data_1SQ0
# 
_entry.id   1SQ0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SQ0         
RCSB  RCSB021902   
WWPDB D_1000021902 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1M10 
'Crystal Structure of the Complex of Glycoprotein Ib Alpha and the von Willebrand Factor A1 Domain with Gain-of-Function Mutations' 
unspecified 
PDB 1M0Z 'Crystal Structure of the Von Willebrand Factor Binding Domain of Glycoprotein Ib Alpha' unspecified 
PDB 1AUQ 'Crystal Structure of the A1 domain of Von Willebrand Factor' unspecified 
PDB 1P8V 'Crystal Structure of the Complex of Glycoprotein Ib-Alpha and Alpha-Thrombin' unspecified 
PDB 1OOK 'Crystal Structure of the Complex of Glycoprotein Ib-Alpha and Alpha-Thrombin' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SQ0 
_pdbx_database_status.recvd_initial_deposition_date   2004-03-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dumas, J.J.'  1 
'Kumar, R.'    2 
'McDonagh, T.' 3 
'Sullivan, F.' 4 
'Stahl, M.L.'  5 
'Somers, W.S.' 6 
'Mosyak, L.'   7 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Crystal structure of the wild-type von Willebrand factor A1-glycoprotein Ibalpha complex reveals conformation differences with a complex bearing von Willebrand disease mutations
;
J.Biol.Chem. 279 23327 23334 2004 JBCHA3 US 0021-9258 0071 ? 15039442 10.1074/jbc.M401659200  
1       'Crystal Structure of the GpIb(alpha)-Thrombin Complex Essential for Platelet Aggregation' Science      301 222   226   
2003 SCIEAS US 0036-8075 0038 ? ?        10.1126/science.1083917 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dumas, J.J.'  1  
primary 'Kumar, R.'    2  
primary 'McDonagh, T.' 3  
primary 'Sullivan, F.' 4  
primary 'Stahl, M.L.'  5  
primary 'Somers, W.S.' 6  
primary 'Mosyak, L.'   7  
1       'Dumas, J.J.'  8  
1       'Kumar, R.'    9  
1       'Seehra, J.'   10 
1       'Somers, W.S.' 11 
1       'Mosyak, L.'   12 
# 
_cell.entry_id           1SQ0 
_cell.length_a           72.497 
_cell.length_b           116.104 
_cell.length_c           67.962 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1SQ0 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Von Willebrand factor (vWF) [Contains: Von Willebrand antigen II]' 24466.361 1   ? ?             A1 ? 
2 polymer man 
;Platelet glycoprotein Ib alpha chain (Glycoprotein Ibalpha) (GP-Ib alpha) (GPIbA) (GPIb-alpha) (CD42B-alpha) (CD42B) [Contains: Glycocalicin]
;
32084.498 1   ? 'N21D, N159D' 'Glycoprotein Ib-(alpha)' ? 
3 water   nat water 18.015    318 ? ?             ?                         ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MEDISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPS
ELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGP
HANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPPPTLPPH
;
;MEDISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPS
ELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGP
HANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPPPTLPPH
;
A ? 
2 'polypeptide(L)' no no 
;HPICEVSKVASHLEVNCDKRDLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLG
TLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNDL
TELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMT
SNVASVQCDNSDKFPVYKYPGKGCPTLGDEGDTDLYDYYPEEDTEGDK
;
;HPICEVSKVASHLEVNCDKRDLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLG
TLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNDL
TELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMT
SNVASVQCDNSDKFPVYKYPGKGCPTLGDEGDTDLYDYYPEEDTEGDK
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   ASP n 
1 4   ILE n 
1 5   SER n 
1 6   GLU n 
1 7   PRO n 
1 8   PRO n 
1 9   LEU n 
1 10  HIS n 
1 11  ASP n 
1 12  PHE n 
1 13  TYR n 
1 14  CYS n 
1 15  SER n 
1 16  ARG n 
1 17  LEU n 
1 18  LEU n 
1 19  ASP n 
1 20  LEU n 
1 21  VAL n 
1 22  PHE n 
1 23  LEU n 
1 24  LEU n 
1 25  ASP n 
1 26  GLY n 
1 27  SER n 
1 28  SER n 
1 29  ARG n 
1 30  LEU n 
1 31  SER n 
1 32  GLU n 
1 33  ALA n 
1 34  GLU n 
1 35  PHE n 
1 36  GLU n 
1 37  VAL n 
1 38  LEU n 
1 39  LYS n 
1 40  ALA n 
1 41  PHE n 
1 42  VAL n 
1 43  VAL n 
1 44  ASP n 
1 45  MET n 
1 46  MET n 
1 47  GLU n 
1 48  ARG n 
1 49  LEU n 
1 50  ARG n 
1 51  ILE n 
1 52  SER n 
1 53  GLN n 
1 54  LYS n 
1 55  TRP n 
1 56  VAL n 
1 57  ARG n 
1 58  VAL n 
1 59  ALA n 
1 60  VAL n 
1 61  VAL n 
1 62  GLU n 
1 63  TYR n 
1 64  HIS n 
1 65  ASP n 
1 66  GLY n 
1 67  SER n 
1 68  HIS n 
1 69  ALA n 
1 70  TYR n 
1 71  ILE n 
1 72  GLY n 
1 73  LEU n 
1 74  LYS n 
1 75  ASP n 
1 76  ARG n 
1 77  LYS n 
1 78  ARG n 
1 79  PRO n 
1 80  SER n 
1 81  GLU n 
1 82  LEU n 
1 83  ARG n 
1 84  ARG n 
1 85  ILE n 
1 86  ALA n 
1 87  SER n 
1 88  GLN n 
1 89  VAL n 
1 90  LYS n 
1 91  TYR n 
1 92  ALA n 
1 93  GLY n 
1 94  SER n 
1 95  GLN n 
1 96  VAL n 
1 97  ALA n 
1 98  SER n 
1 99  THR n 
1 100 SER n 
1 101 GLU n 
1 102 VAL n 
1 103 LEU n 
1 104 LYS n 
1 105 TYR n 
1 106 THR n 
1 107 LEU n 
1 108 PHE n 
1 109 GLN n 
1 110 ILE n 
1 111 PHE n 
1 112 SER n 
1 113 LYS n 
1 114 ILE n 
1 115 ASP n 
1 116 ARG n 
1 117 PRO n 
1 118 GLU n 
1 119 ALA n 
1 120 SER n 
1 121 ARG n 
1 122 ILE n 
1 123 ALA n 
1 124 LEU n 
1 125 LEU n 
1 126 LEU n 
1 127 MET n 
1 128 ALA n 
1 129 SER n 
1 130 GLN n 
1 131 GLU n 
1 132 PRO n 
1 133 GLN n 
1 134 ARG n 
1 135 MET n 
1 136 SER n 
1 137 ARG n 
1 138 ASN n 
1 139 PHE n 
1 140 VAL n 
1 141 ARG n 
1 142 TYR n 
1 143 VAL n 
1 144 GLN n 
1 145 GLY n 
1 146 LEU n 
1 147 LYS n 
1 148 LYS n 
1 149 LYS n 
1 150 LYS n 
1 151 VAL n 
1 152 ILE n 
1 153 VAL n 
1 154 ILE n 
1 155 PRO n 
1 156 VAL n 
1 157 GLY n 
1 158 ILE n 
1 159 GLY n 
1 160 PRO n 
1 161 HIS n 
1 162 ALA n 
1 163 ASN n 
1 164 LEU n 
1 165 LYS n 
1 166 GLN n 
1 167 ILE n 
1 168 ARG n 
1 169 LEU n 
1 170 ILE n 
1 171 GLU n 
1 172 LYS n 
1 173 GLN n 
1 174 ALA n 
1 175 PRO n 
1 176 GLU n 
1 177 ASN n 
1 178 LYS n 
1 179 ALA n 
1 180 PHE n 
1 181 VAL n 
1 182 LEU n 
1 183 SER n 
1 184 SER n 
1 185 VAL n 
1 186 ASP n 
1 187 GLU n 
1 188 LEU n 
1 189 GLU n 
1 190 GLN n 
1 191 GLN n 
1 192 ARG n 
1 193 ASP n 
1 194 GLU n 
1 195 ILE n 
1 196 VAL n 
1 197 SER n 
1 198 TYR n 
1 199 LEU n 
1 200 CYS n 
1 201 ASP n 
1 202 LEU n 
1 203 ALA n 
1 204 PRO n 
1 205 GLU n 
1 206 ALA n 
1 207 PRO n 
1 208 PRO n 
1 209 PRO n 
1 210 THR n 
1 211 LEU n 
1 212 PRO n 
1 213 PRO n 
1 214 HIS n 
2 1   HIS n 
2 2   PRO n 
2 3   ILE n 
2 4   CYS n 
2 5   GLU n 
2 6   VAL n 
2 7   SER n 
2 8   LYS n 
2 9   VAL n 
2 10  ALA n 
2 11  SER n 
2 12  HIS n 
2 13  LEU n 
2 14  GLU n 
2 15  VAL n 
2 16  ASN n 
2 17  CYS n 
2 18  ASP n 
2 19  LYS n 
2 20  ARG n 
2 21  ASP n 
2 22  LEU n 
2 23  THR n 
2 24  ALA n 
2 25  LEU n 
2 26  PRO n 
2 27  PRO n 
2 28  ASP n 
2 29  LEU n 
2 30  PRO n 
2 31  LYS n 
2 32  ASP n 
2 33  THR n 
2 34  THR n 
2 35  ILE n 
2 36  LEU n 
2 37  HIS n 
2 38  LEU n 
2 39  SER n 
2 40  GLU n 
2 41  ASN n 
2 42  LEU n 
2 43  LEU n 
2 44  TYR n 
2 45  THR n 
2 46  PHE n 
2 47  SER n 
2 48  LEU n 
2 49  ALA n 
2 50  THR n 
2 51  LEU n 
2 52  MET n 
2 53  PRO n 
2 54  TYR n 
2 55  THR n 
2 56  ARG n 
2 57  LEU n 
2 58  THR n 
2 59  GLN n 
2 60  LEU n 
2 61  ASN n 
2 62  LEU n 
2 63  ASP n 
2 64  ARG n 
2 65  CYS n 
2 66  GLU n 
2 67  LEU n 
2 68  THR n 
2 69  LYS n 
2 70  LEU n 
2 71  GLN n 
2 72  VAL n 
2 73  ASP n 
2 74  GLY n 
2 75  THR n 
2 76  LEU n 
2 77  PRO n 
2 78  VAL n 
2 79  LEU n 
2 80  GLY n 
2 81  THR n 
2 82  LEU n 
2 83  ASP n 
2 84  LEU n 
2 85  SER n 
2 86  HIS n 
2 87  ASN n 
2 88  GLN n 
2 89  LEU n 
2 90  GLN n 
2 91  SER n 
2 92  LEU n 
2 93  PRO n 
2 94  LEU n 
2 95  LEU n 
2 96  GLY n 
2 97  GLN n 
2 98  THR n 
2 99  LEU n 
2 100 PRO n 
2 101 ALA n 
2 102 LEU n 
2 103 THR n 
2 104 VAL n 
2 105 LEU n 
2 106 ASP n 
2 107 VAL n 
2 108 SER n 
2 109 PHE n 
2 110 ASN n 
2 111 ARG n 
2 112 LEU n 
2 113 THR n 
2 114 SER n 
2 115 LEU n 
2 116 PRO n 
2 117 LEU n 
2 118 GLY n 
2 119 ALA n 
2 120 LEU n 
2 121 ARG n 
2 122 GLY n 
2 123 LEU n 
2 124 GLY n 
2 125 GLU n 
2 126 LEU n 
2 127 GLN n 
2 128 GLU n 
2 129 LEU n 
2 130 TYR n 
2 131 LEU n 
2 132 LYS n 
2 133 GLY n 
2 134 ASN n 
2 135 GLU n 
2 136 LEU n 
2 137 LYS n 
2 138 THR n 
2 139 LEU n 
2 140 PRO n 
2 141 PRO n 
2 142 GLY n 
2 143 LEU n 
2 144 LEU n 
2 145 THR n 
2 146 PRO n 
2 147 THR n 
2 148 PRO n 
2 149 LYS n 
2 150 LEU n 
2 151 GLU n 
2 152 LYS n 
2 153 LEU n 
2 154 SER n 
2 155 LEU n 
2 156 ALA n 
2 157 ASN n 
2 158 ASN n 
2 159 ASP n 
2 160 LEU n 
2 161 THR n 
2 162 GLU n 
2 163 LEU n 
2 164 PRO n 
2 165 ALA n 
2 166 GLY n 
2 167 LEU n 
2 168 LEU n 
2 169 ASN n 
2 170 GLY n 
2 171 LEU n 
2 172 GLU n 
2 173 ASN n 
2 174 LEU n 
2 175 ASP n 
2 176 THR n 
2 177 LEU n 
2 178 LEU n 
2 179 LEU n 
2 180 GLN n 
2 181 GLU n 
2 182 ASN n 
2 183 SER n 
2 184 LEU n 
2 185 TYR n 
2 186 THR n 
2 187 ILE n 
2 188 PRO n 
2 189 LYS n 
2 190 GLY n 
2 191 PHE n 
2 192 PHE n 
2 193 GLY n 
2 194 SER n 
2 195 HIS n 
2 196 LEU n 
2 197 LEU n 
2 198 PRO n 
2 199 PHE n 
2 200 ALA n 
2 201 PHE n 
2 202 LEU n 
2 203 HIS n 
2 204 GLY n 
2 205 ASN n 
2 206 PRO n 
2 207 TRP n 
2 208 LEU n 
2 209 CYS n 
2 210 ASN n 
2 211 CYS n 
2 212 GLU n 
2 213 ILE n 
2 214 LEU n 
2 215 TYR n 
2 216 PHE n 
2 217 ARG n 
2 218 ARG n 
2 219 TRP n 
2 220 LEU n 
2 221 GLN n 
2 222 ASP n 
2 223 ASN n 
2 224 ALA n 
2 225 GLU n 
2 226 ASN n 
2 227 VAL n 
2 228 TYR n 
2 229 VAL n 
2 230 TRP n 
2 231 LYS n 
2 232 GLN n 
2 233 GLY n 
2 234 VAL n 
2 235 ASP n 
2 236 VAL n 
2 237 LYS n 
2 238 ALA n 
2 239 MET n 
2 240 THR n 
2 241 SER n 
2 242 ASN n 
2 243 VAL n 
2 244 ALA n 
2 245 SER n 
2 246 VAL n 
2 247 GLN n 
2 248 CYS n 
2 249 ASP n 
2 250 ASN n 
2 251 SER n 
2 252 ASP n 
2 253 LYS n 
2 254 PHE n 
2 255 PRO n 
2 256 VAL n 
2 257 TYR n 
2 258 LYS n 
2 259 TYR n 
2 260 PRO n 
2 261 GLY n 
2 262 LYS n 
2 263 GLY n 
2 264 CYS n 
2 265 PRO n 
2 266 THR n 
2 267 LEU n 
2 268 GLY n 
2 269 ASP n 
2 270 GLU n 
2 271 GLY n 
2 272 ASP n 
2 273 THR n 
2 274 ASP n 
2 275 LEU n 
2 276 TYR n 
2 277 ASP n 
2 278 TYR n 
2 279 TYR n 
2 280 PRO n 
2 281 GLU n 
2 282 GLU n 
2 283 ASP n 
2 284 THR n 
2 285 GLU n 
2 286 GLY n 
2 287 ASP n 
2 288 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo 'VWF, F8VWF' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ?                 
'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 'Escherichia coli' ? ? BL21DE3 ? ? ? ? ?   ? ? plasmid ? ? ? ? ? ? 
2 1 sample ? ? ? human Homo GP1BA        ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'Chinese hamster' 'Cricetulus griseus' 
10029  Cricetulus  ? ? ?                  ? ? ?       ? ? ? ? CHO ? ? ?       ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP VWF_HUMAN   P04275 1 
;VEDISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPS
ELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGP
HANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPPPTLPPH
;
1259 ? 
2 UNP GP1BA_HUMAN P07359 2 
;HPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLG
TLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNL
TELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMT
SNVASVQCDNSDKFPVYKYPGKGCPTLGDEGDTDLYDYYPEEDTEGDK
;
17   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1SQ0 A 1 ? 214 ? P04275 1259 ? 1472 ? 496 709 
2 2 1SQ0 B 1 ? 288 ? P07359 17   ? 304  ? 1   288 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1SQ0 MET A 1   ? UNP P04275 VAL 1259 ENGINEERED       496 1 
2 1SQ0 ASP B 21  ? UNP P07359 ASN 37   'SEE REMARK 999' 21  2 
2 1SQ0 ASP B 159 ? UNP P07359 ASN 175  'SEE REMARK 999' 159 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1SQ0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.85 
_exptl_crystal.density_percent_sol   56.5 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    'PEG-3350; potassium thiocyanate, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 ?   ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'ADSC QUANTUM 4' 2002-08-31 ? 
2 CCD 'ADSC QUANTUM 4' 2002-05-18 ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M 'Double-crystal, Si(111)' MAD x-ray 
2 1 M ?                         ?   x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.97942 1.0 
2 0.97959 1.0 
3 0.9686  1.0 
4 1       1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'ALS BEAMLINE 5.0.2' ALS 5.0.2 ? '0.97942, 0.97959, 0.9686' 
2 SYNCHROTRON 'ALS BEAMLINE 5.0.2' ALS 5.0.2 ? 1                          
# 
_reflns.entry_id                     1SQ0 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             49.58 
_reflns.d_resolution_high            2.6 
_reflns.number_obs                   17150 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        28.5 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1,2 
# 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.75 
_reflns_shell.percent_possible_all   84 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1,2 
# 
_refine.entry_id                                 1SQ0 
_refine.ls_number_reflns_obs                     17150 
_refine.ls_number_reflns_all                     17150 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               132767.56 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.58 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    93.9 
_refine.ls_R_factor_obs                          0.19 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19 
_refine.ls_R_factor_R_free                       0.239 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.8 
_refine.ls_number_reflns_R_free                  1685 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               40.6 
_refine.aniso_B[1][1]                            -2.42 
_refine.aniso_B[2][2]                            -10.55 
_refine.aniso_B[3][3]                            12.98 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.305156 
_refine.solvent_model_param_bsol                 34.4256 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;DISORDERED RESIDUES IN CHAIN A INCLUDE N-TERMINAL RESIDUES 496-5 AND C-TERMINAL RESIDUES 704-709. IN CHAIN A, SIDE CHAIN FOR LYS IS DISORDERED. DISORDERED RESIDUES IN CHAIN B INCLUDE C-TERMINAL RESIDUES 266-288.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1,2 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1SQ0 
_refine_analyze.Luzzati_coordinate_error_obs    0.28 
_refine_analyze.Luzzati_sigma_a_obs             0.36 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.37 
_refine_analyze.Luzzati_sigma_a_free            0.42 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3664 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             318 
_refine_hist.number_atoms_total               3982 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        49.58 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      26.0  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.87  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.56  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.62  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.34  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.58  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.60 
_refine_ls_shell.d_res_low                        2.76 
_refine_ls_shell.number_reflns_R_work             2261 
_refine_ls_shell.R_factor_R_work                  0.281 
_refine_ls_shell.percent_reflns_obs               84.0 
_refine_ls_shell.R_factor_R_free                  0.322 
_refine_ls_shell.R_factor_R_free_error            0.020 
_refine_ls_shell.percent_reflns_R_free            9.9 
_refine_ls_shell.number_reflns_R_free             248 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
4 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1SQ0 
_struct.title                     
;Crystal Structure of the Complex of the Wild-type Von Willebrand Factor A1 domain and Glycoprotein Ib alpha at 2.6 Angstrom Resolution
;
_struct.pdbx_descriptor           
;Von Willebrand factor (vWF) [Contains: Von Willebrand antigen II], Platelet glycoprotein Ib alpha chain (Glycoprotein Ibalpha) (GP-Ib alpha) (GPIbA) (GPIb-alpha) (CD42B-alpha) (CD42B) [Contains: Glycocalicin]
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SQ0 
_struct_keywords.pdbx_keywords   'BLOOD CLOTTING' 
_struct_keywords.text            
'Leucine Rich Repeat (LRR), right-handed beta-alpha superhelix); Integrin A (or I) domain fold, BLOOD CLOTTING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 31  ? LEU A 49  ? SER A 526 LEU A 544 1 ? 19 
HELX_P HELX_P2  2  ARG A 78  ? VAL A 89  ? ARG A 573 VAL A 584 1 ? 12 
HELX_P HELX_P3  3  SER A 98  ? ILE A 110 ? SER A 593 ILE A 605 1 ? 13 
HELX_P HELX_P4  4  PRO A 132 ? SER A 136 ? PRO A 627 SER A 631 5 ? 5  
HELX_P HELX_P5  5  ASN A 138 ? LYS A 149 ? ASN A 633 LYS A 644 1 ? 12 
HELX_P HELX_P6  6  ASN A 163 ? ALA A 174 ? ASN A 658 ALA A 669 1 ? 12 
HELX_P HELX_P7  7  SER A 184 ? LEU A 188 ? SER A 679 LEU A 683 5 ? 5  
HELX_P HELX_P8  8  GLN A 191 ? ASP A 201 ? GLN A 686 ASP A 696 1 ? 11 
HELX_P HELX_P9  9  ALA B 49  ? MET B 52  ? ALA B 49  MET B 52  5 ? 4  
HELX_P HELX_P10 10 ASN B 210 ? GLU B 212 ? ASN B 210 GLU B 212 5 ? 3  
HELX_P HELX_P11 11 ILE B 213 ? ASN B 223 ? ILE B 213 ASN B 223 1 ? 11 
HELX_P HELX_P12 12 VAL B 243 ? VAL B 246 ? VAL B 243 VAL B 246 5 ? 4  
HELX_P HELX_P13 13 GLN B 247 ? SER B 251 ? GLN B 247 SER B 251 5 ? 5  
HELX_P HELX_P14 14 PRO B 255 ? TYR B 259 ? PRO B 255 TYR B 259 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 14  SG ? ? ? 1_555 A CYS 200 SG ? ? A CYS 509 A CYS 695 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf2 disulf ? ? B CYS 4   SG ? ? ? 1_555 B CYS 17  SG ? ? B CYS 4   B CYS 17  1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf3 disulf ? ? B CYS 209 SG ? ? ? 1_555 B CYS 248 SG ? ? B CYS 209 B CYS 248 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf4 disulf ? ? B CYS 211 SG ? ? ? 1_555 B CYS 264 SG ? ? B CYS 211 B CYS 264 1_555 ? ? ? ? ? ? ? 2.036 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 18 ? 
B ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? parallel      
A 2  3  ? parallel      
A 3  4  ? parallel      
A 4  5  ? parallel      
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? parallel      
A 9  10 ? parallel      
A 10 11 ? parallel      
A 11 12 ? parallel      
A 12 13 ? parallel      
A 13 14 ? parallel      
A 14 15 ? parallel      
A 15 16 ? parallel      
A 16 17 ? parallel      
A 17 18 ? anti-parallel 
B 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  PHE A 180 ? LEU A 182 ? PHE A 675 LEU A 677 
A 2  VAL A 151 ? ILE A 158 ? VAL A 646 ILE A 653 
A 3  SER A 120 ? MET A 127 ? SER A 615 MET A 622 
A 4  LEU A 18  ? ASP A 25  ? LEU A 513 ASP A 520 
A 5  VAL A 56  ? TYR A 63  ? VAL A 551 TYR A 558 
A 6  SER A 67  ? ILE A 71  ? SER A 562 ILE A 566 
A 7  LYS B 237 ? SER B 241 ? LYS B 237 SER B 241 
A 8  VAL B 227 ? GLN B 232 ? VAL B 227 GLN B 232 
A 9  PHE B 199 ? PHE B 201 ? PHE B 199 PHE B 201 
A 10 THR B 176 ? LEU B 178 ? THR B 176 LEU B 178 
A 11 LYS B 152 ? SER B 154 ? LYS B 152 SER B 154 
A 12 GLU B 128 ? TYR B 130 ? GLU B 128 TYR B 130 
A 13 VAL B 104 ? ASP B 106 ? VAL B 104 ASP B 106 
A 14 THR B 81  ? ASP B 83  ? THR B 81  ASP B 83  
A 15 GLN B 59  ? ASN B 61  ? GLN B 59  ASN B 61  
A 16 ILE B 35  ? HIS B 37  ? ILE B 35  HIS B 37  
A 17 HIS B 12  ? ASN B 16  ? HIS B 12  ASN B 16  
A 18 GLU B 5   ? VAL B 9   ? GLU B 5   VAL B 9   
B 1  THR B 45  ? SER B 47  ? THR B 45  SER B 47  
B 2  LYS B 69  ? GLN B 71  ? LYS B 69  GLN B 71  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O LEU A 182 ? O LEU A 677 N GLY A 157 ? N GLY A 652 
A 2  3  O ILE A 152 ? O ILE A 647 N ARG A 121 ? N ARG A 616 
A 3  4  O ILE A 122 ? O ILE A 617 N VAL A 21  ? N VAL A 516 
A 4  5  N PHE A 22  ? N PHE A 517 O VAL A 61  ? O VAL A 556 
A 5  6  N GLU A 62  ? N GLU A 557 O HIS A 68  ? O HIS A 563 
A 6  7  N SER A 67  ? N SER A 562 O MET B 239 ? O MET B 239 
A 7  8  O THR B 240 ? O THR B 240 N VAL B 229 ? N VAL B 229 
A 8  9  O TYR B 228 ? O TYR B 228 N ALA B 200 ? N ALA B 200 
A 9  10 O PHE B 199 ? O PHE B 199 N LEU B 177 ? N LEU B 177 
A 10 11 O THR B 176 ? O THR B 176 N LEU B 153 ? N LEU B 153 
A 11 12 O LYS B 152 ? O LYS B 152 N LEU B 129 ? N LEU B 129 
A 12 13 O TYR B 130 ? O TYR B 130 N LEU B 105 ? N LEU B 105 
A 13 14 O VAL B 104 ? O VAL B 104 N LEU B 82  ? N LEU B 82  
A 14 15 O THR B 81  ? O THR B 81  N LEU B 60  ? N LEU B 60  
A 15 16 O ASN B 61  ? O ASN B 61  N LEU B 36  ? N LEU B 36  
A 16 17 O ILE B 35  ? O ILE B 35  N VAL B 15  ? N VAL B 15  
A 17 18 O HIS B 12  ? O HIS B 12  N VAL B 9   ? N VAL B 9   
B 1  2  N PHE B 46  ? N PHE B 46  O GLN B 71  ? O GLN B 71  
# 
_database_PDB_matrix.entry_id          1SQ0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SQ0 
_atom_sites.fract_transf_matrix[1][1]   0.013794 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008613 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014714 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 11  ? 54.916 69.983  3.429  1.00 82.91  ? 506 ASP A N   1 
ATOM   2    C CA  . ASP A 1 11  ? 54.944 71.212  4.274  1.00 83.62  ? 506 ASP A CA  1 
ATOM   3    C C   . ASP A 1 11  ? 54.007 72.289  3.756  1.00 83.38  ? 506 ASP A C   1 
ATOM   4    O O   . ASP A 1 11  ? 53.783 72.411  2.552  1.00 85.09  ? 506 ASP A O   1 
ATOM   5    C CB  . ASP A 1 11  ? 56.362 71.790  4.347  1.00 83.93  ? 506 ASP A CB  1 
ATOM   6    C CG  . ASP A 1 11  ? 57.182 71.189  5.467  1.00 84.04  ? 506 ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 11  ? 56.747 71.282  6.634  1.00 83.08  ? 506 ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 11  ? 58.261 70.629  5.182  1.00 83.45  ? 506 ASP A OD2 1 
ATOM   9    N N   . PHE A 1 12  ? 53.464 73.071  4.682  1.00 82.05  ? 507 PHE A N   1 
ATOM   10   C CA  . PHE A 1 12  ? 52.562 74.158  4.340  1.00 80.30  ? 507 PHE A CA  1 
ATOM   11   C C   . PHE A 1 12  ? 53.050 75.439  5.006  1.00 78.41  ? 507 PHE A C   1 
ATOM   12   O O   . PHE A 1 12  ? 53.212 75.498  6.225  1.00 76.60  ? 507 PHE A O   1 
ATOM   13   C CB  . PHE A 1 12  ? 51.130 73.835  4.795  1.00 82.25  ? 507 PHE A CB  1 
ATOM   14   C CG  . PHE A 1 12  ? 50.306 73.096  3.765  1.00 84.42  ? 507 PHE A CG  1 
ATOM   15   C CD1 . PHE A 1 12  ? 50.787 71.935  3.159  1.00 85.63  ? 507 PHE A CD1 1 
ATOM   16   C CD2 . PHE A 1 12  ? 49.044 73.565  3.401  1.00 84.88  ? 507 PHE A CD2 1 
ATOM   17   C CE1 . PHE A 1 12  ? 50.022 71.249  2.210  1.00 85.30  ? 507 PHE A CE1 1 
ATOM   18   C CE2 . PHE A 1 12  ? 48.272 72.887  2.455  1.00 85.23  ? 507 PHE A CE2 1 
ATOM   19   C CZ  . PHE A 1 12  ? 48.763 71.729  1.857  1.00 85.64  ? 507 PHE A CZ  1 
ATOM   20   N N   . TYR A 1 13  ? 53.306 76.452  4.183  1.00 76.90  ? 508 TYR A N   1 
ATOM   21   C CA  . TYR A 1 13  ? 53.762 77.759  4.645  1.00 73.99  ? 508 TYR A CA  1 
ATOM   22   C C   . TYR A 1 13  ? 52.810 78.822  4.092  1.00 72.08  ? 508 TYR A C   1 
ATOM   23   O O   . TYR A 1 13  ? 52.018 78.543  3.190  1.00 70.64  ? 508 TYR A O   1 
ATOM   24   C CB  . TYR A 1 13  ? 55.174 78.057  4.132  1.00 74.19  ? 508 TYR A CB  1 
ATOM   25   C CG  . TYR A 1 13  ? 56.298 77.240  4.741  1.00 73.91  ? 508 TYR A CG  1 
ATOM   26   C CD1 . TYR A 1 13  ? 56.376 75.856  4.556  1.00 74.57  ? 508 TYR A CD1 1 
ATOM   27   C CD2 . TYR A 1 13  ? 57.318 77.866  5.464  1.00 74.10  ? 508 TYR A CD2 1 
ATOM   28   C CE1 . TYR A 1 13  ? 57.454 75.116  5.077  1.00 75.43  ? 508 TYR A CE1 1 
ATOM   29   C CE2 . TYR A 1 13  ? 58.393 77.142  5.987  1.00 74.01  ? 508 TYR A CE2 1 
ATOM   30   C CZ  . TYR A 1 13  ? 58.458 75.771  5.793  1.00 75.29  ? 508 TYR A CZ  1 
ATOM   31   O OH  . TYR A 1 13  ? 59.523 75.069  6.322  1.00 72.63  ? 508 TYR A OH  1 
ATOM   32   N N   . CYS A 1 14  ? 52.889 80.034  4.639  1.00 71.08  ? 509 CYS A N   1 
ATOM   33   C CA  . CYS A 1 14  ? 52.057 81.150  4.184  1.00 70.62  ? 509 CYS A CA  1 
ATOM   34   C C   . CYS A 1 14  ? 52.348 82.438  4.959  1.00 68.88  ? 509 CYS A C   1 
ATOM   35   O O   . CYS A 1 14  ? 52.690 82.407  6.142  1.00 68.26  ? 509 CYS A O   1 
ATOM   36   C CB  . CYS A 1 14  ? 50.551 80.811  4.290  1.00 71.26  ? 509 CYS A CB  1 
ATOM   37   S SG  . CYS A 1 14  ? 49.788 80.974  5.946  1.00 71.86  ? 509 CYS A SG  1 
ATOM   38   N N   . SER A 1 15  ? 52.228 83.571  4.273  1.00 67.12  ? 510 SER A N   1 
ATOM   39   C CA  . SER A 1 15  ? 52.449 84.875  4.890  1.00 65.52  ? 510 SER A CA  1 
ATOM   40   C C   . SER A 1 15  ? 51.091 85.553  5.017  1.00 63.74  ? 510 SER A C   1 
ATOM   41   O O   . SER A 1 15  ? 50.338 85.622  4.043  1.00 62.33  ? 510 SER A O   1 
ATOM   42   C CB  . SER A 1 15  ? 53.381 85.737  4.029  1.00 66.09  ? 510 SER A CB  1 
ATOM   43   O OG  . SER A 1 15  ? 54.722 85.674  4.490  1.00 66.41  ? 510 SER A OG  1 
ATOM   44   N N   . ARG A 1 16  ? 50.773 86.039  6.216  1.00 61.33  ? 511 ARG A N   1 
ATOM   45   C CA  . ARG A 1 16  ? 49.488 86.695  6.461  1.00 58.82  ? 511 ARG A CA  1 
ATOM   46   C C   . ARG A 1 16  ? 49.574 87.668  7.637  1.00 56.27  ? 511 ARG A C   1 
ATOM   47   O O   . ARG A 1 16  ? 50.512 87.608  8.431  1.00 56.04  ? 511 ARG A O   1 
ATOM   48   C CB  . ARG A 1 16  ? 48.411 85.647  6.768  1.00 60.21  ? 511 ARG A CB  1 
ATOM   49   C CG  . ARG A 1 16  ? 48.304 84.501  5.763  1.00 59.67  ? 511 ARG A CG  1 
ATOM   50   C CD  . ARG A 1 16  ? 46.919 84.427  5.142  1.00 59.25  ? 511 ARG A CD  1 
ATOM   51   N NE  . ARG A 1 16  ? 46.785 83.315  4.203  1.00 60.45  ? 511 ARG A NE  1 
ATOM   52   C CZ  . ARG A 1 16  ? 47.505 83.170  3.096  1.00 59.37  ? 511 ARG A CZ  1 
ATOM   53   N NH1 . ARG A 1 16  ? 48.426 84.070  2.776  1.00 57.55  ? 511 ARG A NH1 1 
ATOM   54   N NH2 . ARG A 1 16  ? 47.300 82.121  2.307  1.00 58.34  ? 511 ARG A NH2 1 
ATOM   55   N N   . LEU A 1 17  ? 48.601 88.569  7.743  1.00 52.53  ? 512 LEU A N   1 
ATOM   56   C CA  . LEU A 1 17  ? 48.577 89.521  8.850  1.00 49.47  ? 512 LEU A CA  1 
ATOM   57   C C   . LEU A 1 17  ? 48.060 88.748  10.044 1.00 45.81  ? 512 LEU A C   1 
ATOM   58   O O   . LEU A 1 17  ? 46.880 88.417  10.110 1.00 46.07  ? 512 LEU A O   1 
ATOM   59   C CB  . LEU A 1 17  ? 47.649 90.693  8.539  1.00 50.97  ? 512 LEU A CB  1 
ATOM   60   C CG  . LEU A 1 17  ? 48.318 91.842  7.783  1.00 54.24  ? 512 LEU A CG  1 
ATOM   61   C CD1 . LEU A 1 17  ? 47.279 92.873  7.365  1.00 53.91  ? 512 LEU A CD1 1 
ATOM   62   C CD2 . LEU A 1 17  ? 49.389 92.469  8.681  1.00 55.84  ? 512 LEU A CD2 1 
ATOM   63   N N   . LEU A 1 18  ? 48.934 88.467  10.998 1.00 41.49  ? 513 LEU A N   1 
ATOM   64   C CA  . LEU A 1 18  ? 48.515 87.669  12.132 1.00 38.24  ? 513 LEU A CA  1 
ATOM   65   C C   . LEU A 1 18  ? 49.239 87.892  13.456 1.00 36.46  ? 513 LEU A C   1 
ATOM   66   O O   . LEU A 1 18  ? 50.422 88.225  13.496 1.00 35.29  ? 513 LEU A O   1 
ATOM   67   C CB  . LEU A 1 18  ? 48.647 86.198  11.743 1.00 36.52  ? 513 LEU A CB  1 
ATOM   68   C CG  . LEU A 1 18  ? 48.402 85.150  12.821 1.00 35.04  ? 513 LEU A CG  1 
ATOM   69   C CD1 . LEU A 1 18  ? 46.912 85.052  13.112 1.00 34.49  ? 513 LEU A CD1 1 
ATOM   70   C CD2 . LEU A 1 18  ? 48.950 83.817  12.343 1.00 35.51  ? 513 LEU A CD2 1 
ATOM   71   N N   . ASP A 1 19  ? 48.497 87.704  14.539 1.00 34.44  ? 514 ASP A N   1 
ATOM   72   C CA  . ASP A 1 19  ? 49.044 87.785  15.882 1.00 32.96  ? 514 ASP A CA  1 
ATOM   73   C C   . ASP A 1 19  ? 48.674 86.435  16.478 1.00 33.17  ? 514 ASP A C   1 
ATOM   74   O O   . ASP A 1 19  ? 47.525 86.209  16.857 1.00 33.15  ? 514 ASP A O   1 
ATOM   75   C CB  . ASP A 1 19  ? 48.405 88.919  16.672 1.00 34.01  ? 514 ASP A CB  1 
ATOM   76   C CG  . ASP A 1 19  ? 48.938 90.279  16.262 1.00 38.51  ? 514 ASP A CG  1 
ATOM   77   O OD1 . ASP A 1 19  ? 49.875 90.323  15.438 1.00 40.41  ? 514 ASP A OD1 1 
ATOM   78   O OD2 . ASP A 1 19  ? 48.429 91.304  16.763 1.00 39.41  ? 514 ASP A OD2 1 
ATOM   79   N N   . LEU A 1 20  ? 49.649 85.530  16.517 1.00 31.08  ? 515 LEU A N   1 
ATOM   80   C CA  . LEU A 1 20  ? 49.448 84.182  17.030 1.00 30.54  ? 515 LEU A CA  1 
ATOM   81   C C   . LEU A 1 20  ? 50.036 83.998  18.426 1.00 30.29  ? 515 LEU A C   1 
ATOM   82   O O   . LEU A 1 20  ? 51.206 84.289  18.665 1.00 32.62  ? 515 LEU A O   1 
ATOM   83   C CB  . LEU A 1 20  ? 50.084 83.184  16.064 1.00 32.76  ? 515 LEU A CB  1 
ATOM   84   C CG  . LEU A 1 20  ? 49.907 81.699  16.361 1.00 35.13  ? 515 LEU A CG  1 
ATOM   85   C CD1 . LEU A 1 20  ? 48.427 81.404  16.496 1.00 37.08  ? 515 LEU A CD1 1 
ATOM   86   C CD2 . LEU A 1 20  ? 50.523 80.856  15.251 1.00 34.89  ? 515 LEU A CD2 1 
ATOM   87   N N   . VAL A 1 21  ? 49.222 83.503  19.347 1.00 28.70  ? 516 VAL A N   1 
ATOM   88   C CA  . VAL A 1 21  ? 49.669 83.288  20.715 1.00 30.01  ? 516 VAL A CA  1 
ATOM   89   C C   . VAL A 1 21  ? 49.681 81.796  21.065 1.00 32.05  ? 516 VAL A C   1 
ATOM   90   O O   . VAL A 1 21  ? 48.648 81.126  21.006 1.00 33.17  ? 516 VAL A O   1 
ATOM   91   C CB  . VAL A 1 21  ? 48.750 84.024  21.710 1.00 30.69  ? 516 VAL A CB  1 
ATOM   92   C CG1 . VAL A 1 21  ? 49.239 83.809  23.123 1.00 30.70  ? 516 VAL A CG1 1 
