data_1SP1
# 
_entry.id   1SP1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SP1         
WWPDB D_1000176455 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SP1 
_pdbx_database_status.recvd_initial_deposition_date   1996-11-21 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Narayan, V.A.'   1 
'Kriwacki, R.W.'  2 
'Caradonna, J.P.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Structures of zinc finger domains from transcription factor Sp1. Insights into sequence-specific protein-DNA recognition.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            272 
_citation.page_first                7801 
_citation.page_last                 7809 
_citation.year                      1997 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9065444 
_citation.pdbx_database_id_DOI      10.1074/jbc.272.12.7801 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Narayan, V.A.'   1 
primary 'Kriwacki, R.W.'  2 
primary 'Caradonna, J.P.' 3 
# 
_cell.entry_id           1SP1 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SP1 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man SP1F3      3536.247 1 ? ? 'ZINC FINGER DNA BINDING DOMAIN' 
'DOES NOT BIND DNA SPECIFICALLY AS A SINGLE ZINC FINGER' 
2 non-polymer syn 'ZINC ION' 65.409   1 ? ? ?                                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'TRANSCRIPTION FACTOR SP1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       KKFACPECPKRFMRSDHLSKHIKTHQNKK 
_entity_poly.pdbx_seq_one_letter_code_can   KKFACPECPKRFMRSDHLSKHIKTHQNKK 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  LYS n 
1 2  LYS n 
1 3  PHE n 
1 4  ALA n 
1 5  CYS n 
1 6  PRO n 
1 7  GLU n 
1 8  CYS n 
1 9  PRO n 
1 10 LYS n 
1 11 ARG n 
1 12 PHE n 
1 13 MET n 
1 14 ARG n 
1 15 SER n 
1 16 ASP n 
1 17 HIS n 
1 18 LEU n 
1 19 SER n 
1 20 LYS n 
1 21 HIS n 
1 22 ILE n 
1 23 LYS n 
1 24 THR n 
1 25 HIS n 
1 26 GLN n 
1 27 ASN n 
1 28 LYS n 
1 29 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    NUCLEOPLASM 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SP1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P08047 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;TGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMP
NIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQ
TQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVTSGTTISSASLVSSQASSSSFFTNANSYST
TTTTSNMGIMNFTTSGSSGTNSQGQTPQRVSGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGG
QALQALQAAPLSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQG
VSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHG
AGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRW
HTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSG
AGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINISGNGF
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1SP1 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 29 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P08047 
_struct_ref_seq.db_align_beg                  595 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  623 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       29 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 NOESY 1 
2 1 COSY  1 
3 1 TOCSY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         278 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  5.9 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             AM500 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    500 
# 
_pdbx_nmr_refine.entry_id           1SP1 
_pdbx_nmr_refine.method             'DISTANCE GEOMETRY, SIMULATED ANNEALING' 
_pdbx_nmr_refine.details            'MULTIPLE ROUNDS OF SIMULATED ANNEALING REFINEMENT PROTOCOL OF X-PLOR' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                             1SP1 
_pdbx_nmr_ensemble.conformers_calculated_total_number   100 
_pdbx_nmr_ensemble.conformers_submitted_total_number    1 
_pdbx_nmr_ensemble.conformer_selection_criteria         'MEAN STRUCTURE' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           X-PLOR ? BRUNGER 1 
'structure solution' FELIX  ? ?       2 
'structure solution' XPLOR  ? ?       3 
# 
_exptl.entry_id          1SP1 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1SP1 
_struct.title                     
'NMR STRUCTURE OF A ZINC FINGER DOMAIN FROM TRANSCRIPTION FACTOR SP1F3, MINIMIZED AVERAGE STRUCTURE' 
_struct.pdbx_descriptor           SP1F3 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SP1 
_struct_keywords.pdbx_keywords   'ZINC FINGER' 
_struct_keywords.text            'ZINC FINGER, TRANSCRIPTION ACTIVATION, SP1' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A Y N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       ASP 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        16 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       GLN 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        26 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ASP 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         16 
_struct_conf.end_auth_comp_id        GLN 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         26 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 5  SG  ? ? A ZN 30 A CYS 5  1_555 ? ? ? ? ? ? ? 2.268 ? 
metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 8  SG  ? ? A ZN 30 A CYS 8  1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 21 NE2 ? ? A ZN 30 A HIS 21 1_555 ? ? ? ? ? ? ? 2.028 ? 
metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 25 NE2 ? ? A ZN 30 A HIS 25 1_555 ? ? ? ? ? ? ? 2.100 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
S1  Unknown  ? ? ? ? 2 'PROPOSED DNA BINDING RESIDUES.'   
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 30' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 S1  2 ARG A 14 ? ARG A 14 . ? 1_555 ? 
2 S1  2 HIS A 17 ? HIS A 17 . ? 1_555 ? 
3 AC1 4 CYS A 5  ? CYS A 5  . ? 1_555 ? 
4 AC1 4 CYS A 8  ? CYS A 8  . ? 1_555 ? 
5 AC1 4 HIS A 21 ? HIS A 21 . ? 1_555 ? 
6 AC1 4 HIS A 25 ? HIS A 25 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1SP1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SP1 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N    . LYS A 1 1  ? 10.796  5.455   -3.846 1.00 3.73 ? 1  LYS A N    1 
ATOM   2   C  CA   . LYS A 1 1  ? 11.600  4.367   -4.471 1.00 3.24 ? 1  LYS A CA   1 
ATOM   3   C  C    . LYS A 1 1  ? 10.991  3.011   -4.112 1.00 2.50 ? 1  LYS A C    1 
ATOM   4   O  O    . LYS A 1 1  ? 10.218  2.893   -3.182 1.00 2.93 ? 1  LYS A O    1 
