037   1.00 59.72  ? 233 GLY C C   1 
ATOM   5483 O O   . GLY C 1 192 ? 48.390 16.167  3.376   1.00 59.03  ? 233 GLY C O   1 
ATOM   5484 N N   . PHE C 1 193 ? 48.766 14.033  3.965   1.00 62.29  ? 234 PHE C N   1 
ATOM   5485 C CA  . PHE C 1 193 ? 49.938 13.902  3.120   1.00 55.04  ? 234 PHE C CA  1 
ATOM   5486 C C   . PHE C 1 193 ? 49.943 12.604  2.355   1.00 53.54  ? 234 PHE C C   1 
ATOM   5487 O O   . PHE C 1 193 ? 49.524 11.574  2.862   1.00 52.35  ? 234 PHE C O   1 
ATOM   5488 C CB  . PHE C 1 193 ? 51.213 13.962  3.963   1.00 49.15  ? 234 PHE C CB  1 
ATOM   5489 C CG  . PHE C 1 193 ? 51.430 15.277  4.640   1.00 56.48  ? 234 PHE C CG  1 
ATOM   5490 C CD1 . PHE C 1 193 ? 51.033 15.469  5.970   1.00 53.63  ? 234 PHE C CD1 1 
ATOM   5491 C CD2 . PHE C 1 193 ? 52.031 16.337  3.949   1.00 53.63  ? 234 PHE C CD2 1 
ATOM   5492 C CE1 . PHE C 1 193 ? 51.234 16.700  6.606   1.00 53.67  ? 234 PHE C CE1 1 
ATOM   5493 C CE2 . PHE C 1 193 ? 52.241 17.579  4.567   1.00 55.26  ? 234 PHE C CE2 1 
ATOM   5494 C CZ  . PHE C 1 193 ? 51.839 17.758  5.909   1.00 54.37  ? 234 PHE C CZ  1 
ATOM   5495 N N   . ALA C 1 194 ? 50.409 12.662  1.119   1.00 49.99  ? 235 ALA C N   1 
ATOM   5496 C CA  . ALA C 1 194 ? 50.521 11.454  0.324   1.00 57.21  ? 235 ALA C CA  1 
ATOM   5497 C C   . ALA C 1 194 ? 51.913 11.469  -0.303  1.00 54.33  ? 235 ALA C C   1 
ATOM   5498 O O   . ALA C 1 194 ? 52.535 12.520  -0.389  1.00 57.69  ? 235 ALA C O   1 
ATOM   5499 C CB  . ALA C 1 194 ? 49.457 11.428  -0.745  1.00 43.24  ? 235 ALA C CB  1 
ATOM   5500 N N   . ILE C 1 195 ? 52.415 10.305  -0.696  1.00 56.63  ? 236 ILE C N   1 
ATOM   5501 C CA  . ILE C 1 195 ? 53.710 10.236  -1.363  1.00 56.09  ? 236 ILE C CA  1 
ATOM   5502 C C   . ILE C 1 195 ? 53.411 10.363  -2.857  1.00 49.81  ? 236 ILE C C   1 
ATOM   5503 O O   . ILE C 1 195 ? 52.576 9.644   -3.393  1.00 51.30  ? 236 ILE C O   1 
ATOM   5504 C CB  . ILE C 1 195 ? 54.422 8.872   -1.082  1.00 67.71  ? 236 ILE C CB  1 
ATOM   5505 C CG1 . ILE C 1 195 ? 54.882 8.832   0.377   1.00 66.69  ? 236 ILE C CG1 1 
ATOM   5506 C CG2 . ILE C 1 195 ? 55.625 8.674   -2.042  1.00 58.41  ? 236 ILE C CG2 1 
ATOM   5507 C CD1 . ILE C 1 195 ? 54.666 7.513   1.033   1.00 68.55  ? 236 ILE C CD1 1 
ATOM   5508 N N   . PRO C 1 196 ? 54.076 11.296  -3.543  1.00 53.43  ? 237 PRO C N   1 
ATOM   5509 C CA  . PRO C 1 196 ? 53.889 11.527  -4.988  1.00 51.66  ? 237 PRO C CA  1 
ATOM   5510 C C   . PRO C 1 196 ? 53.953 10.210  -5.742  1.00 56.27  ? 237 PRO C C   1 
ATOM   5511 O O   . PRO C 1 196 ? 54.877 9.438   -5.525  1.00 60.36  ? 237 PRO C O   1 
ATOM   5512 C CB  . PRO C 1 196 ? 55.067 12.403  -5.351  1.00 53.69  ? 237 PRO C CB  1 
ATOM   5513 C CG  . PRO C 1 196 ? 55.356 13.155  -4.077  1.00 55.39  ? 237 PRO C CG  1 
ATOM   5514 C CD  . PRO C 1 196 ? 55.174 12.116  -3.000  1.00 51.74  ? 237 PRO C CD  1 
ATOM   5515 N N   . PHE C 1 197 ? 53.009 9.948   -6.644  1.00 58.63  ? 238 PHE C N   1 
ATOM   5516 C CA  . PHE C 1 197 ? 53.035 8.679   -7.375  1.00 63.56  ? 238 PHE C CA  1 
ATOM   5517 C C   . PHE C 1 197 ? 54.345 8.390   -8.115  1.00 61.27  ? 238 PHE C C   1 
ATOM   5518 O O   . PHE C 1 197 ? 54.602 7.254   -8.461  1.00 58.01  ? 238 PHE C O   1 
ATOM   5519 C CB  . PHE C 1 197 ? 51.829 8.562   -8.339  1.00 62.85  ? 238 PHE C CB  1 
ATOM   5520 C CG  . PHE C 1 197 ? 52.024 9.229   -9.660  1.00 71.11  ? 238 PHE C CG  1 
ATOM   5521 C CD1 . PHE C 1 197 ? 52.410 8.487   -10.778 1.00 81.35  ? 238 PHE C CD1 1 
ATOM   5522 C CD2 . PHE C 1 197 ? 51.828 10.600  -9.801  1.00 81.54  ? 238 PHE C CD2 1 
ATOM   5523 C CE1 . PHE C 1 197 ? 52.600 9.102   -12.032 1.00 77.71  ? 238 PHE C CE1 1 
ATOM   5524 C CE2 . PHE C 1 197 ? 52.012 11.230  -11.042 1.00 83.27  ? 238 PHE C CE2 1 
ATOM   5525 C CZ  . PHE C 1 197 ? 52.401 10.474  -12.165 1.00 83.47  ? 238 PHE C CZ  1 
ATOM   5526 N N   . GLN C 1 198 ? 55.167 9.412   -8.347  1.00 67.02  ? 239 GLN C N   1 
ATOM   5527 C CA  . GLN C 1 198 ? 56.445 9.229   -9.038  1.00 71.97  ? 239 GLN C CA  1 
ATOM   5528 C C   . GLN C 1 198 ? 57.459 8.547   -8.120  1.00 74.03  ? 239 GLN C C   1 
ATOM   5529 O O   . GLN C 1 198 ? 58.120 7.580   -8.513  1.00 76.23  ? 239 GLN C O   1 
ATOM   5530 C CB  . GLN C 1 198 ? 57.010 10.571  -9.497  1.00 73.96  ? 239 GLN C CB  1 
ATOM   5531 C CG  . GLN C 1 198 ? 57.298 10.632  -10.995 1.00 85.62  ? 239 GLN C CG  1 
ATOM   5532 C CD  . GLN C 1 198 ? 56.062 10.931  -11.840 1.00 90.47  ? 239 GLN C CD  1 
ATOM   5533 O OE1 . GLN C 1 198 ? 56.082 10.809  -13.070 1.00 89.93  ? 239 GLN C OE1 1 
ATOM   5534 N NE2 . GLN C 1 198 ? 54.986 11.341  -11.183 1.00 98.12  ? 239 GLN C NE2 1 
ATOM   5535 N N   . LEU C 1 199 ? 57.573 9.057   -6.897  1.00 75.04  ? 240 LEU C N   1 
ATOM   5536 C CA  . LEU C 1 199 ? 58.474 8.499   -5.891  1.00 72.59  ? 240 LEU C CA  1 
ATOM   5537 C C   . LEU C 1 199 ? 57.944 7.095   -5.586  1.00 72.60  ? 240 LEU C C   1 
ATOM   5538 O O   . LEU C 1 199 ? 58.692 6.135   -5.528  1.00 76.57  ? 240 LEU C O   1 
ATOM   5539 C CB  . LEU C 1 199 ? 58.455 9.392   -4.642  1.00 73.89  ? 240 LEU C CB  1 
ATOM   5540 C CG  . LEU C 1 199 ? 59.469 9.328   -3.488  1.00 80.73  ? 240 LEU C CG  1 
ATOM   5541 C CD1 . LEU C 1 199 ? 59.119 8.215   -2.517  1.00 85.57  ? 240 LEU C CD1 1 
ATOM   5542 C CD2 . LEU C 1 199 ? 60.873 9.142   -4.054  1.00 83.76  ? 240 LEU C CD2 1 
ATOM   5543 N N   . ALA C 1 200 ? 56.635 6.974   -5.442  1.00 73.17  ? 241 ALA C N   1 
ATOM   5544 C CA  . ALA C 1 200 ? 56.022 5.684   -5.156  1.00 70.55  ? 241 ALA C CA  1 
ATOM   5545 C C   . ALA C 1 200 ? 56.419 4.631   -6.162  1.00 69.15  ? 241 ALA C C   1 
ATOM   5546 O O   . ALA C 1 200 ? 56.523 3.462   -5.812  1.00 71.13  ? 241 ALA C O   1 
ATOM   5547 C CB  . ALA C 1 200 ? 54.489 5.809   -5.132  1.00 63.27  ? 241 ALA C CB  1 
ATOM   5548 N N   . THR C 1 201 ? 56.605 5.028   -7.420  1.00 72.30  ? 242 THR C N   1 
ATOM   5549 C CA  . THR C 1 201 ? 56.970 4.059   -8.459  1.00 77.02  ? 242 THR C CA  1 
ATOM   5550 C C   . THR C 1 201 ? 58.471 3.742   -8.473  1.00 76.15  ? 242 THR C C   1 
ATOM   5551 O O   . THR C 1 201 ? 58.867 2.599   -8.684  1.00 66.43  ? 242 THR C O   1 
ATOM   5552 C CB  . THR C 1 201 ? 56.565 4.548   -9.858  1.00 79.96  ? 242 THR C CB  1 
ATOM   5553 O OG1 . THR C 1 201 ? 55.140 4.496   -9.987  1.00 85.42  ? 242 THR C OG1 1 
ATOM   5554 C CG2 . THR C 1 201 ? 57.204 3.669   -10.927 1.00 82.56  ? 242 THR C CG2 1 
ATOM   5555 N N   . LYS C 1 202 ? 59.296 4.763   -8.265  1.00 72.10  ? 243 LYS C N   1 
ATOM   5556 C CA  . LYS C 1 202 ? 60.728 4.560   -8.227  1.00 77.44  ? 243 LYS C CA  1 
ATOM   5557 C C   . LYS C 1 202 ? 61.010 3.542   -7.112  1.00 76.68  ? 243 LYS C C   1 
ATOM   5558 O O   . LYS C 1 202 ? 61.677 2.541   -7.354  1.00 81.21  ? 243 LYS C O   1 
ATOM   5559 C CB  . LYS C 1 202 ? 61.455 5.893   -7.965  1.00 79.60  ? 243 LYS C CB  1 
ATOM   5560 C CG  . LYS C 1 202 ? 62.964 5.839   -8.212  1.00 91.29  ? 243 LYS C CG  1 
ATOM   5561 C CD  . LYS C 1 202 ? 63.571 7.228   -8.442  1.00 97.11  ? 243 LYS C CD  1 
ATOM   5562 C CE  . LYS C 1 202 ? 63.949 7.948   -7.145  1.00 97.57  ? 243 LYS C CE  1 
ATOM   5563 N NZ  . LYS C 1 202 ? 65.316 7.578   -6.667  1.00 99.20  ? 243 LYS C NZ  1 
ATOM   5564 N N   . ILE C 1 203 ? 60.479 3.784   -5.912  1.00 69.64  ? 244 ILE C N   1 
ATOM   5565 C CA  . ILE C 1 203 ? 60.674 2.887   -4.776  1.00 66.54  ? 244 ILE C CA  1 
ATOM   5566 C C   . ILE C 1 203 ? 60.030 1.497   -5.006  1.00 71.17  ? 244 ILE C C   1 
ATOM   5567 O O   . ILE C 1 203 ? 60.541 0.478   -4.534  1.00 70.00  ? 244 ILE C O   1 
ATOM   5568 C CB  . ILE C 1 203 ? 60.077 3.482   -3.468  1.00 62.24  ? 244 ILE C CB  1 
ATOM   5569 C CG1 . ILE C 1 203 ? 60.730 4.819   -3.124  1.00 57.82  ? 244 ILE C CG1 1 
ATOM   5570 C CG2 . ILE C 1 203 ? 60.254 2.509   -2.324  1.00 62.49  ? 244 ILE C CG2 1 
ATOM   5571 C CD1 . ILE C 1 203 ? 62.192 4.755   -2.777  1.00 65.95  ? 244 ILE C CD1 1 
ATOM   5572 N N   . MET C 1 204 ? 58.913 1.436   -5.719  1.00 68.25  ? 245 MET C N   1 
ATOM   5573 C CA  . MET C 1 204 ? 58.301 0.134   -5.940  1.00 69.29  ? 245 MET C CA  1 
ATOM   5574 C C   . MET C 1 204 ? 59.254 -0.740  -6.744  1.00 75.74  ? 245 MET C C   1 
ATOM   5575 O O   . MET C 1 204 ? 59.732 -1.762  -6.252  1.00 81.48  ? 245 MET C O   1 
ATOM   5576 C CB  . MET C 1 204 ? 56.965 0.255   -6.682  1.00 62.36  ? 245 MET C CB  1 
ATOM   5577 C CG  . MET C 1 204 ? 56.314 -1.089  -6.970  1.00 57.86  ? 245 MET C CG  1 
ATOM   5578 S SD  . MET C 1 204 ? 54.660 -0.984  -7.658  1.00 65.99  ? 245 MET C SD  1 
ATOM   5579 C CE  . MET C 1 204 ? 54.879 -1.460  -9.340  1.00 56.71  ? 245 MET C CE  1 
ATOM   5580 N N   . ASP C 1 205 ? 59.537 -0.325  -7.977  1.00 78.45  ? 246 ASP C N   1 
ATOM   5581 C CA  . ASP C 1 205 ? 60.429 -1.067  -8.865  1.00 79.38  ? 246 ASP C CA  1 
ATOM   5582 C C   . ASP C 1 205 ? 61.748 -1.455  -8.215  1.00 80.01  ? 246 ASP C C   1 
ATOM   5583 O O   . ASP C 1 205 ? 62.323 -2.484  -8.553  1.00 84.71  ? 246 ASP C O   1 
ATOM   5584 C CB  . ASP C 1 205 ? 60.730 -0.269  -10.135 1.00 76.37  ? 246 ASP C CB  1 
ATOM   5585 C CG  . ASP C 1 205 ? 59.505 -0.017  -10.963 1.00 76.28  ? 246 ASP C CG  1 
ATOM   5586 O OD1 . ASP C 1 205 ? 58.617 -0.905  -10.994 1.00 73.33  ? 246 ASP C OD1 1 
ATOM   5587 O OD2 . ASP C 1 205 ? 59.442 1.067   -11.585 1.00 83.00  ? 246 ASP C OD2 1 
ATOM   5588 N N   . LYS C 1 206 ? 62.237 -0.619  -7.307  1.00 79.04  ? 247 LYS C N   1 
ATOM   5589 C CA  . LYS C 1 206 ? 63.479 -0.912  -6.615  1.00 78.36  ? 247 LYS C CA  1 
ATOM   5590 C C   . LYS C 1 206 ? 63.238 -2.042  -5.634  1.00 82.34  ? 247 LYS C C   1 
ATOM   5591 O O   . LYS C 1 206 ? 64.028 -2.978  -5.533  1.00 86.35  ? 247 LYS C O   1 
ATOM   5592 C CB  . LYS C 1 206 ? 63.977 0.314   -5.860  1.00 71.76  ? 247 LYS C CB  1 
ATOM   5593 C CG  . LYS C 1 206 ? 64.800 1.256   -6.705  1.00 67.32  ? 247 LYS C CG  1 
ATOM   5594 C CD  . LYS C 1 206 ? 65.256 2.441   -5.889  1.00 71.14  ? 247 LYS C CD  1 
ATOM   5595 C CE  . LYS C 1 206 ? 66.186 3.301   -6.706  1.00 77.53  ? 247 LYS C CE  1 
ATOM   5596 N NZ  . LYS C 1 206 ? 67.308 2.424   -7.146  1.00 84.80  ? 247 LYS C NZ  1 
ATOM   5597 N N   . LEU C 1 207 ? 62.138 -1.950  -4.905  1.00 81.93  ? 248 LEU C N   1 
ATOM   5598 C CA  . LEU C 1 207 ? 61.808 -2.978  -3.944  1.00 78.25  ? 248 LEU C CA  1 
ATOM   5599 C C   . LEU C 1 207 ? 61.586 -4.287  -4.656  1.00 77.28  ? 248 LEU C C   1 
ATOM   5600 O O   . LEU C 1 207 ? 61.963 -5.334  -4.145  1.00 83.74  ? 248 LEU C O   1 
ATOM   5601 C CB  . LEU C 1 207 ? 60.548 -2.604  -3.167  1.00 78.96  ? 248 LEU C CB  1 
ATOM   5602 C CG  . LEU C 1 207 ? 60.733 -1.503  -2.127  1.00 78.00  ? 248 LEU C CG  1 
ATOM   5603 C CD1 . LEU C 1 207 ? 59.435 -1.310  -1.362  1.00 72.40  ? 248 LEU C CD1 1 
ATOM   5604 C CD2 . LEU C 1 207 ? 61.863 -1.880  -1.176  1.00 72.98  ? 248 LEU C CD2 1 
ATOM   5605 N N   . ILE C 1 208 ? 60.975 -4.232  -5.839  1.00 74.39  ? 249 ILE C N   1 
ATOM   5606 C CA  . ILE C 1 208 ? 60.691 -5.449  -6.597  1.00 69.35  ? 249 ILE C CA  1 
ATOM   5607 C C   . ILE C 1 208 ? 61.967 -6.107  -7.100  1.00 75.94  ? 249 ILE C C   1 
ATOM   5608 O O   . ILE C 1 208 ? 62.068 -7.338  -7.124  1.00 79.35  ? 249 ILE C O   1 
ATOM   5609 C CB  . ILE C 1 208 ? 59.762 -5.162  -7.806  1.00 63.06  ? 249 ILE C CB  1 
ATOM   5610 C CG1 . ILE C 1 208 ? 58.349 -4.852  -7.305  1.00 66.37  ? 249 ILE C CG1 1 
ATOM   5611 C CG2 . ILE C 1 208 ? 59.719 -6.365  -8.755  1.00 55.47  ? 249 ILE C CG2 1 
ATOM   5612 C CD1 . ILE C 1 208 ? 57.308 -4.609  -8.406  1.00 65.22  ? 249 ILE C CD1 1 
ATOM   5613 N N   . ARG C 1 209 ? 62.951 -5.289  -7.464  1.00 76.94  ? 250 ARG C N   1 
ATOM   5614 C CA  . ARG C 1 209 ? 64.195 -5.801  -7.997  1.00 81.75  ? 250 ARG C CA  1 
ATOM   5615 C C   . ARG C 1 209 ? 65.165 -6.337  -6.945  1.00 82.11  ? 250 ARG C C   1 
ATOM   5616 O O   . ARG C 1 209 ? 65.474 -7.524  -6.931  1.00 77.68  ? 250 ARG C O   1 
ATOM   5617 C CB  . ARG C 1 209 ? 64.856 -4.724  -8.873  1.00 88.11  ? 250 ARG C CB  1 
ATOM   5618 C CG  . ARG C 1 209 ? 66.101 -4.068  -8.298  1.00 99.04  ? 250 ARG C CG  1 
ATOM   5619 C CD  . ARG C 1 209 ? 67.301 -4.226  -9.226  1.00 99.55  ? 250 ARG C CD  1 
ATOM   5620 N NE  . ARG C 1 209 ? 67.218 -3.356  -10.396 1.00 104.43 ? 250 ARG C NE  1 
ATOM   5621 C CZ  . ARG C 1 209 ? 67.601 -2.083  -10.406 1.00 105.60 ? 250 ARG C CZ  1 
ATOM   5622 N NH1 . ARG C 1 209 ? 68.100 -1.532  -9.308  1.00 103.88 ? 250 ARG C NH1 1 
ATOM   5623 N NH2 . ARG C 1 209 ? 67.482 -1.361  -11.513 1.00 105.31 ? 250 ARG C NH2 1 
ATOM   5624 N N   . ASP C 1 210 ? 65.618 -5.471  -6.051  1.00 86.77  ? 251 ASP C N   1 
ATOM   5625 C CA  . ASP C 1 210 ? 66.573 -5.849  -5.017  1.00 88.30  ? 251 ASP C CA  1 
ATOM   5626 C C   . ASP C 1 210 ? 65.926 -6.318  -3.728  1.00 88.00  ? 251 ASP C C   1 
ATOM   5627 O O   . ASP C 1 210 ? 66.573 -6.312  -2.679  1.00 89.10  ? 251 ASP C O   1 
ATOM   5628 C CB  . ASP C 1 210 ? 67.491 -4.665  -4.699  1.00 93.08  ? 251 ASP C CB  1 
ATOM   5629 C CG  . ASP C 1 210 ? 68.111 -4.057  -5.944  1.00 101.04 ? 251 ASP C CG  1 
ATOM   5630 O OD1 . ASP C 1 210 ? 68.679 -4.824  -6.751  1.00 105.20 ? 251 ASP C OD1 1 
ATOM   5631 O OD2 . ASP C 1 210 ? 68.034 -2.816  -6.113  1.00 104.94 ? 251 ASP C OD2 1 
ATOM   5632 N N   . GLY C 1 211 ? 64.659 -6.722  -3.796  1.00 90.44  ? 252 GLY C N   1 
ATOM   5633 C CA  . GLY C 1 211 ? 63.967 -7.177  -2.597  1.00 87.51  ? 252 GLY C CA  1 
ATOM   5634 C C   . GLY C 1 211 ? 63.929 -6.102  -1.521  1.00 84.07  ? 252 GLY C C   1 
ATOM   5635 O O   . GLY C 1 211 ? 63.435 -6.320  -0.411  1.00 85.72  ? 252 GLY C O   1 
ATOM   5636 N N   . ARG C 1 212 ? 64.473 -4.939  -1.856  1.00 79.97  ? 253 ARG C N   1 
ATOM   5637 C CA  . ARG C 1 212 ? 64.502 -3.811  -0.951  1.00 80.52  ? 253 ARG C CA  1 
ATOM   5638 C C   . ARG C 1 212 ? 65.204 -2.613  -1.600  1.00 81.09  ? 253 ARG C C   1 
ATOM   5639 O O   . ARG C 1 212 ? 65.610 -2.668  -2.767  1.00 81.68  ? 253 ARG C O   1 
ATOM   5640 C CB  . ARG C 1 212 ? 65.151 -4.205  0.380   1.00 83.78  ? 253 ARG C CB  1 
ATOM   5641 C CG  . ARG C 1 212 ? 66.575 -3.711  0.610   1.00 96.20  ? 253 ARG C CG  1 
ATOM   5642 C CD  . ARG C 1 212 ? 67.635 -4.697  0.127   1.00 102.50 ? 253 ARG C CD  1 
ATOM   5643 N NE  . ARG C 1 212 ? 68.968 -4.260  0.539   1.00 104.32 ? 253 ARG C NE  1 
ATOM   5644 C CZ  . ARG C 1 212 ? 70.091 -4.918  0.277   1.00 104.15 ? 253 ARG C CZ  1 
ATOM   5645 N NH1 . ARG C 1 212 ? 70.061 -6.060  -0.401  1.00 101.57 ? 253 ARG C NH1 1 
ATOM   5646 N NH2 . ARG C 1 212 ? 71.247 -4.424  0.694   1.00 102.03 ? 253 ARG C NH2 1 
ATOM   5647 N N   . VAL C 1 213 ? 65.332 -1.523  -0.856  1.00 84.11  ? 254 VAL C N   1 
ATOM   5648 C CA  . VAL C 1 213 ? 65.941 -0.316  -1.400  1.00 93.26  ? 254 VAL C CA  1 
ATOM   5649 C C   . VAL C 1 213 ? 67.451 -0.216  -1.282  1.00 99.41  ? 254 VAL C C   1 
ATOM   5650 O O   . VAL C 1 213 ? 68.002 -0.206  -0.179  1.00 104.74 ? 254 VAL C O   1 
ATOM   5651 C CB  . VAL C 1 213 ? 65.329 0.945   -0.749  1.00 95.44  ? 254 VAL C CB  1 
ATOM   5652 C CG1 . VAL C 1 213 ? 66.015 2.198   -1.284  1.00 89.66  ? 254 VAL C CG1 1 
ATOM   5653 C CG2 . VAL C 1 213 ? 63.827 0.990   -1.022  1.00 93.57  ? 254 VAL C CG2 1 
ATOM   5654 N N   . ILE C 1 214 ? 68.121 -0.119  -2.425  1.00 103.69 ? 255 ILE C N   1 
ATOM   5655 C CA  . ILE C 1 214 ? 69.571 0.009   -2.433  1.00 106.36 ? 255 ILE C CA  1 
ATOM   5656 C C   . ILE C 1 214 ? 69.992 1.478   -2.571  1.00 106.74 ? 255 ILE C C   1 
ATOM   5657 O O   . ILE C 1 214 ? 70.003 2.032   -3.675  1.00 101.90 ? 255 ILE C O   1 
ATOM   5658 C CB  . ILE C 1 214 ? 70.189 -0.836  -3.577  1.00 109.17 ? 255 ILE C CB  1 
ATOM   5659 C CG1 . ILE C 1 214 ? 70.093 -2.323  -3.219  1.00 108.57 ? 255 ILE C CG1 1 
ATOM   5660 C CG2 . ILE C 1 214 ? 71.641 -0.432  -3.819  1.00 109.14 ? 255 ILE C CG2 1 
ATOM   5661 C CD1 . ILE C 1 214 ? 70.634 -3.255  -4.284  1.00 108.60 ? 255 ILE C CD1 1 
ATOM   5662 N N   . ARG C 1 215 ? 70.322 2.101   -1.436  1.00 109.31 ? 256 ARG C N   1 
ATOM   5663 C CA  . ARG C 1 215 ? 70.756 3.505   -1.406  1.00 113.81 ? 256 ARG C CA  1 