ATOM   93   C CG2 . VAL A 1 21  ? 48.701 85.503  21.380 1.00 28.46  ? 516 VAL A CG2 1 
ATOM   94   N N   . PHE A 1 22  ? 50.858 81.285  21.424 1.00 31.93  ? 517 PHE A N   1 
ATOM   95   C CA  . PHE A 1 22  ? 51.032 79.879  21.794 1.00 31.74  ? 517 PHE A CA  1 
ATOM   96   C C   . PHE A 1 22  ? 50.858 79.692  23.310 1.00 33.57  ? 517 PHE A C   1 
ATOM   97   O O   . PHE A 1 22  ? 51.593 80.285  24.112 1.00 33.96  ? 517 PHE A O   1 
ATOM   98   C CB  . PHE A 1 22  ? 52.433 79.394  21.391 1.00 32.98  ? 517 PHE A CB  1 
ATOM   99   C CG  . PHE A 1 22  ? 52.637 79.257  19.910 1.00 32.83  ? 517 PHE A CG  1 
ATOM   100  C CD1 . PHE A 1 22  ? 52.282 78.087  19.251 1.00 34.30  ? 517 PHE A CD1 1 
ATOM   101  C CD2 . PHE A 1 22  ? 53.191 80.294  19.173 1.00 31.59  ? 517 PHE A CD2 1 
ATOM   102  C CE1 . PHE A 1 22  ? 52.478 77.949  17.876 1.00 34.75  ? 517 PHE A CE1 1 
ATOM   103  C CE2 . PHE A 1 22  ? 53.390 80.166  17.798 1.00 33.78  ? 517 PHE A CE2 1 
ATOM   104  C CZ  . PHE A 1 22  ? 53.033 78.993  17.148 1.00 32.10  ? 517 PHE A CZ  1 
ATOM   105  N N   . LEU A 1 23  ? 49.885 78.874  23.700 1.00 31.56  ? 518 LEU A N   1 
ATOM   106  C CA  . LEU A 1 23  ? 49.638 78.607  25.108 1.00 30.35  ? 518 LEU A CA  1 
ATOM   107  C C   . LEU A 1 23  ? 49.973 77.129  25.307 1.00 31.35  ? 518 LEU A C   1 
ATOM   108  O O   . LEU A 1 23  ? 49.337 76.261  24.709 1.00 34.15  ? 518 LEU A O   1 
ATOM   109  C CB  . LEU A 1 23  ? 48.172 78.912  25.446 1.00 29.76  ? 518 LEU A CB  1 
ATOM   110  C CG  . LEU A 1 23  ? 47.651 80.291  24.989 1.00 28.05  ? 518 LEU A CG  1 
ATOM   111  C CD1 . LEU A 1 23  ? 46.206 80.472  25.394 1.00 28.83  ? 518 LEU A CD1 1 
ATOM   112  C CD2 . LEU A 1 23  ? 48.475 81.392  25.600 1.00 27.50  ? 518 LEU A CD2 1 
ATOM   113  N N   . LEU A 1 24  ? 50.983 76.848  26.132 1.00 31.81  ? 519 LEU A N   1 
ATOM   114  C CA  . LEU A 1 24  ? 51.434 75.473  26.372 1.00 30.18  ? 519 LEU A CA  1 
ATOM   115  C C   . LEU A 1 24  ? 51.111 74.882  27.736 1.00 29.47  ? 519 LEU A C   1 
ATOM   116  O O   . LEU A 1 24  ? 51.461 75.449  28.768 1.00 29.32  ? 519 LEU A O   1 
ATOM   117  C CB  . LEU A 1 24  ? 52.949 75.371  26.180 1.00 30.95  ? 519 LEU A CB  1 
ATOM   118  C CG  . LEU A 1 24  ? 53.650 76.128  25.054 1.00 28.51  ? 519 LEU A CG  1 
ATOM   119  C CD1 . LEU A 1 24  ? 55.018 75.505  24.858 1.00 30.92  ? 519 LEU A CD1 1 
ATOM   120  C CD2 . LEU A 1 24  ? 52.862 76.045  23.772 1.00 32.07  ? 519 LEU A CD2 1 
ATOM   121  N N   . ASP A 1 25  ? 50.476 73.715  27.720 1.00 30.65  ? 520 ASP A N   1 
ATOM   122  C CA  . ASP A 1 25  ? 50.104 72.986  28.934 1.00 30.36  ? 520 ASP A CA  1 
ATOM   123  C C   . ASP A 1 25  ? 51.365 72.580  29.709 1.00 30.89  ? 520 ASP A C   1 
ATOM   124  O O   . ASP A 1 25  ? 52.222 71.867  29.189 1.00 31.41  ? 520 ASP A O   1 
ATOM   125  C CB  . ASP A 1 25  ? 49.304 71.733  28.548 1.00 30.60  ? 520 ASP A CB  1 
ATOM   126  C CG  . ASP A 1 25  ? 48.758 70.983  29.751 1.00 31.59  ? 520 ASP A CG  1 
ATOM   127  O OD1 . ASP A 1 25  ? 49.547 70.600  30.638 1.00 29.96  ? 520 ASP A OD1 1 
ATOM   128  O OD2 . ASP A 1 25  ? 47.530 70.771  29.804 1.00 33.43  ? 520 ASP A OD2 1 
ATOM   129  N N   . GLY A 1 26  ? 51.472 73.035  30.952 1.00 31.56  ? 521 GLY A N   1 
ATOM   130  C CA  . GLY A 1 26  ? 52.630 72.708  31.759 1.00 30.64  ? 521 GLY A CA  1 
ATOM   131  C C   . GLY A 1 26  ? 52.352 71.703  32.861 1.00 31.70  ? 521 GLY A C   1 
ATOM   132  O O   . GLY A 1 26  ? 53.007 71.720  33.898 1.00 30.97  ? 521 GLY A O   1 
ATOM   133  N N   . SER A 1 27  ? 51.388 70.816  32.638 1.00 33.07  ? 522 SER A N   1 
ATOM   134  C CA  . SER A 1 27  ? 51.033 69.803  33.627 1.00 31.70  ? 522 SER A CA  1 
ATOM   135  C C   . SER A 1 27  ? 51.818 68.515  33.429 1.00 31.55  ? 522 SER A C   1 
ATOM   136  O O   . SER A 1 27  ? 52.417 68.291  32.376 1.00 32.87  ? 522 SER A O   1 
ATOM   137  C CB  . SER A 1 27  ? 49.547 69.486  33.545 1.00 31.84  ? 522 SER A CB  1 
ATOM   138  O OG  . SER A 1 27  ? 49.255 68.824  32.331 1.00 28.42  ? 522 SER A OG  1 
ATOM   139  N N   . SER A 1 28  ? 51.798 67.664  34.447 1.00 30.06  ? 523 SER A N   1 
ATOM   140  C CA  . SER A 1 28  ? 52.501 66.395  34.385 1.00 29.92  ? 523 SER A CA  1 
ATOM   141  C C   . SER A 1 28  ? 51.784 65.369  33.510 1.00 29.76  ? 523 SER A C   1 
ATOM   142  O O   . SER A 1 28  ? 52.131 64.194  33.530 1.00 30.34  ? 523 SER A O   1 
ATOM   143  C CB  . SER A 1 28  ? 52.701 65.829  35.796 1.00 29.52  ? 523 SER A CB  1 
ATOM   144  O OG  . SER A 1 28  ? 51.482 65.779  36.515 1.00 32.88  ? 523 SER A OG  1 
ATOM   145  N N   . ARG A 1 29  ? 50.782 65.804  32.752 1.00 30.55  ? 524 ARG A N   1 
ATOM   146  C CA  . ARG A 1 29  ? 50.063 64.885  31.871 1.00 32.51  ? 524 ARG A CA  1 
ATOM   147  C C   . ARG A 1 29  ? 50.961 64.663  30.667 1.00 29.33  ? 524 ARG A C   1 
ATOM   148  O O   . ARG A 1 29  ? 50.723 63.788  29.841 1.00 30.60  ? 524 ARG A O   1 
ATOM   149  C CB  . ARG A 1 29  ? 48.720 65.471  31.421 1.00 35.86  ? 524 ARG A CB  1 
ATOM   150  C CG  . ARG A 1 29  ? 47.760 65.806  32.559 1.00 43.62  ? 524 ARG A CG  1 
ATOM   151  C CD  . ARG A 1 29  ? 46.641 64.782  32.736 1.00 47.49  ? 524 ARG A CD  1 
ATOM   152  N NE  . ARG A 1 29  ? 47.073 63.549  33.389 1.00 51.42  ? 524 ARG A NE  1 
ATOM   153  C CZ  . ARG A 1 29  ? 46.252 62.724  34.037 1.00 53.33  ? 524 ARG A CZ  1 
ATOM   154  N NH1 . ARG A 1 29  ? 44.954 62.999  34.126 1.00 50.16  ? 524 ARG A NH1 1 
ATOM   155  N NH2 . ARG A 1 29  ? 46.731 61.622  34.595 1.00 53.92  ? 524 ARG A NH2 1 
ATOM   156  N N   . LEU A 1 30  ? 51.993 65.485  30.572 1.00 25.96  ? 525 LEU A N   1 
ATOM   157  C CA  . LEU A 1 30  ? 52.966 65.366  29.502 1.00 24.57  ? 525 LEU A CA  1 
ATOM   158  C C   . LEU A 1 30  ? 54.322 65.199  30.178 1.00 24.98  ? 525 LEU A C   1 
ATOM   159  O O   . LEU A 1 30  ? 54.642 65.924  31.124 1.00 24.80  ? 525 LEU A O   1 
ATOM   160  C CB  . LEU A 1 30  ? 52.982 66.629  28.632 1.00 21.23  ? 525 LEU A CB  1 
ATOM   161  C CG  . LEU A 1 30  ? 51.792 66.952  27.727 1.00 18.50  ? 525 LEU A CG  1 
ATOM   162  C CD1 . LEU A 1 30  ? 51.973 68.340  27.123 1.00 20.27  ? 525 LEU A CD1 1 
ATOM   163  C CD2 . LEU A 1 30  ? 51.681 65.912  26.631 1.00 22.22  ? 525 LEU A CD2 1 
ATOM   164  N N   . SER A 1 31  ? 55.111 64.241  29.711 1.00 25.81  ? 526 SER A N   1 
ATOM   165  C CA  . SER A 1 31  ? 56.434 64.023  30.284 1.00 30.54  ? 526 SER A CA  1 
ATOM   166  C C   . SER A 1 31  ? 57.352 65.153  29.815 1.00 31.60  ? 526 SER A C   1 
ATOM   167  O O   . SER A 1 31  ? 57.035 65.857  28.854 1.00 32.68  ? 526 SER A O   1 
ATOM   168  C CB  . SER A 1 31  ? 57.009 62.688  29.815 1.00 31.20  ? 526 SER A CB  1 
ATOM   169  O OG  . SER A 1 31  ? 57.540 62.802  28.506 1.00 34.85  ? 526 SER A OG  1 
ATOM   170  N N   . GLU A 1 32  ? 58.485 65.327  30.486 1.00 32.46  ? 527 GLU A N   1 
ATOM   171  C CA  . GLU A 1 32  ? 59.418 66.379  30.110 1.00 32.74  ? 527 GLU A CA  1 
ATOM   172  C C   . GLU A 1 32  ? 59.789 66.205  28.649 1.00 32.76  ? 527 GLU A C   1 
ATOM   173  O O   . GLU A 1 32  ? 59.825 67.171  27.883 1.00 31.40  ? 527 GLU A O   1 
ATOM   174  C CB  . GLU A 1 32  ? 60.686 66.312  30.962 1.00 35.14  ? 527 GLU A CB  1 
ATOM   175  C CG  . GLU A 1 32  ? 61.584 67.532  30.794 1.00 40.80  ? 527 GLU A CG  1 
ATOM   176  C CD  . GLU A 1 32  ? 62.800 67.500  31.695 1.00 41.84  ? 527 GLU A CD  1 
ATOM   177  O OE1 . GLU A 1 32  ? 63.350 68.580  32.004 1.00 43.89  ? 527 GLU A OE1 1 
ATOM   178  O OE2 . GLU A 1 32  ? 63.210 66.393  32.088 1.00 46.11  ? 527 GLU A OE2 1 
ATOM   179  N N   . ALA A 1 33  ? 60.061 64.959  28.269 1.00 32.82  ? 528 ALA A N   1 
ATOM   180  C CA  . ALA A 1 33  ? 60.437 64.647  26.896 1.00 32.78  ? 528 ALA A CA  1 
ATOM   181  C C   . ALA A 1 33  ? 59.317 64.997  25.926 1.00 31.44  ? 528 ALA A C   1 
ATOM   182  O O   . ALA A 1 33  ? 59.578 65.518  24.842 1.00 28.03  ? 528 ALA A O   1 
ATOM   183  C CB  . ALA A 1 33  ? 60.793 63.184  26.775 1.00 32.31  ? 528 ALA A CB  1 
ATOM   184  N N   . GLU A 1 34  ? 58.074 64.705  26.314 1.00 31.48  ? 529 GLU A N   1 
ATOM   185  C CA  . GLU A 1 34  ? 56.922 65.018  25.469 1.00 31.47  ? 529 GLU A CA  1 
ATOM   186  C C   . GLU A 1 34  ? 56.802 66.534  25.328 1.00 30.03  ? 529 GLU A C   1 
ATOM   187  O O   . GLU A 1 34  ? 56.475 67.043  24.261 1.00 30.98  ? 529 GLU A O   1 
ATOM   188  C CB  . GLU A 1 34  ? 55.635 64.455  26.075 1.00 32.07  ? 529 GLU A CB  1 
ATOM   189  C CG  . GLU A 1 34  ? 55.687 62.960  26.326 1.00 35.77  ? 529 GLU A CG  1 
ATOM   190  C CD  . GLU A 1 34  ? 54.313 62.331  26.464 1.00 38.66  ? 529 GLU A CD  1 
ATOM   191  O OE1 . GLU A 1 34  ? 53.541 62.748  27.356 1.00 39.93  ? 529 GLU A OE1 1 
ATOM   192  O OE2 . GLU A 1 34  ? 54.006 61.410  25.676 1.00 40.48  ? 529 GLU A OE2 1 
ATOM   193  N N   . PHE A 1 35  ? 57.083 67.249  26.411 1.00 27.24  ? 530 PHE A N   1 
ATOM   194  C CA  . PHE A 1 35  ? 57.016 68.704  26.410 1.00 27.73  ? 530 PHE A CA  1 
ATOM   195  C C   . PHE A 1 35  ? 58.019 69.288  25.414 1.00 28.09  ? 530 PHE A C   1 
ATOM   196  O O   . PHE A 1 35  ? 57.777 70.329  24.787 1.00 24.23  ? 530 PHE A O   1 
ATOM   197  C CB  . PHE A 1 35  ? 57.328 69.240  27.809 1.00 24.25  ? 530 PHE A CB  1 
ATOM   198  C CG  . PHE A 1 35  ? 57.031 70.694  27.974 1.00 18.52  ? 530 PHE A CG  1 
ATOM   199  C CD1 . PHE A 1 35  ? 55.719 71.155  27.904 1.00 15.64  ? 530 PHE A CD1 1 
ATOM   200  C CD2 . PHE A 1 35  ? 58.059 71.606  28.198 1.00 17.28  ? 530 PHE A CD2 1 
ATOM   201  C CE1 . PHE A 1 35  ? 55.427 72.511  28.051 1.00 15.32  ? 530 PHE A CE1 1 
ATOM   202  C CE2 . PHE A 1 35  ? 57.783 72.969  28.347 1.00 17.63  ? 530 PHE A CE2 1 
ATOM   203  C CZ  . PHE A 1 35  ? 56.461 73.421  28.274 1.00 15.46  ? 530 PHE A CZ  1 
ATOM   204  N N   . GLU A 1 36  ? 59.152 68.605  25.293 1.00 29.67  ? 531 GLU A N   1 
ATOM   205  C CA  . GLU A 1 36  ? 60.220 69.014  24.399 1.00 30.52  ? 531 GLU A CA  1 
ATOM   206  C C   . GLU A 1 36  ? 59.725 68.866  22.953 1.00 31.63  ? 531 GLU A C   1 
ATOM   207  O O   . GLU A 1 36  ? 60.172 69.581  22.048 1.00 31.85  ? 531 GLU A O   1 
ATOM   208  C CB  . GLU A 1 36  ? 61.450 68.137  24.658 1.00 32.15  ? 531 GLU A CB  1 
ATOM   209  C CG  . GLU A 1 36  ? 62.785 68.845  24.542 1.00 36.34  ? 531 GLU A CG  1 
ATOM   210  C CD  . GLU A 1 36  ? 62.938 69.978  25.532 1.00 38.61  ? 531 GLU A CD  1 
ATOM   211  O OE1 . GLU A 1 36  ? 62.722 69.767  26.737 1.00 44.07  ? 531 GLU A OE1 1 
ATOM   212  O OE2 . GLU A 1 36  ? 63.288 71.089  25.109 1.00 43.99  ? 531 GLU A OE2 1 
ATOM   213  N N   . VAL A 1 37  ? 58.794 67.940  22.741 1.00 30.35  ? 532 VAL A N   1 
ATOM   214  C CA  . VAL A 1 37  ? 58.241 67.737  21.414 1.00 32.03  ? 532 VAL A CA  1 
ATOM   215  C C   . VAL A 1 37  ? 57.248 68.869  21.143 1.00 35.33  ? 532 VAL A C   1 
ATOM   216  O O   . VAL A 1 37  ? 57.186 69.405  20.027 1.00 38.48  ? 532 VAL A O   1 
ATOM   217  C CB  . VAL A 1 37  ? 57.513 66.381  21.305 1.00 30.91  ? 532 VAL A CB  1 
ATOM   218  C CG1 . VAL A 1 37  ? 56.882 66.235  19.923 1.00 26.68  ? 532 VAL A CG1 1 
ATOM   219  C CG2 . VAL A 1 37  ? 58.497 65.241  21.570 1.00 29.07  ? 532 VAL A CG2 1 
ATOM   220  N N   . LEU A 1 38  ? 56.484 69.237  22.170 1.00 34.58  ? 533 LEU A N   1 
ATOM   221  C CA  . LEU A 1 38  ? 55.501 70.309  22.053 1.00 32.86  ? 533 LEU A CA  1 
ATOM   222  C C   . LEU A 1 38  ? 56.183 71.619  21.683 1.00 32.71  ? 533 LEU A C   1 
ATOM   223  O O   . LEU A 1 38  ? 55.680 72.360  20.842 1.00 33.50  ? 533 LEU A O   1 
ATOM   224  C CB  . LEU A 1 38  ? 54.740 70.488  23.373 1.00 33.75  ? 533 LEU A CB  1 
ATOM   225  C CG  . LEU A 1 38  ? 53.635 71.553  23.395 1.00 33.85  ? 533 LEU A CG  1 
ATOM   226  C CD1 . LEU A 1 38  ? 52.497 71.143  22.461 1.00 34.09  ? 533 LEU A CD1 1 
ATOM   227  C CD2 . LEU A 1 38  ? 53.113 71.725  24.808 1.00 30.64  ? 533 LEU A CD2 1 
ATOM   228  N N   . LYS A 1 39  ? 57.325 71.898  22.311 1.00 30.89  ? 534 LYS A N   1 
ATOM   229  C CA  . LYS A 1 39  ? 58.069 73.127  22.041 1.00 30.39  ? 534 LYS A CA  1 
ATOM   230  C C   . LYS A 1 39  ? 58.636 73.103  20.634 1.00 31.35  ? 534 LYS A C   1 
ATOM   231  O O   . LYS A 1 39  ? 58.710 74.137  19.973 1.00 32.01  ? 534 LYS A O   1 
ATOM   232  C CB  . LYS A 1 39  ? 59.220 73.312  23.038 1.00 29.20  ? 534 LYS A CB  1 
ATOM   233  C CG  . LYS A 1 39  ? 58.797 73.311  24.499 1.00 30.52  ? 534 LYS A CG  1 
ATOM   234  C CD  . LYS A 1 39  ? 59.879 73.877  25.416 1.00 31.47  ? 534 LYS A CD  1 
ATOM   235  C CE  . LYS A 1 39  ? 61.156 73.054  25.388 1.00 34.25  ? 534 LYS A CE  1 
ATOM   236  N NZ  . LYS A 1 39  ? 62.194 73.575  26.324 1.00 30.29  ? 534 LYS A NZ  1 
ATOM   237  N N   . ALA A 1 40  ? 59.047 71.921  20.183 1.00 31.66  ? 535 ALA A N   1 
ATOM   238  C CA  . ALA A 1 40  ? 59.608 71.773  18.844 1.00 31.29  ? 535 ALA A CA  1 
ATOM   239  C C   . ALA A 1 40  ? 58.521 72.080  17.825 1.00 31.15  ? 535 ALA A C   1 
ATOM   240  O O   . ALA A 1 40  ? 58.792 72.622  16.753 1.00 28.83  ? 535 ALA A O   1 
ATOM   241  C CB  . ALA A 1 40  ? 60.126 70.363  18.648 1.00 30.88  ? 535 ALA A CB  1 
ATOM   242  N N   . PHE A 1 41  ? 57.289 71.722  18.169 1.00 30.45  ? 536 PHE A N   1 
ATOM   243  C CA  . PHE A 1 41  ? 56.163 71.984  17.292 1.00 33.08  ? 536 PHE A CA  1 
ATOM   244  C C   . PHE A 1 41  ? 55.972 73.490  17.176 1.00 32.83  ? 536 PHE A C   1 
ATOM   245  O O   . PHE A 1 41  ? 55.687 74.000  16.098 1.00 34.84  ? 536 PHE A O   1 
ATOM   246  C CB  . PHE A 1 41  ? 54.882 71.353  17.846 1.00 34.75  ? 536 PHE A CB  1 
ATOM   247  C CG  . PHE A 1 41  ? 53.625 71.844  17.174 1.00 36.45  ? 536 PHE A CG  1 
ATOM   248  C CD1 . PHE A 1 41  ? 53.381 71.565  15.831 1.00 36.87  ? 536 PHE A CD1 1 
ATOM   249  C CD2 . PHE A 1 41  ? 52.689 72.590  17.886 1.00 38.35  ? 536 PHE A CD2 1 
ATOM   250  C CE1 . PHE A 1 41  ? 52.225 72.016  15.207 1.00 38.37  ? 536 PHE A CE1 1 
ATOM   251  C CE2 . PHE A 1 41  ? 51.524 73.051  17.275 1.00 40.26  ? 536 PHE A CE2 1 
ATOM   252  C CZ  . PHE A 1 41  ? 51.292 72.764  15.930 1.00 42.68  ? 536 PHE A CZ  1 
ATOM   253  N N   . VAL A 1 42  ? 56.123 74.194  18.293 1.00 32.01  ? 537 VAL A N   1 
ATOM   254  C CA  . VAL A 1 42  ? 55.963 75.642  18.306 1.00 33.46  ? 537 VAL A CA  1 
ATOM   255  C C   . VAL A 1 42  ? 56.995 76.298  17.387 1.00 33.73  ? 537 VAL A C   1 
ATOM   256  O O   . VAL A 1 42  ? 56.666 77.206  16.625 1.00 33.04  ? 537 VAL A O   1 
ATOM   257  C CB  . VAL A 1 42  ? 56.097 76.208  19.751 1.00 34.74  ? 537 VAL A CB  1 
ATOM   258  C CG1 . VAL A 1 42  ? 56.212 77.718  19.720 1.00 34.75  ? 537 VAL A CG1 1 
ATOM   259  C CG2 . VAL A 1 42  ? 54.883 75.812  20.584 1.00 35.20  ? 537 VAL A CG2 1 
ATOM   260  N N   . VAL A 1 43  ? 58.238 75.833  17.449 1.00 33.65  ? 538 VAL A N   1 
ATOM   261  C CA  . VAL A 1 43  ? 59.282 76.394  16.601 1.00 35.05  ? 538 VAL A CA  1 
ATOM   262  C C   . VAL A 1 43  ? 58.925 76.226  15.125 1.00 37.15  ? 538 VAL A C   1 
ATOM   263  O O   . VAL A 1 43  ? 58.992 77.185  14.357 1.00 36.97  ? 538 VAL A O   1 
ATOM   264  C CB  . VAL A 1 43  ? 60.644 75.718  16.843 1.00 35.06  ? 538 VAL A CB  1 
ATOM   265  C CG1 . VAL A 1 43  ? 61.678 76.299  15.889 1.00 32.23  ? 538 VAL A CG1 1 
ATOM   266  C CG2 . VAL A 1 43  ? 61.076 75.906  18.285 1.00 33.39  ? 538 VAL A CG2 1 
ATOM   267  N N   . ASP A 1 44  ? 58.560 75.005  14.731 1.00 38.30  ? 539 ASP A N   1 
ATOM   268  C CA  . ASP A 1 44  ? 58.182 74.733  13.348 1.00 39.57  ? 539 ASP A CA  1 
ATOM   269  C C   . ASP A 1 44  ? 57.061 75.669  12.931 1.00 38.90  ? 539 ASP A C   1 
ATOM   270  O O   . ASP A 1 44  ? 57.084 76.240  11.842 1.00 36.99  ? 539 ASP A O   1 
ATOM   271  C CB  . ASP A 1 44  ? 57.704 73.289  13.180 1.00 43.38  ? 539 ASP A CB  1 
ATOM   272  C CG  . ASP A 1 44  ? 58.825 72.287  13.293 1.00 46.54  ? 539 ASP A CG  1 
ATOM   273  O OD1 . ASP A 1 44  ? 59.875 72.492  12.643 1.00 47.77  ? 539 ASP A OD1 1 
ATOM   274  O OD2 . ASP A 1 44  ? 58.647 71.286  14.022 1.00 50.26  ? 539 ASP A OD2 1 
ATOM   275  N N   . MET A 1 45  ? 56.072 75.813  13.805 1.00 37.60  ? 540 MET A N   1 
ATOM   276  C CA  . MET A 1 45  ? 54.952 76.686  13.522 1.00 39.01  ? 540 MET A CA  1 
ATOM   277  C C   . MET A 1 45  ? 55.430 78.102  13.225 1.00 38.73  ? 540 MET A C   1 
ATOM   278  O O   . MET A 1 45  ? 54.956 78.731  12.273 1.00 36.47  ? 540 MET A O   1 
ATOM   279  C CB  . MET A 1 45  ? 53.978 76.703  14.700 1.00 42.35  ? 540 MET A CB  1 
ATOM   280  C CG  . MET A 1 45  ? 53.110 75.467  14.795 1.00 43.22  ? 540 MET A CG  1 
ATOM   281  S SD  . MET A 1 45  ? 52.208 75.219  13.268 1.00 47.80  ? 540 MET A SD  1 
ATOM   282  C CE  . MET A 1 45  ? 50.765 76.215  13.558 1.00 46.05  ? 540 MET A CE  1 
ATOM   283  N N   . MET A 1 46  ? 56.372 78.598  14.031 1.00 38.09  ? 541 MET A N   1 
ATOM   284  C CA  . MET A 1 46  ? 56.904 79.949  13.845 1.00 39.05  ? 541 MET A CA  1 
ATOM   285  C C   . MET A 1 46  ? 57.519 80.114  12.461 1.00 40.28  ? 541 MET A C   1 
ATOM   286  O O   . MET A 1 46  ? 57.336 81.144  11.818 1.00 38.06  ? 541 MET A O   1 
ATOM   287  C CB  . MET A 1 46  ? 57.939 80.268  14.918 1.00 36.62  ? 541 MET A CB  1 
ATOM   288  C CG  . MET A 1 46  ? 57.401 80.125  16.325 1.00 38.47  ? 541 MET A CG  1 
ATOM   289  S SD  . MET A 1 46  ? 58.629 80.495  17.581 1.00 38.44  ? 541 MET A SD  1 
ATOM   290  C CE  . MET A 1 46  ? 57.971 81.949  18.259 1.00 38.83  ? 541 MET A CE  1 
ATOM   291  N N   . GLU A 1 47  ? 58.236 79.091  12.002 1.00 43.54  ? 542 GLU A N   1 
ATOM   292  C CA  . GLU A 1 47  ? 58.862 79.124  10.682 1.00 46.85  ? 542 GLU A CA  1 
ATOM   293  C C   . GLU A 1 47  ? 57.823 79.008  9.573  1.00 46.88  ? 542 GLU A C   1 
ATOM   294  O O   . GLU A 1 47  ? 57.910 79.705  8.566  1.00 46.53  ? 542 GLU A O   1 
ATOM   295  C CB  . GLU A 1 47  ? 59.872 77.988  10.540 1.00 49.68  ? 542 GLU A CB  1 
ATOM   296  C CG  . GLU A 1 47  ? 61.210 78.250  11.192 1.00 55.13  ? 542 GLU A CG  1 
ATOM   297  C CD  . GLU A 1 47  ? 61.980 76.968  11.426 1.00 60.43  ? 542 GLU A CD  1 
ATOM   298  O OE1 . GLU A 1 47  ? 62.060 76.142  10.489 1.00 62.57  ? 542 GLU A OE1 1 
ATOM   299  O OE2 . GLU A 1 47  ? 62.504 76.787  12.548 1.00 63.56  ? 542 GLU A OE2 1 
ATOM   300  N N   . ARG A 1 48  ? 56.848 78.123  9.760  1.00 46.58  ? 543 ARG A N   1 
ATOM   301  C CA  . ARG A 1 48  ? 55.795 77.924  8.769  1.00 48.04  ? 543 ARG A CA  1 
ATOM   302  C C   . ARG A 1 48  ? 55.004 79.213  8.510  1.00 49.13  ? 543 ARG A C   1 
ATOM   303  O O   . ARG A 1 48  ? 54.666 79.525  7.369  1.00 48.94  ? 543 ARG A O   1 
ATOM   304  C CB  . ARG A 1 48  ? 54.847 76.810  9.227  1.00 48.76  ? 543 ARG A CB  1 
ATOM   305  C CG  . ARG A 1 48  ? 55.485 75.426  9.306  1.00 52.81  ? 543 ARG A CG  1 
ATOM   306  C CD  . ARG A 1 48  ? 55.860 74.921  7.918  1.00 56.64  ? 543 ARG A CD  1 
ATOM   307  N NE  . ARG A 1 48  ? 56.532 73.621  7.917  1.00 58.64  ? 543 ARG A NE  1 
ATOM   308  C CZ  . ARG A 1 48  ? 57.671 73.358  8.553  1.00 59.57  ? 543 ARG A CZ  1 
ATOM   309  N NH1 . ARG A 1 48  ? 58.279 74.299  9.260  1.00 60.87  ? 543 ARG A NH1 1 
ATOM   310  N NH2 . ARG A 1 48  ? 58.216 72.154  8.467  1.00 60.52  ? 543 ARG A NH2 1 
ATOM   311  N N   . LEU A 1 49  ? 54.714 79.962  9.569  1.00 49.09  ? 544 LEU A N   1 
ATOM   312  C CA  . LEU A 1 49  ? 53.971 81.207  9.429  1.00 48.84  ? 544 LEU A CA  1 
ATOM   313  C C   . LEU A 1 49  ? 54.900 82.360  9.088  1.00 51.36  ? 544 LEU A C   1 
ATOM   314  O O   . LEU A 1 49  ? 54.455 83.469  8.794  1.00 50.76  ? 544 LEU A O   1 
ATOM   315  C CB  . LEU A 1 49  ? 53.198 81.517  10.713 1.00 47.31  ? 544 LEU A CB  1 
ATOM   316  C CG  . LEU A 1 49  ? 51.758 81.001  10.827 1.00 43.04  ? 544 LEU A CG  1 
ATOM   317  C CD1 . LEU A 1 49  ? 51.355 80.233  9.581  1.00 40.85  ? 544 LEU A CD1 1 
ATOM   318  C CD2 . LEU A 1 49  ? 51.639 80.126  12.057 1.00 41.86  ? 544 LEU A CD2 1 
ATOM   319  N N   . ARG A 1 50  ? 56.198 82.089  9.132  1.00 54.81  ? 545 ARG A N   1 
ATOM   320  C CA  . ARG A 1 50  ? 57.202 83.092  8.805  1.00 59.38  ? 545 ARG A CA  1 
ATOM   321  C C   . ARG A 1 50  ? 57.153 84.334  9.698  1.00 61.90  ? 545 ARG A C   1 
ATOM   322  O O   . ARG A 1 50  ? 56.770 85.414  9.245  1.00 63.00  ? 545 ARG A O   1 
ATOM   323  C CB  . ARG A 1 50  ? 57.058 83.504  7.331  1.00 60.57  ? 545 ARG A CB  1 
ATOM   324  C CG  . ARG A 1 50  ? 57.252 82.349  6.346  1.00 63.06  ? 545 ARG A CG  1 
ATOM   325  C CD  . ARG A 1 50  ? 57.532 82.847  4.935  1.00 65.64  ? 545 ARG A CD  1 
ATOM   326  N NE  . ARG A 1 50  ? 56.357 82.792  4.068  1.00 69.16  ? 545 ARG A NE  1 
ATOM   327  C CZ  . ARG A 1 50  ? 56.181 81.902  3.092  1.00 70.41  ? 545 ARG A CZ  1 
ATOM   328  N NH1 . ARG A 1 50  ? 57.106 80.979  2.850  1.00 69.73  ? 545 ARG A NH1 1 
ATOM   329  N NH2 . ARG A 1 50  ? 55.079 81.938  2.353  1.00 70.78  ? 545 ARG A NH2 1 
ATOM   330  N N   . ILE A 1 51  ? 57.549 84.177  10.963 1.00 64.96  ? 546 ILE A N   1 
ATOM   331  C CA  . ILE A 1 51  ? 57.565 85.287  11.918 1.00 67.53  ? 546 ILE A CA  1 
ATOM   332  C C   . ILE A 1 51  ? 58.682 86.250  11.539 1.00 69.15  ? 546 ILE A C   1 
ATOM   333  O O   . ILE A 1 51  ? 58.834 87.315  12.144 1.00 68.90  ? 546 ILE A O   1 
ATOM   334  C CB  . ILE A 1 51  ? 57.820 84.797  13.360 1.00 68.40  ? 546 ILE A CB  1 
ATOM   335  C CG1 . ILE A 1 51  ? 59.199 84.136  13.448 1.00 68.93  ? 546 ILE A CG1 1 
ATOM   336  C CG2 . ILE A 1 51  ? 56.732 83.821  13.780 1.00 69.11  ? 546 ILE A CG2 1 
ATOM   337  C CD1 . ILE A 1 51  ? 59.577 83.685  14.838 1.00 70.70  ? 546 ILE A CD1 1 
ATOM   338  N N   . SER A 1 52  ? 59.460 85.849  10.534 1.00 71.40  ? 547 SER A N   1 
ATOM   339  C CA  . SER A 1 52  ? 60.576 86.636  10.013 1.00 72.84  ? 547 SER A CA  1 
ATOM   340  C C   . SER A 1 52  ? 60.056 87.935  9.398  1.00 74.19  ? 547 SER A C   1 
ATOM   341  O O   . SER A 1 52  ? 60.792 88.914  9.261  1.00 74.11  ? 547 SER A O   1 
ATOM   342  C CB  . SER A 1 52  ? 61.336 85.825  8.960  1.00 71.42  ? 547 SER A CB  1 
ATOM   343  O OG  . SER A 1 52  ? 61.764 84.583  9.497  1.00 70.29  ? 547 SER A OG  1 
ATOM   344  N N   . GLN A 1 53  ? 58.783 87.930  9.015  1.00 75.85  ? 548 GLN A N   1 
ATOM   345  C CA  . GLN A 1 53  ? 58.154 89.113  8.449  1.00 77.17  ? 548 GLN A CA  1 
ATOM   346  C C   . GLN A 1 53  ? 57.395 89.847  9.552  1.00 77.35  ? 548 GLN A C   1 
ATOM   347  O O   . GLN A 1 53  ? 56.962 89.243  10.537 1.00 76.50  ? 548 GLN A O   1 
ATOM   348  C CB  . GLN A 1 53  ? 57.181 88.742  7.328  1.00 77.57  ? 548 GLN A CB  1 
ATOM   349  C CG  . GLN A 1 53  ? 57.794 88.675  5.940  1.00 78.29  ? 548 GLN A CG  1 
ATOM   350  C CD  . GLN A 1 53  ? 58.142 87.266  5.521  1.00 78.74  ? 548 GLN A CD  1 
ATOM   351  O OE1 . GLN A 1 53  ? 59.139 86.700  5.968  1.00 79.11  ? 548 GLN A OE1 1 
ATOM   352  N NE2 . GLN A 1 53  ? 57.309 86.685  4.661  1.00 78.65  ? 548 GLN A NE2 1 
ATOM   353  N N   . LYS A 1 54  ? 57.239 91.154  9.374  1.00 77.96  ? 549 LYS A N   1 
ATOM   354  C CA  . LYS A 1 54  ? 56.540 91.999  10.339 1.00 77.96  ? 549 LYS A CA  1 
ATOM   355  C C   . LYS A 1 54  ? 55.032 91.756  10.259 1.00 75.50  ? 549 LYS A C   1 
ATOM   356  O O   . LYS A 1 54  ? 54.240 92.438  10.908 1.00 74.80  ? 549 LYS A O   1 
ATOM   357  C CB  . LYS A 1 54  ? 56.815 93.470  10.029 1.00 81.42  ? 549 LYS A CB  1 
ATOM   358  C CG  . LYS A 1 54  ? 57.816 94.167  10.958 1.00 83.93  ? 549 LYS A CG  1 
ATOM   359  C CD  . LYS A 1 54  ? 59.268 93.754  10.687 1.00 84.95  ? 549 LYS A CD  1 
ATOM   360  C CE  . LYS A 1 54  ? 60.254 94.460  11.624 1.00 86.86  ? 549 LYS A CE  1 
ATOM   361  N NZ  . LYS A 1 54  ? 61.687 94.090  11.399 1.00 88.64  ? 549 LYS A NZ  1 
ATOM   362  N N   . TRP A 1 55  ? 54.644 90.784  9.445  1.00 73.09  ? 550 TRP A N   1 
ATOM   363  C CA  . TRP A 1 55  ? 53.241 90.450  9.252  1.00 69.51  ? 550 TRP A CA  1 
ATOM   364  C C   . TRP A 1 55  ? 52.697 89.710  10.455 1.00 64.20  ? 550 TRP A C   1 
ATOM   365  O O   . TRP A 1 55  ? 51.631 90.036  10.974 1.00 63.19  ? 550 TRP A O   1 
ATOM   366  C CB  . TRP A 1 55  ? 53.095 89.578  8.002  1.00 74.39  ? 550 TRP A CB  1 
ATOM   367  C CG  . TRP A 1 55  ? 53.647 90.211  6.765  1.00 78.95  ? 550 TRP A CG  1 
ATOM   368  C CD1 . TRP A 1 55  ? 53.962 89.585  5.593  1.00 79.90  ? 550 TRP A CD1 1 
ATOM   369  C CD2 . TRP A 1 55  ? 53.929 91.602  6.565  1.00 82.18  ? 550 TRP A CD2 1 
ATOM   370  N NE1 . TRP A 1 55  ? 54.421 90.498  4.675  1.00 81.96  ? 550 TRP A NE1 1 
ATOM   371  C CE2 . TRP A 1 55  ? 54.414 91.743  5.246  1.00 82.86  ? 550 TRP A CE2 1 
ATOM   372  C CE3 . TRP A 1 55  ? 53.823 92.745  7.374  1.00 85.16  ? 550 TRP A CE3 1 
ATOM   373  C CZ2 . TRP A 1 55  ? 54.788 92.983  4.715  1.00 85.05  ? 550 TRP A CZ2 1 
ATOM   374  C CZ3 . TRP A 1 55  ? 54.195 93.977  6.846  1.00 86.17  ? 550 TRP A CZ3 1 
ATOM   375  C CH2 . TRP A 1 55  ? 54.674 94.085  5.530  1.00 86.84  ? 550 TRP A CH2 1 
ATOM   376  N N   . VAL A 1 56  ? 53.450 88.710  10.890 1.00 58.62  ? 551 VAL A N   1 
ATOM   377  C CA  . VAL A 1 56  ? 53.050 87.887  12.012 1.00 54.29  ? 551 VAL A CA  1 
ATOM   378  C C   . VAL A 1 56  ? 53.760 88.259  13.301 1.00 50.90  ? 551 VAL A C   1 
ATOM   379  O O   . VAL A 1 56  ? 54.974 88.467  13.319 1.00 50.61  ? 551 VAL A O   1 
ATOM   380  C CB  . VAL A 1 56  ? 53.329 86.392  11.720 1.00 52.99  ? 551 VAL A CB  1 
ATOM   381  C CG1 . VAL A 1 56  ? 52.701 85.524  12.797 1.00 52.07  ? 551 VAL A CG1 1 
ATOM   382  C CG2 . VAL A 1 56  ? 52.794 86.018  10.344 1.00 53.13  ? 551 VAL A CG2 1 
ATOM   383  N N   . ARG A 1 57  ? 52.984 88.361  14.373 1.00 46.15  ? 552 ARG A N   1 
ATOM   384  C CA  . ARG A 1 57  ? 53.526 88.643  15.690 1.00 43.78  ? 552 ARG A CA  1 
ATOM   385  C C   . ARG A 1 57  ? 53.245 87.366  16.454 1.00 42.54  ? 552 ARG A C   1 
ATOM   386  O O   . ARG A 1 57  ? 52.160 86.797  16.337 1.00 43.96  ? 552 ARG A O   1 
ATOM   387  C CB  . ARG A 1 57  ? 52.803 89.813  16.364 1.00 45.09  ? 552 ARG A CB  1 
ATOM   388  C CG  . ARG A 1 57  ? 52.941 91.130  15.627 1.00 45.21  ? 552 ARG A CG  1 
ATOM   389  C CD  . ARG A 1 57  ? 53.513 92.246  16.499 1.00 46.62  ? 552 ARG A CD  1 
ATOM   390  N NE  . ARG A 1 57  ? 52.569 92.868  17.436 1.00 48.70  ? 552 ARG A NE  1 
ATOM   391  C CZ  . ARG A 1 57  ? 51.268 93.057  17.211 1.00 49.83  ? 552 ARG A CZ  1 
ATOM   392  N NH1 . ARG A 1 57  ? 50.715 92.658  16.077 1.00 50.69  ? 552 ARG A NH1 1 
ATOM   393  N NH2 . ARG A 1 57  ? 50.521 93.696  18.103 1.00 48.95  ? 552 ARG A NH2 1 
ATOM   394  N N   . VAL A 1 58  ? 54.223 86.888  17.208 1.00 40.24  ? 553 VAL A N   1 
ATOM   395  C CA  . VAL A 1 58  ? 54.029 85.673  17.983 1.00 36.19  ? 553 VAL A CA  1 
ATOM   396  C C   . VAL A 1 58  ? 54.175 85.977  19.460 1.00 36.34  ? 553 VAL A C   1 
ATOM   397  O O   . VAL A 1 58  ? 54.741 87.003  19.848 1.00 35.05  ? 553 VAL A O   1 
ATOM   398  C CB  . VAL A 1 58  ? 55.043 84.554  17.596 1.00 33.20  ? 553 VAL A CB  1 
ATOM   399  C CG1 . VAL A 1 58  ? 54.515 83.758  16.419 1.00 32.53  ? 553 VAL A CG1 1 
ATOM   400  C CG2 . VAL A 1 58  ? 56.395 85.161  17.247 1.00 34.55  ? 553 VAL A CG2 1 
ATOM   401  N N   . ALA A 1 59  ? 53.639 85.079  20.277 1.00 35.02  ? 554 ALA A N   1 
ATOM   402  C CA  . ALA A 1 59  ? 53.704 85.197  21.725 1.00 31.67  ? 554 ALA A CA  1 
ATOM   403  C C   . ALA A 1 59  ? 53.712 83.761  22.236 1.00 31.11  ? 554 ALA A C   1 
ATOM   404  O O   . ALA A 1 59  ? 53.095 82.883  21.630 1.00 32.42  ? 554 ALA A O   1 
ATOM   405  C CB  . ALA A 1 59  ? 52.490 85.951  22.249 1.00 26.25  ? 554 ALA A CB  1 
ATOM   406  N N   . VAL A 1 60  ? 54.431 83.511  23.324 1.00 28.58  ? 555 VAL A N   1 
ATOM   407  C CA  . VAL A 1 60  ? 54.492 82.167  23.882 1.00 26.83  ? 555 VAL A CA  1 
ATOM   408  C C   . VAL A 1 60  ? 54.313 82.193  25.397 1.00 27.51  ? 555 VAL A C   1 
ATOM   409  O O   . VAL A 1 60  ? 55.034 82.886  26.122 1.00 26.46  ? 555 VAL A O   1 
ATOM   410  C CB  . VAL A 1 60  ? 55.820 81.470  23.521 1.00 25.97  ? 555 VAL A CB  1 
ATOM   411  C CG1 . VAL A 1 60  ? 55.951 80.162  24.269 1.00 26.70  ? 555 VAL A CG1 1 
ATOM   412  C CG2 . VAL A 1 60  ? 55.866 81.199  22.030 1.00 25.93  ? 555 VAL A CG2 1 
ATOM   413  N N   . VAL A 1 61  ? 53.330 81.434  25.865 1.00 26.64  ? 556 VAL A N   1 
ATOM   414  C CA  . VAL A 1 61  ? 53.041 81.376  27.281 1.00 28.53  ? 556 VAL A CA  1 
ATOM   415  C C   . VAL A 1 61  ? 52.867 79.943  27.754 1.00 29.69  ? 556 VAL A C   1 
ATOM   416  O O   . VAL A 1 61  ? 52.140 79.154  27.150 1.00 28.49  ? 556 VAL A O   1 
ATOM   417  C CB  . VAL A 1 61  ? 51.757 82.158  27.611 1.00 29.49  ? 556 VAL A CB  1 
ATOM   418  C CG1 . VAL A 1 61  ? 51.595 82.263  29.111 1.00 28.71  ? 556 VAL A CG1 1 
ATOM   419  C CG2 . VAL A 1 61  ? 51.807 83.548  26.973 1.00 28.38  ? 556 VAL A CG2 1 
ATOM   420  N N   . GLU A 1 62  ? 53.560 79.603  28.832 1.00 30.31  ? 557 GLU A N   1 
ATOM   421  C CA  . GLU A 1 62  ? 53.454 78.271  29.408 1.00 29.64  ? 557 GLU A CA  1 
ATOM   422  C C   . GLU A 1 62  ? 52.535 78.456  30.607 1.00 27.98  ? 557 GLU A C   1 
ATOM   423  O O   . GLU A 1 62  ? 52.615 79.471  31.305 1.00 27.48  ? 557 GLU A O   1 
ATOM   424  C CB  . GLU A 1 62  ? 54.835 77.764  29.833 1.00 31.35  ? 557 GLU A CB  1 