ATOM   5   C  CB   . LYS A 1 1  ? 13.038  4.434   -3.954 1.00 4.01 ? 1  LYS A CB   1 
ATOM   6   C  CG   . LYS A 1 1  ? 13.947  5.007   -5.043 1.00 4.89 ? 1  LYS A CG   1 
ATOM   7   C  CD   . LYS A 1 1  ? 14.495  6.362   -4.591 1.00 5.64 ? 1  LYS A CD   1 
ATOM   8   C  CE   . LYS A 1 1  ? 14.635  7.287   -5.802 1.00 6.34 ? 1  LYS A CE   1 
ATOM   9   N  NZ   . LYS A 1 1  ? 16.078  7.442   -6.144 1.00 7.07 ? 1  LYS A NZ   1 
ATOM   10  H  H1   . LYS A 1 1  ? 10.024  5.039   -3.287 1.00 4.02 ? 1  LYS A H1   1 
ATOM   11  H  H2   . LYS A 1 1  ? 11.404  6.022   -3.223 1.00 4.06 ? 1  LYS A H2   1 
ATOM   12  H  H3   . LYS A 1 1  ? 10.398  6.063   -4.591 1.00 4.01 ? 1  LYS A H3   1 
ATOM   13  H  HA   . LYS A 1 1  ? 11.598  4.490   -5.544 1.00 3.44 ? 1  LYS A HA   1 
ATOM   14  H  HB2  . LYS A 1 1  ? 13.077  5.069   -3.080 1.00 4.34 ? 1  LYS A HB2  1 
ATOM   15  H  HB3  . LYS A 1 1  ? 13.374  3.442   -3.693 1.00 4.13 ? 1  LYS A HB3  1 
ATOM   16  H  HG2  . LYS A 1 1  ? 14.768  4.327   -5.221 1.00 5.12 ? 1  LYS A HG2  1 
ATOM   17  H  HG3  . LYS A 1 1  ? 13.382  5.135   -5.954 1.00 5.17 ? 1  LYS A HG3  1 
ATOM   18  H  HD2  . LYS A 1 1  ? 13.816  6.804   -3.876 1.00 5.67 ? 1  LYS A HD2  1 
ATOM   19  H  HD3  . LYS A 1 1  ? 15.462  6.224   -4.132 1.00 6.03 ? 1  LYS A HD3  1 
ATOM   20  H  HE2  . LYS A 1 1  ? 14.110  6.861   -6.644 1.00 6.57 ? 1  LYS A HE2  1 
ATOM   21  H  HE3  . LYS A 1 1  ? 14.215  8.254   -5.566 1.00 6.42 ? 1  LYS A HE3  1 
ATOM   22  H  HZ1  . LYS A 1 1  ? 16.623  6.671   -5.710 1.00 7.43 ? 1  LYS A HZ1  1 
ATOM   23  H  HZ2  . LYS A 1 1  ? 16.194  7.411   -7.177 1.00 7.28 ? 1  LYS A HZ2  1 
ATOM   24  H  HZ3  . LYS A 1 1  ? 16.424  8.353   -5.782 1.00 7.27 ? 1  LYS A HZ3  1 
ATOM   25  N  N    . LYS A 1 2  ? 11.333  1.984   -4.843 1.00 1.97 ? 2  LYS A N    1 
ATOM   26  C  CA   . LYS A 1 2  ? 10.772  0.637   -4.542 1.00 1.60 ? 2  LYS A CA   1 
ATOM   27  C  C    . LYS A 1 2  ? 9.245   0.721   -4.490 1.00 1.31 ? 2  LYS A C    1 
ATOM   28  O  O    . LYS A 1 2  ? 8.650   1.669   -4.962 1.00 1.87 ? 2  LYS A O    1 
ATOM   29  C  CB   . LYS A 1 2  ? 11.302  0.156   -3.190 1.00 2.05 ? 2  LYS A CB   1 
ATOM   30  C  CG   . LYS A 1 2  ? 12.822  0.322   -3.149 1.00 2.63 ? 2  LYS A CG   1 
ATOM   31  C  CD   . LYS A 1 2  ? 13.386  -0.443  -1.951 1.00 3.34 ? 2  LYS A CD   1 
ATOM   32  C  CE   . LYS A 1 2  ? 14.067  -1.724  -2.436 1.00 4.08 ? 2  LYS A CE   1 
ATOM   33  N  NZ   . LYS A 1 2  ? 14.460  -2.553  -1.262 1.00 4.73 ? 2  LYS A NZ   1 
ATOM   34  H  H    . LYS A 1 2  ? 11.958  2.099   -5.589 1.00 2.35 ? 2  LYS A H    1 
ATOM   35  H  HA   . LYS A 1 2  ? 11.069  -0.058  -5.313 1.00 2.09 ? 2  LYS A HA   1 
ATOM   36  H  HB2  . LYS A 1 2  ? 10.854  0.741   -2.399 1.00 2.45 ? 2  LYS A HB2  1 
ATOM   37  H  HB3  . LYS A 1 2  ? 11.051  -0.885  -3.055 1.00 2.46 ? 2  LYS A HB3  1 
ATOM   38  H  HG2  . LYS A 1 2  ? 13.251  -0.069  -4.061 1.00 3.00 ? 2  LYS A HG2  1 
ATOM   39  H  HG3  . LYS A 1 2  ? 13.069  1.368   -3.054 1.00 2.91 ? 2  LYS A HG3  1 
ATOM   40  H  HD2  . LYS A 1 2  ? 14.106  0.176   -1.435 1.00 3.54 ? 2  LYS A HD2  1 
ATOM   41  H  HD3  . LYS A 1 2  ? 12.582  -0.699  -1.276 1.00 3.69 ? 2  LYS A HD3  1 
ATOM   42  H  HE2  . LYS A 1 2  ? 13.382  -2.283  -3.057 1.00 4.34 ? 2  LYS A HE2  1 
ATOM   43  H  HE3  . LYS A 1 2  ? 14.947  -1.470  -3.009 1.00 4.40 ? 2  LYS A HE3  1 
ATOM   44  H  HZ1  . LYS A 1 2  ? 14.406  -1.978  -0.398 1.00 5.02 ? 2  LYS A HZ1  1 
ATOM   45  H  HZ2  . LYS A 1 2  ? 13.815  -3.365  -1.180 1.00 4.97 ? 2  LYS A HZ2  1 
ATOM   46  H  HZ3  . LYS A 1 2  ? 15.434  -2.894  -1.388 1.00 5.05 ? 2  LYS A HZ3  1 
ATOM   47  N  N    . PHE A 1 3  ? 8.606   -0.263  -3.920 1.00 1.28 ? 3  PHE A N    1 
ATOM   48  C  CA   . PHE A 1 3  ? 7.118   -0.236  -3.840 1.00 1.10 ? 3  PHE A CA   1 
ATOM   49  C  C    . PHE A 1 3  ? 6.691   0.329   -2.484 1.00 0.97 ? 3  PHE A C    1 
ATOM   50  O  O    . PHE A 1 3  ? 7.381   0.185   -1.494 1.00 1.45 ? 3  PHE A O    1 
ATOM   51  C  CB   . PHE A 1 3  ? 6.567   -1.655  -3.998 1.00 1.24 ? 3  PHE A CB   1 
ATOM   52  C  CG   . PHE A 1 3  ? 7.439   -2.626  -3.240 1.00 1.11 ? 3  PHE A CG   1 
ATOM   53  C  CD1  . PHE A 1 3  ? 7.482   -2.585  -1.841 1.00 1.85 ? 3  PHE A CD1  1 
ATOM   54  C  CD2  . PHE A 1 3  ? 8.205   -3.568  -3.937 1.00 1.63 ? 3  PHE A CD2  1 
ATOM   55  C  CE1  . PHE A 1 3  ? 8.292   -3.486  -1.139 1.00 2.30 ? 3  PHE A CE1  1 
ATOM   56  C  CE2  . PHE A 1 3  ? 9.014   -4.470  -3.235 1.00 2.12 ? 3  PHE A CE2  1 
ATOM   57  C  CZ   . PHE A 1 3  ? 9.058   -4.429  -1.836 1.00 2.22 ? 3  PHE A CZ   1 
ATOM   58  H  H    . PHE A 1 3  ? 9.104   -1.019  -3.545 1.00 1.87 ? 3  PHE A H    1 
ATOM   59  H  HA   . PHE A 1 3  ? 6.728   0.391   -4.629 1.00 1.35 ? 3  PHE A HA   1 
ATOM   60  H  HB2  . PHE A 1 3  ? 5.560   -1.695  -3.608 1.00 1.67 ? 3  PHE A HB2  1 
ATOM   61  H  HB3  . PHE A 1 3  ? 6.558   -1.923  -5.044 1.00 1.78 ? 3  PHE A HB3  1 
ATOM   62  H  HD1  . PHE A 1 3  ? 6.891   -1.858  -1.304 1.00 2.53 ? 3  PHE A HD1  1 
ATOM   63  H  HD2  . PHE A 1 3  ? 8.171   -3.599  -5.016 1.00 2.24 ? 3  PHE A HD2  1 
ATOM   64  H  HE1  . PHE A 1 3  ? 8.325   -3.455  -0.060 1.00 3.11 ? 3  PHE A HE1  1 
ATOM   65  H  HE2  . PHE A 1 3  ? 9.605   -5.196  -3.773 1.00 2.87 ? 3  PHE A HE2  1 
ATOM   66  H  HZ   . PHE A 1 3  ? 9.683   -5.124  -1.295 1.00 2.80 ? 3  PHE A HZ   1 
ATOM   67  N  N    . ALA A 1 4  ? 5.557   0.973   -2.432 1.00 0.85 ? 4  ALA A N    1 
ATOM   68  C  CA   . ALA A 1 4  ? 5.083   1.551   -1.143 1.00 0.69 ? 4  ALA A CA   1 
ATOM   69  C  C    . ALA A 1 4  ? 3.853   2.423   -1.402 1.00 0.68 ? 4  ALA A C    1 
ATOM   70  O  O    . ALA A 1 4  ? 3.790   3.140   -2.380 1.00 0.82 ? 4  ALA A O    1 
ATOM   71  C  CB   . ALA A 1 4  ? 6.194   2.404   -0.528 1.00 0.79 ? 4  ALA A CB   1 
ATOM   72  H  H    . ALA A 1 4  ? 5.017   1.078   -3.243 1.00 1.25 ? 4  ALA A H    1 
ATOM   73  H  HA   . ALA A 1 4  ? 4.822   0.752   -0.463 1.00 0.69 ? 4  ALA A HA   1 
ATOM   74  H  HB1  . ALA A 1 4  ? 6.931   2.633   -1.283 1.00 1.30 ? 4  ALA A HB1  1 
ATOM   75  H  HB2  . ALA A 1 4  ? 5.773   3.322   -0.145 1.00 1.31 ? 4  ALA A HB2  1 
ATOM   76  H  HB3  . ALA A 1 4  ? 6.662   1.859   0.278  1.00 1.26 ? 4  ALA A HB3  1 
ATOM   77  N  N    . CYS A 1 5  ? 2.875   2.361   -0.536 1.00 0.59 ? 5  CYS A N    1 
ATOM   78  C  CA   . CYS A 1 5  ? 1.643   3.178   -0.728 1.00 0.69 ? 5  CYS A CA   1 
ATOM   79  C  C    . CYS A 1 5  ? 1.994   4.559   -1.283 1.00 0.82 ? 5  CYS A C    1 
ATOM   80  O  O    . CYS A 1 5  ? 2.392   5.435   -0.541 1.00 0.82 ? 5  CYS A O    1 