ATOM   5664 C C   . ARG C 1 215 ? 72.269 3.665   -1.167  1.00 118.20 ? 256 ARG C C   1 
ATOM   5665 O O   . ARG C 1 215 ? 72.829 3.091   -0.224  1.00 116.78 ? 256 ARG C O   1 
ATOM   5666 C CB  . ARG C 1 215 ? 70.002 4.294   -0.320  1.00 107.38 ? 256 ARG C CB  1 
ATOM   5667 C CG  . ARG C 1 215 ? 68.577 4.707   -0.667  1.00 99.77  ? 256 ARG C CG  1 
ATOM   5668 C CD  . ARG C 1 215 ? 68.097 5.778   0.313   1.00 92.47  ? 256 ARG C CD  1 
ATOM   5669 N NE  . ARG C 1 215 ? 66.682 6.138   0.181   1.00 84.36  ? 256 ARG C NE  1 
ATOM   5670 C CZ  . ARG C 1 215 ? 65.663 5.328   0.464   1.00 83.94  ? 256 ARG C CZ  1 
ATOM   5671 N NH1 . ARG C 1 215 ? 65.867 4.088   0.896   1.00 85.75  ? 256 ARG C NH1 1 
ATOM   5672 N NH2 . ARG C 1 215 ? 64.427 5.766   0.335   1.00 84.13  ? 256 ARG C NH2 1 
ATOM   5673 N N   . GLY C 1 216 ? 72.917 4.457   -2.021  1.00 121.10 ? 257 GLY C N   1 
ATOM   5674 C CA  . GLY C 1 216 ? 74.345 4.693   -1.892  1.00 123.29 ? 257 GLY C CA  1 
ATOM   5675 C C   . GLY C 1 216 ? 74.733 5.237   -0.526  1.00 124.52 ? 257 GLY C C   1 
ATOM   5676 O O   . GLY C 1 216 ? 74.734 6.447   -0.293  1.00 123.35 ? 257 GLY C O   1 
ATOM   5677 N N   . GLY C 1 240 ? 77.352 26.016  -3.010  1.00 180.82 ? 281 GLY C N   1 
ATOM   5678 C CA  . GLY C 1 240 ? 77.101 24.803  -3.766  1.00 181.25 ? 281 GLY C CA  1 
ATOM   5679 C C   . GLY C 1 240 ? 76.971 23.571  -2.891  1.00 181.90 ? 281 GLY C C   1 
ATOM   5680 O O   . GLY C 1 240 ? 75.863 23.121  -2.597  1.00 180.92 ? 281 GLY C O   1 
ATOM   5681 N N   . ILE C 1 241 ? 78.107 23.022  -2.473  1.00 182.97 ? 282 ILE C N   1 
ATOM   5682 C CA  . ILE C 1 241 ? 78.121 21.834  -1.629  1.00 183.90 ? 282 ILE C CA  1 
ATOM   5683 C C   . ILE C 1 241 ? 79.394 21.779  -0.786  1.00 184.61 ? 282 ILE C C   1 
ATOM   5684 O O   . ILE C 1 241 ? 80.494 21.633  -1.318  1.00 184.04 ? 282 ILE C O   1 
ATOM   5685 C CB  . ILE C 1 241 ? 78.010 20.583  -2.493  1.00 184.00 ? 282 ILE C CB  1 
ATOM   5686 N N   . VAL C 1 242 ? 79.236 21.895  0.530   1.00 185.51 ? 283 VAL C N   1 
ATOM   5687 C CA  . VAL C 1 242 ? 80.370 21.858  1.450   1.00 186.20 ? 283 VAL C CA  1 
ATOM   5688 C C   . VAL C 1 242 ? 80.066 20.999  2.676   1.00 186.13 ? 283 VAL C C   1 
ATOM   5689 O O   . VAL C 1 242 ? 79.015 21.144  3.303   1.00 185.95 ? 283 VAL C O   1 
ATOM   5690 C CB  . VAL C 1 242 ? 80.734 23.274  1.882   1.00 186.72 ? 283 VAL C CB  1 
ATOM   5691 N N   . VAL C 1 243 ? 80.999 20.112  3.015   1.00 185.71 ? 284 VAL C N   1 
ATOM   5692 C CA  . VAL C 1 243 ? 80.847 19.213  4.158   1.00 184.60 ? 284 VAL C CA  1 
ATOM   5693 C C   . VAL C 1 243 ? 80.754 19.969  5.481   1.00 184.11 ? 284 VAL C C   1 
ATOM   5694 O O   . VAL C 1 243 ? 81.520 20.900  5.728   1.00 184.77 ? 284 VAL C O   1 
ATOM   5695 C CB  . VAL C 1 243 ? 82.030 18.226  4.251   1.00 184.01 ? 284 VAL C CB  1 
ATOM   5696 C CG1 . VAL C 1 243 ? 81.772 17.207  5.349   1.00 183.22 ? 284 VAL C CG1 1 
ATOM   5697 C CG2 . VAL C 1 243 ? 82.237 17.536  2.917   1.00 184.19 ? 284 VAL C CG2 1 
ATOM   5698 N N   . ASN C 1 244 ? 79.815 19.560  6.329   1.00 183.32 ? 285 ASN C N   1 
ATOM   5699 C CA  . ASN C 1 244 ? 79.622 20.196  7.628   1.00 182.91 ? 285 ASN C CA  1 
ATOM   5700 C C   . ASN C 1 244 ? 79.841 19.199  8.762   1.00 182.49 ? 285 ASN C C   1 
ATOM   5701 O O   . ASN C 1 244 ? 80.118 19.587  9.897   1.00 181.17 ? 285 ASN C O   1 
ATOM   5702 C CB  . ASN C 1 244 ? 78.211 20.783  7.729   1.00 183.48 ? 285 ASN C CB  1 
ATOM   5703 C CG  . ASN C 1 244 ? 77.935 21.836  6.670   1.00 184.41 ? 285 ASN C CG  1 
ATOM   5704 O OD1 . ASN C 1 244 ? 76.866 22.445  6.649   1.00 184.98 ? 285 ASN C OD1 1 
ATOM   5705 N ND2 . ASN C 1 244 ? 78.899 22.053  5.784   1.00 184.42 ? 285 ASN C ND2 1 
ATOM   5706 N N   . ASP C 1 261 ? 85.146 21.219  4.926   1.00 193.45 ? 302 ASP C N   1 
ATOM   5707 C CA  . ASP C 1 261 ? 85.633 21.665  3.626   1.00 193.42 ? 302 ASP C CA  1 
ATOM   5708 C C   . ASP C 1 261 ? 84.472 21.868  2.659   1.00 193.58 ? 302 ASP C C   1 
ATOM   5709 O O   . ASP C 1 261 ? 83.324 21.994  3.080   1.00 193.95 ? 302 ASP C O   1 
ATOM   5710 C CB  . ASP C 1 261 ? 86.604 20.637  3.052   1.00 193.56 ? 302 ASP C CB  1 
ATOM   5711 C CG  . ASP C 1 261 ? 85.957 19.289  2.843   1.00 194.20 ? 302 ASP C CG  1 
ATOM   5712 O OD1 . ASP C 1 261 ? 85.506 18.688  3.841   1.00 194.45 ? 302 ASP C OD1 1 
ATOM   5713 O OD2 . ASP C 1 261 ? 85.896 18.836  1.681   1.00 193.97 ? 302 ASP C OD2 1 
ATOM   5714 N N   . LEU C 1 262 ? 84.775 21.893  1.364   1.00 193.90 ? 303 LEU C N   1 
ATOM   5715 C CA  . LEU C 1 262 ? 83.748 22.090  0.344   1.00 193.99 ? 303 LEU C CA  1 
ATOM   5716 C C   . LEU C 1 262 ? 83.953 21.197  -0.875  1.00 193.72 ? 303 LEU C C   1 
ATOM   5717 O O   . LEU C 1 262 ? 85.080 20.978  -1.319  1.00 193.01 ? 303 LEU C O   1 
ATOM   5718 C CB  . LEU C 1 262 ? 83.719 23.551  -0.084  1.00 193.62 ? 303 LEU C CB  1 
ATOM   5719 N N   . ILE C 1 263 ? 82.848 20.689  -1.411  1.00 193.98 ? 304 ILE C N   1 
ATOM   5720 C CA  . ILE C 1 263 ? 82.882 19.820  -2.581  1.00 194.68 ? 304 ILE C CA  1 
ATOM   5721 C C   . ILE C 1 263 ? 82.245 20.514  -3.781  1.00 194.99 ? 304 ILE C C   1 
ATOM   5722 O O   . ILE C 1 263 ? 81.031 20.720  -3.822  1.00 195.17 ? 304 ILE C O   1 
ATOM   5723 C CB  . ILE C 1 263 ? 82.152 18.516  -2.282  1.00 194.56 ? 304 ILE C CB  1 
ATOM   5724 N N   . ILE C 1 264 ? 83.073 20.868  -4.757  1.00 194.76 ? 305 ILE C N   1 
ATOM   5725 C CA  . ILE C 1 264 ? 82.603 21.542  -5.959  1.00 194.65 ? 305 ILE C CA  1 
ATOM   5726 C C   . ILE C 1 264 ? 81.597 20.699  -6.738  1.00 195.31 ? 305 ILE C C   1 
ATOM   5727 O O   . ILE C 1 264 ? 80.579 21.211  -7.205  1.00 195.50 ? 305 ILE C O   1 
ATOM   5728 C CB  . ILE C 1 264 ? 83.786 21.895  -6.851  1.00 193.87 ? 305 ILE C CB  1 
ATOM   5729 N N   . SER C 1 265 ? 81.881 19.407  -6.875  1.00 195.73 ? 306 SER C N   1 
ATOM   5730 C CA  . SER C 1 265 ? 80.996 18.510  -7.612  1.00 196.21 ? 306 SER C CA  1 
ATOM   5731 C C   . SER C 1 265 ? 81.046 17.073  -7.095  1.00 196.89 ? 306 SER C C   1 
ATOM   5732 O O   . SER C 1 265 ? 81.759 16.770  -6.137  1.00 197.37 ? 306 SER C O   1 
ATOM   5733 C CB  . SER C 1 265 ? 81.354 18.541  -9.093  1.00 196.03 ? 306 SER C CB  1 
ATOM   5734 N N   . VAL C 1 266 ? 80.275 16.198  -7.740  1.00 197.18 ? 307 VAL C N   1 
ATOM   5735 C CA  . VAL C 1 266 ? 80.211 14.781  -7.382  1.00 196.15 ? 307 VAL C CA  1 
ATOM   5736 C C   . VAL C 1 266 ? 80.343 13.941  -8.655  1.00 195.98 ? 307 VAL C C   1 
ATOM   5737 O O   . VAL C 1 266 ? 79.964 14.389  -9.738  1.00 195.93 ? 307 VAL C O   1 
ATOM   5738 C CB  . VAL C 1 266 ? 78.877 14.439  -6.679  1.00 195.54 ? 307 VAL C CB  1 
ATOM   5739 C CG1 . VAL C 1 266 ? 78.864 12.978  -6.261  1.00 194.40 ? 307 VAL C CG1 1 
ATOM   5740 C CG2 . VAL C 1 266 ? 78.686 15.335  -5.466  1.00 195.32 ? 307 VAL C CG2 1 
ATOM   5741 N N   . ASP C 1 267 ? 80.870 12.725  -8.511  1.00 195.23 ? 308 ASP C N   1 
ATOM   5742 C CA  . ASP C 1 267 ? 81.099 11.818  -9.638  1.00 194.14 ? 308 ASP C CA  1 
ATOM   5743 C C   . ASP C 1 267 ? 81.623 12.618  -10.826 1.00 193.92 ? 308 ASP C C   1 
ATOM   5744 O O   . ASP C 1 267 ? 82.825 12.854  -10.949 1.00 193.31 ? 308 ASP C O   1 
ATOM   5745 C CB  . ASP C 1 267 ? 79.816 11.079  -10.040 1.00 192.16 ? 308 ASP C CB  1 
ATOM   5746 C CG  . ASP C 1 267 ? 80.100 9.808   -10.834 1.00 190.16 ? 308 ASP C CG  1 
ATOM   5747 O OD1 . ASP C 1 267 ? 80.906 9.857   -11.787 1.00 190.50 ? 308 ASP C OD1 1 
ATOM   5748 O OD2 . ASP C 1 267 ? 79.515 8.755   -10.511 1.00 187.91 ? 308 ASP C OD2 1 
ATOM   5749 N N   . ASN C 1 268 ? 80.711 13.045  -11.691 1.00 193.33 ? 309 ASN C N   1 
ATOM   5750 C CA  . ASN C 1 268 ? 81.081 13.822  -12.865 1.00 192.11 ? 309 ASN C CA  1 
ATOM   5751 C C   . ASN C 1 268 ? 80.018 14.874  -13.154 1.00 189.87 ? 309 ASN C C   1 
ATOM   5752 O O   . ASN C 1 268 ? 79.655 15.097  -14.308 1.00 189.72 ? 309 ASN C O   1 
ATOM   5753 C CB  . ASN C 1 268 ? 81.237 12.901  -14.081 1.00 193.37 ? 309 ASN C CB  1 
ATOM   5754 C CG  . ASN C 1 268 ? 82.397 11.931  -13.939 1.00 193.16 ? 309 ASN C CG  1 
ATOM   5755 O OD1 . ASN C 1 268 ? 83.550 12.342  -13.798 1.00 191.95 ? 309 ASN C OD1 1 
ATOM   5756 N ND2 . ASN C 1 268 ? 82.098 10.637  -13.981 1.00 193.58 ? 309 ASN C ND2 1 
ATOM   5757 N N   . LYS C 1 269 ? 79.519 15.525  -12.111 1.00 186.66 ? 310 LYS C N   1 
ATOM   5758 C CA  . LYS C 1 269 ? 78.489 16.533  -12.309 1.00 184.54 ? 310 LYS C CA  1 
ATOM   5759 C C   . LYS C 1 269 ? 78.435 17.498  -11.126 1.00 182.73 ? 310 LYS C C   1 
ATOM   5760 O O   . LYS C 1 269 ? 78.664 17.103  -9.983  1.00 181.82 ? 310 LYS C O   1 
ATOM   5761 C CB  . LYS C 1 269 ? 77.137 15.839  -12.507 1.00 184.27 ? 310 LYS C CB  1 
ATOM   5762 C CG  . LYS C 1 269 ? 76.090 16.670  -13.241 1.00 184.87 ? 310 LYS C CG  1 
ATOM   5763 C CD  . LYS C 1 269 ? 76.565 17.106  -14.628 1.00 185.24 ? 310 LYS C CD  1 
ATOM   5764 C CE  . LYS C 1 269 ? 76.960 15.924  -15.500 1.00 185.74 ? 310 LYS C CE  1 
ATOM   5765 N NZ  . LYS C 1 269 ? 77.471 16.374  -16.825 1.00 183.36 ? 310 LYS C NZ  1 
ATOM   5766 N N   . PRO C 1 270 ? 78.135 18.783  -11.394 1.00 180.98 ? 311 PRO C N   1 
ATOM   5767 C CA  . PRO C 1 270 ? 78.039 19.856  -10.399 1.00 179.68 ? 311 PRO C CA  1 
ATOM   5768 C C   . PRO C 1 270 ? 77.443 19.501  -9.039  1.00 178.50 ? 311 PRO C C   1 
ATOM   5769 O O   . PRO C 1 270 ? 76.633 18.583  -8.920  1.00 178.00 ? 311 PRO C O   1 
ATOM   5770 C CB  . PRO C 1 270 ? 77.217 20.910  -11.127 1.00 179.32 ? 311 PRO C CB  1 
ATOM   5771 C CG  . PRO C 1 270 ? 77.738 20.799  -12.509 1.00 179.33 ? 311 PRO C CG  1 
ATOM   5772 C CD  . PRO C 1 270 ? 77.796 19.301  -12.733 1.00 179.43 ? 311 PRO C CD  1 
ATOM   5773 N N   . ALA C 1 271 ? 77.853 20.252  -8.020  1.00 177.21 ? 312 ALA C N   1 
ATOM   5774 C CA  . ALA C 1 271 ? 77.371 20.050  -6.659  1.00 176.05 ? 312 ALA C CA  1 
ATOM   5775 C C   . ALA C 1 271 ? 76.754 21.340  -6.131  1.00 174.66 ? 312 ALA C C   1 
ATOM   5776 O O   . ALA C 1 271 ? 76.862 22.391  -6.762  1.00 172.31 ? 312 ALA C O   1 
ATOM   5777 C CB  . ALA C 1 271 ? 78.514 19.613  -5.754  1.00 176.06 ? 312 ALA C CB  1 
ATOM   5778 N N   . THR C 1 277 ? 71.401 16.903  -4.917  1.00 189.61 ? 318 THR C N   1 
ATOM   5779 C CA  . THR C 1 277 ? 72.773 16.420  -5.034  1.00 189.87 ? 318 THR C CA  1 
ATOM   5780 C C   . THR C 1 277 ? 73.075 15.357  -3.980  1.00 189.37 ? 318 THR C C   1 
ATOM   5781 O O   . THR C 1 277 ? 73.561 14.273  -4.307  1.00 189.69 ? 318 THR C O   1 
ATOM   5782 C CB  . THR C 1 277 ? 73.782 17.576  -4.894  1.00 190.12 ? 318 THR C CB  1 
ATOM   5783 O OG1 . THR C 1 277 ? 73.557 18.533  -5.936  1.00 190.05 ? 318 THR C OG1 1 
ATOM   5784 C CG2 . THR C 1 277 ? 75.209 17.054  -4.994  1.00 190.16 ? 318 THR C CG2 1 
ATOM   5785 N N   . MET C 1 278 ? 72.790 15.664  -2.718  1.00 188.56 ? 319 MET C N   1 
ATOM   5786 C CA  . MET C 1 278 ? 73.019 14.709  -1.636  1.00 188.25 ? 319 MET C CA  1 
ATOM   5787 C C   . MET C 1 278 ? 72.023 13.582  -1.890  1.00 187.65 ? 319 MET C C   1 
ATOM   5788 O O   . MET C 1 278 ? 71.890 12.650  -1.099  1.00 188.48 ? 319 MET C O   1 
ATOM   5789 C CB  . MET C 1 278 ? 72.736 15.366  -0.278  1.00 188.41 ? 319 MET C CB  1 
ATOM   5790 C CG  . MET C 1 278 ? 73.535 14.812  0.914   1.00 188.24 ? 319 MET C CG  1 
ATOM   5791 S SD  . MET C 1 278 ? 73.066 13.175  1.541   1.00 187.18 ? 319 MET C SD  1 
ATOM   5792 C CE  . MET C 1 278 ? 74.498 12.198  1.076   1.00 186.21 ? 319 MET C CE  1 
ATOM   5793 N N   . ASP C 1 279 ? 71.330 13.691  -3.019  1.00 186.36 ? 320 ASP C N   1 
ATOM   5794 C CA  . ASP C 1 279 ? 70.325 12.725  -3.429  1.00 185.42 ? 320 ASP C CA  1 
ATOM   5795 C C   . ASP C 1 279 ? 70.887 11.728  -4.450  1.00 184.20 ? 320 ASP C C   1 
ATOM   5796 O O   . ASP C 1 279 ? 70.561 10.541  -4.408  1.00 184.88 ? 320 ASP C O   1 
ATOM   5797 C CB  . ASP C 1 279 ? 69.126 13.473  -4.022  1.00 186.20 ? 320 ASP C CB  1 
ATOM   5798 C CG  . ASP C 1 279 ? 67.888 12.606  -4.136  1.00 186.63 ? 320 ASP C CG  1 
ATOM   5799 O OD1 . ASP C 1 279 ? 67.929 11.596  -4.870  1.00 188.06 ? 320 ASP C OD1 1 
ATOM   5800 O OD2 . ASP C 1 279 ? 66.872 12.938  -3.489  1.00 186.08 ? 320 ASP C OD2 1 
ATOM   5801 N N   . GLN C 1 280 ? 71.733 12.207  -5.358  1.00 181.66 ? 321 GLN C N   1 
ATOM   5802 C CA  . GLN C 1 280 ? 72.322 11.341  -6.380  1.00 178.96 ? 321 GLN C CA  1 
ATOM   5803 C C   . GLN C 1 280 ? 73.200 10.248  -5.788  1.00 177.13 ? 321 GLN C C   1 
ATOM   5804 O O   . GLN C 1 280 ? 73.177 9.106   -6.249  1.00 176.50 ? 321 GLN C O   1 
ATOM   5805 C CB  . GLN C 1 280 ? 73.157 12.156  -7.367  1.00 178.40 ? 321 GLN C CB  1 
ATOM   5806 C CG  . GLN C 1 280 ? 72.363 13.096  -8.246  1.00 177.88 ? 321 GLN C CG  1 
ATOM   5807 C CD  . GLN C 1 280 ? 73.205 13.669  -9.364  1.00 176.64 ? 321 GLN C CD  1 
ATOM   5808 O OE1 . GLN C 1 280 ? 74.260 14.252  -9.122  1.00 175.06 ? 321 GLN C OE1 1 
ATOM   5809 N NE2 . GLN C 1 280 ? 72.745 13.502  -10.599 1.00 176.32 ? 321 GLN C NE2 1 
ATOM   5810 N N   . VAL C 1 281 ? 73.979 10.609  -4.773  1.00 174.93 ? 322 VAL C N   1 
ATOM   5811 C CA  . VAL C 1 281 ? 74.880 9.671   -4.111  1.00 172.86 ? 322 VAL C CA  1 
ATOM   5812 C C   . VAL C 1 281 ? 74.262 8.279   -3.954  1.00 171.28 ? 322 VAL C C   1 
ATOM   5813 O O   . VAL C 1 281 ? 74.913 7.265   -4.214  1.00 171.44 ? 322 VAL C O   1 
ATOM   5814 C CB  . VAL C 1 281 ? 75.303 10.206  -2.713  1.00 172.24 ? 322 VAL C CB  1 
ATOM   5815 C CG1 . VAL C 1 281 ? 74.080 10.409  -1.833  1.00 172.17 ? 322 VAL C CG1 1 
ATOM   5816 C CG2 . VAL C 1 281 ? 76.281 9.245   -2.057  1.00 171.94 ? 322 VAL C CG2 1 
ATOM   5817 N N   . ALA C 1 282 ? 72.998 8.240   -3.544  1.00 168.35 ? 323 ALA C N   1 
ATOM   5818 C CA  . ALA C 1 282 ? 72.297 6.980   -3.342  1.00 165.28 ? 323 ALA C CA  1 
ATOM   5819 C C   . ALA C 1 282 ? 71.986 6.258   -4.649  1.00 163.20 ? 323 ALA C C   1 
ATOM   5820 O O   . ALA C 1 282 ? 71.982 5.026   -4.699  1.00 162.09 ? 323 ALA C O   1 
ATOM   5821 C CB  . ALA C 1 282 ? 71.010 7.226   -2.565  1.00 165.33 ? 323 ALA C CB  1 
ATOM   5822 N N   . GLU C 1 283 ? 71.736 7.025   -5.705  1.00 160.40 ? 324 GLU C N   1 
ATOM   5823 C CA  . GLU C 1 283 ? 71.402 6.447   -7.002  1.00 158.06 ? 324 GLU C CA  1 
ATOM   5824 C C   . GLU C 1 283 ? 72.618 6.029   -7.827  1.00 156.74 ? 324 GLU C C   1 
ATOM   5825 O O   . GLU C 1 283 ? 72.576 6.039   -9.061  1.00 155.03 ? 324 GLU C O   1 
ATOM   5826 C CB  . GLU C 1 283 ? 70.546 7.431   -7.804  1.00 157.49 ? 324 GLU C CB  1 
ATOM   5827 C CG  . GLU C 1 283 ? 69.830 6.804   -8.988  1.00 154.93 ? 324 GLU C CG  1 
ATOM   5828 C CD  . GLU C 1 283 ? 68.927 5.658   -8.574  1.00 153.89 ? 324 GLU C CD  1 
ATOM   5829 O OE1 . GLU C 1 283 ? 68.035 5.874   -7.726  1.00 153.98 ? 324 GLU C OE1 1 
ATOM   5830 O OE2 . GLU C 1 283 ? 69.109 4.541   -9.096  1.00 151.78 ? 324 GLU C OE2 1 
ATOM   5831 N N   . ILE C 1 284 ? 73.701 5.661   -7.148  1.00 155.13 ? 325 ILE C N   1 
ATOM   5832 C CA  . ILE C 1 284 ? 74.911 5.224   -7.837  1.00 153.70 ? 325 ILE C CA  1 
ATOM   5833 C C   . ILE C 1 284 ? 74.951 3.696   -7.866  1.00 153.85 ? 325 ILE C C   1 
ATOM   5834 O O   . ILE C 1 284 ? 74.554 3.079   -8.859  1.00 152.93 ? 325 ILE C O   1 
ATOM   5835 C CB  . ILE C 1 284 ? 76.178 5.751   -7.136  1.00 152.49 ? 325 ILE C CB  1 
ATOM   5836 C CG1 . ILE C 1 284 ? 76.155 7.281   -7.102  1.00 152.77 ? 325 ILE C CG1 1 
ATOM   5837 C CG2 . ILE C 1 284 ? 77.419 5.260   -7.870  1.00 152.37 ? 325 ILE C CG2 1 
ATOM   5838 C CD1 . ILE C 1 284 ? 76.160 7.932   -8.474  1.00 151.37 ? 325 ILE C CD1 1 
ATOM   5839 N N   . ARG C 1 285 ? 75.429 3.106   -6.769  1.00 152.69 ? 326 ARG C N   1 
ATOM   5840 C CA  . ARG C 1 285 ? 75.530 1.654   -6.596  1.00 150.29 ? 326 ARG C CA  1 
ATOM   5841 C C   . ARG C 1 285 ? 76.702 1.326   -5.685  1.00 151.10 ? 326 ARG C C   1 
ATOM   5842 O O   . ARG C 1 285 ? 77.855 1.458   -6.084  1.00 152.23 ? 326 ARG C O   1 
ATOM   5843 C CB  . ARG C 1 285 ? 75.732 0.939   -7.935  1.00 147.05 ? 326 ARG C CB  1 
ATOM   5844 C CG  . ARG C 1 285 ? 75.457 -0.553  -7.872  1.00 145.29 ? 326 ARG C CG  1 
