data_1SP2
# 
_entry.id   1SP2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SP2         
WWPDB D_1000176456 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SP2 
_pdbx_database_status.recvd_initial_deposition_date   1996-11-21 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Narayan, V.A.'   1 
'Kriwacki, R.W.'  2 
'Caradonna, J.P.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Structures of zinc finger domains from transcription factor Sp1. Insights into sequence-specific protein-DNA recognition.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            272 
_citation.page_first                7801 
_citation.page_last                 7809 
_citation.year                      1997 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9065444 
_citation.pdbx_database_id_DOI      10.1074/jbc.272.12.7801 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Narayan, V.A.'   1 
primary 'Kriwacki, R.W.'  2 
primary 'Caradonna, J.P.' 3 
# 
_cell.entry_id           1SP2 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SP2 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man SP1F2      3853.421 1 ? ? 'ZINC FINGER DNA BINDING DOMAIN' 
'DOES NOT BIND DNA SPECIFICALLY AS A SINGLE ZINC FINGER' 
2 non-polymer syn 'ZINC ION' 65.409   1 ? ? ?                                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'TRANSCRIPTION FACTOR SP1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       RPFMCTWSYCGKRFTRSDELQRHKRTHTGEK 
_entity_poly.pdbx_seq_one_letter_code_can   RPFMCTWSYCGKRFTRSDELQRHKRTHTGEK 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ARG n 
1 2  PRO n 
1 3  PHE n 
1 4  MET n 
1 5  CYS n 
1 6  THR n 
1 7  TRP n 
1 8  SER n 
1 9  TYR n 
1 10 CYS n 
1 11 GLY n 
1 12 LYS n 
1 13 ARG n 
1 14 PHE n 
1 15 THR n 
1 16 ARG n 
1 17 SER n 
1 18 ASP n 
1 19 GLU n 
1 20 LEU n 
1 21 GLN n 
1 22 ARG n 
1 23 HIS n 
1 24 LYS n 
1 25 ARG n 
1 26 THR n 
1 27 HIS n 
1 28 THR n 
1 29 GLY n 
1 30 GLU n 
1 31 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    NUCLEOPLASM 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SP1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P08047 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;TGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMP
NIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQ
TQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVTSGTTISSASLVSSQASSSSFFTNANSYST
TTTTSNMGIMNFTTSGSSGTNSQGQTPQRVSGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGG
QALQALQAAPLSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQG
VSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHG
AGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRW
HTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSG
AGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINISGNGF
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1SP2 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 31 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P08047 
_struct_ref_seq.db_align_beg                  565 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  595 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       31 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 NOESY 1 
2 1 COSY  1 
3 1 TOCSY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         288 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  5.9 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
1 AM500 Bruker 500 
2 GE500 OMEGA  500 
# 
_pdbx_nmr_refine.entry_id           1SP2 
_pdbx_nmr_refine.method             'DISTANCE GEOMETRY, SIMULATED ANNEALING' 
_pdbx_nmr_refine.details            'MULTIPLE ROUNDS OF SIMULATED ANNEALING REFINEMENT PROTOCOL OF X-PLOR' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                             1SP2 
_pdbx_nmr_ensemble.conformers_calculated_total_number   100 
_pdbx_nmr_ensemble.conformers_submitted_total_number    1 
_pdbx_nmr_ensemble.conformer_selection_criteria         'MEAN STRUCTURE' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           X-PLOR ? BRUNGER 1 
'structure solution' FELIX  ? ?       2 
'structure solution' XPLOR  ? ?       3 
# 
_exptl.entry_id          1SP2 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1SP2 
_struct.title                     
'NMR STRUCTURE OF A ZINC FINGER DOMAIN FROM TRANSCRIPTION FACTOR SP1F2, MINIMIZED AVERAGE STRUCTURE' 
_struct.pdbx_descriptor           SP1F2 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SP2 
_struct_keywords.pdbx_keywords   'ZINC FINGER' 
_struct_keywords.text            'ZINC FINGER, TRANSCRIPTION ACTIVATION, SP1' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A Y N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       SER 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        17 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       THR 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        26 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        SER 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         17 
_struct_conf.end_auth_comp_id        THR 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         26 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 5  SG  ? ? A ZN 32 A CYS 5  1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 10 SG  ? ? A ZN 32 A CYS 10 1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 23 NE2 ? ? A ZN 32 A HIS 23 1_555 ? ? ? ? ? ? ? 2.033 ? 
metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 27 NE2 ? ? A ZN 32 A HIS 27 1_555 ? ? ? ? ? ? ? 2.124 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
S1  Unknown  ? ? ? ? 2 'PROPOSED DNA BINDING RESIDUES.'   
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 32' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 S1  2 ARG A 16 ? ARG A 16 . ? 1_555 ? 
2 S1  2 ARG A 22 ? ARG A 22 . ? 1_555 ? 
3 AC1 4 CYS A 5  ? CYS A 5  . ? 1_555 ? 
4 AC1 4 CYS A 10 ? CYS A 10 . ? 1_555 ? 
5 AC1 4 HIS A 23 ? HIS A 23 . ? 1_555 ? 
6 AC1 4 HIS A 27 ? HIS A 27 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1SP2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SP2 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N    . ARG A 1 1  ? 15.460  -0.980  -1.373 1.00 3.05 ? 1  ARG A N    1 
ATOM   2   C  CA   . ARG A 1 1  ? 14.117  -1.249  -1.960 1.00 2.52 ? 1  ARG A CA   1 
ATOM   3   C  C    . ARG A 1 1  ? 13.038  -0.622  -1.071 1.00 1.97 ? 1  ARG A C    1 
ATOM   4   O  O    . ARG A 1 1  ? 12.491  -1.279  -0.208 1.00 1.85 ? 1  ARG A O    1 
ATOM   5   C  CB   . ARG A 1 1  ? 13.893  -2.761  -2.048 1.00 3.07 ? 1  ARG A CB   1 
ATOM   6   C  CG   . ARG A 1 1  ? 14.621  -3.314  -3.275 1.00 3.41 ? 1  ARG A CG   1 
ATOM   7   C  CD   . ARG A 1 1  ? 15.849  -4.108  -2.827 1.00 4.16 ? 1  ARG A CD   1 
ATOM   8   N  NE   . ARG A 1 1  ? 16.871  -4.109  -3.914 1.00 4.55 ? 1  ARG A NE   1 