ATOM   425  C CG  . GLU A 1 62  ? 54.845 76.425  30.545 1.00 36.58  ? 557 GLU A CG  1 
ATOM   426  C CD  . GLU A 1 62  ? 54.422 76.530  32.001 1.00 42.26  ? 557 GLU A CD  1 
ATOM   427  O OE1 . GLU A 1 62  ? 55.059 77.302  32.754 1.00 40.37  ? 557 GLU A OE1 1 
ATOM   428  O OE2 . GLU A 1 62  ? 53.456 75.833  32.392 1.00 45.07  ? 557 GLU A OE2 1 
ATOM   429  N N   . TYR A 1 63  ? 51.640 77.504  30.835 1.00 25.11  ? 558 TYR A N   1 
ATOM   430  C CA  . TYR A 1 63  ? 50.728 77.652  31.952 1.00 23.58  ? 558 TYR A CA  1 
ATOM   431  C C   . TYR A 1 63  ? 50.482 76.434  32.824 1.00 22.72  ? 558 TYR A C   1 
ATOM   432  O O   . TYR A 1 63  ? 50.156 75.354  32.337 1.00 20.50  ? 558 TYR A O   1 
ATOM   433  C CB  . TYR A 1 63  ? 49.375 78.177  31.459 1.00 22.76  ? 558 TYR A CB  1 
ATOM   434  C CG  . TYR A 1 63  ? 48.622 77.231  30.552 1.00 22.61  ? 558 TYR A CG  1 
ATOM   435  C CD1 . TYR A 1 63  ? 48.891 77.183  29.180 1.00 18.58  ? 558 TYR A CD1 1 
ATOM   436  C CD2 . TYR A 1 63  ? 47.659 76.350  31.072 1.00 22.84  ? 558 TYR A CD2 1 
ATOM   437  C CE1 . TYR A 1 63  ? 48.228 76.280  28.343 1.00 16.11  ? 558 TYR A CE1 1 
ATOM   438  C CE2 . TYR A 1 63  ? 46.986 75.437  30.243 1.00 20.69  ? 558 TYR A CE2 1 
ATOM   439  C CZ  . TYR A 1 63  ? 47.278 75.407  28.877 1.00 21.00  ? 558 TYR A CZ  1 
ATOM   440  O OH  . TYR A 1 63  ? 46.646 74.494  28.048 1.00 19.24  ? 558 TYR A OH  1 
ATOM   441  N N   . HIS A 1 64  ? 50.695 76.603  34.121 1.00 23.54  ? 559 HIS A N   1 
ATOM   442  C CA  . HIS A 1 64  ? 50.377 75.546  35.057 1.00 26.03  ? 559 HIS A CA  1 
ATOM   443  C C   . HIS A 1 64  ? 49.461 76.199  36.076 1.00 28.57  ? 559 HIS A C   1 
ATOM   444  O O   . HIS A 1 64  ? 48.272 76.371  35.807 1.00 29.41  ? 559 HIS A O   1 
ATOM   445  C CB  . HIS A 1 64  ? 51.608 74.870  35.710 1.00 24.45  ? 559 HIS A CB  1 
ATOM   446  C CG  . HIS A 1 64  ? 52.767 75.773  36.020 1.00 22.55  ? 559 HIS A CG  1 
ATOM   447  N ND1 . HIS A 1 64  ? 53.584 76.306  35.044 1.00 20.30  ? 559 HIS A ND1 1 
ATOM   448  C CD2 . HIS A 1 64  ? 53.336 76.107  37.204 1.00 20.43  ? 559 HIS A CD2 1 
ATOM   449  C CE1 . HIS A 1 64  ? 54.606 76.922  35.614 1.00 20.13  ? 559 HIS A CE1 1 
ATOM   450  N NE2 . HIS A 1 64  ? 54.480 76.816  36.924 1.00 15.53  ? 559 HIS A NE2 1 
ATOM   451  N N   . ASP A 1 65  ? 49.988 76.589  37.224 1.00 30.57  ? 560 ASP A N   1 
ATOM   452  C CA  . ASP A 1 65  ? 49.154 77.238  38.220 1.00 31.43  ? 560 ASP A CA  1 
ATOM   453  C C   . ASP A 1 65  ? 48.992 78.678  37.788 1.00 32.04  ? 560 ASP A C   1 
ATOM   454  O O   . ASP A 1 65  ? 47.939 79.281  37.979 1.00 35.28  ? 560 ASP A O   1 
ATOM   455  C CB  . ASP A 1 65  ? 49.826 77.164  39.581 1.00 35.90  ? 560 ASP A CB  1 
ATOM   456  C CG  . ASP A 1 65  ? 50.128 75.749  39.982 1.00 42.73  ? 560 ASP A CG  1 
ATOM   457  O OD1 . ASP A 1 65  ? 49.162 74.984  40.211 1.00 45.60  ? 560 ASP A OD1 1 
ATOM   458  O OD2 . ASP A 1 65  ? 51.328 75.397  40.050 1.00 47.90  ? 560 ASP A OD2 1 
ATOM   459  N N   . GLY A 1 66  ? 50.051 79.220  37.197 1.00 30.88  ? 561 GLY A N   1 
ATOM   460  C CA  . GLY A 1 66  ? 50.024 80.590  36.727 1.00 29.08  ? 561 GLY A CA  1 
ATOM   461  C C   . GLY A 1 66  ? 50.334 80.631  35.245 1.00 27.66  ? 561 GLY A C   1 
ATOM   462  O O   . GLY A 1 66  ? 50.275 79.607  34.566 1.00 25.59  ? 561 GLY A O   1 
ATOM   463  N N   . SER A 1 67  ? 50.660 81.817  34.742 1.00 27.18  ? 562 SER A N   1 
ATOM   464  C CA  . SER A 1 67  ? 50.995 81.988  33.335 1.00 25.40  ? 562 SER A CA  1 
ATOM   465  C C   . SER A 1 67  ? 52.445 82.453  33.213 1.00 26.59  ? 562 SER A C   1 
ATOM   466  O O   . SER A 1 67  ? 52.868 83.392  33.890 1.00 27.81  ? 562 SER A O   1 
ATOM   467  C CB  . SER A 1 67  ? 50.058 83.009  32.707 1.00 24.11  ? 562 SER A CB  1 
ATOM   468  O OG  . SER A 1 67  ? 48.716 82.558  32.776 1.00 24.12  ? 562 SER A OG  1 
ATOM   469  N N   . HIS A 1 68  ? 53.209 81.787  32.358 1.00 25.54  ? 563 HIS A N   1 
ATOM   470  C CA  . HIS A 1 68  ? 54.607 82.141  32.168 1.00 24.86  ? 563 HIS A CA  1 
ATOM   471  C C   . HIS A 1 68  ? 54.869 82.549  30.718 1.00 26.18  ? 563 HIS A C   1 
ATOM   472  O O   . HIS A 1 68  ? 54.899 81.714  29.809 1.00 26.62  ? 563 HIS A O   1 
ATOM   473  C CB  . HIS A 1 68  ? 55.484 80.958  32.581 1.00 25.33  ? 563 HIS A CB  1 
ATOM   474  C CG  . HIS A 1 68  ? 55.346 80.591  34.029 1.00 29.83  ? 563 HIS A CG  1 
ATOM   475  N ND1 . HIS A 1 68  ? 56.391 80.680  34.926 1.00 29.05  ? 563 HIS A ND1 1 
ATOM   476  C CD2 . HIS A 1 68  ? 54.272 80.179  34.744 1.00 28.60  ? 563 HIS A CD2 1 
ATOM   477  C CE1 . HIS A 1 68  ? 55.966 80.341  36.130 1.00 28.78  ? 563 HIS A CE1 1 
ATOM   478  N NE2 . HIS A 1 68  ? 54.684 80.033  36.048 1.00 29.82  ? 563 HIS A NE2 1 
ATOM   479  N N   . ALA A 1 69  ? 55.051 83.847  30.513 1.00 24.58  ? 564 ALA A N   1 
ATOM   480  C CA  . ALA A 1 69  ? 55.285 84.399  29.185 1.00 26.80  ? 564 ALA A CA  1 
ATOM   481  C C   . ALA A 1 69  ? 56.763 84.559  28.849 1.00 29.01  ? 564 ALA A C   1 
ATOM   482  O O   . ALA A 1 69  ? 57.476 85.316  29.506 1.00 30.01  ? 564 ALA A O   1 
ATOM   483  C CB  . ALA A 1 69  ? 54.586 85.742  29.068 1.00 25.60  ? 564 ALA A CB  1 
ATOM   484  N N   . TYR A 1 70  ? 57.220 83.859  27.815 1.00 30.51  ? 565 TYR A N   1 
ATOM   485  C CA  . TYR A 1 70  ? 58.621 83.954  27.413 1.00 32.02  ? 565 TYR A CA  1 
ATOM   486  C C   . TYR A 1 70  ? 58.814 84.878  26.210 1.00 31.68  ? 565 TYR A C   1 
ATOM   487  O O   . TYR A 1 70  ? 59.920 85.370  25.960 1.00 32.54  ? 565 TYR A O   1 
ATOM   488  C CB  . TYR A 1 70  ? 59.189 82.576  27.083 1.00 30.70  ? 565 TYR A CB  1 
ATOM   489  C CG  . TYR A 1 70  ? 59.293 81.637  28.258 1.00 30.92  ? 565 TYR A CG  1 
ATOM   490  C CD1 . TYR A 1 70  ? 58.188 80.905  28.694 1.00 30.31  ? 565 TYR A CD1 1 
ATOM   491  C CD2 . TYR A 1 70  ? 60.513 81.428  28.894 1.00 30.55  ? 565 TYR A CD2 1 
ATOM   492  C CE1 . TYR A 1 70  ? 58.303 79.978  29.725 1.00 31.95  ? 565 TYR A CE1 1 
ATOM   493  C CE2 . TYR A 1 70  ? 60.640 80.506  29.930 1.00 30.66  ? 565 TYR A CE2 1 
ATOM   494  C CZ  . TYR A 1 70  ? 59.536 79.780  30.339 1.00 32.43  ? 565 TYR A CZ  1 
ATOM   495  O OH  . TYR A 1 70  ? 59.675 78.843  31.341 1.00 29.78  ? 565 TYR A OH  1 
ATOM   496  N N   . ILE A 1 71  ? 57.736 85.098  25.463 1.00 28.70  ? 566 ILE A N   1 
ATOM   497  C CA  . ILE A 1 71  ? 57.777 85.970  24.299 1.00 27.25  ? 566 ILE A CA  1 
ATOM   498  C C   . ILE A 1 71  ? 56.481 86.759  24.228 1.00 28.87  ? 566 ILE A C   1 
ATOM   499  O O   . ILE A 1 71  ? 55.392 86.187  24.316 1.00 28.45  ? 566 ILE A O   1 
ATOM   500  C CB  . ILE A 1 71  ? 57.915 85.169  22.975 1.00 24.77  ? 566 ILE A CB  1 
ATOM   501  C CG1 . ILE A 1 71  ? 59.166 84.296  23.001 1.00 24.22  ? 566 ILE A CG1 1 
ATOM   502  C CG2 . ILE A 1 71  ? 58.010 86.123  21.794 1.00 23.35  ? 566 ILE A CG2 1 
ATOM   503  C CD1 . ILE A 1 71  ? 59.281 83.391  21.801 1.00 22.06  ? 566 ILE A CD1 1 
ATOM   504  N N   . GLY A 1 72  ? 56.605 88.072  24.073 1.00 29.67  ? 567 GLY A N   1 
ATOM   505  C CA  . GLY A 1 72  ? 55.433 88.920  23.960 1.00 31.75  ? 567 GLY A CA  1 
ATOM   506  C C   . GLY A 1 72  ? 55.240 89.369  22.519 1.00 33.19  ? 567 GLY A C   1 
ATOM   507  O O   . GLY A 1 72  ? 56.207 89.431  21.757 1.00 32.33  ? 567 GLY A O   1 
ATOM   508  N N   . LEU A 1 73  ? 54.001 89.679  22.141 1.00 34.31  ? 568 LEU A N   1 
ATOM   509  C CA  . LEU A 1 73  ? 53.695 90.122  20.780 1.00 36.41  ? 568 LEU A CA  1 
ATOM   510  C C   . LEU A 1 73  ? 54.516 91.326  20.311 1.00 37.88  ? 568 LEU A C   1 
ATOM   511  O O   . LEU A 1 73  ? 55.021 91.331  19.187 1.00 38.79  ? 568 LEU A O   1 
ATOM   512  C CB  . LEU A 1 73  ? 52.209 90.470  20.644 1.00 36.69  ? 568 LEU A CB  1 
ATOM   513  C CG  . LEU A 1 73  ? 51.184 89.341  20.582 1.00 34.95  ? 568 LEU A CG  1 
ATOM   514  C CD1 . LEU A 1 73  ? 49.791 89.928  20.439 1.00 34.31  ? 568 LEU A CD1 1 
ATOM   515  C CD2 . LEU A 1 73  ? 51.502 88.429  19.407 1.00 35.62  ? 568 LEU A CD2 1 
ATOM   516  N N   . LYS A 1 74  ? 54.644 92.348  21.156 1.00 38.30  ? 569 LYS A N   1 
ATOM   517  C CA  . LYS A 1 74  ? 55.398 93.530  20.758 1.00 41.31  ? 569 LYS A CA  1 
ATOM   518  C C   . LYS A 1 74  ? 56.901 93.443  21.027 1.00 42.27  ? 569 LYS A C   1 
ATOM   519  O O   . LYS A 1 74  ? 57.615 94.450  20.946 1.00 40.67  ? 569 LYS A O   1 
ATOM   520  C CB  . LYS A 1 74  ? 54.810 94.790  21.406 1.00 41.50  ? 569 LYS A CB  1 
ATOM   521  C CG  . LYS A 1 74  ? 54.773 94.786  22.919 1.00 44.25  ? 569 LYS A CG  1 
ATOM   522  C CD  . LYS A 1 74  ? 53.342 94.814  23.428 1.00 45.14  ? 569 LYS A CD  1 
ATOM   523  C CE  . LYS A 1 74  ? 52.547 95.941  22.803 1.00 44.05  ? 569 LYS A CE  1 
ATOM   524  N NZ  . LYS A 1 74  ? 51.184 95.997  23.381 1.00 45.88  ? 569 LYS A NZ  1 
ATOM   525  N N   . ASP A 1 75  ? 57.379 92.242  21.343 1.00 41.38  ? 570 ASP A N   1 
ATOM   526  C CA  . ASP A 1 75  ? 58.802 92.038  21.574 1.00 41.58  ? 570 ASP A CA  1 
ATOM   527  C C   . ASP A 1 75  ? 59.455 92.170  20.204 1.00 41.53  ? 570 ASP A C   1 
ATOM   528  O O   . ASP A 1 75  ? 59.005 91.549  19.240 1.00 44.85  ? 570 ASP A O   1 
ATOM   529  C CB  . ASP A 1 75  ? 59.060 90.641  22.161 1.00 42.68  ? 570 ASP A CB  1 
ATOM   530  C CG  . ASP A 1 75  ? 58.696 90.545  23.642 1.00 44.41  ? 570 ASP A CG  1 
ATOM   531  O OD1 . ASP A 1 75  ? 58.035 91.475  24.159 1.00 46.09  ? 570 ASP A OD1 1 
ATOM   532  O OD2 . ASP A 1 75  ? 59.065 89.536  24.288 1.00 40.36  ? 570 ASP A OD2 1 
ATOM   533  N N   . ARG A 1 76  ? 60.494 92.995  20.108 1.00 40.76  ? 571 ARG A N   1 
ATOM   534  C CA  . ARG A 1 76  ? 61.182 93.196  18.836 1.00 37.44  ? 571 ARG A CA  1 
ATOM   535  C C   . ARG A 1 76  ? 62.523 92.488  18.863 1.00 39.35  ? 571 ARG A C   1 
ATOM   536  O O   . ARG A 1 76  ? 63.524 93.075  19.256 1.00 41.62  ? 571 ARG A O   1 
ATOM   537  C CB  . ARG A 1 76  ? 61.412 94.686  18.573 1.00 35.78  ? 571 ARG A CB  1 
ATOM   538  C CG  . ARG A 1 76  ? 60.167 95.562  18.625 1.00 34.20  ? 571 ARG A CG  1 
ATOM   539  C CD  . ARG A 1 76  ? 60.450 96.971  18.104 1.00 32.13  ? 571 ARG A CD  1 
ATOM   540  N NE  . ARG A 1 76  ? 61.257 97.782  19.014 1.00 33.93  ? 571 ARG A NE  1 
ATOM   541  C CZ  . ARG A 1 76  ? 60.783 98.412  20.088 1.00 34.21  ? 571 ARG A CZ  1 
ATOM   542  N NH1 . ARG A 1 76  ? 59.498 98.333  20.402 1.00 33.38  ? 571 ARG A NH1 1 
ATOM   543  N NH2 . ARG A 1 76  ? 61.593 99.133  20.849 1.00 35.28  ? 571 ARG A NH2 1 
ATOM   544  N N   . LYS A 1 77  ? 62.534 91.221  18.459 1.00 40.14  ? 572 LYS A N   1 
ATOM   545  C CA  . LYS A 1 77  ? 63.756 90.416  18.423 1.00 40.14  ? 572 LYS A CA  1 
ATOM   546  C C   . LYS A 1 77  ? 63.765 89.637  17.119 1.00 41.29  ? 572 LYS A C   1 
ATOM   547  O O   . LYS A 1 77  ? 62.708 89.362  16.553 1.00 41.53  ? 572 LYS A O   1 
ATOM   548  C CB  . LYS A 1 77  ? 63.789 89.442  19.597 1.00 36.99  ? 572 LYS A CB  1 
ATOM   549  C CG  . LYS A 1 77  ? 63.773 90.118  20.947 1.00 38.44  ? 572 LYS A CG  1 
ATOM   550  C CD  . LYS A 1 77  ? 63.765 89.089  22.064 1.00 40.97  ? 572 LYS A CD  1 
ATOM   551  C CE  . LYS A 1 77  ? 63.776 89.750  23.429 1.00 38.01  ? 572 LYS A CE  1 
ATOM   552  N NZ  . LYS A 1 77  ? 63.645 88.746  24.512 1.00 36.99  ? 572 LYS A NZ  1 
ATOM   553  N N   . ARG A 1 78  ? 64.947 89.278  16.631 1.00 42.16  ? 573 ARG A N   1 
ATOM   554  C CA  . ARG A 1 78  ? 65.000 88.544  15.378 1.00 44.55  ? 573 ARG A CA  1 
ATOM   555  C C   . ARG A 1 78  ? 64.608 87.090  15.548 1.00 44.31  ? 573 ARG A C   1 
ATOM   556  O O   . ARG A 1 78  ? 64.735 86.520  16.631 1.00 43.34  ? 573 ARG A O   1 
ATOM   557  C CB  . ARG A 1 78  ? 66.379 88.656  14.718 1.00 47.49  ? 573 ARG A CB  1 
ATOM   558  C CG  . ARG A 1 78  ? 67.561 88.741  15.652 1.00 52.00  ? 573 ARG A CG  1 
ATOM   559  C CD  . ARG A 1 78  ? 68.850 88.887  14.839 1.00 56.73  ? 573 ARG A CD  1 
ATOM   560  N NE  . ARG A 1 78  ? 70.001 89.183  15.689 1.00 62.98  ? 573 ARG A NE  1 
ATOM   561  C CZ  . ARG A 1 78  ? 70.572 90.382  15.799 1.00 67.41  ? 573 ARG A CZ  1 
ATOM   562  N NH1 . ARG A 1 78  ? 70.107 91.419  15.104 1.00 70.03  ? 573 ARG A NH1 1 
ATOM   563  N NH2 . ARG A 1 78  ? 71.609 90.550  16.615 1.00 69.83  ? 573 ARG A NH2 1 
ATOM   564  N N   . PRO A 1 79  ? 64.117 86.473  14.464 1.00 43.96  ? 574 PRO A N   1 
ATOM   565  C CA  . PRO A 1 79  ? 63.671 85.080  14.402 1.00 42.81  ? 574 PRO A CA  1 
ATOM   566  C C   . PRO A 1 79  ? 64.521 84.090  15.189 1.00 42.35  ? 574 PRO A C   1 
ATOM   567  O O   . PRO A 1 79  ? 64.012 83.377  16.052 1.00 42.70  ? 574 PRO A O   1 
ATOM   568  C CB  . PRO A 1 79  ? 63.680 84.794  12.909 1.00 43.70  ? 574 PRO A CB  1 
ATOM   569  C CG  . PRO A 1 79  ? 63.261 86.103  12.339 1.00 43.97  ? 574 PRO A CG  1 
ATOM   570  C CD  . PRO A 1 79  ? 64.103 87.077  13.119 1.00 42.04  ? 574 PRO A CD  1 
ATOM   571  N N   . SER A 1 80  ? 65.814 84.043  14.888 1.00 41.73  ? 575 SER A N   1 
ATOM   572  C CA  . SER A 1 80  ? 66.715 83.125  15.573 1.00 41.27  ? 575 SER A CA  1 
ATOM   573  C C   . SER A 1 80  ? 66.638 83.251  17.093 1.00 40.86  ? 575 SER A C   1 
ATOM   574  O O   . SER A 1 80  ? 66.740 82.251  17.809 1.00 39.90  ? 575 SER A O   1 
ATOM   575  C CB  . SER A 1 80  ? 68.156 83.345  15.097 1.00 41.89  ? 575 SER A CB  1 
ATOM   576  O OG  . SER A 1 80  ? 68.565 84.696  15.246 1.00 43.74  ? 575 SER A OG  1 
ATOM   577  N N   . GLU A 1 81  ? 66.450 84.476  17.581 1.00 41.16  ? 576 GLU A N   1 
ATOM   578  C CA  . GLU A 1 81  ? 66.364 84.726  19.015 1.00 39.94  ? 576 GLU A CA  1 
ATOM   579  C C   . GLU A 1 81  ? 65.066 84.195  19.587 1.00 39.26  ? 576 GLU A C   1 
ATOM   580  O O   . GLU A 1 81  ? 65.054 83.614  20.670 1.00 40.03  ? 576 GLU A O   1 
ATOM   581  C CB  . GLU A 1 81  ? 66.472 86.219  19.316 1.00 40.64  ? 576 GLU A CB  1 
ATOM   582  C CG  . GLU A 1 81  ? 67.651 86.566  20.210 1.00 47.50  ? 576 GLU A CG  1 
ATOM   583  C CD  . GLU A 1 81  ? 67.647 85.799  21.535 1.00 49.28  ? 576 GLU A CD  1 
ATOM   584  O OE1 . GLU A 1 81  ? 66.940 86.216  22.480 1.00 48.49  ? 576 GLU A OE1 1 
ATOM   585  O OE2 . GLU A 1 81  ? 68.353 84.771  21.627 1.00 48.63  ? 576 GLU A OE2 1 
ATOM   586  N N   . LEU A 1 82  ? 63.974 84.397  18.858 1.00 38.36  ? 577 LEU A N   1 
ATOM   587  C CA  . LEU A 1 82  ? 62.668 83.928  19.300 1.00 39.06  ? 577 LEU A CA  1 
ATOM   588  C C   . LEU A 1 82  ? 62.615 82.409  19.331 1.00 39.91  ? 577 LEU A C   1 
ATOM   589  O O   . LEU A 1 82  ? 62.094 81.832  20.286 1.00 41.98  ? 577 LEU A O   1 
ATOM   590  C CB  . LEU A 1 82  ? 61.564 84.462  18.387 1.00 37.98  ? 577 LEU A CB  1 
ATOM   591  C CG  . LEU A 1 82  ? 61.381 85.981  18.399 1.00 38.67  ? 577 LEU A CG  1 
ATOM   592  C CD1 . LEU A 1 82  ? 60.278 86.340  17.421 1.00 38.38  ? 577 LEU A CD1 1 
ATOM   593  C CD2 . LEU A 1 82  ? 61.053 86.477  19.815 1.00 33.70  ? 577 LEU A CD2 1 
ATOM   594  N N   . ARG A 1 83  ? 63.148 81.763  18.292 1.00 40.48  ? 578 ARG A N   1 
ATOM   595  C CA  . ARG A 1 83  ? 63.161 80.304  18.236 1.00 40.32  ? 578 ARG A CA  1 
ATOM   596  C C   . ARG A 1 83  ? 63.909 79.743  19.447 1.00 39.65  ? 578 ARG A C   1 
ATOM   597  O O   . ARG A 1 83  ? 63.528 78.705  19.993 1.00 38.63  ? 578 ARG A O   1 
ATOM   598  C CB  . ARG A 1 83  ? 63.822 79.808  16.943 1.00 42.90  ? 578 ARG A CB  1 
ATOM   599  C CG  . ARG A 1 83  ? 62.982 79.991  15.672 1.00 46.35  ? 578 ARG A CG  1 
ATOM   600  C CD  . ARG A 1 83  ? 63.586 79.223  14.493 1.00 49.48  ? 578 ARG A CD  1 
ATOM   601  N NE  . ARG A 1 83  ? 64.916 79.713  14.138 1.00 54.86  ? 578 ARG A NE  1 
ATOM   602  C CZ  . ARG A 1 83  ? 65.147 80.715  13.294 1.00 57.11  ? 578 ARG A CZ  1 
ATOM   603  N NH1 . ARG A 1 83  ? 64.133 81.337  12.701 1.00 59.00  ? 578 ARG A NH1 1 
ATOM   604  N NH2 . ARG A 1 83  ? 66.392 81.113  13.056 1.00 57.50  ? 578 ARG A NH2 1 
ATOM   605  N N   . ARG A 1 84  ? 64.965 80.438  19.863 1.00 37.77  ? 579 ARG A N   1 
ATOM   606  C CA  . ARG A 1 84  ? 65.757 80.023  21.015 1.00 37.55  ? 579 ARG A CA  1 
ATOM   607  C C   . ARG A 1 84  ? 64.892 80.048  22.267 1.00 37.00  ? 579 ARG A C   1 
ATOM   608  O O   . ARG A 1 84  ? 64.743 79.037  22.949 1.00 36.64  ? 579 ARG A O   1 
ATOM   609  C CB  . ARG A 1 84  ? 66.934 80.970  21.227 1.00 39.70  ? 579 ARG A CB  1 
ATOM   610  C CG  . ARG A 1 84  ? 68.281 80.350  21.047 1.00 42.20  ? 579 ARG A CG  1 
ATOM   611  C CD  . ARG A 1 84  ? 69.125 80.671  22.241 1.00 42.03  ? 579 ARG A CD  1 
ATOM   612  N NE  . ARG A 1 84  ? 68.944 82.030  22.740 1.00 41.91  ? 579 ARG A NE  1 
ATOM   613  C CZ  . ARG A 1 84  ? 68.452 82.313  23.945 1.00 44.90  ? 579 ARG A CZ  1 
ATOM   614  N NH1 . ARG A 1 84  ? 68.082 81.334  24.765 1.00 45.62  ? 579 ARG A NH1 1 
ATOM   615  N NH2 . ARG A 1 84  ? 68.395 83.571  24.363 1.00 46.41  ? 579 ARG A NH2 1 
ATOM   616  N N   . ILE A 1 85  ? 64.335 81.219  22.568 1.00 34.06  ? 580 ILE A N   1 
ATOM   617  C CA  . ILE A 1 85  ? 63.486 81.387  23.736 1.00 31.47  ? 580 ILE A CA  1 
ATOM   618  C C   . ILE A 1 85  ? 62.442 80.282  23.789 1.00 31.90  ? 580 ILE A C   1 
ATOM   619  O O   . ILE A 1 85  ? 62.307 79.591  24.803 1.00 27.51  ? 580 ILE A O   1 
ATOM   620  C CB  . ILE A 1 85  ? 62.799 82.765  23.704 1.00 30.18  ? 580 ILE A CB  1 
ATOM   621  C CG1 . ILE A 1 85  ? 63.870 83.854  23.848 1.00 30.92  ? 580 ILE A CG1 1 
ATOM   622  C CG2 . ILE A 1 85  ? 61.750 82.864  24.809 1.00 30.49  ? 580 ILE A CG2 1 
ATOM   623  C CD1 . ILE A 1 85  ? 63.355 85.276  23.770 1.00 29.86  ? 580 ILE A CD1 1 
ATOM   624  N N   . ALA A 1 86  ? 61.723 80.118  22.679 1.00 32.40  ? 581 ALA A N   1 
ATOM   625  C CA  . ALA A 1 86  ? 60.684 79.104  22.555 1.00 31.97  ? 581 ALA A CA  1 
ATOM   626  C C   . ALA A 1 86  ? 61.239 77.739  22.940 1.00 32.86  ? 581 ALA A C   1 
ATOM   627  O O   . ALA A 1 86  ? 60.616 77.000  23.700 1.00 35.67  ? 581 ALA A O   1 
ATOM   628  C CB  . ALA A 1 86  ? 60.163 79.070  21.125 1.00 28.93  ? 581 ALA A CB  1 
ATOM   629  N N   . SER A 1 87  ? 62.417 77.419  22.414 1.00 31.48  ? 582 SER A N   1 
ATOM   630  C CA  . SER A 1 87  ? 63.072 76.147  22.684 1.00 32.24  ? 582 SER A CA  1 
ATOM   631  C C   . SER A 1 87  ? 63.527 75.999  24.130 1.00 30.46  ? 582 SER A C   1 
ATOM   632  O O   . SER A 1 87  ? 63.690 74.888  24.631 1.00 30.39  ? 582 SER A O   1 
ATOM   633  C CB  . SER A 1 87  ? 64.282 75.982  21.764 1.00 32.47  ? 582 SER A CB  1 
ATOM   634  O OG  . SER A 1 87  ? 64.097 74.886  20.890 1.00 37.86  ? 582 SER A OG  1 
ATOM   635  N N   . GLN A 1 88  ? 63.724 77.125  24.796 1.00 29.02  ? 583 GLN A N   1 
ATOM   636  C CA  . GLN A 1 88  ? 64.190 77.113  26.161 1.00 27.45  ? 583 GLN A CA  1 
ATOM   637  C C   . GLN A 1 88  ? 63.065 77.171  27.205 1.00 28.36  ? 583 GLN A C   1 
ATOM   638  O O   . GLN A 1 88  ? 63.335 77.071  28.404 1.00 29.41  ? 583 GLN A O   1 
ATOM   639  C CB  . GLN A 1 88  ? 65.182 78.262  26.359 1.00 28.17  ? 583 GLN A CB  1 
ATOM   640  C CG  . GLN A 1 88  ? 66.296 77.939  27.334 1.00 32.17  ? 583 GLN A CG  1 
ATOM   641  C CD  . GLN A 1 88  ? 67.121 76.742  26.903 1.00 32.29  ? 583 GLN A CD  1 
ATOM   642  O OE1 . GLN A 1 88  ? 67.775 76.100  27.719 1.00 34.43  ? 583 GLN A OE1 1 
ATOM   643  N NE2 . GLN A 1 88  ? 67.103 76.444  25.614 1.00 33.23  ? 583 GLN A NE2 1 
ATOM   644  N N   . VAL A 1 89  ? 61.815 77.317  26.765 1.00 25.91  ? 584 VAL A N   1 
ATOM   645  C CA  . VAL A 1 89  ? 60.693 77.353  27.707 1.00 26.89  ? 584 VAL A CA  1 
ATOM   646  C C   . VAL A 1 89  ? 60.834 76.186  28.695 1.00 27.09  ? 584 VAL A C   1 
ATOM   647  O O   . VAL A 1 89  ? 60.975 75.034  28.290 1.00 25.20  ? 584 VAL A O   1 
ATOM   648  C CB  . VAL A 1 89  ? 59.333 77.237  26.977 1.00 27.33  ? 584 VAL A CB  1 
ATOM   649  C CG1 . VAL A 1 89  ? 58.211 77.028  27.994 1.00 24.45  ? 584 VAL A CG1 1 
ATOM   650  C CG2 . VAL A 1 89  ? 59.080 78.483  26.151 1.00 22.16  ? 584 VAL A CG2 1 
ATOM   651  N N   . LYS A 1 90  ? 60.776 76.485  29.987 1.00 28.76  ? 585 LYS A N   1 
ATOM   652  C CA  . LYS A 1 90  ? 60.968 75.456  30.995 1.00 31.93  ? 585 LYS A CA  1 
ATOM   653  C C   . LYS A 1 90  ? 59.810 74.489  31.268 1.00 32.16  ? 585 LYS A C   1 
ATOM   654  O O   . LYS A 1 90  ? 58.641 74.881  31.310 1.00 32.75  ? 585 LYS A O   1 
ATOM   655  C CB  . LYS A 1 90  ? 61.415 76.107  32.303 1.00 35.67  ? 585 LYS A CB  1 
ATOM   656  C CG  . LYS A 1 90  ? 62.342 75.215  33.113 1.00 47.55  ? 585 LYS A CG  1 
ATOM   657  C CD  . LYS A 1 90  ? 62.596 75.739  34.523 1.00 52.35  ? 585 LYS A CD  1 
ATOM   658  C CE  . LYS A 1 90  ? 63.418 74.729  35.329 1.00 54.35  ? 585 LYS A CE  1 
ATOM   659  N NZ  . LYS A 1 90  ? 63.699 75.185  36.721 1.00 55.31  ? 585 LYS A NZ  1 
ATOM   660  N N   . TYR A 1 91  ? 60.153 73.214  31.447 1.00 30.49  ? 586 TYR A N   1 
ATOM   661  C CA  . TYR A 1 91  ? 59.166 72.182  31.744 1.00 30.27  ? 586 TYR A CA  1 
ATOM   662  C C   . TYR A 1 91  ? 58.786 72.375  33.201 1.00 32.05  ? 586 TYR A C   1 
ATOM   663  O O   . TYR A 1 91  ? 59.650 72.558  34.059 1.00 32.34  ? 586 TYR A O   1 
ATOM   664  C CB  . TYR A 1 91  ? 59.765 70.787  31.539 1.00 29.07  ? 586 TYR A CB  1 
ATOM   665  C CG  . TYR A 1 91  ? 58.871 69.637  31.964 1.00 27.74  ? 586 TYR A CG  1 
ATOM   666  C CD1 . TYR A 1 91  ? 57.635 69.420  31.361 1.00 27.36  ? 586 TYR A CD1 1 
ATOM   667  C CD2 . TYR A 1 91  ? 59.274 68.749  32.966 1.00 28.49  ? 586 TYR A CD2 1 
ATOM   668  C CE1 . TYR A 1 91  ? 56.822 68.345  31.747 1.00 28.40  ? 586 TYR A CE1 1 
ATOM   669  C CE2 . TYR A 1 91  ? 58.470 67.677  33.358 1.00 22.79  ? 586 TYR A CE2 1 
ATOM   670  C CZ  . TYR A 1 91  ? 57.250 67.480  32.750 1.00 26.88  ? 586 TYR A CZ  1 
ATOM   671  O OH  . TYR A 1 91  ? 56.447 66.438  33.165 1.00 28.29  ? 586 TYR A OH  1 
ATOM   672  N N   . ALA A 1 92  ? 57.489 72.342  33.478 1.00 33.68  ? 587 ALA A N   1 
ATOM   673  C CA  . ALA A 1 92  ? 57.005 72.536  34.833 1.00 33.10  ? 587 ALA A CA  1 
ATOM   674  C C   . ALA A 1 92  ? 56.602 71.224  35.472 1.00 33.77  ? 587 ALA A C   1 
ATOM   675  O O   . ALA A 1 92  ? 56.854 71.004  36.651 1.00 34.90  ? 587 ALA A O   1 
ATOM   676  C CB  . ALA A 1 92  ? 55.826 73.495  34.826 1.00 30.56  ? 587 ALA A CB  1 
ATOM   677  N N   . GLY A 1 93  ? 55.969 70.356  34.689 1.00 34.95  ? 588 GLY A N   1 
ATOM   678  C CA  . GLY A 1 93  ? 55.527 69.074  35.207 1.00 35.14  ? 588 GLY A CA  1 
ATOM   679  C C   . GLY A 1 93  ? 54.571 69.242  36.373 1.00 34.18  ? 588 GLY A C   1 
ATOM   680  O O   . GLY A 1 93  ? 54.508 68.394  37.261 1.00 35.33  ? 588 GLY A O   1 
ATOM   681  N N   . SER A 1 94  ? 53.815 70.332  36.362 1.00 32.31  ? 589 SER A N   1 
ATOM   682  C CA  . SER A 1 94  ? 52.878 70.629  37.436 1.00 33.95  ? 589 SER A CA  1 
ATOM   683  C C   . SER A 1 94  ? 51.621 69.767  37.537 1.00 33.97  ? 589 SER A C   1 
ATOM   684  O O   . SER A 1 94  ? 51.135 69.209  36.552 1.00 32.41  ? 589 SER A O   1 
ATOM   685  C CB  . SER A 1 94  ? 52.451 72.092  37.364 1.00 35.29  ? 589 SER A CB  1 
ATOM   686  O OG  . SER A 1 94  ? 51.291 72.315  38.152 1.00 38.12  ? 589 SER A OG  1 
ATOM   687  N N   . GLN A 1 95  ? 51.112 69.679  38.764 1.00 34.64  ? 590 GLN A N   1 
ATOM   688  C CA  . GLN A 1 95  ? 49.905 68.932  39.092 1.00 35.45  ? 590 GLN A CA  1 
ATOM   689  C C   . GLN A 1 95  ? 48.725 69.585  38.396 1.00 33.83  ? 590 GLN A C   1 
ATOM   690  O O   . GLN A 1 95  ? 47.861 68.907  37.847 1.00 32.74  ? 590 GLN A O   1 
ATOM   691  C CB  . GLN A 1 95  ? 49.659 68.977  40.603 1.00 37.19  ? 590 GLN A CB  1 
ATOM   692  C CG  . GLN A 1 95  ? 50.130 67.767  41.349 1.00 43.38  ? 590 GLN A CG  1 
ATOM   693  C CD  . GLN A 1 95  ? 49.408 66.526  40.890 1.00 47.69  ? 590 GLN A CD  1 
ATOM   694  O OE1 . GLN A 1 95  ? 48.181 66.522  40.768 1.00 52.11  ? 590 GLN A OE1 1 
ATOM   695  N NE2 . GLN A 1 95  ? 50.160 65.460  40.632 1.00 51.10  ? 590 GLN A NE2 1 
ATOM   696  N N   . VAL A 1 96  ? 48.713 70.915  38.425 1.00 32.75  ? 591 VAL A N   1 
ATOM   697  C CA  . VAL A 1 96  ? 47.643 71.701  37.841 1.00 33.01  ? 591 VAL A CA  1 
ATOM   698  C C   . VAL A 1 96  ? 48.044 72.579  36.666 1.00 32.23  ? 591 VAL A C   1 
ATOM   699  O O   . VAL A 1 96  ? 49.116 73.183  36.644 1.00 29.60  ? 591 VAL A O   1 
ATOM   700  C CB  . VAL A 1 96  ? 47.019 72.614  38.898 1.00 37.91  ? 591 VAL A CB  1 
ATOM   701  C CG1 . VAL A 1 96  ? 45.829 73.375  38.307 1.00 38.51  ? 591 VAL A CG1 1 
ATOM   702  C CG2 . VAL A 1 96  ? 46.612 71.785  40.099 1.00 38.58  ? 591 VAL A CG2 1 
ATOM   703  N N   . ALA A 1 97  ? 47.145 72.646  35.695 1.00 31.54  ? 592 ALA A N   1 
ATOM   704  C CA  . ALA A 1 97  ? 47.327 73.451  34.502 1.00 29.97  ? 592 ALA A CA  1 
ATOM   705  C C   . ALA A 1 97  ? 45.960 74.082  34.258 1.00 30.85  ? 592 ALA A C   1 
ATOM   706  O O   . ALA A 1 97  ? 45.095 73.484  33.610 1.00 30.10  ? 592 ALA A O   1 
ATOM   707  C CB  . ALA A 1 97  ? 47.723 72.568  33.335 1.00 29.90  ? 592 ALA A CB  1 
ATOM   708  N N   . SER A 1 98  ? 45.764 75.283  34.795 1.00 28.11  ? 593 SER A N   1 
ATOM   709  C CA  . SER A 1 98  ? 44.491 75.970  34.656 1.00 25.63  ? 593 SER A CA  1 
ATOM   710  C C   . SER A 1 98  ? 44.301 76.682  33.322 1.00 27.02  ? 593 SER A C   1 
ATOM   711  O O   . SER A 1 98  ? 44.929 77.711  33.061 1.00 26.44  ? 593 SER A O   1 
ATOM   712  C CB  . SER A 1 98  ? 44.315 76.979  35.782 1.00 20.99  ? 593 SER A CB  1 
ATOM   713  O OG  . SER A 1 98  ? 43.042 77.592  35.686 1.00 22.12  ? 593 SER A OG  1 
ATOM   714  N N   . THR A 1 99  ? 43.422 76.139  32.486 1.00 27.25  ? 594 THR A N   1 
ATOM   715  C CA  . THR A 1 99  ? 43.137 76.736  31.190 1.00 29.92  ? 594 THR A CA  1 
ATOM   716  C C   . THR A 1 99  ? 42.352 78.035  31.363 1.00 30.99  ? 594 THR A C   1 
ATOM   717  O O   . THR A 1 99  ? 42.400 78.915  30.497 1.00 30.99  ? 594 THR A O   1 
ATOM   718  C CB  . THR A 1 99  ? 42.319 75.783  30.295 1.00 31.33  ? 594 THR A CB  1 
ATOM   719  O OG1 . THR A 1 99  ? 41.179 75.304  31.021 1.00 32.96  ? 594 THR A OG1 1 
ATOM   720  C CG2 . THR A 1 99  ? 43.177 74.615  29.839 1.00 31.20  ? 594 THR A CG2 1 
ATOM   721  N N   . SER A 1 100 ? 41.627 78.150  32.473 1.00 29.99  ? 595 SER A N   1 
ATOM   722  C CA  . SER A 1 100 ? 40.857 79.363  32.740 1.00 31.45  ? 595 SER A CA  1 
ATOM   723  C C   . SER A 1 100 ? 41.783 80.503  33.149 1.00 31.63  ? 595 SER A C   1 
ATOM   724  O O   . SER A 1 100 ? 41.486 81.677  32.905 1.00 32.91  ? 595 SER A O   1 
ATOM   725  C CB  . SER A 1 100 ? 39.819 79.126  33.840 1.00 29.99  ? 595 SER A CB  1 
ATOM   726  O OG  . SER A 1 100 ? 38.788 78.264  33.388 1.00 32.92  ? 595 SER A OG  1 
ATOM   727  N N   . GLU A 1 101 ? 42.905 80.152  33.771 1.00 30.22  ? 596 GLU A N   1 
ATOM   728  C CA  . GLU A 1 101 ? 43.877 81.145  34.207 1.00 28.36  ? 596 GLU A CA  1 
ATOM   729  C C   . GLU A 1 101 ? 44.595 81.707  33.005 1.00 26.90  ? 596 GLU A C   1 
ATOM   730  O O   . GLU A 1 101 ? 44.662 82.924  32.825 1.00 26.82  ? 596 GLU A O   1 
ATOM   731  C CB  . GLU A 1 101 ? 44.921 80.532  35.145 1.00 32.32  ? 596 GLU A CB  1 
ATOM   732  C CG  . GLU A 1 101 ? 44.603 80.621  36.627 1.00 35.16  ? 596 GLU A CG  1 
ATOM   733  C CD  . GLU A 1 101 ? 44.431 82.050  37.099 1.00 38.78  ? 596 GLU A CD  1 
ATOM   734  O OE1 . GLU A 1 101 ? 45.266 82.913  36.743 1.00 40.61  ? 596 GLU A OE1 1 
ATOM   735  O OE2 . GLU A 1 101 ? 43.460 82.310  37.838 1.00 42.51  ? 596 GLU A OE2 1 
ATOM   736  N N   . VAL A 1 102 ? 45.136 80.817  32.179 1.00 25.44  ? 597 VAL A N   1 
ATOM   737  C CA  . VAL A 1 102 ? 45.870 81.250  31.002 1.00 25.30  ? 597 VAL A CA  1 
ATOM   738  C C   . VAL A 1 102 ? 44.952 82.065  30.095 1.00 24.73  ? 597 VAL A C   1 
ATOM   739  O O   . VAL A 1 102 ? 45.375 83.074  29.535 1.00 24.19  ? 597 VAL A O   1 
ATOM   740  C CB  . VAL A 1 102 ? 46.493 80.038  30.241 1.00 25.84  ? 597 VAL A CB  1 
ATOM   741  C CG1 . VAL A 1 102 ? 45.415 79.203  29.577 1.00 25.89  ? 597 VAL A CG1 1 
ATOM   742  C CG2 . VAL A 1 102 ? 47.517 80.528  29.237 1.00 22.71  ? 597 VAL A CG2 1 
ATOM   743  N N   . LEU A 1 103 ? 43.693 81.652  29.965 1.00 25.82  ? 598 LEU A N   1 
ATOM   744  C CA  . LEU A 1 103 ? 42.760 82.411  29.139 1.00 27.86  ? 598 LEU A CA  1 
ATOM   745  C C   . LEU A 1 103 ? 42.499 83.791  29.762 1.00 28.17  ? 598 LEU A C   1 
ATOM   746  O O   . LEU A 1 103 ? 42.533 84.811  29.070 1.00 27.22  ? 598 LEU A O   1 
ATOM   747  C CB  . LEU A 1 103 ? 41.448 81.643  28.949 1.00 26.62  ? 598 LEU A CB  1 
ATOM   748  C CG  . LEU A 1 103 ? 41.574 80.514  27.920 1.00 27.23  ? 598 LEU A CG  1 
ATOM   749  C CD1 . LEU A 1 103 ? 40.200 79.944  27.617 1.00 26.48  ? 598 LEU A CD1 1 
ATOM   750  C CD2 . LEU A 1 103 ? 42.217 81.046  26.638 1.00 24.92  ? 598 LEU A CD2 1 
ATOM   751  N N   . LYS A 1 104 ? 42.249 83.824  31.068 1.00 27.77  ? 599 LYS A N   1 
ATOM   752  C CA  . LYS A 1 104 ? 42.029 85.092  31.749 1.00 26.85  ? 599 LYS A CA  1 
ATOM   753  C C   . LYS A 1 104 ? 43.245 85.984  31.476 1.00 28.42  ? 599 LYS A C   1 
ATOM   754  O O   . LYS A 1 104 ? 43.105 87.183  31.235 1.00 29.58  ? 599 LYS A O   1 
ATOM   755  C CB  . LYS A 1 104 ? 41.876 84.863  33.253 1.00 22.47  ? 599 LYS A CB  1 
ATOM   756  C CG  . LYS A 1 104 ? 41.773 86.142  34.083 1.00 18.98  ? 599 LYS A CG  1 