ATOM   5845 C CD  . ARG C 1 285 ? 75.543 -1.185  -9.251  1.00 145.18 ? 326 ARG C CD  1 
ATOM   5846 N NE  . ARG C 1 285 ? 74.978 -2.534  -9.288  1.00 144.48 ? 326 ARG C NE  1 
ATOM   5847 C CZ  . ARG C 1 285 ? 75.444 -3.569  -8.596  1.00 142.26 ? 326 ARG C CZ  1 
ATOM   5848 N NH1 . ARG C 1 285 ? 76.495 -3.421  -7.800  1.00 140.85 ? 326 ARG C NH1 1 
ATOM   5849 N NH2 . ARG C 1 285 ? 74.859 -4.756  -8.701  1.00 136.98 ? 326 ARG C NH2 1 
ATOM   5850 N N   . PRO C 1 286 ? 76.420 0.891   -4.447  1.00 152.93 ? 327 PRO C N   1 
ATOM   5851 C CA  . PRO C 1 286 ? 77.463 0.544   -3.479  1.00 154.39 ? 327 PRO C CA  1 
ATOM   5852 C C   . PRO C 1 286 ? 78.662 -0.155  -4.115  1.00 155.71 ? 327 PRO C C   1 
ATOM   5853 O O   . PRO C 1 286 ? 78.507 -1.121  -4.862  1.00 154.02 ? 327 PRO C O   1 
ATOM   5854 C CB  . PRO C 1 286 ? 76.716 -0.342  -2.494  1.00 154.10 ? 327 PRO C CB  1 
ATOM   5855 C CG  . PRO C 1 286 ? 75.390 0.332   -2.427  1.00 152.42 ? 327 PRO C CG  1 
ATOM   5856 C CD  . PRO C 1 286 ? 75.086 0.595   -3.893  1.00 153.83 ? 327 PRO C CD  1 
ATOM   5857 N N   . GLY C 1 287 ? 79.855 0.348   -3.814  1.00 158.24 ? 328 GLY C N   1 
ATOM   5858 C CA  . GLY C 1 287 ? 81.067 -0.224  -4.367  1.00 161.02 ? 328 GLY C CA  1 
ATOM   5859 C C   . GLY C 1 287 ? 81.585 0.597   -5.534  1.00 163.19 ? 328 GLY C C   1 
ATOM   5860 O O   . GLY C 1 287 ? 82.509 0.180   -6.233  1.00 163.12 ? 328 GLY C O   1 
ATOM   5861 N N   . SER C 1 288 ? 80.984 1.767   -5.744  1.00 164.97 ? 329 SER C N   1 
ATOM   5862 C CA  . SER C 1 288 ? 81.381 2.658   -6.831  1.00 166.24 ? 329 SER C CA  1 
ATOM   5863 C C   . SER C 1 288 ? 82.280 3.779   -6.323  1.00 167.99 ? 329 SER C C   1 
ATOM   5864 O O   . SER C 1 288 ? 81.922 4.495   -5.389  1.00 167.75 ? 329 SER C O   1 
ATOM   5865 C CB  . SER C 1 288 ? 80.146 3.263   -7.504  1.00 164.26 ? 329 SER C CB  1 
ATOM   5866 O OG  . SER C 1 288 ? 79.394 2.272   -8.180  1.00 162.24 ? 329 SER C OG  1 
ATOM   5867 N N   . VAL C 1 289 ? 83.446 3.924   -6.948  1.00 170.29 ? 330 VAL C N   1 
ATOM   5868 C CA  . VAL C 1 289 ? 84.412 4.950   -6.570  1.00 172.30 ? 330 VAL C CA  1 
ATOM   5869 C C   . VAL C 1 289 ? 84.244 6.202   -7.426  1.00 173.64 ? 330 VAL C C   1 
ATOM   5870 O O   . VAL C 1 289 ? 83.889 6.117   -8.602  1.00 173.14 ? 330 VAL C O   1 
ATOM   5871 C CB  . VAL C 1 289 ? 85.856 4.436   -6.737  1.00 172.64 ? 330 VAL C CB  1 
ATOM   5872 C CG1 . VAL C 1 289 ? 86.839 5.478   -6.235  1.00 172.52 ? 330 VAL C CG1 1 
ATOM   5873 C CG2 . VAL C 1 289 ? 86.032 3.126   -5.989  1.00 172.39 ? 330 VAL C CG2 1 
ATOM   5874 N N   . ILE C 1 290 ? 84.504 7.362   -6.831  1.00 175.61 ? 331 ILE C N   1 
ATOM   5875 C CA  . ILE C 1 290 ? 84.378 8.631   -7.540  1.00 177.60 ? 331 ILE C CA  1 
ATOM   5876 C C   . ILE C 1 290 ? 85.255 9.709   -6.904  1.00 179.10 ? 331 ILE C C   1 
ATOM   5877 O O   . ILE C 1 290 ? 85.594 9.631   -5.722  1.00 179.01 ? 331 ILE C O   1 
ATOM   5878 C CB  . ILE C 1 290 ? 82.920 9.078   -7.551  1.00 176.82 ? 331 ILE C CB  1 
ATOM   5879 N N   . PRO C 1 291 ? 85.632 10.734  -7.687  1.00 180.62 ? 332 PRO C N   1 
ATOM   5880 C CA  . PRO C 1 291 ? 86.473 11.838  -7.216  1.00 181.96 ? 332 PRO C CA  1 
ATOM   5881 C C   . PRO C 1 291 ? 85.743 12.774  -6.256  1.00 183.00 ? 332 PRO C C   1 
ATOM   5882 O O   . PRO C 1 291 ? 86.076 13.956  -6.154  1.00 183.29 ? 332 PRO C O   1 
ATOM   5883 C CB  . PRO C 1 291 ? 86.871 12.535  -8.511  1.00 181.74 ? 332 PRO C CB  1 
ATOM   5884 C CG  . PRO C 1 291 ? 85.645 12.367  -9.345  1.00 181.56 ? 332 PRO C CG  1 
ATOM   5885 C CD  . PRO C 1 291 ? 85.289 10.915  -9.109  1.00 180.80 ? 332 PRO C CD  1 
ATOM   5886 N N   . LEU C 1 303 ? 89.267 13.030  -4.733  1.00 173.79 ? 344 LEU C N   1 
ATOM   5887 C CA  . LEU C 1 303 ? 89.740 11.964  -3.857  1.00 174.79 ? 344 LEU C CA  1 
ATOM   5888 C C   . LEU C 1 303 ? 89.095 10.631  -4.229  1.00 174.98 ? 344 LEU C C   1 
ATOM   5889 O O   . LEU C 1 303 ? 88.211 10.576  -5.084  1.00 175.04 ? 344 LEU C O   1 
ATOM   5890 C CB  . LEU C 1 303 ? 89.431 12.311  -2.399  1.00 173.20 ? 344 LEU C CB  1 
ATOM   5891 N N   . GLN C 1 304 ? 89.548 9.557   -3.589  1.00 174.98 ? 345 GLN C N   1 
ATOM   5892 C CA  . GLN C 1 304 ? 89.006 8.229   -3.851  1.00 174.80 ? 345 GLN C CA  1 
ATOM   5893 C C   . GLN C 1 304 ? 88.078 7.771   -2.733  1.00 175.86 ? 345 GLN C C   1 
ATOM   5894 O O   . GLN C 1 304 ? 88.527 7.193   -1.741  1.00 175.48 ? 345 GLN C O   1 
ATOM   5895 C CB  . GLN C 1 304 ? 90.131 7.199   -4.011  1.00 173.49 ? 345 GLN C CB  1 
ATOM   5896 C CG  . GLN C 1 304 ? 89.617 5.772   -4.209  1.00 170.29 ? 345 GLN C CG  1 
ATOM   5897 C CD  . GLN C 1 304 ? 90.719 4.730   -4.236  1.00 167.25 ? 345 GLN C CD  1 
ATOM   5898 O OE1 . GLN C 1 304 ? 90.457 3.539   -4.408  1.00 164.85 ? 345 GLN C OE1 1 
ATOM   5899 N NE2 . GLN C 1 304 ? 91.958 5.173   -4.063  1.00 165.30 ? 345 GLN C NE2 1 
ATOM   5900 N N   . VAL C 1 305 ? 86.784 8.035   -2.894  1.00 176.63 ? 346 VAL C N   1 
ATOM   5901 C CA  . VAL C 1 305 ? 85.793 7.625   -1.907  1.00 176.50 ? 346 VAL C CA  1 
ATOM   5902 C C   . VAL C 1 305 ? 84.878 6.594   -2.564  1.00 176.98 ? 346 VAL C C   1 
ATOM   5903 O O   . VAL C 1 305 ? 84.418 6.788   -3.690  1.00 176.65 ? 346 VAL C O   1 
ATOM   5904 C CB  . VAL C 1 305 ? 84.942 8.824   -1.408  1.00 175.07 ? 346 VAL C CB  1 
ATOM   5905 C CG1 . VAL C 1 305 ? 83.997 8.370   -0.304  1.00 173.13 ? 346 VAL C CG1 1 
ATOM   5906 C CG2 . VAL C 1 305 ? 85.846 9.933   -0.893  1.00 174.06 ? 346 VAL C CG2 1 
ATOM   5907 N N   . THR C 1 306 ? 84.636 5.489   -1.866  1.00 177.20 ? 347 THR C N   1 
ATOM   5908 C CA  . THR C 1 306 ? 83.778 4.432   -2.387  1.00 177.34 ? 347 THR C CA  1 
ATOM   5909 C C   . THR C 1 306 ? 82.506 4.348   -1.550  1.00 177.54 ? 347 THR C C   1 
ATOM   5910 O O   . THR C 1 306 ? 82.563 4.183   -0.332  1.00 177.68 ? 347 THR C O   1 
ATOM   5911 C CB  . THR C 1 306 ? 84.497 3.070   -2.360  1.00 177.30 ? 347 THR C CB  1 
ATOM   5912 O OG1 . THR C 1 306 ? 85.688 3.147   -3.155  1.00 176.59 ? 347 THR C OG1 1 
ATOM   5913 C CG2 . THR C 1 306 ? 83.593 1.977   -2.914  1.00 178.16 ? 347 THR C CG2 1 
ATOM   5914 N N   . ILE C 1 307 ? 81.361 4.466   -2.216  1.00 176.76 ? 348 ILE C N   1 
ATOM   5915 C CA  . ILE C 1 307 ? 80.072 4.418   -1.545  1.00 176.53 ? 348 ILE C CA  1 
ATOM   5916 C C   . ILE C 1 307 ? 79.555 2.996   -1.371  1.00 177.39 ? 348 ILE C C   1 
ATOM   5917 O O   . ILE C 1 307 ? 80.049 2.060   -2.002  1.00 177.53 ? 348 ILE C O   1 
ATOM   5918 C CB  . ILE C 1 307 ? 79.058 5.251   -2.318  1.00 176.17 ? 348 ILE C CB  1 
ATOM   5919 N N   . GLN C 1 308 ? 78.558 2.852   -0.499  1.00 177.95 ? 349 GLN C N   1 
ATOM   5920 C CA  . GLN C 1 308 ? 77.932 1.567   -0.214  1.00 178.02 ? 349 GLN C CA  1 
ATOM   5921 C C   . GLN C 1 308 ? 76.668 1.791   0.618   1.00 178.85 ? 349 GLN C C   1 
ATOM   5922 O O   . GLN C 1 308 ? 76.343 2.927   0.972   1.00 177.28 ? 349 GLN C O   1 
ATOM   5923 C CB  . GLN C 1 308 ? 78.900 0.642   0.535   1.00 177.12 ? 349 GLN C CB  1 
ATOM   5924 C CG  . GLN C 1 308 ? 78.427 -0.805  0.641   1.00 176.05 ? 349 GLN C CG  1 
ATOM   5925 C CD  . GLN C 1 308 ? 79.431 -1.700  1.337   1.00 175.56 ? 349 GLN C CD  1 
ATOM   5926 O OE1 . GLN C 1 308 ? 80.545 -1.893  0.855   1.00 177.07 ? 349 GLN C OE1 1 
ATOM   5927 N NE2 . GLN C 1 308 ? 79.039 -2.253  2.478   1.00 174.26 ? 349 GLN C NE2 1 
ATOM   5928 N N   . GLU C 1 309 ? 75.973 0.696   0.923   1.00 181.10 ? 350 GLU C N   1 
ATOM   5929 C CA  . GLU C 1 309 ? 74.725 0.694   1.689   1.00 183.17 ? 350 GLU C CA  1 
ATOM   5930 C C   . GLU C 1 309 ? 74.470 1.845   2.651   1.00 184.97 ? 350 GLU C C   1 
ATOM   5931 O O   . GLU C 1 309 ? 75.389 2.494   3.152   1.00 185.28 ? 350 GLU C O   1 
ATOM   5932 C CB  . GLU C 1 309 ? 74.578 -0.632  2.438   1.00 182.10 ? 350 GLU C CB  1 
ATOM   5933 C CG  . GLU C 1 309 ? 74.492 -1.830  1.512   1.00 180.31 ? 350 GLU C CG  1 
ATOM   5934 C CD  . GLU C 1 309 ? 73.450 -1.642  0.422   1.00 178.42 ? 350 GLU C CD  1 
ATOM   5935 O OE1 . GLU C 1 309 ? 72.250 -1.535  0.751   1.00 177.41 ? 350 GLU C OE1 1 
ATOM   5936 O OE2 . GLU C 1 309 ? 73.837 -1.593  -0.763  1.00 177.17 ? 350 GLU C OE2 1 
ATOM   5937 N N   . TYR C 1 310 ? 73.187 2.062   2.913   1.00 186.92 ? 351 TYR C N   1 
ATOM   5938 C CA  . TYR C 1 310 ? 72.700 3.128   3.783   1.00 188.85 ? 351 TYR C CA  1 
ATOM   5939 C C   . TYR C 1 310 ? 71.907 2.487   4.928   1.00 190.28 ? 351 TYR C C   1 
ATOM   5940 O O   . TYR C 1 310 ? 70.687 2.611   4.999   1.00 191.43 ? 351 TYR C O   1 
ATOM   5941 C CB  . TYR C 1 310 ? 71.817 4.054   2.935   1.00 189.33 ? 351 TYR C CB  1 
ATOM   5942 C CG  . TYR C 1 310 ? 71.230 5.292   3.600   1.00 189.29 ? 351 TYR C CG  1 
ATOM   5943 C CD1 . TYR C 1 310 ? 70.504 6.216   2.842   1.00 189.23 ? 351 TYR C CD1 1 
ATOM   5944 C CD2 . TYR C 1 310 ? 71.376 5.540   4.965   1.00 188.89 ? 351 TYR C CD2 1 
ATOM   5945 C CE1 . TYR C 1 310 ? 69.943 7.359   3.422   1.00 189.42 ? 351 TYR C CE1 1 
ATOM   5946 C CE2 . TYR C 1 310 ? 70.812 6.679   5.559   1.00 188.72 ? 351 TYR C CE2 1 
ATOM   5947 C CZ  . TYR C 1 310 ? 70.099 7.582   4.783   1.00 189.23 ? 351 TYR C CZ  1 
ATOM   5948 O OH  . TYR C 1 310 ? 69.555 8.705   5.370   1.00 189.56 ? 351 TYR C OH  1 
ATOM   5949 N N   . PRO C 1 311 ? 72.601 1.777   5.835   1.00 190.96 ? 352 PRO C N   1 
ATOM   5950 C CA  . PRO C 1 311 ? 71.968 1.105   6.980   1.00 191.98 ? 352 PRO C CA  1 
ATOM   5951 C C   . PRO C 1 311 ? 71.555 1.998   8.154   1.00 192.93 ? 352 PRO C C   1 
ATOM   5952 O O   . PRO C 1 311 ? 71.888 3.183   8.199   1.00 192.88 ? 352 PRO C O   1 
ATOM   5953 C CB  . PRO C 1 311 ? 73.020 0.074   7.398   1.00 191.76 ? 352 PRO C CB  1 
ATOM   5954 C CG  . PRO C 1 311 ? 73.815 -0.151  6.141   1.00 191.24 ? 352 PRO C CG  1 
ATOM   5955 C CD  . PRO C 1 311 ? 73.955 1.242   5.617   1.00 190.76 ? 352 PRO C CD  1 
ATOM   5956 N N   . ALA C 1 312 ? 70.828 1.400   9.100   1.00 194.02 ? 353 ALA C N   1 
ATOM   5957 C CA  . ALA C 1 312 ? 70.339 2.075   10.306  1.00 194.53 ? 353 ALA C CA  1 
ATOM   5958 C C   . ALA C 1 312 ? 69.132 2.988   10.085  1.00 194.89 ? 353 ALA C C   1 
ATOM   5959 O O   . ALA C 1 312 ? 69.300 4.227   10.145  1.00 195.12 ? 353 ALA C O   1 
ATOM   5960 C CB  . ALA C 1 312 ? 71.466 2.856   10.973  1.00 194.21 ? 353 ALA C CB  1 
ATOM   5961 N N   . VAL D 2 7   ? 24.600 -11.380 12.067  1.00 155.44 ? 407 VAL D N   1 
ATOM   5962 C CA  . VAL D 2 7   ? 23.514 -11.101 13.052  1.00 156.76 ? 407 VAL D CA  1 
ATOM   5963 C C   . VAL D 2 7   ? 22.230 -10.740 12.307  1.00 158.81 ? 407 VAL D C   1 
ATOM   5964 O O   . VAL D 2 7   ? 22.281 -10.354 11.138  1.00 159.12 ? 407 VAL D O   1 
ATOM   5965 C CB  . VAL D 2 7   ? 23.892 -9.920  13.979  1.00 155.71 ? 407 VAL D CB  1 
ATOM   5966 C CG1 . VAL D 2 7   ? 22.965 -9.882  15.187  1.00 153.14 ? 407 VAL D CG1 1 
ATOM   5967 C CG2 . VAL D 2 7   ? 25.342 -10.042 14.413  1.00 155.01 ? 407 VAL D CG2 1 
ATOM   5968 N N   . TYR D 2 8   ? 21.090 -10.880 12.986  1.00 161.47 ? 408 TYR D N   1 
ATOM   5969 C CA  . TYR D 2 8   ? 19.773 -10.556 12.423  1.00 163.73 ? 408 TYR D CA  1 
ATOM   5970 C C   . TYR D 2 8   ? 18.618 -11.037 13.310  1.00 163.99 ? 408 TYR D C   1 
ATOM   5971 O O   . TYR D 2 8   ? 18.811 -11.869 14.195  1.00 165.28 ? 408 TYR D O   1 
ATOM   5972 C CB  . TYR D 2 8   ? 19.616 -11.143 11.008  1.00 165.78 ? 408 TYR D CB  1 
ATOM   5973 C CG  . TYR D 2 8   ? 19.659 -12.655 10.921  1.00 167.47 ? 408 TYR D CG  1 
ATOM   5974 C CD1 . TYR D 2 8   ? 18.655 -13.440 11.493  1.00 166.50 ? 408 TYR D CD1 1 
ATOM   5975 C CD2 . TYR D 2 8   ? 20.698 -13.300 10.249  1.00 168.46 ? 408 TYR D CD2 1 
ATOM   5976 C CE1 . TYR D 2 8   ? 18.683 -14.829 11.397  1.00 166.60 ? 408 TYR D CE1 1 
ATOM   5977 C CE2 . TYR D 2 8   ? 20.736 -14.690 10.146  1.00 169.01 ? 408 TYR D CE2 1 
ATOM   5978 C CZ  . TYR D 2 8   ? 19.725 -15.448 10.721  1.00 167.63 ? 408 TYR D CZ  1 
ATOM   5979 O OH  . TYR D 2 8   ? 19.756 -16.820 10.609  1.00 165.88 ? 408 TYR D OH  1 
ATOM   5980 N N   . GLN D 2 9   ? 17.421 -10.504 13.067  1.00 163.80 ? 409 GLN D N   1 
ATOM   5981 C CA  . GLN D 2 9   ? 16.224 -10.863 13.833  1.00 162.27 ? 409 GLN D CA  1 
ATOM   5982 C C   . GLN D 2 9   ? 14.984 -10.644 12.967  1.00 162.13 ? 409 GLN D C   1 
ATOM   5983 O O   . GLN D 2 9   ? 14.588 -9.503  12.721  1.00 160.82 ? 409 GLN D O   1 
ATOM   5984 C CB  . GLN D 2 9   ? 16.124 -9.995  15.089  1.00 160.89 ? 409 GLN D CB  1 
ATOM   5985 C CG  . GLN D 2 9   ? 17.336 -10.076 15.995  1.00 158.36 ? 409 GLN D CG  1 
ATOM   5986 C CD  . GLN D 2 9   ? 17.643 -8.754  16.665  1.00 158.78 ? 409 GLN D CD  1 
ATOM   5987 O OE1 . GLN D 2 9   ? 16.843 -8.237  17.446  1.00 159.99 ? 409 GLN D OE1 1 
ATOM   5988 N NE2 . GLN D 2 9   ? 18.808 -8.193  16.357  1.00 157.97 ? 409 GLN D NE2 1 
ATOM   5989 N N   . PHE D 2 10  ? 14.373 -11.737 12.515  1.00 162.39 ? 410 PHE D N   1 
ATOM   5990 C CA  . PHE D 2 10  ? 13.184 -11.666 11.663  1.00 161.93 ? 410 PHE D CA  1 
ATOM   5991 C C   . PHE D 2 10  ? 11.898 -12.025 12.406  1.00 161.52 ? 410 PHE D C   1 
ATOM   5992 O O   . PHE D 2 10  ? 11.231 -12.991 11.976  1.00 161.15 ? 410 PHE D O   1 
ATOM   5993 C CB  . PHE D 2 10  ? 13.343 -12.601 10.454  1.00 160.96 ? 410 PHE D CB  1 
ATOM   5994 C CG  . PHE D 2 10  ? 14.414 -12.176 9.482   1.00 157.94 ? 410 PHE D CG  1 
ATOM   5995 C CD1 . PHE D 2 10  ? 15.705 -11.893 9.919   1.00 155.90 ? 410 PHE D CD1 1 
ATOM   5996 C CD2 . PHE D 2 10  ? 14.134 -12.088 8.122   1.00 155.81 ? 410 PHE D CD2 1 
ATOM   5997 C CE1 . PHE D 2 10  ? 16.700 -11.529 9.018   1.00 155.06 ? 410 PHE D CE1 1 
ATOM   5998 C CE2 . PHE D 2 10  ? 15.122 -11.728 7.214   1.00 155.07 ? 410 PHE D CE2 1 
ATOM   5999 C CZ  . PHE D 2 10  ? 16.407 -11.447 7.662   1.00 155.17 ? 410 PHE D CZ  1 
ATOM   6000 O OXT . PHE D 2 10  ? 11.569 -11.339 13.398  1.00 160.49 ? 410 PHE D OXT 1 
ATOM   6001 N N   . VAL E 2 7   ? 16.746 45.733  17.426  1.00 160.74 ? 407 VAL E N   1 
ATOM   6002 C CA  . VAL E 2 7   ? 17.710 46.185  18.471  1.00 160.18 ? 407 VAL E CA  1 
ATOM   6003 C C   . VAL E 2 7   ? 18.778 47.081  17.833  1.00 160.36 ? 407 VAL E C   1 
ATOM   6004 O O   . VAL E 2 7   ? 19.071 46.957  16.641  1.00 160.81 ? 407 VAL E O   1 
ATOM   6005 C CB  . VAL E 2 7   ? 18.372 44.957  19.175  1.00 159.40 ? 407 VAL E CB  1 
ATOM   6006 C CG1 . VAL E 2 7   ? 19.154 44.124  18.167  1.00 158.02 ? 407 VAL E CG1 1 
ATOM   6007 C CG2 . VAL E 2 7   ? 19.266 45.419  20.308  1.00 155.50 ? 407 VAL E CG2 1 
ATOM   6008 N N   . TYR E 2 8   ? 19.345 47.989  18.626  1.00 159.64 ? 408 TYR E N   1 
ATOM   6009 C CA  . TYR E 2 8   ? 20.369 48.916  18.141  1.00 157.06 ? 408 TYR E CA  1 
ATOM   6010 C C   . TYR E 2 8   ? 21.102 49.597  19.296  1.00 155.11 ? 408 TYR E C   1 
ATOM   6011 O O   . TYR E 2 8   ? 20.472 50.123  20.217  1.00 154.63 ? 408 TYR E O   1 
ATOM   6012 C CB  . TYR E 2 8   ? 19.719 49.964  17.230  1.00 159.07 ? 408 TYR E CB  1 
ATOM   6013 C CG  . TYR E 2 8   ? 18.426 50.550  17.778  1.00 161.85 ? 408 TYR E CG  1 
ATOM   6014 C CD1 . TYR E 2 8   ? 18.438 51.656  18.635  1.00 161.11 ? 408 TYR E CD1 1 
ATOM   6015 C CD2 . TYR E 2 8   ? 17.187 49.988  17.446  1.00 162.61 ? 408 TYR E CD2 1 
ATOM   6016 C CE1 . TYR E 2 8   ? 17.247 52.189  19.143  1.00 160.28 ? 408 TYR E CE1 1 
ATOM   6017 C CE2 . TYR E 2 8   ? 15.993 50.513  17.950  1.00 161.13 ? 408 TYR E CE2 1 
ATOM   6018 C CZ  . TYR E 2 8   ? 16.031 51.612  18.794  1.00 160.48 ? 408 TYR E CZ  1 
ATOM   6019 O OH  . TYR E 2 8   ? 14.856 52.135  19.278  1.00 159.15 ? 408 TYR E OH  1 
ATOM   6020 N N   . GLN E 2 9   ? 22.432 49.585  19.248  1.00 152.90 ? 409 GLN E N   1 
ATOM   6021 C CA  . GLN E 2 9   ? 23.232 50.197  20.305  1.00 151.80 ? 409 GLN E CA  1 
ATOM   6022 C C   . GLN E 2 9   ? 24.291 51.173  19.785  1.00 152.72 ? 409 GLN E C   1 
ATOM   6023 O O   . GLN E 2 9   ? 25.398 51.243  20.322  1.00 151.99 ? 409 GLN E O   1 
ATOM   6024 C CB  . GLN E 2 9   ? 23.900 49.106  21.153  1.00 148.89 ? 409 GLN E CB  1 
ATOM   6025 C CG  . GLN E 2 9   ? 24.799 48.163  20.368  1.00 145.66 ? 409 GLN E CG  1 