ATOM   81  C  CB   . CYS A 1 5  ? 0.941   3.364   0.616  1.00 0.66 ? 5  CYS A CB   1 
ATOM   82  S  SG   . CYS A 1 5  ? -0.717  4.025   0.340  1.00 0.89 ? 5  CYS A SG   1 
ATOM   83  H  H    . CYS A 1 5  ? 2.946   1.768   0.241  1.00 0.53 ? 5  CYS A H    1 
ATOM   84  H  HA   . CYS A 1 5  ? 0.976   2.671   -1.408 1.00 0.77 ? 5  CYS A HA   1 
ATOM   85  H  HB2  . CYS A 1 5  ? 0.873   2.423   1.118  1.00 0.64 ? 5  CYS A HB2  1 
ATOM   86  H  HB3  . CYS A 1 5  ? 1.502   4.050   1.227  1.00 0.63 ? 5  CYS A HB3  1 
ATOM   87  N  N    . PRO A 1 6  ? 1.812   4.726   -2.568 1.00 0.97 ? 6  PRO A N    1 
ATOM   88  C  CA   . PRO A 1 6  ? 2.080   6.014   -3.222 1.00 1.13 ? 6  PRO A CA   1 
ATOM   89  C  C    . PRO A 1 6  ? 1.144   7.072   -2.633 1.00 1.18 ? 6  PRO A C    1 
ATOM   90  O  O    . PRO A 1 6  ? 1.322   8.258   -2.826 1.00 1.28 ? 6  PRO A O    1 
ATOM   91  C  CB   . PRO A 1 6  ? 1.769   5.775   -4.706 1.00 1.29 ? 6  PRO A CB   1 
ATOM   92  C  CG   . PRO A 1 6  ? 1.306   4.303   -4.858 1.00 1.21 ? 6  PRO A CG   1 
ATOM   93  C  CD   . PRO A 1 6  ? 1.331   3.659   -3.463 1.00 1.01 ? 6  PRO A CD   1 
ATOM   94  H  HA   . PRO A 1 6  ? 3.112   6.301   -3.097 1.00 1.12 ? 6  PRO A HA   1 
ATOM   95  H  HB2  . PRO A 1 6  ? 0.983   6.445   -5.028 1.00 1.41 ? 6  PRO A HB2  1 
ATOM   96  H  HB3  . PRO A 1 6  ? 2.656   5.938   -5.299 1.00 1.35 ? 6  PRO A HB3  1 
ATOM   97  H  HG2  . PRO A 1 6  ? 0.303   4.274   -5.260 1.00 1.32 ? 6  PRO A HG2  1 
ATOM   98  H  HG3  . PRO A 1 6  ? 1.979   3.772   -5.514 1.00 1.23 ? 6  PRO A HG3  1 
ATOM   99  H  HD2  . PRO A 1 6  ? 0.337   3.344   -3.177 1.00 1.02 ? 6  PRO A HD2  1 
ATOM   100 H  HD3  . PRO A 1 6  ? 2.013   2.823   -3.445 1.00 0.93 ? 6  PRO A HD3  1 
ATOM   101 N  N    . GLU A 1 7  ? 0.142   6.639   -1.910 1.00 1.12 ? 7  GLU A N    1 
ATOM   102 C  CA   . GLU A 1 7  ? -0.817  7.599   -1.300 1.00 1.20 ? 7  GLU A CA   1 
ATOM   103 C  C    . GLU A 1 7  ? -0.202  8.218   -0.046 1.00 1.09 ? 7  GLU A C    1 
ATOM   104 O  O    . GLU A 1 7  ? -0.213  9.420   0.127  1.00 1.19 ? 7  GLU A O    1 
ATOM   105 C  CB   . GLU A 1 7  ? -2.105  6.862   -0.927 1.00 1.24 ? 7  GLU A CB   1 
ATOM   106 C  CG   . GLU A 1 7  ? -2.489  5.905   -2.056 1.00 1.78 ? 7  GLU A CG   1 
ATOM   107 C  CD   . GLU A 1 7  ? -4.006  5.933   -2.255 1.00 2.00 ? 7  GLU A CD   1 
ATOM   108 O  OE1  . GLU A 1 7  ? -4.579  7.003   -2.134 1.00 2.41 ? 7  GLU A OE1  1 
ATOM   109 O  OE2  . GLU A 1 7  ? -4.567  4.885   -2.527 1.00 2.43 ? 7  GLU A OE2  1 
ATOM   110 H  H    . GLU A 1 7  ? 0.019   5.678   -1.771 1.00 1.05 ? 7  GLU A H    1 
ATOM   111 H  HA   . GLU A 1 7  ? -1.042  8.377   -2.008 1.00 1.34 ? 7  GLU A HA   1 
ATOM   112 H  HB2  . GLU A 1 7  ? -1.948  6.302   -0.016 1.00 1.38 ? 7  GLU A HB2  1 
ATOM   113 H  HB3  . GLU A 1 7  ? -2.899  7.578   -0.778 1.00 1.47 ? 7  GLU A HB3  1 
ATOM   114 H  HG2  . GLU A 1 7  ? -2.000  6.211   -2.969 1.00 2.22 ? 7  GLU A HG2  1 
ATOM   115 H  HG3  . GLU A 1 7  ? -2.180  4.903   -1.800 1.00 2.36 ? 7  GLU A HG3  1 
ATOM   116 N  N    . CYS A 1 8  ? 0.331   7.416   0.835  1.00 0.93 ? 8  CYS A N    1 
ATOM   117 C  CA   . CYS A 1 8  ? 0.936   7.993   2.072  1.00 0.86 ? 8  CYS A CA   1 
ATOM   118 C  C    . CYS A 1 8  ? 2.437   7.674   2.116  1.00 0.78 ? 8  CYS A C    1 
ATOM   119 O  O    . CYS A 1 8  ? 2.849   6.600   1.729  1.00 0.72 ? 8  CYS A O    1 
ATOM   120 C  CB   . CYS A 1 8  ? 0.244   7.407   3.305  1.00 0.83 ? 8  CYS A CB   1 
ATOM   121 S  SG   . CYS A 1 8  ? 0.580   5.634   3.405  1.00 0.71 ? 8  CYS A SG   1 
ATOM   122 H  H    . CYS A 1 8  ? 0.333   6.442   0.686  1.00 0.87 ? 8  CYS A H    1 
ATOM   123 H  HA   . CYS A 1 8  ? 0.797   9.063   2.062  1.00 0.95 ? 8  CYS A HA   1 
ATOM   124 H  HB2  . CYS A 1 8  ? 0.618   7.895   4.193  1.00 0.84 ? 8  CYS A HB2  1 
ATOM   125 H  HB3  . CYS A 1 8  ? -0.822  7.568   3.230  1.00 0.93 ? 8  CYS A HB3  1 
ATOM   126 N  N    . PRO A 1 9  ? 3.210   8.629   2.582  1.00 0.86 ? 9  PRO A N    1 
ATOM   127 C  CA   . PRO A 1 9  ? 4.676   8.482   2.682  1.00 0.90 ? 9  PRO A CA   1 
ATOM   128 C  C    . PRO A 1 9  ? 5.041   7.396   3.704  1.00 0.83 ? 9  PRO A C    1 
ATOM   129 O  O    . PRO A 1 9  ? 5.385   7.693   4.831  1.00 0.91 ? 9  PRO A O    1 
ATOM   130 C  CB   . PRO A 1 9  ? 5.173   9.849   3.173  1.00 1.07 ? 9  PRO A CB   1 
ATOM   131 C  CG   . PRO A 1 9  ? 3.931   10.735  3.442  1.00 1.08 ? 9  PRO A CG   1 
ATOM   132 C  CD   . PRO A 1 9  ? 2.686   9.928   3.043  1.00 0.97 ? 9  PRO A CD   1 
ATOM   133 H  HA   . PRO A 1 9  ? 5.104   8.264   1.717  1.00 0.96 ? 9  PRO A HA   1 
ATOM   134 H  HB2  . PRO A 1 9  ? 5.742   9.725   4.084  1.00 1.09 ? 9  PRO A HB2  1 
ATOM   135 H  HB3  . PRO A 1 9  ? 5.788   10.310  2.415  1.00 1.19 ? 9  PRO A HB3  1 
ATOM   136 H  HG2  . PRO A 1 9  ? 3.884   10.990  4.491  1.00 1.11 ? 9  PRO A HG2  1 
ATOM   137 H  HG3  . PRO A 1 9  ? 3.986   11.634  2.848  1.00 1.20 ? 9  PRO A HG3  1 
ATOM   138 H  HD2  . PRO A 1 9  ? 2.037   9.794   3.896  1.00 0.95 ? 9  PRO A HD2  1 
ATOM   139 H  HD3  . PRO A 1 9  ? 2.159   10.421  2.240  1.00 1.04 ? 9  PRO A HD3  1 
ATOM   140 N  N    . LYS A 1 10 ? 4.976   6.143   3.331  1.00 0.75 ? 10 LYS A N    1 
ATOM   141 C  CA   . LYS A 1 10 ? 5.327   5.068   4.296  1.00 0.77 ? 10 LYS A CA   1 
ATOM   142 C  C    . LYS A 1 10 ? 6.422   4.188   3.696  1.00 0.88 ? 10 LYS A C    1 
ATOM   143 O  O    . LYS A 1 10 ? 6.999   4.502   2.674  1.00 1.17 ? 10 LYS A O    1 
ATOM   144 C  CB   . LYS A 1 10 ? 4.089   4.217   4.587  1.00 0.75 ? 10 LYS A CB   1 
ATOM   145 C  CG   . LYS A 1 10 ? 3.475   4.651   5.920  1.00 1.01 ? 10 LYS A CG   1 
ATOM   146 C  CD   . LYS A 1 10 ? 3.953   3.717   7.033  1.00 1.11 ? 10 LYS A CD   1 
ATOM   147 C  CE   . LYS A 1 10 ? 5.330   4.168   7.524  1.00 1.65 ? 10 LYS A CE   1 
ATOM   148 N  NZ   . LYS A 1 10 ? 5.484   3.820   8.965  1.00 2.32 ? 10 LYS A NZ   1 
ATOM   149 H  H    . LYS A 1 10 ? 4.700   5.909   2.423  1.00 0.73 ? 10 LYS A H    1 
ATOM   150 H  HA   . LYS A 1 10 ? 5.684   5.510   5.214  1.00 0.87 ? 10 LYS A HA   1 
ATOM   151 H  HB2  . LYS A 1 10 ? 3.367   4.350   3.795  1.00 1.02 ? 10 LYS A HB2  1 
ATOM   152 H  HB3  . LYS A 1 10 ? 4.373   3.177   4.646  1.00 0.83 ? 10 LYS A HB3  1 
ATOM   153 H  HG2  . LYS A 1 10 ? 3.778   5.664   6.143  1.00 1.37 ? 10 LYS A HG2  1 
ATOM   154 H  HG3  . LYS A 1 10 ? 2.398   4.605   5.851  1.00 1.42 ? 10 LYS A HG3  1 
ATOM   155 H  HD2  . LYS A 1 10 ? 3.250   3.746   7.853  1.00 1.42 ? 10 LYS A HD2  1 
ATOM   156 H  HD3  . LYS A 1 10 ? 4.021   2.709   6.653  1.00 1.29 ? 10 LYS A HD3  1 