ATOM   9   C  CZ   . ARG A 1 1  ? 16.498  -4.174  -5.164 1.00 5.37 ? 1  ARG A CZ   1 
ATOM   10  N  NH1  . ARG A 1 1  ? 15.528  -4.974  -5.513 1.00 5.95 ? 1  ARG A NH1  1 
ATOM   11  N  NH2  . ARG A 1 1  ? 17.096  -3.441  -6.063 1.00 5.92 ? 1  ARG A NH2  1 
ATOM   12  H  H1   . ARG A 1 1  ? 15.386  -0.209  -0.679 1.00 3.51 ? 1  ARG A H1   1 
ATOM   13  H  H2   . ARG A 1 1  ? 15.811  -1.838  -0.902 1.00 3.24 ? 1  ARG A H2   1 
ATOM   14  H  H3   . ARG A 1 1  ? 16.120  -0.707  -2.127 1.00 3.38 ? 1  ARG A H3   1 
ATOM   15  H  HA   . ARG A 1 1  ? 14.064  -0.819  -2.949 1.00 2.77 ? 1  ARG A HA   1 
ATOM   16  H  HB2  . ARG A 1 1  ? 14.277  -3.234  -1.156 1.00 3.63 ? 1  ARG A HB2  1 
ATOM   17  H  HB3  . ARG A 1 1  ? 12.836  -2.964  -2.137 1.00 3.29 ? 1  ARG A HB3  1 
ATOM   18  H  HG2  . ARG A 1 1  ? 13.954  -3.961  -3.827 1.00 3.20 ? 1  ARG A HG2  1 
ATOM   19  H  HG3  . ARG A 1 1  ? 14.934  -2.497  -3.907 1.00 3.93 ? 1  ARG A HG3  1 
ATOM   20  H  HD2  . ARG A 1 1  ? 16.269  -3.653  -1.942 1.00 4.57 ? 1  ARG A HD2  1 
ATOM   21  H  HD3  . ARG A 1 1  ? 15.558  -5.125  -2.604 1.00 4.49 ? 1  ARG A HD3  1 
ATOM   22  H  HE   . ARG A 1 1  ? 17.824  -4.059  -3.690 1.00 4.45 ? 1  ARG A HE   1 
ATOM   23  H  HH11 . ARG A 1 1  ? 15.071  -5.536  -4.824 1.00 5.80 ? 1  ARG A HH11 1 
ATOM   24  H  HH12 . ARG A 1 1  ? 15.242  -5.025  -6.470 1.00 6.71 ? 1  ARG A HH12 1 
ATOM   25  H  HH21 . ARG A 1 1  ? 17.839  -2.828  -5.796 1.00 5.78 ? 1  ARG A HH21 1 
ATOM   26  H  HH22 . ARG A 1 1  ? 16.810  -3.492  -7.020 1.00 6.66 ? 1  ARG A HH22 1 
ATOM   27  N  N    . PRO A 1 2  ? 12.766  0.636   -1.312 1.00 1.88 ? 2  PRO A N    1 
ATOM   28  C  CA   . PRO A 1 2  ? 11.755  1.383   -0.542 1.00 1.59 ? 2  PRO A CA   1 
ATOM   29  C  C    . PRO A 1 2  ? 10.375  0.744   -0.722 1.00 1.20 ? 2  PRO A C    1 
ATOM   30  O  O    . PRO A 1 2  ? 10.025  0.291   -1.794 1.00 1.37 ? 2  PRO A O    1 
ATOM   31  C  CB   . PRO A 1 2  ? 11.776  2.799   -1.134 1.00 1.93 ? 2  PRO A CB   1 
ATOM   32  C  CG   . PRO A 1 2  ? 12.826  2.818   -2.275 1.00 2.37 ? 2  PRO A CG   1 
ATOM   33  C  CD   . PRO A 1 2  ? 13.443  1.413   -2.366 1.00 2.34 ? 2  PRO A CD   1 
ATOM   34  H  HA   . PRO A 1 2  ? 12.023  1.417   0.501  1.00 1.71 ? 2  PRO A HA   1 
ATOM   35  H  HB2  . PRO A 1 2  ? 10.799  3.046   -1.527 1.00 1.90 ? 2  PRO A HB2  1 
ATOM   36  H  HB3  . PRO A 1 2  ? 12.057  3.511   -0.373 1.00 2.13 ? 2  PRO A HB3  1 
ATOM   37  H  HG2  . PRO A 1 2  ? 12.345  3.071   -3.210 1.00 2.59 ? 2  PRO A HG2  1 
ATOM   38  H  HG3  . PRO A 1 2  ? 13.597  3.538   -2.052 1.00 2.65 ? 2  PRO A HG3  1 
ATOM   39  H  HD2  . PRO A 1 2  ? 13.249  0.981   -3.338 1.00 2.55 ? 2  PRO A HD2  1 
ATOM   40  H  HD3  . PRO A 1 2  ? 14.504  1.454   -2.175 1.00 2.60 ? 2  PRO A HD3  1 
ATOM   41  N  N    . PHE A 1 3  ? 9.589   0.707   0.318  1.00 0.94 ? 3  PHE A N    1 
ATOM   42  C  CA   . PHE A 1 3  ? 8.233   0.099   0.208  1.00 0.77 ? 3  PHE A CA   1 
ATOM   43  C  C    . PHE A 1 3  ? 7.176   1.147   0.561  1.00 0.72 ? 3  PHE A C    1 
ATOM   44  O  O    . PHE A 1 3  ? 6.711   1.219   1.682  1.00 1.00 ? 3  PHE A O    1 
ATOM   45  C  CB   . PHE A 1 3  ? 8.124   -1.082  1.174  1.00 0.87 ? 3  PHE A CB   1 
ATOM   46  C  CG   . PHE A 1 3  ? 9.058   -2.183  0.731  1.00 0.97 ? 3  PHE A CG   1 
ATOM   47  C  CD1  . PHE A 1 3  ? 8.804   -2.883  -0.454 1.00 1.36 ? 3  PHE A CD1  1 
ATOM   48  C  CD2  . PHE A 1 3  ? 10.179  -2.503  1.507  1.00 1.76 ? 3  PHE A CD2  1 
ATOM   49  C  CE1  . PHE A 1 3  ? 9.670   -3.904  -0.863 1.00 1.52 ? 3  PHE A CE1  1 
ATOM   50  C  CE2  . PHE A 1 3  ? 11.045  -3.524  1.097  1.00 1.92 ? 3  PHE A CE2  1 
ATOM   51  C  CZ   . PHE A 1 3  ? 10.790  -4.224  -0.088 1.00 1.42 ? 3  PHE A CZ   1 
ATOM   52  H  H    . PHE A 1 3  ? 9.891   1.079   1.174  1.00 1.10 ? 3  PHE A H    1 
ATOM   53  H  HA   . PHE A 1 3  ? 8.075   -0.246  -0.803 1.00 0.93 ? 3  PHE A HA   1 
ATOM   54  H  HB2  . PHE A 1 3  ? 8.393   -0.759  2.169  1.00 1.01 ? 3  PHE A HB2  1 
ATOM   55  H  HB3  . PHE A 1 3  ? 7.110   -1.452  1.177  1.00 1.01 ? 3  PHE A HB3  1 
ATOM   56  H  HD1  . PHE A 1 3  ? 7.939   -2.636  -1.052 1.00 2.04 ? 3  PHE A HD1  1 
ATOM   57  H  HD2  . PHE A 1 3  ? 10.375  -1.963  2.421  1.00 2.50 ? 3  PHE A HD2  1 
ATOM   58  H  HE1  . PHE A 1 3  ? 9.473   -4.444  -1.778 1.00 2.21 ? 3  PHE A HE1  1 
ATOM   59  H  HE2  . PHE A 1 3  ? 11.910  -3.771  1.696  1.00 2.73 ? 3  PHE A HE2  1 
ATOM   60  H  HZ   . PHE A 1 3  ? 11.459  -5.012  -0.404 1.00 1.64 ? 3  PHE A HZ   1 
ATOM   61  N  N    . MET A 1 4  ? 6.794   1.961   -0.384 1.00 0.60 ? 4  MET A N    1 
ATOM   62  C  CA   . MET A 1 4  ? 5.768   3.005   -0.100 1.00 0.66 ? 4  MET A CA   1 
ATOM   63  C  C    . MET A 1 4  ? 4.498   2.705   -0.900 1.00 0.72 ? 4  MET A C    1 
ATOM   64  O  O    . MET A 1 4  ? 4.531   2.017   -1.900 1.00 1.32 ? 4  MET A O    1 
ATOM   65  C  CB   . MET A 1 4  ? 6.313   4.376   -0.503 1.00 0.82 ? 4  MET A CB   1 
ATOM   66  C  CG   . MET A 1 4  ? 5.926   5.411   0.555  1.00 1.52 ? 4  MET A CG   1 
ATOM   67  S  SD   . MET A 1 4  ? 6.348   7.068   -0.038 1.00 2.06 ? 4  MET A SD   1 
ATOM   68  C  CE   . MET A 1 4  ? 8.123   6.986   0.305  1.00 2.62 ? 4  MET A CE   1 
ATOM   69  H  H    . MET A 1 4  ? 7.182   1.888   -1.281 1.00 0.69 ? 4  MET A H    1 
ATOM   70  H  HA   . MET A 1 4  ? 5.538   3.005   0.955  1.00 0.67 ? 4  MET A HA   1 
ATOM   71  H  HB2  . MET A 1 4  ? 7.389   4.327   -0.583 1.00 1.25 ? 4  MET A HB2  1 
ATOM   72  H  HB3  . MET A 1 4  ? 5.894   4.664   -1.456 1.00 1.45 ? 4  MET A HB3  1 
ATOM   73  H  HG2  . MET A 1 4  ? 4.863   5.355   0.741  1.00 2.14 ? 4  MET A HG2  1 
ATOM   74  H  HG3  . MET A 1 4  ? 6.463   5.208   1.470  1.00 2.12 ? 4  MET A HG3  1 
ATOM   75  H  HE1  . MET A 1 4  ? 8.321   6.161   0.976  1.00 3.20 ? 4  MET A HE1  1 
ATOM   76  H  HE2  . MET A 1 4  ? 8.662   6.834   -0.616 1.00 2.94 ? 4  MET A HE2  1 
ATOM   77  H  HE3  . MET A 1 4  ? 8.444   7.913   0.760  1.00 2.86 ? 4  MET A HE3  1 
ATOM   78  N  N    . CYS A 1 5  ? 3.378   3.219   -0.467 1.00 0.56 ? 5  CYS A N    1 
ATOM   79  C  CA   . CYS A 1 5  ? 2.107   2.964   -1.204 1.00 0.64 ? 5  CYS A CA   1 
ATOM   80  C  C    . CYS A 1 5  ? 1.960   3.988   -2.332 1.00 0.87 ? 5  CYS A C    1 
ATOM   81  O  O    . CYS A 1 5  ? 2.280   5.149   -2.175 1.00 1.49 ? 5  CYS A O    1 
ATOM   82  C  CB   . CYS A 1 5  ? 0.925   3.088   -0.240 1.00 0.59 ? 5  CYS A CB   1 
ATOM   83  S  SG   . CYS A 1 5  ? -0.625  2.920   -1.160 1.00 0.76 ? 5  CYS A SG   1 
ATOM   84  H  H    . CYS A 1 5  ? 3.373   3.772   0.341  1.00 0.91 ? 5  CYS A H    1 
ATOM   85  H  HA   . CYS A 1 5  ? 2.128   1.969   -1.623 1.00 0.74 ? 5  CYS A HA   1 
ATOM   86  H  HB2  . CYS A 1 5  ? 0.986   2.312   0.507  1.00 0.58 ? 5  CYS A HB2  1 
ATOM   87  H  HB3  . CYS A 1 5  ? 0.953   4.053   0.242  1.00 0.59 ? 5  CYS A HB3  1 