ATOM   757  C CD  . LYS A 1 104 ? 41.800 85.826  35.574 1.00 15.68  ? 599 LYS A CD  1 
ATOM   758  C CE  . LYS A 1 104 ? 41.721 87.081  36.418 1.00 13.45  ? 599 LYS A CE  1 
ATOM   759  N NZ  . LYS A 1 104 ? 41.700 86.757  37.870 1.00 13.38  ? 599 LYS A NZ  1 
ATOM   760  N N   . TYR A 1 105 ? 44.432 85.379  31.508 1.00 26.95  ? 600 TYR A N   1 
ATOM   761  C CA  . TYR A 1 105 ? 45.679 86.090  31.265 1.00 26.19  ? 600 TYR A CA  1 
ATOM   762  C C   . TYR A 1 105 ? 45.738 86.593  29.824 1.00 27.31  ? 600 TYR A C   1 
ATOM   763  O O   . TYR A 1 105 ? 46.126 87.734  29.569 1.00 26.71  ? 600 TYR A O   1 
ATOM   764  C CB  . TYR A 1 105 ? 46.879 85.171  31.522 1.00 23.99  ? 600 TYR A CB  1 
ATOM   765  C CG  . TYR A 1 105 ? 48.222 85.829  31.285 1.00 24.22  ? 600 TYR A CG  1 
ATOM   766  C CD1 . TYR A 1 105 ? 48.867 86.521  32.304 1.00 24.29  ? 600 TYR A CD1 1 
ATOM   767  C CD2 . TYR A 1 105 ? 48.828 85.797  30.022 1.00 23.18  ? 600 TYR A CD2 1 
ATOM   768  C CE1 . TYR A 1 105 ? 50.085 87.166  32.080 1.00 27.76  ? 600 TYR A CE1 1 
ATOM   769  C CE2 . TYR A 1 105 ? 50.043 86.444  29.783 1.00 23.21  ? 600 TYR A CE2 1 
ATOM   770  C CZ  . TYR A 1 105 ? 50.668 87.127  30.818 1.00 27.53  ? 600 TYR A CZ  1 
ATOM   771  O OH  . TYR A 1 105 ? 51.867 87.777  30.616 1.00 24.87  ? 600 TYR A OH  1 
ATOM   772  N N   . THR A 1 106 ? 45.363 85.741  28.879 1.00 27.01  ? 601 THR A N   1 
ATOM   773  C CA  . THR A 1 106 ? 45.398 86.128  27.472 1.00 27.19  ? 601 THR A CA  1 
ATOM   774  C C   . THR A 1 106 ? 44.508 87.345  27.229 1.00 29.09  ? 601 THR A C   1 
ATOM   775  O O   . THR A 1 106 ? 44.920 88.315  26.583 1.00 29.40  ? 601 THR A O   1 
ATOM   776  C CB  . THR A 1 106 ? 44.942 84.959  26.565 1.00 24.01  ? 601 THR A CB  1 
ATOM   777  O OG1 . THR A 1 106 ? 45.754 83.814  26.838 1.00 23.08  ? 601 THR A OG1 1 
ATOM   778  C CG2 . THR A 1 106 ? 45.095 85.317  25.089 1.00 23.73  ? 601 THR A CG2 1 
ATOM   779  N N   . LEU A 1 107 ? 43.298 87.289  27.779 1.00 29.31  ? 602 LEU A N   1 
ATOM   780  C CA  . LEU A 1 107 ? 42.308 88.353  27.635 1.00 31.46  ? 602 LEU A CA  1 
ATOM   781  C C   . LEU A 1 107 ? 42.727 89.719  28.186 1.00 31.96  ? 602 LEU A C   1 
ATOM   782  O O   . LEU A 1 107 ? 42.646 90.732  27.484 1.00 30.36  ? 602 LEU A O   1 
ATOM   783  C CB  . LEU A 1 107 ? 40.999 87.934  28.315 1.00 31.66  ? 602 LEU A CB  1 
ATOM   784  C CG  . LEU A 1 107 ? 39.868 88.967  28.269 1.00 35.12  ? 602 LEU A CG  1 
ATOM   785  C CD1 . LEU A 1 107 ? 39.417 89.162  26.821 1.00 33.13  ? 602 LEU A CD1 1 
ATOM   786  C CD2 . LEU A 1 107 ? 38.700 88.509  29.135 1.00 33.78  ? 602 LEU A CD2 1 
ATOM   787  N N   . PHE A 1 108 ? 43.165 89.737  29.441 1.00 31.12  ? 603 PHE A N   1 
ATOM   788  C CA  . PHE A 1 108 ? 43.552 90.971  30.111 1.00 32.96  ? 603 PHE A CA  1 
ATOM   789  C C   . PHE A 1 108 ? 44.987 91.459  29.891 1.00 35.00  ? 603 PHE A C   1 
ATOM   790  O O   . PHE A 1 108 ? 45.222 92.660  29.739 1.00 33.53  ? 603 PHE A O   1 
ATOM   791  C CB  . PHE A 1 108 ? 43.311 90.819  31.616 1.00 32.60  ? 603 PHE A CB  1 
ATOM   792  C CG  . PHE A 1 108 ? 41.865 90.888  32.017 1.00 32.25  ? 603 PHE A CG  1 
ATOM   793  C CD1 . PHE A 1 108 ? 41.213 92.109  32.095 1.00 32.23  ? 603 PHE A CD1 1 
ATOM   794  C CD2 . PHE A 1 108 ? 41.160 89.737  32.339 1.00 33.40  ? 603 PHE A CD2 1 
ATOM   795  C CE1 . PHE A 1 108 ? 39.885 92.186  32.498 1.00 30.36  ? 603 PHE A CE1 1 
ATOM   796  C CE2 . PHE A 1 108 ? 39.824 89.809  32.743 1.00 33.65  ? 603 PHE A CE2 1 
ATOM   797  C CZ  . PHE A 1 108 ? 39.190 91.038  32.820 1.00 29.34  ? 603 PHE A CZ  1 
ATOM   798  N N   . GLN A 1 109 ? 45.942 90.533  29.880 1.00 35.89  ? 604 GLN A N   1 
ATOM   799  C CA  . GLN A 1 109 ? 47.355 90.887  29.735 1.00 35.56  ? 604 GLN A CA  1 
ATOM   800  C C   . GLN A 1 109 ? 47.967 90.839  28.335 1.00 35.95  ? 604 GLN A C   1 
ATOM   801  O O   . GLN A 1 109 ? 49.078 91.333  28.129 1.00 36.70  ? 604 GLN A O   1 
ATOM   802  C CB  . GLN A 1 109 ? 48.192 90.001  30.656 1.00 33.96  ? 604 GLN A CB  1 
ATOM   803  C CG  . GLN A 1 109 ? 47.756 90.050  32.100 1.00 35.38  ? 604 GLN A CG  1 
ATOM   804  C CD  . GLN A 1 109 ? 47.608 91.464  32.596 1.00 36.37  ? 604 GLN A CD  1 
ATOM   805  O OE1 . GLN A 1 109 ? 48.453 92.316  32.329 1.00 38.35  ? 604 GLN A OE1 1 
ATOM   806  N NE2 . GLN A 1 109 ? 46.536 91.724  33.329 1.00 38.81  ? 604 GLN A NE2 1 
ATOM   807  N N   . ILE A 1 110 ? 47.266 90.254  27.373 1.00 36.04  ? 605 ILE A N   1 
ATOM   808  C CA  . ILE A 1 110 ? 47.817 90.156  26.029 1.00 36.64  ? 605 ILE A CA  1 
ATOM   809  C C   . ILE A 1 110 ? 46.990 90.897  24.994 1.00 40.80  ? 605 ILE A C   1 
ATOM   810  O O   . ILE A 1 110 ? 47.502 91.748  24.271 1.00 42.85  ? 605 ILE A O   1 
ATOM   811  C CB  . ILE A 1 110 ? 47.944 88.678  25.592 1.00 34.23  ? 605 ILE A CB  1 
ATOM   812  C CG1 . ILE A 1 110 ? 48.885 87.933  26.541 1.00 30.63  ? 605 ILE A CG1 1 
ATOM   813  C CG2 . ILE A 1 110 ? 48.452 88.596  24.166 1.00 31.14  ? 605 ILE A CG2 1 
ATOM   814  C CD1 . ILE A 1 110 ? 49.174 86.512  26.125 1.00 30.21  ? 605 ILE A CD1 1 
ATOM   815  N N   . PHE A 1 111 ? 45.706 90.569  24.931 1.00 43.88  ? 606 PHE A N   1 
ATOM   816  C CA  . PHE A 1 111 ? 44.798 91.178  23.966 1.00 46.22  ? 606 PHE A CA  1 
ATOM   817  C C   . PHE A 1 111 ? 43.885 92.239  24.571 1.00 50.86  ? 606 PHE A C   1 
ATOM   818  O O   . PHE A 1 111 ? 42.741 92.388  24.139 1.00 52.45  ? 606 PHE A O   1 
ATOM   819  C CB  . PHE A 1 111 ? 43.936 90.088  23.315 1.00 43.45  ? 606 PHE A CB  1 
ATOM   820  C CG  . PHE A 1 111 ? 44.672 89.235  22.311 1.00 40.68  ? 606 PHE A CG  1 
ATOM   821  C CD1 . PHE A 1 111 ? 44.542 87.850  22.331 1.00 38.66  ? 606 PHE A CD1 1 
ATOM   822  C CD2 . PHE A 1 111 ? 45.446 89.820  21.314 1.00 38.67  ? 606 PHE A CD2 1 
ATOM   823  C CE1 . PHE A 1 111 ? 45.170 87.061  21.375 1.00 38.31  ? 606 PHE A CE1 1 
ATOM   824  C CE2 . PHE A 1 111 ? 46.079 89.042  20.353 1.00 37.01  ? 606 PHE A CE2 1 
ATOM   825  C CZ  . PHE A 1 111 ? 45.939 87.661  20.381 1.00 39.80  ? 606 PHE A CZ  1 
ATOM   826  N N   . SER A 1 112 ? 44.380 92.972  25.563 1.00 55.51  ? 607 SER A N   1 
ATOM   827  C CA  . SER A 1 112 ? 43.581 94.010  26.217 1.00 60.69  ? 607 SER A CA  1 
ATOM   828  C C   . SER A 1 112 ? 43.068 95.056  25.233 1.00 64.55  ? 607 SER A C   1 
ATOM   829  O O   . SER A 1 112 ? 41.910 95.470  25.294 1.00 65.70  ? 607 SER A O   1 
ATOM   830  C CB  . SER A 1 112 ? 44.406 94.693  27.305 1.00 60.80  ? 607 SER A CB  1 
ATOM   831  O OG  . SER A 1 112 ? 45.752 94.860  26.891 1.00 60.85  ? 607 SER A OG  1 
ATOM   832  N N   . LYS A 1 113 ? 43.941 95.470  24.325 1.00 68.48  ? 608 LYS A N   1 
ATOM   833  C CA  . LYS A 1 113 ? 43.623 96.472  23.310 1.00 72.43  ? 608 LYS A CA  1 
ATOM   834  C C   . LYS A 1 113 ? 43.592 95.868  21.901 1.00 73.52  ? 608 LYS A C   1 
ATOM   835  O O   . LYS A 1 113 ? 43.524 94.653  21.741 1.00 72.62  ? 608 LYS A O   1 
ATOM   836  C CB  . LYS A 1 113 ? 44.663 97.589  23.369 1.00 74.57  ? 608 LYS A CB  1 
ATOM   837  C CG  . LYS A 1 113 ? 46.016 97.126  23.902 1.00 77.68  ? 608 LYS A CG  1 
ATOM   838  C CD  . LYS A 1 113 ? 46.379 95.733  23.385 1.00 79.38  ? 608 LYS A CD  1 
ATOM   839  C CE  . LYS A 1 113 ? 47.751 95.311  23.838 1.00 80.55  ? 608 LYS A CE  1 
ATOM   840  N NZ  . LYS A 1 113 ? 48.765 96.138  23.140 1.00 82.66  ? 608 LYS A NZ  1 
ATOM   841  N N   . ILE A 1 114 ? 43.646 96.726  20.885 1.00 75.25  ? 609 ILE A N   1 
ATOM   842  C CA  . ILE A 1 114 ? 43.622 96.277  19.495 1.00 75.57  ? 609 ILE A CA  1 
ATOM   843  C C   . ILE A 1 114 ? 44.455 97.213  18.618 1.00 75.19  ? 609 ILE A C   1 
ATOM   844  O O   . ILE A 1 114 ? 43.913 97.919  17.766 1.00 75.53  ? 609 ILE A O   1 
ATOM   845  C CB  . ILE A 1 114 ? 42.179 96.258  18.930 1.00 77.02  ? 609 ILE A CB  1 
ATOM   846  C CG1 . ILE A 1 114 ? 41.185 95.884  20.035 1.00 78.06  ? 609 ILE A CG1 1 
ATOM   847  C CG2 . ILE A 1 114 ? 42.086 95.263  17.777 1.00 76.05  ? 609 ILE A CG2 1 
ATOM   848  C CD1 . ILE A 1 114 ? 39.719 96.006  19.630 1.00 78.62  ? 609 ILE A CD1 1 
ATOM   849  N N   . ASP A 1 115 ? 45.768 97.224  18.823 1.00 73.91  ? 610 ASP A N   1 
ATOM   850  C CA  . ASP A 1 115 ? 46.649 98.090  18.042 1.00 72.34  ? 610 ASP A CA  1 
ATOM   851  C C   . ASP A 1 115 ? 46.841 97.567  16.618 1.00 69.55  ? 610 ASP A C   1 
ATOM   852  O O   . ASP A 1 115 ? 47.731 98.008  15.892 1.00 69.20  ? 610 ASP A O   1 
ATOM   853  C CB  . ASP A 1 115 ? 48.004 98.205  18.735 1.00 75.85  ? 610 ASP A CB  1 
ATOM   854  C CG  . ASP A 1 115 ? 48.729 96.875  18.816 1.00 78.13  ? 610 ASP A CG  1 
ATOM   855  O OD1 . ASP A 1 115 ? 49.974 96.872  18.856 1.00 79.19  ? 610 ASP A OD1 1 
ATOM   856  O OD2 . ASP A 1 115 ? 48.054 95.826  18.859 1.00 79.61  ? 610 ASP A OD2 1 
ATOM   857  N N   . ARG A 1 116 ? 45.987 96.632  16.219 1.00 66.24  ? 611 ARG A N   1 
ATOM   858  C CA  . ARG A 1 116 ? 46.073 96.029  14.888 1.00 63.29  ? 611 ARG A CA  1 
ATOM   859  C C   . ARG A 1 116 ? 44.724 95.441  14.504 1.00 63.23  ? 611 ARG A C   1 
ATOM   860  O O   . ARG A 1 116 ? 44.587 94.234  14.368 1.00 63.85  ? 611 ARG A O   1 
ATOM   861  C CB  . ARG A 1 116 ? 47.096 94.907  14.916 1.00 62.07  ? 611 ARG A CB  1 
ATOM   862  C CG  . ARG A 1 116 ? 48.445 95.261  14.341 1.00 60.66  ? 611 ARG A CG  1 
ATOM   863  C CD  . ARG A 1 116 ? 49.124 93.997  13.860 1.00 59.16  ? 611 ARG A CD  1 
ATOM   864  N NE  . ARG A 1 116 ? 50.523 94.207  13.546 1.00 60.45  ? 611 ARG A NE  1 
ATOM   865  C CZ  . ARG A 1 116 ? 51.281 93.231  13.065 1.00 61.58  ? 611 ARG A CZ  1 
ATOM   866  N NH1 . ARG A 1 116 ? 50.739 92.022  12.860 1.00 61.29  ? 611 ARG A NH1 1 
ATOM   867  N NH2 . ARG A 1 116 ? 52.565 93.436  12.795 1.00 60.29  ? 611 ARG A NH2 1 
ATOM   868  N N   . PRO A 1 117 ? 43.710 96.289  14.308 1.00 62.86  ? 612 PRO A N   1 
ATOM   869  C CA  . PRO A 1 117 ? 42.384 95.781  13.949 1.00 61.45  ? 612 PRO A CA  1 
ATOM   870  C C   . PRO A 1 117 ? 42.337 95.194  12.554 1.00 59.79  ? 612 PRO A C   1 
ATOM   871  O O   . PRO A 1 117 ? 41.255 94.894  12.032 1.00 60.91  ? 612 PRO A O   1 
ATOM   872  C CB  . PRO A 1 117 ? 41.491 97.013  14.072 1.00 62.36  ? 612 PRO A CB  1 
ATOM   873  C CG  . PRO A 1 117 ? 42.394 98.128  13.665 1.00 62.25  ? 612 PRO A CG  1 
ATOM   874  C CD  . PRO A 1 117 ? 43.731 97.761  14.313 1.00 62.32  ? 612 PRO A CD  1 
ATOM   875  N N   . GLU A 1 118 ? 43.502 95.035  11.938 1.00 56.42  ? 613 GLU A N   1 
ATOM   876  C CA  . GLU A 1 118 ? 43.563 94.479  10.587 1.00 55.23  ? 613 GLU A CA  1 
ATOM   877  C C   . GLU A 1 118 ? 43.974 93.009  10.567 1.00 51.03  ? 613 GLU A C   1 
ATOM   878  O O   . GLU A 1 118 ? 43.463 92.226  9.768  1.00 50.95  ? 613 GLU A O   1 
ATOM   879  C CB  . GLU A 1 118 ? 44.546 95.268  9.724  1.00 58.88  ? 613 GLU A CB  1 
ATOM   880  C CG  . GLU A 1 118 ? 44.086 96.669  9.347  1.00 65.94  ? 613 GLU A CG  1 
ATOM   881  C CD  . GLU A 1 118 ? 44.028 96.849  7.848  1.00 73.04  ? 613 GLU A CD  1 
ATOM   882  O OE1 . GLU A 1 118 ? 44.871 96.236  7.160  1.00 76.12  ? 613 GLU A OE1 1 
ATOM   883  O OE2 . GLU A 1 118 ? 43.148 97.585  7.356  1.00 75.15  ? 613 GLU A OE2 1 
ATOM   884  N N   . ALA A 1 119 ? 44.904 92.645  11.441 1.00 46.25  ? 614 ALA A N   1 
ATOM   885  C CA  . ALA A 1 119 ? 45.382 91.277  11.504 1.00 43.01  ? 614 ALA A CA  1 
ATOM   886  C C   . ALA A 1 119 ? 44.436 90.400  12.309 1.00 40.74  ? 614 ALA A C   1 
ATOM   887  O O   . ALA A 1 119 ? 43.650 90.888  13.114 1.00 38.74  ? 614 ALA A O   1 
ATOM   888  C CB  . ALA A 1 119 ? 46.770 91.252  12.125 1.00 43.05  ? 614 ALA A CB  1 
ATOM   889  N N   . SER A 1 120 ? 44.502 89.097  12.077 1.00 39.86  ? 615 SER A N   1 
ATOM   890  C CA  . SER A 1 120 ? 43.677 88.170  12.832 1.00 38.34  ? 615 SER A CA  1 
ATOM   891  C C   . SER A 1 120 ? 44.372 87.941  14.158 1.00 38.33  ? 615 SER A C   1 
ATOM   892  O O   . SER A 1 120 ? 45.589 88.098  14.271 1.00 39.19  ? 615 SER A O   1 
ATOM   893  C CB  . SER A 1 120 ? 43.517 86.844  12.094 1.00 35.82  ? 615 SER A CB  1 
ATOM   894  O OG  . SER A 1 120 ? 42.538 86.958  11.080 1.00 36.86  ? 615 SER A OG  1 
ATOM   895  N N   . ARG A 1 121 ? 43.593 87.584  15.165 1.00 37.91  ? 616 ARG A N   1 
ATOM   896  C CA  . ARG A 1 121 ? 44.129 87.344  16.495 1.00 39.05  ? 616 ARG A CA  1 
ATOM   897  C C   . ARG A 1 121 ? 43.759 85.910  16.844 1.00 39.36  ? 616 ARG A C   1 
ATOM   898  O O   . ARG A 1 121 ? 42.581 85.583  17.008 1.00 41.28  ? 616 ARG A O   1 
ATOM   899  C CB  . ARG A 1 121 ? 43.494 88.335  17.466 1.00 41.86  ? 616 ARG A CB  1 
ATOM   900  C CG  . ARG A 1 121 ? 43.183 89.671  16.788 1.00 45.73  ? 616 ARG A CG  1 
ATOM   901  C CD  . ARG A 1 121 ? 42.446 90.623  17.692 1.00 43.66  ? 616 ARG A CD  1 
ATOM   902  N NE  . ARG A 1 121 ? 43.369 91.396  18.506 1.00 47.29  ? 616 ARG A NE  1 
ATOM   903  C CZ  . ARG A 1 121 ? 43.005 92.091  19.579 1.00 49.43  ? 616 ARG A CZ  1 
ATOM   904  N NH1 . ARG A 1 121 ? 41.735 92.100  19.971 1.00 48.65  ? 616 ARG A NH1 1 
ATOM   905  N NH2 . ARG A 1 121 ? 43.907 92.792  20.254 1.00 51.36  ? 616 ARG A NH2 1 
ATOM   906  N N   . ILE A 1 122 ? 44.768 85.052  16.949 1.00 37.08  ? 617 ILE A N   1 
ATOM   907  C CA  . ILE A 1 122 ? 44.529 83.645  17.229 1.00 33.16  ? 617 ILE A CA  1 
ATOM   908  C C   . ILE A 1 122 ? 45.310 83.111  18.426 1.00 33.09  ? 617 ILE A C   1 
ATOM   909  O O   . ILE A 1 122 ? 46.518 83.311  18.530 1.00 34.66  ? 617 ILE A O   1 
ATOM   910  C CB  . ILE A 1 122 ? 44.882 82.798  15.980 1.00 31.63  ? 617 ILE A CB  1 
ATOM   911  C CG1 . ILE A 1 122 ? 44.099 83.329  14.773 1.00 30.19  ? 617 ILE A CG1 1 
ATOM   912  C CG2 . ILE A 1 122 ? 44.588 81.322  16.239 1.00 27.05  ? 617 ILE A CG2 1 
ATOM   913  C CD1 . ILE A 1 122 ? 44.445 82.683  13.457 1.00 30.22  ? 617 ILE A CD1 1 
ATOM   914  N N   . ALA A 1 123 ? 44.612 82.434  19.331 1.00 30.79  ? 618 ALA A N   1 
ATOM   915  C CA  . ALA A 1 123 ? 45.256 81.837  20.492 1.00 30.90  ? 618 ALA A CA  1 
ATOM   916  C C   . ALA A 1 123 ? 45.186 80.319  20.319 1.00 30.56  ? 618 ALA A C   1 
ATOM   917  O O   . ALA A 1 123 ? 44.103 79.734  20.298 1.00 32.11  ? 618 ALA A O   1 
ATOM   918  C CB  . ALA A 1 123 ? 44.550 82.260  21.768 1.00 29.76  ? 618 ALA A CB  1 
ATOM   919  N N   . LEU A 1 124 ? 46.343 79.686  20.174 1.00 29.23  ? 619 LEU A N   1 
ATOM   920  C CA  . LEU A 1 124 ? 46.400 78.243  19.994 1.00 28.60  ? 619 LEU A CA  1 
ATOM   921  C C   . LEU A 1 124 ? 46.618 77.620  21.371 1.00 29.43  ? 619 LEU A C   1 
ATOM   922  O O   . LEU A 1 124 ? 47.747 77.539  21.854 1.00 29.60  ? 619 LEU A O   1 
ATOM   923  C CB  . LEU A 1 124 ? 47.551 77.896  19.051 1.00 27.04  ? 619 LEU A CB  1 
ATOM   924  C CG  . LEU A 1 124 ? 47.419 76.698  18.110 1.00 28.89  ? 619 LEU A CG  1 
ATOM   925  C CD1 . LEU A 1 124 ? 46.118 76.782  17.322 1.00 26.60  ? 619 LEU A CD1 1 
ATOM   926  C CD2 . LEU A 1 124 ? 48.626 76.676  17.176 1.00 27.02  ? 619 LEU A CD2 1 
ATOM   927  N N   . LEU A 1 125 ? 45.528 77.192  21.999 1.00 27.84  ? 620 LEU A N   1 
ATOM   928  C CA  . LEU A 1 125 ? 45.580 76.608  23.337 1.00 29.90  ? 620 LEU A CA  1 
ATOM   929  C C   . LEU A 1 125 ? 45.886 75.117  23.321 1.00 30.34  ? 620 LEU A C   1 
ATOM   930  O O   . LEU A 1 125 ? 44.979 74.290  23.232 1.00 31.03  ? 620 LEU A O   1 
ATOM   931  C CB  . LEU A 1 125 ? 44.248 76.853  24.056 1.00 27.92  ? 620 LEU A CB  1 
ATOM   932  C CG  . LEU A 1 125 ? 44.025 76.295  25.464 1.00 27.11  ? 620 LEU A CG  1 
ATOM   933  C CD1 . LEU A 1 125 ? 44.974 76.943  26.459 1.00 25.61  ? 620 LEU A CD1 1 
ATOM   934  C CD2 . LEU A 1 125 ? 42.583 76.554  25.864 1.00 27.02  ? 620 LEU A CD2 1 
ATOM   935  N N   . LEU A 1 126 ? 47.167 74.781  23.426 1.00 30.01  ? 621 LEU A N   1 
ATOM   936  C CA  . LEU A 1 126 ? 47.597 73.388  23.420 1.00 30.78  ? 621 LEU A CA  1 
ATOM   937  C C   . LEU A 1 126 ? 47.340 72.781  24.792 1.00 32.03  ? 621 LEU A C   1 
ATOM   938  O O   . LEU A 1 126 ? 48.077 73.039  25.745 1.00 33.83  ? 621 LEU A O   1 
ATOM   939  C CB  . LEU A 1 126 ? 49.075 73.327  23.048 1.00 30.96  ? 621 LEU A CB  1 
ATOM   940  C CG  . LEU A 1 126 ? 49.323 73.967  21.670 1.00 32.68  ? 621 LEU A CG  1 
ATOM   941  C CD1 . LEU A 1 126 ? 50.646 74.716  21.638 1.00 30.67  ? 621 LEU A CD1 1 
ATOM   942  C CD2 . LEU A 1 126 ? 49.270 72.891  20.605 1.00 29.30  ? 621 LEU A CD2 1 
ATOM   943  N N   . MET A 1 127 ? 46.282 71.979  24.892 1.00 31.34  ? 622 MET A N   1 
ATOM   944  C CA  . MET A 1 127 ? 45.917 71.370  26.163 1.00 30.35  ? 622 MET A CA  1 
ATOM   945  C C   . MET A 1 127 ? 46.040 69.857  26.221 1.00 28.91  ? 622 MET A C   1 
ATOM   946  O O   . MET A 1 127 ? 45.696 69.148  25.280 1.00 26.81  ? 622 MET A O   1 
ATOM   947  C CB  . MET A 1 127 ? 44.499 71.806  26.551 1.00 31.75  ? 622 MET A CB  1 
ATOM   948  C CG  . MET A 1 127 ? 43.511 71.847  25.402 1.00 33.56  ? 622 MET A CG  1 
ATOM   949  S SD  . MET A 1 127 ? 41.974 72.746  25.807 1.00 39.24  ? 622 MET A SD  1 
ATOM   950  C CE  . MET A 1 127 ? 41.292 71.714  27.099 1.00 35.17  ? 622 MET A CE  1 
ATOM   951  N N   . ALA A 1 128 ? 46.533 69.376  27.356 1.00 28.82  ? 623 ALA A N   1 
ATOM   952  C CA  . ALA A 1 128 ? 46.735 67.952  27.584 1.00 28.90  ? 623 ALA A CA  1 
ATOM   953  C C   . ALA A 1 128 ? 46.184 67.515  28.930 1.00 28.63  ? 623 ALA A C   1 
ATOM   954  O O   . ALA A 1 128 ? 46.446 66.399  29.370 1.00 29.79  ? 623 ALA A O   1 
ATOM   955  C CB  . ALA A 1 128 ? 48.217 67.625  27.520 1.00 27.80  ? 623 ALA A CB  1 
ATOM   956  N N   . SER A 1 129 ? 45.424 68.386  29.584 1.00 27.10  ? 624 SER A N   1 
ATOM   957  C CA  . SER A 1 129 ? 44.883 68.059  30.895 1.00 26.23  ? 624 SER A CA  1 
ATOM   958  C C   . SER A 1 129 ? 43.497 68.638  31.187 1.00 26.06  ? 624 SER A C   1 
ATOM   959  O O   . SER A 1 129 ? 42.864 69.254  30.338 1.00 24.58  ? 624 SER A O   1 
ATOM   960  C CB  . SER A 1 129 ? 45.865 68.515  31.973 1.00 25.84  ? 624 SER A CB  1 
ATOM   961  O OG  . SER A 1 129 ? 46.093 69.914  31.892 1.00 27.92  ? 624 SER A OG  1 
ATOM   962  N N   . GLN A 1 130 ? 43.034 68.424  32.408 1.00 27.04  ? 625 GLN A N   1 
ATOM   963  C CA  . GLN A 1 130 ? 41.729 68.896  32.830 1.00 28.25  ? 625 GLN A CA  1 
ATOM   964  C C   . GLN A 1 130 ? 41.886 69.540  34.209 1.00 29.69  ? 625 GLN A C   1 
ATOM   965  O O   . GLN A 1 130 ? 42.215 68.868  35.190 1.00 29.90  ? 625 GLN A O   1 
ATOM   966  C CB  . GLN A 1 130 ? 40.776 67.700  32.867 1.00 28.37  ? 625 GLN A CB  1 
ATOM   967  C CG  . GLN A 1 130 ? 39.360 67.950  33.361 1.00 34.34  ? 625 GLN A CG  1 
ATOM   968  C CD  . GLN A 1 130 ? 38.481 66.697  33.221 1.00 38.54  ? 625 GLN A CD  1 
ATOM   969  O OE1 . GLN A 1 130 ? 37.521 66.499  33.972 1.00 38.25  ? 625 GLN A OE1 1 
ATOM   970  N NE2 . GLN A 1 130 ? 38.809 65.853  32.244 1.00 40.15  ? 625 GLN A NE2 1 
ATOM   971  N N   . GLU A 1 131 ? 41.682 70.852  34.273 1.00 29.94  ? 626 GLU A N   1 
ATOM   972  C CA  . GLU A 1 131 ? 41.797 71.581  35.533 1.00 32.73  ? 626 GLU A CA  1 
ATOM   973  C C   . GLU A 1 131 ? 40.646 71.189  36.450 1.00 34.42  ? 626 GLU A C   1 
ATOM   974  O O   . GLU A 1 131 ? 39.606 70.726  35.988 1.00 33.59  ? 626 GLU A O   1 
ATOM   975  C CB  . GLU A 1 131 ? 41.757 73.104  35.288 1.00 30.49  ? 626 GLU A CB  1 
ATOM   976  C CG  . GLU A 1 131 ? 40.401 73.634  34.798 1.00 31.02  ? 626 GLU A CG  1 
ATOM   977  C CD  . GLU A 1 131 ? 40.408 75.123  34.446 1.00 31.86  ? 626 GLU A CD  1 
ATOM   978  O OE1 . GLU A 1 131 ? 39.328 75.663  34.117 1.00 28.85  ? 626 GLU A OE1 1 
ATOM   979  O OE2 . GLU A 1 131 ? 41.485 75.755  34.495 1.00 32.07  ? 626 GLU A OE2 1 
ATOM   980  N N   . PRO A 1 132 ? 40.819 71.362  37.768 1.00 37.67  ? 627 PRO A N   1 
ATOM   981  C CA  . PRO A 1 132 ? 39.742 71.013  38.702 1.00 38.01  ? 627 PRO A CA  1 
ATOM   982  C C   . PRO A 1 132 ? 38.537 71.920  38.452 1.00 39.27  ? 627 PRO A C   1 
ATOM   983  O O   . PRO A 1 132 ? 38.694 73.124  38.240 1.00 40.59  ? 627 PRO A O   1 
ATOM   984  C CB  . PRO A 1 132 ? 40.378 71.250  40.068 1.00 37.58  ? 627 PRO A CB  1 
ATOM   985  C CG  . PRO A 1 132 ? 41.360 72.354  39.792 1.00 39.14  ? 627 PRO A CG  1 
ATOM   986  C CD  . PRO A 1 132 ? 41.981 71.915  38.487 1.00 38.03  ? 627 PRO A CD  1 
ATOM   987  N N   . GLN A 1 133 ? 37.341 71.339  38.469 1.00 40.07  ? 628 GLN A N   1 
ATOM   988  C CA  . GLN A 1 133 ? 36.116 72.089  38.224 1.00 41.34  ? 628 GLN A CA  1 
ATOM   989  C C   . GLN A 1 133 ? 36.008 73.386  39.024 1.00 43.64  ? 628 GLN A C   1 
ATOM   990  O O   . GLN A 1 133 ? 35.515 74.393  38.524 1.00 44.88  ? 628 GLN A O   1 
ATOM   991  C CB  . GLN A 1 133 ? 34.898 71.225  38.538 1.00 40.46  ? 628 GLN A CB  1 
ATOM   992  C CG  . GLN A 1 133 ? 33.600 71.862  38.098 1.00 38.38  ? 628 GLN A CG  1 
ATOM   993  C CD  . GLN A 1 133 ? 33.496 71.944  36.594 1.00 39.39  ? 628 GLN A CD  1 
ATOM   994  O OE1 . GLN A 1 133 ? 32.836 72.825  36.056 1.00 41.60  ? 628 GLN A OE1 1 
ATOM   995  N NE2 . GLN A 1 133 ? 34.138 71.007  35.903 1.00 39.71  ? 628 GLN A NE2 1 
ATOM   996  N N   . ARG A 1 134 ? 36.461 73.355  40.270 1.00 45.41  ? 629 ARG A N   1 
ATOM   997  C CA  . ARG A 1 134 ? 36.386 74.522  41.134 1.00 45.70  ? 629 ARG A CA  1 
ATOM   998  C C   . ARG A 1 134 ? 37.140 75.739  40.584 1.00 44.97  ? 629 ARG A C   1 
ATOM   999  O O   . ARG A 1 134 ? 36.991 76.851  41.097 1.00 46.27  ? 629 ARG A O   1 
ATOM   1000 C CB  . ARG A 1 134 ? 36.920 74.169  42.522 1.00 47.60  ? 629 ARG A CB  1 
ATOM   1001 C CG  . ARG A 1 134 ? 36.428 75.102  43.603 1.00 52.15  ? 629 ARG A CG  1 
ATOM   1002 C CD  . ARG A 1 134 ? 37.198 74.917  44.891 1.00 57.78  ? 629 ARG A CD  1 
ATOM   1003 N NE  . ARG A 1 134 ? 36.690 75.793  45.942 1.00 62.72  ? 629 ARG A NE  1 
ATOM   1004 C CZ  . ARG A 1 134 ? 37.398 76.165  47.005 1.00 65.23  ? 629 ARG A CZ  1 
ATOM   1005 N NH1 . ARG A 1 134 ? 38.648 75.738  47.156 1.00 64.00  ? 629 ARG A NH1 1 
ATOM   1006 N NH2 . ARG A 1 134 ? 36.861 76.971  47.915 1.00 67.74  ? 629 ARG A NH2 1 
ATOM   1007 N N   . MET A 1 135 ? 37.941 75.533  39.541 1.00 42.29  ? 630 MET A N   1 
ATOM   1008 C CA  . MET A 1 135 ? 38.719 76.619  38.946 1.00 40.15  ? 630 MET A CA  1 
ATOM   1009 C C   . MET A 1 135 ? 38.126 77.109  37.639 1.00 38.12  ? 630 MET A C   1 
ATOM   1010 O O   . MET A 1 135 ? 38.578 78.111  37.087 1.00 35.78  ? 630 MET A O   1 
ATOM   1011 C CB  . MET A 1 135 ? 40.157 76.164  38.672 1.00 42.28  ? 630 MET A CB  1 
ATOM   1012 C CG  . MET A 1 135 ? 41.026 75.966  39.899 1.00 45.21  ? 630 MET A CG  1 
ATOM   1013 S SD  . MET A 1 135 ? 42.667 75.338  39.478 1.00 45.45  ? 630 MET A SD  1 
ATOM   1014 C CE  . MET A 1 135 ? 43.504 76.829  39.045 1.00 45.86  ? 630 MET A CE  1 
ATOM   1015 N N   . SER A 1 136 ? 37.118 76.396  37.152 1.00 38.16  ? 631 SER A N   1 
ATOM   1016 C CA  . SER A 1 136 ? 36.473 76.718  35.885 1.00 40.42  ? 631 SER A CA  1 
ATOM   1017 C C   . SER A 1 136 ? 35.221 77.565  36.031 1.00 40.71  ? 631 SER A C   1 
ATOM   1018 O O   . SER A 1 136 ? 34.382 77.596  35.133 1.00 41.33  ? 631 SER A O   1 
ATOM   1019 C CB  . SER A 1 136 ? 36.107 75.424  35.157 1.00 41.04  ? 631 SER A CB  1 
ATOM   1020 O OG  . SER A 1 136 ? 37.226 74.561  35.064 1.00 42.97  ? 631 SER A OG  1 
ATOM   1021 N N   . ARG A 1 137 ? 35.097 78.266  37.148 1.00 42.51  ? 632 ARG A N   1 
ATOM   1022 C CA  . ARG A 1 137 ? 33.914 79.078  37.371 1.00 44.51  ? 632 ARG A CA  1 
ATOM   1023 C C   . ARG A 1 137 ? 33.708 80.180  36.333 1.00 41.71  ? 632 ARG A C   1 
ATOM   1024 O O   . ARG A 1 137 ? 32.567 80.496  35.991 1.00 41.11  ? 632 ARG A O   1 
ATOM   1025 C CB  . ARG A 1 137 ? 33.945 79.692  38.769 1.00 49.57  ? 632 ARG A CB  1 
ATOM   1026 C CG  . ARG A 1 137 ? 32.573 80.144  39.247 1.00 58.73  ? 632 ARG A CG  1 
ATOM   1027 C CD  . ARG A 1 137 ? 32.632 81.557  39.787 1.00 66.70  ? 632 ARG A CD  1 
ATOM   1028 N NE  . ARG A 1 137 ? 33.589 81.658  40.883 1.00 72.90  ? 632 ARG A NE  1 
ATOM   1029 C CZ  . ARG A 1 137 ? 34.111 82.801  41.316 1.00 74.71  ? 632 ARG A CZ  1 
ATOM   1030 N NH1 . ARG A 1 137 ? 33.772 83.954  40.743 1.00 75.80  ? 632 ARG A NH1 1 
ATOM   1031 N NH2 . ARG A 1 137 ? 34.968 82.792  42.330 1.00 76.31  ? 632 ARG A NH2 1 
ATOM   1032 N N   . ASN A 1 138 ? 34.798 80.753  35.828 1.00 37.96  ? 633 ASN A N   1 
ATOM   1033 C CA  . ASN A 1 138 ? 34.696 81.827  34.846 1.00 36.30  ? 633 ASN A CA  1 
ATOM   1034 C C   . ASN A 1 138 ? 35.213 81.476  33.461 1.00 35.30  ? 633 ASN A C   1 
ATOM   1035 O O   . ASN A 1 138 ? 35.533 82.372  32.671 1.00 33.43  ? 633 ASN A O   1 
ATOM   1036 C CB  . ASN A 1 138 ? 35.446 83.066  35.328 1.00 39.57  ? 633 ASN A CB  1 
ATOM   1037 C CG  . ASN A 1 138 ? 34.964 83.552  36.667 1.00 41.05  ? 633 ASN A CG  1 
ATOM   1038 O OD1 . ASN A 1 138 ? 33.760 83.603  36.926 1.00 42.67  ? 633 ASN A OD1 1 
ATOM   1039 N ND2 . ASN A 1 138 ? 35.904 83.924  37.533 1.00 43.88  ? 633 ASN A ND2 1 
ATOM   1040 N N   . PHE A 1 139 ? 35.284 80.186  33.156 1.00 33.94  ? 634 PHE A N   1 
ATOM   1041 C CA  . PHE A 1 139 ? 35.790 79.752  31.862 1.00 33.04  ? 634 PHE A CA  1 
ATOM   1042 C C   . PHE A 1 139 ? 35.057 80.393  30.688 1.00 31.93  ? 634 PHE A C   1 
ATOM   1043 O O   . PHE A 1 139 ? 35.660 81.090  29.871 1.00 30.62  ? 634 PHE A O   1 
ATOM   1044 C CB  . PHE A 1 139 ? 35.700 78.231  31.738 1.00 31.73  ? 634 PHE A CB  1 
ATOM   1045 C CG  . PHE A 1 139 ? 36.326 77.690  30.482 1.00 27.46  ? 634 PHE A CG  1 
ATOM   1046 C CD1 . PHE A 1 139 ? 37.706 77.742  30.299 1.00 27.70  ? 634 PHE A CD1 1 
ATOM   1047 C CD2 . PHE A 1 139 ? 35.539 77.124  29.485 1.00 25.39  ? 634 PHE A CD2 1 
ATOM   1048 C CE1 . PHE A 1 139 ? 38.296 77.241  29.135 1.00 26.97  ? 634 PHE A CE1 1 
ATOM   1049 C CE2 . PHE A 1 139 ? 36.117 76.619  28.316 1.00 25.76  ? 634 PHE A CE2 1 
ATOM   1050 C CZ  . PHE A 1 139 ? 37.500 76.675  28.143 1.00 25.89  ? 634 PHE A CZ  1 
ATOM   1051 N N   . VAL A 1 140 ? 33.756 80.151  30.607 1.00 32.51  ? 635 VAL A N   1 
ATOM   1052 C CA  . VAL A 1 140 ? 32.950 80.686  29.519 1.00 33.54  ? 635 VAL A CA  1 
ATOM   1053 C C   . VAL A 1 140 ? 32.986 82.209  29.491 1.00 34.38  ? 635 VAL A C   1 
ATOM   1054 O O   . VAL A 1 140 ? 33.012 82.808  28.414 1.00 33.84  ? 635 VAL A O   1 
ATOM   1055 C CB  . VAL A 1 140 ? 31.484 80.196  29.617 1.00 33.22  ? 635 VAL A CB  1 
ATOM   1056 C CG1 . VAL A 1 140 ? 30.654 80.812  28.503 1.00 33.19  ? 635 VAL A CG1 1 
ATOM   1057 C CG2 . VAL A 1 140 ? 31.437 78.673  29.514 1.00 31.21  ? 635 VAL A CG2 1 
ATOM   1058 N N   . ARG A 1 141 ? 32.997 82.834  30.669 1.00 35.29  ? 636 ARG A N   1 
ATOM   1059 C CA  . ARG A 1 141 ? 33.046 84.289  30.750 1.00 34.51  ? 636 ARG A CA  1 
ATOM   1060 C C   . ARG A 1 141 ? 34.297 84.797  30.032 1.00 35.48  ? 636 ARG A C   1 
ATOM   1061 O O   . ARG A 1 141 ? 34.220 85.707  29.207 1.00 37.21  ? 636 ARG A O   1 
ATOM   1062 C CB  . ARG A 1 141 ? 33.056 84.749  32.212 1.00 35.86  ? 636 ARG A CB  1 
ATOM   1063 C CG  . ARG A 1 141 ? 32.813 86.249  32.376 1.00 36.49  ? 636 ARG A CG  1 
ATOM   1064 C CD  . ARG A 1 141 ? 34.018 87.010  32.947 1.00 37.96  ? 636 ARG A CD  1 
ATOM   1065 N NE  . ARG A 1 141 ? 34.102 87.090  34.413 1.00 38.55  ? 636 ARG A NE  1 
ATOM   1066 C CZ  . ARG A 1 141 ? 33.090 86.927  35.266 1.00 39.38  ? 636 ARG A CZ  1 
ATOM   1067 N NH1 . ARG A 1 141 ? 31.865 86.651  34.835 1.00 42.27  ? 636 ARG A NH1 1 
ATOM   1068 N NH2 . ARG A 1 141 ? 33.294 87.079  36.568 1.00 37.82  ? 636 ARG A NH2 1 
ATOM   1069 N N   . TYR A 1 142 ? 35.447 84.196  30.333 1.00 35.37  ? 637 TYR A N   1 
ATOM   1070 C CA  . TYR A 1 142 ? 36.702 84.601  29.701 1.00 34.14  ? 637 TYR A CA  1 
ATOM   1071 C C   . TYR A 1 142 ? 36.725 84.285  28.208 1.00 34.38  ? 637 TYR A C   1 
ATOM   1072 O O   . TYR A 1 142 ? 37.184 85.107  27.417 1.00 34.77  ? 637 TYR A O   1 
ATOM   1073 C CB  . TYR A 1 142 ? 37.904 83.923  30.370 1.00 33.35  ? 637 TYR A CB  1 
ATOM   1074 C CG  . TYR A 1 142 ? 38.082 84.238  31.845 1.00 33.41  ? 637 TYR A CG  1 
ATOM   1075 C CD1 . TYR A 1 142 ? 37.902 85.535  32.336 1.00 31.65  ? 637 TYR A CD1 1 
ATOM   1076 C CD2 . TYR A 1 142 ? 38.450 83.240  32.747 1.00 31.16  ? 637 TYR A CD2 1 
ATOM   1077 C CE1 . TYR A 1 142 ? 38.084 85.824  33.687 1.00 31.60  ? 637 TYR A CE1 1 
ATOM   1078 C CE2 . TYR A 1 142 ? 38.634 83.518  34.095 1.00 31.28  ? 637 TYR A CE2 1 
ATOM   1079 C CZ  . TYR A 1 142 ? 38.450 84.809  34.560 1.00 31.82  ? 637 TYR A CZ  1 
ATOM   1080 O OH  . TYR A 1 142 ? 38.646 85.076  35.896 1.00 31.47  ? 637 TYR A OH  1 
ATOM   1081 N N   . VAL A 1 143 ? 36.245 83.099  27.823 1.00 34.92  ? 638 VAL A N   1 
ATOM   1082 C CA  . VAL A 1 143 ? 36.216 82.699  26.411 1.00 35.41  ? 638 VAL A CA  1 
ATOM   1083 C C   . VAL A 1 143 ? 35.357 83.675  25.616 1.00 37.19  ? 638 VAL A C   1 
ATOM   1084 O O   . VAL A 1 143 ? 35.681 84.032  24.483 1.00 35.48  ? 638 VAL A O   1 
ATOM   1085 C CB  . VAL A 1 143 ? 35.626 81.284  26.228 1.00 35.37  ? 638 VAL A CB  1 
ATOM   1086 C CG1 . VAL A 1 143 ? 35.692 80.879  24.758 1.00 31.85  ? 638 VAL A CG1 1 
ATOM   1087 C CG2 . VAL A 1 143 ? 36.376 80.287  27.096 1.00 34.27  ? 638 VAL A CG2 1 
ATOM   1088 N N   . GLN A 1 144 ? 34.250 84.089  26.227 1.00 40.57  ? 639 GLN A N   1 