ATOM   6026 C CD  . GLN E 2 9   ? 25.374 47.054  21.230  1.00 143.42 ? 409 GLN E CD  1 
ATOM   6027 O OE1 . GLN E 2 9   ? 24.633 46.258  21.808  1.00 141.83 ? 409 GLN E OE1 1 
ATOM   6028 N NE2 . GLN E 2 9   ? 26.700 46.996  21.321  1.00 139.99 ? 409 GLN E NE2 1 
ATOM   6029 N N   . PHE E 2 10  ? 23.940 51.933  18.750  1.00 153.95 ? 410 PHE E N   1 
ATOM   6030 C CA  . PHE E 2 10  ? 24.857 52.904  18.159  1.00 153.57 ? 410 PHE E CA  1 
ATOM   6031 C C   . PHE E 2 10  ? 24.826 54.234  18.913  1.00 153.44 ? 410 PHE E C   1 
ATOM   6032 O O   . PHE E 2 10  ? 25.914 54.778  19.207  1.00 151.34 ? 410 PHE E O   1 
ATOM   6033 C CB  . PHE E 2 10  ? 24.517 53.114  16.674  1.00 155.89 ? 410 PHE E CB  1 
ATOM   6034 C CG  . PHE E 2 10  ? 23.551 54.243  16.402  1.00 160.14 ? 410 PHE E CG  1 
ATOM   6035 C CD1 . PHE E 2 10  ? 24.009 55.554  16.298  1.00 162.22 ? 410 PHE E CD1 1 
ATOM   6036 C CD2 . PHE E 2 10  ? 22.190 53.995  16.236  1.00 160.63 ? 410 PHE E CD2 1 
ATOM   6037 C CE1 . PHE E 2 10  ? 23.128 56.601  16.031  1.00 163.36 ? 410 PHE E CE1 1 
ATOM   6038 C CE2 . PHE E 2 10  ? 21.301 55.037  15.969  1.00 161.72 ? 410 PHE E CE2 1 
ATOM   6039 C CZ  . PHE E 2 10  ? 21.772 56.341  15.867  1.00 162.94 ? 410 PHE E CZ  1 
ATOM   6040 O OXT . PHE E 2 10  ? 23.711 54.723  19.194  1.00 153.94 ? 410 PHE E OXT 1 
HETATM 6041 O O   . HOH F 3 .   ? 14.267 29.160  24.265  1.00 40.66  ? 356 HOH A O   1 
HETATM 6042 O O   . HOH F 3 .   ? 33.266 12.913  10.533  1.00 61.55  ? 357 HOH A O   1 
HETATM 6043 O O   . HOH F 3 .   ? 13.987 28.141  -4.687  1.00 50.52  ? 358 HOH A O   1 
HETATM 6044 O O   . HOH F 3 .   ? 26.012 16.779  -7.656  1.00 44.23  ? 359 HOH A O   1 
HETATM 6045 O O   . HOH F 3 .   ? 1.669  24.520  12.506  1.00 54.03  ? 360 HOH A O   1 
HETATM 6046 O O   . HOH F 3 .   ? 24.030 16.395  17.312  1.00 66.39  ? 361 HOH A O   1 
HETATM 6047 O O   . HOH F 3 .   ? 1.620  31.393  6.558   1.00 49.93  ? 362 HOH A O   1 
HETATM 6048 O O   . HOH F 3 .   ? 25.656 27.297  -9.256  1.00 58.35  ? 363 HOH A O   1 
HETATM 6049 O O   . HOH F 3 .   ? 21.229 18.222  15.196  1.00 57.24  ? 364 HOH A O   1 
HETATM 6050 O O   . HOH F 3 .   ? 28.880 4.642   -7.741  1.00 70.05  ? 365 HOH A O   1 
HETATM 6051 O O   . HOH F 3 .   ? 12.977 27.192  5.349   1.00 37.49  ? 366 HOH A O   1 
HETATM 6052 O O   . HOH F 3 .   ? 25.227 20.650  -11.744 1.00 56.19  ? 367 HOH A O   1 
HETATM 6053 O O   . HOH F 3 .   ? 9.999  21.903  35.753  1.00 46.84  ? 368 HOH A O   1 
HETATM 6054 O O   . HOH F 3 .   ? 31.581 15.538  9.066   1.00 62.16  ? 369 HOH A O   1 
HETATM 6055 O O   . HOH F 3 .   ? -1.413 13.943  9.750   1.00 51.94  ? 370 HOH A O   1 
HETATM 6056 O O   . HOH F 3 .   ? 24.499 24.023  -8.290  1.00 52.28  ? 371 HOH A O   1 
HETATM 6057 O O   . HOH F 3 .   ? 11.841 29.554  3.302   1.00 50.73  ? 372 HOH A O   1 
HETATM 6058 O O   . HOH F 3 .   ? 33.708 22.021  0.699   1.00 47.71  ? 373 HOH A O   1 
HETATM 6059 O O   . HOH F 3 .   ? 6.586  24.153  -3.564  1.00 66.01  ? 374 HOH A O   1 
HETATM 6060 O O   . HOH F 3 .   ? 21.403 29.734  2.487   1.00 47.44  ? 375 HOH A O   1 
HETATM 6061 O O   . HOH F 3 .   ? 23.820 10.628  -9.930  1.00 57.48  ? 376 HOH A O   1 
HETATM 6062 O O   . HOH F 3 .   ? 30.742 14.441  6.359   1.00 56.89  ? 377 HOH A O   1 
HETATM 6063 O O   . HOH F 3 .   ? 8.926  17.944  -2.704  1.00 49.91  ? 378 HOH A O   1 
HETATM 6064 O O   . HOH F 3 .   ? 20.770 31.128  0.571   1.00 60.55  ? 379 HOH A O   1 
HETATM 6065 O O   . HOH F 3 .   ? 5.192  33.256  11.844  1.00 58.29  ? 380 HOH A O   1 
HETATM 6066 O O   . HOH F 3 .   ? -0.421 26.682  2.512   1.00 55.26  ? 381 HOH A O   1 
HETATM 6067 O O   . HOH F 3 .   ? 17.850 29.792  1.868   1.00 53.79  ? 382 HOH A O   1 
HETATM 6068 O O   . HOH F 3 .   ? 16.017 13.566  -5.583  1.00 44.23  ? 383 HOH A O   1 
HETATM 6069 O O   . HOH F 3 .   ? 16.530 6.708   -7.191  1.00 64.35  ? 384 HOH A O   1 
HETATM 6070 O O   . HOH F 3 .   ? 17.929 24.503  14.554  1.00 57.13  ? 385 HOH A O   1 
HETATM 6071 O O   . HOH F 3 .   ? 33.272 10.297  4.615   1.00 51.54  ? 386 HOH A O   1 
HETATM 6072 O O   . HOH F 3 .   ? 29.427 32.089  -10.501 1.00 57.92  ? 387 HOH A O   1 
HETATM 6073 O O   . HOH F 3 .   ? 22.014 22.717  21.790  1.00 66.85  ? 388 HOH A O   1 
HETATM 6074 O O   . HOH F 3 .   ? 13.796 30.345  26.733  1.00 66.08  ? 389 HOH A O   1 
HETATM 6075 O O   . HOH F 3 .   ? 10.581 23.812  31.514  1.00 59.61  ? 390 HOH A O   1 
HETATM 6076 O O   . HOH F 3 .   ? 34.808 17.272  0.291   1.00 55.94  ? 391 HOH A O   1 
HETATM 6077 O O   . HOH F 3 .   ? 14.122 29.932  -7.458  1.00 74.00  ? 392 HOH A O   1 
HETATM 6078 O O   . HOH F 3 .   ? 3.013  16.895  18.856  1.00 63.98  ? 393 HOH A O   1 
HETATM 6079 O O   . HOH F 3 .   ? 13.124 32.065  1.088   1.00 54.24  ? 394 HOH A O   1 
HETATM 6080 O O   . HOH F 3 .   ? 8.054  29.011  39.116  1.00 53.82  ? 395 HOH A O   1 
HETATM 6081 O O   . HOH F 3 .   ? 7.418  3.208   13.527  1.00 56.76  ? 396 HOH A O   1 
HETATM 6082 O O   . HOH F 3 .   ? 10.573 32.157  29.076  1.00 65.55  ? 397 HOH A O   1 
HETATM 6083 O O   . HOH F 3 .   ? 6.402  29.870  0.478   1.00 60.79  ? 398 HOH A O   1 
HETATM 6084 O O   . HOH F 3 .   ? 17.730 6.972   -2.576  1.00 64.37  ? 399 HOH A O   1 
HETATM 6085 O O   . HOH F 3 .   ? 3.546  19.756  -2.769  1.00 54.76  ? 400 HOH A O   1 
HETATM 6086 O O   . HOH F 3 .   ? 19.789 33.154  1.846   1.00 60.94  ? 401 HOH A O   1 
HETATM 6087 O O   . HOH F 3 .   ? -0.073 4.869   15.315  1.00 77.16  ? 402 HOH A O   1 
HETATM 6088 O O   . HOH F 3 .   ? 18.751 30.439  9.553   1.00 54.78  ? 403 HOH A O   1 
HETATM 6089 O O   . HOH F 3 .   ? 16.389 19.090  -11.343 1.00 59.18  ? 404 HOH A O   1 
HETATM 6090 O O   . HOH F 3 .   ? 21.969 18.845  7.022   1.00 47.26  ? 405 HOH A O   1 
HETATM 6091 O O   . HOH F 3 .   ? 16.755 20.599  32.322  1.00 45.23  ? 406 HOH A O   1 
HETATM 6092 O O   . HOH F 3 .   ? 22.872 4.329   -12.467 1.00 68.59  ? 407 HOH A O   1 
HETATM 6093 O O   . HOH F 3 .   ? 1.228  8.896   2.319   1.00 71.78  ? 408 HOH A O   1 
HETATM 6094 O O   . HOH F 3 .   ? 16.952 11.790  -13.992 1.00 68.95  ? 409 HOH A O   1 
HETATM 6095 O O   . HOH F 3 .   ? 30.202 2.048   -0.862  1.00 71.30  ? 410 HOH A O   1 
HETATM 6096 O O   . HOH F 3 .   ? 5.921  28.356  28.123  1.00 62.88  ? 411 HOH A O   1 
HETATM 6097 O O   . HOH F 3 .   ? 16.295 30.948  -3.061  1.00 60.85  ? 412 HOH A O   1 
HETATM 6098 O O   . HOH F 3 .   ? 11.191 19.574  29.799  1.00 59.37  ? 413 HOH A O   1 
HETATM 6099 O O   . HOH F 3 .   ? 1.962  27.656  14.282  1.00 58.85  ? 414 HOH A O   1 
HETATM 6100 O O   . HOH F 3 .   ? 25.760 22.286  6.676   1.00 54.19  ? 415 HOH A O   1 
HETATM 6101 O O   . HOH F 3 .   ? 14.093 32.098  39.654  1.00 61.79  ? 416 HOH A O   1 
HETATM 6102 O O   . HOH F 3 .   ? 37.219 15.644  2.258   1.00 52.35  ? 417 HOH A O   1 
HETATM 6103 O O   . HOH F 3 .   ? 10.096 4.110   17.207  1.00 71.52  ? 418 HOH A O   1 
HETATM 6104 O O   . HOH F 3 .   ? 4.347  18.505  20.243  1.00 53.29  ? 419 HOH A O   1 
HETATM 6105 O O   . HOH F 3 .   ? 32.124 20.192  -9.676  1.00 70.26  ? 420 HOH A O   1 
HETATM 6106 O O   . HOH F 3 .   ? 4.783  20.903  19.159  1.00 67.30  ? 421 HOH A O   1 
HETATM 6107 O O   . HOH F 3 .   ? 10.432 12.881  -9.238  1.00 67.67  ? 422 HOH A O   1 
HETATM 6108 O O   . HOH F 3 .   ? 22.226 12.027  -16.305 1.00 66.92  ? 423 HOH A O   1 
HETATM 6109 O O   . HOH F 3 .   ? 0.573  24.087  5.288   1.00 66.90  ? 424 HOH A O   1 
HETATM 6110 O O   . HOH F 3 .   ? 21.804 32.434  -2.367  1.00 59.31  ? 425 HOH A O   1 
HETATM 6111 O O   . HOH F 3 .   ? 0.259  22.253  13.075  1.00 69.45  ? 426 HOH A O   1 
HETATM 6112 O O   . HOH F 3 .   ? 11.875 12.339  -12.690 1.00 65.24  ? 427 HOH A O   1 
HETATM 6113 O O   . HOH F 3 .   ? 5.738  16.297  20.961  1.00 61.47  ? 428 HOH A O   1 
HETATM 6114 O O   . HOH F 3 .   ? 17.822 12.910  22.245  1.00 61.16  ? 429 HOH A O   1 
HETATM 6115 O O   . HOH F 3 .   ? 26.826 10.715  -11.254 1.00 71.56  ? 430 HOH A O   1 
HETATM 6116 O O   . HOH F 3 .   ? 28.934 -0.584  1.369   1.00 71.07  ? 431 HOH A O   1 
HETATM 6117 O O   . HOH F 3 .   ? -1.995 11.517  10.369  1.00 70.73  ? 432 HOH A O   1 
HETATM 6118 O O   . HOH F 3 .   ? 8.467  31.552  1.022   1.00 58.54  ? 433 HOH A O   1 
HETATM 6119 O O   . HOH F 3 .   ? 8.007  14.666  27.885  1.00 66.79  ? 434 HOH A O   1 
HETATM 6120 O O   . HOH F 3 .   ? 16.428 5.517   -12.026 1.00 75.61  ? 435 HOH A O   1 
HETATM 6121 O O   . HOH F 3 .   ? 4.137  33.558  2.564   1.00 68.82  ? 436 HOH A O   1 
HETATM 6122 O O   . HOH F 3 .   ? 17.935 20.232  -13.539 1.00 56.06  ? 437 HOH A O   1 
HETATM 6123 O O   . HOH F 3 .   ? 18.344 30.356  -0.946  1.00 55.76  ? 438 HOH A O   1 
HETATM 6124 O O   . HOH F 3 .   ? 17.170 3.957   -1.418  1.00 67.76  ? 439 HOH A O   1 
HETATM 6125 O O   . HOH F 3 .   ? 11.135 30.677  1.013   1.00 52.78  ? 440 HOH A O   1 
HETATM 6126 O O   . HOH F 3 .   ? 8.416  -26.173 3.603   1.00 72.29  ? 441 HOH A O   1 
HETATM 6127 O O   . HOH F 3 .   ? 3.860  22.133  -4.011  1.00 60.90  ? 442 HOH A O   1 
HETATM 6128 O O   . HOH F 3 .   ? 22.210 10.604  -12.761 1.00 74.08  ? 443 HOH A O   1 
HETATM 6129 O O   . HOH F 3 .   ? 4.751  14.073  0.038   1.00 60.35  ? 444 HOH A O   1 
HETATM 6130 O O   . HOH F 3 .   ? 27.959 21.991  9.647   1.00 58.17  ? 445 HOH A O   1 
HETATM 6131 O O   . HOH F 3 .   ? 27.237 29.878  18.877  1.00 66.13  ? 446 HOH A O   1 
HETATM 6132 O O   . HOH F 3 .   ? 13.095 -29.233 10.634  1.00 76.27  ? 447 HOH A O   1 
HETATM 6133 O O   . HOH F 3 .   ? 34.577 18.384  2.834   1.00 60.26  ? 448 HOH A O   1 
HETATM 6134 O O   . HOH F 3 .   ? 18.812 25.183  7.417   1.00 77.54  ? 449 HOH A O   1 
HETATM 6135 O O   . HOH F 3 .   ? 12.587 17.456  -9.311  1.00 59.44  ? 450 HOH A O   1 
HETATM 6136 O O   . HOH F 3 .   ? -0.634 20.348  11.875  1.00 69.79  ? 451 HOH A O   1 
HETATM 6137 O O   . HOH F 3 .   ? 4.273  13.963  21.061  1.00 72.29  ? 452 HOH A O   1 
HETATM 6138 O O   . HOH F 3 .   ? 22.737 3.910   0.444   1.00 70.87  ? 453 HOH A O   1 
HETATM 6139 O O   . HOH F 3 .   ? 22.030 28.686  20.319  1.00 65.74  ? 454 HOH A O   1 
HETATM 6140 O O   . HOH F 3 .   ? 22.468 -25.610 15.602  1.00 81.03  ? 455 HOH A O   1 
HETATM 6141 O O   . HOH F 3 .   ? 8.106  14.249  20.211  1.00 68.39  ? 456 HOH A O   1 
HETATM 6142 O O   . HOH F 3 .   ? 8.993  15.355  -8.227  1.00 74.21  ? 457 HOH A O   1 
HETATM 6143 O O   . HOH G 3 .   ? 34.340 30.301  -7.345  1.00 32.65  ? 356 HOH B O   1 
HETATM 6144 O O   . HOH G 3 .   ? 44.110 32.023  5.027   1.00 50.41  ? 357 HOH B O   1 
HETATM 6145 O O   . HOH G 3 .   ? 40.764 28.171  -10.762 1.00 52.12  ? 358 HOH B O   1 
HETATM 6146 O O   . HOH G 3 .   ? 39.988 58.928  6.494   1.00 72.03  ? 359 HOH B O   1 
HETATM 6147 O O   . HOH G 3 .   ? 36.209 28.837  -12.595 1.00 56.99  ? 360 HOH B O   1 
HETATM 6148 O O   . HOH G 3 .   ? 23.893 29.557  4.268   1.00 53.27  ? 361 HOH B O   1 
HETATM 6149 O O   . HOH G 3 .   ? 36.034 26.231  7.688   1.00 52.11  ? 362 HOH B O   1 
HETATM 6150 O O   . HOH G 3 .   ? 27.508 32.818  -8.384  1.00 50.40  ? 363 HOH B O   1 
HETATM 6151 O O   . HOH G 3 .   ? 32.823 34.739  -6.102  1.00 44.18  ? 364 HOH B O   1 
HETATM 6152 O O   . HOH G 3 .   ? 49.258 37.582  -6.936  1.00 55.72  ? 365 HOH B O   1 
HETATM 6153 O O   . HOH G 3 .   ? 23.569 33.282  4.872   1.00 57.07  ? 366 HOH B O   1 
HETATM 6154 O O   . HOH G 3 .   ? 44.377 25.402  6.344   1.00 43.39  ? 367 HOH B O   1 
HETATM 6155 O O   . HOH G 3 .   ? 28.358 38.964  -9.193  1.00 52.60  ? 368 HOH B O   1 
HETATM 6156 O O   . HOH G 3 .   ? 36.990 40.481  -5.269  1.00 48.20  ? 369 HOH B O   1 
HETATM 6157 O O   . HOH G 3 .   ? 23.995 34.189  -1.923  1.00 45.93  ? 370 HOH B O   1 
HETATM 6158 O O   . HOH G 3 .   ? 58.415 48.093  -5.729  1.00 67.45  ? 371 HOH B O   1 
HETATM 6159 O O   . HOH G 3 .   ? 42.632 26.123  -12.862 1.00 64.50  ? 372 HOH B O   1 
HETATM 6160 O O   . HOH G 3 .   ? 30.748 26.553  7.277   1.00 58.45  ? 373 HOH B O   1 
HETATM 6161 O O   . HOH G 3 .   ? 44.963 27.289  3.691   1.00 56.35  ? 374 HOH B O   1 
HETATM 6162 O O   . HOH G 3 .   ? 39.232 56.258  9.811   1.00 64.54  ? 375 HOH B O   1 
HETATM 6163 O O   . HOH G 3 .   ? 24.468 35.827  11.708  1.00 56.77  ? 376 HOH B O   1 
HETATM 6164 O O   . HOH G 3 .   ? 53.470 36.210  -1.278  1.00 63.78  ? 377 HOH B O   1 
HETATM 6165 O O   . HOH G 3 .   ? 28.177 44.818  -7.078  1.00 68.89  ? 378 HOH B O   1 
HETATM 6166 O O   . HOH G 3 .   ? 31.771 41.973  0.066   1.00 58.08  ? 379 HOH B O   1 
HETATM 6167 O O   . HOH G 3 .   ? 57.199 38.002  24.225  1.00 71.14  ? 380 HOH B O   1 
HETATM 6168 O O   . HOH G 3 .   ? 46.846 50.724  14.813  1.00 69.61  ? 381 HOH B O   1 
HETATM 6169 O O   . HOH G 3 .   ? 35.775 21.530  2.353   1.00 67.74  ? 382 HOH B O   1 
HETATM 6170 O O   . HOH G 3 .   ? 34.513 23.453  -10.352 1.00 70.67  ? 383 HOH B O   1 
HETATM 6171 O O   . HOH G 3 .   ? 47.009 37.615  -11.113 1.00 54.11  ? 384 HOH B O   1 
HETATM 6172 O O   . HOH G 3 .   ? 24.043 38.357  3.920   1.00 73.14  ? 385 HOH B O   1 
HETATM 6173 O O   . HOH G 3 .   ? 38.165 25.206  9.022   1.00 76.05  ? 386 HOH B O   1 
HETATM 6174 O O   . HOH G 3 .   ? 55.628 36.050  -4.064  1.00 60.83  ? 387 HOH B O   1 
HETATM 6175 O O   . HOH G 3 .   ? 44.988 38.090  -12.695 1.00 64.19  ? 388 HOH B O   1 
HETATM 6176 O O   . HOH G 3 .   ? 24.229 35.845  -0.094  1.00 70.54  ? 389 HOH B O   1 
HETATM 6177 O O   . HOH G 3 .   ? 22.024 48.267  6.766   1.00 71.07  ? 390 HOH B O   1 
HETATM 6178 O O   . HOH G 3 .   ? 50.986 27.673  -3.927  1.00 69.28  ? 391 HOH B O   1 
HETATM 6179 O O   . HOH G 3 .   ? 35.784 24.529  12.046  1.00 74.17  ? 392 HOH B O   1 
HETATM 6180 O O   . HOH G 3 .   ? 30.100 35.572  -6.687  1.00 58.16  ? 393 HOH B O   1 
HETATM 6181 O O   . HOH G 3 .   ? 24.267 39.505  -6.935  1.00 74.10  ? 394 HOH B O   1 
HETATM 6182 O O   . HOH G 3 .   ? 37.887 21.480  26.887  1.00 75.42  ? 395 HOH B O   1 
HETATM 6183 O O   . HOH G 3 .   ? 37.047 53.667  2.410   1.00 61.36  ? 396 HOH B O   1 
HETATM 6184 O O   . HOH G 3 .   ? 48.243 56.594  8.412   1.00 62.67  ? 397 HOH B O   1 
HETATM 6185 O O   . HOH G 3 .   ? 49.536 35.594  -11.949 1.00 77.21  ? 398 HOH B O   1 
HETATM 6186 O O   . HOH G 3 .   ? 29.865 49.655  -9.699  1.00 73.36  ? 399 HOH B O   1 
HETATM 6187 O O   . HOH G 3 .   ? 53.553 32.624  9.140   1.00 69.05  ? 400 HOH B O   1 
HETATM 6188 O O   . HOH G 3 .   ? 51.771 27.762  -6.516  1.00 74.67  ? 401 HOH B O   1 
HETATM 6189 O O   . HOH G 3 .   ? 29.740 37.035  -10.361 1.00 70.82  ? 402 HOH B O   1 
HETATM 6190 O O   . HOH G 3 .   ? 26.028 59.386  29.638  1.00 77.37  ? 403 HOH B O   1 
HETATM 6191 O O   . HOH G 3 .   ? 22.925 34.889  8.112   1.00 67.63  ? 404 HOH B O   1 
HETATM 6192 O O   . HOH G 3 .   ? 26.127 74.816  13.891  1.00 74.19  ? 405 HOH B O   1 
HETATM 6193 O O   . HOH G 3 .   ? 52.624 37.194  -9.271  1.00 72.49  ? 406 HOH B O   1 
HETATM 6194 O O   . HOH G 3 .   ? 47.403 40.370  -9.679  1.00 72.23  ? 407 HOH B O   1 
HETATM 6195 O O   . HOH G 3 .   ? 38.414 37.670  -13.656 1.00 77.73  ? 408 HOH B O   1 
HETATM 6196 O O   . HOH G 3 .   ? 28.725 38.266  4.293   1.00 70.04  ? 409 HOH B O   1 
HETATM 6197 O O   . HOH G 3 .   ? 39.105 55.938  3.567   1.00 59.25  ? 410 HOH B O   1 
HETATM 6198 O O   . HOH G 3 .   ? 37.557 45.822  -9.785  1.00 65.85  ? 411 HOH B O   1 
HETATM 6199 O O   . HOH H 3 .   ? 38.218 20.268  0.012   1.00 45.34  ? 356 HOH C O   1 
HETATM 6200 O O   . HOH H 3 .   ? 38.652 9.276   5.167   1.00 45.82  ? 357 HOH C O   1 
HETATM 6201 O O   . HOH H 3 .   ? 33.496 2.920   -4.125  1.00 51.83  ? 358 HOH C O   1 
HETATM 6202 O O   . HOH H 3 .   ? 39.571 0.842   13.077  1.00 57.21  ? 359 HOH C O   1 
HETATM 6203 O O   . HOH H 3 .   ? 43.426 15.868  4.440   1.00 48.00  ? 360 HOH C O   1 
HETATM 6204 O O   . HOH H 3 .   ? 32.985 3.755   -1.558  1.00 60.19  ? 361 HOH C O   1 
HETATM 6205 O O   . HOH H 3 .   ? 46.820 3.325   -16.662 1.00 61.63  ? 362 HOH C O   1 
HETATM 6206 O O   . HOH H 3 .   ? 30.532 16.443  -13.505 1.00 55.72  ? 363 HOH C O   1 