ATOM   88  N  N    . THR A 1 6  ? 1.479   3.566   -3.470 1.00 0.97 ? 6  THR A N    1 
ATOM   89  C  CA   . THR A 1 6  ? 1.313   4.514   -4.608 1.00 1.15 ? 6  THR A CA   1 
ATOM   90  C  C    . THR A 1 6  ? -0.145  4.973   -4.686 1.00 1.11 ? 6  THR A C    1 
ATOM   91  O  O    . THR A 1 6  ? -0.935  4.435   -5.437 1.00 1.79 ? 6  THR A O    1 
ATOM   92  C  CB   . THR A 1 6  ? 1.693   3.813   -5.914 1.00 1.55 ? 6  THR A CB   1 
ATOM   93  O  OG1  . THR A 1 6  ? 3.041   3.368   -5.836 1.00 2.11 ? 6  THR A OG1  1 
ATOM   94  C  CG2  . THR A 1 6  ? 1.543   4.789   -7.081 1.00 2.02 ? 6  THR A CG2  1 
ATOM   95  H  H    . THR A 1 6  ? 1.228   2.624   -3.576 1.00 1.35 ? 6  THR A H    1 
ATOM   96  H  HA   . THR A 1 6  ? 1.955   5.370   -4.460 1.00 1.19 ? 6  THR A HA   1 
ATOM   97  H  HB   . THR A 1 6  ? 1.043   2.967   -6.072 1.00 1.94 ? 6  THR A HB   1 
ATOM   98  H  HG1  . THR A 1 6  ? 3.433   3.456   -6.707 1.00 2.50 ? 6  THR A HG1  1 
ATOM   99  H  HG21 . THR A 1 6  ? 1.001   5.663   -6.751 1.00 2.69 ? 6  THR A HG21 1 
ATOM   100 H  HG22 . THR A 1 6  ? 2.521   5.084   -7.432 1.00 2.23 ? 6  THR A HG22 1 
ATOM   101 H  HG23 . THR A 1 6  ? 1.001   4.311   -7.883 1.00 2.35 ? 6  THR A HG23 1 
ATOM   102 N  N    . TRP A 1 7  ? -0.511  5.965   -3.918 1.00 1.14 ? 7  TRP A N    1 
ATOM   103 C  CA   . TRP A 1 7  ? -1.918  6.455   -3.955 1.00 1.04 ? 7  TRP A CA   1 
ATOM   104 C  C    . TRP A 1 7  ? -1.958  7.920   -3.514 1.00 1.00 ? 7  TRP A C    1 
ATOM   105 O  O    . TRP A 1 7  ? -1.060  8.403   -2.854 1.00 1.09 ? 7  TRP A O    1 
ATOM   106 C  CB   . TRP A 1 7  ? -2.777  5.610   -3.012 1.00 0.96 ? 7  TRP A CB   1 
ATOM   107 C  CG   . TRP A 1 7  ? -4.108  5.358   -3.641 1.00 1.03 ? 7  TRP A CG   1 
ATOM   108 C  CD1  . TRP A 1 7  ? -5.232  6.067   -3.388 1.00 1.04 ? 7  TRP A CD1  1 
ATOM   109 C  CD2  . TRP A 1 7  ? -4.475  4.342   -4.618 1.00 1.17 ? 7  TRP A CD2  1 
ATOM   110 N  NE1  . TRP A 1 7  ? -6.266  5.550   -4.149 1.00 1.15 ? 7  TRP A NE1  1 
ATOM   111 C  CE2  . TRP A 1 7  ? -5.849  4.485   -4.923 1.00 1.23 ? 7  TRP A CE2  1 
ATOM   112 C  CE3  . TRP A 1 7  ? -3.755  3.319   -5.263 1.00 1.28 ? 7  TRP A CE3  1 
ATOM   113 C  CZ2  . TRP A 1 7  ? -6.487  3.645   -5.836 1.00 1.37 ? 7  TRP A CZ2  1 
ATOM   114 C  CZ3  . TRP A 1 7  ? -4.394  2.471   -6.182 1.00 1.44 ? 7  TRP A CZ3  1 
ATOM   115 C  CH2  . TRP A 1 7  ? -5.757  2.634   -6.467 1.00 1.47 ? 7  TRP A CH2  1 
ATOM   116 H  H    . TRP A 1 7  ? 0.139   6.388   -3.319 1.00 1.74 ? 7  TRP A H    1 
ATOM   117 H  HA   . TRP A 1 7  ? -2.301  6.372   -4.962 1.00 1.17 ? 7  TRP A HA   1 
ATOM   118 H  HB2  . TRP A 1 7  ? -2.284  4.668   -2.822 1.00 0.96 ? 7  TRP A HB2  1 
ATOM   119 H  HB3  . TRP A 1 7  ? -2.915  6.138   -2.081 1.00 0.91 ? 7  TRP A HB3  1 
ATOM   120 H  HD1  . TRP A 1 7  ? -5.310  6.900   -2.704 1.00 1.00 ? 7  TRP A HD1  1 
ATOM   121 H  HE1  . TRP A 1 7  ? -7.187  5.884   -4.151 1.00 1.21 ? 7  TRP A HE1  1 
ATOM   122 H  HE3  . TRP A 1 7  ? -2.705  3.185   -5.050 1.00 1.28 ? 7  TRP A HE3  1 
ATOM   123 H  HZ2  . TRP A 1 7  ? -7.537  3.774   -6.052 1.00 1.43 ? 7  TRP A HZ2  1 
ATOM   124 H  HZ3  . TRP A 1 7  ? -3.833  1.689   -6.671 1.00 1.55 ? 7  TRP A HZ3  1 
ATOM   125 H  HH2  . TRP A 1 7  ? -6.243  1.978   -7.175 1.00 1.60 ? 7  TRP A HH2  1 
ATOM   126 N  N    . SER A 1 8  ? -2.991  8.631   -3.875 1.00 1.02 ? 8  SER A N    1 
ATOM   127 C  CA   . SER A 1 8  ? -3.085  10.066  -3.479 1.00 1.07 ? 8  SER A CA   1 
ATOM   128 C  C    . SER A 1 8  ? -3.712  10.177  -2.088 1.00 0.97 ? 8  SER A C    1 
ATOM   129 O  O    . SER A 1 8  ? -4.617  9.443   -1.742 1.00 0.97 ? 8  SER A O    1 
ATOM   130 C  CB   . SER A 1 8  ? -3.953  10.817  -4.489 1.00 1.27 ? 8  SER A CB   1 
ATOM   131 O  OG   . SER A 1 8  ? -5.185  10.127  -4.655 1.00 1.82 ? 8  SER A OG   1 
ATOM   132 H  H    . SER A 1 8  ? -3.703  8.224   -4.410 1.00 1.11 ? 8  SER A H    1 
ATOM   133 H  HA   . SER A 1 8  ? -2.096  10.499  -3.463 1.00 1.13 ? 8  SER A HA   1 
ATOM   134 H  HB2  . SER A 1 8  ? -4.150  11.812  -4.128 1.00 1.77 ? 8  SER A HB2  1 
ATOM   135 H  HB3  . SER A 1 8  ? -3.432  10.877  -5.436 1.00 1.58 ? 8  SER A HB3  1 
ATOM   136 H  HG   . SER A 1 8  ? -5.472  10.245  -5.563 1.00 2.18 ? 8  SER A HG   1 
ATOM   137 N  N    . TYR A 1 9  ? -3.240  11.095  -1.287 1.00 0.98 ? 9  TYR A N    1 
ATOM   138 C  CA   . TYR A 1 9  ? -3.809  11.260  0.080  1.00 0.93 ? 9  TYR A CA   1 
ATOM   139 C  C    . TYR A 1 9  ? -3.300  10.139  0.990  1.00 0.85 ? 9  TYR A C    1 
ATOM   140 O  O    . TYR A 1 9  ? -3.708  10.018  2.128  1.00 0.93 ? 9  TYR A O    1 
ATOM   141 C  CB   . TYR A 1 9  ? -5.337  11.205  0.008  1.00 0.95 ? 9  TYR A CB   1 
ATOM   142 C  CG   . TYR A 1 9  ? -5.917  12.389  0.744  1.00 1.23 ? 9  TYR A CG   1 
ATOM   143 C  CD1  . TYR A 1 9  ? -5.522  12.657  2.060  1.00 1.92 ? 9  TYR A CD1  1 
ATOM   144 C  CD2  . TYR A 1 9  ? -6.850  13.220  0.110  1.00 1.89 ? 9  TYR A CD2  1 
ATOM   145 C  CE1  . TYR A 1 9  ? -6.058  13.755  2.742  1.00 2.41 ? 9  TYR A CE1  1 
ATOM   146 C  CE2  . TYR A 1 9  ? -7.386  14.318  0.793  1.00 2.38 ? 9  TYR A CE2  1 
ATOM   147 C  CZ   . TYR A 1 9  ? -6.991  14.586  2.109  1.00 2.41 ? 9  TYR A CZ   1 
ATOM   148 O  OH   . TYR A 1 9  ? -7.519  15.669  2.782  1.00 3.06 ? 9  TYR A OH   1 
ATOM   149 H  H    . TYR A 1 9  ? -2.512  11.678  -1.588 1.00 1.07 ? 9  TYR A H    1 
ATOM   150 H  HA   . TYR A 1 9  ? -3.504  12.214  0.483  1.00 0.99 ? 9  TYR A HA   1 
ATOM   151 H  HB2  . TYR A 1 9  ? -5.649  11.234  -1.026 1.00 1.12 ? 9  TYR A HB2  1 
ATOM   152 H  HB3  . TYR A 1 9  ? -5.687  10.291  0.465  1.00 1.11 ? 9  TYR A HB3  1 
ATOM   153 H  HD1  . TYR A 1 9  ? -4.803  12.016  2.548  1.00 2.49 ? 9  TYR A HD1  1 
ATOM   154 H  HD2  . TYR A 1 9  ? -7.155  13.014  -0.905 1.00 2.44 ? 9  TYR A HD2  1 
ATOM   155 H  HE1  . TYR A 1 9  ? -5.753  13.962  3.757  1.00 3.16 ? 9  TYR A HE1  1 
ATOM   156 H  HE2  . TYR A 1 9  ? -8.105  14.959  0.305  1.00 3.12 ? 9  TYR A HE2  1 
ATOM   157 H  HH   . TYR A 1 9  ? -7.806  16.313  2.129  1.00 3.25 ? 9  TYR A HH   1 
ATOM   158 N  N    . CYS A 1 10 ? -2.413  9.317   0.499  1.00 0.80 ? 10 CYS A N    1 
ATOM   159 C  CA   . CYS A 1 10 ? -1.882  8.207   1.339  1.00 0.74 ? 10 CYS A CA   1 
ATOM   160 C  C    . CYS A 1 10 ? -0.466  8.559   1.812  1.00 0.72 ? 10 CYS A C    1 
ATOM   161 O  O    . CYS A 1 10 ? -0.286  9.206   2.825  1.00 0.76 ? 10 CYS A O    1 
ATOM   162 C  CB   . CYS A 1 10 ? -1.865  6.915   0.510  1.00 0.74 ? 10 CYS A CB   1 
ATOM   163 S  SG   . CYS A 1 10 ? -0.825  5.669   1.313  1.00 0.71 ? 10 CYS A SG   1 
ATOM   164 H  H    . CYS A 1 10 ? -2.096  9.429   -0.422 1.00 0.87 ? 10 CYS A H    1 
ATOM   165 H  HA   . CYS A 1 10 ? -2.522  8.073   2.198  1.00 0.77 ? 10 CYS A HA   1 
ATOM   166 H  HB2  . CYS A 1 10 ? -2.869  6.536   0.428  1.00 0.78 ? 10 CYS A HB2  1 