ATOM   1089 C CA  . GLN A 1 144 ? 33.323 85.040  25.622 1.00 42.83  ? 639 GLN A CA  1 
ATOM   1090 C C   . GLN A 1 144 ? 34.018 86.385  25.456 1.00 42.28  ? 639 GLN A C   1 
ATOM   1091 O O   . GLN A 1 144 ? 33.872 87.051  24.431 1.00 39.55  ? 639 GLN A O   1 
ATOM   1092 C CB  . GLN A 1 144 ? 32.088 85.213  26.511 1.00 47.03  ? 639 GLN A CB  1 
ATOM   1093 C CG  . GLN A 1 144 ? 30.999 84.185  26.275 1.00 52.12  ? 639 GLN A CG  1 
ATOM   1094 C CD  . GLN A 1 144 ? 30.543 84.167  24.829 1.00 58.56  ? 639 GLN A CD  1 
ATOM   1095 O OE1 . GLN A 1 144 ? 30.189 85.206  24.259 1.00 61.03  ? 639 GLN A OE1 1 
ATOM   1096 N NE2 . GLN A 1 144 ? 30.548 82.984  24.222 1.00 61.09  ? 639 GLN A NE2 1 
ATOM   1097 N N   . GLY A 1 145 ? 34.765 86.778  26.485 1.00 42.42  ? 640 GLY A N   1 
ATOM   1098 C CA  . GLY A 1 145 ? 35.495 88.029  26.443 1.00 41.38  ? 640 GLY A CA  1 
ATOM   1099 C C   . GLY A 1 145 ? 36.440 88.039  25.258 1.00 40.90  ? 640 GLY A C   1 
ATOM   1100 O O   . GLY A 1 145 ? 36.515 89.031  24.529 1.00 40.55  ? 640 GLY A O   1 
ATOM   1101 N N   . LEU A 1 146 ? 37.169 86.942  25.060 1.00 39.47  ? 641 LEU A N   1 
ATOM   1102 C CA  . LEU A 1 146 ? 38.096 86.856  23.936 1.00 39.78  ? 641 LEU A CA  1 
ATOM   1103 C C   . LEU A 1 146 ? 37.349 87.100  22.633 1.00 39.21  ? 641 LEU A C   1 
ATOM   1104 O O   . LEU A 1 146 ? 37.870 87.732  21.715 1.00 38.26  ? 641 LEU A O   1 
ATOM   1105 C CB  . LEU A 1 146 ? 38.778 85.485  23.872 1.00 38.70  ? 641 LEU A CB  1 
ATOM   1106 C CG  . LEU A 1 146 ? 40.115 85.298  24.602 1.00 38.38  ? 641 LEU A CG  1 
ATOM   1107 C CD1 . LEU A 1 146 ? 40.811 86.642  24.780 1.00 35.02  ? 641 LEU A CD1 1 
ATOM   1108 C CD2 . LEU A 1 146 ? 39.880 84.656  25.945 1.00 37.83  ? 641 LEU A CD2 1 
ATOM   1109 N N   . LYS A 1 147 ? 36.124 86.595  22.561 1.00 39.05  ? 642 LYS A N   1 
ATOM   1110 C CA  . LYS A 1 147 ? 35.305 86.762  21.373 1.00 38.41  ? 642 LYS A CA  1 
ATOM   1111 C C   . LYS A 1 147 ? 35.003 88.238  21.132 1.00 38.69  ? 642 LYS A C   1 
ATOM   1112 O O   . LYS A 1 147 ? 35.211 88.748  20.033 1.00 38.20  ? 642 LYS A O   1 
ATOM   1113 C CB  . LYS A 1 147 ? 33.999 85.989  21.528 1.00 38.48  ? 642 LYS A CB  1 
ATOM   1114 C CG  . LYS A 1 147 ? 33.180 85.882  20.255 1.00 33.15  ? 642 LYS A CG  1 
ATOM   1115 C CD  . LYS A 1 147 ? 31.884 85.152  20.540 1.00 36.20  ? 642 LYS A CD  1 
ATOM   1116 C CE  . LYS A 1 147 ? 31.038 84.960  19.294 1.00 35.15  ? 642 LYS A CE  1 
ATOM   1117 N NZ  . LYS A 1 147 ? 29.714 84.418  19.673 1.00 35.20  ? 642 LYS A NZ  1 
ATOM   1118 N N   . LYS A 1 148 ? 34.509 88.918  22.162 1.00 39.05  ? 643 LYS A N   1 
ATOM   1119 C CA  . LYS A 1 148 ? 34.177 90.330  22.042 1.00 42.00  ? 643 LYS A CA  1 
ATOM   1120 C C   . LYS A 1 148 ? 35.359 91.132  21.505 1.00 42.61  ? 643 LYS A C   1 
ATOM   1121 O O   . LYS A 1 148 ? 35.180 92.219  20.945 1.00 44.84  ? 643 LYS A O   1 
ATOM   1122 C CB  . LYS A 1 148 ? 33.732 90.894  23.396 1.00 43.95  ? 643 LYS A CB  1 
ATOM   1123 C CG  . LYS A 1 148 ? 32.409 90.321  23.904 1.00 49.58  ? 643 LYS A CG  1 
ATOM   1124 C CD  . LYS A 1 148 ? 32.151 90.686  25.367 1.00 52.73  ? 643 LYS A CD  1 
ATOM   1125 C CE  . LYS A 1 148 ? 31.003 89.866  25.961 1.00 54.79  ? 643 LYS A CE  1 
ATOM   1126 N NZ  . LYS A 1 148 ? 30.910 89.995  27.451 1.00 53.31  ? 643 LYS A NZ  1 
ATOM   1127 N N   . LYS A 1 149 ? 36.566 90.596  21.665 1.00 41.22  ? 644 LYS A N   1 
ATOM   1128 C CA  . LYS A 1 149 ? 37.761 91.277  21.182 1.00 40.52  ? 644 LYS A CA  1 
ATOM   1129 C C   . LYS A 1 149 ? 38.343 90.667  19.912 1.00 40.43  ? 644 LYS A C   1 
ATOM   1130 O O   . LYS A 1 149 ? 39.532 90.822  19.633 1.00 37.86  ? 644 LYS A O   1 
ATOM   1131 C CB  . LYS A 1 149 ? 38.831 91.310  22.270 1.00 40.24  ? 644 LYS A CB  1 
ATOM   1132 C CG  . LYS A 1 149 ? 38.496 92.240  23.404 1.00 41.05  ? 644 LYS A CG  1 
ATOM   1133 C CD  . LYS A 1 149 ? 39.663 92.411  24.333 1.00 41.82  ? 644 LYS A CD  1 
ATOM   1134 C CE  . LYS A 1 149 ? 39.310 93.386  25.436 1.00 47.97  ? 644 LYS A CE  1 
ATOM   1135 N NZ  . LYS A 1 149 ? 40.392 93.480  26.457 1.00 53.39  ? 644 LYS A NZ  1 
ATOM   1136 N N   . LYS A 1 150 ? 37.501 89.985  19.142 1.00 41.33  ? 645 LYS A N   1 
ATOM   1137 C CA  . LYS A 1 150 ? 37.933 89.363  17.896 1.00 42.61  ? 645 LYS A CA  1 
ATOM   1138 C C   . LYS A 1 150 ? 39.149 88.447  18.043 1.00 42.24  ? 645 LYS A C   1 
ATOM   1139 O O   . LYS A 1 150 ? 40.075 88.500  17.231 1.00 42.64  ? 645 LYS A O   1 
ATOM   1140 C CB  . LYS A 1 150 ? 38.234 90.442  16.848 1.00 44.23  ? 645 LYS A CB  1 
ATOM   1141 C CG  . LYS A 1 150 ? 37.008 90.959  16.112 1.00 49.05  ? 645 LYS A CG  1 
ATOM   1142 C CD  . LYS A 1 150 ? 36.018 91.633  17.051 1.00 52.08  ? 645 LYS A CD  1 
ATOM   1143 C CE  . LYS A 1 150 ? 34.663 91.822  16.376 1.00 53.63  ? 645 LYS A CE  1 
ATOM   1144 N NZ  . LYS A 1 150 ? 33.657 92.384  17.318 1.00 55.05  ? 645 LYS A NZ  1 
ATOM   1145 N N   . VAL A 1 151 ? 39.151 87.614  19.079 1.00 40.25  ? 646 VAL A N   1 
ATOM   1146 C CA  . VAL A 1 151 ? 40.249 86.678  19.289 1.00 38.11  ? 646 VAL A CA  1 
ATOM   1147 C C   . VAL A 1 151 ? 39.697 85.268  19.128 1.00 38.90  ? 646 VAL A C   1 
ATOM   1148 O O   . VAL A 1 151 ? 38.820 84.849  19.881 1.00 40.16  ? 646 VAL A O   1 
ATOM   1149 C CB  . VAL A 1 151 ? 40.869 86.807  20.699 1.00 37.90  ? 646 VAL A CB  1 
ATOM   1150 C CG1 . VAL A 1 151 ? 41.977 85.774  20.866 1.00 36.42  ? 646 VAL A CG1 1 
ATOM   1151 C CG2 . VAL A 1 151 ? 41.424 88.208  20.914 1.00 35.91  ? 646 VAL A CG2 1 
ATOM   1152 N N   . ILE A 1 152 ? 40.209 84.552  18.132 1.00 38.87  ? 647 ILE A N   1 
ATOM   1153 C CA  . ILE A 1 152 ? 39.783 83.189  17.837 1.00 37.03  ? 647 ILE A CA  1 
ATOM   1154 C C   . ILE A 1 152 ? 40.572 82.190  18.687 1.00 36.52  ? 647 ILE A C   1 
ATOM   1155 O O   . ILE A 1 152 ? 41.804 82.222  18.704 1.00 37.20  ? 647 ILE A O   1 
ATOM   1156 C CB  . ILE A 1 152 ? 40.024 82.887  16.356 1.00 37.20  ? 647 ILE A CB  1 
ATOM   1157 C CG1 . ILE A 1 152 ? 39.386 83.982  15.502 1.00 39.87  ? 647 ILE A CG1 1 
ATOM   1158 C CG2 . ILE A 1 152 ? 39.464 81.529  15.999 1.00 37.80  ? 647 ILE A CG2 1 
ATOM   1159 C CD1 . ILE A 1 152 ? 39.710 83.885  14.020 1.00 40.11  ? 647 ILE A CD1 1 
ATOM   1160 N N   . VAL A 1 153 ? 39.866 81.306  19.389 1.00 33.52  ? 648 VAL A N   1 
ATOM   1161 C CA  . VAL A 1 153 ? 40.527 80.320  20.246 1.00 33.22  ? 648 VAL A CA  1 
ATOM   1162 C C   . VAL A 1 153 ? 40.484 78.930  19.628 1.00 32.53  ? 648 VAL A C   1 
ATOM   1163 O O   . VAL A 1 153 ? 39.411 78.359  19.453 1.00 34.39  ? 648 VAL A O   1 
ATOM   1164 C CB  . VAL A 1 153 ? 39.866 80.269  21.656 1.00 32.10  ? 648 VAL A CB  1 
ATOM   1165 C CG1 . VAL A 1 153 ? 40.538 79.221  22.522 1.00 29.20  ? 648 VAL A CG1 1 
ATOM   1166 C CG2 . VAL A 1 153 ? 39.968 81.623  22.320 1.00 31.06  ? 648 VAL A CG2 1 
ATOM   1167 N N   . ILE A 1 154 ? 41.653 78.383  19.309 1.00 31.47  ? 649 ILE A N   1 
ATOM   1168 C CA  . ILE A 1 154 ? 41.733 77.060  18.695 1.00 30.84  ? 649 ILE A CA  1 
ATOM   1169 C C   . ILE A 1 154 ? 42.299 76.010  19.650 1.00 32.84  ? 649 ILE A C   1 
ATOM   1170 O O   . ILE A 1 154 ? 43.509 75.933  19.867 1.00 33.80  ? 649 ILE A O   1 
ATOM   1171 C CB  . ILE A 1 154 ? 42.581 77.123  17.410 1.00 30.37  ? 649 ILE A CB  1 
ATOM   1172 C CG1 . ILE A 1 154 ? 41.944 78.140  16.452 1.00 29.04  ? 649 ILE A CG1 1 
ATOM   1173 C CG2 . ILE A 1 154 ? 42.699 75.733  16.771 1.00 25.31  ? 649 ILE A CG2 1 
ATOM   1174 C CD1 . ILE A 1 154 ? 42.703 78.374  15.175 1.00 31.80  ? 649 ILE A CD1 1 
ATOM   1175 N N   . PRO A 1 155 ? 41.421 75.169  20.224 1.00 33.68  ? 650 PRO A N   1 
ATOM   1176 C CA  . PRO A 1 155 ? 41.871 74.135  21.156 1.00 32.58  ? 650 PRO A CA  1 
ATOM   1177 C C   . PRO A 1 155 ? 42.532 72.983  20.423 1.00 34.30  ? 650 PRO A C   1 
ATOM   1178 O O   . PRO A 1 155 ? 42.086 72.571  19.344 1.00 34.39  ? 650 PRO A O   1 
ATOM   1179 C CB  . PRO A 1 155 ? 40.579 73.674  21.839 1.00 31.42  ? 650 PRO A CB  1 
ATOM   1180 C CG  . PRO A 1 155 ? 39.476 74.545  21.248 1.00 32.95  ? 650 PRO A CG  1 
ATOM   1181 C CD  . PRO A 1 155 ? 39.993 74.994  19.927 1.00 32.17  ? 650 PRO A CD  1 
ATOM   1182 N N   . VAL A 1 156 ? 43.602 72.473  21.017 1.00 33.72  ? 651 VAL A N   1 
ATOM   1183 C CA  . VAL A 1 156 ? 44.319 71.339  20.461 1.00 31.86  ? 651 VAL A CA  1 
ATOM   1184 C C   . VAL A 1 156 ? 44.473 70.316  21.576 1.00 31.11  ? 651 VAL A C   1 
ATOM   1185 O O   . VAL A 1 156 ? 45.425 70.354  22.356 1.00 30.57  ? 651 VAL A O   1 
ATOM   1186 C CB  . VAL A 1 156 ? 45.697 71.748  19.931 1.00 31.52  ? 651 VAL A CB  1 
ATOM   1187 C CG1 . VAL A 1 156 ? 46.411 70.536  19.352 1.00 32.01  ? 651 VAL A CG1 1 
ATOM   1188 C CG2 . VAL A 1 156 ? 45.540 72.812  18.870 1.00 28.75  ? 651 VAL A CG2 1 
ATOM   1189 N N   . GLY A 1 157 ? 43.501 69.418  21.657 1.00 30.63  ? 652 GLY A N   1 
ATOM   1190 C CA  . GLY A 1 157 ? 43.534 68.396  22.677 1.00 31.65  ? 652 GLY A CA  1 
ATOM   1191 C C   . GLY A 1 157 ? 44.627 67.395  22.396 1.00 30.87  ? 652 GLY A C   1 
ATOM   1192 O O   . GLY A 1 157 ? 44.685 66.826  21.313 1.00 33.34  ? 652 GLY A O   1 
ATOM   1193 N N   . ILE A 1 158 ? 45.497 67.177  23.371 1.00 29.94  ? 653 ILE A N   1 
ATOM   1194 C CA  . ILE A 1 158 ? 46.586 66.232  23.207 1.00 29.84  ? 653 ILE A CA  1 
ATOM   1195 C C   . ILE A 1 158 ? 46.466 65.126  24.234 1.00 29.66  ? 653 ILE A C   1 
ATOM   1196 O O   . ILE A 1 158 ? 46.540 65.376  25.437 1.00 27.99  ? 653 ILE A O   1 
ATOM   1197 C CB  . ILE A 1 158 ? 47.945 66.928  23.379 1.00 30.39  ? 653 ILE A CB  1 
ATOM   1198 C CG1 . ILE A 1 158 ? 48.118 67.979  22.278 1.00 31.11  ? 653 ILE A CG1 1 
ATOM   1199 C CG2 . ILE A 1 158 ? 49.073 65.897  23.370 1.00 29.36  ? 653 ILE A CG2 1 
ATOM   1200 C CD1 . ILE A 1 158 ? 49.408 68.778  22.373 1.00 31.06  ? 653 ILE A CD1 1 
ATOM   1201 N N   . GLY A 1 159 ? 46.273 63.903  23.757 1.00 29.85  ? 654 GLY A N   1 
ATOM   1202 C CA  . GLY A 1 159 ? 46.158 62.782  24.669 1.00 31.41  ? 654 GLY A CA  1 
ATOM   1203 C C   . GLY A 1 159 ? 44.768 62.555  25.230 1.00 30.69  ? 654 GLY A C   1 
ATOM   1204 O O   . GLY A 1 159 ? 43.841 63.314  24.954 1.00 30.28  ? 654 GLY A O   1 
ATOM   1205 N N   . PRO A 1 160 ? 44.608 61.520  26.061 1.00 32.59  ? 655 PRO A N   1 
ATOM   1206 C CA  . PRO A 1 160 ? 43.346 61.129  26.695 1.00 33.43  ? 655 PRO A CA  1 
ATOM   1207 C C   . PRO A 1 160 ? 42.857 61.992  27.844 1.00 33.89  ? 655 PRO A C   1 
ATOM   1208 O O   . PRO A 1 160 ? 41.714 61.877  28.262 1.00 34.68  ? 655 PRO A O   1 
ATOM   1209 C CB  . PRO A 1 160 ? 43.633 59.708  27.149 1.00 31.31  ? 655 PRO A CB  1 
ATOM   1210 C CG  . PRO A 1 160 ? 45.055 59.815  27.587 1.00 30.61  ? 655 PRO A CG  1 
ATOM   1211 C CD  . PRO A 1 160 ? 45.700 60.623  26.488 1.00 31.75  ? 655 PRO A CD  1 
ATOM   1212 N N   . HIS A 1 161 ? 43.707 62.863  28.357 1.00 35.86  ? 656 HIS A N   1 
ATOM   1213 C CA  . HIS A 1 161 ? 43.285 63.669  29.484 1.00 38.15  ? 656 HIS A CA  1 
ATOM   1214 C C   . HIS A 1 161 ? 42.972 65.120  29.182 1.00 38.73  ? 656 HIS A C   1 
ATOM   1215 O O   . HIS A 1 161 ? 42.916 65.945  30.094 1.00 39.88  ? 656 HIS A O   1 
ATOM   1216 C CB  . HIS A 1 161 ? 44.326 63.560  30.583 1.00 40.69  ? 656 HIS A CB  1 
ATOM   1217 C CG  . HIS A 1 161 ? 44.527 62.159  31.058 1.00 45.32  ? 656 HIS A CG  1 
ATOM   1218 N ND1 . HIS A 1 161 ? 43.523 61.430  31.660 1.00 46.12  ? 656 HIS A ND1 1 
ATOM   1219 C CD2 . HIS A 1 161 ? 45.606 61.343  31.005 1.00 44.93  ? 656 HIS A CD2 1 
ATOM   1220 C CE1 . HIS A 1 161 ? 43.976 60.226  31.959 1.00 47.23  ? 656 HIS A CE1 1 
ATOM   1221 N NE2 . HIS A 1 161 ? 45.238 60.149  31.572 1.00 47.82  ? 656 HIS A NE2 1 
ATOM   1222 N N   . ALA A 1 162 ? 42.752 65.427  27.907 1.00 36.69  ? 657 ALA A N   1 
ATOM   1223 C CA  . ALA A 1 162 ? 42.419 66.783  27.505 1.00 34.29  ? 657 ALA A CA  1 
ATOM   1224 C C   . ALA A 1 162 ? 40.974 67.095  27.902 1.00 33.31  ? 657 ALA A C   1 
ATOM   1225 O O   . ALA A 1 162 ? 40.069 66.311  27.630 1.00 31.70  ? 657 ALA A O   1 
ATOM   1226 C CB  . ALA A 1 162 ? 42.600 66.938  26.003 1.00 33.32  ? 657 ALA A CB  1 
ATOM   1227 N N   . ASN A 1 163 ? 40.776 68.243  28.548 1.00 33.57  ? 658 ASN A N   1 
ATOM   1228 C CA  . ASN A 1 163 ? 39.460 68.693  29.005 1.00 35.44  ? 658 ASN A CA  1 
ATOM   1229 C C   . ASN A 1 163 ? 38.472 68.786  27.834 1.00 37.43  ? 658 ASN A C   1 
ATOM   1230 O O   . ASN A 1 163 ? 38.216 69.869  27.310 1.00 38.90  ? 658 ASN A O   1 
ATOM   1231 C CB  . ASN A 1 163 ? 39.602 70.063  29.675 1.00 34.25  ? 658 ASN A CB  1 
ATOM   1232 C CG  . ASN A 1 163 ? 38.450 70.388  30.610 1.00 37.13  ? 658 ASN A CG  1 
ATOM   1233 O OD1 . ASN A 1 163 ? 37.297 70.039  30.347 1.00 37.92  ? 658 ASN A OD1 1 
ATOM   1234 N ND2 . ASN A 1 163 ? 38.757 71.080  31.706 1.00 36.48  ? 658 ASN A ND2 1 
ATOM   1235 N N   . LEU A 1 164 ? 37.910 67.648  27.438 1.00 37.83  ? 659 LEU A N   1 
ATOM   1236 C CA  . LEU A 1 164 ? 36.980 67.601  26.319 1.00 36.52  ? 659 LEU A CA  1 
ATOM   1237 C C   . LEU A 1 164 ? 35.731 68.442  26.516 1.00 36.79  ? 659 LEU A C   1 
ATOM   1238 O O   . LEU A 1 164 ? 35.153 68.933  25.547 1.00 39.09  ? 659 LEU A O   1 
ATOM   1239 C CB  . LEU A 1 164 ? 36.572 66.157  26.028 1.00 38.08  ? 659 LEU A CB  1 
ATOM   1240 C CG  . LEU A 1 164 ? 37.656 65.232  25.472 1.00 38.70  ? 659 LEU A CG  1 
ATOM   1241 C CD1 . LEU A 1 164 ? 37.112 63.820  25.394 1.00 38.02  ? 659 LEU A CD1 1 
ATOM   1242 C CD2 . LEU A 1 164 ? 38.113 65.718  24.104 1.00 37.79  ? 659 LEU A CD2 1 
ATOM   1243 N N   . LYS A 1 165 ? 35.303 68.616  27.759 1.00 35.98  ? 660 LYS A N   1 
ATOM   1244 C CA  . LYS A 1 165 ? 34.111 69.414  27.995 1.00 34.82  ? 660 LYS A CA  1 
ATOM   1245 C C   . LYS A 1 165 ? 34.413 70.856  27.610 1.00 33.90  ? 660 LYS A C   1 
ATOM   1246 O O   . LYS A 1 165 ? 33.596 71.516  26.971 1.00 33.76  ? 660 LYS A O   1 
ATOM   1247 C CB  . LYS A 1 165 ? 33.676 69.323  29.464 1.00 34.95  ? 660 LYS A CB  1 
ATOM   1248 C CG  . LYS A 1 165 ? 32.253 69.811  29.696 1.00 36.00  ? 660 LYS A CG  1 
ATOM   1249 C CD  . LYS A 1 165 ? 31.723 69.460  31.077 1.00 36.47  ? 660 LYS A CD  1 
ATOM   1250 C CE  . LYS A 1 165 ? 32.320 70.338  32.156 1.00 36.34  ? 660 LYS A CE  1 
ATOM   1251 N NZ  . LYS A 1 165 ? 31.725 70.022  33.487 1.00 36.49  ? 660 LYS A NZ  1 
ATOM   1252 N N   . GLN A 1 166 ? 35.600 71.331  27.985 1.00 33.17  ? 661 GLN A N   1 
ATOM   1253 C CA  . GLN A 1 166 ? 36.014 72.694  27.675 1.00 32.56  ? 661 GLN A CA  1 
ATOM   1254 C C   . GLN A 1 166 ? 36.287 72.898  26.188 1.00 32.45  ? 661 GLN A C   1 
ATOM   1255 O O   . GLN A 1 166 ? 36.000 73.968  25.645 1.00 30.16  ? 661 GLN A O   1 
ATOM   1256 C CB  . GLN A 1 166 ? 37.251 73.077  28.491 1.00 31.24  ? 661 GLN A CB  1 
ATOM   1257 C CG  . GLN A 1 166 ? 36.931 73.478  29.928 1.00 29.93  ? 661 GLN A CG  1 
ATOM   1258 C CD  . GLN A 1 166 ? 38.127 74.059  30.655 1.00 28.26  ? 661 GLN A CD  1 
ATOM   1259 O OE1 . GLN A 1 166 ? 38.012 74.533  31.780 1.00 29.56  ? 661 GLN A OE1 1 
ATOM   1260 N NE2 . GLN A 1 166 ? 39.281 74.023  30.015 1.00 29.68  ? 661 GLN A NE2 1 
ATOM   1261 N N   . ILE A 1 167 ? 36.841 71.878  25.533 1.00 32.31  ? 662 ILE A N   1 
ATOM   1262 C CA  . ILE A 1 167 ? 37.125 71.967  24.102 1.00 32.48  ? 662 ILE A CA  1 
ATOM   1263 C C   . ILE A 1 167 ? 35.813 72.134  23.352 1.00 33.20  ? 662 ILE A C   1 
ATOM   1264 O O   . ILE A 1 167 ? 35.717 72.922  22.409 1.00 32.26  ? 662 ILE A O   1 
ATOM   1265 C CB  . ILE A 1 167 ? 37.848 70.704  23.575 1.00 31.36  ? 662 ILE A CB  1 
ATOM   1266 C CG1 . ILE A 1 167 ? 39.329 70.763  23.951 1.00 31.63  ? 662 ILE A CG1 1 
ATOM   1267 C CG2 . ILE A 1 167 ? 37.694 70.601  22.056 1.00 27.94  ? 662 ILE A CG2 1 
ATOM   1268 C CD1 . ILE A 1 167 ? 40.138 69.575  23.448 1.00 31.28  ? 662 ILE A CD1 1 
ATOM   1269 N N   . ARG A 1 168 ? 34.802 71.381  23.773 1.00 34.32  ? 663 ARG A N   1 
ATOM   1270 C CA  . ARG A 1 168 ? 33.491 71.467  23.151 1.00 35.06  ? 663 ARG A CA  1 
ATOM   1271 C C   . ARG A 1 168 ? 32.949 72.868  23.408 1.00 33.30  ? 663 ARG A C   1 
ATOM   1272 O O   . ARG A 1 168 ? 32.556 73.568  22.475 1.00 30.20  ? 663 ARG A O   1 
ATOM   1273 C CB  . ARG A 1 168 ? 32.550 70.401  23.741 1.00 40.59  ? 663 ARG A CB  1 
ATOM   1274 C CG  . ARG A 1 168 ? 31.108 70.430  23.201 1.00 48.25  ? 663 ARG A CG  1 
ATOM   1275 C CD  . ARG A 1 168 ? 30.191 71.354  24.024 1.00 52.38  ? 663 ARG A CD  1 
ATOM   1276 N NE  . ARG A 1 168 ? 28.989 71.748  23.285 1.00 56.00  ? 663 ARG A NE  1 
ATOM   1277 C CZ  . ARG A 1 168 ? 28.006 72.497  23.786 1.00 58.29  ? 663 ARG A CZ  1 
ATOM   1278 N NH1 . ARG A 1 168 ? 26.962 72.818  23.028 1.00 56.56  ? 663 ARG A NH1 1 
ATOM   1279 N NH2 . ARG A 1 168 ? 28.067 72.938  25.040 1.00 58.37  ? 663 ARG A NH2 1 
ATOM   1280 N N   . LEU A 1 169 ? 32.961 73.274  24.679 1.00 32.92  ? 664 LEU A N   1 
ATOM   1281 C CA  . LEU A 1 169 ? 32.474 74.586  25.092 1.00 33.54  ? 664 LEU A CA  1 
ATOM   1282 C C   . LEU A 1 169 ? 33.160 75.732  24.360 1.00 35.03  ? 664 LEU A C   1 
ATOM   1283 O O   . LEU A 1 169 ? 32.608 76.821  24.268 1.00 35.88  ? 664 LEU A O   1 
ATOM   1284 C CB  . LEU A 1 169 ? 32.648 74.779  26.605 1.00 32.75  ? 664 LEU A CB  1 
ATOM   1285 C CG  . LEU A 1 169 ? 31.660 74.095  27.563 1.00 33.27  ? 664 LEU A CG  1 
ATOM   1286 C CD1 . LEU A 1 169 ? 32.074 74.343  29.021 1.00 29.41  ? 664 LEU A CD1 1 
ATOM   1287 C CD2 . LEU A 1 169 ? 30.249 74.620  27.305 1.00 31.45  ? 664 LEU A CD2 1 
ATOM   1288 N N   . ILE A 1 170 ? 34.365 75.503  23.850 1.00 37.83  ? 665 ILE A N   1 
ATOM   1289 C CA  . ILE A 1 170 ? 35.069 76.554  23.125 1.00 40.23  ? 665 ILE A CA  1 
ATOM   1290 C C   . ILE A 1 170 ? 34.595 76.592  21.674 1.00 43.14  ? 665 ILE A C   1 
ATOM   1291 O O   . ILE A 1 170 ? 34.298 77.664  21.139 1.00 44.15  ? 665 ILE A O   1 
ATOM   1292 C CB  . ILE A 1 170 ? 36.605 76.356  23.174 1.00 38.86  ? 665 ILE A CB  1 
ATOM   1293 C CG1 . ILE A 1 170 ? 37.116 76.631  24.595 1.00 33.75  ? 665 ILE A CG1 1 
ATOM   1294 C CG2 . ILE A 1 170 ? 37.290 77.290  22.167 1.00 35.38  ? 665 ILE A CG2 1 
ATOM   1295 C CD1 . ILE A 1 170 ? 38.600 76.422  24.756 1.00 31.20  ? 665 ILE A CD1 1 
ATOM   1296 N N   . GLU A 1 171 ? 34.518 75.424  21.043 1.00 45.22  ? 666 GLU A N   1 
ATOM   1297 C CA  . GLU A 1 171 ? 34.051 75.344  19.662 1.00 46.89  ? 666 GLU A CA  1 
ATOM   1298 C C   . GLU A 1 171 ? 32.676 75.996  19.569 1.00 46.80  ? 666 GLU A C   1 
ATOM   1299 O O   . GLU A 1 171 ? 32.337 76.633  18.575 1.00 46.83  ? 666 GLU A O   1 
ATOM   1300 C CB  . GLU A 1 171 ? 33.933 73.884  19.210 1.00 49.00  ? 666 GLU A CB  1 
ATOM   1301 C CG  . GLU A 1 171 ? 35.261 73.160  19.012 1.00 50.77  ? 666 GLU A CG  1 
ATOM   1302 C CD  . GLU A 1 171 ? 35.097 71.831  18.288 1.00 51.41  ? 666 GLU A CD  1 
ATOM   1303 O OE1 . GLU A 1 171 ? 34.504 70.901  18.880 1.00 51.70  ? 666 GLU A OE1 1 
ATOM   1304 O OE2 . GLU A 1 171 ? 35.556 71.723  17.126 1.00 49.46  ? 666 GLU A OE2 1 
ATOM   1305 N N   . LYS A 1 172 ? 31.900 75.837  20.634 1.00 47.21  ? 667 LYS A N   1 
ATOM   1306 C CA  . LYS A 1 172 ? 30.547 76.360  20.713 1.00 47.39  ? 667 LYS A CA  1 
ATOM   1307 C C   . LYS A 1 172 ? 30.423 77.883  20.800 1.00 47.07  ? 667 LYS A C   1 
ATOM   1308 O O   . LYS A 1 172 ? 29.572 78.464  20.135 1.00 48.62  ? 667 LYS A O   1 
ATOM   1309 C CB  . LYS A 1 172 ? 29.837 75.717  21.911 1.00 47.96  ? 667 LYS A CB  1 
ATOM   1310 C CG  . LYS A 1 172 ? 28.431 76.230  22.193 1.00 50.82  ? 667 LYS A CG  1 
ATOM   1311 C CD  . LYS A 1 172 ? 27.417 75.740  21.168 1.00 53.58  ? 667 LYS A CD  1 
ATOM   1312 C CE  . LYS A 1 172 ? 26.019 76.253  21.501 1.00 54.59  ? 667 LYS A CE  1 
ATOM   1313 N NZ  . LYS A 1 172 ? 24.977 75.789  20.542 1.00 54.55  ? 667 LYS A NZ  1 
ATOM   1314 N N   . GLN A 1 173 ? 31.264 78.531  21.602 1.00 46.28  ? 668 GLN A N   1 
ATOM   1315 C CA  . GLN A 1 173 ? 31.166 79.979  21.778 1.00 46.15  ? 668 GLN A CA  1 
ATOM   1316 C C   . GLN A 1 173 ? 31.379 80.829  20.531 1.00 47.29  ? 668 GLN A C   1 
ATOM   1317 O O   . GLN A 1 173 ? 30.976 81.992  20.493 1.00 46.41  ? 668 GLN A O   1 
ATOM   1318 C CB  . GLN A 1 173 ? 32.121 80.449  22.878 1.00 44.71  ? 668 GLN A CB  1 
ATOM   1319 C CG  . GLN A 1 173 ? 31.919 79.769  24.240 1.00 43.65  ? 668 GLN A CG  1 
ATOM   1320 C CD  . GLN A 1 173 ? 30.461 79.689  24.686 1.00 42.88  ? 668 GLN A CD  1 
ATOM   1321 O OE1 . GLN A 1 173 ? 29.721 80.674  24.636 1.00 42.08  ? 668 GLN A OE1 1 
ATOM   1322 N NE2 . GLN A 1 173 ? 30.051 78.511  25.142 1.00 40.51  ? 668 GLN A NE2 1 
ATOM   1323 N N   . ALA A 1 174 ? 32.003 80.255  19.510 1.00 48.88  ? 669 ALA A N   1 
ATOM   1324 C CA  . ALA A 1 174 ? 32.254 80.984  18.270 1.00 50.21  ? 669 ALA A CA  1 
ATOM   1325 C C   . ALA A 1 174 ? 32.419 80.000  17.117 1.00 51.36  ? 669 ALA A C   1 
ATOM   1326 O O   . ALA A 1 174 ? 32.992 78.924  17.283 1.00 54.16  ? 669 ALA A O   1 
ATOM   1327 C CB  . ALA A 1 174 ? 33.500 81.839  18.416 1.00 49.06  ? 669 ALA A CB  1 
ATOM   1328 N N   . PRO A 1 175 ? 31.921 80.357  15.926 1.00 51.70  ? 670 PRO A N   1 
ATOM   1329 C CA  . PRO A 1 175 ? 32.034 79.465  14.769 1.00 51.38  ? 670 PRO A CA  1 
ATOM   1330 C C   . PRO A 1 175 ? 33.461 79.149  14.324 1.00 51.38  ? 670 PRO A C   1 
ATOM   1331 O O   . PRO A 1 175 ? 33.815 77.981  14.150 1.00 50.46  ? 670 PRO A O   1 
ATOM   1332 C CB  . PRO A 1 175 ? 31.235 80.196  13.694 1.00 50.36  ? 670 PRO A CB  1 
ATOM   1333 C CG  . PRO A 1 175 ? 31.417 81.630  14.063 1.00 50.50  ? 670 PRO A CG  1 
ATOM   1334 C CD  . PRO A 1 175 ? 31.237 81.607  15.558 1.00 50.48  ? 670 PRO A CD  1 
ATOM   1335 N N   . GLU A 1 176 ? 34.281 80.181  14.153 1.00 51.30  ? 671 GLU A N   1 
ATOM   1336 C CA  . GLU A 1 176 ? 35.655 79.976  13.710 1.00 52.76  ? 671 GLU A CA  1 
ATOM   1337 C C   . GLU A 1 176 ? 36.546 79.277  14.731 1.00 51.68  ? 671 GLU A C   1 
ATOM   1338 O O   . GLU A 1 176 ? 37.709 78.995  14.452 1.00 51.25  ? 671 GLU A O   1 
ATOM   1339 C CB  . GLU A 1 176 ? 36.284 81.307  13.298 1.00 55.68  ? 671 GLU A CB  1 
ATOM   1340 C CG  . GLU A 1 176 ? 35.567 81.993  12.142 1.00 63.20  ? 671 GLU A CG  1 
ATOM   1341 C CD  . GLU A 1 176 ? 36.353 83.161  11.575 1.00 67.91  ? 671 GLU A CD  1 
ATOM   1342 O OE1 . GLU A 1 176 ? 37.080 83.815  12.353 1.00 72.14  ? 671 GLU A OE1 1 
ATOM   1343 O OE2 . GLU A 1 176 ? 36.237 83.436  10.359 1.00 69.84  ? 671 GLU A OE2 1 
ATOM   1344 N N   . ASN A 1 177 ? 36.004 78.997  15.911 1.00 50.65  ? 672 ASN A N   1 
ATOM   1345 C CA  . ASN A 1 177 ? 36.768 78.311  16.947 1.00 49.10  ? 672 ASN A CA  1 
ATOM   1346 C C   . ASN A 1 177 ? 36.811 76.811  16.653 1.00 48.77  ? 672 ASN A C   1 
ATOM   1347 O O   . ASN A 1 177 ? 36.120 76.032  17.302 1.00 49.41  ? 672 ASN A O   1 
ATOM   1348 C CB  . ASN A 1 177 ? 36.130 78.547  18.323 1.00 47.58  ? 672 ASN A CB  1 
ATOM   1349 C CG  . ASN A 1 177 ? 36.486 79.902  18.917 1.00 47.31  ? 672 ASN A CG  1 
ATOM   1350 O OD1 . ASN A 1 177 ? 37.060 80.758  18.253 1.00 48.38  ? 672 ASN A OD1 1 
ATOM   1351 N ND2 . ASN A 1 177 ? 36.136 80.099  20.177 1.00 47.24  ? 672 ASN A ND2 1 
ATOM   1352 N N   . LYS A 1 178 ? 37.613 76.404  15.675 1.00 48.95  ? 673 LYS A N   1 
ATOM   1353 C CA  . LYS A 1 178 ? 37.717 74.985  15.325 1.00 49.57  ? 673 LYS A CA  1 
ATOM   1354 C C   . LYS A 1 178 ? 38.789 74.298  16.170 1.00 46.84  ? 673 LYS A C   1 
ATOM   1355 O O   . LYS A 1 178 ? 39.841 74.875  16.437 1.00 47.00  ? 673 LYS A O   1 
ATOM   1356 C CB  . LYS A 1 178 ? 38.052 74.820  13.839 1.00 50.42  ? 673 LYS A CB  1 
ATOM   1357 C CG  . LYS A 1 178 ? 38.186 73.372  13.391 1.00 54.46  ? 673 LYS A CG  1 
ATOM   1358 C CD  . LYS A 1 178 ? 38.759 73.290  11.980 1.00 58.37  ? 673 LYS A CD  1 
ATOM   1359 C CE  . LYS A 1 178 ? 38.937 71.845  11.526 1.00 58.80  ? 673 LYS A CE  1 
ATOM   1360 N NZ  . LYS A 1 178 ? 39.528 71.757  10.163 1.00 57.40  ? 673 LYS A NZ  1 
ATOM   1361 N N   . ALA A 1 179 ? 38.526 73.061  16.580 1.00 43.96  ? 674 ALA A N   1 
ATOM   1362 C CA  . ALA A 1 179 ? 39.481 72.334  17.406 1.00 41.27  ? 674 ALA A CA  1 
ATOM   1363 C C   . ALA A 1 179 ? 40.117 71.131  16.712 1.00 39.48  ? 674 ALA A C   1 
ATOM   1364 O O   . ALA A 1 179 ? 39.604 70.612  15.721 1.00 37.64  ? 674 ALA A O   1 
ATOM   1365 C CB  . ALA A 1 179 ? 38.815 71.894  18.702 1.00 41.01  ? 674 ALA A CB  1 
ATOM   1366 N N   . PHE A 1 180 ? 41.251 70.702  17.255 1.00 38.14  ? 675 PHE A N   1 
ATOM   1367 C CA  . PHE A 1 180 ? 42.001 69.570  16.738 1.00 35.31  ? 675 PHE A CA  1 
ATOM   1368 C C   . PHE A 1 180 ? 42.247 68.586  17.872 1.00 36.50  ? 675 PHE A C   1 
ATOM   1369 O O   . PHE A 1 180 ? 42.568 68.989  18.987 1.00 38.25  ? 675 PHE A O   1 
ATOM   1370 C CB  . PHE A 1 180 ? 43.333 70.057  16.179 1.00 32.13  ? 675 PHE A CB  1 
ATOM   1371 C CG  . PHE A 1 180 ? 43.199 70.891  14.946 1.00 30.65  ? 675 PHE A CG  1 
ATOM   1372 C CD1 . PHE A 1 180 ? 43.162 70.292  13.687 1.00 31.30  ? 675 PHE A CD1 1 
ATOM   1373 C CD2 . PHE A 1 180 ? 43.079 72.269  15.038 1.00 28.85  ? 675 PHE A CD2 1 
ATOM   1374 C CE1 . PHE A 1 180 ? 43.017 71.055  12.540 1.00 26.19  ? 675 PHE A CE1 1 
ATOM   1375 C CE2 . PHE A 1 180 ? 42.933 73.042  13.897 1.00 28.80  ? 675 PHE A CE2 1 
ATOM   1376 C CZ  . PHE A 1 180 ? 42.899 72.433  12.646 1.00 29.27  ? 675 PHE A CZ  1 
ATOM   1377 N N   . VAL A 1 181 ? 42.087 67.299  17.596 1.00 36.01  ? 676 VAL A N   1 
ATOM   1378 C CA  . VAL A 1 181 ? 42.315 66.298  18.623 1.00 38.02  ? 676 VAL A CA  1 
ATOM   1379 C C   . VAL A 1 181 ? 43.353 65.281  18.167 1.00 37.86  ? 676 VAL A C   1 
ATOM   1380 O O   . VAL A 1 181 ? 43.143 64.541  17.203 1.00 39.95  ? 676 VAL A O   1 
ATOM   1381 C CB  . VAL A 1 181 ? 41.013 65.573  18.998 1.00 40.96  ? 676 VAL A CB  1 
ATOM   1382 C CG1 . VAL A 1 181 ? 41.281 64.576  20.116 1.00 43.00  ? 676 VAL A CG1 1 
ATOM   1383 C CG2 . VAL A 1 181 ? 39.960 66.590  19.441 1.00 42.21  ? 676 VAL A CG2 1 
ATOM   1384 N N   . LEU A 1 182 ? 44.478 65.263  18.875 1.00 34.95  ? 677 LEU A N   1 
ATOM   1385 C CA  . LEU A 1 182 ? 45.581 64.372  18.575 1.00 32.28  ? 677 LEU A CA  1 
ATOM   1386 C C   . LEU A 1 182 ? 45.782 63.389  19.725 1.00 32.28  ? 677 LEU A C   1 
ATOM   1387 O O   . LEU A 1 182 ? 45.681 63.764  20.892 1.00 32.74  ? 677 LEU A O   1 
ATOM   1388 C CB  . LEU A 1 182 ? 46.856 65.190  18.370 1.00 32.16  ? 677 LEU A CB  1 
ATOM   1389 C CG  . LEU A 1 182 ? 46.896 66.240  17.253 1.00 31.92  ? 677 LEU A CG  1 
ATOM   1390 C CD1 . LEU A 1 182 ? 45.855 67.304  17.492 1.00 30.65  ? 677 LEU A CD1 1 
ATOM   1391 C CD2 . LEU A 1 182 ? 48.280 66.873  17.199 1.00 29.96  ? 677 LEU A CD2 1 
ATOM   1392 N N   . SER A 1 183 ? 46.077 62.137  19.389 1.00 32.04  ? 678 SER A N   1 
ATOM   1393 C CA  . SER A 1 183 ? 46.293 61.090  20.386 1.00 33.96  ? 678 SER A CA  1 
ATOM   1394 C C   . SER A 1 183 ? 47.564 61.266  21.214 1.00 34.26  ? 678 SER A C   1 
ATOM   1395 O O   . SER A 1 183 ? 47.684 60.693  22.289 1.00 34.93  ? 678 SER A O   1 
ATOM   1396 C CB  . SER A 1 183 ? 46.323 59.721  19.700 1.00 35.82  ? 678 SER A CB  1 
ATOM   1397 O OG  . SER A 1 183 ? 47.293 59.689  18.665 1.00 36.95  ? 678 SER A OG  1 
ATOM   1398 N N   . SER A 1 184 ? 48.513 62.049  20.709 1.00 36.92  ? 679 SER A N   1 
ATOM   1399 C CA  . SER A 1 184 ? 49.768 62.289  21.418 1.00 39.00  ? 679 SER A CA  1 
ATOM   1400 C C   . SER A 1 184 ? 50.566 63.402  20.745 1.00 41.16  ? 679 SER A C   1 
ATOM   1401 O O   . SER A 1 184 ? 50.293 63.766  19.599 1.00 41.31  ? 679 SER A O   1 
ATOM   1402 C CB  . SER A 1 184 ? 50.618 61.025  21.434 1.00 39.68  ? 679 SER A CB  1 
ATOM   1403 O OG  . SER A 1 184 ? 51.130 60.764  20.138 1.00 44.09  ? 679 SER A OG  1 
ATOM   1404 N N   . VAL A 1 185 ? 51.561 63.931  21.453 1.00 41.52  ? 680 VAL A N   1 
ATOM   1405 C CA  . VAL A 1 185 ? 52.383 64.999  20.907 1.00 43.35  ? 680 VAL A CA  1 
ATOM   1406 C C   . VAL A 1 185 ? 53.021 64.610  19.576 1.00 44.65  ? 680 VAL A C   1 
ATOM   1407 O O   . VAL A 1 185 ? 53.458 65.472  18.814 1.00 45.38  ? 680 VAL A O   1 
ATOM   1408 C CB  . VAL A 1 185 ? 53.498 65.408  21.882 1.00 41.52  ? 680 VAL A CB  1 
ATOM   1409 C CG1 . VAL A 1 185 ? 52.898 66.013  23.139 1.00 44.49  ? 680 VAL A CG1 1 
ATOM   1410 C CG2 . VAL A 1 185 ? 54.344 64.210  22.224 1.00 42.04  ? 680 VAL A CG2 1 
ATOM   1411 N N   . ASP A 1 186 ? 53.078 63.314  19.293 1.00 46.31  ? 681 ASP A N   1 
ATOM   1412 C CA  . ASP A 1 186 ? 53.667 62.855  18.040 1.00 49.55  ? 681 ASP A CA  1 
ATOM   1413 C C   . ASP A 1 186 ? 52.782 63.163  16.846 1.00 50.30  ? 681 ASP A C   1 
ATOM   1414 O O   . ASP A 1 186 ? 53.265 63.289  15.721 1.00 50.36  ? 681 ASP A O   1 
ATOM   1415 C CB  . ASP A 1 186 ? 53.946 61.355  18.085 1.00 50.77  ? 681 ASP A CB  1 
ATOM   1416 C CG  . ASP A 1 186 ? 55.252 61.037  18.770 1.00 53.70  ? 681 ASP A CG  1 
ATOM   1417 O OD1 . ASP A 1 186 ? 56.206 61.839  18.620 1.00 52.83  ? 681 ASP A OD1 1 
ATOM   1418 O OD2 . ASP A 1 186 ? 55.329 59.989  19.445 1.00 55.36  ? 681 ASP A OD2 1 
ATOM   1419 N N   . GLU A 1 187 ? 51.484 63.267  17.104 1.00 52.00  ? 682 GLU A N   1 
ATOM   1420 C CA  . GLU A 1 187 ? 50.500 63.566  16.077 1.00 51.47  ? 682 GLU A CA  1 