ATOM   157 H  HE2  . LYS A 1 10 ? 6.098   3.670   6.950  1.00 2.14 ? 10 LYS A HE2  1 
ATOM   158 H  HE3  . LYS A 1 10 ? 5.424   5.237   7.400  1.00 1.89 ? 10 LYS A HE3  1 
ATOM   159 H  HZ1  . LYS A 1 10 ? 5.354   2.796   9.090  1.00 2.67 ? 10 LYS A HZ1  1 
ATOM   160 H  HZ2  . LYS A 1 10 ? 6.435   4.092   9.288  1.00 2.68 ? 10 LYS A HZ2  1 
ATOM   161 H  HZ3  . LYS A 1 10 ? 4.769   4.328   9.523  1.00 2.79 ? 10 LYS A HZ3  1 
ATOM   162 N  N    . ARG A 1 11 ? 6.711   3.088   4.326  1.00 0.94 ? 11 ARG A N    1 
ATOM   163 C  CA   . ARG A 1 11 ? 7.769   2.179   3.801  1.00 1.06 ? 11 ARG A CA   1 
ATOM   164 C  C    . ARG A 1 11 ? 7.351   0.727   4.035  1.00 1.09 ? 11 ARG A C    1 
ATOM   165 O  O    . ARG A 1 11 ? 6.816   0.384   5.071  1.00 1.63 ? 11 ARG A O    1 
ATOM   166 C  CB   . ARG A 1 11 ? 9.087   2.454   4.529  1.00 1.26 ? 11 ARG A CB   1 
ATOM   167 C  CG   . ARG A 1 11 ? 9.519   3.901   4.280  1.00 1.86 ? 11 ARG A CG   1 
ATOM   168 C  CD   . ARG A 1 11 ? 10.796  4.195   5.071  1.00 2.20 ? 11 ARG A CD   1 
ATOM   169 N  NE   . ARG A 1 11 ? 10.445  4.642   6.452  1.00 2.97 ? 11 ARG A NE   1 
ATOM   170 C  CZ   . ARG A 1 11 ? 9.406   5.407   6.652  1.00 3.50 ? 11 ARG A CZ   1 
ATOM   171 N  NH1  . ARG A 1 11 ? 9.526   6.704   6.570  1.00 4.03 ? 11 ARG A NH1  1 
ATOM   172 N  NH2  . ARG A 1 11 ? 8.249   4.876   6.938  1.00 4.04 ? 11 ARG A NH2  1 
ATOM   173 H  H    . ARG A 1 11 ? 6.231   2.859   5.147  1.00 1.10 ? 11 ARG A H    1 
ATOM   174 H  HA   . ARG A 1 11 ? 7.899   2.351   2.742  1.00 1.11 ? 11 ARG A HA   1 
ATOM   175 H  HB2  . ARG A 1 11 ? 8.951   2.295   5.589  1.00 1.58 ? 11 ARG A HB2  1 
ATOM   176 H  HB3  . ARG A 1 11 ? 9.848   1.784   4.159  1.00 1.63 ? 11 ARG A HB3  1 
ATOM   177 H  HG2  . ARG A 1 11 ? 9.708   4.041   3.225  1.00 2.37 ? 11 ARG A HG2  1 
ATOM   178 H  HG3  . ARG A 1 11 ? 8.735   4.571   4.597  1.00 2.32 ? 11 ARG A HG3  1 
ATOM   179 H  HD2  . ARG A 1 11 ? 11.395  3.299   5.130  1.00 2.31 ? 11 ARG A HD2  1 
ATOM   180 H  HD3  . ARG A 1 11 ? 11.358  4.970   4.570  1.00 2.51 ? 11 ARG A HD3  1 
ATOM   181 H  HE   . ARG A 1 11 ? 10.997  4.360   7.211  1.00 3.44 ? 11 ARG A HE   1 
ATOM   182 H  HH11 . ARG A 1 11 ? 10.414  7.111   6.355  1.00 4.10 ? 11 ARG A HH11 1 
ATOM   183 H  HH12 . ARG A 1 11 ? 8.731   7.290   6.724  1.00 4.65 ? 11 ARG A HH12 1 
ATOM   184 H  HH21 . ARG A 1 11 ? 8.157   3.883   7.004  1.00 4.08 ? 11 ARG A HH21 1 
ATOM   185 H  HH22 . ARG A 1 11 ? 7.453   5.463   7.089  1.00 4.69 ? 11 ARG A HH22 1 
ATOM   186 N  N    . PHE A 1 12 ? 7.589   -0.132  3.081  1.00 0.85 ? 12 PHE A N    1 
ATOM   187 C  CA   . PHE A 1 12 ? 7.202   -1.560  3.255  1.00 0.90 ? 12 PHE A CA   1 
ATOM   188 C  C    . PHE A 1 12 ? 8.266   -2.461  2.624  1.00 1.12 ? 12 PHE A C    1 
ATOM   189 O  O    . PHE A 1 12 ? 9.191   -1.995  1.990  1.00 1.93 ? 12 PHE A O    1 
ATOM   190 C  CB   . PHE A 1 12 ? 5.855   -1.809  2.576  1.00 0.86 ? 12 PHE A CB   1 
ATOM   191 C  CG   . PHE A 1 12 ? 4.809   -0.903  3.180  1.00 0.69 ? 12 PHE A CG   1 
ATOM   192 C  CD1  . PHE A 1 12 ? 4.696   0.423   2.744  1.00 1.30 ? 12 PHE A CD1  1 
ATOM   193 C  CD2  . PHE A 1 12 ? 3.951   -1.388  4.175  1.00 1.46 ? 12 PHE A CD2  1 
ATOM   194 C  CE1  . PHE A 1 12 ? 3.726   1.263   3.302  1.00 1.26 ? 12 PHE A CE1  1 
ATOM   195 C  CE2  . PHE A 1 12 ? 2.981   -0.547  4.733  1.00 1.53 ? 12 PHE A CE2  1 
ATOM   196 C  CZ   . PHE A 1 12 ? 2.868   0.778   4.297  1.00 0.78 ? 12 PHE A CZ   1 
ATOM   197 H  H    . PHE A 1 12 ? 8.021   0.162   2.252  1.00 1.01 ? 12 PHE A H    1 
ATOM   198 H  HA   . PHE A 1 12 ? 7.121   -1.784  4.308  1.00 0.96 ? 12 PHE A HA   1 
ATOM   199 H  HB2  . PHE A 1 12 ? 5.941   -1.605  1.519  1.00 0.96 ? 12 PHE A HB2  1 
ATOM   200 H  HB3  . PHE A 1 12 ? 5.564   -2.839  2.721  1.00 1.00 ? 12 PHE A HB3  1 
ATOM   201 H  HD1  . PHE A 1 12 ? 5.358   0.798   1.977  1.00 2.18 ? 12 PHE A HD1  1 
ATOM   202 H  HD2  . PHE A 1 12 ? 4.038   -2.411  4.511  1.00 2.31 ? 12 PHE A HD2  1 
ATOM   203 H  HE1  . PHE A 1 12 ? 3.639   2.285   2.966  1.00 2.10 ? 12 PHE A HE1  1 
ATOM   204 H  HE2  . PHE A 1 12 ? 2.320   -0.922  5.501  1.00 2.43 ? 12 PHE A HE2  1 
ATOM   205 H  HZ   . PHE A 1 12 ? 2.120   1.426   4.728  1.00 0.93 ? 12 PHE A HZ   1 
ATOM   206 N  N    . MET A 1 13 ? 8.137   -3.748  2.792  1.00 1.11 ? 13 MET A N    1 
ATOM   207 C  CA   . MET A 1 13 ? 9.136   -4.683  2.202  1.00 1.25 ? 13 MET A CA   1 
ATOM   208 C  C    . MET A 1 13 ? 8.406   -5.844  1.526  1.00 1.21 ? 13 MET A C    1 
ATOM   209 O  O    . MET A 1 13 ? 8.793   -6.989  1.648  1.00 1.63 ? 13 MET A O    1 
ATOM   210 C  CB   . MET A 1 13 ? 10.044  -5.224  3.309  1.00 1.50 ? 13 MET A CB   1 
ATOM   211 C  CG   . MET A 1 13 ? 10.944  -4.101  3.827  1.00 1.60 ? 13 MET A CG   1 
ATOM   212 S  SD   . MET A 1 13 ? 12.078  -4.763  5.073  1.00 2.46 ? 13 MET A SD   1 
ATOM   213 C  CE   . MET A 1 13 ? 13.289  -5.466  3.927  1.00 3.02 ? 13 MET A CE   1 
ATOM   214 H  H    . MET A 1 13 ? 7.382   -4.101  3.307  1.00 1.59 ? 13 MET A H    1 
ATOM   215 H  HA   . MET A 1 13 ? 9.733   -4.158  1.471  1.00 1.30 ? 13 MET A HA   1 
ATOM   216 H  HB2  . MET A 1 13 ? 9.437   -5.603  4.119  1.00 1.86 ? 13 MET A HB2  1 
ATOM   217 H  HB3  . MET A 1 13 ? 10.657  -6.021  2.915  1.00 1.83 ? 13 MET A HB3  1 
ATOM   218 H  HG2  . MET A 1 13 ? 11.512  -3.689  3.007  1.00 1.85 ? 13 MET A HG2  1 
ATOM   219 H  HG3  . MET A 1 13 ? 10.335  -3.327  4.269  1.00 1.89 ? 13 MET A HG3  1 
ATOM   220 H  HE1  . MET A 1 13 ? 12.786  -6.097  3.212  1.00 3.35 ? 13 MET A HE1  1 
ATOM   221 H  HE2  . MET A 1 13 ? 13.795  -4.666  3.405  1.00 3.38 ? 13 MET A HE2  1 
ATOM   222 H  HE3  . MET A 1 13 ? 14.008  -6.054  4.481  1.00 3.35 ? 13 MET A HE3  1 
ATOM   223 N  N    . ARG A 1 14 ? 7.350   -5.559  0.815  1.00 1.16 ? 14 ARG A N    1 
ATOM   224 C  CA   . ARG A 1 14 ? 6.594   -6.646  0.133  1.00 1.09 ? 14 ARG A CA   1 
ATOM   225 C  C    . ARG A 1 14 ? 5.475   -6.034  -0.713 1.00 0.86 ? 14 ARG A C    1 
ATOM   226 O  O    . ARG A 1 14 ? 5.196   -4.854  -0.630 1.00 1.03 ? 14 ARG A O    1 
ATOM   227 C  CB   . ARG A 1 14 ? 5.988   -7.581  1.182  1.00 1.22 ? 14 ARG A CB   1 
ATOM   228 C  CG   . ARG A 1 14 ? 6.147   -9.033  0.726  1.00 1.64 ? 14 ARG A CG   1 
ATOM   229 C  CD   . ARG A 1 14 ? 6.170   -9.953  1.948  1.00 2.13 ? 14 ARG A CD   1 
ATOM   230 N  NE   . ARG A 1 14 ? 6.923   -11.200 1.624  1.00 2.57 ? 14 ARG A NE   1 
ATOM   231 C  CZ   . ARG A 1 14 ? 6.829   -11.731 0.435  1.00 3.18 ? 14 ARG A CZ   1 