ATOM   167 H  HB3  . CYS A 1 10 ? -1.484  7.124   -0.477 1.00 0.76 ? 10 CYS A HB3  1 
ATOM   168 N  N    . GLY A 1 11 ? 0.540   8.140   1.093  1.00 0.71 ? 11 GLY A N    1 
ATOM   169 C  CA   . GLY A 1 11 ? 1.936   8.453   1.509  1.00 0.72 ? 11 GLY A CA   1 
ATOM   170 C  C    . GLY A 1 11 ? 2.284   7.663   2.773  1.00 0.64 ? 11 GLY A C    1 
ATOM   171 O  O    . GLY A 1 11 ? 2.607   8.227   3.799  1.00 0.74 ? 11 GLY A O    1 
ATOM   172 H  H    . GLY A 1 11 ? 0.378   7.619   0.281  1.00 0.72 ? 11 GLY A H    1 
ATOM   173 H  HA2  . GLY A 1 11 ? 2.617   8.183   0.715  1.00 0.73 ? 11 GLY A HA2  1 
ATOM   174 H  HA3  . GLY A 1 11 ? 2.022   9.509   1.715  1.00 0.81 ? 11 GLY A HA3  1 
ATOM   175 N  N    . LYS A 1 12 ? 2.224   6.360   2.707  1.00 0.55 ? 12 LYS A N    1 
ATOM   176 C  CA   . LYS A 1 12 ? 2.555   5.539   3.906  1.00 0.51 ? 12 LYS A CA   1 
ATOM   177 C  C    . LYS A 1 12 ? 3.723   4.607   3.576  1.00 0.48 ? 12 LYS A C    1 
ATOM   178 O  O    . LYS A 1 12 ? 3.735   3.949   2.555  1.00 0.57 ? 12 LYS A O    1 
ATOM   179 C  CB   . LYS A 1 12 ? 1.336   4.708   4.311  1.00 0.52 ? 12 LYS A CB   1 
ATOM   180 C  CG   . LYS A 1 12 ? 1.310   4.549   5.833  1.00 0.85 ? 12 LYS A CG   1 
ATOM   181 C  CD   . LYS A 1 12 ? -0.014  3.911   6.259  1.00 1.22 ? 12 LYS A CD   1 
ATOM   182 C  CE   . LYS A 1 12 ? -0.490  4.546   7.567  1.00 1.77 ? 12 LYS A CE   1 
ATOM   183 N  NZ   . LYS A 1 12 ? -1.431  3.619   8.257  1.00 2.51 ? 12 LYS A NZ   1 
ATOM   184 H  H    . LYS A 1 12 ? 1.963   5.922   1.870  1.00 0.59 ? 12 LYS A H    1 
ATOM   185 H  HA   . LYS A 1 12 ? 2.834   6.190   4.721  1.00 0.58 ? 12 LYS A HA   1 
ATOM   186 H  HB2  . LYS A 1 12 ? 0.435   5.208   3.984  1.00 0.71 ? 12 LYS A HB2  1 
ATOM   187 H  HB3  . LYS A 1 12 ? 1.394   3.734   3.850  1.00 0.79 ? 12 LYS A HB3  1 
ATOM   188 H  HG2  . LYS A 1 12 ? 2.130   3.918   6.142  1.00 1.55 ? 12 LYS A HG2  1 
ATOM   189 H  HG3  . LYS A 1 12 ? 1.406   5.519   6.297  1.00 1.46 ? 12 LYS A HG3  1 
ATOM   190 H  HD2  . LYS A 1 12 ? -0.756  4.072   5.489  1.00 1.65 ? 12 LYS A HD2  1 
ATOM   191 H  HD3  . LYS A 1 12 ? 0.127   2.851   6.406  1.00 1.80 ? 12 LYS A HD3  1 
ATOM   192 H  HE2  . LYS A 1 12 ? 0.361   4.736   8.205  1.00 1.98 ? 12 LYS A HE2  1 
ATOM   193 H  HE3  . LYS A 1 12 ? -0.993  5.477   7.353  1.00 2.33 ? 12 LYS A HE3  1 
ATOM   194 H  HZ1  . LYS A 1 12 ? -2.206  3.368   7.612  1.00 3.03 ? 12 LYS A HZ1  1 
ATOM   195 H  HZ2  . LYS A 1 12 ? -0.922  2.757   8.541  1.00 2.79 ? 12 LYS A HZ2  1 
ATOM   196 H  HZ3  . LYS A 1 12 ? -1.822  4.086   9.100  1.00 2.90 ? 12 LYS A HZ3  1 
ATOM   197 N  N    . ARG A 1 13 ? 4.707   4.547   4.431  1.00 0.50 ? 13 ARG A N    1 
ATOM   198 C  CA   . ARG A 1 13 ? 5.873   3.660   4.163  1.00 0.54 ? 13 ARG A CA   1 
ATOM   199 C  C    . ARG A 1 13 ? 5.733   2.368   4.969  1.00 0.49 ? 13 ARG A C    1 
ATOM   200 O  O    . ARG A 1 13 ? 4.988   2.299   5.927  1.00 0.59 ? 13 ARG A O    1 
ATOM   201 C  CB   . ARG A 1 13 ? 7.162   4.376   4.570  1.00 0.71 ? 13 ARG A CB   1 
ATOM   202 C  CG   . ARG A 1 13 ? 7.456   5.503   3.577  1.00 1.30 ? 13 ARG A CG   1 
ATOM   203 C  CD   . ARG A 1 13 ? 8.401   6.518   4.221  1.00 1.70 ? 13 ARG A CD   1 
ATOM   204 N  NE   . ARG A 1 13 ? 9.806   6.201   3.839  1.00 1.96 ? 13 ARG A NE   1 
ATOM   205 C  CZ   . ARG A 1 13 ? 10.747  7.086   4.023  1.00 2.45 ? 13 ARG A CZ   1 
ATOM   206 N  NH1  . ARG A 1 13 ? 10.907  7.635   5.196  1.00 3.27 ? 13 ARG A NH1  1 
ATOM   207 N  NH2  . ARG A 1 13 ? 11.529  7.422   3.034  1.00 2.80 ? 13 ARG A NH2  1 
ATOM   208 H  H    . ARG A 1 13 ? 4.679   5.087   5.249  1.00 0.60 ? 13 ARG A H    1 
ATOM   209 H  HA   . ARG A 1 13 ? 5.910   3.424   3.110  1.00 0.58 ? 13 ARG A HA   1 
ATOM   210 H  HB2  . ARG A 1 13 ? 7.046   4.791   5.561  1.00 1.41 ? 13 ARG A HB2  1 
ATOM   211 H  HB3  . ARG A 1 13 ? 7.981   3.674   4.566  1.00 1.35 ? 13 ARG A HB3  1 
ATOM   212 H  HG2  . ARG A 1 13 ? 7.918   5.090   2.692  1.00 1.96 ? 13 ARG A HG2  1 
ATOM   213 H  HG3  . ARG A 1 13 ? 6.533   5.994   3.306  1.00 1.93 ? 13 ARG A HG3  1 
ATOM   214 H  HD2  . ARG A 1 13 ? 8.150   7.511   3.879  1.00 2.22 ? 13 ARG A HD2  1 
ATOM   215 H  HD3  . ARG A 1 13 ? 8.300   6.472   5.296  1.00 2.23 ? 13 ARG A HD3  1 
ATOM   216 H  HE   . ARG A 1 13 ? 10.022  5.328   3.450  1.00 2.38 ? 13 ARG A HE   1 
ATOM   217 H  HH11 . ARG A 1 13 ? 10.307  7.377   5.954  1.00 3.49 ? 13 ARG A HH11 1 
ATOM   218 H  HH12 . ARG A 1 13 ? 11.628  8.312   5.337  1.00 3.93 ? 13 ARG A HH12 1 
ATOM   219 H  HH21 . ARG A 1 13 ? 11.407  7.001   2.135  1.00 2.73 ? 13 ARG A HH21 1 
ATOM   220 H  HH22 . ARG A 1 13 ? 12.251  8.100   3.175  1.00 3.51 ? 13 ARG A HH22 1 
ATOM   221 N  N    . PHE A 1 14 ? 6.445   1.343   4.589  1.00 0.50 ? 14 PHE A N    1 
ATOM   222 C  CA   . PHE A 1 14 ? 6.357   0.055   5.332  1.00 0.50 ? 14 PHE A CA   1 
ATOM   223 C  C    . PHE A 1 14 ? 7.730   -0.618  5.345  1.00 0.58 ? 14 PHE A C    1 
ATOM   224 O  O    . PHE A 1 14 ? 8.635   -0.217  4.640  1.00 0.61 ? 14 PHE A O    1 
ATOM   225 C  CB   . PHE A 1 14 ? 5.346   -0.865  4.643  1.00 0.52 ? 14 PHE A CB   1 
ATOM   226 C  CG   . PHE A 1 14 ? 4.037   -0.133  4.464  1.00 0.49 ? 14 PHE A CG   1 
ATOM   227 C  CD1  . PHE A 1 14 ? 3.137   -0.038  5.532  1.00 1.34 ? 14 PHE A CD1  1 
ATOM   228 C  CD2  . PHE A 1 14 ? 3.724   0.450   3.230  1.00 1.26 ? 14 PHE A CD2  1 
ATOM   229 C  CE1  . PHE A 1 14 ? 1.923   0.640   5.366  1.00 1.36 ? 14 PHE A CE1  1 
ATOM   230 C  CE2  . PHE A 1 14 ? 2.510   1.128   3.064  1.00 1.29 ? 14 PHE A CE2  1 
ATOM   231 C  CZ   . PHE A 1 14 ? 1.610   1.223   4.132  1.00 0.60 ? 14 PHE A CZ   1 
ATOM   232 H  H    . PHE A 1 14 ? 7.040   1.421   3.814  1.00 0.60 ? 14 PHE A H    1 
ATOM   233 H  HA   . PHE A 1 14 ? 6.039   0.245   6.346  1.00 0.54 ? 14 PHE A HA   1 
ATOM   234 H  HB2  . PHE A 1 14 ? 5.728   -1.160  3.677  1.00 0.59 ? 14 PHE A HB2  1 
ATOM   235 H  HB3  . PHE A 1 14 ? 5.186   -1.743  5.251  1.00 0.60 ? 14 PHE A HB3  1 
ATOM   236 H  HD1  . PHE A 1 14 ? 3.379   -0.488  6.483  1.00 2.24 ? 14 PHE A HD1  1 
ATOM   237 H  HD2  . PHE A 1 14 ? 4.419   0.377   2.407  1.00 2.14 ? 14 PHE A HD2  1 
ATOM   238 H  HE1  . PHE A 1 14 ? 1.229   0.713   6.190  1.00 2.24 ? 14 PHE A HE1  1 
ATOM   239 H  HE2  . PHE A 1 14 ? 2.268   1.577   2.113  1.00 2.18 ? 14 PHE A HE2  1 
ATOM   240 H  HZ   . PHE A 1 14 ? 0.673   1.745   4.004  1.00 0.68 ? 14 PHE A HZ   1 
ATOM   241 N  N    . THR A 1 15 ? 7.894   -1.640  6.139  1.00 0.68 ? 15 THR A N    1 
ATOM   242 C  CA   . THR A 1 15 ? 9.209   -2.336  6.194  1.00 0.78 ? 15 THR A CA   1 
ATOM   243 C  C    . THR A 1 15 ? 9.116   -3.658  5.430  1.00 0.73 ? 15 THR A C    1 
ATOM   244 O  O    . THR A 1 15 ? 9.894   -4.566  5.644  1.00 0.87 ? 15 THR A O    1 
ATOM   245 C  CB   . THR A 1 15 ? 9.579   -2.615  7.653  1.00 0.90 ? 15 THR A CB   1 