HETATM 6207 O O   . HOH H 3 .   ? 40.953 0.031   -11.514 1.00 51.75  ? 364 HOH C O   1 
HETATM 6208 O O   . HOH H 3 .   ? 49.536 9.450   -12.600 1.00 58.61  ? 365 HOH C O   1 
HETATM 6209 O O   . HOH H 3 .   ? 39.258 21.740  2.906   1.00 46.41  ? 366 HOH C O   1 
HETATM 6210 O O   . HOH H 3 .   ? 45.266 -16.386 -8.599  1.00 69.07  ? 367 HOH C O   1 
HETATM 6211 O O   . HOH H 3 .   ? 41.665 16.362  -10.678 1.00 56.81  ? 368 HOH C O   1 
HETATM 6212 O O   . HOH H 3 .   ? 37.864 -4.736  -6.961  1.00 67.51  ? 369 HOH C O   1 
HETATM 6213 O O   . HOH H 3 .   ? 39.892 -3.463  -4.675  1.00 60.24  ? 370 HOH C O   1 
HETATM 6214 O O   . HOH H 3 .   ? 34.659 20.444  -5.771  1.00 76.59  ? 371 HOH C O   1 
HETATM 6215 O O   . HOH H 3 .   ? 63.332 -1.267  -11.959 1.00 74.37  ? 372 HOH C O   1 
HETATM 6216 O O   . HOH H 3 .   ? 54.787 12.446  -8.928  1.00 61.40  ? 373 HOH C O   1 
HETATM 6217 O O   . HOH H 3 .   ? 66.053 -7.743  1.869   1.00 71.33  ? 374 HOH C O   1 
HETATM 6218 O O   . HOH H 3 .   ? 37.401 15.507  -14.653 1.00 57.93  ? 375 HOH C O   1 
HETATM 6219 O O   . HOH H 3 .   ? 41.335 -2.483  5.620   1.00 71.49  ? 376 HOH C O   1 
HETATM 6220 O O   . HOH H 3 .   ? 38.877 8.405   2.171   1.00 49.88  ? 377 HOH C O   1 
HETATM 6221 O O   . HOH H 3 .   ? 40.543 0.323   0.901   1.00 63.33  ? 378 HOH C O   1 
HETATM 6222 O O   . HOH H 3 .   ? 31.601 11.701  -13.121 1.00 55.34  ? 379 HOH C O   1 
HETATM 6223 O O   . HOH H 3 .   ? 44.446 17.400  9.172   1.00 64.07  ? 380 HOH C O   1 
HETATM 6224 O O   . HOH H 3 .   ? 46.137 20.877  3.228   1.00 53.76  ? 381 HOH C O   1 
HETATM 6225 O O   . HOH H 3 .   ? 44.214 27.725  16.323  1.00 62.20  ? 382 HOH C O   1 
HETATM 6226 O O   . HOH H 3 .   ? 43.418 6.317   0.942   1.00 74.90  ? 383 HOH C O   1 
HETATM 6227 O O   . HOH H 3 .   ? 52.892 -15.276 2.019   1.00 62.19  ? 384 HOH C O   1 
HETATM 6228 O O   . HOH H 3 .   ? 51.180 23.754  -9.029  1.00 69.64  ? 385 HOH C O   1 
HETATM 6229 O O   . HOH H 3 .   ? 82.804 13.331  6.191   1.00 69.81  ? 386 HOH C O   1 
HETATM 6230 O O   . HOH H 3 .   ? 35.009 -3.944  5.330   1.00 75.93  ? 387 HOH C O   1 
HETATM 6231 O O   . HOH H 3 .   ? 34.526 15.893  -13.682 1.00 77.07  ? 388 HOH C O   1 
HETATM 6232 O O   . HOH H 3 .   ? 42.831 14.562  6.750   1.00 74.78  ? 389 HOH C O   1 
HETATM 6233 O O   . HOH H 3 .   ? 52.391 0.004   -12.167 1.00 64.18  ? 390 HOH C O   1 
HETATM 6234 O O   . HOH H 3 .   ? 62.200 -1.177  11.075  1.00 66.57  ? 391 HOH C O   1 
HETATM 6235 O O   . HOH H 3 .   ? 37.836 18.497  2.125   1.00 62.54  ? 392 HOH C O   1 
HETATM 6236 O O   . HOH H 3 .   ? 57.615 -11.322 7.114   1.00 74.16  ? 393 HOH C O   1 
HETATM 6237 O O   . HOH H 3 .   ? 32.093 2.200   -6.592  1.00 68.04  ? 394 HOH C O   1 
HETATM 6238 O O   . HOH H 3 .   ? 45.704 20.989  -14.094 1.00 70.09  ? 395 HOH C O   1 
HETATM 6239 O O   . HOH H 3 .   ? 39.823 1.529   -15.062 1.00 60.03  ? 396 HOH C O   1 
HETATM 6240 O O   . HOH H 3 .   ? 46.491 15.665  -11.976 1.00 62.26  ? 397 HOH C O   1 
HETATM 6241 O O   . HOH H 3 .   ? 54.903 -13.344 2.927   1.00 70.33  ? 398 HOH C O   1 
HETATM 6242 O O   . HOH H 3 .   ? 56.965 0.649   10.520  1.00 79.51  ? 399 HOH C O   1 
HETATM 6243 O O   . HOH H 3 .   ? 26.047 12.819  -13.233 1.00 64.79  ? 400 HOH C O   1 
HETATM 6244 O O   . HOH H 3 .   ? 62.451 -2.112  5.935   1.00 64.37  ? 401 HOH C O   1 
HETATM 6245 O O   . HOH H 3 .   ? 35.100 0.170   -6.581  1.00 74.06  ? 402 HOH C O   1 
HETATM 6246 O O   . HOH H 3 .   ? 62.770 -4.636  2.337   1.00 77.17  ? 403 HOH C O   1 
HETATM 6247 O O   . HOH H 3 .   ? 72.520 -6.299  -3.442  1.00 74.89  ? 404 HOH C O   1 
HETATM 6248 O O   . HOH H 3 .   ? 61.600 -2.014  -13.729 1.00 73.39  ? 405 HOH C O   1 
HETATM 6249 O O   . HOH H 3 .   ? 54.979 6.605   -12.458 1.00 76.33  ? 406 HOH C O   1 
HETATM 6250 O O   . HOH H 3 .   ? 43.941 9.518   -18.460 1.00 68.05  ? 407 HOH C O   1 
HETATM 6251 O O   . HOH H 3 .   ? 55.548 -11.512 -11.731 1.00 63.91  ? 408 HOH C O   1 
HETATM 6252 O O   . HOH H 3 .   ? 41.600 -2.442  -14.517 1.00 70.59  ? 409 HOH C O   1 
HETATM 6253 O O   . HOH H 3 .   ? 56.346 22.702  -0.487  1.00 76.10  ? 410 HOH C O   1 
HETATM 6254 O O   . HOH H 3 .   ? 50.428 17.510  -16.840 1.00 62.13  ? 411 HOH C O   1 
HETATM 6255 O O   . HOH H 3 .   ? 53.619 24.034  -2.678  1.00 63.10  ? 412 HOH C O   1 
HETATM 6256 O O   . HOH H 3 .   ? 50.745 -15.180 4.390   1.00 74.86  ? 413 HOH C O   1 
HETATM 6257 O O   . HOH H 3 .   ? 52.011 -12.233 4.942   1.00 60.92  ? 414 HOH C O   1 
HETATM 6258 O O   . HOH H 3 .   ? 47.459 18.325  -13.973 1.00 77.15  ? 415 HOH C O   1 
HETATM 6259 O O   . HOH H 3 .   ? 55.333 13.751  -13.791 1.00 80.58  ? 416 HOH C O   1 
HETATM 6260 O O   . HOH H 3 .   ? 35.698 12.308  -12.023 1.00 75.94  ? 417 HOH C O   1 
HETATM 6261 O O   . HOH H 3 .   ? 38.865 -15.845 -6.471  1.00 76.05  ? 418 HOH C O   1 
HETATM 6262 O O   . HOH H 3 .   ? 30.372 -0.107  7.282   1.00 67.23  ? 419 HOH C O   1 
HETATM 6263 O O   . HOH H 3 .   ? 56.465 -6.969  8.009   1.00 72.85  ? 420 HOH C O   1 
HETATM 6264 O O   . HOH H 3 .   ? 57.483 16.796  -15.596 1.00 75.85  ? 421 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   42  42  MET MET A . n 
A 1 2   THR 2   43  43  THR THR A . n 
A 1 3   PRO 3   44  44  PRO PRO A . n 
A 1 4   ALA 4   45  45  ALA ALA A . n 
A 1 5   SER 5   46  46  SER SER A . n 
A 1 6   TYR 6   47  47  TYR TYR A . n 
A 1 7   ASN 7   48  48  ASN ASN A . n 
A 1 8   LEU 8   49  49  LEU LEU A . n 
A 1 9   ALA 9   50  50  ALA ALA A . n 
A 1 10  VAL 10  51  51  VAL VAL A . n 
A 1 11  ARG 11  52  52  ARG ARG A . n 
A 1 12  ARG 12  53  53  ARG ARG A . n 
A 1 13  ALA 13  54  54  ALA ALA A . n 
A 1 14  ALA 14  55  55  ALA ALA A . n 
A 1 15  PRO 15  56  56  PRO PRO A . n 
A 1 16  ALA 16  57  57  ALA ALA A . n 
A 1 17  VAL 17  58  58  VAL VAL A . n 
A 1 18  VAL 18  59  59  VAL VAL A . n 
A 1 19  ASN 19  60  60  ASN ASN A . n 
A 1 20  VAL 20  61  61  VAL VAL A . n 
A 1 21  TYR 21  62  62  TYR TYR A . n 
A 1 22  ASN 22  63  63  ASN ASN A . n 
A 1 23  ARG 23  64  64  ARG ARG A . n 
A 1 24  GLY 24  65  65  GLY GLY A . n 
A 1 25  LEU 25  66  66  LEU LEU A . n 
A 1 26  ASN 26  67  67  ASN ASN A . n 
A 1 27  THR 27  68  68  THR THR A . n 
A 1 28  ASN 28  69  69  ASN ASN A . n 
A 1 29  SER 29  70  70  SER SER A . n 
A 1 30  HIS 30  71  71  HIS HIS A . n 
A 1 31  ASN 31  72  72  ASN ASN A . n 
A 1 32  GLN 32  73  73  GLN GLN A . n 
A 1 33  LEU 33  74  74  LEU LEU A . n 
A 1 34  GLU 34  75  75  GLU GLU A . n 
A 1 35  ILE 35  76  76  ILE ILE A . n 
A 1 36  ARG 36  77  77  ARG ARG A . n 
A 1 37  THR 37  78  78  THR THR A . n 
A 1 38  LEU 38  79  79  LEU LEU A . n 
A 1 39  GLY 39  80  80  GLY GLY A . n 
A 1 40  SER 40  81  81  SER SER A . n 
A 1 41  GLY 41  82  82  GLY GLY A . n 
A 1 42  VAL 42  83  83  VAL VAL A . n 
A 1 43  ILE 43  84  84  ILE ILE A . n 
A 1 44  MET 44  85  85  MET MET A . n 
A 1 45  ASP 45  86  86  ASP ASP A . n 
A 1 46  GLN 46  87  87  GLN GLN A . n 
A 1 47  ARG 47  88  88  ARG ARG A . n 
A 1 48  GLY 48  89  89  GLY GLY A . n 
A 1 49  TYR 49  90  90  TYR TYR A . n 
A 1 50  ILE 50  91  91  ILE ILE A . n 
A 1 51  ILE 51  92  92  ILE ILE A . n 
A 1 52  THR 52  93  93  THR THR A . n 
A 1 53  ASN 53  94  94  ASN ASN A . n 
A 1 54  LYS 54  95  95  LYS LYS A . n 
A 1 55  HIS 55  96  96  HIS HIS A . n 
A 1 56  VAL 56  97  97  VAL VAL A . n 
A 1 57  ILE 57  98  98  ILE ILE A . n 
A 1 58  ASN 58  99  99  ASN ASN A . n 
A 1 59  ASP 59  100 100 ASP ASP A . n 
A 1 60  ALA 60  101 101 ALA ALA A . n 
A 1 61  ASP 61  102 102 ASP ASP A . n 
A 1 62  GLN 62  103 103 GLN GLN A . n 
A 1 63  ILE 63  104 104 ILE ILE A . n 
A 1 64  ILE 64  105 105 ILE ILE A . n 
A 1 65  VAL 65  106 106 VAL VAL A . n 
A 1 66  ALA 66  107 107 ALA ALA A . n 
A 1 67  LEU 67  108 108 LEU LEU A . n 
A 1 68  GLN 68  109 109 GLN GLN A . n 
A 1 69  ASP 69  110 110 ASP ASP A . n 
A 1 70  GLY 70  111 111 GLY GLY A . n 
A 1 71  ARG 71  112 112 ARG ARG A . n 
A 1 72  VAL 72  113 113 VAL VAL A . n 
A 1 73  PHE 73  114 114 PHE PHE A . n 
A 1 74  GLU 74  115 115 GLU GLU A . n 
A 1 75  ALA 75  116 116 ALA ALA A . n 
A 1 76  LEU 76  117 117 LEU LEU A . n 
A 1 77  LEU 77  118 118 LEU LEU A . n 
A 1 78  VAL 78  119 119 VAL VAL A . n 
A 1 79  GLY 79  120 120 GLY GLY A . n 
A 1 80  SER 80  121 121 SER SER A . n 
A 1 81  ASP 81  122 122 ASP ASP A . n 
A 1 82  SER 82  123 123 SER SER A . n 
A 1 83  LEU 83  124 124 LEU LEU A . n 
A 1 84  THR 84  125 125 THR THR A . n 
A 1 85  ASP 85  126 126 ASP ASP A . n 
A 1 86  LEU 86  127 127 LEU LEU A . n 
A 1 87  ALA 87  128 128 ALA ALA A . n 
A 1 88  VAL 88  129 129 VAL VAL A . n 
A 1 89  LEU 89  130 130 LEU LEU A . n 
A 1 90  LYS 90  131 131 LYS LYS A . n 
A 1 91  ILE 91  132 132 ILE ILE A . n 
A 1 92  ASN 92  133 133 ASN ASN A . n 
A 1 93  ALA 93  134 134 ALA ALA A . n 
A 1 94  THR 94  135 135 THR THR A . n 
A 1 95  GLY 95  136 136 GLY GLY A . n 
A 1 96  GLY 96  137 137 GLY GLY A . n 
A 1 97  LEU 97  138 138 LEU LEU A . n 
A 1 98  PRO 98  139 139 PRO PRO A . n 
A 1 99  THR 99  140 140 THR THR A . n 
A 1 100 ILE 100 141 141 ILE ILE A . n 
A 1 101 PRO 101 142 142 PRO PRO A . n 
A 1 102 ILE 102 143 143 ILE ILE A . n 
A 1 103 ASN 103 144 144 ASN ASN A . n 
A 1 104 ALA 104 145 145 ALA ALA A . n 
A 1 105 ARG 105 146 146 ARG ARG A . n 
A 1 106 ARG 106 147 147 ARG ARG A . n 
A 1 107 VAL 107 148 148 VAL VAL A . n 
A 1 108 PRO 108 149 149 PRO PRO A . n 
A 1 109 HIS 109 150 150 HIS HIS A . n 
A 1 110 ILE 110 151 151 ILE ILE A . n 
A 1 111 GLY 111 152 152 GLY GLY A . n 
A 1 112 ASP 112 153 153 ASP ASP A . n 
A 1 113 VAL 113 154 154 VAL VAL A . n 
A 1 114 VAL 114 155 155 VAL VAL A . n 
A 1 115 LEU 115 156 156 LEU LEU A . n 
A 1 116 ALA 116 157 157 ALA ALA A . n 
A 1 117 ILE 117 158 158 ILE ILE A . n 
A 1 118 GLY 118 159 159 GLY GLY A . n 
A 1 119 ASN 119 160 160 ASN ASN A . n 
A 1 120 PRO 120 161 161 PRO PRO A . n 
A 1 121 TYR 121 162 162 TYR TYR A . n 
A 1 122 ASN 122 163 163 ASN ASN A . n 
A 1 123 LEU 123 164 164 LEU LEU A . n 
A 1 124 GLY 124 165 165 GLY GLY A . n 
A 1 125 GLN 125 166 166 GLN GLN A . n 
A 1 126 THR 126 167 167 THR THR A . n 
A 1 127 ILE 127 168 168 ILE ILE A . n 
A 1 128 THR 128 169 169 THR THR A . n 
A 1 129 GLN 129 170 170 GLN GLN A . n 
A 1 130 GLY 130 171 171 GLY GLY A . n 
A 1 131 ILE 131 172 172 ILE ILE A . n 
A 1 132 ILE 132 173 173 ILE ILE A . n 
A 1 133 SER 133 174 174 SER SER A . n 
A 1 134 ALA 134 175 175 ALA ALA A . n 
A 1 135 THR 135 176 176 THR THR A . n 
A 1 136 GLY 136 177 177 GLY GLY A . n 
A 1 137 ARG 137 178 178 ARG ARG A . n 
A 1 138 ILE 138 179 179 ILE ILE A . n 
A 1 139 GLY 139 180 180 GLY GLY A . n 
A 1 140 LEU 140 181 181 LEU LEU A . n 
A 1 141 ASN 141 182 182 ASN ASN A . n 
A 1 142 PRO 142 183 183 PRO PRO A . n 
A 1 143 THR 143 184 184 THR THR A . n 
A 1 144 GLY 144 185 185 GLY GLY A . n 
A 1 145 ARG 145 186 186 ARG ARG A . n 
A 1 146 GLN 146 187 187 GLN GLN A . n 
A 1 147 ASN 147 188 188 ASN ASN A . n 
A 1 148 PHE 148 189 189 PHE PHE A . n 
A 1 149 LEU 149 190 190 LEU LEU A . n 
A 1 150 GLN 150 191 191 GLN GLN A . n 
A 1 151 THR 151 192 192 THR THR A . n 
A 1 152 ASP 152 193 193 ASP ASP A . n 
A 1 153 ALA 153 194 194 ALA ALA A . n 
A 1 154 SER 154 195 195 SER SER A . n 
A 1 155 ILE 155 196 196 ILE ILE A . n 
A 1 156 ASN 156 197 197 ASN ASN A . n 
A 1 157 HIS 157 198 198 HIS HIS A . n 
A 1 158 GLY 158 199 199 GLY GLY A . n 
A 1 159 ASN 159 200 200 ASN ASN A . n 
A 1 160 SER 160 201 201 SER SER A . n 
A 1 161 GLY 161 202 202 GLY GLY A . n 
A 1 162 GLY 162 203 203 GLY GLY A . n 
A 1 163 ALA 163 204 204 ALA ALA A . n 
A 1 164 LEU 164 205 205 LEU LEU A . n 
A 1 165 VAL 165 206 206 VAL VAL A . n 
A 1 166 ASN 166 207 207 ASN ASN A . n 
A 1 167 SER 167 208 208 SER SER A . n 
A 1 168 LEU 168 209 209 LEU LEU A . n 
A 1 169 GLY 169 210 210 GLY GLY A . n 
A 1 170 GLU 170 211 211 GLU GLU A . n 
A 1 171 LEU 171 212 212 LEU LEU A . n 
A 1 172 MET 172 213 213 MET MET A . n 
A 1 173 GLY 173 214 214 GLY GLY A . n 
A 1 174 ILE 174 215 215 ILE ILE A . n 
A 1 175 ASN 175 216 216 ASN ASN A . n 
A 1 176 THR 176 217 217 THR THR A . n 
A 1 177 LEU 177 218 218 LEU LEU A . n 
A 1 178 SER 178 219 219 SER SER A . n 
A 1 179 PHE 179 220 220 PHE PHE A . n 
A 1 180 ASP 180 221 221 ASP ASP A . n 
A 1 181 LYS 181 222 222 LYS LYS A . n 
A 1 182 SER 182 223 223 SER SER A . n 
A 1 183 ASN 183 224 224 ASN ASN A . n 
A 1 184 ASP 184 225 225 ASP ASP A . n 
A 1 185 GLY 185 226 226 GLY GLY A . n 
A 1 186 GLU 186 227 227 GLU GLU A . n 
A 1 187 THR 187 228 228 THR THR A . n 
A 1 188 PRO 188 229 229 PRO PRO A . n 
A 1 189 GLU 189 230 230 GLU GLU A . n 
A 1 190 GLY 190 231 231 GLY GLY A . n 
A 1 191 ILE 191 232 232 ILE ILE A . n 
A 1 192 GLY 192 233 233 GLY GLY A . n 
A 1 193 PHE 193 234 234 PHE PHE A . n 
A 1 194 ALA 194 235 235 ALA ALA A . n 
A 1 195 ILE 195 236 236 ILE ILE A . n 
A 1 196 PRO 196 237 237 PRO PRO A . n 
A 1 197 PHE 197 238 238 PHE PHE A . n 
A 1 198 GLN 198 239 239 GLN GLN A . n 
A 1 199 LEU 199 240 240 LEU LEU A . n 
A 1 200 ALA 200 241 241 ALA ALA A . n 
A 1 201 THR 201 242 242 THR THR A . n 
A 1 202 LYS 202 243 243 LYS LYS A . n 
A 1 203 ILE 203 244 244 ILE ILE A . n 
A 1 204 MET 204 245 245 MET MET A . n 
A 1 205 ASP 205 246 246 ASP ASP A . n 
A 1 206 LYS 206 247 247 LYS LYS A . n 
A 1 207 LEU 207 248 248 LEU LEU A . n 
A 1 208 ILE 208 249 249 ILE ILE A . n 
A 1 209 ARG 209 250 250 ARG ARG A . n 
A 1 210 ASP 210 251 251 ASP ASP A . n 
A 1 211 GLY 211 252 252 GLY GLY A . n 
A 1 212 ARG 212 253 253 ARG ARG A . n 
A 1 213 VAL 213 254 254 VAL VAL A . n 
A 1 214 ILE 214 255 255 ILE ILE A . n 
A 1 215 ARG 215 256 256 ARG ARG A . n 
A 1 216 GLY 216 257 257 GLY GLY A . n 
A 1 217 TYR 217 258 258 TYR TYR A . n 
A 1 218 ILE 218 259 259 ILE ILE A . n 
A 1 219 GLY 219 260 260 GLY GLY A . n 
A 1 220 ILE 220 261 261 ILE ILE A . n 
A 1 221 GLY 221 262 262 GLY GLY A . n 
A 1 222 GLY 222 263 263 GLY GLY A . n 
A 1 223 ARG 223 264 264 ARG ALA A . n 
A 1 224 GLU 224 265 ?   ?   ?   A . n 
A 1 225 ILE 225 266 ?   ?   ?   A . n 
A 1 226 ALA 226 267 ?   ?   ?   A . n 
A 1 227 PRO 227 268 ?   ?   ?   A . n 
A 1 228 LEU 228 269 ?   ?   ?   A . n 
A 1 229 HIS 229 270 ?   ?   ?   A . n 
A 1 230 ALA 230 271 ?   ?   ?   A . n 
A 1 231 GLN 231 272 ?   ?   ?   A . n 
A 1 232 GLY 232 273 ?   ?   ?   A . n 
A 1 233 GLY 233 274 ?   ?   ?   A . n 
A 1 234 GLY 234 275 ?   ?   ?   A . n 
A 1 235 ILE 235 276 ?   ?   ?   A . n 
A 1 236 ASP 236 277 ?   ?   ?   A . n 
A 1 237 GLN 237 278 ?   ?   ?   A . n 
A 1 238 LEU 238 279 ?   ?   ?   A . n 
A 1 239 GLN 239 280 ?   ?   ?   A . n 
A 1 240 GLY 240 281 ?   ?   ?   A . n 
A 1 241 ILE 241 282 282 ILE ALA A . n 
A 1 242 VAL 242 283 283 VAL VAL A . n 
A 1 243 VAL 243 284 284 VAL VAL A . n 
A 1 244 ASN 244 285 285 ASN ASN A . n 
A 1 245 GLU 245 286 286 GLU GLU A . n 
A 1 246 VAL 246 287 287 VAL ALA A . n 
A 1 247 SER 247 288 288 SER ALA A . n 
A 1 248 PRO 248 289 289 PRO PRO A . n 
A 1 249 ASP 249 290 290 ASP ALA A . n 
A 1 250 GLY 250 291 291 GLY GLY A . n 
A 1 251 PRO 251 292 292 PRO PRO A . n 
A 1 252 ALA 252 293 293 ALA ALA A . n 
A 1 253 ALA 253 294 294 ALA ALA A . n 
A 1 254 ASN 254 295 295 ASN ALA A . n 
A 1 255 ALA 255 296 296 ALA ALA A . n 
A 1 256 GLY 256 297 297 GLY GLY A . n 
A 1 257 ILE 257 298 298 ILE ALA A . n 
A 1 258 GLN 258 299 299 GLN ALA A . n 
A 1 259 VAL 259 300 300 VAL VAL A . n 
A 1 260 ASN 260 301 301 ASN ALA A . n 
A 1 261 ASP 261 302 302 ASP ASP A . n 
A 1 262 LEU 262 303 303 LEU ALA A . n 
A 1 263 ILE 263 304 304 ILE ILE A . n 
A 1 264 ILE 264 305 305 ILE ALA A . n 
A 1 265 SER 265 306 306 SER SER A . n 
A 1 266 VAL 266 307 307 VAL VAL A . n 
A 1 267 ASP 267 308 308 ASP ASP A . n 
A 1 268 ASN 268 309 309 ASN ASN A . n 
A 1 269 LYS 269 310 310 LYS LYS A . n 
A 1 270 PRO 270 311 311 PRO PRO A . n 
A 1 271 ALA 271 312 312 ALA ALA A . n 
A 1 272 ILE 272 313 ?   ?   ?   A . n 
A 1 273 SER 273 314 ?   ?   ?   A . n 
A 1 274 ALA 274 315 ?   ?   ?   A . n 
A 1 275 LEU 275 316 ?   ?   ?   A . n 
A 1 276 GLU 276 317 ?   ?   ?   A . n 