ATOM   1421 C C   . GLU A 1 187 ? 50.556 65.050  15.754 1.00 51.50  ? 682 GLU A C   1 
ATOM   1422 O O   . GLU A 1 187 ? 49.927 65.518  14.805 1.00 51.46  ? 682 GLU A O   1 
ATOM   1423 C CB  . GLU A 1 187 ? 49.111 63.194  16.584 1.00 53.04  ? 682 GLU A CB  1 
ATOM   1424 C CG  . GLU A 1 187 ? 48.649 61.831  16.135 1.00 57.77  ? 682 GLU A CG  1 
ATOM   1425 C CD  . GLU A 1 187 ? 47.922 61.897  14.807 1.00 63.29  ? 682 GLU A CD  1 
ATOM   1426 O OE1 . GLU A 1 187 ? 46.812 62.478  14.768 1.00 65.00  ? 682 GLU A OE1 1 
ATOM   1427 O OE2 . GLU A 1 187 ? 48.461 61.378  13.804 1.00 65.55  ? 682 GLU A OE2 1 
ATOM   1428 N N   . LEU A 1 188 ? 51.323 65.789  16.549 1.00 51.54  ? 683 LEU A N   1 
ATOM   1429 C CA  . LEU A 1 188 ? 51.461 67.228  16.362 1.00 51.64  ? 683 LEU A CA  1 
ATOM   1430 C C   . LEU A 1 188 ? 51.988 67.523  14.955 1.00 52.02  ? 683 LEU A C   1 
ATOM   1431 O O   . LEU A 1 188 ? 51.308 68.153  14.137 1.00 50.34  ? 683 LEU A O   1 
ATOM   1432 C CB  . LEU A 1 188 ? 52.415 67.782  17.419 1.00 48.60  ? 683 LEU A CB  1 
ATOM   1433 C CG  . LEU A 1 188 ? 51.976 69.017  18.212 1.00 47.33  ? 683 LEU A CG  1 
ATOM   1434 C CD1 . LEU A 1 188 ? 50.491 69.294  18.054 1.00 44.91  ? 683 LEU A CD1 1 
ATOM   1435 C CD2 . LEU A 1 188 ? 52.308 68.808  19.675 1.00 45.73  ? 683 LEU A CD2 1 
ATOM   1436 N N   . GLU A 1 189 ? 53.197 67.055  14.675 1.00 53.15  ? 684 GLU A N   1 
ATOM   1437 C CA  . GLU A 1 189 ? 53.797 67.272  13.373 1.00 56.15  ? 684 GLU A CA  1 
ATOM   1438 C C   . GLU A 1 189 ? 53.003 66.573  12.262 1.00 56.85  ? 684 GLU A C   1 
ATOM   1439 O O   . GLU A 1 189 ? 53.288 66.745  11.070 1.00 56.92  ? 684 GLU A O   1 
ATOM   1440 C CB  . GLU A 1 189 ? 55.239 66.776  13.396 1.00 57.15  ? 684 GLU A CB  1 
ATOM   1441 C CG  . GLU A 1 189 ? 55.961 66.928  12.084 1.00 59.97  ? 684 GLU A CG  1 
ATOM   1442 C CD  . GLU A 1 189 ? 56.342 65.589  11.527 1.00 62.28  ? 684 GLU A CD  1 
ATOM   1443 O OE1 . GLU A 1 189 ? 57.085 64.867  12.219 1.00 62.76  ? 684 GLU A OE1 1 
ATOM   1444 O OE2 . GLU A 1 189 ? 55.898 65.261  10.409 1.00 64.37  ? 684 GLU A OE2 1 
ATOM   1445 N N   . GLN A 1 190 ? 52.006 65.783  12.658 1.00 58.53  ? 685 GLN A N   1 
ATOM   1446 C CA  . GLN A 1 190 ? 51.166 65.058  11.700 1.00 59.16  ? 685 GLN A CA  1 
ATOM   1447 C C   . GLN A 1 190 ? 50.141 65.961  11.043 1.00 57.87  ? 685 GLN A C   1 
ATOM   1448 O O   . GLN A 1 190 ? 50.138 66.139  9.822  1.00 56.77  ? 685 GLN A O   1 
ATOM   1449 C CB  . GLN A 1 190 ? 50.449 63.888  12.387 1.00 62.09  ? 685 GLN A CB  1 
ATOM   1450 C CG  . GLN A 1 190 ? 51.348 62.678  12.566 1.00 67.75  ? 685 GLN A CG  1 
ATOM   1451 C CD  . GLN A 1 190 ? 52.109 62.384  11.282 1.00 71.73  ? 685 GLN A CD  1 
ATOM   1452 O OE1 . GLN A 1 190 ? 51.628 61.666  10.398 1.00 72.96  ? 685 GLN A OE1 1 
ATOM   1453 N NE2 . GLN A 1 190 ? 53.305 62.955  11.169 1.00 74.09  ? 685 GLN A NE2 1 
ATOM   1454 N N   . GLN A 1 191 ? 49.250 66.506  11.859 1.00 56.62  ? 686 GLN A N   1 
ATOM   1455 C CA  . GLN A 1 191 ? 48.255 67.408  11.342 1.00 56.59  ? 686 GLN A CA  1 
ATOM   1456 C C   . GLN A 1 191 ? 48.734 68.864  11.436 1.00 54.38  ? 686 GLN A C   1 
ATOM   1457 O O   . GLN A 1 191 ? 47.927 69.771  11.573 1.00 53.62  ? 686 GLN A O   1 
ATOM   1458 C CB  . GLN A 1 191 ? 46.932 67.225  12.084 1.00 58.35  ? 686 GLN A CB  1 
ATOM   1459 C CG  . GLN A 1 191 ? 47.039 66.588  13.445 1.00 59.56  ? 686 GLN A CG  1 
ATOM   1460 C CD  . GLN A 1 191 ? 45.682 66.153  13.953 1.00 62.34  ? 686 GLN A CD  1 
ATOM   1461 O OE1 . GLN A 1 191 ? 44.710 66.912  13.886 1.00 64.14  ? 686 GLN A OE1 1 
ATOM   1462 N NE2 . GLN A 1 191 ? 45.605 64.934  14.472 1.00 60.98  ? 686 GLN A NE2 1 
ATOM   1463 N N   . ARG A 1 192 ? 50.039 69.106  11.333 1.00 52.30  ? 687 ARG A N   1 
ATOM   1464 C CA  . ARG A 1 192 ? 50.549 70.481  11.396 1.00 50.92  ? 687 ARG A CA  1 
ATOM   1465 C C   . ARG A 1 192 ? 50.067 71.277  10.183 1.00 50.06  ? 687 ARG A C   1 
ATOM   1466 O O   . ARG A 1 192 ? 49.516 72.369  10.327 1.00 48.59  ? 687 ARG A O   1 
ATOM   1467 C CB  . ARG A 1 192 ? 52.077 70.484  11.426 1.00 50.98  ? 687 ARG A CB  1 
ATOM   1468 C CG  . ARG A 1 192 ? 52.686 71.867  11.574 1.00 50.88  ? 687 ARG A CG  1 
ATOM   1469 C CD  . ARG A 1 192 ? 53.811 72.039  10.585 1.00 55.46  ? 687 ARG A CD  1 
ATOM   1470 N NE  . ARG A 1 192 ? 54.863 71.063  10.843 1.00 60.67  ? 687 ARG A NE  1 
ATOM   1471 C CZ  . ARG A 1 192 ? 55.543 70.425  9.895  1.00 60.46  ? 687 ARG A CZ  1 
ATOM   1472 N NH1 . ARG A 1 192 ? 55.283 70.653  8.614  1.00 59.84  ? 687 ARG A NH1 1 
ATOM   1473 N NH2 . ARG A 1 192 ? 56.491 69.562  10.227 1.00 60.79  ? 687 ARG A NH2 1 
ATOM   1474 N N   . ASP A 1 193 ? 50.299 70.727  8.993  1.00 48.20  ? 688 ASP A N   1 
ATOM   1475 C CA  . ASP A 1 193 ? 49.872 71.365  7.756  1.00 47.43  ? 688 ASP A CA  1 
ATOM   1476 C C   . ASP A 1 193 ? 48.383 71.681  7.832  1.00 45.76  ? 688 ASP A C   1 
ATOM   1477 O O   . ASP A 1 193 ? 47.926 72.709  7.338  1.00 43.68  ? 688 ASP A O   1 
ATOM   1478 C CB  . ASP A 1 193 ? 50.134 70.438  6.573  1.00 50.02  ? 688 ASP A CB  1 
ATOM   1479 C CG  . ASP A 1 193 ? 51.603 70.324  6.236  1.00 51.61  ? 688 ASP A CG  1 
ATOM   1480 O OD1 . ASP A 1 193 ? 51.949 69.441  5.419  1.00 49.27  ? 688 ASP A OD1 1 
ATOM   1481 O OD2 . ASP A 1 193 ? 52.403 71.122  6.780  1.00 52.28  ? 688 ASP A OD2 1 
ATOM   1482 N N   . GLU A 1 194 ? 47.634 70.784  8.461  1.00 46.49  ? 689 GLU A N   1 
ATOM   1483 C CA  . GLU A 1 194 ? 46.193 70.945  8.624  1.00 47.33  ? 689 GLU A CA  1 
ATOM   1484 C C   . GLU A 1 194 ? 45.894 72.140  9.539  1.00 45.51  ? 689 GLU A C   1 
ATOM   1485 O O   . GLU A 1 194 ? 44.931 72.878  9.326  1.00 44.21  ? 689 GLU A O   1 
ATOM   1486 C CB  . GLU A 1 194 ? 45.610 69.670  9.229  1.00 49.80  ? 689 GLU A CB  1 
ATOM   1487 C CG  . GLU A 1 194 ? 44.141 69.439  8.945  1.00 55.90  ? 689 GLU A CG  1 
ATOM   1488 C CD  . GLU A 1 194 ? 43.620 68.197  9.645  1.00 60.11  ? 689 GLU A CD  1 
ATOM   1489 O OE1 . GLU A 1 194 ? 44.305 67.146  9.587  1.00 61.28  ? 689 GLU A OE1 1 
ATOM   1490 O OE2 . GLU A 1 194 ? 42.525 68.272  10.249 1.00 61.47  ? 689 GLU A OE2 1 
ATOM   1491 N N   . ILE A 1 195 ? 46.728 72.318  10.559 1.00 44.25  ? 690 ILE A N   1 
ATOM   1492 C CA  . ILE A 1 195 ? 46.574 73.413  11.507 1.00 42.76  ? 690 ILE A CA  1 
ATOM   1493 C C   . ILE A 1 195 ? 47.025 74.730  10.881 1.00 43.77  ? 690 ILE A C   1 
ATOM   1494 O O   . ILE A 1 195 ? 46.421 75.779  11.116 1.00 44.99  ? 690 ILE A O   1 
ATOM   1495 C CB  . ILE A 1 195 ? 47.400 73.164  12.787 1.00 39.16  ? 690 ILE A CB  1 
ATOM   1496 C CG1 . ILE A 1 195 ? 46.904 71.895  13.485 1.00 36.33  ? 690 ILE A CG1 1 
ATOM   1497 C CG2 . ILE A 1 195 ? 47.277 74.354  13.718 1.00 36.30  ? 690 ILE A CG2 1 
ATOM   1498 C CD1 . ILE A 1 195 ? 47.739 71.479  14.672 1.00 34.14  ? 690 ILE A CD1 1 
ATOM   1499 N N   . VAL A 1 196 ? 48.095 74.674  10.093 1.00 43.91  ? 691 VAL A N   1 
ATOM   1500 C CA  . VAL A 1 196 ? 48.617 75.863  9.431  1.00 43.95  ? 691 VAL A CA  1 
ATOM   1501 C C   . VAL A 1 196 ? 47.622 76.302  8.358  1.00 44.60  ? 691 VAL A C   1 
ATOM   1502 O O   . VAL A 1 196 ? 47.261 77.476  8.269  1.00 42.89  ? 691 VAL A O   1 
ATOM   1503 C CB  . VAL A 1 196 ? 49.978 75.577  8.755  1.00 43.26  ? 691 VAL A CB  1 
ATOM   1504 C CG1 . VAL A 1 196 ? 50.477 76.821  8.037  1.00 43.33  ? 691 VAL A CG1 1 
ATOM   1505 C CG2 . VAL A 1 196 ? 50.988 75.113  9.790  1.00 41.73  ? 691 VAL A CG2 1 
ATOM   1506 N N   . SER A 1 197 ? 47.184 75.341  7.552  1.00 45.77  ? 692 SER A N   1 
ATOM   1507 C CA  . SER A 1 197 ? 46.236 75.598  6.476  1.00 47.58  ? 692 SER A CA  1 
ATOM   1508 C C   . SER A 1 197 ? 44.983 76.319  6.974  1.00 46.79  ? 692 SER A C   1 
ATOM   1509 O O   . SER A 1 197 ? 44.445 77.186  6.282  1.00 45.74  ? 692 SER A O   1 
ATOM   1510 C CB  . SER A 1 197 ? 45.846 74.277  5.804  1.00 49.21  ? 692 SER A CB  1 
ATOM   1511 O OG  . SER A 1 197 ? 44.906 74.484  4.764  1.00 53.08  ? 692 SER A OG  1 
ATOM   1512 N N   . TYR A 1 198 ? 44.526 75.967  8.174  1.00 46.64  ? 693 TYR A N   1 
ATOM   1513 C CA  . TYR A 1 198 ? 43.331 76.582  8.750  1.00 46.00  ? 693 TYR A CA  1 
ATOM   1514 C C   . TYR A 1 198 ? 43.582 78.007  9.213  1.00 45.60  ? 693 TYR A C   1 
ATOM   1515 O O   . TYR A 1 198 ? 42.662 78.820  9.260  1.00 45.08  ? 693 TYR A O   1 
ATOM   1516 C CB  . TYR A 1 198 ? 42.807 75.759  9.934  1.00 45.76  ? 693 TYR A CB  1 
ATOM   1517 C CG  . TYR A 1 198 ? 41.531 76.321  10.528 1.00 43.92  ? 693 TYR A CG  1 
ATOM   1518 C CD1 . TYR A 1 198 ? 40.419 76.558  9.722  1.00 43.48  ? 693 TYR A CD1 1 
ATOM   1519 C CD2 . TYR A 1 198 ? 41.440 76.636  11.884 1.00 42.61  ? 693 TYR A CD2 1 
ATOM   1520 C CE1 . TYR A 1 198 ? 39.253 77.096  10.241 1.00 42.25  ? 693 TYR A CE1 1 
ATOM   1521 C CE2 . TYR A 1 198 ? 40.268 77.176  12.414 1.00 42.26  ? 693 TYR A CE2 1 
ATOM   1522 C CZ  . TYR A 1 198 ? 39.182 77.403  11.581 1.00 41.22  ? 693 TYR A CZ  1 
ATOM   1523 O OH  . TYR A 1 198 ? 38.022 77.942  12.074 1.00 39.12  ? 693 TYR A OH  1 
ATOM   1524 N N   . LEU A 1 199 ? 44.825 78.305  9.568  1.00 46.61  ? 694 LEU A N   1 
ATOM   1525 C CA  . LEU A 1 199 ? 45.173 79.641  10.025 1.00 48.22  ? 694 LEU A CA  1 
ATOM   1526 C C   . LEU A 1 199 ? 45.316 80.588  8.834  1.00 50.13  ? 694 LEU A C   1 
ATOM   1527 O O   . LEU A 1 199 ? 44.941 81.758  8.915  1.00 49.86  ? 694 LEU A O   1 
ATOM   1528 C CB  . LEU A 1 199 ? 46.470 79.593  10.839 1.00 46.85  ? 694 LEU A CB  1 
ATOM   1529 C CG  . LEU A 1 199 ? 46.396 78.820  12.161 1.00 44.90  ? 694 LEU A CG  1 
ATOM   1530 C CD1 . LEU A 1 199 ? 47.770 78.721  12.785 1.00 45.65  ? 694 LEU A CD1 1 
ATOM   1531 C CD2 . LEU A 1 199 ? 45.440 79.521  13.107 1.00 44.10  ? 694 LEU A CD2 1 
ATOM   1532 N N   . CYS A 1 200 ? 45.843 80.076  7.724  1.00 53.19  ? 695 CYS A N   1 
ATOM   1533 C CA  . CYS A 1 200 ? 46.018 80.887  6.526  1.00 56.68  ? 695 CYS A CA  1 
ATOM   1534 C C   . CYS A 1 200 ? 44.646 81.224  5.953  1.00 57.11  ? 695 CYS A C   1 
ATOM   1535 O O   . CYS A 1 200 ? 44.491 82.205  5.229  1.00 57.40  ? 695 CYS A O   1 
ATOM   1536 C CB  . CYS A 1 200 ? 46.855 80.138  5.477  1.00 60.87  ? 695 CYS A CB  1 
ATOM   1537 S SG  . CYS A 1 200 ? 48.441 79.450  6.074  1.00 68.43  ? 695 CYS A SG  1 
ATOM   1538 N N   . ASP A 1 201 ? 43.650 80.405  6.281  1.00 58.74  ? 696 ASP A N   1 
ATOM   1539 C CA  . ASP A 1 201 ? 42.286 80.629  5.808  1.00 60.77  ? 696 ASP A CA  1 
ATOM   1540 C C   . ASP A 1 201 ? 41.530 81.559  6.747  1.00 61.20  ? 696 ASP A C   1 
ATOM   1541 O O   . ASP A 1 201 ? 40.441 82.028  6.420  1.00 61.70  ? 696 ASP A O   1 
ATOM   1542 C CB  . ASP A 1 201 ? 41.517 79.308  5.700  1.00 62.55  ? 696 ASP A CB  1 
ATOM   1543 C CG  . ASP A 1 201 ? 42.141 78.349  4.712  1.00 63.76  ? 696 ASP A CG  1 
ATOM   1544 O OD1 . ASP A 1 201 ? 43.019 78.784  3.937  1.00 64.84  ? 696 ASP A OD1 1 
ATOM   1545 O OD2 . ASP A 1 201 ? 41.743 77.164  4.707  1.00 63.73  ? 696 ASP A OD2 1 
ATOM   1546 N N   . LEU A 1 202 ? 42.106 81.812  7.918  1.00 61.67  ? 697 LEU A N   1 
ATOM   1547 C CA  . LEU A 1 202 ? 41.481 82.686  8.900  1.00 62.98  ? 697 LEU A CA  1 
ATOM   1548 C C   . LEU A 1 202 ? 42.055 84.100  8.893  1.00 64.06  ? 697 LEU A C   1 
ATOM   1549 O O   . LEU A 1 202 ? 41.327 85.064  9.126  1.00 64.19  ? 697 LEU A O   1 
ATOM   1550 C CB  . LEU A 1 202 ? 41.621 82.098  10.307 1.00 63.16  ? 697 LEU A CB  1 
ATOM   1551 C CG  . LEU A 1 202 ? 40.649 80.999  10.741 1.00 63.42  ? 697 LEU A CG  1 
ATOM   1552 C CD1 . LEU A 1 202 ? 41.070 80.459  12.095 1.00 62.92  ? 697 LEU A CD1 1 
ATOM   1553 C CD2 . LEU A 1 202 ? 39.233 81.556  10.807 1.00 63.15  ? 697 LEU A CD2 1 
ATOM   1554 N N   . ALA A 1 203 ? 43.354 84.222  8.629  1.00 64.99  ? 698 ALA A N   1 
ATOM   1555 C CA  . ALA A 1 203 ? 44.007 85.531  8.615  1.00 67.05  ? 698 ALA A CA  1 
ATOM   1556 C C   . ALA A 1 203 ? 44.112 86.125  7.218  1.00 68.08  ? 698 ALA A C   1 
ATOM   1557 O O   . ALA A 1 203 ? 44.254 85.403  6.233  1.00 67.25  ? 698 ALA A O   1 
ATOM   1558 C CB  . ALA A 1 203 ? 45.386 85.432  9.245  1.00 67.38  ? 698 ALA A CB  1 
ATOM   1559 N N   . PRO A 1 204 ? 44.072 87.463  7.121  1.00 70.04  ? 699 PRO A N   1 
ATOM   1560 C CA  . PRO A 1 204 ? 44.156 88.121  5.818  1.00 72.00  ? 699 PRO A CA  1 
ATOM   1561 C C   . PRO A 1 204 ? 45.531 87.975  5.231  1.00 73.95  ? 699 PRO A C   1 
ATOM   1562 O O   . PRO A 1 204 ? 46.511 87.735  5.946  1.00 71.25  ? 699 PRO A O   1 
ATOM   1563 C CB  . PRO A 1 204 ? 43.841 89.586  6.126  1.00 72.37  ? 699 PRO A CB  1 
ATOM   1564 C CG  . PRO A 1 204 ? 43.410 89.596  7.587  1.00 71.28  ? 699 PRO A CG  1 
ATOM   1565 C CD  . PRO A 1 204 ? 44.150 88.458  8.197  1.00 70.43  ? 699 PRO A CD  1 
ATOM   1566 N N   . GLU A 1 205 ? 45.620 88.167  3.926  1.00 78.23  ? 700 GLU A N   1 
ATOM   1567 C CA  . GLU A 1 205 ? 46.907 88.010  3.283  1.00 82.62  ? 700 GLU A CA  1 
ATOM   1568 C C   . GLU A 1 205 ? 47.950 89.090  3.383  1.00 84.68  ? 700 GLU A C   1 
ATOM   1569 O O   . GLU A 1 205 ? 47.661 90.284  3.423  1.00 83.83  ? 700 GLU A O   1 
ATOM   1570 C CB  . GLU A 1 205 ? 46.725 87.650  1.801  1.00 84.67  ? 700 GLU A CB  1 
ATOM   1571 C CG  . GLU A 1 205 ? 46.218 86.244  1.589  1.00 88.60  ? 700 GLU A CG  1 
ATOM   1572 C CD  . GLU A 1 205 ? 46.038 85.858  0.125  1.00 90.57  ? 700 GLU A CD  1 
ATOM   1573 O OE1 . GLU A 1 205 ? 46.014 86.744  -0.758 1.00 90.56  ? 700 GLU A OE1 1 
ATOM   1574 O OE2 . GLU A 1 205 ? 45.899 84.645  -0.137 1.00 89.96  ? 700 GLU A OE2 1 
ATOM   1575 N N   . ALA A 1 206 ? 49.177 88.596  3.382  1.00 88.16  ? 701 ALA A N   1 
ATOM   1576 C CA  . ALA A 1 206 ? 50.361 89.393  3.404  1.00 91.71  ? 701 ALA A CA  1 
ATOM   1577 C C   . ALA A 1 206 ? 51.135 89.060  2.134  1.00 94.54  ? 701 ALA A C   1 
ATOM   1578 O O   . ALA A 1 206 ? 50.841 88.085  1.440  1.00 95.02  ? 701 ALA A O   1 
ATOM   1579 C CB  . ALA A 1 206 ? 51.187 89.054  4.618  1.00 91.29  ? 701 ALA A CB  1 
ATOM   1580 N N   . PRO A 1 207 ? 52.158 89.866  1.825  1.00 97.82  ? 702 PRO A N   1 
ATOM   1581 C CA  . PRO A 1 207 ? 52.982 89.654  0.631  1.00 100.47 ? 702 PRO A CA  1 
ATOM   1582 C C   . PRO A 1 207 ? 54.203 88.761  0.884  1.00 103.11 ? 702 PRO A C   1 
ATOM   1583 O O   . PRO A 1 207 ? 54.850 88.857  1.930  1.00 103.01 ? 702 PRO A O   1 
ATOM   1584 C CB  . PRO A 1 207 ? 53.367 91.073  0.239  1.00 100.06 ? 702 PRO A CB  1 
ATOM   1585 C CG  . PRO A 1 207 ? 53.611 91.708  1.587  1.00 99.16  ? 702 PRO A CG  1 
ATOM   1586 C CD  . PRO A 1 207 ? 52.459 91.172  2.447  1.00 98.60  ? 702 PRO A CD  1 
ATOM   1587 N N   . PRO A 1 208 ? 54.532 87.876  -0.078 1.00 105.48 ? 703 PRO A N   1 
ATOM   1588 C CA  . PRO A 1 208 ? 55.683 86.978  0.068  1.00 107.33 ? 703 PRO A CA  1 
ATOM   1589 C C   . PRO A 1 208 ? 56.966 87.639  -0.427 1.00 108.83 ? 703 PRO A C   1 
ATOM   1590 O O   . PRO A 1 208 ? 57.505 87.174  -1.458 1.00 110.26 ? 703 PRO A O   1 
ATOM   1591 C CB  . PRO A 1 208 ? 55.310 85.761  -0.794 1.00 107.45 ? 703 PRO A CB  1 
ATOM   1592 C CG  . PRO A 1 208 ? 53.985 86.136  -1.489 1.00 107.16 ? 703 PRO A CG  1 
ATOM   1593 C CD  . PRO A 1 208 ? 53.851 87.628  -1.358 1.00 106.01 ? 703 PRO A CD  1 
ATOM   1594 N N   . HIS B 2 1   ? 65.060 105.139 4.321  1.00 54.42  ? 1   HIS B N   1 
ATOM   1595 C CA  . HIS B 2 1   ? 66.002 105.883 5.187  1.00 56.37  ? 1   HIS B CA  1 
ATOM   1596 C C   . HIS B 2 1   ? 67.334 105.140 5.255  1.00 56.52  ? 1   HIS B C   1 
ATOM   1597 O O   . HIS B 2 1   ? 67.377 103.915 5.300  1.00 55.10  ? 1   HIS B O   1 
ATOM   1598 C CB  . HIS B 2 1   ? 65.402 106.038 6.584  1.00 57.29  ? 1   HIS B CB  1 
ATOM   1599 C CG  . HIS B 2 1   ? 65.989 107.166 7.365  1.00 59.05  ? 1   HIS B CG  1 
ATOM   1600 N ND1 . HIS B 2 1   ? 67.141 107.038 8.108  1.00 60.42  ? 1   HIS B ND1 1 
ATOM   1601 C CD2 . HIS B 2 1   ? 65.607 108.461 7.478  1.00 59.73  ? 1   HIS B CD2 1 
ATOM   1602 C CE1 . HIS B 2 1   ? 67.444 108.206 8.646  1.00 63.56  ? 1   HIS B CE1 1 
ATOM   1603 N NE2 . HIS B 2 1   ? 66.530 109.086 8.278  1.00 61.56  ? 1   HIS B NE2 1 
ATOM   1604 N N   . PRO B 2 2   ? 68.452 105.882 5.258  1.00 57.53  ? 2   PRO B N   1 
ATOM   1605 C CA  . PRO B 2 2   ? 69.778 105.264 5.317  1.00 59.27  ? 2   PRO B CA  1 
ATOM   1606 C C   . PRO B 2 2   ? 70.300 105.020 6.728  1.00 60.65  ? 2   PRO B C   1 
ATOM   1607 O O   . PRO B 2 2   ? 71.454 104.630 6.911  1.00 61.97  ? 2   PRO B O   1 
ATOM   1608 C CB  . PRO B 2 2   ? 70.670 106.246 4.541  1.00 59.61  ? 2   PRO B CB  1 
ATOM   1609 C CG  . PRO B 2 2   ? 69.948 107.591 4.624  1.00 58.00  ? 2   PRO B CG  1 
ATOM   1610 C CD  . PRO B 2 2   ? 68.562 107.347 5.221  1.00 57.38  ? 2   PRO B CD  1 
ATOM   1611 N N   . ILE B 2 3   ? 69.458 105.257 7.727  1.00 61.12  ? 3   ILE B N   1 
ATOM   1612 C CA  . ILE B 2 3   ? 69.863 105.042 9.115  1.00 60.74  ? 3   ILE B CA  1 
ATOM   1613 C C   . ILE B 2 3   ? 68.963 104.030 9.832  1.00 60.44  ? 3   ILE B C   1 
ATOM   1614 O O   . ILE B 2 3   ? 69.450 103.038 10.381 1.00 60.09  ? 3   ILE B O   1 
ATOM   1615 C CB  . ILE B 2 3   ? 69.866 106.375 9.894  1.00 60.26  ? 3   ILE B CB  1 
ATOM   1616 C CG1 . ILE B 2 3   ? 70.859 107.362 9.262  1.00 59.24  ? 3   ILE B CG1 1 
ATOM   1617 C CG2 . ILE B 2 3   ? 70.272 106.134 11.346 1.00 58.54  ? 3   ILE B CG2 1 
ATOM   1618 C CD1 . ILE B 2 3   ? 70.950 108.672 10.006 1.00 59.98  ? 3   ILE B CD1 1 
ATOM   1619 N N   . CYS B 2 4   ? 67.654 104.275 9.803  1.00 59.53  ? 4   CYS B N   1 
ATOM   1620 C CA  . CYS B 2 4   ? 66.696 103.378 10.440 1.00 58.10  ? 4   CYS B CA  1 
ATOM   1621 C C   . CYS B 2 4   ? 66.001 102.473 9.419  1.00 58.57  ? 4   CYS B C   1 
ATOM   1622 O O   . CYS B 2 4   ? 66.008 102.758 8.222  1.00 58.53  ? 4   CYS B O   1 
ATOM   1623 C CB  . CYS B 2 4   ? 65.633 104.178 11.197 1.00 55.49  ? 4   CYS B CB  1 
ATOM   1624 S SG  . CYS B 2 4   ? 66.231 105.573 12.208 1.00 53.42  ? 4   CYS B SG  1 
ATOM   1625 N N   . GLU B 2 5   ? 65.398 101.389 9.901  1.00 59.26  ? 5   GLU B N   1 
ATOM   1626 C CA  . GLU B 2 5   ? 64.677 100.453 9.039  1.00 59.55  ? 5   GLU B CA  1 
ATOM   1627 C C   . GLU B 2 5   ? 63.208 100.851 8.930  1.00 58.57  ? 5   GLU B C   1 
ATOM   1628 O O   . GLU B 2 5   ? 62.534 101.038 9.941  1.00 58.65  ? 5   GLU B O   1 
ATOM   1629 C CB  . GLU B 2 5   ? 64.771 99.033  9.600  1.00 61.33  ? 5   GLU B CB  1 
ATOM   1630 C CG  . GLU B 2 5   ? 63.691 98.092  9.079  1.00 65.46  ? 5   GLU B CG  1 
ATOM   1631 C CD  . GLU B 2 5   ? 63.758 96.704  9.697  1.00 67.72  ? 5   GLU B CD  1 
ATOM   1632 O OE1 . GLU B 2 5   ? 63.797 96.606  10.944 1.00 68.45  ? 5   GLU B OE1 1 
ATOM   1633 O OE2 . GLU B 2 5   ? 63.760 95.711  8.935  1.00 67.60  ? 5   GLU B OE2 1 
ATOM   1634 N N   . VAL B 2 6   ? 62.715 100.988 7.704  1.00 57.85  ? 6   VAL B N   1 
ATOM   1635 C CA  . VAL B 2 6   ? 61.320 101.348 7.489  1.00 57.17  ? 6   VAL B CA  1 
ATOM   1636 C C   . VAL B 2 6   ? 60.568 100.173 6.893  1.00 58.02  ? 6   VAL B C   1 
ATOM   1637 O O   . VAL B 2 6   ? 61.045 99.521  5.967  1.00 59.74  ? 6   VAL B O   1 
ATOM   1638 C CB  . VAL B 2 6   ? 61.176 102.542 6.537  1.00 55.53  ? 6   VAL B CB  1 
ATOM   1639 C CG1 . VAL B 2 6   ? 59.703 102.806 6.267  1.00 54.62  ? 6   VAL B CG1 1 
ATOM   1640 C CG2 . VAL B 2 6   ? 61.822 103.772 7.141  1.00 57.18  ? 6   VAL B CG2 1 
ATOM   1641 N N   . SER B 2 7   ? 59.385 99.907  7.425  1.00 58.03  ? 7   SER B N   1 
ATOM   1642 C CA  . SER B 2 7   ? 58.579 98.803  6.936  1.00 59.08  ? 7   SER B CA  1 
ATOM   1643 C C   . SER B 2 7   ? 57.098 99.057  7.180  1.00 59.16  ? 7   SER B C   1 
ATOM   1644 O O   . SER B 2 7   ? 56.635 99.058  8.316  1.00 57.59  ? 7   SER B O   1 
ATOM   1645 C CB  . SER B 2 7   ? 59.017 97.504  7.615  1.00 58.26  ? 7   SER B CB  1 
ATOM   1646 O OG  . SER B 2 7   ? 59.104 97.682  9.017  1.00 58.31  ? 7   SER B OG  1 
ATOM   1647 N N   . LYS B 2 8   ? 56.363 99.285  6.099  1.00 60.93  ? 8   LYS B N   1 
ATOM   1648 C CA  . LYS B 2 8   ? 54.936 99.535  6.189  1.00 63.02  ? 8   LYS B CA  1 
ATOM   1649 C C   . LYS B 2 8   ? 54.192 98.220  6.350  1.00 63.83  ? 8   LYS B C   1 
ATOM   1650 O O   . LYS B 2 8   ? 54.397 97.283  5.577  1.00 64.63  ? 8   LYS B O   1 
ATOM   1651 C CB  . LYS B 2 8   ? 54.451 100.274 4.936  1.00 63.55  ? 8   LYS B CB  1 
ATOM   1652 C CG  . LYS B 2 8   ? 54.734 99.550  3.635  1.00 65.88  ? 8   LYS B CG  1 
ATOM   1653 C CD  . LYS B 2 8   ? 53.623 98.560  3.286  1.00 68.17  ? 8   LYS B CD  1 
ATOM   1654 C CE  . LYS B 2 8   ? 54.048 97.599  2.176  1.00 67.42  ? 8   LYS B CE  1 
ATOM   1655 N NZ  . LYS B 2 8   ? 54.755 96.411  2.752  1.00 65.78  ? 8   LYS B NZ  1 
ATOM   1656 N N   . VAL B 2 9   ? 53.347 98.162  7.376  1.00 63.90  ? 9   VAL B N   1 
ATOM   1657 C CA  . VAL B 2 9   ? 52.531 96.990  7.673  1.00 62.39  ? 9   VAL B CA  1 
ATOM   1658 C C   . VAL B 2 9   ? 51.100 97.498  7.656  1.00 61.56  ? 9   VAL B C   1 
ATOM   1659 O O   . VAL B 2 9   ? 50.636 98.089  8.631  1.00 62.64  ? 9   VAL B O   1 
ATOM   1660 C CB  . VAL B 2 9   ? 52.832 96.413  9.084  1.00 62.67  ? 9   VAL B CB  1 
ATOM   1661 C CG1 . VAL B 2 9   ? 52.043 95.127  9.300  1.00 61.70  ? 9   VAL B CG1 1 
ATOM   1662 C CG2 . VAL B 2 9   ? 54.327 96.162  9.251  1.00 62.77  ? 9   VAL B CG2 1 
ATOM   1663 N N   . ALA B 2 10  ? 50.413 97.287  6.539  1.00 60.03  ? 10  ALA B N   1 
ATOM   1664 C CA  . ALA B 2 10  ? 49.035 97.741  6.387  1.00 58.99  ? 10  ALA B CA  1 
ATOM   1665 C C   . ALA B 2 10  ? 48.961 99.264  6.521  1.00 58.19  ? 10  ALA B C   1 
ATOM   1666 O O   . ALA B 2 10  ? 49.706 99.984  5.854  1.00 58.55  ? 10  ALA B O   1 
ATOM   1667 C CB  . ALA B 2 10  ? 48.142 97.070  7.428  1.00 58.29  ? 10  ALA B CB  1 
ATOM   1668 N N   . SER B 2 11  ? 48.079 99.753  7.387  1.00 56.47  ? 11  SER B N   1 
ATOM   1669 C CA  . SER B 2 11  ? 47.929 101.190 7.577  1.00 55.05  ? 11  SER B CA  1 
ATOM   1670 C C   . SER B 2 11  ? 48.924 101.760 8.588  1.00 54.42  ? 11  SER B C   1 
ATOM   1671 O O   . SER B 2 11  ? 48.719 102.845 9.129  1.00 52.77  ? 11  SER B O   1 
ATOM   1672 C CB  . SER B 2 11  ? 46.504 101.516 8.023  1.00 56.19  ? 11  SER B CB  1 
ATOM   1673 O OG  . SER B 2 11  ? 46.282 101.095 9.356  1.00 58.81  ? 11  SER B OG  1 
ATOM   1674 N N   . HIS B 2 12  ? 50.004 101.030 8.839  1.00 53.99  ? 12  HIS B N   1 
ATOM   1675 C CA  . HIS B 2 12  ? 51.008 101.495 9.781  1.00 54.62  ? 12  HIS B CA  1 
ATOM   1676 C C   . HIS B 2 12  ? 52.397 101.557 9.171  1.00 52.57  ? 12  HIS B C   1 
ATOM   1677 O O   . HIS B 2 12  ? 52.802 100.667 8.425  1.00 51.84  ? 12  HIS B O   1 
ATOM   1678 C CB  . HIS B 2 12  ? 51.020 100.605 11.031 1.00 58.66  ? 12  HIS B CB  1 
ATOM   1679 C CG  . HIS B 2 12  ? 50.504 101.292 12.260 1.00 65.03  ? 12  HIS B CG  1 
ATOM   1680 N ND1 . HIS B 2 12  ? 50.364 100.651 13.473 1.00 67.04  ? 12  HIS B ND1 1 
ATOM   1681 C CD2 . HIS B 2 12  ? 50.108 102.572 12.465 1.00 65.49  ? 12  HIS B CD2 1 
ATOM   1682 C CE1 . HIS B 2 12  ? 49.908 101.508 14.371 1.00 67.11  ? 12  HIS B CE1 1 
ATOM   1683 N NE2 . HIS B 2 12  ? 49.744 102.681 13.785 1.00 65.69  ? 12  HIS B NE2 1 
ATOM   1684 N N   . LEU B 2 13  ? 53.117 102.629 9.488  1.00 50.34  ? 13  LEU B N   1 
ATOM   1685 C CA  . LEU B 2 13  ? 54.473 102.830 8.994  1.00 48.47  ? 13  LEU B CA  1 
ATOM   1686 C C   . LEU B 2 13  ? 55.400 102.793 10.194 1.00 47.88  ? 13  LEU B C   1 
ATOM   1687 O O   . LEU B 2 13  ? 55.425 103.729 10.994 1.00 49.21  ? 13  LEU B O   1 
ATOM   1688 C CB  . LEU B 2 13  ? 54.588 104.181 8.297  1.00 46.63  ? 13  LEU B CB  1 
ATOM   1689 C CG  . LEU B 2 13  ? 55.811 104.355 7.403  1.00 45.95  ? 13  LEU B CG  1 
ATOM   1690 C CD1 . LEU B 2 13  ? 55.767 103.326 6.285  1.00 43.80  ? 13  LEU B CD1 1 
ATOM   1691 C CD2 . LEU B 2 13  ? 55.826 105.761 6.834  1.00 46.15  ? 13  LEU B CD2 1 
ATOM   1692 N N   . GLU B 2 14  ? 56.163 101.711 10.310 1.00 46.30  ? 14  GLU B N   1 
ATOM   1693 C CA  . GLU B 2 14  ? 57.073 101.522 11.436 1.00 45.04  ? 14  GLU B CA  1 
ATOM   1694 C C   . GLU B 2 14  ? 58.526 101.869 11.117 1.00 42.97  ? 14  GLU B C   1 
ATOM   1695 O O   . GLU B 2 14  ? 59.083 101.412 10.119 1.00 43.59  ? 14  GLU B O   1 
ATOM   1696 C CB  . GLU B 2 14  ? 56.979 100.069 11.917 1.00 45.03  ? 14  GLU B CB  1 
ATOM   1697 C CG  . GLU B 2 14  ? 57.562 99.800  13.288 1.00 46.79  ? 14  GLU B CG  1 
ATOM   1698 C CD  . GLU B 2 14  ? 57.127 98.453  13.835 1.00 49.84  ? 14  GLU B CD  1 
ATOM   1699 O OE1 . GLU B 2 14  ? 57.406 98.166  15.020 1.00 51.68  ? 14  GLU B OE1 1 
ATOM   1700 O OE2 . GLU B 2 14  ? 56.502 97.678  13.076 1.00 50.86  ? 14  GLU B OE2 1 
ATOM   1701 N N   . VAL B 2 15  ? 59.129 102.689 11.972 1.00 41.21  ? 15  VAL B N   1 
ATOM   1702 C CA  . VAL B 2 15  ? 60.521 103.091 11.811 1.00 37.85  ? 15  VAL B CA  1 
ATOM   1703 C C   . VAL B 2 15  ? 61.304 102.602 13.021 1.00 38.05  ? 15  VAL B C   1 
ATOM   1704 O O   . VAL B 2 15  ? 61.024 102.991 14.154 1.00 37.05  ? 15  VAL B O   1 
ATOM   1705 C CB  . VAL B 2 15  ? 60.649 104.621 11.692 1.00 34.72  ? 15  VAL B CB  1 
ATOM   1706 C CG1 . VAL B 2 15  ? 62.107 105.015 11.633 1.00 34.06  ? 15  VAL B CG1 1 
ATOM   1707 C CG2 . VAL B 2 15  ? 59.937 105.103 10.449 1.00 33.81  ? 15  VAL B CG2 1 
ATOM   1708 N N   . ASN B 2 16  ? 62.280 101.734 12.776 1.00 39.56  ? 16  ASN B N   1 
ATOM   1709 C CA  . ASN B 2 16  ? 63.084 101.181 13.854 1.00 41.48  ? 16  ASN B CA  1 
ATOM   1710 C C   . ASN B 2 16  ? 64.480 101.781 13.870 1.00 42.78  ? 16  ASN B C   1 
ATOM   1711 O O   . ASN B 2 16  ? 65.250 101.609 12.929 1.00 42.88  ? 16  ASN B O   1 
ATOM   1712 C CB  . ASN B 2 16  ? 63.194 99.659  13.714 1.00 42.87  ? 16  ASN B CB  1 
ATOM   1713 C CG  . ASN B 2 16  ? 63.650 98.986  14.999 1.00 46.63  ? 16  ASN B CG  1 
ATOM   1714 O OD1 . ASN B 2 16  ? 64.636 99.397  15.617 1.00 47.19  ? 16  ASN B OD1 1 
ATOM   1715 N ND2 . ASN B 2 16  ? 62.931 97.942  15.406 1.00 47.40  ? 16  ASN B ND2 1 
ATOM   1716 N N   . CYS B 2 17  ? 64.794 102.501 14.939 1.00 44.42  ? 17  CYS B N   1 
ATOM   1717 C CA  . CYS B 2 17  ? 66.110 103.096 15.088 1.00 44.85  ? 17  CYS B CA  1 
ATOM   1718 C C   . CYS B 2 17  ? 66.687 102.563 16.400 1.00 46.04  ? 17  CYS B C   1 
ATOM   1719 O O   . CYS B 2 17  ? 67.405 103.267 17.110 1.00 45.60  ? 17  CYS B O   1 
ATOM   1720 C CB  . CYS B 2 17  ? 66.035 104.624 15.153 1.00 45.90  ? 17  CYS B CB  1 
ATOM   1721 S SG  . CYS B 2 17  ? 65.069 105.519 13.883 1.00 50.11  ? 17  CYS B SG  1 
ATOM   1722 N N   . ASP B 2 18  ? 66.348 101.319 16.724 1.00 47.01  ? 18  ASP B N   1 
ATOM   1723 C CA  . ASP B 2 18  ? 66.844 100.686 17.938 1.00 48.93  ? 18  ASP B CA  1 
ATOM   1724 C C   . ASP B 2 18  ? 68.362 100.498 17.906 1.00 49.19  ? 18  ASP B C   1 
ATOM   1725 O O   . ASP B 2 18  ? 68.928 100.087 16.896 1.00 48.24  ? 18  ASP B O   1 
ATOM   1726 C CB  . ASP B 2 18  ? 66.185 99.315  18.143 1.00 49.40  ? 18  ASP B CB  1 
ATOM   1727 C CG  . ASP B 2 18  ? 64.779 99.413  18.704 1.00 52.07  ? 18  ASP B CG  1 
ATOM   1728 O OD1 . ASP B 2 18  ? 64.358 100.530 19.077 1.00 52.90  ? 18  ASP B OD1 1 
ATOM   1729 O OD2 . ASP B 2 18  ? 64.098 98.368  18.783 1.00 51.56  ? 18  ASP B OD2 1 
ATOM   1730 N N   . LYS B 2 19  ? 69.009 100.808 19.024 1.00 50.05  ? 19  LYS B N   1 
ATOM   1731 C CA  . LYS B 2 19  ? 70.450 100.645 19.174 1.00 49.98  ? 19  LYS B CA  1 
ATOM   1732 C C   . LYS B 2 19  ? 71.251 100.993 17.927 1.00 48.98  ? 19  LYS B C   1 
ATOM   1733 O O   . LYS B 2 19  ? 71.916 100.130 17.357 1.00 48.52  ? 19  LYS B O   1 
ATOM   1734 C CB  . LYS B 2 19  ? 70.756 99.202  19.576 1.00 51.81  ? 19  LYS B CB  1 
ATOM   1735 C CG  . LYS B 2 19  ? 69.519 98.396  19.936 1.00 55.86  ? 19  LYS B CG  1 
ATOM   1736 C CD  . LYS B 2 19  ? 69.790 96.902  19.905 1.00 59.32  ? 19  LYS B CD  1 
ATOM   1737 C CE  . LYS B 2 19  ? 68.498 96.103  20.060 1.00 61.14  ? 19  LYS B CE  1 
ATOM   1738 N NZ  . LYS B 2 19  ? 68.718 94.634  19.896 1.00 61.70  ? 19  LYS B NZ  1 
ATOM   1739 N N   . ARG B 2 20  ? 71.186 102.248 17.502 1.00 47.55  ? 20  ARG B N   1 
ATOM   1740 C CA  . ARG B 2 20  ? 71.936 102.687 16.332 1.00 46.84  ? 20  ARG B CA  1 
ATOM   1741 C C   . ARG B 2 20  ? 73.026 103.655 16.781 1.00 47.99  ? 20  ARG B C   1 
ATOM   1742 O O   . ARG B 2 20  ? 73.638 104.327 15.952 1.00 47.99  ? 20  ARG B O   1 
ATOM   1743 C CB  . ARG B 2 20  ? 71.030 103.408 15.324 1.00 46.31  ? 20  ARG B CB  1 
ATOM   1744 C CG  . ARG B 2 20  ? 69.834 102.623 14.837 1.00 47.61  ? 20  ARG B CG  1 
ATOM   1745 C CD  . ARG B 2 20  ? 70.249 101.361 14.143 1.00 49.46  ? 20  ARG B CD  1 
ATOM   1746 N NE  . ARG B 2 20  ? 69.142 100.414 14.063 1.00 53.41  ? 20  ARG B NE  1 
ATOM   1747 C CZ  . ARG B 2 20  ? 68.276 100.362 13.059 1.00 55.11  ? 20  ARG B CZ  1 
ATOM   1748 N NH1 . ARG B 2 20  ? 68.389 101.202 12.038 1.00 56.34  ? 20  ARG B NH1 1 
ATOM   1749 N NH2 . ARG B 2 20  ? 67.293 99.473  13.079 1.00 55.67  ? 20  ARG B NH2 1 
ATOM   1750 N N   . ASP B 2 21  ? 73.260 103.731 18.090 1.00 48.22  ? 21  ASP B N   1 
ATOM   1751 C CA  . ASP B 2 21  ? 74.270 104.637 18.631 1.00 48.95  ? 21  ASP B CA  1 