ATOM   246 O  OG1  . THR A 1 15 ? 9.296   -1.466  8.438  1.00 1.34 ? 15 THR A OG1  1 
ATOM   247 C  CG2  . THR A 1 15 ? 11.069  -2.947  7.749  1.00 1.70 ? 15 THR A CG2  1 
ATOM   248 H  H    . THR A 1 15 ? 7.151   -1.949  6.699  1.00 0.72 ? 15 THR A H    1 
ATOM   249 H  HA   . THR A 1 15 ? 9.966   -1.712  5.743  1.00 0.86 ? 15 THR A HA   1 
ATOM   250 H  HB   . THR A 1 15 ? 9.004   -3.452  8.017  1.00 1.39 ? 15 THR A HB   1 
ATOM   251 H  HG1  . THR A 1 15 ? 9.871   -0.756  8.144  1.00 1.82 ? 15 THR A HG1  1 
ATOM   252 H  HG21 . THR A 1 15 ? 11.460  -3.136  6.760  1.00 2.14 ? 15 THR A HG21 1 
ATOM   253 H  HG22 . THR A 1 15 ? 11.595  -2.114  8.191  1.00 2.23 ? 15 THR A HG22 1 
ATOM   254 H  HG23 . THR A 1 15 ? 11.203  -3.825  8.363  1.00 2.27 ? 15 THR A HG23 1 
ATOM   255 N  N    . ARG A 1 16 ? 8.169   -3.773  4.539  1.00 0.74 ? 16 ARG A N    1 
ATOM   256 C  CA   . ARG A 1 16 ? 8.026   -5.036  3.762  1.00 0.71 ? 16 ARG A CA   1 
ATOM   257 C  C    . ARG A 1 16 ? 6.837   -4.916  2.803  1.00 0.62 ? 16 ARG A C    1 
ATOM   258 O  O    . ARG A 1 16 ? 5.715   -4.705  3.219  1.00 0.56 ? 16 ARG A O    1 
ATOM   259 C  CB   . ARG A 1 16 ? 7.785   -6.201  4.725  1.00 0.76 ? 16 ARG A CB   1 
ATOM   260 C  CG   . ARG A 1 16 ? 7.854   -7.521  3.955  1.00 1.17 ? 16 ARG A CG   1 
ATOM   261 C  CD   . ARG A 1 16 ? 9.181   -8.220  4.257  1.00 1.68 ? 16 ARG A CD   1 
ATOM   262 N  NE   . ARG A 1 16 ? 9.034   -9.684  4.022  1.00 1.96 ? 16 ARG A NE   1 
ATOM   263 C  CZ   . ARG A 1 16 ? 10.094  -10.438 3.919  1.00 2.49 ? 16 ARG A CZ   1 
ATOM   264 N  NH1  . ARG A 1 16 ? 10.807  -10.710 4.977  1.00 3.07 ? 16 ARG A NH1  1 
ATOM   265 N  NH2  . ARG A 1 16 ? 10.439  -10.922 2.757  1.00 2.95 ? 16 ARG A NH2  1 
ATOM   266 H  H    . ARG A 1 16 ? 7.551   -3.029  4.381  1.00 0.89 ? 16 ARG A H    1 
ATOM   267 H  HA   . ARG A 1 16 ? 8.930   -5.216  3.200  1.00 0.79 ? 16 ARG A HA   1 
ATOM   268 H  HB2  . ARG A 1 16 ? 8.541   -6.192  5.496  1.00 1.02 ? 16 ARG A HB2  1 
ATOM   269 H  HB3  . ARG A 1 16 ? 6.809   -6.100  5.175  1.00 0.87 ? 16 ARG A HB3  1 
ATOM   270 H  HG2  . ARG A 1 16 ? 7.034   -8.157  4.258  1.00 1.43 ? 16 ARG A HG2  1 
ATOM   271 H  HG3  . ARG A 1 16 ? 7.786   -7.324  2.896  1.00 1.35 ? 16 ARG A HG3  1 
ATOM   272 H  HD2  . ARG A 1 16 ? 9.951   -7.826  3.609  1.00 1.98 ? 16 ARG A HD2  1 
ATOM   273 H  HD3  . ARG A 1 16 ? 9.453   -8.047  5.287  1.00 2.26 ? 16 ARG A HD3  1 
ATOM   274 H  HE   . ARG A 1 16 ? 8.141   -10.080 3.945  1.00 2.20 ? 16 ARG A HE   1 
ATOM   275 H  HH11 . ARG A 1 16 ? 10.542  -10.339 5.867  1.00 3.29 ? 16 ARG A HH11 1 
ATOM   276 H  HH12 . ARG A 1 16 ? 11.619  -11.288 4.898  1.00 3.58 ? 16 ARG A HH12 1 
ATOM   277 H  HH21 . ARG A 1 16 ? 9.891   -10.715 1.946  1.00 3.13 ? 16 ARG A HH21 1 
ATOM   278 H  HH22 . ARG A 1 16 ? 11.251  -11.501 2.678  1.00 3.44 ? 16 ARG A HH22 1 
ATOM   279 N  N    . SER A 1 17 ? 7.070   -5.048  1.524  1.00 0.67 ? 17 SER A N    1 
ATOM   280 C  CA   . SER A 1 17 ? 5.947   -4.941  0.549  1.00 0.65 ? 17 SER A CA   1 
ATOM   281 C  C    . SER A 1 17 ? 4.761   -5.777  1.038  1.00 0.61 ? 17 SER A C    1 
ATOM   282 O  O    . SER A 1 17 ? 3.626   -5.522  0.689  1.00 0.63 ? 17 SER A O    1 
ATOM   283 C  CB   . SER A 1 17 ? 6.406   -5.457  -0.815 1.00 0.79 ? 17 SER A CB   1 
ATOM   284 O  OG   . SER A 1 17 ? 5.696   -4.772  -1.839 1.00 1.66 ? 17 SER A OG   1 
ATOM   285 H  H    . SER A 1 17 ? 7.981   -5.218  1.203  1.00 0.75 ? 17 SER A H    1 
ATOM   286 H  HA   . SER A 1 17 ? 5.645   -3.908  0.461  1.00 0.63 ? 17 SER A HA   1 
ATOM   287 H  HB2  . SER A 1 17 ? 7.461   -5.276  -0.934 1.00 1.25 ? 17 SER A HB2  1 
ATOM   288 H  HB3  . SER A 1 17 ? 6.215   -6.520  -0.880 1.00 1.24 ? 17 SER A HB3  1 
ATOM   289 H  HG   . SER A 1 17 ? 6.189   -4.868  -2.657 1.00 2.06 ? 17 SER A HG   1 
ATOM   290 N  N    . ASP A 1 18 ? 5.013   -6.774  1.844  1.00 0.63 ? 18 ASP A N    1 
ATOM   291 C  CA   . ASP A 1 18 ? 3.896   -7.620  2.351  1.00 0.67 ? 18 ASP A CA   1 
ATOM   292 C  C    . ASP A 1 18 ? 2.774   -6.719  2.868  1.00 0.64 ? 18 ASP A C    1 
ATOM   293 O  O    . ASP A 1 18 ? 1.626   -6.864  2.497  1.00 0.72 ? 18 ASP A O    1 
ATOM   294 C  CB   . ASP A 1 18 ? 4.404   -8.508  3.489  1.00 0.72 ? 18 ASP A CB   1 
ATOM   295 C  CG   . ASP A 1 18 ? 3.279   -9.433  3.957  1.00 1.18 ? 18 ASP A CG   1 
ATOM   296 O  OD1  . ASP A 1 18 ? 2.799   -10.208 3.145  1.00 1.89 ? 18 ASP A OD1  1 
ATOM   297 O  OD2  . ASP A 1 18 ? 2.917   -9.351  5.119  1.00 1.74 ? 18 ASP A OD2  1 
ATOM   298 H  H    . ASP A 1 18 ? 5.934   -6.966  2.115  1.00 0.67 ? 18 ASP A H    1 
ATOM   299 H  HA   . ASP A 1 18 ? 3.521   -8.239  1.550  1.00 0.74 ? 18 ASP A HA   1 
ATOM   300 H  HB2  . ASP A 1 18 ? 5.237   -9.102  3.137  1.00 0.92 ? 18 ASP A HB2  1 
ATOM   301 H  HB3  . ASP A 1 18 ? 4.726   -7.890  4.313  1.00 1.09 ? 18 ASP A HB3  1 
ATOM   302 N  N    . GLU A 1 19 ? 3.096   -5.785  3.722  1.00 0.60 ? 19 GLU A N    1 
ATOM   303 C  CA   . GLU A 1 19 ? 2.048   -4.874  4.260  1.00 0.63 ? 19 GLU A CA   1 
ATOM   304 C  C    . GLU A 1 19 ? 1.462   -4.043  3.117  1.00 0.58 ? 19 GLU A C    1 
ATOM   305 O  O    . GLU A 1 19 ? 0.305   -3.672  3.134  1.00 0.65 ? 19 GLU A O    1 
ATOM   306 C  CB   . GLU A 1 19 ? 2.670   -3.940  5.301  1.00 0.66 ? 19 GLU A CB   1 
ATOM   307 C  CG   . GLU A 1 19 ? 1.613   -3.548  6.334  1.00 1.19 ? 19 GLU A CG   1 
ATOM   308 C  CD   . GLU A 1 19 ? 1.975   -4.155  7.691  1.00 1.37 ? 19 GLU A CD   1 
ATOM   309 O  OE1  . GLU A 1 19 ? 2.761   -5.088  7.709  1.00 1.91 ? 19 GLU A OE1  1 
ATOM   310 O  OE2  . GLU A 1 19 ? 1.461   -3.676  8.688  1.00 1.95 ? 19 GLU A OE2  1 
ATOM   311 H  H    . GLU A 1 19 ? 4.028   -5.683  4.008  1.00 0.60 ? 19 GLU A H    1 
ATOM   312 H  HA   . GLU A 1 19 ? 1.264   -5.457  4.721  1.00 0.73 ? 19 GLU A HA   1 
ATOM   313 H  HB2  . GLU A 1 19 ? 3.487   -4.446  5.795  1.00 1.13 ? 19 GLU A HB2  1 
ATOM   314 H  HB3  . GLU A 1 19 ? 3.040   -3.051  4.812  1.00 0.86 ? 19 GLU A HB3  1 
ATOM   315 H  HG2  . GLU A 1 19 ? 1.574   -2.471  6.419  1.00 1.77 ? 19 GLU A HG2  1 
ATOM   316 H  HG3  . GLU A 1 19 ? 0.648   -3.919  6.022  1.00 1.92 ? 19 GLU A HG3  1 
ATOM   317 N  N    . LEU A 1 20 ? 2.253   -3.749  2.121  1.00 0.53 ? 20 LEU A N    1 
ATOM   318 C  CA   . LEU A 1 20 ? 1.744   -2.943  0.976  1.00 0.56 ? 20 LEU A CA   1 
ATOM   319 C  C    . LEU A 1 20 ? 0.710   -3.757  0.195  1.00 0.70 ? 20 LEU A C    1 
ATOM   320 O  O    . LEU A 1 20 ? -0.113  -3.215  -0.515 1.00 0.79 ? 20 LEU A O    1 
ATOM   321 C  CB   . LEU A 1 20 ? 2.909   -2.583  0.050  1.00 0.55 ? 20 LEU A CB   1 
ATOM   322 C  CG   . LEU A 1 20 ? 3.384   -1.161  0.352  1.00 0.48 ? 20 LEU A CG   1 
ATOM   323 C  CD1  . LEU A 1 20 ? 4.466   -0.761  -0.652 1.00 0.56 ? 20 LEU A CD1  1 
ATOM   324 C  CD2  . LEU A 1 20 ? 2.203   -0.194  0.240  1.00 0.56 ? 20 LEU A CD2  1 