A 1 277 THR 277 318 318 THR THR A . n 
A 1 278 MET 278 319 319 MET MET A . n 
A 1 279 ASP 279 320 320 ASP ASP A . n 
A 1 280 GLN 280 321 321 GLN ALA A . n 
A 1 281 VAL 281 322 322 VAL VAL A . n 
A 1 282 ALA 282 323 323 ALA ALA A . n 
A 1 283 GLU 283 324 324 GLU GLU A . n 
A 1 284 ILE 284 325 325 ILE ILE A . n 
A 1 285 ARG 285 326 326 ARG ARG A . n 
A 1 286 PRO 286 327 327 PRO PRO A . n 
A 1 287 GLY 287 328 328 GLY GLY A . n 
A 1 288 SER 288 329 329 SER SER A . n 
A 1 289 VAL 289 330 330 VAL ALA A . n 
A 1 290 ILE 290 331 331 ILE ILE A . n 
A 1 291 PRO 291 332 332 PRO PRO A . n 
A 1 292 VAL 292 333 333 VAL VAL A . n 
A 1 293 VAL 293 334 334 VAL VAL A . n 
A 1 294 VAL 294 335 335 VAL ALA A . n 
A 1 295 MET 295 336 ?   ?   ?   A . n 
A 1 296 ARG 296 337 ?   ?   ?   A . n 
A 1 297 ASP 297 338 ?   ?   ?   A . n 
A 1 298 ASP 298 339 ?   ?   ?   A . n 
A 1 299 LYS 299 340 ?   ?   ?   A . n 
A 1 300 GLN 300 341 ?   ?   ?   A . n 
A 1 301 LEU 301 342 ?   ?   ?   A . n 
A 1 302 THR 302 343 ?   ?   ?   A . n 
A 1 303 LEU 303 344 344 LEU ALA A . n 
A 1 304 GLN 304 345 345 GLN ALA A . n 
A 1 305 VAL 305 346 346 VAL VAL A . n 
A 1 306 THR 306 347 347 THR THR A . n 
A 1 307 ILE 307 348 348 ILE ILE A . n 
A 1 308 GLN 308 349 349 GLN ALA A . n 
A 1 309 GLU 309 350 350 GLU ALA A . n 
A 1 310 TYR 310 351 351 TYR TYR A . n 
A 1 311 PRO 311 352 352 PRO PRO A . n 
A 1 312 ALA 312 353 ?   ?   ?   A . n 
A 1 313 THR 313 354 ?   ?   ?   A . n 
A 1 314 ASN 314 355 ?   ?   ?   A . n 
B 1 1   MET 1   42  42  MET MET B . n 
B 1 2   THR 2   43  43  THR THR B . n 
B 1 3   PRO 3   44  44  PRO PRO B . n 
B 1 4   ALA 4   45  45  ALA ALA B . n 
B 1 5   SER 5   46  46  SER SER B . n 
B 1 6   TYR 6   47  47  TYR TYR B . n 
B 1 7   ASN 7   48  48  ASN ASN B . n 
B 1 8   LEU 8   49  49  LEU LEU B . n 
B 1 9   ALA 9   50  50  ALA ALA B . n 
B 1 10  VAL 10  51  51  VAL VAL B . n 
B 1 11  ARG 11  52  52  ARG ARG B . n 
B 1 12  ARG 12  53  53  ARG ARG B . n 
B 1 13  ALA 13  54  54  ALA ALA B . n 
B 1 14  ALA 14  55  55  ALA ALA B . n 
B 1 15  PRO 15  56  56  PRO PRO B . n 
B 1 16  ALA 16  57  57  ALA ALA B . n 
B 1 17  VAL 17  58  58  VAL VAL B . n 
B 1 18  VAL 18  59  59  VAL VAL B . n 
B 1 19  ASN 19  60  60  ASN ASN B . n 
B 1 20  VAL 20  61  61  VAL VAL B . n 
B 1 21  TYR 21  62  62  TYR TYR B . n 
B 1 22  ASN 22  63  63  ASN ASN B . n 
B 1 23  ARG 23  64  64  ARG ARG B . n 
B 1 24  GLY 24  65  65  GLY GLY B . n 
B 1 25  LEU 25  66  66  LEU LEU B . n 
B 1 26  ASN 26  67  67  ASN ALA B . n 
B 1 27  THR 27  68  68  THR ALA B . n 
B 1 28  ASN 28  69  69  ASN ALA B . n 
B 1 29  SER 29  70  70  SER ALA B . n 
B 1 30  HIS 30  71  71  HIS ALA B . n 
B 1 31  ASN 31  72  72  ASN ALA B . n 
B 1 32  GLN 32  73  73  GLN GLN B . n 
B 1 33  LEU 33  74  74  LEU LEU B . n 
B 1 34  GLU 34  75  75  GLU GLU B . n 
B 1 35  ILE 35  76  76  ILE ILE B . n 
B 1 36  ARG 36  77  77  ARG ARG B . n 
B 1 37  THR 37  78  78  THR THR B . n 
B 1 38  LEU 38  79  79  LEU LEU B . n 
B 1 39  GLY 39  80  80  GLY GLY B . n 
B 1 40  SER 40  81  81  SER SER B . n 
B 1 41  GLY 41  82  82  GLY GLY B . n 
B 1 42  VAL 42  83  83  VAL VAL B . n 
B 1 43  ILE 43  84  84  ILE ILE B . n 
B 1 44  MET 44  85  85  MET MET B . n 
B 1 45  ASP 45  86  86  ASP ASP B . n 
B 1 46  GLN 46  87  87  GLN GLN B . n 
B 1 47  ARG 47  88  88  ARG ARG B . n 
B 1 48  GLY 48  89  89  GLY GLY B . n 
B 1 49  TYR 49  90  90  TYR TYR B . n 
B 1 50  ILE 50  91  91  ILE ILE B . n 
B 1 51  ILE 51  92  92  ILE ILE B . n 
B 1 52  THR 52  93  93  THR THR B . n 
B 1 53  ASN 53  94  94  ASN ASN B . n 
B 1 54  LYS 54  95  95  LYS LYS B . n 
B 1 55  HIS 55  96  96  HIS HIS B . n 
B 1 56  VAL 56  97  97  VAL VAL B . n 
B 1 57  ILE 57  98  98  ILE ILE B . n 
B 1 58  ASN 58  99  99  ASN ASN B . n 
B 1 59  ASP 59  100 100 ASP ASP B . n 
B 1 60  ALA 60  101 101 ALA ALA B . n 
B 1 61  ASP 61  102 102 ASP ASP B . n 
B 1 62  GLN 62  103 103 GLN GLN B . n 
B 1 63  ILE 63  104 104 ILE ILE B . n 
B 1 64  ILE 64  105 105 ILE ILE B . n 
B 1 65  VAL 65  106 106 VAL VAL B . n 
B 1 66  ALA 66  107 107 ALA ALA B . n 
B 1 67  LEU 67  108 108 LEU LEU B . n 
B 1 68  GLN 68  109 109 GLN GLN B . n 
B 1 69  ASP 69  110 110 ASP ASP B . n 
B 1 70  GLY 70  111 111 GLY GLY B . n 
B 1 71  ARG 71  112 112 ARG ARG B . n 
B 1 72  VAL 72  113 113 VAL VAL B . n 
B 1 73  PHE 73  114 114 PHE PHE B . n 
B 1 74  GLU 74  115 115 GLU GLU B . n 
B 1 75  ALA 75  116 116 ALA ALA B . n 
B 1 76  LEU 76  117 117 LEU LEU B . n 
B 1 77  LEU 77  118 118 LEU LEU B . n 
B 1 78  VAL 78  119 119 VAL VAL B . n 
B 1 79  GLY 79  120 120 GLY GLY B . n 
B 1 80  SER 80  121 121 SER SER B . n 
B 1 81  ASP 81  122 122 ASP ASP B . n 
B 1 82  SER 82  123 123 SER SER B . n 
B 1 83  LEU 83  124 124 LEU LEU B . n 
B 1 84  THR 84  125 125 THR THR B . n 
B 1 85  ASP 85  126 126 ASP ASP B . n 
B 1 86  LEU 86  127 127 LEU LEU B . n 
B 1 87  ALA 87  128 128 ALA ALA B . n 
B 1 88  VAL 88  129 129 VAL VAL B . n 
B 1 89  LEU 89  130 130 LEU LEU B . n 
B 1 90  LYS 90  131 131 LYS LYS B . n 
B 1 91  ILE 91  132 132 ILE ILE B . n 
B 1 92  ASN 92  133 133 ASN ASN B . n 
B 1 93  ALA 93  134 134 ALA ALA B . n 
B 1 94  THR 94  135 135 THR THR B . n 
B 1 95  GLY 95  136 136 GLY GLY B . n 
B 1 96  GLY 96  137 137 GLY GLY B . n 
B 1 97  LEU 97  138 138 LEU LEU B . n 
B 1 98  PRO 98  139 139 PRO PRO B . n 
B 1 99  THR 99  140 140 THR THR B . n 
B 1 100 ILE 100 141 141 ILE ILE B . n 
B 1 101 PRO 101 142 142 PRO PRO B . n 
B 1 102 ILE 102 143 143 ILE ILE B . n 
B 1 103 ASN 103 144 144 ASN ASN B . n 
B 1 104 ALA 104 145 145 ALA ALA B . n 
B 1 105 ARG 105 146 146 ARG ARG B . n 
B 1 106 ARG 106 147 147 ARG ARG B . n 
B 1 107 VAL 107 148 148 VAL VAL B . n 
B 1 108 PRO 108 149 149 PRO PRO B . n 
B 1 109 HIS 109 150 150 HIS HIS B . n 
B 1 110 ILE 110 151 151 ILE ILE B . n 
B 1 111 GLY 111 152 152 GLY GLY B . n 
B 1 112 ASP 112 153 153 ASP ASP B . n 
B 1 113 VAL 113 154 154 VAL VAL B . n 
B 1 114 VAL 114 155 155 VAL VAL B . n 
B 1 115 LEU 115 156 156 LEU LEU B . n 
B 1 116 ALA 116 157 157 ALA ALA B . n 
B 1 117 ILE 117 158 158 ILE ILE B . n 
B 1 118 GLY 118 159 159 GLY GLY B . n 
B 1 119 ASN 119 160 160 ASN ASN B . n 
B 1 120 PRO 120 161 161 PRO PRO B . n 
B 1 121 TYR 121 162 162 TYR TYR B . n 
B 1 122 ASN 122 163 163 ASN ASN B . n 
B 1 123 LEU 123 164 164 LEU LEU B . n 
B 1 124 GLY 124 165 165 GLY GLY B . n 
B 1 125 GLN 125 166 166 GLN GLN B . n 
B 1 126 THR 126 167 167 THR THR B . n 
B 1 127 ILE 127 168 168 ILE ILE B . n 
B 1 128 THR 128 169 169 THR THR B . n 
B 1 129 GLN 129 170 170 GLN GLN B . n 
B 1 130 GLY 130 171 171 GLY GLY B . n 
B 1 131 ILE 131 172 172 ILE ILE B . n 
B 1 132 ILE 132 173 173 ILE ILE B . n 
B 1 133 SER 133 174 174 SER SER B . n 
B 1 134 ALA 134 175 175 ALA ALA B . n 
B 1 135 THR 135 176 176 THR THR B . n 
B 1 136 GLY 136 177 177 GLY GLY B . n 
B 1 137 ARG 137 178 178 ARG ARG B . n 
B 1 138 ILE 138 179 179 ILE ILE B . n 
B 1 139 GLY 139 180 180 GLY GLY B . n 
B 1 140 LEU 140 181 181 LEU LEU B . n 
B 1 141 ASN 141 182 182 ASN ASN B . n 
B 1 142 PRO 142 183 183 PRO PRO B . n 
B 1 143 THR 143 184 184 THR THR B . n 
B 1 144 GLY 144 185 185 GLY GLY B . n 
B 1 145 ARG 145 186 186 ARG ARG B . n 
B 1 146 GLN 146 187 187 GLN GLN B . n 
B 1 147 ASN 147 188 188 ASN ASN B . n 
B 1 148 PHE 148 189 189 PHE PHE B . n 
B 1 149 LEU 149 190 190 LEU LEU B . n 
B 1 150 GLN 150 191 191 GLN GLN B . n 
B 1 151 THR 151 192 192 THR THR B . n 
B 1 152 ASP 152 193 193 ASP ASP B . n 
B 1 153 ALA 153 194 194 ALA ALA B . n 
B 1 154 SER 154 195 195 SER SER B . n 
B 1 155 ILE 155 196 196 ILE ILE B . n 
B 1 156 ASN 156 197 197 ASN ASN B . n 
B 1 157 HIS 157 198 198 HIS HIS B . n 
B 1 158 GLY 158 199 199 GLY GLY B . n 
B 1 159 ASN 159 200 200 ASN ASN B . n 
B 1 160 SER 160 201 201 SER SER B . n 
B 1 161 GLY 161 202 202 GLY GLY B . n 
B 1 162 GLY 162 203 203 GLY GLY B . n 
B 1 163 ALA 163 204 204 ALA ALA B . n 
B 1 164 LEU 164 205 205 LEU LEU B . n 
B 1 165 VAL 165 206 206 VAL VAL B . n 
B 1 166 ASN 166 207 207 ASN ASN B . n 
B 1 167 SER 167 208 208 SER SER B . n 
B 1 168 LEU 168 209 209 LEU LEU B . n 
B 1 169 GLY 169 210 210 GLY GLY B . n 
B 1 170 GLU 170 211 211 GLU GLU B . n 
B 1 171 LEU 171 212 212 LEU LEU B . n 
B 1 172 MET 172 213 213 MET MET B . n 
B 1 173 GLY 173 214 214 GLY GLY B . n 
B 1 174 ILE 174 215 215 ILE ILE B . n 
B 1 175 ASN 175 216 216 ASN ASN B . n 
B 1 176 THR 176 217 217 THR THR B . n 
B 1 177 LEU 177 218 218 LEU LEU B . n 
B 1 178 SER 178 219 219 SER SER B . n 
B 1 179 PHE 179 220 220 PHE PHE B . n 
B 1 180 ASP 180 221 221 ASP ASP B . n 
B 1 181 LYS 181 222 222 LYS LYS B . n 
B 1 182 SER 182 223 223 SER SER B . n 
B 1 183 ASN 183 224 224 ASN ASN B . n 
B 1 184 ASP 184 225 225 ASP ASP B . n 
B 1 185 GLY 185 226 226 GLY GLY B . n 
B 1 186 GLU 186 227 227 GLU GLU B . n 
B 1 187 THR 187 228 228 THR THR B . n 
B 1 188 PRO 188 229 229 PRO PRO B . n 
B 1 189 GLU 189 230 230 GLU GLU B . n 
B 1 190 GLY 190 231 231 GLY GLY B . n 
B 1 191 ILE 191 232 232 ILE ILE B . n 
B 1 192 GLY 192 233 233 GLY GLY B . n 
B 1 193 PHE 193 234 234 PHE PHE B . n 
B 1 194 ALA 194 235 235 ALA ALA B . n 
B 1 195 ILE 195 236 236 ILE ILE B . n 
B 1 196 PRO 196 237 237 PRO PRO B . n 
B 1 197 PHE 197 238 238 PHE PHE B . n 
B 1 198 GLN 198 239 239 GLN GLN B . n 
B 1 199 LEU 199 240 240 LEU LEU B . n 
B 1 200 ALA 200 241 241 ALA ALA B . n 
B 1 201 THR 201 242 242 THR THR B . n 
B 1 202 LYS 202 243 243 LYS LYS B . n 
B 1 203 ILE 203 244 244 ILE ILE B . n 
B 1 204 MET 204 245 245 MET MET B . n 
B 1 205 ASP 205 246 246 ASP ASP B . n 
B 1 206 LYS 206 247 247 LYS LYS B . n 
B 1 207 LEU 207 248 248 LEU LEU B . n 
B 1 208 ILE 208 249 249 ILE ILE B . n 
B 1 209 ARG 209 250 250 ARG ARG B . n 
B 1 210 ASP 210 251 251 ASP ASP B . n 
B 1 211 GLY 211 252 252 GLY GLY B . n 
B 1 212 ARG 212 253 253 ARG ARG B . n 
B 1 213 VAL 213 254 254 VAL VAL B . n 
B 1 214 ILE 214 255 255 ILE ILE B . n 
B 1 215 ARG 215 256 256 ARG ARG B . n 
B 1 216 GLY 216 257 257 GLY GLY B . n 
B 1 217 TYR 217 258 258 TYR TYR B . n 
B 1 218 ILE 218 259 259 ILE ILE B . n 
B 1 219 GLY 219 260 260 GLY GLY B . n 
B 1 220 ILE 220 261 261 ILE ILE B . n 
B 1 221 GLY 221 262 262 GLY GLY B . n 
B 1 222 GLY 222 263 263 GLY GLY B . n 
B 1 223 ARG 223 264 264 ARG ALA B . n 
B 1 224 GLU 224 265 ?   ?   ?   B . n 
B 1 225 ILE 225 266 ?   ?   ?   B . n 
B 1 226 ALA 226 267 ?   ?   ?   B . n 
B 1 227 PRO 227 268 ?   ?   ?   B . n 
B 1 228 LEU 228 269 ?   ?   ?   B . n 
B 1 229 HIS 229 270 ?   ?   ?   B . n 
B 1 230 ALA 230 271 ?   ?   ?   B . n 
B 1 231 GLN 231 272 ?   ?   ?   B . n 
B 1 232 GLY 232 273 ?   ?   ?   B . n 
B 1 233 GLY 233 274 ?   ?   ?   B . n 
B 1 234 GLY 234 275 ?   ?   ?   B . n 
B 1 235 ILE 235 276 ?   ?   ?   B . n 
B 1 236 ASP 236 277 ?   ?   ?   B . n 
B 1 237 GLN 237 278 ?   ?   ?   B . n 
B 1 238 LEU 238 279 ?   ?   ?   B . n 
B 1 239 GLN 239 280 ?   ?   ?   B . n 
B 1 240 GLY 240 281 ?   ?   ?   B . n 
B 1 241 ILE 241 282 282 ILE ALA B . n 
B 1 242 VAL 242 283 283 VAL ALA B . n 
B 1 243 VAL 243 284 284 VAL ALA B . n 
B 1 244 ASN 244 285 285 ASN ASN B . n 
B 1 245 GLU 245 286 286 GLU GLU B . n 
B 1 246 VAL 246 287 ?   ?   ?   B . n 
B 1 247 SER 247 288 ?   ?   ?   B . n 
B 1 248 PRO 248 289 ?   ?   ?   B . n 
B 1 249 ASP 249 290 ?   ?   ?   B . n 
B 1 250 GLY 250 291 291 GLY GLY B . n 
B 1 251 PRO 251 292 292 PRO PRO B . n 
B 1 252 ALA 252 293 293 ALA ALA B . n 
B 1 253 ALA 253 294 294 ALA ALA B . n 
B 1 254 ASN 254 295 295 ASN ASN B . n 
B 1 255 ALA 255 296 296 ALA ALA B . n 
B 1 256 GLY 256 297 297 GLY GLY B . n 
B 1 257 ILE 257 298 298 ILE ALA B . n 
B 1 258 GLN 258 299 299 GLN ALA B . n 
B 1 259 VAL 259 300 300 VAL VAL B . n 
B 1 260 ASN 260 301 301 ASN ASN B . n 
B 1 261 ASP 261 302 302 ASP ASP B . n 
B 1 262 LEU 262 303 303 LEU ALA B . n 
B 1 263 ILE 263 304 304 ILE ILE B . n 
B 1 264 ILE 264 305 305 ILE ILE B . n 
B 1 265 SER 265 306 306 SER SER B . n 
B 1 266 VAL 266 307 307 VAL VAL B . n 
B 1 267 ASP 267 308 308 ASP ASP B . n 
B 1 268 ASN 268 309 309 ASN ASN B . n 
B 1 269 LYS 269 310 310 LYS LYS B . n 
B 1 270 PRO 270 311 311 PRO PRO B . n 
B 1 271 ALA 271 312 312 ALA ALA B . n 
B 1 272 ILE 272 313 313 ILE ILE B . n 
B 1 273 SER 273 314 314 SER SER B . n 
B 1 274 ALA 274 315 315 ALA ALA B . n 
B 1 275 LEU 275 316 316 LEU LEU B . n 
B 1 276 GLU 276 317 317 GLU GLU B . n 
B 1 277 THR 277 318 318 THR THR B . n 
B 1 278 MET 278 319 319 MET MET B . n 
B 1 279 ASP 279 320 320 ASP ASP B . n 
B 1 280 GLN 280 321 321 GLN GLN B . n 
B 1 281 VAL 281 322 322 VAL VAL B . n 
B 1 282 ALA 282 323 323 ALA ALA B . n 
B 1 283 GLU 283 324 324 GLU GLU B . n 
B 1 284 ILE 284 325 325 ILE ILE B . n 
B 1 285 ARG 285 326 326 ARG ARG B . n 
B 1 286 PRO 286 327 327 PRO PRO B . n 
B 1 287 GLY 287 328 328 GLY GLY B . n 
B 1 288 SER 288 329 329 SER SER B . n 
B 1 289 VAL 289 330 330 VAL VAL B . n 
B 1 290 ILE 290 331 331 ILE ILE B . n 
B 1 291 PRO 291 332 332 PRO PRO B . n 
B 1 292 VAL 292 333 333 VAL VAL B . n 
B 1 293 VAL 293 334 ?   ?   ?   B . n 
B 1 294 VAL 294 335 ?   ?   ?   B . n 
B 1 295 MET 295 336 ?   ?   ?   B . n 
B 1 296 ARG 296 337 ?   ?   ?   B . n 
B 1 297 ASP 297 338 ?   ?   ?   B . n 
B 1 298 ASP 298 339 ?   ?   ?   B . n 
B 1 299 LYS 299 340 ?   ?   ?   B . n 
B 1 300 GLN 300 341 ?   ?   ?   B . n 
B 1 301 LEU 301 342 ?   ?   ?   B . n 
B 1 302 THR 302 343 ?   ?   ?   B . n 
B 1 303 LEU 303 344 344 LEU ALA B . n 
B 1 304 GLN 304 345 345 GLN ALA B . n 
B 1 305 VAL 305 346 346 VAL VAL B . n 
B 1 306 THR 306 347 347 THR THR B . n 
B 1 307 ILE 307 348 348 ILE ILE B . n 
B 1 308 GLN 308 349 349 GLN GLN B . n 
B 1 309 GLU 309 350 350 GLU GLU B . n 
B 1 310 TYR 310 351 351 TYR TYR B . n 
B 1 311 PRO 311 352 352 PRO PRO B . n 
B 1 312 ALA 312 353 353 ALA ALA B . n 
B 1 313 THR 313 354 ?   ?   ?   B . n 
B 1 314 ASN 314 355 ?   ?   ?   B . n 
C 1 1   MET 1   42  42  MET MET C . n 
C 1 2   THR 2   43  43  THR THR C . n 
C 1 3   PRO 3   44  44  PRO PRO C . n 
C 1 4   ALA 4   45  45  ALA ALA C . n 
C 1 5   SER 5   46  46  SER SER C . n 
C 1 6   TYR 6   47  47  TYR TYR C . n 
C 1 7   ASN 7   48  48  ASN ASN C . n 
C 1 8   LEU 8   49  49  LEU LEU C . n 
C 1 9   ALA 9   50  50  ALA ALA C . n 
C 1 10  VAL 10  51  51  VAL VAL C . n 
C 1 11  ARG 11  52  52  ARG ARG C . n 
C 1 12  ARG 12  53  53  ARG ARG C . n 
C 1 13  ALA 13  54  54  ALA ALA C . n 
C 1 14  ALA 14  55  55  ALA ALA C . n 
C 1 15  PRO 15  56  56  PRO PRO C . n 
C 1 16  ALA 16  57  57  ALA ALA C . n 
C 1 17  VAL 17  58  58  VAL VAL C . n 
C 1 18  VAL 18  59  59  VAL VAL C . n 
C 1 19  ASN 19  60  60  ASN ASN C . n 
C 1 20  VAL 20  61  61  VAL VAL C . n 
C 1 21  TYR 21  62  62  TYR TYR C . n 
C 1 22  ASN 22  63  63  ASN ASN C . n 
C 1 23  ARG 23  64  64  ARG ARG C . n 
C 1 24  GLY 24  65  65  GLY GLY C . n 
C 1 25  LEU 25  66  66  LEU LEU C . n 
C 1 26  ASN 26  67  67  ASN ASN C . n 
C 1 27  THR 27  68  68  THR THR C . n 
C 1 28  ASN 28  69  69  ASN ASN C . n 
C 1 29  SER 29  70  70  SER SER C . n 
C 1 30  HIS 30  71  71  HIS HIS C . n 
C 1 31  ASN 31  72  72  ASN ASN C . n 
C 1 32  GLN 32  73  73  GLN GLN C . n 
C 1 33  LEU 33  74  74  LEU LEU C . n 
C 1 34  GLU 34  75  75  GLU ALA C . n 
C 1 35  ILE 35  76  76  ILE ILE C . n 
C 1 36  ARG 36  77  77  ARG ARG C . n 
C 1 37  THR 37  78  78  THR THR C . n 
C 1 38  LEU 38  79  79  LEU LEU C . n 
C 1 39  GLY 39  80  80  GLY GLY C . n 
C 1 40  SER 40  81  81  SER SER C . n 
C 1 41  GLY 41  82  82  GLY GLY C . n 
C 1 42  VAL 42  83  83  VAL VAL C . n 
C 1 43  ILE 43  84  84  ILE ILE C . n 
C 1 44  MET 44  85  85  MET MET C . n 
C 1 45  ASP 45  86  86  ASP ASP C . n 
C 1 46  GLN 46  87  87  GLN GLN C . n 
C 1 47  ARG 47  88  88  ARG ARG C . n 
C 1 48  GLY 48  89  89  GLY GLY C . n 
C 1 49  TYR 49  90  90  TYR TYR C . n 
C 1 50  ILE 50  91  91  ILE ILE C . n 
C 1 51  ILE 51  92  92  ILE ILE C . n 
C 1 52  THR 52  93  93  THR THR C . n 
C 1 53  ASN 53  94  94  ASN ASN C . n 
C 1 54  LYS 54  95  95  LYS LYS C . n 
C 1 55  HIS 55  96  96  HIS HIS C . n 
C 1 56  VAL 56  97  97  VAL VAL C . n 
C 1 57  ILE 57  98  98  ILE ILE C . n 