ATOM   232 N  NH1  . ARG A 1 14 ? 5.657   -11.904 -0.112 1.00 3.58 ? 14 ARG A NH1  1 
ATOM   233 N  NH2  . ARG A 1 14 ? 7.908   -12.089 -0.207 1.00 3.91 ? 14 ARG A NH2  1 
ATOM   234 H  H    . ARG A 1 14 ? 7.053   -4.628  0.730  1.00 1.49 ? 14 ARG A H    1 
ATOM   235 H  HA   . ARG A 1 14 ? 7.263   -7.205  -0.505 1.00 1.23 ? 14 ARG A HA   1 
ATOM   236 H  HB2  . ARG A 1 14 ? 6.497   -7.442  2.125  1.00 1.42 ? 14 ARG A HB2  1 
ATOM   237 H  HB3  . ARG A 1 14 ? 4.939   -7.356  1.302  1.00 1.42 ? 14 ARG A HB3  1 
ATOM   238 H  HG2  . ARG A 1 14 ? 5.318   -9.301  0.087  1.00 2.10 ? 14 ARG A HG2  1 
ATOM   239 H  HG3  . ARG A 1 14 ? 7.072   -9.139  0.180  1.00 1.91 ? 14 ARG A HG3  1 
ATOM   240 H  HD2  . ARG A 1 14 ? 6.654   -9.447  2.770  1.00 2.41 ? 14 ARG A HD2  1 
ATOM   241 H  HD3  . ARG A 1 14 ? 5.157   -10.205 2.228  1.00 2.60 ? 14 ARG A HD3  1 
ATOM   242 H  HE   . ARG A 1 14 ? 7.488   -11.620 2.304  1.00 2.87 ? 14 ARG A HE   1 
ATOM   243 H  HH11 . ARG A 1 14 ? 4.831   -11.629 0.380  1.00 3.52 ? 14 ARG A HH11 1 
ATOM   244 H  HH12 . ARG A 1 14 ? 5.585   -12.309 -1.023 1.00 4.28 ? 14 ARG A HH12 1 
ATOM   245 H  HH21 . ARG A 1 14 ? 8.806   -11.957 0.212  1.00 4.06 ? 14 ARG A HH21 1 
ATOM   246 H  HH22 . ARG A 1 14 ? 7.836   -12.496 -1.118 1.00 4.58 ? 14 ARG A HH22 1 
ATOM   247 N  N    . SER A 1 15 ? 4.831   -6.825  -1.526 1.00 0.72 ? 15 SER A N    1 
ATOM   248 C  CA   . SER A 1 15 ? 3.731   -6.285  -2.375 1.00 0.70 ? 15 SER A CA   1 
ATOM   249 C  C    . SER A 1 15 ? 2.387   -6.800  -1.857 1.00 0.61 ? 15 SER A C    1 
ATOM   250 O  O    . SER A 1 15 ? 1.354   -6.203  -2.084 1.00 0.71 ? 15 SER A O    1 
ATOM   251 C  CB   . SER A 1 15 ? 3.931   -6.744  -3.819 1.00 0.94 ? 15 SER A CB   1 
ATOM   252 O  OG   . SER A 1 15 ? 3.632   -8.130  -3.917 1.00 1.38 ? 15 SER A OG   1 
ATOM   253 H  H    . SER A 1 15 ? 5.070   -7.774  -1.579 1.00 0.86 ? 15 SER A H    1 
ATOM   254 H  HA   . SER A 1 15 ? 3.742   -5.205  -2.334 1.00 0.71 ? 15 SER A HA   1 
ATOM   255 H  HB2  . SER A 1 15 ? 3.272   -6.192  -4.469 1.00 1.59 ? 15 SER A HB2  1 
ATOM   256 H  HB3  . SER A 1 15 ? 4.957   -6.564  -4.114 1.00 1.49 ? 15 SER A HB3  1 
ATOM   257 H  HG   . SER A 1 15 ? 2.767   -8.219  -4.323 1.00 1.72 ? 15 SER A HG   1 
ATOM   258 N  N    . ASP A 1 16 ? 2.392   -7.906  -1.164 1.00 0.58 ? 16 ASP A N    1 
ATOM   259 C  CA   . ASP A 1 16 ? 1.114   -8.456  -0.633 1.00 0.67 ? 16 ASP A CA   1 
ATOM   260 C  C    . ASP A 1 16 ? 0.645   -7.601  0.546  1.00 0.69 ? 16 ASP A C    1 
ATOM   261 O  O    . ASP A 1 16 ? -0.284  -6.827  0.432  1.00 0.79 ? 16 ASP A O    1 
ATOM   262 C  CB   . ASP A 1 16 ? 1.333   -9.897  -0.166 1.00 0.78 ? 16 ASP A CB   1 
ATOM   263 C  CG   . ASP A 1 16 ? 1.549   -10.800 -1.381 1.00 1.48 ? 16 ASP A CG   1 
ATOM   264 O  OD1  . ASP A 1 16 ? 2.592   -10.684 -2.004 1.00 2.17 ? 16 ASP A OD1  1 
ATOM   265 O  OD2  . ASP A 1 16 ? 0.668   -11.593 -1.669 1.00 2.12 ? 16 ASP A OD2  1 
ATOM   266 H  H    . ASP A 1 16 ? 3.236   -8.373  -0.992 1.00 0.61 ? 16 ASP A H    1 
ATOM   267 H  HA   . ASP A 1 16 ? 0.364   -8.439  -1.410 1.00 0.77 ? 16 ASP A HA   1 
ATOM   268 H  HB2  . ASP A 1 16 ? 2.203   -9.939  0.475  1.00 1.10 ? 16 ASP A HB2  1 
ATOM   269 H  HB3  . ASP A 1 16 ? 0.466   -10.234 0.382  1.00 1.16 ? 16 ASP A HB3  1 
ATOM   270 N  N    . HIS A 1 17 ? 1.282   -7.731  1.678  1.00 0.73 ? 17 HIS A N    1 
ATOM   271 C  CA   . HIS A 1 17 ? 0.872   -6.922  2.860  1.00 0.84 ? 17 HIS A CA   1 
ATOM   272 C  C    . HIS A 1 17 ? 0.874   -5.439  2.486  1.00 0.74 ? 17 HIS A C    1 
ATOM   273 O  O    . HIS A 1 17 ? 0.126   -4.650  3.028  1.00 0.87 ? 17 HIS A O    1 
ATOM   274 C  CB   . HIS A 1 17 ? 1.857   -7.160  4.008  1.00 0.98 ? 17 HIS A CB   1 
ATOM   275 C  CG   . HIS A 1 17 ? 1.110   -7.639  5.222  1.00 1.47 ? 17 HIS A CG   1 
ATOM   276 N  ND1  . HIS A 1 17 ? 0.115   -6.884  5.825  1.00 2.16 ? 17 HIS A ND1  1 
ATOM   277 C  CD2  . HIS A 1 17 ? 1.202   -8.794  5.959  1.00 2.26 ? 17 HIS A CD2  1 
ATOM   278 C  CE1  . HIS A 1 17 ? -0.347  -7.587  6.875  1.00 2.81 ? 17 HIS A CE1  1 
ATOM   279 N  NE2  . HIS A 1 17 ? 0.281   -8.759  7.002  1.00 2.86 ? 17 HIS A NE2  1 
ATOM   280 H  H    . HIS A 1 17 ? 2.031   -8.359  1.749  1.00 0.77 ? 17 HIS A H    1 
ATOM   281 H  HA   . HIS A 1 17 ? -0.121  -7.214  3.170  1.00 0.97 ? 17 HIS A HA   1 
ATOM   282 H  HB2  . HIS A 1 17 ? 2.579   -7.907  3.713  1.00 1.32 ? 17 HIS A HB2  1 
ATOM   283 H  HB3  . HIS A 1 17 ? 2.368   -6.238  4.241  1.00 1.20 ? 17 HIS A HB3  1 
ATOM   284 H  HD1  . HIS A 1 17 ? -0.195  -6.000  5.538  1.00 2.56 ? 17 HIS A HD1  1 
ATOM   285 H  HD2  . HIS A 1 17 ? 1.886   -9.605  5.759  1.00 2.80 ? 17 HIS A HD2  1 
ATOM   286 H  HE1  . HIS A 1 17 ? -1.131  -7.246  7.535  1.00 3.56 ? 17 HIS A HE1  1 
ATOM   287 N  N    . LEU A 1 18 ? 1.710   -5.054  1.561  1.00 0.56 ? 18 LEU A N    1 
ATOM   288 C  CA   . LEU A 1 18 ? 1.762   -3.622  1.149  1.00 0.53 ? 18 LEU A CA   1 
ATOM   289 C  C    . LEU A 1 18 ? 0.483   -3.268  0.385  1.00 0.64 ? 18 LEU A C    1 
ATOM   290 O  O    . LEU A 1 18 ? -0.084  -2.209  0.563  1.00 0.74 ? 18 LEU A O    1 
ATOM   291 C  CB   . LEU A 1 18 ? 2.987   -3.400  0.253  1.00 0.48 ? 18 LEU A CB   1 
ATOM   292 C  CG   . LEU A 1 18 ? 2.837   -2.095  -0.535 1.00 0.56 ? 18 LEU A CG   1 
ATOM   293 C  CD1  . LEU A 1 18 ? 2.353   -0.981  0.396  1.00 1.39 ? 18 LEU A CD1  1 
ATOM   294 C  CD2  . LEU A 1 18 ? 4.191   -1.703  -1.131 1.00 1.28 ? 18 LEU A CD2  1 
ATOM   295 H  H    . LEU A 1 18 ? 2.305   -5.707  1.136  1.00 0.51 ? 18 LEU A H    1 
ATOM   296 H  HA   . LEU A 1 18 ? 1.840   -2.999  2.027  1.00 0.58 ? 18 LEU A HA   1 
ATOM   297 H  HB2  . LEU A 1 18 ? 3.874   -3.347  0.867  1.00 0.53 ? 18 LEU A HB2  1 
ATOM   298 H  HB3  . LEU A 1 18 ? 3.080   -4.225  -0.438 1.00 0.51 ? 18 LEU A HB3  1 
ATOM   299 H  HG   . LEU A 1 18 ? 2.119   -2.236  -1.330 1.00 1.21 ? 18 LEU A HG   1 
ATOM   300 H  HD11 . LEU A 1 18 ? 2.402   -1.320  1.420  1.00 1.89 ? 18 LEU A HD11 1 
ATOM   301 H  HD12 . LEU A 1 18 ? 2.983   -0.112  0.275  1.00 1.89 ? 18 LEU A HD12 1 
ATOM   302 H  HD13 . LEU A 1 18 ? 1.334   -0.723  0.150  1.00 2.00 ? 18 LEU A HD13 1 
ATOM   303 H  HD21 . LEU A 1 18 ? 4.956   -1.788  -0.374 1.00 1.94 ? 18 LEU A HD21 1 
ATOM   304 H  HD22 . LEU A 1 18 ? 4.425   -2.361  -1.955 1.00 1.64 ? 18 LEU A HD22 1 
ATOM   305 H  HD23 . LEU A 1 18 ? 4.146   -0.684  -1.485 1.00 1.94 ? 18 LEU A HD23 1 
ATOM   306 N  N    . SER A 1 19 ? 0.024   -4.145  -0.464 1.00 0.75 ? 19 SER A N    1 
ATOM   307 C  CA   . SER A 1 19 ? -1.216  -3.854  -1.236 1.00 0.94 ? 19 SER A CA   1 