ATOM   325 H  H    . LEU A 1 20 ? 3.182   -4.058  2.127  1.00 0.53 ? 20 LEU A H    1 
ATOM   326 H  HA   . LEU A 1 20 ? 1.285   -2.039  1.347  1.00 0.57 ? 20 LEU A HA   1 
ATOM   327 H  HB2  . LEU A 1 20 ? 3.722   -3.276  0.209  1.00 0.58 ? 20 LEU A HB2  1 
ATOM   328 H  HB3  . LEU A 1 20 ? 2.582   -2.640  -0.978 1.00 0.67 ? 20 LEU A HB3  1 
ATOM   329 H  HG   . LEU A 1 20 ? 3.790   -1.123  1.353  1.00 0.45 ? 20 LEU A HG   1 
ATOM   330 H  HD11 . LEU A 1 20 ? 4.127   -0.981  -1.654 1.00 1.12 ? 20 LEU A HD11 1 
ATOM   331 H  HD12 . LEU A 1 20 ? 4.666   0.297   -0.565 1.00 1.20 ? 20 LEU A HD12 1 
ATOM   332 H  HD13 . LEU A 1 20 ? 5.370   -1.316  -0.448 1.00 1.15 ? 20 LEU A HD13 1 
ATOM   333 H  HD21 . LEU A 1 20 ? 1.499   -0.568  -0.488 1.00 1.13 ? 20 LEU A HD21 1 
ATOM   334 H  HD22 . LEU A 1 20 ? 1.717   -0.107  1.200  1.00 1.11 ? 20 LEU A HD22 1 
ATOM   335 H  HD23 . LEU A 1 20 ? 2.561   0.777   -0.072 1.00 1.20 ? 20 LEU A HD23 1 
ATOM   336 N  N    . GLN A 1 21 ? 0.747   -5.056  0.318  1.00 0.77 ? 21 GLN A N    1 
ATOM   337 C  CA   . GLN A 1 21 ? -0.232  -5.903  -0.421 1.00 0.93 ? 21 GLN A CA   1 
ATOM   338 C  C    . GLN A 1 21 ? -1.629  -5.717  0.176  1.00 0.98 ? 21 GLN A C    1 
ATOM   339 O  O    . GLN A 1 21 ? -2.560  -5.337  -0.506 1.00 1.08 ? 21 GLN A O    1 
ATOM   340 C  CB   . GLN A 1 21 ? 0.179   -7.372  -0.309 1.00 1.00 ? 21 GLN A CB   1 
ATOM   341 C  CG   . GLN A 1 21 ? 1.212   -7.697  -1.391 1.00 1.09 ? 21 GLN A CG   1 
ATOM   342 C  CD   . GLN A 1 21 ? 2.436   -8.351  -0.748 1.00 1.15 ? 21 GLN A CD   1 
ATOM   343 O  OE1  . GLN A 1 21 ? 2.370   -9.476  -0.294 1.00 2.03 ? 21 GLN A OE1  1 
ATOM   344 N  NE2  . GLN A 1 21 ? 3.559   -7.688  -0.689 1.00 1.01 ? 21 GLN A NE2  1 
ATOM   345 H  H    . GLN A 1 21 ? 1.420   -5.475  0.894  1.00 0.75 ? 21 GLN A H    1 
ATOM   346 H  HA   . GLN A 1 21 ? -0.245  -5.612  -1.461 1.00 0.99 ? 21 GLN A HA   1 
ATOM   347 H  HB2  . GLN A 1 21 ? 0.609   -7.552  0.665  1.00 0.99 ? 21 GLN A HB2  1 
ATOM   348 H  HB3  . GLN A 1 21 ? -0.688  -8.000  -0.442 1.00 1.15 ? 21 GLN A HB3  1 
ATOM   349 H  HG2  . GLN A 1 21 ? 0.777   -8.375  -2.111 1.00 1.56 ? 21 GLN A HG2  1 
ATOM   350 H  HG3  . GLN A 1 21 ? 1.512   -6.787  -1.888 1.00 1.51 ? 21 GLN A HG3  1 
ATOM   351 H  HE21 . GLN A 1 21 ? 3.612   -6.780  -1.054 1.00 1.13 ? 21 GLN A HE21 1 
ATOM   352 H  HE22 . GLN A 1 21 ? 4.349   -8.098  -0.278 1.00 1.41 ? 21 GLN A HE22 1 
ATOM   353 N  N    . ARG A 1 22 ? -1.785  -5.984  1.444  1.00 0.95 ? 22 ARG A N    1 
ATOM   354 C  CA   . ARG A 1 22 ? -3.123  -5.825  2.081  1.00 1.03 ? 22 ARG A CA   1 
ATOM   355 C  C    . ARG A 1 22 ? -3.467  -4.337  2.188  1.00 0.99 ? 22 ARG A C    1 
ATOM   356 O  O    . ARG A 1 22 ? -4.589  -3.969  2.473  1.00 1.09 ? 22 ARG A O    1 
ATOM   357 C  CB   . ARG A 1 22 ? -3.097  -6.443  3.480  1.00 1.05 ? 22 ARG A CB   1 
ATOM   358 C  CG   . ARG A 1 22 ? -3.988  -7.687  3.508  1.00 1.64 ? 22 ARG A CG   1 
ATOM   359 C  CD   . ARG A 1 22 ? -4.331  -8.036  4.958  1.00 2.16 ? 22 ARG A CD   1 
ATOM   360 N  NE   . ARG A 1 22 ? -5.148  -9.284  4.993  1.00 3.03 ? 22 ARG A NE   1 
ATOM   361 C  CZ   . ARG A 1 22 ? -6.036  -9.514  4.064  1.00 3.79 ? 22 ARG A CZ   1 
ATOM   362 N  NH1  . ARG A 1 22 ? -5.658  -9.955  2.896  1.00 4.48 ? 22 ARG A NH1  1 
ATOM   363 N  NH2  . ARG A 1 22 ? -7.301  -9.304  4.304  1.00 4.27 ? 22 ARG A NH2  1 
ATOM   364 H  H    . ARG A 1 22 ? -1.022  -6.291  1.977  1.00 0.89 ? 22 ARG A H    1 
ATOM   365 H  HA   . ARG A 1 22 ? -3.869  -6.325  1.481  1.00 1.13 ? 22 ARG A HA   1 
ATOM   366 H  HB2  . ARG A 1 22 ? -2.084  -6.719  3.733  1.00 1.55 ? 22 ARG A HB2  1 
ATOM   367 H  HB3  . ARG A 1 22 ? -3.464  -5.725  4.198  1.00 1.35 ? 22 ARG A HB3  1 
ATOM   368 H  HG2  . ARG A 1 22 ? -4.897  -7.491  2.958  1.00 2.05 ? 22 ARG A HG2  1 
ATOM   369 H  HG3  . ARG A 1 22 ? -3.464  -8.515  3.055  1.00 2.27 ? 22 ARG A HG3  1 
ATOM   370 H  HD2  . ARG A 1 22 ? -3.420  -8.189  5.516  1.00 2.40 ? 22 ARG A HD2  1 
ATOM   371 H  HD3  . ARG A 1 22 ? -4.891  -7.225  5.399  1.00 2.47 ? 22 ARG A HD3  1 
ATOM   372 H  HE   . ARG A 1 22 ? -5.017  -9.933  5.716  1.00 3.35 ? 22 ARG A HE   1 
ATOM   373 H  HH11 . ARG A 1 22 ? -4.689  -10.117 2.712  1.00 4.52 ? 22 ARG A HH11 1 
ATOM   374 H  HH12 . ARG A 1 22 ? -6.338  -10.132 2.184  1.00 5.17 ? 22 ARG A HH12 1 
ATOM   375 H  HH21 . ARG A 1 22 ? -7.591  -8.966  5.200  1.00 4.19 ? 22 ARG A HH21 1 
ATOM   376 H  HH22 . ARG A 1 22 ? -7.981  -9.481  3.593  1.00 4.95 ? 22 ARG A HH22 1 
ATOM   377 N  N    . HIS A 1 23 ? -2.511  -3.479  1.962  1.00 0.87 ? 23 HIS A N    1 
ATOM   378 C  CA   . HIS A 1 23 ? -2.784  -2.016  2.053  1.00 0.83 ? 23 HIS A CA   1 
ATOM   379 C  C    . HIS A 1 23 ? -3.396  -1.523  0.744  1.00 0.89 ? 23 HIS A C    1 
ATOM   380 O  O    . HIS A 1 23 ? -4.318  -0.733  0.736  1.00 0.94 ? 23 HIS A O    1 
ATOM   381 C  CB   . HIS A 1 23 ? -1.476  -1.264  2.290  1.00 0.71 ? 23 HIS A CB   1 
ATOM   382 C  CG   . HIS A 1 23 ? -1.764  0.208   2.386  1.00 0.67 ? 23 HIS A CG   1 
ATOM   383 N  ND1  . HIS A 1 23 ? -2.408  0.768   3.478  1.00 0.69 ? 23 HIS A ND1  1 
ATOM   384 C  CD2  . HIS A 1 23 ? -1.514  1.246   1.524  1.00 0.66 ? 23 HIS A CD2  1 
ATOM   385 C  CE1  . HIS A 1 23 ? -2.526  2.088   3.244  1.00 0.67 ? 23 HIS A CE1  1 
ATOM   386 N  NE2  . HIS A 1 23 ? -1.997  2.431   2.067  1.00 0.65 ? 23 HIS A NE2  1 
ATOM   387 H  H    . HIS A 1 23 ? -1.612  -3.796  1.734  1.00 0.84 ? 23 HIS A H    1 
ATOM   388 H  HA   . HIS A 1 23 ? -3.465  -1.823  2.869  1.00 0.87 ? 23 HIS A HA   1 
ATOM   389 H  HB2  . HIS A 1 23 ? -1.019  -1.608  3.206  1.00 0.71 ? 23 HIS A HB2  1 
ATOM   390 H  HB3  . HIS A 1 23 ? -0.809  -1.443  1.459  1.00 0.71 ? 23 HIS A HB3  1 
ATOM   391 H  HD1  . HIS A 1 23 ? -2.722  0.290   4.274  1.00 0.74 ? 23 HIS A HD1  1 
ATOM   392 H  HD2  . HIS A 1 23 ? -1.012  1.157   0.573  1.00 0.69 ? 23 HIS A HD2  1 
ATOM   393 H  HE1  . HIS A 1 23 ? -2.991  2.784   3.926  1.00 0.71 ? 23 HIS A HE1  1 
ATOM   394 N  N    . LYS A 1 24 ? -2.874  -1.967  -0.364 1.00 0.93 ? 24 LYS A N    1 
ATOM   395 C  CA   . LYS A 1 24 ? -3.410  -1.509  -1.672 1.00 1.04 ? 24 LYS A CA   1 
ATOM   396 C  C    . LYS A 1 24 ? -4.844  -2.015  -1.854 1.00 1.17 ? 24 LYS A C    1 
ATOM   397 O  O    . LYS A 1 24 ? -5.582  -1.526  -2.686 1.00 1.26 ? 24 LYS A O    1 
ATOM   398 C  CB   . LYS A 1 24 ? -2.527  -2.049  -2.798 1.00 1.09 ? 24 LYS A CB   1 
ATOM   399 C  CG   . LYS A 1 24 ? -3.181  -1.761  -4.151 1.00 1.68 ? 24 LYS A CG   1 
ATOM   400 C  CD   . LYS A 1 24 ? -2.108  -1.757  -5.242 1.00 2.28 ? 24 LYS A CD   1 
ATOM   401 C  CE   . LYS A 1 24 ? -2.711  -1.244  -6.552 1.00 2.78 ? 24 LYS A CE   1 
ATOM   402 N  NZ   . LYS A 1 24 ? -1.749  -0.316  -7.211 1.00 3.32 ? 24 LYS A NZ   1 
ATOM   403 H  H    . LYS A 1 24 ? -2.120  -2.593  -0.334 1.00 0.90 ? 24 LYS A H    1 