C 1 58  ASN 58  99  99  ASN ASN C . n 
C 1 59  ASP 59  100 100 ASP ASP C . n 
C 1 60  ALA 60  101 101 ALA ALA C . n 
C 1 61  ASP 61  102 102 ASP ASP C . n 
C 1 62  GLN 62  103 103 GLN GLN C . n 
C 1 63  ILE 63  104 104 ILE ILE C . n 
C 1 64  ILE 64  105 105 ILE ILE C . n 
C 1 65  VAL 65  106 106 VAL VAL C . n 
C 1 66  ALA 66  107 107 ALA ALA C . n 
C 1 67  LEU 67  108 108 LEU LEU C . n 
C 1 68  GLN 68  109 109 GLN GLN C . n 
C 1 69  ASP 69  110 110 ASP ASP C . n 
C 1 70  GLY 70  111 111 GLY GLY C . n 
C 1 71  ARG 71  112 112 ARG ARG C . n 
C 1 72  VAL 72  113 113 VAL VAL C . n 
C 1 73  PHE 73  114 114 PHE PHE C . n 
C 1 74  GLU 74  115 115 GLU GLU C . n 
C 1 75  ALA 75  116 116 ALA ALA C . n 
C 1 76  LEU 76  117 117 LEU LEU C . n 
C 1 77  LEU 77  118 118 LEU LEU C . n 
C 1 78  VAL 78  119 119 VAL VAL C . n 
C 1 79  GLY 79  120 120 GLY GLY C . n 
C 1 80  SER 80  121 121 SER SER C . n 
C 1 81  ASP 81  122 122 ASP ASP C . n 
C 1 82  SER 82  123 123 SER SER C . n 
C 1 83  LEU 83  124 124 LEU LEU C . n 
C 1 84  THR 84  125 125 THR THR C . n 
C 1 85  ASP 85  126 126 ASP ASP C . n 
C 1 86  LEU 86  127 127 LEU LEU C . n 
C 1 87  ALA 87  128 128 ALA ALA C . n 
C 1 88  VAL 88  129 129 VAL VAL C . n 
C 1 89  LEU 89  130 130 LEU LEU C . n 
C 1 90  LYS 90  131 131 LYS LYS C . n 
C 1 91  ILE 91  132 132 ILE ILE C . n 
C 1 92  ASN 92  133 133 ASN ASN C . n 
C 1 93  ALA 93  134 134 ALA ALA C . n 
C 1 94  THR 94  135 135 THR THR C . n 
C 1 95  GLY 95  136 136 GLY GLY C . n 
C 1 96  GLY 96  137 137 GLY GLY C . n 
C 1 97  LEU 97  138 138 LEU LEU C . n 
C 1 98  PRO 98  139 139 PRO PRO C . n 
C 1 99  THR 99  140 140 THR THR C . n 
C 1 100 ILE 100 141 141 ILE ILE C . n 
C 1 101 PRO 101 142 142 PRO PRO C . n 
C 1 102 ILE 102 143 143 ILE ILE C . n 
C 1 103 ASN 103 144 144 ASN ASN C . n 
C 1 104 ALA 104 145 145 ALA ALA C . n 
C 1 105 ARG 105 146 146 ARG ARG C . n 
C 1 106 ARG 106 147 147 ARG ARG C . n 
C 1 107 VAL 107 148 148 VAL VAL C . n 
C 1 108 PRO 108 149 149 PRO PRO C . n 
C 1 109 HIS 109 150 150 HIS HIS C . n 
C 1 110 ILE 110 151 151 ILE ILE C . n 
C 1 111 GLY 111 152 152 GLY GLY C . n 
C 1 112 ASP 112 153 153 ASP ASP C . n 
C 1 113 VAL 113 154 154 VAL VAL C . n 
C 1 114 VAL 114 155 155 VAL VAL C . n 
C 1 115 LEU 115 156 156 LEU LEU C . n 
C 1 116 ALA 116 157 157 ALA ALA C . n 
C 1 117 ILE 117 158 158 ILE ILE C . n 
C 1 118 GLY 118 159 159 GLY GLY C . n 
C 1 119 ASN 119 160 160 ASN ASN C . n 
C 1 120 PRO 120 161 161 PRO PRO C . n 
C 1 121 TYR 121 162 162 TYR TYR C . n 
C 1 122 ASN 122 163 163 ASN ASN C . n 
C 1 123 LEU 123 164 164 LEU LEU C . n 
C 1 124 GLY 124 165 165 GLY GLY C . n 
C 1 125 GLN 125 166 166 GLN GLN C . n 
C 1 126 THR 126 167 167 THR THR C . n 
C 1 127 ILE 127 168 168 ILE ILE C . n 
C 1 128 THR 128 169 169 THR THR C . n 
C 1 129 GLN 129 170 170 GLN GLN C . n 
C 1 130 GLY 130 171 171 GLY GLY C . n 
C 1 131 ILE 131 172 172 ILE ILE C . n 
C 1 132 ILE 132 173 173 ILE ILE C . n 
C 1 133 SER 133 174 174 SER SER C . n 
C 1 134 ALA 134 175 175 ALA ALA C . n 
C 1 135 THR 135 176 176 THR THR C . n 
C 1 136 GLY 136 177 177 GLY GLY C . n 
C 1 137 ARG 137 178 178 ARG ARG C . n 
C 1 138 ILE 138 179 179 ILE ILE C . n 
C 1 139 GLY 139 180 180 GLY GLY C . n 
C 1 140 LEU 140 181 181 LEU LEU C . n 
C 1 141 ASN 141 182 182 ASN ASN C . n 
C 1 142 PRO 142 183 183 PRO PRO C . n 
C 1 143 THR 143 184 184 THR THR C . n 
C 1 144 GLY 144 185 185 GLY GLY C . n 
C 1 145 ARG 145 186 186 ARG ALA C . n 
C 1 146 GLN 146 187 187 GLN ALA C . n 
C 1 147 ASN 147 188 188 ASN ASN C . n 
C 1 148 PHE 148 189 189 PHE PHE C . n 
C 1 149 LEU 149 190 190 LEU LEU C . n 
C 1 150 GLN 150 191 191 GLN GLN C . n 
C 1 151 THR 151 192 192 THR THR C . n 
C 1 152 ASP 152 193 193 ASP ASP C . n 
C 1 153 ALA 153 194 194 ALA ALA C . n 
C 1 154 SER 154 195 195 SER SER C . n 
C 1 155 ILE 155 196 196 ILE ILE C . n 
C 1 156 ASN 156 197 197 ASN ASN C . n 
C 1 157 HIS 157 198 198 HIS HIS C . n 
C 1 158 GLY 158 199 199 GLY GLY C . n 
C 1 159 ASN 159 200 200 ASN ASN C . n 
C 1 160 SER 160 201 201 SER SER C . n 
C 1 161 GLY 161 202 202 GLY GLY C . n 
C 1 162 GLY 162 203 203 GLY GLY C . n 
C 1 163 ALA 163 204 204 ALA ALA C . n 
C 1 164 LEU 164 205 205 LEU LEU C . n 
C 1 165 VAL 165 206 206 VAL VAL C . n 
C 1 166 ASN 166 207 207 ASN ASN C . n 
C 1 167 SER 167 208 208 SER SER C . n 
C 1 168 LEU 168 209 209 LEU LEU C . n 
C 1 169 GLY 169 210 210 GLY GLY C . n 
C 1 170 GLU 170 211 211 GLU GLU C . n 
C 1 171 LEU 171 212 212 LEU LEU C . n 
C 1 172 MET 172 213 213 MET MET C . n 
C 1 173 GLY 173 214 214 GLY GLY C . n 
C 1 174 ILE 174 215 215 ILE ILE C . n 
C 1 175 ASN 175 216 216 ASN ASN C . n 
C 1 176 THR 176 217 217 THR THR C . n 
C 1 177 LEU 177 218 218 LEU LEU C . n 
C 1 178 SER 178 219 219 SER SER C . n 
C 1 179 PHE 179 220 220 PHE PHE C . n 
C 1 180 ASP 180 221 221 ASP ASP C . n 
C 1 181 LYS 181 222 222 LYS LYS C . n 
C 1 182 SER 182 223 223 SER SER C . n 
C 1 183 ASN 183 224 224 ASN ASN C . n 
C 1 184 ASP 184 225 225 ASP ASP C . n 
C 1 185 GLY 185 226 226 GLY GLY C . n 
C 1 186 GLU 186 227 227 GLU GLU C . n 
C 1 187 THR 187 228 228 THR THR C . n 
C 1 188 PRO 188 229 229 PRO PRO C . n 
C 1 189 GLU 189 230 230 GLU GLU C . n 
C 1 190 GLY 190 231 231 GLY GLY C . n 
C 1 191 ILE 191 232 232 ILE ILE C . n 
C 1 192 GLY 192 233 233 GLY GLY C . n 
C 1 193 PHE 193 234 234 PHE PHE C . n 
C 1 194 ALA 194 235 235 ALA ALA C . n 
C 1 195 ILE 195 236 236 ILE ILE C . n 
C 1 196 PRO 196 237 237 PRO PRO C . n 
C 1 197 PHE 197 238 238 PHE PHE C . n 
C 1 198 GLN 198 239 239 GLN GLN C . n 
C 1 199 LEU 199 240 240 LEU LEU C . n 
C 1 200 ALA 200 241 241 ALA ALA C . n 
C 1 201 THR 201 242 242 THR THR C . n 
C 1 202 LYS 202 243 243 LYS LYS C . n 
C 1 203 ILE 203 244 244 ILE ILE C . n 
C 1 204 MET 204 245 245 MET MET C . n 
C 1 205 ASP 205 246 246 ASP ASP C . n 
C 1 206 LYS 206 247 247 LYS LYS C . n 
C 1 207 LEU 207 248 248 LEU LEU C . n 
C 1 208 ILE 208 249 249 ILE ILE C . n 
C 1 209 ARG 209 250 250 ARG ARG C . n 
C 1 210 ASP 210 251 251 ASP ASP C . n 
C 1 211 GLY 211 252 252 GLY GLY C . n 
C 1 212 ARG 212 253 253 ARG ARG C . n 
C 1 213 VAL 213 254 254 VAL VAL C . n 
C 1 214 ILE 214 255 255 ILE ILE C . n 
C 1 215 ARG 215 256 256 ARG ARG C . n 
C 1 216 GLY 216 257 257 GLY GLY C . n 
C 1 217 TYR 217 258 ?   ?   ?   C . n 
C 1 218 ILE 218 259 ?   ?   ?   C . n 
C 1 219 GLY 219 260 ?   ?   ?   C . n 
C 1 220 ILE 220 261 ?   ?   ?   C . n 
C 1 221 GLY 221 262 ?   ?   ?   C . n 
C 1 222 GLY 222 263 ?   ?   ?   C . n 
C 1 223 ARG 223 264 ?   ?   ?   C . n 
C 1 224 GLU 224 265 ?   ?   ?   C . n 
C 1 225 ILE 225 266 ?   ?   ?   C . n 
C 1 226 ALA 226 267 ?   ?   ?   C . n 
C 1 227 PRO 227 268 ?   ?   ?   C . n 
C 1 228 LEU 228 269 ?   ?   ?   C . n 
C 1 229 HIS 229 270 ?   ?   ?   C . n 
C 1 230 ALA 230 271 ?   ?   ?   C . n 
C 1 231 GLN 231 272 ?   ?   ?   C . n 
C 1 232 GLY 232 273 ?   ?   ?   C . n 
C 1 233 GLY 233 274 ?   ?   ?   C . n 
C 1 234 GLY 234 275 ?   ?   ?   C . n 
C 1 235 ILE 235 276 ?   ?   ?   C . n 
C 1 236 ASP 236 277 ?   ?   ?   C . n 
C 1 237 GLN 237 278 ?   ?   ?   C . n 
C 1 238 LEU 238 279 ?   ?   ?   C . n 
C 1 239 GLN 239 280 ?   ?   ?   C . n 
C 1 240 GLY 240 281 281 GLY GLY C . n 
C 1 241 ILE 241 282 282 ILE ALA C . n 
C 1 242 VAL 242 283 283 VAL ALA C . n 
C 1 243 VAL 243 284 284 VAL VAL C . n 
C 1 244 ASN 244 285 285 ASN ASN C . n 
C 1 245 GLU 245 286 ?   ?   ?   C . n 
C 1 246 VAL 246 287 ?   ?   ?   C . n 
C 1 247 SER 247 288 ?   ?   ?   C . n 
C 1 248 PRO 248 289 ?   ?   ?   C . n 
C 1 249 ASP 249 290 ?   ?   ?   C . n 
C 1 250 GLY 250 291 ?   ?   ?   C . n 
C 1 251 PRO 251 292 ?   ?   ?   C . n 
C 1 252 ALA 252 293 ?   ?   ?   C . n 
C 1 253 ALA 253 294 ?   ?   ?   C . n 
C 1 254 ASN 254 295 ?   ?   ?   C . n 
C 1 255 ALA 255 296 ?   ?   ?   C . n 
C 1 256 GLY 256 297 ?   ?   ?   C . n 
C 1 257 ILE 257 298 ?   ?   ?   C . n 
C 1 258 GLN 258 299 ?   ?   ?   C . n 
C 1 259 VAL 259 300 ?   ?   ?   C . n 
C 1 260 ASN 260 301 ?   ?   ?   C . n 
C 1 261 ASP 261 302 302 ASP ASP C . n 
C 1 262 LEU 262 303 303 LEU ALA C . n 
C 1 263 ILE 263 304 304 ILE ALA C . n 
C 1 264 ILE 264 305 305 ILE ALA C . n 
C 1 265 SER 265 306 306 SER ALA C . n 
C 1 266 VAL 266 307 307 VAL VAL C . n 
C 1 267 ASP 267 308 308 ASP ASP C . n 
C 1 268 ASN 268 309 309 ASN ASN C . n 
C 1 269 LYS 269 310 310 LYS LYS C . n 
C 1 270 PRO 270 311 311 PRO PRO C . n 
C 1 271 ALA 271 312 312 ALA ALA C . n 
C 1 272 ILE 272 313 ?   ?   ?   C . n 
C 1 273 SER 273 314 ?   ?   ?   C . n 
C 1 274 ALA 274 315 ?   ?   ?   C . n 
C 1 275 LEU 275 316 ?   ?   ?   C . n 
C 1 276 GLU 276 317 ?   ?   ?   C . n 
C 1 277 THR 277 318 318 THR THR C . n 
C 1 278 MET 278 319 319 MET MET C . n 
C 1 279 ASP 279 320 320 ASP ASP C . n 
C 1 280 GLN 280 321 321 GLN GLN C . n 
C 1 281 VAL 281 322 322 VAL VAL C . n 
C 1 282 ALA 282 323 323 ALA ALA C . n 
C 1 283 GLU 283 324 324 GLU GLU C . n 
C 1 284 ILE 284 325 325 ILE ILE C . n 
C 1 285 ARG 285 326 326 ARG ARG C . n 
C 1 286 PRO 286 327 327 PRO PRO C . n 
C 1 287 GLY 287 328 328 GLY GLY C . n 
C 1 288 SER 288 329 329 SER SER C . n 
C 1 289 VAL 289 330 330 VAL VAL C . n 
C 1 290 ILE 290 331 331 ILE ALA C . n 
C 1 291 PRO 291 332 332 PRO PRO C . n 
C 1 292 VAL 292 333 ?   ?   ?   C . n 
C 1 293 VAL 293 334 ?   ?   ?   C . n 
C 1 294 VAL 294 335 ?   ?   ?   C . n 
C 1 295 MET 295 336 ?   ?   ?   C . n 
C 1 296 ARG 296 337 ?   ?   ?   C . n 
C 1 297 ASP 297 338 ?   ?   ?   C . n 
C 1 298 ASP 298 339 ?   ?   ?   C . n 
C 1 299 LYS 299 340 ?   ?   ?   C . n 
C 1 300 GLN 300 341 ?   ?   ?   C . n 
C 1 301 LEU 301 342 ?   ?   ?   C . n 
C 1 302 THR 302 343 ?   ?   ?   C . n 
C 1 303 LEU 303 344 344 LEU ALA C . n 
C 1 304 GLN 304 345 345 GLN GLN C . n 
C 1 305 VAL 305 346 346 VAL VAL C . n 
C 1 306 THR 306 347 347 THR THR C . n 
C 1 307 ILE 307 348 348 ILE ALA C . n 
C 1 308 GLN 308 349 349 GLN GLN C . n 
C 1 309 GLU 309 350 350 GLU GLU C . n 
C 1 310 TYR 310 351 351 TYR TYR C . n 
C 1 311 PRO 311 352 352 PRO PRO C . n 
C 1 312 ALA 312 353 353 ALA ALA C . n 
C 1 313 THR 313 354 ?   ?   ?   C . n 
C 1 314 ASN 314 355 ?   ?   ?   C . n 
D 2 1   ASP 1   401 ?   ?   ?   D . n 
D 2 2   ASN 2   402 ?   ?   ?   D . n 
D 2 3   ARG 3   403 ?   ?   ?   D . n 
D 2 4   LEU 4   404 ?   ?   ?   D . n 
D 2 5   GLY 5   405 ?   ?   ?   D . n 
D 2 6   LEU 6   406 ?   ?   ?   D . n 
D 2 7   VAL 7   407 407 VAL VAL D . n 
D 2 8   TYR 8   408 408 TYR TYR D . n 
D 2 9   GLN 9   409 409 GLN GLN D . n 
D 2 10  PHE 10  410 410 PHE PHE D . n 
E 2 1   ASP 1   401 ?   ?   ?   E . n 
E 2 2   ASN 2   402 ?   ?   ?   E . n 
E 2 3   ARG 3   403 ?   ?   ?   E . n 
E 2 4   LEU 4   404 ?   ?   ?   E . n 
E 2 5   GLY 5   405 ?   ?   ?   E . n 
E 2 6   LEU 6   406 ?   ?   ?   E . n 
E 2 7   VAL 7   407 407 VAL VAL E . n 
E 2 8   TYR 8   408 408 TYR TYR E . n 
E 2 9   GLN 9   409 409 GLN GLN E . n 
E 2 10  PHE 10  410 410 PHE PHE E . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   pentameric 
_pdbx_struct_assembly.oligomeric_count     5 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 8180  ? 
1 MORE         -38   ? 
1 'SSA (A^2)'  37420 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-06-08 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
AMoRE     phasing          .   ? 3 
CNS       refinement       1.0 ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 67  ? ? -117.74 53.38   
2  1 ALA A 145 ? ? -54.23  -9.72   
3  1 ASN A 160 ? ? -116.63 57.46   
4  1 TYR A 162 ? ? 48.34   20.88   
5  1 ILE A 179 ? ? 100.38  120.45  
6  1 ASN A 182 ? ? -115.92 63.00   
7  1 THR A 184 ? ? -156.84 -65.77  
8  1 GLN A 187 ? ? -166.60 109.64  
9  1 LEU A 218 ? ? 168.00  148.20  
10 1 PHE A 220 ? ? -41.60  107.43  
11 1 LYS A 222 ? ? 59.63   172.88  
12 1 ASN A 224 ? ? -150.07 -132.83 
13 1 GLU A 227 ? ? 176.89  157.20  
14 1 ARG A 256 ? ? -112.26 -157.55 
15 1 ASN A 285 ? ? -89.07  -142.44 
16 1 ALA A 296 ? ? -156.99 -25.79  
17 1 VAL A 300 ? ? -150.59 -16.95  
18 1 ASN A 301 ? ? -173.51 66.50   
19 1 ILE A 305 ? ? -70.04  -83.74  
20 1 PRO A 311 ? ? -39.02  124.06  
21 1 ARG A 326 ? ? 76.97   95.53   
22 1 SER A 329 ? ? -163.77 111.25  
23 1 GLN A 345 ? ? -112.22 74.94   
24 1 TYR A 351 ? ? -49.69  154.47  
25 1 ASN B 67  ? ? 5.60    81.70   
26 1 SER B 70  ? ? -173.30 -44.18  
27 1 GLN B 73  ? ? -173.86 132.68  
28 1 ASN B 160 ? ? -117.93 71.28   
29 1 TYR B 162 ? ? 48.67   23.33   
30 1 ILE B 179 ? ? 82.42   65.60   
31 1 ASN B 182 ? ? -170.25 50.58   
32 1 THR B 184 ? ? -121.78 -79.89  
33 1 ARG B 186 ? ? -43.96  152.62  
34 1 THR B 217 ? ? -112.74 -137.43 
35 1 LYS B 222 ? ? 32.60   79.45   
36 1 SER B 223 ? ? -35.39  -79.73  
37 1 ASN B 224 ? ? -129.87 -86.89  
38 1 ILE B 261 ? ? -165.53 79.12   
39 1 ALA B 296 ? ? -163.32 70.26   
40 1 GLN B 299 ? ? -95.33  -144.71 
41 1 VAL B 300 ? ? -109.62 -82.75  
42 1 ASN B 301 ? ? -101.83 52.87   
43 1 ILE B 304 ? ? -161.80 95.83   
44 1 ALA B 312 ? ? -107.72 53.46   
45 1 ILE B 313 ? ? 30.33   -77.22  
46 1 SER B 314 ? ? -83.88  -147.60 
47 1 THR C 68  ? ? -107.09 49.95   
48 1 SER C 70  ? ? 167.57  -50.82  
49 1 HIS C 71  ? ? 173.23  20.31   
50 1 ASN C 72  ? ? -59.69  108.96  
51 1 TYR C 162 ? ? 39.60   36.90   
52 1 THR C 184 ? ? 93.48   89.87   
53 1 GLN C 187 ? ? 178.85  149.90  
54 1 THR C 217 ? ? -104.48 -91.06  
55 1 PHE C 220 ? ? -15.64  85.89   
56 1 ASP C 221 ? ? -27.44  -108.53 
57 1 ASN C 224 ? ? -93.23  -70.76  
58 1 ARG C 253 ? ? 179.35  -178.07 
59 1 ASP C 308 ? ? 40.24   -93.40  
60 1 ASN C 309 ? ? -143.72 41.90   
61 1 PRO C 311 ? ? -37.12  153.05  
62 1 MET C 319 ? ? -67.07  5.33    
63 1 ILE C 325 ? ? -98.37  -83.07  
64 1 ARG C 326 ? ? 149.98  108.13  
65 1 PRO C 327 ? ? -38.00  129.62  
66 1 GLU C 350 ? ? -25.38  155.77  
67 1 TYR D 408 ? ? 169.80  163.50  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A ARG 264 ? CG  ? A ARG 223 CG  
2   1 Y 1 A ARG 264 ? CD  ? A ARG 223 CD  
3   1 Y 1 A ARG 264 ? NE  ? A ARG 223 NE  
4   1 Y 1 A ARG 264 ? CZ  ? A ARG 223 CZ  
5   1 Y 1 A ARG 264 ? NH1 ? A ARG 223 NH1 
6   1 Y 1 A ARG 264 ? NH2 ? A ARG 223 NH2 
7   1 Y 1 A ILE 282 ? CG1 ? A ILE 241 CG1 
8   1 Y 1 A ILE 282 ? CG2 ? A ILE 241 CG2 
9   1 Y 1 A ILE 282 ? CD1 ? A ILE 241 CD1 
10  1 Y 1 A VAL 287 ? CG1 ? A VAL 246 CG1 
11  1 Y 1 A VAL 287 ? CG2 ? A VAL 246 CG2 
12  1 Y 1 A SER 288 ? OG  ? A SER 247 OG  
13  1 Y 1 A ASP 290 ? CG  ? A ASP 249 CG  
14  1 Y 1 A ASP 290 ? OD1 ? A ASP 249 OD1 
15  1 Y 1 A ASP 290 ? OD2 ? A ASP 249 OD2 
16  1 Y 1 A ASN 295 ? CG  ? A ASN 254 CG  
17  1 Y 1 A ASN 295 ? OD1 ? A ASN 254 OD1 
18  1 Y 1 A ASN 295 ? ND2 ? A ASN 254 ND2 
19  1 Y 1 A ILE 298 ? CG1 ? A ILE 257 CG1 
20  1 Y 1 A ILE 298 ? CG2 ? A ILE 257 CG2 
21  1 Y 1 A ILE 298 ? CD1 ? A ILE 257 CD1 
22  1 Y 1 A GLN 299 ? CG  ? A GLN 258 CG  
23  1 Y 1 A GLN 299 ? CD  ? A GLN 258 CD  
24  1 Y 1 A GLN 299 ? OE1 ? A GLN 258 OE1 
25  1 Y 1 A GLN 299 ? NE2 ? A GLN 258 NE2 
26  1 Y 1 A ASN 301 ? CG  ? A ASN 260 CG  
27  1 Y 1 A ASN 301 ? OD1 ? A ASN 260 OD1 
28  1 Y 1 A ASN 301 ? ND2 ? A ASN 260 ND2 
29  1 Y 1 A LEU 303 ? CG  ? A LEU 262 CG  
30  1 Y 1 A LEU 303 ? CD1 ? A LEU 262 CD1 
31  1 Y 1 A LEU 303 ? CD2 ? A LEU 262 CD2 
32  1 Y 1 A ILE 305 ? CG1 ? A ILE 264 CG1 
33  1 Y 1 A ILE 305 ? CG2 ? A ILE 264 CG2 
34  1 Y 1 A ILE 305 ? CD1 ? A ILE 264 CD1 
35  1 Y 1 A GLN 321 ? CG  ? A GLN 280 CG  
36  1 Y 1 A GLN 321 ? CD  ? A GLN 280 CD  
37  1 Y 1 A GLN 321 ? OE1 ? A GLN 280 OE1 
38  1 Y 1 A GLN 321 ? NE2 ? A GLN 280 NE2 
39  1 Y 1 A VAL 330 ? CG1 ? A VAL 289 CG1 
40  1 Y 1 A VAL 330 ? CG2 ? A VAL 289 CG2 
41  1 Y 1 A VAL 335 ? CG1 ? A VAL 294 CG1 
42  1 Y 1 A VAL 335 ? CG2 ? A VAL 294 CG2 
43  1 Y 1 A LEU 344 ? CG  ? A LEU 303 CG  
44  1 Y 1 A LEU 344 ? CD1 ? A LEU 303 CD1 
45  1 Y 1 A LEU 344 ? CD2 ? A LEU 303 CD2 
46  1 Y 1 A GLN 345 ? CG  ? A GLN 304 CG  
47  1 Y 1 A GLN 345 ? CD  ? A GLN 304 CD  
48  1 Y 1 A GLN 345 ? OE1 ? A GLN 304 OE1 
49  1 Y 1 A GLN 345 ? NE2 ? A GLN 304 NE2 
50  1 Y 1 A GLN 349 ? CG  ? A GLN 308 CG  
51  1 Y 1 A GLN 349 ? CD  ? A GLN 308 CD  
52  1 Y 1 A GLN 349 ? OE1 ? A GLN 308 OE1 