ATOM   308 C  C    . SER A 1 19 ? -2.415  -3.812  -0.285 1.00 1.06 ? 19 SER A C    1 
ATOM   309 O  O    . SER A 1 19 ? -3.168  -2.859  -0.262 1.00 1.21 ? 19 SER A O    1 
ATOM   310 C  CB   . SER A 1 19 ? -1.433  -4.948  -2.281 1.00 1.03 ? 19 SER A CB   1 
ATOM   311 O  OG   . SER A 1 19 ? -2.547  -4.605  -3.095 1.00 1.61 ? 19 SER A OG   1 
ATOM   312 H  H    . SER A 1 19 ? 0.495   -4.995  -0.594 1.00 0.77 ? 19 SER A H    1 
ATOM   313 H  HA   . SER A 1 19 ? -1.116  -2.899  -1.730 1.00 0.97 ? 19 SER A HA   1 
ATOM   314 H  HB2  . SER A 1 19 ? -0.556  -5.037  -2.900 1.00 1.17 ? 19 SER A HB2  1 
ATOM   315 H  HB3  . SER A 1 19 ? -1.616  -5.891  -1.782 1.00 1.52 ? 19 SER A HB3  1 
ATOM   316 H  HG   . SER A 1 19 ? -2.453  -5.061  -3.935 1.00 2.01 ? 19 SER A HG   1 
ATOM   317 N  N    . LYS A 1 20 ? -2.599  -4.838  0.501  1.00 1.05 ? 20 LYS A N    1 
ATOM   318 C  CA   . LYS A 1 20 ? -3.749  -4.855  1.448  1.00 1.23 ? 20 LYS A CA   1 
ATOM   319 C  C    . LYS A 1 20 ? -3.831  -3.509  2.172  1.00 1.19 ? 20 LYS A C    1 
ATOM   320 O  O    . LYS A 1 20 ? -4.899  -2.965  2.372  1.00 1.38 ? 20 LYS A O    1 
ATOM   321 C  CB   . LYS A 1 20 ? -3.550  -5.975  2.472  1.00 1.28 ? 20 LYS A CB   1 
ATOM   322 C  CG   . LYS A 1 20 ? -4.608  -7.059  2.258  1.00 1.75 ? 20 LYS A CG   1 
ATOM   323 C  CD   . LYS A 1 20 ? -4.247  -8.296  3.082  1.00 2.02 ? 20 LYS A CD   1 
ATOM   324 C  CE   . LYS A 1 20 ? -4.324  -9.541  2.197  1.00 2.70 ? 20 LYS A CE   1 
ATOM   325 N  NZ   . LYS A 1 20 ? -5.744  -9.796  1.820  1.00 3.23 ? 20 LYS A NZ   1 
ATOM   326 H  H    . LYS A 1 20 ? -1.981  -5.598  0.468  1.00 0.96 ? 20 LYS A H    1 
ATOM   327 H  HA   . LYS A 1 20 ? -4.664  -5.025  0.901  1.00 1.38 ? 20 LYS A HA   1 
ATOM   328 H  HB2  . LYS A 1 20 ? -2.565  -6.403  2.349  1.00 1.48 ? 20 LYS A HB2  1 
ATOM   329 H  HB3  . LYS A 1 20 ? -3.646  -5.573  3.469  1.00 1.52 ? 20 LYS A HB3  1 
ATOM   330 H  HG2  . LYS A 1 20 ? -5.573  -6.686  2.570  1.00 2.25 ? 20 LYS A HG2  1 
ATOM   331 H  HG3  . LYS A 1 20 ? -4.645  -7.324  1.212  1.00 2.19 ? 20 LYS A HG3  1 
ATOM   332 H  HD2  . LYS A 1 20 ? -3.244  -8.189  3.470  1.00 2.31 ? 20 LYS A HD2  1 
ATOM   333 H  HD3  . LYS A 1 20 ? -4.941  -8.396  3.903  1.00 2.35 ? 20 LYS A HD3  1 
ATOM   334 H  HE2  . LYS A 1 20 ? -3.737  -9.384  1.304  1.00 3.15 ? 20 LYS A HE2  1 
ATOM   335 H  HE3  . LYS A 1 20 ? -3.937  -10.391 2.738  1.00 3.04 ? 20 LYS A HE3  1 
ATOM   336 H  HZ1  . LYS A 1 20 ? -6.303  -8.933  1.969  1.00 3.49 ? 20 LYS A HZ1  1 
ATOM   337 H  HZ2  . LYS A 1 20 ? -5.793  -10.070 0.818  1.00 3.75 ? 20 LYS A HZ2  1 
ATOM   338 H  HZ3  . LYS A 1 20 ? -6.125  -10.565 2.409  1.00 3.38 ? 20 LYS A HZ3  1 
ATOM   339 N  N    . HIS A 1 21 ? -2.711  -2.968  2.566  1.00 1.01 ? 21 HIS A N    1 
ATOM   340 C  CA   . HIS A 1 21 ? -2.724  -1.658  3.275  1.00 0.98 ? 21 HIS A CA   1 
ATOM   341 C  C    . HIS A 1 21 ? -3.352  -0.594  2.366  1.00 1.04 ? 21 HIS A C    1 
ATOM   342 O  O    . HIS A 1 21 ? -4.267  0.106   2.753  1.00 1.15 ? 21 HIS A O    1 
ATOM   343 C  CB   . HIS A 1 21 ? -1.282  -1.257  3.633  1.00 0.81 ? 21 HIS A CB   1 
ATOM   344 C  CG   . HIS A 1 21 ? -1.186  0.240   3.788  1.00 0.79 ? 21 HIS A CG   1 
ATOM   345 N  ND1  . HIS A 1 21 ? -1.499  0.883   4.975  1.00 0.88 ? 21 HIS A ND1  1 
ATOM   346 C  CD2  . HIS A 1 21 ? -0.849  1.232   2.900  1.00 0.77 ? 21 HIS A CD2  1 
ATOM   347 C  CE1  . HIS A 1 21 ? -1.350  2.204   4.770  1.00 0.88 ? 21 HIS A CE1  1 
ATOM   348 N  NE2  . HIS A 1 21 ? -0.958  2.471   3.521  1.00 0.82 ? 21 HIS A NE2  1 
ATOM   349 H  H    . HIS A 1 21 ? -1.860  -3.423  2.394  1.00 0.93 ? 21 HIS A H    1 
ATOM   350 H  HA   . HIS A 1 21 ? -3.308  -1.745  4.180  1.00 1.09 ? 21 HIS A HA   1 
ATOM   351 H  HB2  . HIS A 1 21 ? -0.998  -1.732  4.561  1.00 0.83 ? 21 HIS A HB2  1 
ATOM   352 H  HB3  . HIS A 1 21 ? -0.615  -1.580  2.848  1.00 0.73 ? 21 HIS A HB3  1 
ATOM   353 H  HD1  . HIS A 1 21 ? -1.777  0.453   5.811  1.00 0.97 ? 21 HIS A HD1  1 
ATOM   354 H  HD2  . HIS A 1 21 ? -0.538  1.076   1.878  1.00 0.76 ? 21 HIS A HD2  1 
ATOM   355 H  HE1  . HIS A 1 21 ? -1.527  2.957   5.523  1.00 0.97 ? 21 HIS A HE1  1 
ATOM   356 N  N    . ILE A 1 22 ? -2.856  -0.460  1.168  1.00 0.99 ? 22 ILE A N    1 
ATOM   357 C  CA   . ILE A 1 22 ? -3.413  0.566   0.242  1.00 1.09 ? 22 ILE A CA   1 
ATOM   358 C  C    . ILE A 1 22 ? -4.887  0.264   -0.039 1.00 1.29 ? 22 ILE A C    1 
ATOM   359 O  O    . ILE A 1 22 ? -5.626  1.112   -0.498 1.00 1.41 ? 22 ILE A O    1 
ATOM   360 C  CB   . ILE A 1 22 ? -2.631  0.550   -1.073 1.00 1.07 ? 22 ILE A CB   1 
ATOM   361 C  CG1  . ILE A 1 22 ? -1.129  0.667   -0.787 1.00 0.90 ? 22 ILE A CG1  1 
ATOM   362 C  CG2  . ILE A 1 22 ? -3.074  1.728   -1.942 1.00 1.21 ? 22 ILE A CG2  1 
ATOM   363 C  CD1  . ILE A 1 22 ? -0.344  0.373   -2.066 1.00 1.02 ? 22 ILE A CD1  1 
ATOM   364 H  H    . ILE A 1 22 ? -2.113  -1.029  0.880  1.00 0.91 ? 22 ILE A H    1 
ATOM   365 H  HA   . ILE A 1 22 ? -3.328  1.542   0.696  1.00 1.07 ? 22 ILE A HA   1 
ATOM   366 H  HB   . ILE A 1 22 ? -2.829  -0.373  -1.595 1.00 1.11 ? 22 ILE A HB   1 
ATOM   367 H  HG12 . ILE A 1 22 ? -0.903  1.666   -0.448 1.00 0.97 ? 22 ILE A HG12 1 
ATOM   368 H  HG13 . ILE A 1 22 ? -0.847  -0.043  -0.025 1.00 1.03 ? 22 ILE A HG13 1 
ATOM   369 H  HG21 . ILE A 1 22 ? -4.140  1.671   -2.108 1.00 1.53 ? 22 ILE A HG21 1 
ATOM   370 H  HG22 . ILE A 1 22 ? -2.838  2.655   -1.440 1.00 1.72 ? 22 ILE A HG22 1 
ATOM   371 H  HG23 . ILE A 1 22 ? -2.560  1.691   -2.890 1.00 1.54 ? 22 ILE A HG23 1 
ATOM   372 H  HD11 . ILE A 1 22 ? -0.928  0.675   -2.923 1.00 1.62 ? 22 ILE A HD11 1 
ATOM   373 H  HD12 . ILE A 1 22 ? 0.585   0.923   -2.052 1.00 1.61 ? 22 ILE A HD12 1 
ATOM   374 H  HD13 . ILE A 1 22 ? -0.136  -0.685  -2.126 1.00 1.17 ? 22 ILE A HD13 1 
ATOM   375 N  N    . LYS A 1 23 ? -5.320  -0.938  0.227  1.00 1.33 ? 23 LYS A N    1 
ATOM   376 C  CA   . LYS A 1 23 ? -6.746  -1.289  -0.031 1.00 1.53 ? 23 LYS A CA   1 
ATOM   377 C  C    . LYS A 1 23 ? -7.657  -0.472  0.887  1.00 1.63 ? 23 LYS A C    1 
ATOM   378 O  O    . LYS A 1 23 ? -8.782  -0.163  0.547  1.00 1.80 ? 23 LYS A O    1 
ATOM   379 C  CB   . LYS A 1 23 ? -6.960  -2.781  0.234  1.00 1.56 ? 23 LYS A CB   1 
ATOM   380 C  CG   . LYS A 1 23 ? -7.695  -3.412  -0.951 1.00 1.84 ? 23 LYS A CG   1 
ATOM   381 C  CD   . LYS A 1 23 ? -9.201  -3.402  -0.682 1.00 2.62 ? 23 LYS A CD   1 
ATOM   382 C  CE   . LYS A 1 23 ? -9.812  -4.722  -1.155 1.00 2.94 ? 23 LYS A CE   1 
ATOM   383 N  NZ   . LYS A 1 23 ? -9.325  -5.832  -0.289 1.00 3.68 ? 23 LYS A NZ   1 