ATOM   404 H  HA   . LYS A 1 24 ? -3.402  -0.431  -1.697 1.00 1.01 ? 24 LYS A HA   1 
ATOM   405 H  HB2  . LYS A 1 24 ? -1.560  -1.567  -2.755 1.00 1.42 ? 24 LYS A HB2  1 
ATOM   406 H  HB3  . LYS A 1 24 ? -2.404  -3.114  -2.679 1.00 1.42 ? 24 LYS A HB3  1 
ATOM   407 H  HG2  . LYS A 1 24 ? -3.913  -2.526  -4.367 1.00 2.22 ? 24 LYS A HG2  1 
ATOM   408 H  HG3  . LYS A 1 24 ? -3.664  -0.796  -4.120 1.00 2.07 ? 24 LYS A HG3  1 
ATOM   409 H  HD2  . LYS A 1 24 ? -1.294  -1.112  -4.943 1.00 2.62 ? 24 LYS A HD2  1 
ATOM   410 H  HD3  . LYS A 1 24 ? -1.738  -2.760  -5.387 1.00 2.76 ? 24 LYS A HD3  1 
ATOM   411 H  HE2  . LYS A 1 24 ? -2.911  -2.079  -7.207 1.00 3.23 ? 24 LYS A HE2  1 
ATOM   412 H  HE3  . LYS A 1 24 ? -3.632  -0.720  -6.343 1.00 3.00 ? 24 LYS A HE3  1 
ATOM   413 H  HZ1  . LYS A 1 24 ? -0.787  -0.708  -7.142 1.00 3.63 ? 24 LYS A HZ1  1 
ATOM   414 H  HZ2  . LYS A 1 24 ? -2.007  -0.202  -8.211 1.00 3.59 ? 24 LYS A HZ2  1 
ATOM   415 H  HZ3  . LYS A 1 24 ? -1.781  0.610   -6.739 1.00 3.68 ? 24 LYS A HZ3  1 
ATOM   416 N  N    . ARG A 1 25 ? -5.245  -2.990  -1.085 1.00 1.24 ? 25 ARG A N    1 
ATOM   417 C  CA   . ARG A 1 25 ? -6.631  -3.521  -1.220 1.00 1.40 ? 25 ARG A CA   1 
ATOM   418 C  C    . ARG A 1 25 ? -7.599  -2.619  -0.455 1.00 1.38 ? 25 ARG A C    1 
ATOM   419 O  O    . ARG A 1 25 ? -8.796  -2.661  -0.656 1.00 1.47 ? 25 ARG A O    1 
ATOM   420 C  CB   . ARG A 1 25 ? -6.694  -4.941  -0.652 1.00 1.52 ? 25 ARG A CB   1 
ATOM   421 C  CG   . ARG A 1 25 ? -5.684  -5.828  -1.382 1.00 1.88 ? 25 ARG A CG   1 
ATOM   422 C  CD   . ARG A 1 25 ? -5.816  -7.269  -0.884 1.00 2.49 ? 25 ARG A CD   1 
ATOM   423 N  NE   . ARG A 1 25 ? -6.844  -7.983  -1.692 1.00 3.10 ? 25 ARG A NE   1 
ATOM   424 C  CZ   . ARG A 1 25 ? -6.917  -9.285  -1.651 1.00 3.61 ? 25 ARG A CZ   1 
ATOM   425 N  NH1  . ARG A 1 25 ? -7.601  -9.872  -0.707 1.00 4.22 ? 25 ARG A NH1  1 
ATOM   426 N  NH2  . ARG A 1 25 ? -6.305  -10.001 -2.555 1.00 3.92 ? 25 ARG A NH2  1 
ATOM   427 H  H    . ARG A 1 25 ? -4.636  -3.372  -0.419 1.00 1.22 ? 25 ARG A H    1 
ATOM   428 H  HA   . ARG A 1 25 ? -6.908  -3.536  -2.262 1.00 1.48 ? 25 ARG A HA   1 
ATOM   429 H  HB2  . ARG A 1 25 ? -6.458  -4.917  0.402  1.00 1.72 ? 25 ARG A HB2  1 
ATOM   430 H  HB3  . ARG A 1 25 ? -7.688  -5.341  -0.790 1.00 1.74 ? 25 ARG A HB3  1 
ATOM   431 H  HG2  . ARG A 1 25 ? -5.878  -5.794  -2.445 1.00 2.25 ? 25 ARG A HG2  1 
ATOM   432 H  HG3  . ARG A 1 25 ? -4.684  -5.472  -1.186 1.00 2.21 ? 25 ARG A HG3  1 
ATOM   433 H  HD2  . ARG A 1 25 ? -4.866  -7.773  -0.985 1.00 2.79 ? 25 ARG A HD2  1 
ATOM   434 H  HD3  . ARG A 1 25 ? -6.113  -7.265  0.154  1.00 2.92 ? 25 ARG A HD3  1 
ATOM   435 H  HE   . ARG A 1 25 ? -7.466  -7.474  -2.254 1.00 3.45 ? 25 ARG A HE   1 
ATOM   436 H  HH11 . ARG A 1 25 ? -8.070  -9.323  -0.015 1.00 4.34 ? 25 ARG A HH11 1 
ATOM   437 H  HH12 . ARG A 1 25 ? -7.657  -10.870 -0.676 1.00 4.78 ? 25 ARG A HH12 1 
ATOM   438 H  HH21 . ARG A 1 25 ? -5.781  -9.551  -3.278 1.00 3.91 ? 25 ARG A HH21 1 
ATOM   439 H  HH22 . ARG A 1 25 ? -6.360  -10.999 -2.524 1.00 4.43 ? 25 ARG A HH22 1 
ATOM   440 N  N    . THR A 1 26 ? -7.086  -1.800  0.417  1.00 1.30 ? 26 THR A N    1 
ATOM   441 C  CA   . THR A 1 26 ? -7.970  -0.887  1.194  1.00 1.34 ? 26 THR A CA   1 
ATOM   442 C  C    . THR A 1 26 ? -8.058  0.464   0.479  1.00 1.31 ? 26 THR A C    1 
ATOM   443 O  O    . THR A 1 26 ? -8.713  1.378   0.938  1.00 1.42 ? 26 THR A O    1 
ATOM   444 C  CB   . THR A 1 26 ? -7.390  -0.684  2.597  1.00 1.29 ? 26 THR A CB   1 
ATOM   445 O  OG1  . THR A 1 26 ? -7.126  -1.950  3.186  1.00 2.04 ? 26 THR A OG1  1 
ATOM   446 C  CG2  . THR A 1 26 ? -8.393  0.083   3.459  1.00 1.90 ? 26 THR A CG2  1 
ATOM   447 H  H    . THR A 1 26 ? -6.118  -1.783  0.557  1.00 1.25 ? 26 THR A H    1 
ATOM   448 H  HA   . THR A 1 26 ? -8.956  -1.319  1.271  1.00 1.45 ? 26 THR A HA   1 
ATOM   449 H  HB   . THR A 1 26 ? -6.473  -0.119  2.530  1.00 1.37 ? 26 THR A HB   1 
ATOM   450 H  HG1  . THR A 1 26 ? -6.757  -2.521  2.509  1.00 2.41 ? 26 THR A HG1  1 
ATOM   451 H  HG21 . THR A 1 26 ? -9.312  0.217   2.908  1.00 2.39 ? 26 THR A HG21 1 
ATOM   452 H  HG22 . THR A 1 26 ? -8.592  -0.474  4.362  1.00 2.35 ? 26 THR A HG22 1 
ATOM   453 H  HG23 . THR A 1 26 ? -7.983  1.049   3.715  1.00 2.34 ? 26 THR A HG23 1 
ATOM   454 N  N    . HIS A 1 27 ? -7.401  0.596   -0.643 1.00 1.23 ? 27 HIS A N    1 
ATOM   455 C  CA   . HIS A 1 27 ? -7.445  1.887   -1.385 1.00 1.26 ? 27 HIS A CA   1 
ATOM   456 C  C    . HIS A 1 27 ? -8.562  1.839   -2.429 1.00 1.44 ? 27 HIS A C    1 
ATOM   457 O  O    . HIS A 1 27 ? -9.198  2.834   -2.716 1.00 1.63 ? 27 HIS A O    1 
ATOM   458 C  CB   . HIS A 1 27 ? -6.104  2.116   -2.087 1.00 1.19 ? 27 HIS A CB   1 
ATOM   459 C  CG   . HIS A 1 27 ? -5.294  3.113   -1.306 1.00 1.04 ? 27 HIS A CG   1 
ATOM   460 N  ND1  . HIS A 1 27 ? -5.795  4.354   -0.950 1.00 0.96 ? 27 HIS A ND1  1 
ATOM   461 C  CD2  . HIS A 1 27 ? -4.016  3.066   -0.804 1.00 0.99 ? 27 HIS A CD2  1 
ATOM   462 C  CE1  . HIS A 1 27 ? -4.834  5.000   -0.266 1.00 0.88 ? 27 HIS A CE1  1 
ATOM   463 N  NE2  . HIS A 1 27 ? -3.727  4.260   -0.147 1.00 0.89 ? 27 HIS A NE2  1 
ATOM   464 H  H    . HIS A 1 27 ? -6.877  -0.152  -0.996 1.00 1.20 ? 27 HIS A H    1 
ATOM   465 H  HA   . HIS A 1 27 ? -7.632  2.694   -0.693 1.00 1.25 ? 27 HIS A HA   1 
ATOM   466 H  HB2  . HIS A 1 27 ? -5.565  1.182   -2.147 1.00 1.23 ? 27 HIS A HB2  1 
ATOM   467 H  HB3  . HIS A 1 27 ? -6.280  2.496   -3.082 1.00 1.26 ? 27 HIS A HB3  1 
ATOM   468 H  HD1  . HIS A 1 27 ? -6.689  4.699   -1.159 1.00 0.99 ? 27 HIS A HD1  1 
ATOM   469 H  HD2  . HIS A 1 27 ? -3.338  2.230   -0.906 1.00 1.06 ? 27 HIS A HD2  1 
ATOM   470 H  HE1  . HIS A 1 27 ? -4.946  5.994   0.139  1.00 0.86 ? 27 HIS A HE1  1 
ATOM   471 N  N    . THR A 1 28 ? -8.805  0.692   -3.002 1.00 1.46 ? 28 THR A N    1 
ATOM   472 C  CA   . THR A 1 28 ? -9.880  0.588   -4.029 1.00 1.66 ? 28 THR A CA   1 
ATOM   473 C  C    . THR A 1 28 ? -10.832 -0.551  -3.663 1.00 1.07 ? 28 THR A C    1 
ATOM   474 O  O    . THR A 1 28 ? -10.962 -1.520  -4.385 1.00 1.71 ? 28 THR A O    1 
ATOM   475 C  CB   . THR A 1 28 ? -9.252  0.310   -5.397 1.00 2.76 ? 28 THR A CB   1 
ATOM   476 O  OG1  . THR A 1 28 ? -8.027  1.022   -5.507 1.00 3.54 ? 28 THR A OG1  1 
ATOM   477 C  CG2  . THR A 1 28 ? -10.209 0.761   -6.501 1.00 3.45 ? 28 THR A CG2  1 
ATOM   478 H  H    . THR A 1 28 ? -8.280  -0.100  -2.759 1.00 1.41 ? 28 THR A H    1 
ATOM   479 H  HA   . THR A 1 28 ? -10.429 1.517   -4.068 1.00 2.17 ? 28 THR A HA   1 
ATOM   480 H  HB   . THR A 1 28 ? -9.064  -0.748  -5.499 1.00 3.11 ? 28 THR A HB   1 
ATOM   481 H  HG1  . THR A 1 28 ? -7.576  0.716   -6.297 1.00 4.01 ? 28 THR A HG1  1 
ATOM   482 H  HG21 . THR A 1 28 ? -11.187 0.936   -6.080 1.00 3.93 ? 28 THR A HG21 1 