53  1 Y 1 A GLN 349 ? NE2 ? A GLN 308 NE2 
54  1 Y 1 A GLU 350 ? CG  ? A GLU 309 CG  
55  1 Y 1 A GLU 350 ? CD  ? A GLU 309 CD  
56  1 Y 1 A GLU 350 ? OE1 ? A GLU 309 OE1 
57  1 Y 1 A GLU 350 ? OE2 ? A GLU 309 OE2 
58  1 Y 1 B ASN 67  ? CG  ? B ASN 26  CG  
59  1 Y 1 B ASN 67  ? OD1 ? B ASN 26  OD1 
60  1 Y 1 B ASN 67  ? ND2 ? B ASN 26  ND2 
61  1 Y 1 B THR 68  ? OG1 ? B THR 27  OG1 
62  1 Y 1 B THR 68  ? CG2 ? B THR 27  CG2 
63  1 Y 1 B ASN 69  ? CG  ? B ASN 28  CG  
64  1 Y 1 B ASN 69  ? OD1 ? B ASN 28  OD1 
65  1 Y 1 B ASN 69  ? ND2 ? B ASN 28  ND2 
66  1 Y 1 B SER 70  ? OG  ? B SER 29  OG  
67  1 Y 1 B HIS 71  ? CG  ? B HIS 30  CG  
68  1 Y 1 B HIS 71  ? ND1 ? B HIS 30  ND1 
69  1 Y 1 B HIS 71  ? CD2 ? B HIS 30  CD2 
70  1 Y 1 B HIS 71  ? CE1 ? B HIS 30  CE1 
71  1 Y 1 B HIS 71  ? NE2 ? B HIS 30  NE2 
72  1 Y 1 B ASN 72  ? CG  ? B ASN 31  CG  
73  1 Y 1 B ASN 72  ? OD1 ? B ASN 31  OD1 
74  1 Y 1 B ASN 72  ? ND2 ? B ASN 31  ND2 
75  1 Y 1 B ARG 264 ? CG  ? B ARG 223 CG  
76  1 Y 1 B ARG 264 ? CD  ? B ARG 223 CD  
77  1 Y 1 B ARG 264 ? NE  ? B ARG 223 NE  
78  1 Y 1 B ARG 264 ? CZ  ? B ARG 223 CZ  
79  1 Y 1 B ARG 264 ? NH1 ? B ARG 223 NH1 
80  1 Y 1 B ARG 264 ? NH2 ? B ARG 223 NH2 
81  1 Y 1 B ILE 282 ? CG1 ? B ILE 241 CG1 
82  1 Y 1 B ILE 282 ? CG2 ? B ILE 241 CG2 
83  1 Y 1 B ILE 282 ? CD1 ? B ILE 241 CD1 
84  1 Y 1 B VAL 283 ? CG1 ? B VAL 242 CG1 
85  1 Y 1 B VAL 283 ? CG2 ? B VAL 242 CG2 
86  1 Y 1 B VAL 284 ? CG1 ? B VAL 243 CG1 
87  1 Y 1 B VAL 284 ? CG2 ? B VAL 243 CG2 
88  1 Y 1 B ILE 298 ? CG1 ? B ILE 257 CG1 
89  1 Y 1 B ILE 298 ? CG2 ? B ILE 257 CG2 
90  1 Y 1 B ILE 298 ? CD1 ? B ILE 257 CD1 
91  1 Y 1 B GLN 299 ? CG  ? B GLN 258 CG  
92  1 Y 1 B GLN 299 ? CD  ? B GLN 258 CD  
93  1 Y 1 B GLN 299 ? OE1 ? B GLN 258 OE1 
94  1 Y 1 B GLN 299 ? NE2 ? B GLN 258 NE2 
95  1 Y 1 B LEU 303 ? CG  ? B LEU 262 CG  
96  1 Y 1 B LEU 303 ? CD1 ? B LEU 262 CD1 
97  1 Y 1 B LEU 303 ? CD2 ? B LEU 262 CD2 
98  1 Y 1 B LEU 344 ? CG  ? B LEU 303 CG  
99  1 Y 1 B LEU 344 ? CD1 ? B LEU 303 CD1 
100 1 Y 1 B LEU 344 ? CD2 ? B LEU 303 CD2 
101 1 Y 1 B GLN 345 ? CG  ? B GLN 304 CG  
102 1 Y 1 B GLN 345 ? CD  ? B GLN 304 CD  
103 1 Y 1 B GLN 345 ? OE1 ? B GLN 304 OE1 
104 1 Y 1 B GLN 345 ? NE2 ? B GLN 304 NE2 
105 1 Y 1 C GLU 75  ? CG  ? C GLU 34  CG  
106 1 Y 1 C GLU 75  ? CD  ? C GLU 34  CD  
107 1 Y 1 C GLU 75  ? OE1 ? C GLU 34  OE1 
108 1 Y 1 C GLU 75  ? OE2 ? C GLU 34  OE2 
109 1 Y 1 C ARG 186 ? CG  ? C ARG 145 CG  
110 1 Y 1 C ARG 186 ? CD  ? C ARG 145 CD  
111 1 Y 1 C ARG 186 ? NE  ? C ARG 145 NE  
112 1 Y 1 C ARG 186 ? CZ  ? C ARG 145 CZ  
113 1 Y 1 C ARG 186 ? NH1 ? C ARG 145 NH1 
114 1 Y 1 C ARG 186 ? NH2 ? C ARG 145 NH2 
115 1 Y 1 C GLN 187 ? CG  ? C GLN 146 CG  
116 1 Y 1 C GLN 187 ? CD  ? C GLN 146 CD  
117 1 Y 1 C GLN 187 ? OE1 ? C GLN 146 OE1 
118 1 Y 1 C GLN 187 ? NE2 ? C GLN 146 NE2 
119 1 Y 1 C ILE 282 ? CG1 ? C ILE 241 CG1 
120 1 Y 1 C ILE 282 ? CG2 ? C ILE 241 CG2 
121 1 Y 1 C ILE 282 ? CD1 ? C ILE 241 CD1 
122 1 Y 1 C VAL 283 ? CG1 ? C VAL 242 CG1 
123 1 Y 1 C VAL 283 ? CG2 ? C VAL 242 CG2 
124 1 Y 1 C LEU 303 ? CG  ? C LEU 262 CG  
125 1 Y 1 C LEU 303 ? CD1 ? C LEU 262 CD1 
126 1 Y 1 C LEU 303 ? CD2 ? C LEU 262 CD2 
127 1 Y 1 C ILE 304 ? CG1 ? C ILE 263 CG1 
128 1 Y 1 C ILE 304 ? CG2 ? C ILE 263 CG2 
129 1 Y 1 C ILE 304 ? CD1 ? C ILE 263 CD1 
130 1 Y 1 C ILE 305 ? CG1 ? C ILE 264 CG1 
131 1 Y 1 C ILE 305 ? CG2 ? C ILE 264 CG2 
132 1 Y 1 C ILE 305 ? CD1 ? C ILE 264 CD1 
133 1 Y 1 C SER 306 ? OG  ? C SER 265 OG  
134 1 Y 1 C ILE 331 ? CG1 ? C ILE 290 CG1 
135 1 Y 1 C ILE 331 ? CG2 ? C ILE 290 CG2 
136 1 Y 1 C ILE 331 ? CD1 ? C ILE 290 CD1 
137 1 Y 1 C LEU 344 ? CG  ? C LEU 303 CG  
138 1 Y 1 C LEU 344 ? CD1 ? C LEU 303 CD1 
139 1 Y 1 C LEU 344 ? CD2 ? C LEU 303 CD2 
140 1 Y 1 C ILE 348 ? CG1 ? C ILE 307 CG1 
141 1 Y 1 C ILE 348 ? CG2 ? C ILE 307 CG2 
142 1 Y 1 C ILE 348 ? CD1 ? C ILE 307 CD1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 0 A LEU 205 ? A LEU 164 
2   1 Y 1 A GLU 265 ? A GLU 224 
3   1 Y 1 A ILE 266 ? A ILE 225 
4   1 Y 1 A ALA 267 ? A ALA 226 
5   1 Y 1 A PRO 268 ? A PRO 227 
6   1 Y 1 A LEU 269 ? A LEU 228 
7   1 Y 1 A HIS 270 ? A HIS 229 
8   1 Y 1 A ALA 271 ? A ALA 230 
9   1 Y 1 A GLN 272 ? A GLN 231 
10  1 Y 1 A GLY 273 ? A GLY 232 
11  1 Y 1 A GLY 274 ? A GLY 233 
12  1 Y 1 A GLY 275 ? A GLY 234 
13  1 Y 1 A ILE 276 ? A ILE 235 
14  1 Y 1 A ASP 277 ? A ASP 236 
15  1 Y 1 A GLN 278 ? A GLN 237 
16  1 Y 1 A LEU 279 ? A LEU 238 
17  1 Y 1 A GLN 280 ? A GLN 239 
18  1 Y 1 A GLY 281 ? A GLY 240 
19  1 Y 1 A ILE 313 ? A ILE 272 
20  1 Y 1 A SER 314 ? A SER 273 
21  1 Y 1 A ALA 315 ? A ALA 274 
22  1 Y 1 A LEU 316 ? A LEU 275 
23  1 Y 1 A GLU 317 ? A GLU 276 
24  1 Y 1 A MET 336 ? A MET 295 
25  1 Y 1 A ARG 337 ? A ARG 296 
26  1 Y 1 A ASP 338 ? A ASP 297 
27  1 Y 1 A ASP 339 ? A ASP 298 
28  1 Y 1 A LYS 340 ? A LYS 299 
29  1 Y 1 A GLN 341 ? A GLN 300 
30  1 Y 1 A LEU 342 ? A LEU 301 
31  1 Y 1 A THR 343 ? A THR 302 
32  1 Y 1 A ALA 353 ? A ALA 312 
33  1 Y 1 A THR 354 ? A THR 313 
34  1 Y 1 A ASN 355 ? A ASN 314 
35  1 Y 0 B LEU 205 ? B LEU 164 
36  1 Y 1 B GLU 265 ? B GLU 224 
37  1 Y 1 B ILE 266 ? B ILE 225 
38  1 Y 1 B ALA 267 ? B ALA 226 
39  1 Y 1 B PRO 268 ? B PRO 227 
40  1 Y 1 B LEU 269 ? B LEU 228 
41  1 Y 1 B HIS 270 ? B HIS 229 
42  1 Y 1 B ALA 271 ? B ALA 230 
43  1 Y 1 B GLN 272 ? B GLN 231 
44  1 Y 1 B GLY 273 ? B GLY 232 
45  1 Y 1 B GLY 274 ? B GLY 233 
46  1 Y 1 B GLY 275 ? B GLY 234 
47  1 Y 1 B ILE 276 ? B ILE 235 
48  1 Y 1 B ASP 277 ? B ASP 236 
49  1 Y 1 B GLN 278 ? B GLN 237 
50  1 Y 1 B LEU 279 ? B LEU 238 
51  1 Y 1 B GLN 280 ? B GLN 239 
52  1 Y 1 B GLY 281 ? B GLY 240 
53  1 Y 1 B VAL 287 ? B VAL 246 
54  1 Y 1 B SER 288 ? B SER 247 
55  1 Y 1 B PRO 289 ? B PRO 248 
56  1 Y 1 B ASP 290 ? B ASP 249 
57  1 Y 1 B VAL 334 ? B VAL 293 
58  1 Y 1 B VAL 335 ? B VAL 294 
59  1 Y 1 B MET 336 ? B MET 295 
60  1 Y 1 B ARG 337 ? B ARG 296 
61  1 Y 1 B ASP 338 ? B ASP 297 
62  1 Y 1 B ASP 339 ? B ASP 298 
63  1 Y 1 B LYS 340 ? B LYS 299 
64  1 Y 1 B GLN 341 ? B GLN 300 
65  1 Y 1 B LEU 342 ? B LEU 301 
66  1 Y 1 B THR 343 ? B THR 302 
67  1 Y 1 B THR 354 ? B THR 313 
68  1 Y 1 B ASN 355 ? B ASN 314 
69  1 Y 0 C LEU 205 ? C LEU 164 
70  1 Y 1 C TYR 258 ? C TYR 217 
71  1 Y 1 C ILE 259 ? C ILE 218 
72  1 Y 1 C GLY 260 ? C GLY 219 
73  1 Y 1 C ILE 261 ? C ILE 220 
74  1 Y 1 C GLY 262 ? C GLY 221 
75  1 Y 1 C GLY 263 ? C GLY 222 
76  1 Y 1 C ARG 264 ? C ARG 223 
77  1 Y 1 C GLU 265 ? C GLU 224 
78  1 Y 1 C ILE 266 ? C ILE 225 
79  1 Y 1 C ALA 267 ? C ALA 226 
80  1 Y 1 C PRO 268 ? C PRO 227 
81  1 Y 1 C LEU 269 ? C LEU 228 
82  1 Y 1 C HIS 270 ? C HIS 229 
83  1 Y 1 C ALA 271 ? C ALA 230 
84  1 Y 1 C GLN 272 ? C GLN 231 
85  1 Y 1 C GLY 273 ? C GLY 232 
86  1 Y 1 C GLY 274 ? C GLY 233 
87  1 Y 1 C GLY 275 ? C GLY 234 
88  1 Y 1 C ILE 276 ? C ILE 235 
89  1 Y 1 C ASP 277 ? C ASP 236 
90  1 Y 1 C GLN 278 ? C GLN 237 
91  1 Y 1 C LEU 279 ? C LEU 238 
92  1 Y 1 C GLN 280 ? C GLN 239 
93  1 Y 1 C GLU 286 ? C GLU 245 
94  1 Y 1 C VAL 287 ? C VAL 246 
95  1 Y 1 C SER 288 ? C SER 247 
96  1 Y 1 C PRO 289 ? C PRO 248 
97  1 Y 1 C ASP 290 ? C ASP 249 
98  1 Y 1 C GLY 291 ? C GLY 250 
99  1 Y 1 C PRO 292 ? C PRO 251 
100 1 Y 1 C ALA 293 ? C ALA 252 
101 1 Y 1 C ALA 294 ? C ALA 253 
102 1 Y 1 C ASN 295 ? C ASN 254 
103 1 Y 1 C ALA 296 ? C ALA 255 
104 1 Y 1 C GLY 297 ? C GLY 256 
105 1 Y 1 C ILE 298 ? C ILE 257 
106 1 Y 1 C GLN 299 ? C GLN 258 
107 1 Y 1 C VAL 300 ? C VAL 259 
108 1 Y 1 C ASN 301 ? C ASN 260 
109 1 Y 1 C ILE 313 ? C ILE 272 
110 1 Y 1 C SER 314 ? C SER 273 
111 1 Y 1 C ALA 315 ? C ALA 274 
112 1 Y 1 C LEU 316 ? C LEU 275 
113 1 Y 1 C GLU 317 ? C GLU 276 
114 1 Y 1 C VAL 333 ? C VAL 292 
115 1 Y 1 C VAL 334 ? C VAL 293 
116 1 Y 1 C VAL 335 ? C VAL 294 
117 1 Y 1 C MET 336 ? C MET 295 
118 1 Y 1 C ARG 337 ? C ARG 296 
119 1 Y 1 C ASP 338 ? C ASP 297 
120 1 Y 1 C ASP 339 ? C ASP 298 
121 1 Y 1 C LYS 340 ? C LYS 299 
122 1 Y 1 C GLN 341 ? C GLN 300 
123 1 Y 1 C LEU 342 ? C LEU 301 
124 1 Y 1 C THR 343 ? C THR 302 
125 1 Y 1 C THR 354 ? C THR 313 
126 1 Y 1 C ASN 355 ? C ASN 314 
127 1 Y 1 D ASP 401 ? D ASP 1   
128 1 Y 1 D ASN 402 ? D ASN 2   
129 1 Y 1 D ARG 403 ? D ARG 3   
130 1 Y 1 D LEU 404 ? D LEU 4   
131 1 Y 1 D GLY 405 ? D GLY 5   
132 1 Y 1 D LEU 406 ? D LEU 6   
133 1 Y 1 E ASP 401 ? E ASP 1   
134 1 Y 1 E ASN 402 ? E ASN 2   
135 1 Y 1 E ARG 403 ? E ARG 3   
136 1 Y 1 E LEU 404 ? E LEU 4   
137 1 Y 1 E GLY 405 ? E GLY 5   
138 1 Y 1 E LEU 406 ? E LEU 6   
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 3 HOH 1   356 1   HOH WAT A . 
F 3 HOH 2   357 3   HOH WAT A . 
F 3 HOH 3   358 5   HOH WAT A . 
F 3 HOH 4   359 6   HOH WAT A . 
F 3 HOH 5   360 7   HOH WAT A . 
F 3 HOH 6   361 9   HOH WAT A . 
F 3 HOH 7   362 10  HOH WAT A . 
F 3 HOH 8   363 12  HOH WAT A . 
F 3 HOH 9   364 13  HOH WAT A . 
F 3 HOH 10  365 14  HOH WAT A . 
F 3 HOH 11  366 15  HOH WAT A . 
F 3 HOH 12  367 17  HOH WAT A . 
F 3 HOH 13  368 18  HOH WAT A . 
F 3 HOH 14  369 21  HOH WAT A . 
F 3 HOH 15  370 23  HOH WAT A . 
F 3 HOH 16  371 30  HOH WAT A . 
F 3 HOH 17  372 31  HOH WAT A . 
F 3 HOH 18  373 33  HOH WAT A . 
F 3 HOH 19  374 40  HOH WAT A . 
F 3 HOH 20  375 42  HOH WAT A . 
F 3 HOH 21  376 43  HOH WAT A . 
F 3 HOH 22  377 44  HOH WAT A . 
F 3 HOH 23  378 45  HOH WAT A . 
F 3 HOH 24  379 46  HOH WAT A . 
F 3 HOH 25  380 47  HOH WAT A . 
F 3 HOH 26  381 49  HOH WAT A . 
F 3 HOH 27  382 51  HOH WAT A . 
F 3 HOH 28  383 52  HOH WAT A . 
F 3 HOH 29  384 53  HOH WAT A . 
F 3 HOH 30  385 54  HOH WAT A . 
F 3 HOH 31  386 61  HOH WAT A . 
F 3 HOH 32  387 63  HOH WAT A . 
F 3 HOH 33  388 64  HOH WAT A . 
F 3 HOH 34  389 67  HOH WAT A . 
F 3 HOH 35  390 68  HOH WAT A . 
F 3 HOH 36  391 73  HOH WAT A . 
F 3 HOH 37  392 74  HOH WAT A . 
F 3 HOH 38  393 75  HOH WAT A . 
F 3 HOH 39  394 77  HOH WAT A . 
F 3 HOH 40  395 78  HOH WAT A . 
F 3 HOH 41  396 79  HOH WAT A . 
F 3 HOH 42  397 80  HOH WAT A . 
F 3 HOH 43  398 83  HOH WAT A . 
F 3 HOH 44  399 85  HOH WAT A . 
F 3 HOH 45  400 87  HOH WAT A . 
F 3 HOH 46  401 92  HOH WAT A . 
F 3 HOH 47  402 93  HOH WAT A . 
F 3 HOH 48  403 94  HOH WAT A . 
F 3 HOH 49  404 96  HOH WAT A . 
F 3 HOH 50  405 97  HOH WAT A . 
F 3 HOH 51  406 99  HOH WAT A . 
F 3 HOH 52  407 100 HOH WAT A . 
F 3 HOH 53  408 103 HOH WAT A . 
F 3 HOH 54  409 104 HOH WAT A . 
F 3 HOH 55  410 106 HOH WAT A . 
F 3 HOH 56  411 108 HOH WAT A . 
F 3 HOH 57  412 109 HOH WAT A . 
F 3 HOH 58  413 111 HOH WAT A . 
F 3 HOH 59  414 112 HOH WAT A . 
F 3 HOH 60  415 115 HOH WAT A . 
F 3 HOH 61  416 117 HOH WAT A . 
F 3 HOH 62  417 118 HOH WAT A . 
F 3 HOH 63  418 119 HOH WAT A . 
F 3 HOH 64  419 120 HOH WAT A . 
F 3 HOH 65  420 121 HOH WAT A . 
F 3 HOH 66  421 123 HOH WAT A . 
F 3 HOH 67  422 124 HOH WAT A . 
F 3 HOH 68  423 128 HOH WAT A . 
F 3 HOH 69  424 132 HOH WAT A . 
F 3 HOH 70  425 133 HOH WAT A . 
F 3 HOH 71  426 135 HOH WAT A . 
F 3 HOH 72  427 136 HOH WAT A . 
F 3 HOH 73  428 141 HOH WAT A . 
F 3 HOH 74  429 145 HOH WAT A . 
F 3 HOH 75  430 151 HOH WAT A . 
F 3 HOH 76  431 152 HOH WAT A . 
F 3 HOH 77  432 153 HOH WAT A . 
F 3 HOH 78  433 154 HOH WAT A . 
F 3 HOH 79  434 156 HOH WAT A . 
F 3 HOH 80  435 159 HOH WAT A . 
F 3 HOH 81  436 160 HOH WAT A . 
F 3 HOH 82  437 161 HOH WAT A . 
F 3 HOH 83  438 163 HOH WAT A . 
F 3 HOH 84  439 164 HOH WAT A . 
F 3 HOH 85  440 165 HOH WAT A . 
F 3 HOH 86  441 168 HOH WAT A . 
F 3 HOH 87  442 171 HOH WAT A . 
F 3 HOH 88  443 172 HOH WAT A . 
F 3 HOH 89  444 178 HOH WAT A . 
F 3 HOH 90  445 180 HOH WAT A . 
F 3 HOH 91  446 183 HOH WAT A . 
F 3 HOH 92  447 186 HOH WAT A . 
F 3 HOH 93  448 187 HOH WAT A . 
F 3 HOH 94  449 191 HOH WAT A . 
F 3 HOH 95  450 193 HOH WAT A . 
F 3 HOH 96  451 196 HOH WAT A . 
F 3 HOH 97  452 198 HOH WAT A . 
F 3 HOH 98  453 199 HOH WAT A . 
F 3 HOH 99  454 202 HOH WAT A . 
F 3 HOH 100 455 203 HOH WAT A . 
F 3 HOH 101 456 209 HOH WAT A . 
F 3 HOH 102 457 216 HOH WAT A . 
G 3 HOH 1   356 2   HOH WAT B . 
G 3 HOH 2   357 8   HOH WAT B . 
G 3 HOH 3   358 16  HOH WAT B . 
G 3 HOH 4   359 20  HOH WAT B . 
G 3 HOH 5   360 22  HOH WAT B . 
G 3 HOH 6   361 24  HOH WAT B . 
G 3 HOH 7   362 25  HOH WAT B . 
G 3 HOH 8   363 27  HOH WAT B . 
G 3 HOH 9   364 28  HOH WAT B . 
G 3 HOH 10  365 34  HOH WAT B . 
G 3 HOH 11  366 35  HOH WAT B . 
G 3 HOH 12  367 36  HOH WAT B . 
G 3 HOH 13  368 37  HOH WAT B . 
G 3 HOH 14  369 48  HOH WAT B . 
G 3 HOH 15  370 50  HOH WAT B . 
G 3 HOH 16  371 59  HOH WAT B . 
G 3 HOH 17  372 76  HOH WAT B . 
G 3 HOH 18  373 81  HOH WAT B . 
G 3 HOH 19  374 86  HOH WAT B . 
G 3 HOH 20  375 89  HOH WAT B . 
G 3 HOH 21  376 90  HOH WAT B . 
G 3 HOH 22  377 91  HOH WAT B . 
G 3 HOH 23  378 95  HOH WAT B . 
G 3 HOH 24  379 98  HOH WAT B . 
G 3 HOH 25  380 107 HOH WAT B . 
G 3 HOH 26  381 110 HOH WAT B . 
G 3 HOH 27  382 113 HOH WAT B . 
G 3 HOH 28  383 114 HOH WAT B . 
G 3 HOH 29  384 122 HOH WAT B . 
G 3 HOH 30  385 125 HOH WAT B . 
G 3 HOH 31  386 127 HOH WAT B . 
G 3 HOH 32  387 130 HOH WAT B . 
G 3 HOH 33  388 134 HOH WAT B . 
G 3 HOH 34  389 142 HOH WAT B . 
G 3 HOH 35  390 149 HOH WAT B . 
G 3 HOH 36  391 157 HOH WAT B . 
G 3 HOH 37  392 166 HOH WAT B . 
G 3 HOH 38  393 167 HOH WAT B . 
G 3 HOH 39  394 170 HOH WAT B . 
G 3 HOH 40  395 175 HOH WAT B . 
G 3 HOH 41  396 176 HOH WAT B . 
G 3 HOH 42  397 182 HOH WAT B . 
G 3 HOH 43  398 184 HOH WAT B . 
G 3 HOH 44  399 185 HOH WAT B . 
G 3 HOH 45  400 188 HOH WAT B . 
G 3 HOH 46  401 192 HOH WAT B . 
G 3 HOH 47  402 194 HOH WAT B . 
G 3 HOH 48  403 200 HOH WAT B . 
G 3 HOH 49  404 201 HOH WAT B . 
G 3 HOH 50  405 204 HOH WAT B . 
G 3 HOH 51  406 205 HOH WAT B . 
G 3 HOH 52  407 207 HOH WAT B . 
G 3 HOH 53  408 210 HOH WAT B . 
G 3 HOH 54  409 214 HOH WAT B . 
G 3 HOH 55  410 217 HOH WAT B . 
G 3 HOH 56  411 218 HOH WAT B . 
H 3 HOH 1   356 4   HOH WAT C . 
H 3 HOH 2   357 11  HOH WAT C . 
H 3 HOH 3   358 19  HOH WAT C . 
H 3 HOH 4   359 26  HOH WAT C . 
H 3 HOH 5   360 29  HOH WAT C . 
H 3 HOH 6   361 32  HOH WAT C . 
H 3 HOH 7   362 38  HOH WAT C . 
H 3 HOH 8   363 39  HOH WAT C . 
H 3 HOH 9   364 41  HOH WAT C . 
H 3 HOH 10  365 55  HOH WAT C . 
H 3 HOH 11  366 56  HOH WAT C . 
H 3 HOH 12  367 57  HOH WAT C . 
H 3 HOH 13  368 58  HOH WAT C . 
H 3 HOH 14  369 60  HOH WAT C . 
H 3 HOH 15  370 62  HOH WAT C . 
H 3 HOH 16  371 65  HOH WAT C . 
H 3 HOH 17  372 66  HOH WAT C . 
H 3 HOH 18  373 69  HOH WAT C . 
H 3 HOH 19  374 70  HOH WAT C . 
H 3 HOH 20  375 71  HOH WAT C . 
H 3 HOH 21  376 72  HOH WAT C . 
H 3 HOH 22  377 82  HOH WAT C . 
H 3 HOH 23  378 84  HOH WAT C . 
H 3 HOH 24  379 88  HOH WAT C . 
H 3 HOH 25  380 101 HOH WAT C . 
H 3 HOH 26  381 102 HOH WAT C . 
H 3 HOH 27  382 105 HOH WAT C . 
H 3 HOH 28  383 116 HOH WAT C . 
H 3 HOH 29  384 126 HOH WAT C . 
H 3 HOH 30  385 129 HOH WAT C . 
H 3 HOH 31  386 131 HOH WAT C . 
H 3 HOH 32  387 137 HOH WAT C . 
H 3 HOH 33  388 138 HOH WAT C . 
H 3 HOH 34  389 139 HOH WAT C . 
H 3 HOH 35  390 140 HOH WAT C . 
H 3 HOH 36  391 143 HOH WAT C . 
H 3 HOH 37  392 144 HOH WAT C . 
H 3 HOH 38  393 146 HOH WAT C . 
H 3 HOH 39  394 147 HOH WAT C . 
H 3 HOH 40  395 148 HOH WAT C . 
H 3 HOH 41  396 150 HOH WAT C . 
H 3 HOH 42  397 155 HOH WAT C . 
H 3 HOH 43  398 158 HOH WAT C . 
H 3 HOH 44  399 162 HOH WAT C . 
H 3 HOH 45  400 169 HOH WAT C . 
H 3 HOH 46  401 173 HOH WAT C . 
H 3 HOH 47  402 174 HOH WAT C . 
H 3 HOH 48  403 177 HOH WAT C . 
H 3 HOH 49  404 179 HOH WAT C . 
H 3 HOH 50  405 181 HOH WAT C . 
H 3 HOH 51  406 189 HOH WAT C . 
H 3 HOH 52  407 190 HOH WAT C . 
H 3 HOH 53  408 195 HOH WAT C . 
H 3 HOH 54  409 197 HOH WAT C . 
H 3 HOH 55  410 206 HOH WAT C . 
H 3 HOH 56  411 208 HOH WAT C . 
H 3 HOH 57  412 211 HOH WAT C . 
H 3 HOH 58  413 212 HOH WAT C . 
H 3 HOH 59  414 213 HOH WAT C . 
H 3 HOH 60  415 215 HOH WAT C . 
H 3 HOH 61  416 219 HOH WAT C . 
H 3 HOH 62  417 220 HOH WAT C . 
H 3 HOH 63  418 221 HOH WAT C . 
H 3 HOH 64  419 222 HOH WAT C . 
H 3 HOH 65  420 223 HOH WAT C . 
H 3 HOH 66  421 224 HOH WAT C . 
#