ATOM   384 H  H    . LYS A 1 23 ? -4.707  -1.611  0.591  1.00 1.24 ? 23 LYS A H    1 
ATOM   385 H  HA   . LYS A 1 23 ? -6.987  -1.068  -1.056 1.00 1.60 ? 23 LYS A HA   1 
ATOM   386 H  HB2  . LYS A 1 23 ? -6.002  -3.264  0.363  1.00 1.55 ? 23 LYS A HB2  1 
ATOM   387 H  HB3  . LYS A 1 23 ? -7.550  -2.907  1.130  1.00 1.73 ? 23 LYS A HB3  1 
ATOM   388 H  HG2  . LYS A 1 23 ? -7.485  -2.846  -1.847 1.00 2.10 ? 23 LYS A HG2  1 
ATOM   389 H  HG3  . LYS A 1 23 ? -7.361  -4.430  -1.081 1.00 2.06 ? 23 LYS A HG3  1 
ATOM   390 H  HD2  . LYS A 1 23 ? -9.377  -3.282  0.378  1.00 3.14 ? 23 LYS A HD2  1 
ATOM   391 H  HD3  . LYS A 1 23 ? -9.658  -2.584  -1.218 1.00 3.09 ? 23 LYS A HD3  1 
ATOM   392 H  HE2  . LYS A 1 23 ? -10.889 -4.663  -1.093 1.00 3.21 ? 23 LYS A HE2  1 
ATOM   393 H  HE3  . LYS A 1 23 ? -9.520  -4.908  -2.178 1.00 3.08 ? 23 LYS A HE3  1 
ATOM   394 H  HZ1  . LYS A 1 23 ? -9.366  -5.537  0.708  1.00 4.05 ? 23 LYS A HZ1  1 
ATOM   395 H  HZ2  . LYS A 1 23 ? -9.924  -6.670  -0.428 1.00 3.93 ? 23 LYS A HZ2  1 
ATOM   396 H  HZ3  . LYS A 1 23 ? -8.344  -6.065  -0.543 1.00 4.06 ? 23 LYS A HZ3  1 
ATOM   397 N  N    . THR A 1 24 ? -7.181  -0.119  2.046  1.00 1.55 ? 24 THR A N    1 
ATOM   398 C  CA   . THR A 1 24 ? -8.019  0.679   2.986  1.00 1.68 ? 24 THR A CA   1 
ATOM   399 C  C    . THR A 1 24 ? -7.968  2.155   2.586  1.00 1.69 ? 24 THR A C    1 
ATOM   400 O  O    . THR A 1 24 ? -8.699  2.975   3.106  1.00 1.81 ? 24 THR A O    1 
ATOM   401 C  CB   . THR A 1 24 ? -7.485  0.517   4.411  1.00 1.62 ? 24 THR A CB   1 
ATOM   402 O  OG1  . THR A 1 24 ? -6.408  1.420   4.619  1.00 1.81 ? 24 THR A OG1  1 
ATOM   403 C  CG2  . THR A 1 24 ? -6.996  -0.918  4.615  1.00 1.82 ? 24 THR A CG2  1 
ATOM   404 H  H    . THR A 1 24 ? -6.273  -0.377  2.298  1.00 1.44 ? 24 THR A H    1 
ATOM   405 H  HA   . THR A 1 24 ? -9.040  0.330   2.942  1.00 1.82 ? 24 THR A HA   1 
ATOM   406 H  HB   . THR A 1 24 ? -8.273  0.727   5.118  1.00 1.86 ? 24 THR A HB   1 
ATOM   407 H  HG1  . THR A 1 24 ? -6.020  1.621   3.764  1.00 1.93 ? 24 THR A HG1  1 
ATOM   408 H  HG21 . THR A 1 24 ? -7.351  -1.538  3.804  1.00 2.34 ? 24 THR A HG21 1 
ATOM   409 H  HG22 . THR A 1 24 ? -5.917  -0.931  4.632  1.00 2.07 ? 24 THR A HG22 1 
ATOM   410 H  HG23 . THR A 1 24 ? -7.376  -1.298  5.552  1.00 2.10 ? 24 THR A HG23 1 
ATOM   411 N  N    . HIS A 1 25 ? -7.111  2.500   1.664  1.00 1.58 ? 25 HIS A N    1 
ATOM   412 C  CA   . HIS A 1 25 ? -7.015  3.922   1.229  1.00 1.62 ? 25 HIS A CA   1 
ATOM   413 C  C    . HIS A 1 25 ? -8.141  4.225   0.239  1.00 1.85 ? 25 HIS A C    1 
ATOM   414 O  O    . HIS A 1 25 ? -8.514  5.363   0.036  1.00 2.01 ? 25 HIS A O    1 
ATOM   415 C  CB   . HIS A 1 25 ? -5.665  4.157   0.549  1.00 1.48 ? 25 HIS A CB   1 
ATOM   416 C  CG   . HIS A 1 25 ? -4.675  4.689   1.550  1.00 1.30 ? 25 HIS A CG   1 
ATOM   417 N  ND1  . HIS A 1 25 ? -4.949  5.786   2.353  1.00 1.33 ? 25 HIS A ND1  1 
ATOM   418 C  CD2  . HIS A 1 25 ? -3.402  4.293   1.878  1.00 1.11 ? 25 HIS A CD2  1 
ATOM   419 C  CE1  . HIS A 1 25 ? -3.862  6.011   3.116  1.00 1.19 ? 25 HIS A CE1  1 
ATOM   420 N  NE2  . HIS A 1 25 ? -2.890  5.131   2.866  1.00 1.04 ? 25 HIS A NE2  1 
ATOM   421 H  H    . HIS A 1 25 ? -6.532  1.824   1.256  1.00 1.49 ? 25 HIS A H    1 
ATOM   422 H  HA   . HIS A 1 25 ? -7.106  4.569   2.088  1.00 1.61 ? 25 HIS A HA   1 
ATOM   423 H  HB2  . HIS A 1 25 ? -5.301  3.225   0.144  1.00 1.43 ? 25 HIS A HB2  1 
ATOM   424 H  HB3  . HIS A 1 25 ? -5.786  4.873   -0.251 1.00 1.59 ? 25 HIS A HB3  1 
ATOM   425 H  HD1  . HIS A 1 25 ? -5.781  6.302   2.364  1.00 1.46 ? 25 HIS A HD1  1 
ATOM   426 H  HD2  . HIS A 1 25 ? -2.882  3.450   1.442  1.00 1.05 ? 25 HIS A HD2  1 
ATOM   427 H  HE1  . HIS A 1 25 ? -3.785  6.809   3.841  1.00 1.21 ? 25 HIS A HE1  1 
ATOM   428 N  N    . GLN A 1 26 ? -8.683  3.213   -0.381 1.00 1.88 ? 26 GLN A N    1 
ATOM   429 C  CA   . GLN A 1 26 ? -9.784  3.440   -1.360 1.00 2.11 ? 26 GLN A CA   1 
ATOM   430 C  C    . GLN A 1 26 ? -11.003 2.611   -0.959 1.00 1.38 ? 26 GLN A C    1 
ATOM   431 O  O    . GLN A 1 26 ? -11.412 1.708   -1.661 1.00 2.06 ? 26 GLN A O    1 
ATOM   432 C  CB   . GLN A 1 26 ? -9.325  3.013   -2.749 1.00 3.28 ? 26 GLN A CB   1 
ATOM   433 C  CG   . GLN A 1 26 ? -9.297  4.229   -3.676 1.00 4.24 ? 26 GLN A CG   1 
ATOM   434 C  CD   . GLN A 1 26 ? -8.043  5.058   -3.395 1.00 5.23 ? 26 GLN A CD   1 
ATOM   435 O  OE1  . GLN A 1 26 ? -7.306  4.772   -2.472 1.00 5.80 ? 26 GLN A OE1  1 
ATOM   436 N  NE2  . GLN A 1 26 ? -7.768  6.081   -4.156 1.00 5.78 ? 26 GLN A NE2  1 
ATOM   437 H  H    . GLN A 1 26 ? -8.366  2.303   -0.203 1.00 1.77 ? 26 GLN A H    1 
ATOM   438 H  HA   . GLN A 1 26 ? -10.047 4.487   -1.372 1.00 2.53 ? 26 GLN A HA   1 
ATOM   439 H  HB2  . GLN A 1 26 ? -8.336  2.585   -2.681 1.00 3.67 ? 26 GLN A HB2  1 
ATOM   440 H  HB3  . GLN A 1 26 ? -10.011 2.278   -3.140 1.00 3.48 ? 26 GLN A HB3  1 
ATOM   441 H  HG2  . GLN A 1 26 ? -9.288  3.897   -4.704 1.00 4.35 ? 26 GLN A HG2  1 
ATOM   442 H  HG3  . GLN A 1 26 ? -10.174 4.834   -3.501 1.00 4.51 ? 26 GLN A HG3  1 
ATOM   443 H  HE21 . GLN A 1 26 ? -8.363  6.312   -4.900 1.00 5.64 ? 26 GLN A HE21 1 
ATOM   444 H  HE22 . GLN A 1 26 ? -6.967  6.619   -3.984 1.00 6.53 ? 26 GLN A HE22 1 
ATOM   445 N  N    . ASN A 1 27 ? -11.582 2.910   0.164  1.00 1.29 ? 27 ASN A N    1 
ATOM   446 C  CA   . ASN A 1 27 ? -12.776 2.143   0.619  1.00 2.11 ? 27 ASN A CA   1 
ATOM   447 C  C    . ASN A 1 27 ? -13.863 2.201   -0.457 1.00 2.31 ? 27 ASN A C    1 
ATOM   448 O  O    . ASN A 1 27 ? -14.235 3.261   -0.918 1.00 2.39 ? 27 ASN A O    1 
ATOM   449 C  CB   . ASN A 1 27 ? -13.307 2.754   1.917  1.00 3.10 ? 27 ASN A CB   1 
ATOM   450 C  CG   . ASN A 1 27 ? -14.118 1.705   2.680  1.00 4.04 ? 27 ASN A CG   1 
ATOM   451 O  OD1  . ASN A 1 27 ? -14.636 0.775   2.094  1.00 4.56 ? 27 ASN A OD1  1 
ATOM   452 N  ND2  . ASN A 1 27 ? -14.250 1.816   3.974  1.00 4.72 ? 27 ASN A ND2  1 
ATOM   453 H  H    . ASN A 1 27 ? -11.230 3.641   0.710  1.00 1.66 ? 27 ASN A H    1 
ATOM   454 H  HA   . ASN A 1 27 ? -12.496 1.115   0.794  1.00 2.70 ? 27 ASN A HA   1 
ATOM   455 H  HB2  . ASN A 1 27 ? -12.478 3.081   2.527  1.00 3.28 ? 27 ASN A HB2  1 
ATOM   456 H  HB3  . ASN A 1 27 ? -13.940 3.597   1.687  1.00 3.56 ? 27 ASN A HB3  1 
ATOM   457 H  HD21 . ASN A 1 27 ? -13.832 2.566   4.446  1.00 4.68 ? 27 ASN A HD21 1 
ATOM   458 H  HD22 . ASN A 1 27 ? -14.767 1.150   4.473  1.00 5.50 ? 27 ASN A HD22 1 
ATOM   459 N  N    . LYS A 1 28 ? -14.371 1.064   -0.859 1.00 3.13 ? 28 LYS A N    1 