ATOM   483 H  HG22 . THR A 1 28 ? -9.839  1.672   -6.947 1.00 3.89 ? 28 THR A HG22 1 
ATOM   484 H  HG23 . THR A 1 28 ? -10.274 -0.009  -7.256 1.00 3.60 ? 28 THR A HG23 1 
ATOM   485 N  N    . GLY A 1 29 ? -11.501 -0.444  -2.548 1.00 1.29 ? 29 GLY A N    1 
ATOM   486 C  CA   . GLY A 1 29 ? -12.445 -1.522  -2.141 1.00 2.39 ? 29 GLY A CA   1 
ATOM   487 C  C    . GLY A 1 29 ? -13.816 -1.264  -2.771 1.00 2.77 ? 29 GLY A C    1 
ATOM   488 O  O    . GLY A 1 29 ? -13.926 -1.014  -3.955 1.00 3.44 ? 29 GLY A O    1 
ATOM   489 H  H    . GLY A 1 29 ? -11.383 0.346   -1.980 1.00 1.47 ? 29 GLY A H    1 
ATOM   490 H  HA2  . GLY A 1 29 ? -12.066 -2.477  -2.477 1.00 3.02 ? 29 GLY A HA2  1 
ATOM   491 H  HA3  . GLY A 1 29 ? -12.542 -1.530  -1.066 1.00 2.96 ? 29 GLY A HA3  1 
ATOM   492 N  N    . GLU A 1 30 ? -14.862 -1.319  -1.991 1.00 3.05 ? 30 GLU A N    1 
ATOM   493 C  CA   . GLU A 1 30 ? -16.222 -1.075  -2.549 1.00 4.02 ? 30 GLU A CA   1 
ATOM   494 C  C    . GLU A 1 30 ? -16.370 -1.814  -3.881 1.00 4.26 ? 30 GLU A C    1 
ATOM   495 O  O    . GLU A 1 30 ? -16.226 -1.237  -4.941 1.00 4.39 ? 30 GLU A O    1 
ATOM   496 C  CB   . GLU A 1 30 ? -16.419 0.426   -2.774 1.00 4.83 ? 30 GLU A CB   1 
ATOM   497 C  CG   . GLU A 1 30 ? -16.445 1.147   -1.425 1.00 5.56 ? 30 GLU A CG   1 
ATOM   498 C  CD   . GLU A 1 30 ? -15.148 1.938   -1.244 1.00 6.44 ? 30 GLU A CD   1 
ATOM   499 O  OE1  . GLU A 1 30 ? -14.777 2.648   -2.164 1.00 6.78 ? 30 GLU A OE1  1 
ATOM   500 O  OE2  . GLU A 1 30 ? -14.548 1.819   -0.189 1.00 7.01 ? 30 GLU A OE2  1 
ATOM   501 H  H    . GLU A 1 30 ? -14.753 -1.520  -1.038 1.00 3.04 ? 30 GLU A H    1 
ATOM   502 H  HA   . GLU A 1 30 ? -16.966 -1.435  -1.854 1.00 4.48 ? 30 GLU A HA   1 
ATOM   503 H  HB2  . GLU A 1 30 ? -15.606 0.810   -3.373 1.00 4.88 ? 30 GLU A HB2  1 
ATOM   504 H  HB3  . GLU A 1 30 ? -17.354 0.593   -3.287 1.00 5.26 ? 30 GLU A HB3  1 
ATOM   505 H  HG2  . GLU A 1 30 ? -17.287 1.824   -1.395 1.00 5.71 ? 30 GLU A HG2  1 
ATOM   506 H  HG3  . GLU A 1 30 ? -16.537 0.422   -0.631 1.00 5.71 ? 30 GLU A HG3  1 
ATOM   507 N  N    . LYS A 1 31 ? -16.659 -3.086  -3.837 1.00 4.85 ? 31 LYS A N    1 
ATOM   508 C  CA   . LYS A 1 31 ? -16.817 -3.858  -5.102 1.00 5.58 ? 31 LYS A CA   1 
ATOM   509 C  C    . LYS A 1 31 ? -18.169 -4.575  -5.095 1.00 6.27 ? 31 LYS A C    1 
ATOM   510 O  O    . LYS A 1 31 ? -18.857 -4.491  -4.092 1.00 6.66 ? 31 LYS A O    1 
ATOM   511 C  CB   . LYS A 1 31 ? -15.694 -4.891  -5.214 1.00 6.15 ? 31 LYS A CB   1 
ATOM   512 C  CG   . LYS A 1 31 ? -15.761 -5.849  -4.023 1.00 6.70 ? 31 LYS A CG   1 
ATOM   513 C  CD   . LYS A 1 31 ? -14.346 -6.293  -3.645 1.00 7.60 ? 31 LYS A CD   1 
ATOM   514 C  CE   . LYS A 1 31 ? -13.812 -7.257  -4.707 1.00 8.36 ? 31 LYS A CE   1 
ATOM   515 N  NZ   . LYS A 1 31 ? -12.363 -7.507  -4.466 1.00 8.96 ? 31 LYS A NZ   1 
ATOM   516 O  OXT  . LYS A 1 31 ? -18.492 -5.197  -6.094 1.00 6.71 ? 31 LYS A OXT  1 
ATOM   517 H  H    . LYS A 1 31 ? -16.772 -3.533  -2.972 1.00 5.10 ? 31 LYS A H    1 
ATOM   518 H  HA   . LYS A 1 31 ? -16.771 -3.184  -5.944 1.00 5.65 ? 31 LYS A HA   1 
ATOM   519 H  HB2  . LYS A 1 31 ? -15.809 -5.449  -6.132 1.00 5.95 ? 31 LYS A HB2  1 
ATOM   520 H  HB3  . LYS A 1 31 ? -14.739 -4.387  -5.215 1.00 6.72 ? 31 LYS A HB3  1 
ATOM   521 H  HG2  . LYS A 1 31 ? -16.219 -5.347  -3.183 1.00 6.86 ? 31 LYS A HG2  1 
ATOM   522 H  HG3  . LYS A 1 31 ? -16.349 -6.715  -4.290 1.00 6.63 ? 31 LYS A HG3  1 
ATOM   523 H  HD2  . LYS A 1 31 ? -13.702 -5.428  -3.585 1.00 7.61 ? 31 LYS A HD2  1 
ATOM   524 H  HD3  . LYS A 1 31 ? -14.370 -6.792  -2.688 1.00 7.95 ? 31 LYS A HD3  1 
ATOM   525 H  HE2  . LYS A 1 31 ? -14.353 -8.190  -4.650 1.00 8.68 ? 31 LYS A HE2  1 
ATOM   526 H  HE3  . LYS A 1 31 ? -13.945 -6.822  -5.686 1.00 8.42 ? 31 LYS A HE3  1 
ATOM   527 H  HZ1  . LYS A 1 31 ? -11.939 -6.676  -4.007 1.00 9.08 ? 31 LYS A HZ1  1 
ATOM   528 H  HZ2  . LYS A 1 31 ? -12.251 -8.336  -3.849 1.00 9.27 ? 31 LYS A HZ2  1 
ATOM   529 H  HZ3  . LYS A 1 31 ? -11.887 -7.682  -5.375 1.00 9.17 ? 31 LYS A HZ3  1 
HETATM 530 ZN ZN   . ZN  B 2 .  ? -1.783  3.781   0.562  1.00 0.72 ? 32 ZN  A ZN   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ARG 1  1  1  ARG ARG A . n 
A 1 2  PRO 2  2  2  PRO PRO A . n 
A 1 3  PHE 3  3  3  PHE PHE A . n 
A 1 4  MET 4  4  4  MET MET A . n 
A 1 5  CYS 5  5  5  CYS CYS A . n 
A 1 6  THR 6  6  6  THR THR A . n 
A 1 7  TRP 7  7  7  TRP TRP A . n 
A 1 8  SER 8  8  8  SER SER A . n 
A 1 9  TYR 9  9  9  TYR TYR A . n 
A 1 10 CYS 10 10 10 CYS CYS A . n 
A 1 11 GLY 11 11 11 GLY GLY A . n 
A 1 12 LYS 12 12 12 LYS LYS A . n 
A 1 13 ARG 13 13 13 ARG ARG A . n 
A 1 14 PHE 14 14 14 PHE PHE A . n 
A 1 15 THR 15 15 15 THR THR A . n 
A 1 16 ARG 16 16 16 ARG ARG A . n 
A 1 17 SER 17 17 17 SER SER A . n 
A 1 18 ASP 18 18 18 ASP ASP A . n 
A 1 19 GLU 19 19 19 GLU GLU A . n 
A 1 20 LEU 20 20 20 LEU LEU A . n 
A 1 21 GLN 21 21 21 GLN GLN A . n 
A 1 22 ARG 22 22 22 ARG ARG A . n 
A 1 23 HIS 23 23 23 HIS HIS A . n 
A 1 24 LYS 24 24 24 LYS LYS A . n 
A 1 25 ARG 25 25 25 ARG ARG A . n 
A 1 26 THR 26 26 26 THR THR A . n 
A 1 27 HIS 27 27 27 HIS HIS A . n 
A 1 28 THR 28 28 28 THR THR A . n 
A 1 29 GLY 29 29 29 GLY GLY A . n 
A 1 30 GLU 30 30 30 GLU GLU A . n 
A 1 31 LYS 31 31 31 LYS LYS A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          ZN 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     32 
_pdbx_nonpoly_scheme.auth_seq_num    32 
_pdbx_nonpoly_scheme.pdb_mon_id      ZN 
_pdbx_nonpoly_scheme.auth_mon_id     ZN 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG  ? A CYS 5  ? A CYS 5  ? 1_555 ZN ? B ZN . ? A ZN 32 ? 1_555 SG  ? A CYS 10 ? A CYS 10 ? 1_555 111.0 ? 
2 SG  ? A CYS 5  ? A CYS 5  ? 1_555 ZN ? B ZN . ? A ZN 32 ? 1_555 NE2 ? A HIS 23 ? A HIS 23 ? 1_555 111.5 ? 
3 SG  ? A CYS 10 ? A CYS 10 ? 1_555 ZN ? B ZN . ? A ZN 32 ? 1_555 NE2 ? A HIS 23 ? A HIS 23 ? 1_555 110.8 ? 
4 SG  ? A CYS 5  ? A CYS 5  ? 1_555 ZN ? B ZN . ? A ZN 32 ? 1_555 NE2 ? A HIS 27 ? A HIS 27 ? 1_555 107.6 ? 
5 SG  ? A CYS 10 ? A CYS 10 ? 1_555 ZN ? B ZN . ? A ZN 32 ? 1_555 NE2 ? A HIS 27 ? A HIS 27 ? 1_555 108.2 ? 
6 NE2 ? A HIS 23 ? A HIS 23 ? 1_555 ZN ? B ZN . ? A ZN 32 ? 1_555 NE2 ? A HIS 27 ? A HIS 27 ? 1_555 107.5 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-04-21 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
X-PLOR phasing          . ? 3 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 10 ? ? -104.24 -93.30 
2 1 ARG A 16 ? ? 179.35  120.49 
3 1 GLU A 30 ? ? 43.70   81.38  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 ARG A 1  ? ? 0.204 'SIDE CHAIN' 
2 1 ARG A 13 ? ? 0.249 'SIDE CHAIN' 
3 1 ARG A 16 ? ? 0.301 'SIDE CHAIN' 
4 1 ARG A 22 ? ? 0.310 'SIDE CHAIN' 
5 1 ARG A 25 ? ? 0.316 'SIDE CHAIN' 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'ZINC ION' 
_pdbx_entity_nonpoly.comp_id     ZN 
#