ATOM   1752 C C   . ASP B 2 21  ? 73.903 106.086 18.336 1.00 48.46  ? 21  ASP B C   1 
ATOM   1753 O O   . ASP B 2 21  ? 74.769 106.962 18.300 1.00 49.13  ? 21  ASP B O   1 
ATOM   1754 C CB  . ASP B 2 21  ? 75.644 104.322 18.023 1.00 52.03  ? 21  ASP B CB  1 
ATOM   1755 C CG  . ASP B 2 21  ? 76.477 103.402 18.900 1.00 55.73  ? 21  ASP B CG  1 
ATOM   1756 O OD1 . ASP B 2 21  ? 77.304 102.642 18.349 1.00 56.20  ? 21  ASP B OD1 1 
ATOM   1757 O OD2 . ASP B 2 21  ? 76.319 103.451 20.142 1.00 58.08  ? 21  ASP B OD2 1 
ATOM   1758 N N   . LEU B 2 22  ? 72.617 106.336 18.126 1.00 45.45  ? 22  LEU B N   1 
ATOM   1759 C CA  . LEU B 2 22  ? 72.153 107.680 17.820 1.00 44.21  ? 22  LEU B CA  1 
ATOM   1760 C C   . LEU B 2 22  ? 72.231 108.614 19.026 1.00 43.75  ? 22  LEU B C   1 
ATOM   1761 O O   . LEU B 2 22  ? 71.948 108.215 20.152 1.00 44.10  ? 22  LEU B O   1 
ATOM   1762 C CB  . LEU B 2 22  ? 70.714 107.622 17.312 1.00 42.49  ? 22  LEU B CB  1 
ATOM   1763 C CG  . LEU B 2 22  ? 70.481 106.661 16.147 1.00 42.86  ? 22  LEU B CG  1 
ATOM   1764 C CD1 . LEU B 2 22  ? 68.993 106.589 15.851 1.00 42.05  ? 22  LEU B CD1 1 
ATOM   1765 C CD2 . LEU B 2 22  ? 71.264 107.114 14.920 1.00 41.48  ? 22  LEU B CD2 1 
ATOM   1766 N N   . THR B 2 23  ? 72.628 109.858 18.785 1.00 43.25  ? 23  THR B N   1 
ATOM   1767 C CA  . THR B 2 23  ? 72.719 110.845 19.851 1.00 44.45  ? 23  THR B CA  1 
ATOM   1768 C C   . THR B 2 23  ? 71.649 111.912 19.669 1.00 45.26  ? 23  THR B C   1 
ATOM   1769 O O   . THR B 2 23  ? 71.486 112.790 20.514 1.00 46.23  ? 23  THR B O   1 
ATOM   1770 C CB  . THR B 2 23  ? 74.094 111.527 19.877 1.00 43.18  ? 23  THR B CB  1 
ATOM   1771 O OG1 . THR B 2 23  ? 74.474 111.886 18.547 1.00 45.81  ? 23  THR B OG1 1 
ATOM   1772 C CG2 . THR B 2 23  ? 75.131 110.608 20.468 1.00 43.29  ? 23  THR B CG2 1 
ATOM   1773 N N   . ALA B 2 24  ? 70.923 111.824 18.559 1.00 45.54  ? 24  ALA B N   1 
ATOM   1774 C CA  . ALA B 2 24  ? 69.855 112.768 18.248 1.00 44.64  ? 24  ALA B CA  1 
ATOM   1775 C C   . ALA B 2 24  ? 68.920 112.174 17.201 1.00 44.62  ? 24  ALA B C   1 
ATOM   1776 O O   . ALA B 2 24  ? 69.296 111.265 16.458 1.00 43.09  ? 24  ALA B O   1 
ATOM   1777 C CB  . ALA B 2 24  ? 70.440 114.071 17.741 1.00 43.43  ? 24  ALA B CB  1 
ATOM   1778 N N   . LEU B 2 25  ? 67.701 112.693 17.143 1.00 44.99  ? 25  LEU B N   1 
ATOM   1779 C CA  . LEU B 2 25  ? 66.716 112.199 16.190 1.00 46.31  ? 25  LEU B CA  1 
ATOM   1780 C C   . LEU B 2 25  ? 67.230 112.280 14.756 1.00 46.01  ? 25  LEU B C   1 
ATOM   1781 O O   . LEU B 2 25  ? 67.710 113.324 14.325 1.00 45.70  ? 25  LEU B O   1 
ATOM   1782 C CB  . LEU B 2 25  ? 65.422 113.003 16.310 1.00 46.48  ? 25  LEU B CB  1 
ATOM   1783 C CG  . LEU B 2 25  ? 64.278 112.589 15.383 1.00 49.40  ? 25  LEU B CG  1 
ATOM   1784 C CD1 . LEU B 2 25  ? 63.787 111.192 15.744 1.00 48.81  ? 25  LEU B CD1 1 
ATOM   1785 C CD2 . LEU B 2 25  ? 63.143 113.590 15.508 1.00 52.47  ? 25  LEU B CD2 1 
ATOM   1786 N N   . PRO B 2 26  ? 67.157 111.166 14.008 1.00 46.30  ? 26  PRO B N   1 
ATOM   1787 C CA  . PRO B 2 26  ? 67.620 111.156 12.618 1.00 47.29  ? 26  PRO B CA  1 
ATOM   1788 C C   . PRO B 2 26  ? 66.742 112.084 11.778 1.00 49.33  ? 26  PRO B C   1 
ATOM   1789 O O   . PRO B 2 26  ? 65.522 112.120 11.941 1.00 50.70  ? 26  PRO B O   1 
ATOM   1790 C CB  . PRO B 2 26  ? 67.457 109.694 12.209 1.00 45.49  ? 26  PRO B CB  1 
ATOM   1791 C CG  . PRO B 2 26  ? 67.634 108.963 13.502 1.00 46.24  ? 26  PRO B CG  1 
ATOM   1792 C CD  . PRO B 2 26  ? 66.826 109.803 14.454 1.00 45.08  ? 26  PRO B CD  1 
ATOM   1793 N N   . PRO B 2 27  ? 67.351 112.856 10.869 1.00 50.00  ? 27  PRO B N   1 
ATOM   1794 C CA  . PRO B 2 27  ? 66.544 113.758 10.046 1.00 49.29  ? 27  PRO B CA  1 
ATOM   1795 C C   . PRO B 2 27  ? 65.967 113.051 8.826  1.00 50.01  ? 27  PRO B C   1 
ATOM   1796 O O   . PRO B 2 27  ? 66.448 111.993 8.418  1.00 48.92  ? 27  PRO B O   1 
ATOM   1797 C CB  . PRO B 2 27  ? 67.541 114.840 9.663  1.00 48.25  ? 27  PRO B CB  1 
ATOM   1798 C CG  . PRO B 2 27  ? 68.789 114.041 9.458  1.00 48.59  ? 27  PRO B CG  1 
ATOM   1799 C CD  . PRO B 2 27  ? 68.789 113.092 10.646 1.00 50.25  ? 27  PRO B CD  1 
ATOM   1800 N N   . ASP B 2 28  ? 64.924 113.640 8.256  1.00 51.49  ? 28  ASP B N   1 
ATOM   1801 C CA  . ASP B 2 28  ? 64.282 113.094 7.067  1.00 53.32  ? 28  ASP B CA  1 
ATOM   1802 C C   . ASP B 2 28  ? 63.634 111.733 7.257  1.00 52.39  ? 28  ASP B C   1 
ATOM   1803 O O   . ASP B 2 28  ? 63.765 110.857 6.404  1.00 53.69  ? 28  ASP B O   1 
ATOM   1804 C CB  . ASP B 2 28  ? 65.287 113.016 5.915  1.00 55.64  ? 28  ASP B CB  1 
ATOM   1805 C CG  . ASP B 2 28  ? 66.062 114.302 5.746  1.00 59.54  ? 28  ASP B CG  1 
ATOM   1806 O OD1 . ASP B 2 28  ? 65.429 115.381 5.812  1.00 59.30  ? 28  ASP B OD1 1 
ATOM   1807 O OD2 . ASP B 2 28  ? 67.296 114.237 5.547  1.00 61.29  ? 28  ASP B OD2 1 
ATOM   1808 N N   . LEU B 2 29  ? 62.941 111.551 8.376  1.00 50.86  ? 29  LEU B N   1 
ATOM   1809 C CA  . LEU B 2 29  ? 62.241 110.297 8.621  1.00 47.19  ? 29  LEU B CA  1 
ATOM   1810 C C   . LEU B 2 29  ? 60.978 110.387 7.781  1.00 46.15  ? 29  LEU B C   1 
ATOM   1811 O O   . LEU B 2 29  ? 60.392 111.461 7.654  1.00 47.12  ? 29  LEU B O   1 
ATOM   1812 C CB  . LEU B 2 29  ? 61.870 110.160 10.096 1.00 44.78  ? 29  LEU B CB  1 
ATOM   1813 C CG  . LEU B 2 29  ? 63.024 109.927 11.067 1.00 43.46  ? 29  LEU B CG  1 
ATOM   1814 C CD1 . LEU B 2 29  ? 62.503 109.875 12.490 1.00 41.27  ? 29  LEU B CD1 1 
ATOM   1815 C CD2 . LEU B 2 29  ? 63.728 108.627 10.704 1.00 42.81  ? 29  LEU B CD2 1 
ATOM   1816 N N   . PRO B 2 30  ? 60.540 109.268 7.189  1.00 45.22  ? 30  PRO B N   1 
ATOM   1817 C CA  . PRO B 2 30  ? 59.325 109.326 6.372  1.00 44.88  ? 30  PRO B CA  1 
ATOM   1818 C C   . PRO B 2 30  ? 58.221 110.139 7.046  1.00 46.24  ? 30  PRO B C   1 
ATOM   1819 O O   . PRO B 2 30  ? 57.956 109.975 8.237  1.00 44.58  ? 30  PRO B O   1 
ATOM   1820 C CB  . PRO B 2 30  ? 58.961 107.852 6.183  1.00 44.30  ? 30  PRO B CB  1 
ATOM   1821 C CG  . PRO B 2 30  ? 59.665 107.153 7.322  1.00 46.39  ? 30  PRO B CG  1 
ATOM   1822 C CD  . PRO B 2 30  ? 60.967 107.877 7.400  1.00 45.21  ? 30  PRO B CD  1 
ATOM   1823 N N   . LYS B 2 31  ? 57.591 111.028 6.280  1.00 48.99  ? 31  LYS B N   1 
ATOM   1824 C CA  . LYS B 2 31  ? 56.533 111.894 6.804  1.00 52.05  ? 31  LYS B CA  1 
ATOM   1825 C C   . LYS B 2 31  ? 55.293 111.185 7.335  1.00 51.39  ? 31  LYS B C   1 
ATOM   1826 O O   . LYS B 2 31  ? 54.555 111.759 8.128  1.00 52.67  ? 31  LYS B O   1 
ATOM   1827 C CB  . LYS B 2 31  ? 56.098 112.915 5.742  1.00 54.93  ? 31  LYS B CB  1 
ATOM   1828 C CG  . LYS B 2 31  ? 57.156 113.965 5.409  1.00 59.49  ? 31  LYS B CG  1 
ATOM   1829 C CD  . LYS B 2 31  ? 57.703 114.641 6.671  1.00 60.08  ? 31  LYS B CD  1 
ATOM   1830 C CE  . LYS B 2 31  ? 58.794 115.646 6.334  1.00 60.20  ? 31  LYS B CE  1 
ATOM   1831 N NZ  . LYS B 2 31  ? 59.619 115.995 7.524  1.00 60.97  ? 31  LYS B NZ  1 
ATOM   1832 N N   . ASP B 2 32  ? 55.058 109.951 6.903  1.00 50.91  ? 32  ASP B N   1 
ATOM   1833 C CA  . ASP B 2 32  ? 53.887 109.210 7.355  1.00 50.82  ? 32  ASP B CA  1 
ATOM   1834 C C   . ASP B 2 32  ? 54.161 108.275 8.525  1.00 48.56  ? 32  ASP B C   1 
ATOM   1835 O O   . ASP B 2 32  ? 53.318 107.442 8.860  1.00 49.08  ? 32  ASP B O   1 
ATOM   1836 C CB  . ASP B 2 32  ? 53.294 108.399 6.200  1.00 55.09  ? 32  ASP B CB  1 
ATOM   1837 C CG  . ASP B 2 32  ? 52.567 109.264 5.190  1.00 57.47  ? 32  ASP B CG  1 
ATOM   1838 O OD1 . ASP B 2 32  ? 51.987 108.700 4.236  1.00 58.75  ? 32  ASP B OD1 1 
ATOM   1839 O OD2 . ASP B 2 32  ? 52.573 110.504 5.351  1.00 58.39  ? 32  ASP B OD2 1 
ATOM   1840 N N   . THR B 2 33  ? 55.331 108.414 9.141  1.00 45.12  ? 33  THR B N   1 
ATOM   1841 C CA  . THR B 2 33  ? 55.716 107.575 10.276 1.00 41.91  ? 33  THR B CA  1 
ATOM   1842 C C   . THR B 2 33  ? 54.668 107.553 11.391 1.00 40.21  ? 33  THR B C   1 
ATOM   1843 O O   . THR B 2 33  ? 54.304 108.597 11.933 1.00 40.70  ? 33  THR B O   1 
ATOM   1844 C CB  . THR B 2 33  ? 57.056 108.047 10.877 1.00 39.30  ? 33  THR B CB  1 
ATOM   1845 O OG1 . THR B 2 33  ? 58.084 107.936 9.889  1.00 38.76  ? 33  THR B OG1 1 
ATOM   1846 C CG2 . THR B 2 33  ? 57.437 107.202 12.076 1.00 37.74  ? 33  THR B CG2 1 
ATOM   1847 N N   . THR B 2 34  ? 54.196 106.356 11.733 1.00 36.48  ? 34  THR B N   1 
ATOM   1848 C CA  . THR B 2 34  ? 53.194 106.192 12.787 1.00 34.05  ? 34  THR B CA  1 
ATOM   1849 C C   . THR B 2 34  ? 53.782 105.533 14.032 1.00 32.25  ? 34  THR B C   1 
ATOM   1850 O O   . THR B 2 34  ? 53.208 105.615 15.116 1.00 30.44  ? 34  THR B O   1 
ATOM   1851 C CB  . THR B 2 34  ? 52.018 105.337 12.305 1.00 31.79  ? 34  THR B CB  1 
ATOM   1852 O OG1 . THR B 2 34  ? 52.526 104.150 11.691 1.00 32.54  ? 34  THR B OG1 1 
ATOM   1853 C CG2 . THR B 2 34  ? 51.175 106.100 11.306 1.00 31.87  ? 34  THR B CG2 1 
ATOM   1854 N N   . ILE B 2 35  ? 54.918 104.866 13.866 1.00 30.84  ? 35  ILE B N   1 
ATOM   1855 C CA  . ILE B 2 35  ? 55.579 104.208 14.979 1.00 30.69  ? 35  ILE B CA  1 
ATOM   1856 C C   . ILE B 2 35  ? 57.082 104.401 14.872 1.00 30.23  ? 35  ILE B C   1 
ATOM   1857 O O   . ILE B 2 35  ? 57.699 104.009 13.879 1.00 27.37  ? 35  ILE B O   1 
ATOM   1858 C CB  . ILE B 2 35  ? 55.280 102.708 15.002 1.00 32.08  ? 35  ILE B CB  1 
ATOM   1859 C CG1 . ILE B 2 35  ? 53.773 102.480 15.129 1.00 33.40  ? 35  ILE B CG1 1 
ATOM   1860 C CG2 . ILE B 2 35  ? 56.002 102.060 16.171 1.00 33.74  ? 35  ILE B CG2 1 
ATOM   1861 C CD1 . ILE B 2 35  ? 53.363 101.019 15.048 1.00 32.99  ? 35  ILE B CD1 1 
ATOM   1862 N N   . LEU B 2 36  ? 57.664 105.007 15.904 1.00 28.50  ? 36  LEU B N   1 
ATOM   1863 C CA  . LEU B 2 36  ? 59.096 105.266 15.919 1.00 28.78  ? 36  LEU B CA  1 
ATOM   1864 C C   . LEU B 2 36  ? 59.819 104.663 17.123 1.00 29.56  ? 36  LEU B C   1 
ATOM   1865 O O   . LEU B 2 36  ? 59.478 104.930 18.276 1.00 28.00  ? 36  LEU B O   1 
ATOM   1866 C CB  . LEU B 2 36  ? 59.342 106.772 15.869 1.00 26.83  ? 36  LEU B CB  1 
ATOM   1867 C CG  . LEU B 2 36  ? 60.805 107.215 15.834 1.00 27.43  ? 36  LEU B CG  1 
ATOM   1868 C CD1 . LEU B 2 36  ? 61.553 106.531 14.705 1.00 24.07  ? 36  LEU B CD1 1 
ATOM   1869 C CD2 . LEU B 2 36  ? 60.845 108.723 15.674 1.00 29.46  ? 36  LEU B CD2 1 
ATOM   1870 N N   . HIS B 2 37  ? 60.828 103.846 16.839 1.00 31.57  ? 37  HIS B N   1 
ATOM   1871 C CA  . HIS B 2 37  ? 61.606 103.199 17.884 1.00 31.46  ? 37  HIS B CA  1 
ATOM   1872 C C   . HIS B 2 37  ? 62.975 103.846 17.993 1.00 32.10  ? 37  HIS B C   1 
ATOM   1873 O O   . HIS B 2 37  ? 63.766 103.776 17.054 1.00 31.11  ? 37  HIS B O   1 
ATOM   1874 C CB  . HIS B 2 37  ? 61.794 101.713 17.575 1.00 30.08  ? 37  HIS B CB  1 
ATOM   1875 C CG  . HIS B 2 37  ? 60.516 100.976 17.342 1.00 32.04  ? 37  HIS B CG  1 
ATOM   1876 N ND1 . HIS B 2 37  ? 59.495 100.945 18.266 1.00 34.21  ? 37  HIS B ND1 1 
ATOM   1877 C CD2 . HIS B 2 37  ? 60.091 100.240 16.288 1.00 33.94  ? 37  HIS B CD2 1 
ATOM   1878 C CE1 . HIS B 2 37  ? 58.495 100.223 17.793 1.00 33.79  ? 37  HIS B CE1 1 
ATOM   1879 N NE2 . HIS B 2 37  ? 58.831 99.783  16.593 1.00 34.30  ? 37  HIS B NE2 1 
ATOM   1880 N N   . LEU B 2 38  ? 63.248 104.467 19.138 1.00 31.99  ? 38  LEU B N   1 
ATOM   1881 C CA  . LEU B 2 38  ? 64.539 105.107 19.378 1.00 32.77  ? 38  LEU B CA  1 
ATOM   1882 C C   . LEU B 2 38  ? 65.211 104.497 20.601 1.00 33.27  ? 38  LEU B C   1 
ATOM   1883 O O   . LEU B 2 38  ? 66.188 105.031 21.116 1.00 37.48  ? 38  LEU B O   1 
ATOM   1884 C CB  . LEU B 2 38  ? 64.356 106.613 19.583 1.00 28.54  ? 38  LEU B CB  1 
ATOM   1885 C CG  . LEU B 2 38  ? 63.970 107.347 18.299 1.00 28.49  ? 38  LEU B CG  1 
ATOM   1886 C CD1 . LEU B 2 38  ? 63.556 108.762 18.609 1.00 26.36  ? 38  LEU B CD1 1 
ATOM   1887 C CD2 . LEU B 2 38  ? 65.149 107.324 17.334 1.00 25.46  ? 38  LEU B CD2 1 
ATOM   1888 N N   . SER B 2 39  ? 64.691 103.365 21.053 1.00 33.71  ? 39  SER B N   1 
ATOM   1889 C CA  . SER B 2 39  ? 65.224 102.705 22.234 1.00 36.29  ? 39  SER B CA  1 
ATOM   1890 C C   . SER B 2 39  ? 66.703 102.366 22.129 1.00 38.46  ? 39  SER B C   1 
ATOM   1891 O O   . SER B 2 39  ? 67.239 102.185 21.042 1.00 39.79  ? 39  SER B O   1 
ATOM   1892 C CB  . SER B 2 39  ? 64.417 101.440 22.532 1.00 35.45  ? 39  SER B CB  1 
ATOM   1893 O OG  . SER B 2 39  ? 63.415 101.234 21.551 1.00 36.33  ? 39  SER B OG  1 
ATOM   1894 N N   . GLU B 2 40  ? 67.356 102.294 23.281 1.00 40.95  ? 40  GLU B N   1 
ATOM   1895 C CA  . GLU B 2 40  ? 68.775 101.970 23.372 1.00 42.14  ? 40  GLU B CA  1 
ATOM   1896 C C   . GLU B 2 40  ? 69.698 102.769 22.482 1.00 40.77  ? 40  GLU B C   1 
ATOM   1897 O O   . GLU B 2 40  ? 70.496 102.212 21.734 1.00 39.81  ? 40  GLU B O   1 
ATOM   1898 C CB  . GLU B 2 40  ? 68.996 100.478 23.139 1.00 43.62  ? 40  GLU B CB  1 
ATOM   1899 C CG  . GLU B 2 40  ? 68.718 99.670  24.391 1.00 47.56  ? 40  GLU B CG  1 
ATOM   1900 C CD  . GLU B 2 40  ? 68.582 98.197  24.113 1.00 50.32  ? 40  GLU B CD  1 
ATOM   1901 O OE1 . GLU B 2 40  ? 67.927 97.853  23.103 1.00 52.36  ? 40  GLU B OE1 1 
ATOM   1902 O OE2 . GLU B 2 40  ? 69.108 97.388  24.910 1.00 51.21  ? 40  GLU B OE2 1 
ATOM   1903 N N   . ASN B 2 41  ? 69.585 104.086 22.581 1.00 39.12  ? 41  ASN B N   1 
ATOM   1904 C CA  . ASN B 2 41  ? 70.432 104.990 21.831 1.00 36.93  ? 41  ASN B CA  1 
ATOM   1905 C C   . ASN B 2 41  ? 71.098 105.921 22.833 1.00 36.37  ? 41  ASN B C   1 
ATOM   1906 O O   . ASN B 2 41  ? 70.796 105.873 24.025 1.00 35.09  ? 41  ASN B O   1 
ATOM   1907 C CB  . ASN B 2 41  ? 69.610 105.775 20.809 1.00 37.86  ? 41  ASN B CB  1 
ATOM   1908 C CG  . ASN B 2 41  ? 69.440 105.022 19.497 1.00 40.26  ? 41  ASN B CG  1 
ATOM   1909 O OD1 . ASN B 2 41  ? 70.420 104.708 18.821 1.00 40.82  ? 41  ASN B OD1 1 
ATOM   1910 N ND2 . ASN B 2 41  ? 68.196 104.728 19.132 1.00 40.86  ? 41  ASN B ND2 1 
ATOM   1911 N N   . LEU B 2 42  ? 72.008 106.761 22.353 1.00 38.07  ? 42  LEU B N   1 
ATOM   1912 C CA  . LEU B 2 42  ? 72.727 107.686 23.223 1.00 38.00  ? 42  LEU B CA  1 
ATOM   1913 C C   . LEU B 2 42  ? 72.115 109.079 23.236 1.00 36.81  ? 42  LEU B C   1 
ATOM   1914 O O   . LEU B 2 42  ? 72.782 110.059 22.899 1.00 37.23  ? 42  LEU B O   1 
ATOM   1915 C CB  . LEU B 2 42  ? 74.194 107.776 22.790 1.00 38.59  ? 42  LEU B CB  1 
ATOM   1916 C CG  . LEU B 2 42  ? 74.933 106.445 22.650 1.00 39.18  ? 42  LEU B CG  1 
ATOM   1917 C CD1 . LEU B 2 42  ? 76.404 106.697 22.359 1.00 38.41  ? 42  LEU B CD1 1 
ATOM   1918 C CD2 . LEU B 2 42  ? 74.773 105.641 23.926 1.00 41.23  ? 42  LEU B CD2 1 
ATOM   1919 N N   . LEU B 2 43  ? 70.849 109.160 23.633 1.00 34.95  ? 43  LEU B N   1 
ATOM   1920 C CA  . LEU B 2 43  ? 70.142 110.432 23.705 1.00 33.38  ? 43  LEU B CA  1 
ATOM   1921 C C   . LEU B 2 43  ? 70.122 110.950 25.147 1.00 34.24  ? 43  LEU B C   1 
ATOM   1922 O O   . LEU B 2 43  ? 69.370 110.442 25.978 1.00 31.47  ? 43  LEU B O   1 
ATOM   1923 C CB  . LEU B 2 43  ? 68.703 110.255 23.226 1.00 31.34  ? 43  LEU B CB  1 
ATOM   1924 C CG  . LEU B 2 43  ? 68.467 109.493 21.924 1.00 30.83  ? 43  LEU B CG  1 
ATOM   1925 C CD1 . LEU B 2 43  ? 66.968 109.226 21.783 1.00 27.61  ? 43  LEU B CD1 1 
ATOM   1926 C CD2 . LEU B 2 43  ? 69.012 110.291 20.730 1.00 27.34  ? 43  LEU B CD2 1 
ATOM   1927 N N   . TYR B 2 44  ? 70.936 111.964 25.435 1.00 35.92  ? 44  TYR B N   1 
ATOM   1928 C CA  . TYR B 2 44  ? 71.005 112.545 26.777 1.00 37.19  ? 44  TYR B CA  1 
ATOM   1929 C C   . TYR B 2 44  ? 69.876 113.542 27.019 1.00 35.86  ? 44  TYR B C   1 
ATOM   1930 O O   . TYR B 2 44  ? 69.535 113.850 28.162 1.00 34.28  ? 44  TYR B O   1 
ATOM   1931 C CB  . TYR B 2 44  ? 72.363 113.234 26.994 1.00 40.12  ? 44  TYR B CB  1 
ATOM   1932 C CG  . TYR B 2 44  ? 73.531 112.302 26.785 1.00 46.49  ? 44  TYR B CG  1 
ATOM   1933 C CD1 . TYR B 2 44  ? 73.959 111.967 25.493 1.00 48.30  ? 44  TYR B CD1 1 
ATOM   1934 C CD2 . TYR B 2 44  ? 74.158 111.677 27.872 1.00 49.25  ? 44  TYR B CD2 1 
ATOM   1935 C CE1 . TYR B 2 44  ? 74.978 111.025 25.286 1.00 51.12  ? 44  TYR B CE1 1 
ATOM   1936 C CE2 . TYR B 2 44  ? 75.177 110.728 27.676 1.00 51.49  ? 44  TYR B CE2 1 
ATOM   1937 C CZ  . TYR B 2 44  ? 75.577 110.408 26.381 1.00 51.98  ? 44  TYR B CZ  1 
ATOM   1938 O OH  . TYR B 2 44  ? 76.549 109.454 26.179 1.00 52.36  ? 44  TYR B OH  1 
ATOM   1939 N N   . THR B 2 45  ? 69.290 114.029 25.931 1.00 35.01  ? 45  THR B N   1 
ATOM   1940 C CA  . THR B 2 45  ? 68.207 114.999 26.003 1.00 34.67  ? 45  THR B CA  1 
ATOM   1941 C C   . THR B 2 45  ? 67.280 114.825 24.808 1.00 33.46  ? 45  THR B C   1 
ATOM   1942 O O   . THR B 2 45  ? 67.705 114.342 23.762 1.00 36.07  ? 45  THR B O   1 
ATOM   1943 C CB  . THR B 2 45  ? 68.769 116.438 26.003 1.00 35.51  ? 45  THR B CB  1 
ATOM   1944 O OG1 . THR B 2 45  ? 67.691 117.374 25.931 1.00 40.20  ? 45  THR B OG1 1 
ATOM   1945 C CG2 . THR B 2 45  ? 69.700 116.649 24.820 1.00 35.89  ? 45  THR B CG2 1 
ATOM   1946 N N   . PHE B 2 46  ? 66.016 115.205 24.954 1.00 31.95  ? 46  PHE B N   1 
ATOM   1947 C CA  . PHE B 2 46  ? 65.081 115.075 23.841 1.00 31.05  ? 46  PHE B CA  1 
ATOM   1948 C C   . PHE B 2 46  ? 63.948 116.088 23.913 1.00 31.50  ? 46  PHE B C   1 
ATOM   1949 O O   . PHE B 2 46  ? 63.451 116.418 24.991 1.00 31.31  ? 46  PHE B O   1 
ATOM   1950 C CB  . PHE B 2 46  ? 64.491 113.664 23.789 1.00 30.74  ? 46  PHE B CB  1 
ATOM   1951 C CG  . PHE B 2 46  ? 63.798 113.350 22.487 1.00 33.42  ? 46  PHE B CG  1 
ATOM   1952 C CD1 . PHE B 2 46  ? 64.496 112.757 21.434 1.00 32.26  ? 46  PHE B CD1 1 
ATOM   1953 C CD2 . PHE B 2 46  ? 62.461 113.699 22.290 1.00 30.52  ? 46  PHE B CD2 1 
ATOM   1954 C CE1 . PHE B 2 46  ? 63.878 112.527 20.205 1.00 30.28  ? 46  PHE B CE1 1 
ATOM   1955 C CE2 . PHE B 2 46  ? 61.839 113.473 21.066 1.00 29.11  ? 46  PHE B CE2 1 
ATOM   1956 C CZ  . PHE B 2 46  ? 62.548 112.884 20.022 1.00 30.01  ? 46  PHE B CZ  1 
ATOM   1957 N N   . SER B 2 47  ? 63.536 116.573 22.750 1.00 32.35  ? 47  SER B N   1 
ATOM   1958 C CA  . SER B 2 47  ? 62.465 117.556 22.675 1.00 34.47  ? 47  SER B CA  1 
ATOM   1959 C C   . SER B 2 47  ? 61.328 117.056 21.791 1.00 33.24  ? 47  SER B C   1 
ATOM   1960 O O   . SER B 2 47  ? 61.532 116.739 20.616 1.00 33.57  ? 47  SER B O   1 
ATOM   1961 C CB  . SER B 2 47  ? 63.009 118.880 22.127 1.00 35.46  ? 47  SER B CB  1 
ATOM   1962 O OG  . SER B 2 47  ? 62.034 119.905 22.207 1.00 37.99  ? 47  SER B OG  1 
ATOM   1963 N N   . LEU B 2 48  ? 60.128 116.998 22.360 1.00 30.58  ? 48  LEU B N   1 
ATOM   1964 C CA  . LEU B 2 48  ? 58.957 116.530 21.635 1.00 28.67  ? 48  LEU B CA  1 
ATOM   1965 C C   . LEU B 2 48  ? 58.608 117.383 20.422 1.00 28.96  ? 48  LEU B C   1 
ATOM   1966 O O   . LEU B 2 48  ? 58.110 116.864 19.425 1.00 26.46  ? 48  LEU B O   1 
ATOM   1967 C CB  . LEU B 2 48  ? 57.748 116.469 22.567 1.00 27.97  ? 48  LEU B CB  1 
ATOM   1968 C CG  . LEU B 2 48  ? 57.858 115.502 23.749 1.00 29.83  ? 48  LEU B CG  1 
ATOM   1969 C CD1 . LEU B 2 48  ? 56.519 115.390 24.469 1.00 28.97  ? 48  LEU B CD1 1 
ATOM   1970 C CD2 . LEU B 2 48  ? 58.294 114.144 23.240 1.00 28.51  ? 48  LEU B CD2 1 
ATOM   1971 N N   . ALA B 2 49  ? 58.867 118.686 20.503 1.00 29.86  ? 49  ALA B N   1 
ATOM   1972 C CA  . ALA B 2 49  ? 58.547 119.592 19.402 1.00 30.33  ? 49  ALA B CA  1 
ATOM   1973 C C   . ALA B 2 49  ? 59.167 119.139 18.090 1.00 30.36  ? 49  ALA B C   1 
ATOM   1974 O O   . ALA B 2 49  ? 58.576 119.329 17.034 1.00 33.95  ? 49  ALA B O   1 
ATOM   1975 C CB  . ALA B 2 49  ? 58.997 121.015 19.736 1.00 27.86  ? 49  ALA B CB  1 
ATOM   1976 N N   . THR B 2 50  ? 60.345 118.529 18.150 1.00 30.42  ? 50  THR B N   1 
ATOM   1977 C CA  . THR B 2 50  ? 61.009 118.078 16.933 1.00 31.64  ? 50  THR B CA  1 
ATOM   1978 C C   . THR B 2 50  ? 60.254 116.995 16.165 1.00 33.48  ? 50  THR B C   1 
ATOM   1979 O O   . THR B 2 50  ? 60.666 116.607 15.068 1.00 37.08  ? 50  THR B O   1 
ATOM   1980 C CB  . THR B 2 50  ? 62.432 117.559 17.224 1.00 31.67  ? 50  THR B CB  1 
ATOM   1981 O OG1 . THR B 2 50  ? 62.377 116.486 18.172 1.00 33.85  ? 50  THR B OG1 1 
ATOM   1982 C CG2 . THR B 2 50  ? 63.293 118.676 17.777 1.00 31.89  ? 50  THR B CG2 1 
ATOM   1983 N N   . LEU B 2 51  ? 59.151 116.513 16.732 1.00 32.55  ? 51  LEU B N   1 
ATOM   1984 C CA  . LEU B 2 51  ? 58.348 115.472 16.095 1.00 31.81  ? 51  LEU B CA  1 
ATOM   1985 C C   . LEU B 2 51  ? 57.063 116.013 15.478 1.00 31.36  ? 51  LEU B C   1 
ATOM   1986 O O   . LEU B 2 51  ? 56.326 115.277 14.827 1.00 28.93  ? 51  LEU B O   1 
ATOM   1987 C CB  . LEU B 2 51  ? 57.983 114.387 17.108 1.00 32.11  ? 51  LEU B CB  1 
ATOM   1988 C CG  . LEU B 2 51  ? 59.091 113.471 17.624 1.00 33.70  ? 51  LEU B CG  1 
ATOM   1989 C CD1 . LEU B 2 51  ? 58.490 112.477 18.615 1.00 34.53  ? 51  LEU B CD1 1 
ATOM   1990 C CD2 . LEU B 2 51  ? 59.740 112.737 16.461 1.00 32.04  ? 51  LEU B CD2 1 
ATOM   1991 N N   . MET B 2 52  ? 56.789 117.295 15.687 1.00 32.33  ? 52  MET B N   1 
ATOM   1992 C CA  . MET B 2 52  ? 55.581 117.899 15.137 1.00 33.47  ? 52  MET B CA  1 
ATOM   1993 C C   . MET B 2 52  ? 55.424 117.653 13.641 1.00 33.09  ? 52  MET B C   1 
ATOM   1994 O O   . MET B 2 52  ? 54.314 117.514 13.145 1.00 32.90  ? 52  MET B O   1 
ATOM   1995 C CB  . MET B 2 52  ? 55.554 119.393 15.447 1.00 30.98  ? 52  MET B CB  1 
ATOM   1996 C CG  . MET B 2 52  ? 55.441 119.659 16.931 1.00 33.51  ? 52  MET B CG  1 
ATOM   1997 S SD  . MET B 2 52  ? 55.166 121.367 17.395 1.00 36.43  ? 52  MET B SD  1 
ATOM   1998 C CE  . MET B 2 52  ? 53.376 121.449 17.311 1.00 36.22  ? 52  MET B CE  1 
ATOM   1999 N N   . PRO B 2 53  ? 56.537 117.593 12.900 1.00 35.75  ? 53  PRO B N   1 
ATOM   2000 C CA  . PRO B 2 53  ? 56.417 117.349 11.460 1.00 36.77  ? 53  PRO B CA  1 
ATOM   2001 C C   . PRO B 2 53  ? 55.711 116.032 11.121 1.00 37.86  ? 53  PRO B C   1 
ATOM   2002 O O   . PRO B 2 53  ? 55.127 115.889 10.051 1.00 39.27  ? 53  PRO B O   1 
ATOM   2003 C CB  . PRO B 2 53  ? 57.869 117.351 10.993 1.00 35.44  ? 53  PRO B CB  1 
ATOM   2004 C CG  . PRO B 2 53  ? 58.503 118.349 11.909 1.00 37.45  ? 53  PRO B CG  1 
ATOM   2005 C CD  . PRO B 2 53  ? 57.920 117.974 13.252 1.00 36.92  ? 53  PRO B CD  1 
ATOM   2006 N N   . TYR B 2 54  ? 55.764 115.068 12.032 1.00 39.75  ? 54  TYR B N   1 
ATOM   2007 C CA  . TYR B 2 54  ? 55.135 113.776 11.783 1.00 41.21  ? 54  TYR B CA  1 
ATOM   2008 C C   . TYR B 2 54  ? 53.718 113.723 12.340 1.00 42.87  ? 54  TYR B C   1 
ATOM   2009 O O   . TYR B 2 54  ? 53.460 113.110 13.370 1.00 44.60  ? 54  TYR B O   1 
ATOM   2010 C CB  . TYR B 2 54  ? 56.000 112.665 12.375 1.00 38.92  ? 54  TYR B CB  1 
ATOM   2011 C CG  . TYR B 2 54  ? 57.453 112.800 11.983 1.00 38.87  ? 54  TYR B CG  1 
ATOM   2012 C CD1 . TYR B 2 54  ? 58.332 113.570 12.745 1.00 41.73  ? 54  TYR B CD1 1 
ATOM   2013 C CD2 . TYR B 2 54  ? 57.939 112.211 10.821 1.00 39.39  ? 54  TYR B CD2 1 
ATOM   2014 C CE1 . TYR B 2 54  ? 59.659 113.753 12.355 1.00 43.29  ? 54  TYR B CE1 1 
ATOM   2015 C CE2 . TYR B 2 54  ? 59.261 112.389 10.421 1.00 42.17  ? 54  TYR B CE2 1 
ATOM   2016 C CZ  . TYR B 2 54  ? 60.115 113.162 11.191 1.00 43.05  ? 54  TYR B CZ  1 
ATOM   2017 O OH  . TYR B 2 54  ? 61.418 113.357 10.786 1.00 41.33  ? 54  TYR B OH  1 
ATOM   2018 N N   . THR B 2 55  ? 52.806 114.376 11.629 1.00 45.59  ? 55  THR B N   1 
ATOM   2019 C CA  . THR B 2 55  ? 51.397 114.463 12.006 1.00 46.73  ? 55  THR B CA  1 
ATOM   2020 C C   . THR B 2 55  ? 50.692 113.114 12.089 1.00 46.17  ? 55  THR B C   1 
ATOM   2021 O O   . THR B 2 55  ? 49.479 113.058 12.295 1.00 45.36  ? 55  THR B O   1 
ATOM   2022 C CB  . THR B 2 55  ? 50.619 115.323 10.993 1.00 48.46  ? 55  THR B CB  1 
ATOM   2023 O OG1 . THR B 2 55  ? 50.472 114.593 9.763  1.00 48.00  ? 55  THR B OG1 1 
ATOM   2024 C CG2 . THR B 2 55  ? 51.368 116.628 10.716 1.00 46.63  ? 55  THR B CG2 1 
ATOM   2025 N N   . ARG B 2 56  ? 51.443 112.030 11.929 1.00 46.57  ? 56  ARG B N   1 
ATOM   2026 C CA  . ARG B 2 56  ? 50.856 110.697 11.968 1.00 45.19  ? 56  ARG B CA  1 
ATOM   2027 C C   . ARG B 2 56  ? 51.400 109.823 13.104 1.00 42.14  ? 56  ARG B C   1 
ATOM   2028 O O   . ARG B 2 56  ? 50.925 108.708 13.321 1.00 40.24  ? 56  ARG B O   1 
ATOM   2029 C CB  . ARG B 2 56  ? 51.107 109.998 10.633 1.00 47.70  ? 56  ARG B CB  1 
ATOM   2030 C CG  . ARG B 2 56  ? 49.901 109.300 10.049 1.00 53.66  ? 56  ARG B CG  1 
ATOM   2031 C CD  . ARG B 2 56  ? 49.119 110.242 9.157  1.00 57.16  ? 56  ARG B CD  1 
ATOM   2032 N NE  . ARG B 2 56  ? 48.981 109.700 7.806  1.00 58.65  ? 56  ARG B NE  1 
ATOM   2033 C CZ  . ARG B 2 56  ? 48.466 110.372 6.779  1.00 59.97  ? 56  ARG B CZ  1 
ATOM   2034 N NH1 . ARG B 2 56  ? 48.033 111.622 6.934  1.00 60.18  ? 56  ARG B NH1 1 
ATOM   2035 N NH2 . ARG B 2 56  ? 48.379 109.791 5.592  1.00 59.84  ? 56  ARG B NH2 1 
ATOM   2036 N N   . LEU B 2 57  ? 52.389 110.330 13.831 1.00 38.67  ? 57  LEU B N   1 
ATOM   2037 C CA  . LEU B 2 57  ? 52.999 109.568 14.916 1.00 37.60  ? 57  LEU B CA  1 
ATOM   2038 C C   . LEU B 2 57  ? 52.016 109.191 16.030 1.00 35.90  ? 57  LEU B C   1 
ATOM   2039 O O   . LEU B 2 57  ? 51.366 110.067 16.604 1.00 34.92  ? 57  LEU B O   1 
ATOM   2040 C CB  . LEU B 2 57  ? 54.160 110.364 15.512 1.00 35.97  ? 57  LEU B CB  1 
ATOM   2041 C CG  . LEU B 2 57  ? 55.115 109.595 16.426 1.00 36.46  ? 57  LEU B CG  1 
ATOM   2042 C CD1 . LEU B 2 57  ? 55.757 108.463 15.638 1.00 35.91  ? 57  LEU B CD1 1 
ATOM   2043 C CD2 . LEU B 2 57  ? 56.189 110.542 16.973 1.00 36.68  ? 57  LEU B CD2 1 
ATOM   2044 N N   . THR B 2 58  ? 51.912 107.893 16.331 1.00 33.92  ? 58  THR B N   1 
ATOM   2045 C CA  . THR B 2 58  ? 51.018 107.424 17.392 1.00 34.33  ? 58  THR B CA  1 
ATOM   2046 C C   . THR B 2 58  ? 51.729 106.665 18.516 1.00 34.67  ? 58  THR B C   1 
ATOM   2047 O O   . THR B 2 58  ? 51.170 106.486 19.600 1.00 34.73  ? 58  THR B O   1 
ATOM   2048 C CB  . THR B 2 58  ? 49.889 106.517 16.852 1.00 32.51  ? 58  THR B CB  1 
ATOM   2049 O OG1 . THR B 2 58  ? 50.450 105.349 16.250 1.00 35.75  ? 58  THR B OG1 1 
ATOM   2050 C CG2 . THR B 2 58  ? 49.053 107.254 15.838 1.00 29.05  ? 58  THR B CG2 1 
ATOM   2051 N N   . GLN B 2 59  ? 52.948 106.206 18.255 1.00 35.43  ? 59  GLN B N   1 
ATOM   2052 C CA  . GLN B 2 59  ? 53.727 105.490 19.264 1.00 37.85  ? 59  GLN B CA  1 
ATOM   2053 C C   . GLN B 2 59  ? 55.160 105.965 19.203 1.00 37.35  ? 59  GLN B C   1 
ATOM   2054 O O   . GLN B 2 59  ? 55.725 106.113 18.122 1.00 39.27  ? 59  GLN B O   1 
ATOM   2055 C CB  . GLN B 2 59  ? 53.707 103.984 19.027 1.00 40.36  ? 59  GLN B CB  1 
ATOM   2056 C CG  . GLN B 2 59  ? 52.340 103.357 19.139 1.00 46.52  ? 59  GLN B CG  1 
ATOM   2057 C CD  . GLN B 2 59  ? 52.367 101.883 18.804 1.00 50.69  ? 59  GLN B CD  1 
ATOM   2058 O OE1 . GLN B 2 59  ? 51.331 101.281 18.539 1.00 56.13  ? 59  GLN B OE1 1 
ATOM   2059 N NE2 . GLN B 2 59  ? 53.557 101.291 18.823 1.00 50.05  ? 59  GLN B NE2 1 
ATOM   2060 N N   . LEU B 2 60  ? 55.750 106.200 20.366 1.00 35.98  ? 60  LEU B N   1 
ATOM   2061 C CA  . LEU B 2 60  ? 57.121 106.667 20.426 1.00 36.68  ? 60  LEU B CA  1 
ATOM   2062 C C   . LEU B 2 60  ? 57.865 105.986 21.560 1.00 37.48  ? 60  LEU B C   1 
ATOM   2063 O O   . LEU B 2 60  ? 57.429 106.030 22.708 1.00 38.75  ? 60  LEU B O   1 
ATOM   2064 C CB  . LEU B 2 60  ? 57.151 108.182 20.639 1.00 37.32  ? 60  LEU B CB  1 
ATOM   2065 C CG  . LEU B 2 60  ? 58.550 108.798 20.666 1.00 37.74  ? 60  LEU B CG  1 
ATOM   2066 C CD1 . LEU B 2 60  ? 59.190 108.666 19.286 1.00 36.61  ? 60  LEU B CD1 1 
ATOM   2067 C CD2 . LEU B 2 60  ? 58.465 110.254 21.085 1.00 36.18  ? 60  LEU B CD2 1 
ATOM   2068 N N   . ASN B 2 61  ? 58.994 105.362 21.234 1.00 36.92  ? 61  ASN B N   1 
ATOM   2069 C CA  . ASN B 2 61  ? 59.799 104.676 22.235 1.00 34.55  ? 61  ASN B CA  1 
ATOM   2070 C C   . ASN B 2 61  ? 61.159 105.328 22.461 1.00 34.59  ? 61  ASN B C   1 
ATOM   2071 O O   . ASN B 2 61  ? 62.014 105.352 21.572 1.00 32.95  ? 61  ASN B O   1 
ATOM   2072 C CB  . ASN B 2 61  ? 59.972 103.214 21.839 1.00 35.02  ? 61  ASN B CB  1 
ATOM   2073 C CG  . ASN B 2 61  ? 58.666 102.460 21.866 1.00 35.39  ? 61  ASN B CG  1 
ATOM   2074 O OD1 . ASN B 2 61  ? 58.262 101.862 20.878 1.00 35.30  ? 61  ASN B OD1 1 
ATOM   2075 N ND2 . ASN B 2 61  ? 57.992 102.492 23.004 1.00 37.32  ? 61  ASN B ND2 1 
ATOM   2076 N N   . LEU B 2 62  ? 61.341 105.868 23.662 1.00 34.78  ? 62  LEU B N   1 
ATOM   2077 C CA  . LEU B 2 62  ? 62.586 106.516 24.042 1.00 34.84  ? 62  LEU B CA  1 
ATOM   2078 C C   . LEU B 2 62  ? 63.150 105.811 25.260 1.00 34.49  ? 62  LEU B C   1 
ATOM   2079 O O   . LEU B 2 62  ? 63.862 106.411 26.061 1.00 35.35  ? 62  LEU B O   1 
ATOM   2080 C CB  . LEU B 2 62  ? 62.345 107.988 24.381 1.00 37.12  ? 62  LEU B CB  1 
ATOM   2081 C CG  . LEU B 2 62  ? 62.042 108.925 23.209 1.00 40.29  ? 62  LEU B CG  1 
ATOM   2082 C CD1 . LEU B 2 62  ? 61.830 110.337 23.726 1.00 38.90  ? 62  LEU B CD1 1 
ATOM   2083 C CD2 . LEU B 2 62  ? 63.199 108.894 22.212 1.00 40.56  ? 62  LEU B CD2 1 