ATOM   460 C  CA   . LYS A 1 28 ? -15.435 1.033   -1.907 1.00 3.87 ? 28 LYS A CA   1 
ATOM   461 C  C    . LYS A 1 28 ? -15.078 1.995   -3.044 1.00 4.35 ? 28 LYS A C    1 
ATOM   462 O  O    . LYS A 1 28 ? -13.988 2.530   -3.095 1.00 4.69 ? 28 LYS A O    1 
ATOM   463 C  CB   . LYS A 1 28 ? -16.782 1.433   -1.293 1.00 4.61 ? 28 LYS A CB   1 
ATOM   464 C  CG   . LYS A 1 28 ? -16.761 2.913   -0.906 1.00 5.29 ? 28 LYS A CG   1 
ATOM   465 C  CD   . LYS A 1 28 ? -18.195 3.427   -0.767 1.00 6.12 ? 28 LYS A CD   1 
ATOM   466 C  CE   . LYS A 1 28 ? -18.237 4.548   0.274  1.00 6.76 ? 28 LYS A CE   1 
ATOM   467 N  NZ   . LYS A 1 28 ? -19.638 5.033   0.429  1.00 7.40 ? 28 LYS A NZ   1 
ATOM   468 H  H    . LYS A 1 28 ? -14.050 0.224   -0.469 1.00 3.55 ? 28 LYS A H    1 
ATOM   469 H  HA   . LYS A 1 28 ? -15.510 0.031   -2.304 1.00 4.08 ? 28 LYS A HA   1 
ATOM   470 H  HB2  . LYS A 1 28 ? -17.569 1.263   -2.015 1.00 4.85 ? 28 LYS A HB2  1 
ATOM   471 H  HB3  . LYS A 1 28 ? -16.967 0.835   -0.413 1.00 4.91 ? 28 LYS A HB3  1 
ATOM   472 H  HG2  . LYS A 1 28 ? -16.243 3.030   0.036  1.00 5.49 ? 28 LYS A HG2  1 
ATOM   473 H  HG3  . LYS A 1 28 ? -16.250 3.478   -1.670 1.00 5.43 ? 28 LYS A HG3  1 
ATOM   474 H  HD2  . LYS A 1 28 ? -18.535 3.806   -1.720 1.00 6.24 ? 28 LYS A HD2  1 
ATOM   475 H  HD3  . LYS A 1 28 ? -18.839 2.620   -0.450 1.00 6.49 ? 28 LYS A HD3  1 
ATOM   476 H  HE2  . LYS A 1 28 ? -17.878 4.173   1.221  1.00 6.96 ? 28 LYS A HE2  1 
ATOM   477 H  HE3  . LYS A 1 28 ? -17.608 5.364   -0.052 1.00 6.90 ? 28 LYS A HE3  1 
ATOM   478 H  HZ1  . LYS A 1 28 ? -20.296 4.317   0.062  1.00 7.89 ? 28 LYS A HZ1  1 
ATOM   479 H  HZ2  . LYS A 1 28 ? -19.837 5.200   1.436  1.00 7.53 ? 28 LYS A HZ2  1 
ATOM   480 H  HZ3  . LYS A 1 28 ? -19.758 5.920   -0.101 1.00 7.48 ? 28 LYS A HZ3  1 
ATOM   481 N  N    . LYS A 1 29 ? -15.991 2.209   -3.957 1.00 4.87 ? 29 LYS A N    1 
ATOM   482 C  CA   . LYS A 1 29 ? -15.721 3.130   -5.102 1.00 5.76 ? 29 LYS A CA   1 
ATOM   483 C  C    . LYS A 1 29 ? -14.275 2.966   -5.575 1.00 6.47 ? 29 LYS A C    1 
ATOM   484 O  O    . LYS A 1 29 ? -13.743 3.913   -6.128 1.00 6.56 ? 29 LYS A O    1 
ATOM   485 C  CB   . LYS A 1 29 ? -15.955 4.576   -4.661 1.00 6.23 ? 29 LYS A CB   1 
ATOM   486 C  CG   . LYS A 1 29 ? -14.824 5.020   -3.733 1.00 6.79 ? 29 LYS A CG   1 
ATOM   487 C  CD   . LYS A 1 29 ? -15.012 6.493   -3.371 1.00 7.46 ? 29 LYS A CD   1 
ATOM   488 C  CE   . LYS A 1 29 ? -16.220 6.639   -2.444 1.00 8.45 ? 29 LYS A CE   1 
ATOM   489 N  NZ   . LYS A 1 29 ? -16.695 8.051   -2.467 1.00 9.11 ? 29 LYS A NZ   1 
ATOM   490 O  OXT  . LYS A 1 29 ? -13.724 1.896   -5.373 1.00 7.19 ? 29 LYS A OXT  1 
ATOM   491 H  H    . LYS A 1 29 ? -16.859 1.758   -3.891 1.00 4.93 ? 29 LYS A H    1 
ATOM   492 H  HA   . LYS A 1 29 ? -16.391 2.892   -5.915 1.00 5.95 ? 29 LYS A HA   1 
ATOM   493 H  HB2  . LYS A 1 29 ? -15.981 5.217   -5.531 1.00 6.23 ? 29 LYS A HB2  1 
ATOM   494 H  HB3  . LYS A 1 29 ? -16.896 4.644   -4.136 1.00 6.57 ? 29 LYS A HB3  1 
ATOM   495 H  HG2  . LYS A 1 29 ? -14.841 4.422   -2.833 1.00 6.87 ? 29 LYS A HG2  1 
ATOM   496 H  HG3  . LYS A 1 29 ? -13.876 4.892   -4.233 1.00 6.99 ? 29 LYS A HG3  1 
ATOM   497 H  HD2  . LYS A 1 29 ? -14.126 6.857   -2.871 1.00 7.51 ? 29 LYS A HD2  1 
ATOM   498 H  HD3  . LYS A 1 29 ? -15.180 7.066   -4.270 1.00 7.45 ? 29 LYS A HD3  1 
ATOM   499 H  HE2  . LYS A 1 29 ? -17.013 5.987   -2.779 1.00 8.61 ? 29 LYS A HE2  1 
ATOM   500 H  HE3  . LYS A 1 29 ? -15.935 6.372   -1.437 1.00 8.77 ? 29 LYS A HE3  1 
ATOM   501 H  HZ1  . LYS A 1 29 ? -15.886 8.692   -2.347 1.00 9.23 ? 29 LYS A HZ1  1 
ATOM   502 H  HZ2  . LYS A 1 29 ? -17.161 8.245   -3.378 1.00 9.48 ? 29 LYS A HZ2  1 
ATOM   503 H  HZ3  . LYS A 1 29 ? -17.372 8.203   -1.693 1.00 9.28 ? 29 LYS A HZ3  1 
HETATM 504 ZN ZN   . ZN  B 2 .  ? -0.998  4.266   2.578  1.00 0.81 ? 30 ZN  A ZN   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  LYS 1  1  1  LYS LYS A . n 
A 1 2  LYS 2  2  2  LYS LYS A . n 
A 1 3  PHE 3  3  3  PHE PHE A . n 
A 1 4  ALA 4  4  4  ALA ALA A . n 
A 1 5  CYS 5  5  5  CYS CYS A . n 
A 1 6  PRO 6  6  6  PRO PRO A . n 
A 1 7  GLU 7  7  7  GLU GLU A . n 
A 1 8  CYS 8  8  8  CYS CYS A . n 
A 1 9  PRO 9  9  9  PRO PRO A . n 
A 1 10 LYS 10 10 10 LYS LYS A . n 
A 1 11 ARG 11 11 11 ARG ARG A . n 
A 1 12 PHE 12 12 12 PHE PHE A . n 
A 1 13 MET 13 13 13 MET MET A . n 
A 1 14 ARG 14 14 14 ARG ARG A . n 
A 1 15 SER 15 15 15 SER SER A . n 
A 1 16 ASP 16 16 16 ASP ASP A . n 
A 1 17 HIS 17 17 17 HIS HIS A . n 
A 1 18 LEU 18 18 18 LEU LEU A . n 
A 1 19 SER 19 19 19 SER SER A . n 
A 1 20 LYS 20 20 20 LYS LYS A . n 
A 1 21 HIS 21 21 21 HIS HIS A . n 
A 1 22 ILE 22 22 22 ILE ILE A . n 
A 1 23 LYS 23 23 23 LYS LYS A . n 
A 1 24 THR 24 24 24 THR THR A . n 
A 1 25 HIS 25 25 25 HIS HIS A . n 
A 1 26 GLN 26 26 26 GLN GLN A . n 
A 1 27 ASN 27 27 27 ASN ASN A . n 
A 1 28 LYS 28 28 28 LYS LYS A . n 
A 1 29 LYS 29 29 29 LYS LYS A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          ZN 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     30 
_pdbx_nonpoly_scheme.auth_seq_num    30 
_pdbx_nonpoly_scheme.pdb_mon_id      ZN 
_pdbx_nonpoly_scheme.auth_mon_id     ZN 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG  ? A CYS 5  ? A CYS 5  ? 1_555 ZN ? B ZN . ? A ZN 30 ? 1_555 SG  ? A CYS 8  ? A CYS 8  ? 1_555 109.9 ? 
2 SG  ? A CYS 5  ? A CYS 5  ? 1_555 ZN ? B ZN . ? A ZN 30 ? 1_555 NE2 ? A HIS 21 ? A HIS 21 ? 1_555 111.2 ? 
3 SG  ? A CYS 8  ? A CYS 8  ? 1_555 ZN ? B ZN . ? A ZN 30 ? 1_555 NE2 ? A HIS 21 ? A HIS 21 ? 1_555 110.7 ? 
4 SG  ? A CYS 5  ? A CYS 5  ? 1_555 ZN ? B ZN . ? A ZN 30 ? 1_555 NE2 ? A HIS 25 ? A HIS 25 ? 1_555 106.9 ? 
5 SG  ? A CYS 8  ? A CYS 8  ? 1_555 ZN ? B ZN . ? A ZN 30 ? 1_555 NE2 ? A HIS 25 ? A HIS 25 ? 1_555 109.4 ? 
6 NE2 ? A HIS 21 ? A HIS 21 ? 1_555 ZN ? B ZN . ? A ZN 30 ? 1_555 NE2 ? A HIS 25 ? A HIS 25 ? 1_555 108.6 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-04-21 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
X-PLOR phasing          . ? 3 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 2  ? ? 53.18  -163.29 
2 1 ALA A 4  ? ? 171.48 139.84  
3 1 CYS A 5  ? ? -38.31 100.74  
4 1 PRO A 9  ? ? -65.61 80.18   
5 1 ASP A 16 ? ? -73.59 -74.30  
6 1 LYS A 28 ? ? 43.89  -171.56 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 ARG A 11 ? ? 0.316 'SIDE CHAIN' 
2 1 ARG A 14 ? ? 0.232 'SIDE CHAIN' 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'ZINC ION' 
_pdbx_entity_nonpoly.comp_id     ZN 
#