ATOM   2084 N N   . ASP B 2 63  ? 62.816 104.536 25.401 1.00 32.73  ? 63  ASP B N   1 
ATOM   2085 C CA  . ASP B 2 63  ? 63.284 103.741 26.526 1.00 32.38  ? 63  ASP B CA  1 
ATOM   2086 C C   . ASP B 2 63  ? 64.759 103.336 26.406 1.00 32.93  ? 63  ASP B C   1 
ATOM   2087 O O   . ASP B 2 63  ? 65.325 103.277 25.310 1.00 30.50  ? 63  ASP B O   1 
ATOM   2088 C CB  . ASP B 2 63  ? 62.431 102.476 26.650 1.00 30.72  ? 63  ASP B CB  1 
ATOM   2089 C CG  . ASP B 2 63  ? 62.426 101.649 25.365 1.00 32.13  ? 63  ASP B CG  1 
ATOM   2090 O OD1 . ASP B 2 63  ? 61.869 102.128 24.355 1.00 32.51  ? 63  ASP B OD1 1 
ATOM   2091 O OD2 . ASP B 2 63  ? 62.988 100.531 25.358 1.00 29.88  ? 63  ASP B OD2 1 
ATOM   2092 N N   . ARG B 2 64  ? 65.369 103.059 27.554 1.00 32.98  ? 64  ARG B N   1 
ATOM   2093 C CA  . ARG B 2 64  ? 66.748 102.607 27.614 1.00 33.57  ? 64  ARG B CA  1 
ATOM   2094 C C   . ARG B 2 64  ? 67.752 103.480 26.876 1.00 34.45  ? 64  ARG B C   1 
ATOM   2095 O O   . ARG B 2 64  ? 68.568 102.990 26.095 1.00 35.01  ? 64  ARG B O   1 
ATOM   2096 C CB  . ARG B 2 64  ? 66.830 101.165 27.102 1.00 33.54  ? 64  ARG B CB  1 
ATOM   2097 C CG  . ARG B 2 64  ? 66.001 100.193 27.944 1.00 37.91  ? 64  ARG B CG  1 
ATOM   2098 C CD  . ARG B 2 64  ? 65.979 98.786  27.369 1.00 36.51  ? 64  ARG B CD  1 
ATOM   2099 N NE  . ARG B 2 64  ? 65.193 97.867  28.190 1.00 35.83  ? 64  ARG B NE  1 
ATOM   2100 C CZ  . ARG B 2 64  ? 63.888 97.991  28.432 1.00 36.18  ? 64  ARG B CZ  1 
ATOM   2101 N NH1 . ARG B 2 64  ? 63.194 99.002  27.921 1.00 32.46  ? 64  ARG B NH1 1 
ATOM   2102 N NH2 . ARG B 2 64  ? 63.266 97.092  29.184 1.00 36.67  ? 64  ARG B NH2 1 
ATOM   2103 N N   . CYS B 2 65  ? 67.689 104.780 27.126 1.00 35.54  ? 65  CYS B N   1 
ATOM   2104 C CA  . CYS B 2 65  ? 68.621 105.713 26.520 1.00 36.18  ? 65  CYS B CA  1 
ATOM   2105 C C   . CYS B 2 65  ? 69.374 106.375 27.662 1.00 38.53  ? 65  CYS B C   1 
ATOM   2106 O O   . CYS B 2 65  ? 69.520 105.782 28.735 1.00 38.77  ? 65  CYS B O   1 
ATOM   2107 C CB  . CYS B 2 65  ? 67.878 106.750 25.678 1.00 34.93  ? 65  CYS B CB  1 
ATOM   2108 S SG  . CYS B 2 65  ? 67.218 106.094 24.123 1.00 38.31  ? 65  CYS B SG  1 
ATOM   2109 N N   . GLU B 2 66  ? 69.841 107.599 27.442 1.00 39.03  ? 66  GLU B N   1 
ATOM   2110 C CA  . GLU B 2 66  ? 70.592 108.322 28.460 1.00 40.01  ? 66  GLU B CA  1 
ATOM   2111 C C   . GLU B 2 66  ? 69.895 109.633 28.788 1.00 40.36  ? 66  GLU B C   1 
ATOM   2112 O O   . GLU B 2 66  ? 70.544 110.630 29.123 1.00 39.41  ? 66  GLU B O   1 
ATOM   2113 C CB  . GLU B 2 66  ? 72.005 108.613 27.944 1.00 42.03  ? 66  GLU B CB  1 
ATOM   2114 C CG  . GLU B 2 66  ? 72.742 107.396 27.396 1.00 42.55  ? 66  GLU B CG  1 
ATOM   2115 C CD  . GLU B 2 66  ? 73.098 106.391 28.473 1.00 42.18  ? 66  GLU B CD  1 
ATOM   2116 O OE1 . GLU B 2 66  ? 73.576 105.291 28.123 1.00 43.03  ? 66  GLU B OE1 1 
ATOM   2117 O OE2 . GLU B 2 66  ? 72.904 106.703 29.667 1.00 43.68  ? 66  GLU B OE2 1 
ATOM   2118 N N   . LEU B 2 67  ? 68.570 109.631 28.687 1.00 39.34  ? 67  LEU B N   1 
ATOM   2119 C CA  . LEU B 2 67  ? 67.789 110.835 28.942 1.00 37.88  ? 67  LEU B CA  1 
ATOM   2120 C C   . LEU B 2 67  ? 67.882 111.376 30.361 1.00 37.34  ? 67  LEU B C   1 
ATOM   2121 O O   . LEU B 2 67  ? 67.504 110.706 31.328 1.00 37.35  ? 67  LEU B O   1 
ATOM   2122 C CB  . LEU B 2 67  ? 66.323 110.595 28.590 1.00 36.36  ? 67  LEU B CB  1 
ATOM   2123 C CG  . LEU B 2 67  ? 66.056 110.455 27.097 1.00 38.28  ? 67  LEU B CG  1 
ATOM   2124 C CD1 . LEU B 2 67  ? 64.592 110.151 26.880 1.00 39.98  ? 67  LEU B CD1 1 
ATOM   2125 C CD2 . LEU B 2 67  ? 66.452 111.737 26.373 1.00 36.48  ? 67  LEU B CD2 1 
ATOM   2126 N N   . THR B 2 68  ? 68.392 112.598 30.470 1.00 34.20  ? 68  THR B N   1 
ATOM   2127 C CA  . THR B 2 68  ? 68.514 113.267 31.752 1.00 33.30  ? 68  THR B CA  1 
ATOM   2128 C C   . THR B 2 68  ? 67.566 114.452 31.740 1.00 33.25  ? 68  THR B C   1 
ATOM   2129 O O   . THR B 2 68  ? 67.335 115.087 32.761 1.00 34.72  ? 68  THR B O   1 
ATOM   2130 C CB  . THR B 2 68  ? 69.956 113.787 32.007 1.00 32.30  ? 68  THR B CB  1 
ATOM   2131 O OG1 . THR B 2 68  ? 70.315 114.753 31.011 1.00 34.65  ? 68  THR B OG1 1 
ATOM   2132 C CG2 . THR B 2 68  ? 70.950 112.644 31.976 1.00 33.45  ? 68  THR B CG2 1 
ATOM   2133 N N   . LYS B 2 69  ? 67.002 114.731 30.572 1.00 34.64  ? 69  LYS B N   1 
ATOM   2134 C CA  . LYS B 2 69  ? 66.095 115.855 30.415 1.00 34.30  ? 69  LYS B CA  1 
ATOM   2135 C C   . LYS B 2 69  ? 65.158 115.651 29.229 1.00 32.24  ? 69  LYS B C   1 
ATOM   2136 O O   . LYS B 2 69  ? 65.569 115.168 28.179 1.00 33.42  ? 69  LYS B O   1 
ATOM   2137 C CB  . LYS B 2 69  ? 66.925 117.130 30.234 1.00 38.42  ? 69  LYS B CB  1 
ATOM   2138 C CG  . LYS B 2 69  ? 66.135 118.392 29.954 1.00 45.00  ? 69  LYS B CG  1 
ATOM   2139 C CD  . LYS B 2 69  ? 66.996 119.632 30.198 1.00 47.47  ? 69  LYS B CD  1 
ATOM   2140 C CE  . LYS B 2 69  ? 66.437 120.845 29.474 1.00 48.34  ? 69  LYS B CE  1 
ATOM   2141 N NZ  . LYS B 2 69  ? 66.557 120.672 27.994 1.00 51.41  ? 69  LYS B NZ  1 
ATOM   2142 N N   . LEU B 2 70  ? 63.890 115.999 29.411 1.00 30.72  ? 70  LEU B N   1 
ATOM   2143 C CA  . LEU B 2 70  ? 62.891 115.873 28.355 1.00 29.68  ? 70  LEU B CA  1 
ATOM   2144 C C   . LEU B 2 70  ? 62.116 117.179 28.243 1.00 32.88  ? 70  LEU B C   1 
ATOM   2145 O O   . LEU B 2 70  ? 61.483 117.616 29.205 1.00 33.08  ? 70  LEU B O   1 
ATOM   2146 C CB  . LEU B 2 70  ? 61.912 114.739 28.665 1.00 26.62  ? 70  LEU B CB  1 
ATOM   2147 C CG  . LEU B 2 70  ? 60.739 114.598 27.694 1.00 25.16  ? 70  LEU B CG  1 
ATOM   2148 C CD1 . LEU B 2 70  ? 61.231 113.970 26.405 1.00 29.62  ? 70  LEU B CD1 1 
ATOM   2149 C CD2 . LEU B 2 70  ? 59.642 113.752 28.299 1.00 22.81  ? 70  LEU B CD2 1 
ATOM   2150 N N   . GLN B 2 71  ? 62.166 117.809 27.072 1.00 36.27  ? 71  GLN B N   1 
ATOM   2151 C CA  . GLN B 2 71  ? 61.433 119.056 26.870 1.00 40.01  ? 71  GLN B CA  1 
ATOM   2152 C C   . GLN B 2 71  ? 60.024 118.761 26.382 1.00 39.83  ? 71  GLN B C   1 
ATOM   2153 O O   . GLN B 2 71  ? 59.834 118.029 25.410 1.00 40.73  ? 71  GLN B O   1 
ATOM   2154 C CB  . GLN B 2 71  ? 62.136 119.961 25.851 1.00 42.66  ? 71  GLN B CB  1 
ATOM   2155 C CG  . GLN B 2 71  ? 63.508 120.458 26.274 1.00 46.58  ? 71  GLN B CG  1 
ATOM   2156 C CD  . GLN B 2 71  ? 63.935 121.683 25.490 1.00 49.33  ? 71  GLN B CD  1 
ATOM   2157 O OE1 . GLN B 2 71  ? 65.122 121.894 25.242 1.00 51.03  ? 71  GLN B OE1 1 
ATOM   2158 N NE2 . GLN B 2 71  ? 62.965 122.509 25.111 1.00 50.86  ? 71  GLN B NE2 1 
ATOM   2159 N N   . VAL B 2 72  ? 59.038 119.331 27.061 1.00 40.02  ? 72  VAL B N   1 
ATOM   2160 C CA  . VAL B 2 72  ? 57.646 119.129 26.688 1.00 41.43  ? 72  VAL B CA  1 
ATOM   2161 C C   . VAL B 2 72  ? 57.136 120.387 25.994 1.00 41.81  ? 72  VAL B C   1 
ATOM   2162 O O   . VAL B 2 72  ? 56.576 121.281 26.628 1.00 42.73  ? 72  VAL B O   1 
ATOM   2163 C CB  . VAL B 2 72  ? 56.797 118.818 27.939 1.00 40.40  ? 72  VAL B CB  1 
ATOM   2164 C CG1 . VAL B 2 72  ? 55.340 118.591 27.554 1.00 41.31  ? 72  VAL B CG1 1 
ATOM   2165 C CG2 . VAL B 2 72  ? 57.359 117.598 28.639 1.00 37.27  ? 72  VAL B CG2 1 
ATOM   2166 N N   . ASP B 2 73  ? 57.343 120.436 24.682 1.00 43.30  ? 73  ASP B N   1 
ATOM   2167 C CA  . ASP B 2 73  ? 56.959 121.579 23.860 1.00 45.81  ? 73  ASP B CA  1 
ATOM   2168 C C   . ASP B 2 73  ? 56.064 121.212 22.678 1.00 45.98  ? 73  ASP B C   1 
ATOM   2169 O O   . ASP B 2 73  ? 56.087 120.083 22.186 1.00 48.00  ? 73  ASP B O   1 
ATOM   2170 C CB  . ASP B 2 73  ? 58.224 122.278 23.355 1.00 48.97  ? 73  ASP B CB  1 
ATOM   2171 C CG  . ASP B 2 73  ? 59.341 121.293 23.009 1.00 52.97  ? 73  ASP B CG  1 
ATOM   2172 O OD1 . ASP B 2 73  ? 60.477 121.747 22.743 1.00 57.56  ? 73  ASP B OD1 1 
ATOM   2173 O OD2 . ASP B 2 73  ? 59.091 120.066 23.002 1.00 52.12  ? 73  ASP B OD2 1 
ATOM   2174 N N   . GLY B 2 74  ? 55.280 122.179 22.217 1.00 45.37  ? 74  GLY B N   1 
ATOM   2175 C CA  . GLY B 2 74  ? 54.381 121.926 21.106 1.00 45.74  ? 74  GLY B CA  1 
ATOM   2176 C C   . GLY B 2 74  ? 53.349 120.872 21.466 1.00 44.96  ? 74  GLY B C   1 
ATOM   2177 O O   . GLY B 2 74  ? 52.986 120.728 22.636 1.00 46.67  ? 74  GLY B O   1 
ATOM   2178 N N   . THR B 2 75  ? 52.872 120.134 20.469 1.00 41.48  ? 75  THR B N   1 
ATOM   2179 C CA  . THR B 2 75  ? 51.880 119.100 20.710 1.00 40.72  ? 75  THR B CA  1 
ATOM   2180 C C   . THR B 2 75  ? 51.900 118.012 19.641 1.00 41.42  ? 75  THR B C   1 
ATOM   2181 O O   . THR B 2 75  ? 52.063 118.289 18.449 1.00 40.88  ? 75  THR B O   1 
ATOM   2182 C CB  . THR B 2 75  ? 50.443 119.683 20.767 1.00 40.19  ? 75  THR B CB  1 
ATOM   2183 O OG1 . THR B 2 75  ? 50.189 120.445 19.583 1.00 38.09  ? 75  THR B OG1 1 
ATOM   2184 C CG2 . THR B 2 75  ? 50.263 120.578 21.975 1.00 40.00  ? 75  THR B CG2 1 
ATOM   2185 N N   . LEU B 2 76  ? 51.742 116.769 20.091 1.00 39.80  ? 76  LEU B N   1 
ATOM   2186 C CA  . LEU B 2 76  ? 51.698 115.608 19.211 1.00 37.60  ? 76  LEU B CA  1 
ATOM   2187 C C   . LEU B 2 76  ? 50.305 115.033 19.474 1.00 37.35  ? 76  LEU B C   1 
ATOM   2188 O O   . LEU B 2 76  ? 50.151 113.975 20.081 1.00 38.71  ? 76  LEU B O   1 
ATOM   2189 C CB  . LEU B 2 76  ? 52.795 114.618 19.606 1.00 34.73  ? 76  LEU B CB  1 
ATOM   2190 C CG  . LEU B 2 76  ? 54.198 115.225 19.739 1.00 33.36  ? 76  LEU B CG  1 
ATOM   2191 C CD1 . LEU B 2 76  ? 55.192 114.166 20.196 1.00 32.75  ? 76  LEU B CD1 1 
ATOM   2192 C CD2 . LEU B 2 76  ? 54.631 115.809 18.414 1.00 32.11  ? 76  LEU B CD2 1 
ATOM   2193 N N   . PRO B 2 77  ? 49.270 115.736 18.993 1.00 37.10  ? 77  PRO B N   1 
ATOM   2194 C CA  . PRO B 2 77  ? 47.837 115.435 19.113 1.00 36.93  ? 77  PRO B CA  1 
ATOM   2195 C C   . PRO B 2 77  ? 47.369 114.009 18.845 1.00 35.15  ? 77  PRO B C   1 
ATOM   2196 O O   . PRO B 2 77  ? 46.265 113.630 19.237 1.00 31.90  ? 77  PRO B O   1 
ATOM   2197 C CB  . PRO B 2 77  ? 47.203 116.426 18.142 1.00 35.32  ? 77  PRO B CB  1 
ATOM   2198 C CG  . PRO B 2 77  ? 48.229 116.520 17.072 1.00 35.26  ? 77  PRO B CG  1 
ATOM   2199 C CD  . PRO B 2 77  ? 49.490 116.680 17.880 1.00 37.36  ? 77  PRO B CD  1 
ATOM   2200 N N   . VAL B 2 78  ? 48.206 113.219 18.193 1.00 35.18  ? 78  VAL B N   1 
ATOM   2201 C CA  . VAL B 2 78  ? 47.823 111.859 17.846 1.00 36.02  ? 78  VAL B CA  1 
ATOM   2202 C C   . VAL B 2 78  ? 48.635 110.779 18.568 1.00 35.41  ? 78  VAL B C   1 
ATOM   2203 O O   . VAL B 2 78  ? 48.395 109.585 18.395 1.00 36.44  ? 78  VAL B O   1 
ATOM   2204 C CB  . VAL B 2 78  ? 47.895 111.712 16.284 1.00 36.97  ? 78  VAL B CB  1 
ATOM   2205 C CG1 . VAL B 2 78  ? 48.171 110.297 15.862 1.00 35.67  ? 78  VAL B CG1 1 
ATOM   2206 C CG2 . VAL B 2 78  ? 46.576 112.180 15.674 1.00 35.42  ? 78  VAL B CG2 1 
ATOM   2207 N N   . LEU B 2 79  ? 49.571 111.192 19.412 1.00 34.42  ? 79  LEU B N   1 
ATOM   2208 C CA  . LEU B 2 79  ? 50.395 110.220 20.113 1.00 34.92  ? 79  LEU B CA  1 
ATOM   2209 C C   . LEU B 2 79  ? 49.663 109.630 21.317 1.00 35.83  ? 79  LEU B C   1 
ATOM   2210 O O   . LEU B 2 79  ? 49.179 110.361 22.181 1.00 35.30  ? 79  LEU B O   1 
ATOM   2211 C CB  . LEU B 2 79  ? 51.706 110.870 20.561 1.00 34.33  ? 79  LEU B CB  1 
ATOM   2212 C CG  . LEU B 2 79  ? 52.806 109.919 21.042 1.00 36.12  ? 79  LEU B CG  1 
ATOM   2213 C CD1 . LEU B 2 79  ? 53.463 109.246 19.839 1.00 33.92  ? 79  LEU B CD1 1 
ATOM   2214 C CD2 . LEU B 2 79  ? 53.837 110.689 21.855 1.00 34.57  ? 79  LEU B CD2 1 
ATOM   2215 N N   . GLY B 2 80  ? 49.582 108.303 21.366 1.00 36.28  ? 80  GLY B N   1 
ATOM   2216 C CA  . GLY B 2 80  ? 48.910 107.645 22.475 1.00 37.23  ? 80  GLY B CA  1 
ATOM   2217 C C   . GLY B 2 80  ? 49.803 106.697 23.262 1.00 37.74  ? 80  GLY B C   1 
ATOM   2218 O O   . GLY B 2 80  ? 49.388 106.148 24.276 1.00 39.70  ? 80  GLY B O   1 
ATOM   2219 N N   . THR B 2 81  ? 51.035 106.508 22.807 1.00 36.66  ? 81  THR B N   1 
ATOM   2220 C CA  . THR B 2 81  ? 51.962 105.611 23.477 1.00 35.17  ? 81  THR B CA  1 
ATOM   2221 C C   . THR B 2 81  ? 53.343 106.229 23.606 1.00 34.47  ? 81  THR B C   1 
ATOM   2222 O O   . THR B 2 81  ? 53.963 106.617 22.609 1.00 31.24  ? 81  THR B O   1 
ATOM   2223 C CB  . THR B 2 81  ? 52.080 104.292 22.704 1.00 37.79  ? 81  THR B CB  1 
ATOM   2224 O OG1 . THR B 2 81  ? 50.867 103.544 22.859 1.00 40.14  ? 81  THR B OG1 1 
ATOM   2225 C CG2 . THR B 2 81  ? 53.263 103.477 23.201 1.00 38.18  ? 81  THR B CG2 1 
ATOM   2226 N N   . LEU B 2 82  ? 53.819 106.313 24.844 1.00 33.00  ? 82  LEU B N   1 
ATOM   2227 C CA  . LEU B 2 82  ? 55.128 106.880 25.123 1.00 32.13  ? 82  LEU B CA  1 
ATOM   2228 C C   . LEU B 2 82  ? 55.852 106.064 26.182 1.00 33.51  ? 82  LEU B C   1 
ATOM   2229 O O   . LEU B 2 82  ? 55.380 105.951 27.319 1.00 32.91  ? 82  LEU B O   1 
ATOM   2230 C CB  . LEU B 2 82  ? 54.983 108.318 25.607 1.00 31.32  ? 82  LEU B CB  1 
ATOM   2231 C CG  . LEU B 2 82  ? 56.295 109.077 25.799 1.00 32.09  ? 82  LEU B CG  1 
ATOM   2232 C CD1 . LEU B 2 82  ? 57.039 109.157 24.466 1.00 29.88  ? 82  LEU B CD1 1 
ATOM   2233 C CD2 . LEU B 2 82  ? 55.998 110.475 26.354 1.00 31.36  ? 82  LEU B CD2 1 
ATOM   2234 N N   . ASP B 2 83  ? 56.998 105.500 25.798 1.00 34.51  ? 83  ASP B N   1 
ATOM   2235 C CA  . ASP B 2 83  ? 57.823 104.687 26.690 1.00 34.23  ? 83  ASP B CA  1 
ATOM   2236 C C   . ASP B 2 83  ? 59.065 105.483 27.079 1.00 33.57  ? 83  ASP B C   1 
ATOM   2237 O O   . ASP B 2 83  ? 59.910 105.769 26.229 1.00 33.48  ? 83  ASP B O   1 
ATOM   2238 C CB  . ASP B 2 83  ? 58.253 103.405 25.978 1.00 35.76  ? 83  ASP B CB  1 
ATOM   2239 C CG  . ASP B 2 83  ? 58.663 102.307 26.943 1.00 34.99  ? 83  ASP B CG  1 
ATOM   2240 O OD1 . ASP B 2 83  ? 59.030 102.614 28.093 1.00 32.50  ? 83  ASP B OD1 1 
ATOM   2241 O OD2 . ASP B 2 83  ? 58.628 101.129 26.539 1.00 36.17  ? 83  ASP B OD2 1 
ATOM   2242 N N   . LEU B 2 84  ? 59.167 105.840 28.357 1.00 33.05  ? 84  LEU B N   1 
ATOM   2243 C CA  . LEU B 2 84  ? 60.301 106.614 28.859 1.00 34.13  ? 84  LEU B CA  1 
ATOM   2244 C C   . LEU B 2 84  ? 61.074 105.845 29.925 1.00 34.26  ? 84  LEU B C   1 
ATOM   2245 O O   . LEU B 2 84  ? 61.924 106.407 30.614 1.00 36.85  ? 84  LEU B O   1 
ATOM   2246 C CB  . LEU B 2 84  ? 59.821 107.941 29.463 1.00 33.52  ? 84  LEU B CB  1 
ATOM   2247 C CG  . LEU B 2 84  ? 59.165 108.995 28.564 1.00 33.76  ? 84  LEU B CG  1 
ATOM   2248 C CD1 . LEU B 2 84  ? 58.757 110.182 29.419 1.00 31.18  ? 84  LEU B CD1 1 
ATOM   2249 C CD2 . LEU B 2 84  ? 60.129 109.440 27.473 1.00 29.26  ? 84  LEU B CD2 1 
ATOM   2250 N N   . SER B 2 85  ? 60.774 104.559 30.054 1.00 32.99  ? 85  SER B N   1 
ATOM   2251 C CA  . SER B 2 85  ? 61.415 103.702 31.044 1.00 33.42  ? 85  SER B CA  1 
ATOM   2252 C C   . SER B 2 85  ? 62.920 103.521 30.869 1.00 33.48  ? 85  SER B C   1 
ATOM   2253 O O   . SER B 2 85  ? 63.436 103.559 29.750 1.00 33.56  ? 85  SER B O   1 
ATOM   2254 C CB  . SER B 2 85  ? 60.745 102.328 31.030 1.00 33.87  ? 85  SER B CB  1 
ATOM   2255 O OG  . SER B 2 85  ? 60.795 101.752 29.733 1.00 34.97  ? 85  SER B OG  1 
ATOM   2256 N N   . HIS B 2 86  ? 63.610 103.322 31.992 1.00 33.41  ? 86  HIS B N   1 
ATOM   2257 C CA  . HIS B 2 86  ? 65.056 103.094 32.017 1.00 34.83  ? 86  HIS B CA  1 
ATOM   2258 C C   . HIS B 2 86  ? 65.938 104.271 31.587 1.00 36.24  ? 86  HIS B C   1 
ATOM   2259 O O   . HIS B 2 86  ? 66.878 104.106 30.795 1.00 34.78  ? 86  HIS B O   1 
ATOM   2260 C CB  . HIS B 2 86  ? 65.405 101.866 31.172 1.00 35.57  ? 86  HIS B CB  1 
ATOM   2261 C CG  . HIS B 2 86  ? 64.771 100.601 31.657 1.00 34.80  ? 86  HIS B CG  1 
ATOM   2262 N ND1 . HIS B 2 86  ? 65.106 100.013 32.857 1.00 35.73  ? 86  HIS B ND1 1 
ATOM   2263 C CD2 . HIS B 2 86  ? 63.814 99.815  31.109 1.00 34.35  ? 86  HIS B CD2 1 
ATOM   2264 C CE1 . HIS B 2 86  ? 64.384 98.919  33.026 1.00 34.08  ? 86  HIS B CE1 1 
ATOM   2265 N NE2 . HIS B 2 86  ? 63.591 98.776  31.979 1.00 30.77  ? 86  HIS B NE2 1 
ATOM   2266 N N   . ASN B 2 87  ? 65.628 105.455 32.110 1.00 36.07  ? 87  ASN B N   1 
ATOM   2267 C CA  . ASN B 2 87  ? 66.414 106.651 31.827 1.00 34.82  ? 87  ASN B CA  1 
ATOM   2268 C C   . ASN B 2 87  ? 66.832 107.286 33.151 1.00 35.72  ? 87  ASN B C   1 
ATOM   2269 O O   . ASN B 2 87  ? 66.664 106.675 34.207 1.00 35.44  ? 87  ASN B O   1 
ATOM   2270 C CB  . ASN B 2 87  ? 65.622 107.635 30.963 1.00 31.43  ? 87  ASN B CB  1 
ATOM   2271 C CG  . ASN B 2 87  ? 65.571 107.209 29.502 1.00 29.23  ? 87  ASN B CG  1 
ATOM   2272 O OD1 . ASN B 2 87  ? 64.524 106.809 28.986 1.00 26.28  ? 87  ASN B OD1 1 
ATOM   2273 N ND2 . ASN B 2 87  ? 66.711 107.285 28.833 1.00 24.36  ? 87  ASN B ND2 1 
ATOM   2274 N N   . GLN B 2 88  ? 67.372 108.500 33.102 1.00 36.54  ? 88  GLN B N   1 
ATOM   2275 C CA  . GLN B 2 88  ? 67.836 109.170 34.313 1.00 35.55  ? 88  GLN B CA  1 
ATOM   2276 C C   . GLN B 2 88  ? 66.989 110.382 34.665 1.00 36.21  ? 88  GLN B C   1 
ATOM   2277 O O   . GLN B 2 88  ? 67.505 111.342 35.232 1.00 35.81  ? 88  GLN B O   1 
ATOM   2278 C CB  . GLN B 2 88  ? 69.293 109.626 34.140 1.00 38.31  ? 88  GLN B CB  1 
ATOM   2279 C CG  . GLN B 2 88  ? 70.246 108.582 33.564 1.00 43.45  ? 88  GLN B CG  1 
ATOM   2280 C CD  . GLN B 2 88  ? 70.699 107.558 34.590 1.00 48.42  ? 88  GLN B CD  1 
ATOM   2281 O OE1 . GLN B 2 88  ? 71.220 106.496 34.240 1.00 50.75  ? 88  GLN B OE1 1 
ATOM   2282 N NE2 . GLN B 2 88  ? 70.515 107.877 35.867 1.00 50.69  ? 88  GLN B NE2 1 
ATOM   2283 N N   . LEU B 2 89  ? 65.701 110.355 34.329 1.00 37.10  ? 89  LEU B N   1 
ATOM   2284 C CA  . LEU B 2 89  ? 64.823 111.494 34.624 1.00 37.35  ? 89  LEU B CA  1 
ATOM   2285 C C   . LEU B 2 89  ? 64.574 111.635 36.126 1.00 37.76  ? 89  LEU B C   1 
ATOM   2286 O O   . LEU B 2 89  ? 64.256 110.660 36.803 1.00 37.45  ? 89  LEU B O   1 
ATOM   2287 C CB  . LEU B 2 89  ? 63.496 111.345 33.880 1.00 36.79  ? 89  LEU B CB  1 
ATOM   2288 C CG  . LEU B 2 89  ? 63.609 111.251 32.351 1.00 38.59  ? 89  LEU B CG  1 
ATOM   2289 C CD1 . LEU B 2 89  ? 62.211 111.081 31.762 1.00 36.16  ? 89  LEU B CD1 1 
ATOM   2290 C CD2 . LEU B 2 89  ? 64.294 112.497 31.774 1.00 33.63  ? 89  LEU B CD2 1 
ATOM   2291 N N   . GLN B 2 90  ? 64.720 112.850 36.648 1.00 38.37  ? 90  GLN B N   1 
ATOM   2292 C CA  . GLN B 2 90  ? 64.543 113.081 38.075 1.00 37.59  ? 90  GLN B CA  1 
ATOM   2293 C C   . GLN B 2 90  ? 63.167 113.552 38.457 1.00 38.44  ? 90  GLN B C   1 
ATOM   2294 O O   . GLN B 2 90  ? 62.886 113.756 39.638 1.00 40.28  ? 90  GLN B O   1 
ATOM   2295 C CB  . GLN B 2 90  ? 65.559 114.091 38.577 1.00 37.52  ? 90  GLN B CB  1 
ATOM   2296 C CG  . GLN B 2 90  ? 66.984 113.670 38.338 1.00 41.50  ? 90  GLN B CG  1 
ATOM   2297 C CD  . GLN B 2 90  ? 67.958 114.613 38.986 1.00 43.71  ? 90  GLN B CD  1 
ATOM   2298 O OE1 . GLN B 2 90  ? 68.097 114.630 40.209 1.00 44.61  ? 90  GLN B OE1 1 
ATOM   2299 N NE2 . GLN B 2 90  ? 68.633 115.417 38.174 1.00 43.98  ? 90  GLN B NE2 1 
ATOM   2300 N N   . SER B 2 91  ? 62.309 113.736 37.464 1.00 36.54  ? 91  SER B N   1 
ATOM   2301 C CA  . SER B 2 91  ? 60.955 114.179 37.740 1.00 35.65  ? 91  SER B CA  1 
ATOM   2302 C C   . SER B 2 91  ? 60.016 113.727 36.641 1.00 34.09  ? 91  SER B C   1 
ATOM   2303 O O   . SER B 2 91  ? 60.428 113.504 35.503 1.00 33.94  ? 91  SER B O   1 
ATOM   2304 C CB  . SER B 2 91  ? 60.907 115.704 37.859 1.00 37.45  ? 91  SER B CB  1 
ATOM   2305 O OG  . SER B 2 91  ? 61.175 116.325 36.608 1.00 42.20  ? 91  SER B OG  1 
ATOM   2306 N N   . LEU B 2 92  ? 58.748 113.584 36.993 1.00 32.08  ? 92  LEU B N   1 
ATOM   2307 C CA  . LEU B 2 92  ? 57.746 113.172 36.031 1.00 32.54  ? 92  LEU B CA  1 
ATOM   2308 C C   . LEU B 2 92  ? 57.381 114.343 35.136 1.00 32.19  ? 92  LEU B C   1 
ATOM   2309 O O   . LEU B 2 92  ? 57.124 115.444 35.612 1.00 34.86  ? 92  LEU B O   1 
ATOM   2310 C CB  . LEU B 2 92  ? 56.483 112.701 36.744 1.00 34.81  ? 92  LEU B CB  1 
ATOM   2311 C CG  . LEU B 2 92  ? 55.350 112.303 35.796 1.00 35.99  ? 92  LEU B CG  1 
ATOM   2312 C CD1 . LEU B 2 92  ? 55.355 110.798 35.601 1.00 35.48  ? 92  LEU B CD1 1 
ATOM   2313 C CD2 . LEU B 2 92  ? 54.021 112.758 36.365 1.00 36.67  ? 92  LEU B CD2 1 
ATOM   2314 N N   . PRO B 2 93  ? 57.373 114.128 33.822 1.00 31.71  ? 93  PRO B N   1 
ATOM   2315 C CA  . PRO B 2 93  ? 57.016 115.216 32.910 1.00 30.67  ? 93  PRO B CA  1 
ATOM   2316 C C   . PRO B 2 93  ? 55.503 115.459 32.948 1.00 31.60  ? 93  PRO B C   1 
ATOM   2317 O O   . PRO B 2 93  ? 54.724 114.532 33.188 1.00 31.09  ? 93  PRO B O   1 
ATOM   2318 C CB  . PRO B 2 93  ? 57.458 114.689 31.547 1.00 31.48  ? 93  PRO B CB  1 
ATOM   2319 C CG  . PRO B 2 93  ? 58.543 113.693 31.885 1.00 33.36  ? 93  PRO B CG  1 
ATOM   2320 C CD  . PRO B 2 93  ? 57.995 113.008 33.098 1.00 32.86  ? 93  PRO B CD  1 
ATOM   2321 N N   . LEU B 2 94  ? 55.097 116.705 32.725 1.00 29.58  ? 94  LEU B N   1 
ATOM   2322 C CA  . LEU B 2 94  ? 53.686 117.063 32.695 1.00 30.19  ? 94  LEU B CA  1 
ATOM   2323 C C   . LEU B 2 94  ? 53.330 117.041 31.205 1.00 32.74  ? 94  LEU B C   1 
ATOM   2324 O O   . LEU B 2 94  ? 53.773 117.908 30.446 1.00 35.13  ? 94  LEU B O   1 
ATOM   2325 C CB  . LEU B 2 94  ? 53.498 118.457 33.293 1.00 29.31  ? 94  LEU B CB  1 
ATOM   2326 C CG  . LEU B 2 94  ? 54.042 118.644 34.718 1.00 27.54  ? 94  LEU B CG  1 
ATOM   2327 C CD1 . LEU B 2 94  ? 53.857 120.083 35.158 1.00 25.79  ? 94  LEU B CD1 1 
ATOM   2328 C CD2 . LEU B 2 94  ? 53.323 117.715 35.681 1.00 28.26  ? 94  LEU B CD2 1 
ATOM   2329 N N   . LEU B 2 95  ? 52.537 116.052 30.789 1.00 31.80  ? 95  LEU B N   1 
ATOM   2330 C CA  . LEU B 2 95  ? 52.193 115.876 29.376 1.00 31.12  ? 95  LEU B CA  1 
ATOM   2331 C C   . LEU B 2 95  ? 50.752 116.161 28.961 1.00 33.87  ? 95  LEU B C   1 
ATOM   2332 O O   . LEU B 2 95  ? 50.436 116.130 27.772 1.00 34.11  ? 95  LEU B O   1 
ATOM   2333 C CB  . LEU B 2 95  ? 52.518 114.449 28.965 1.00 27.37  ? 95  LEU B CB  1 
ATOM   2334 C CG  . LEU B 2 95  ? 53.874 113.891 29.376 1.00 24.71  ? 95  LEU B CG  1 
ATOM   2335 C CD1 . LEU B 2 95  ? 53.883 112.390 29.168 1.00 24.45  ? 95  LEU B CD1 1 
ATOM   2336 C CD2 . LEU B 2 95  ? 54.965 114.550 28.563 1.00 25.59  ? 95  LEU B CD2 1 
ATOM   2337 N N   . GLY B 2 96  ? 49.886 116.428 29.932 1.00 35.80  ? 96  GLY B N   1 
ATOM   2338 C CA  . GLY B 2 96  ? 48.487 116.685 29.642 1.00 37.65  ? 96  GLY B CA  1 
ATOM   2339 C C   . GLY B 2 96  ? 48.172 117.685 28.543 1.00 40.24  ? 96  GLY B C   1 
ATOM   2340 O O   . GLY B 2 96  ? 47.199 117.514 27.799 1.00 41.31  ? 96  GLY B O   1 
ATOM   2341 N N   . GLN B 2 97  ? 48.979 118.731 28.428 1.00 41.06  ? 97  GLN B N   1 
ATOM   2342 C CA  . GLN B 2 97  ? 48.724 119.751 27.417 1.00 42.02  ? 97  GLN B CA  1 
ATOM   2343 C C   . GLN B 2 97  ? 49.441 119.506 26.083 1.00 40.95  ? 97  GLN B C   1 
ATOM   2344 O O   . GLN B 2 97  ? 49.065 120.077 25.059 1.00 42.42  ? 97  GLN B O   1 
ATOM   2345 C CB  . GLN B 2 97  ? 49.085 121.139 27.978 1.00 44.06  ? 97  GLN B CB  1 
ATOM   2346 C CG  . GLN B 2 97  ? 48.139 121.665 29.086 1.00 46.42  ? 97  GLN B CG  1 
ATOM   2347 C CD  . GLN B 2 97  ? 48.080 120.771 30.342 1.00 52.04  ? 97  GLN B CD  1 
ATOM   2348 O OE1 . GLN B 2 97  ? 47.035 120.180 30.654 1.00 51.25  ? 97  GLN B OE1 1 
ATOM   2349 N NE2 . GLN B 2 97  ? 49.201 120.680 31.067 1.00 51.45  ? 97  GLN B NE2 1 
ATOM   2350 N N   . THR B 2 98  ? 50.451 118.641 26.081 1.00 39.82  ? 98  THR B N   1 
ATOM   2351 C CA  . THR B 2 98  ? 51.194 118.354 24.858 1.00 38.20  ? 98  THR B CA  1 
ATOM   2352 C C   . THR B 2 98  ? 50.834 117.018 24.215 1.00 37.88  ? 98  THR B C   1 
ATOM   2353 O O   . THR B 2 98  ? 51.003 116.842 23.004 1.00 37.62  ? 98  THR B O   1 
ATOM   2354 C CB  . THR B 2 98  ? 52.705 118.395 25.133 1.00 38.54  ? 98  THR B CB  1 
ATOM   2355 O OG1 . THR B 2 98  ? 53.080 119.739 25.442 1.00 42.13  ? 98  THR B OG1 1 
ATOM   2356 C CG2 . THR B 2 98  ? 53.495 117.933 23.924 1.00 39.62  ? 98  THR B CG2 1 
ATOM   2357 N N   . LEU B 2 99  ? 50.329 116.088 25.024 1.00 36.63  ? 99  LEU B N   1 
ATOM   2358 C CA  . LEU B 2 99  ? 49.954 114.761 24.544 1.00 34.82  ? 99  LEU B CA  1 
ATOM   2359 C C   . LEU B 2 99  ? 48.529 114.386 24.955 1.00 34.71  ? 99  LEU B C   1 
ATOM   2360 O O   . LEU B 2 99  ? 48.328 113.455 25.734 1.00 35.88  ? 99  LEU B O   1 
ATOM   2361 C CB  . LEU B 2 99  ? 50.922 113.729 25.108 1.00 33.38  ? 99  LEU B CB  1 
ATOM   2362 C CG  . LEU B 2 99  ? 52.402 114.093 25.016 1.00 33.28  ? 99  LEU B CG  1 
ATOM   2363 C CD1 . LEU B 2 99  ? 53.216 113.021 25.715 1.00 31.81  ? 99  LEU B CD1 1 
ATOM   2364 C CD2 . LEU B 2 99  ? 52.825 114.234 23.557 1.00 32.09  ? 99  LEU B CD2 1 
ATOM   2365 N N   . PRO B 2 100 ? 47.524 115.091 24.415 1.00 33.44  ? 100 PRO B N   1 
ATOM   2366 C CA  . PRO B 2 100 ? 46.098 114.883 24.692 1.00 32.14  ? 100 PRO B CA  1 
ATOM   2367 C C   . PRO B 2 100 ? 45.565 113.464 24.524 1.00 31.83  ? 100 PRO B C   1 
ATOM   2368 O O   . PRO B 2 100 ? 44.816 112.979 25.370 1.00 33.11  ? 100 PRO B O   1 
ATOM   2369 C CB  . PRO B 2 100 ? 45.418 115.851 23.728 1.00 32.89  ? 100 PRO B CB  1 
ATOM   2370 C CG  . PRO B 2 100 ? 46.411 116.952 23.611 1.00 35.09  ? 100 PRO B CG  1 
ATOM   2371 C CD  . PRO B 2 100 ? 47.701 116.193 23.455 1.00 34.08  ? 100 PRO B CD  1 
ATOM   2372 N N   . ALA B 2 101 ? 45.943 112.804 23.434 1.00 29.61  ? 101 ALA B N   1 
ATOM   2373 C CA  . ALA B 2 101 ? 45.463 111.454 23.154 1.00 29.10  ? 101 ALA B CA  1 
ATOM   2374 C C   . ALA B 2 101 ? 46.230 110.307 23.821 1.00 29.89  ? 101 ALA B C   1 
ATOM   2375 O O   . ALA B 2 101 ? 45.959 109.137 23.533 1.00 31.07  ? 101 ALA B O   1 
ATOM   2376 C CB  . ALA B 2 101 ? 45.436 111.233 21.647 1.00 27.42  ? 101 ALA B CB  1 
ATOM   2377 N N   . LEU B 2 102 ? 47.166 110.623 24.711 1.00 28.34  ? 102 LEU B N   1 
ATOM   2378 C CA  . LEU B 2 102 ? 47.964 109.587 25.372 1.00 29.52  ? 102 LEU B CA  1 
ATOM   2379 C C   . LEU B 2 102 ? 47.144 108.516 26.113 1.00 28.76  ? 102 LEU B C   1 
ATOM   2380 O O   . LEU B 2 102 ? 46.319 108.830 26.976 1.00 30.12  ? 102 LEU B O   1 
ATOM   2381 C CB  . LEU B 2 102 ? 48.953 110.240 26.344 1.00 29.07  ? 102 LEU B CB  1 
ATOM   2382 C CG  . LEU B 2 102 ? 50.210 109.438 26.698 1.00 26.27  ? 102 LEU B CG  1 
ATOM   2383 C CD1 . LEU B 2 102 ? 51.072 109.248 25.448 1.00 22.64  ? 102 LEU B CD1 1 
ATOM   2384 C CD2 . LEU B 2 102 ? 50.991 110.174 27.781 1.00 23.86  ? 102 LEU B CD2 1 
ATOM   2385 N N   . THR B 2 103 ? 47.392 107.251 25.787 1.00 25.99  ? 103 THR B N   1 
ATOM   2386 C CA  . THR B 2 103 ? 46.682 106.143 26.417 1.00 26.53  ? 103 THR B CA  1 
ATOM   2387 C C   . THR B 2 103 ? 47.619 105.253 27.221 1.00 27.60  ? 103 THR B C   1 
ATOM   2388 O O   . THR B 2 103 ? 47.189 104.538 28.124 1.00 29.39  ? 103 THR B O   1 
ATOM   2389 C CB  . THR B 2 103 ? 45.972 105.276 25.376 1.00 29.41  ? 103 THR B CB  1 
ATOM   2390 O OG1 . THR B 2 103 ? 46.941 104.735 24.467 1.00 28.74  ? 103 THR B OG1 1 
ATOM   2391 C CG2 . THR B 2 103 ? 44.960 106.108 24.599 1.00 30.30  ? 103 THR B CG2 1 
ATOM   2392 N N   . VAL B 2 104 ? 48.904 105.291 26.889 1.00 28.37  ? 104 VAL B N   1 
ATOM   2393 C CA  . VAL B 2 104 ? 49.893 104.497 27.604 1.00 27.18  ? 104 VAL B CA  1 
ATOM   2394 C C   . VAL B 2 104 ? 51.144 105.318 27.920 1.00 28.56  ? 104 VAL B C   1 
ATOM   2395 O O   . VAL B 2 104 ? 51.755 105.924 27.031 1.00 26.61  ? 104 VAL B O   1 
ATOM   2396 C CB  . VAL B 2 104 ? 50.297 103.246 26.798 1.00 26.82  ? 104 VAL B CB  1 
ATOM   2397 C CG1 . VAL B 2 104 ? 51.348 102.449 27.562 1.00 25.26  ? 104 VAL B CG1 1 
ATOM   2398 C CG2 . VAL B 2 104 ? 49.076 102.386 26.534 1.00 24.35  ? 104 VAL B CG2 1 
ATOM   2399 N N   . LEU B 2 105 ? 51.503 105.339 29.204 1.00 28.80  ? 105 LEU B N   1 
ATOM   2400 C CA  . LEU B 2 105 ? 52.673 106.065 29.683 1.00 27.32  ? 105 LEU B CA  1 
ATOM   2401 C C   . LEU B 2 105 ? 53.505 105.165 30.581 1.00 28.59  ? 105 LEU B C   1 
ATOM   2402 O O   . LEU B 2 105 ? 52.996 104.596 31.548 1.00 28.23  ? 105 LEU B O   1 
ATOM   2403 C CB  . LEU B 2 105 ? 52.258 107.312 30.468 1.00 25.38  ? 105 LEU B CB  1 
ATOM   2404 C CG  . LEU B 2 105 ? 53.428 108.074 31.107 1.00 27.86  ? 105 LEU B CG  1 
ATOM   2405 C CD1 . LEU B 2 105 ? 54.419 108.498 30.020 1.00 27.62  ? 105 LEU B CD1 1 
ATOM   2406 C CD2 . LEU B 2 105 ? 52.912 109.291 31.875 1.00 29.77  ? 105 LEU B CD2 1 
ATOM   2407 N N   . ASP B 2 106 ? 54.787 105.042 30.255 1.00 30.35  ? 106 ASP B N   1 
ATOM   2408 C CA  . ASP B 2 106 ? 55.713 104.218 31.022 1.00 31.79  ? 106 ASP B CA  1 
ATOM   2409 C C   . ASP B 2 106 ? 56.923 105.070 31.413 1.00 33.46  ? 106 ASP B C   1 
ATOM   2410 O O   . ASP B 2 106 ? 57.651 105.569 30.548 1.00 36.20  ? 106 ASP B O   1 
ATOM   2411 C CB  . ASP B 2 106 ? 56.184 103.027 30.169 1.00 33.69  ? 106 ASP B CB  1 
ATOM   2412 C CG  . ASP B 2 106 ? 57.000 102.005 30.966 1.00 37.68  ? 106 ASP B CG  1 
ATOM   2413 O OD1 . ASP B 2 106 ? 57.640 102.383 31.968 1.00 40.02  ? 106 ASP B OD1 1 
ATOM   2414 O OD2 . ASP B 2 106 ? 57.014 100.816 30.581 1.00 37.35  ? 106 ASP B OD2 1 
ATOM   2415 N N   . VAL B 2 107 ? 57.138 105.258 32.709 1.00 32.47  ? 107 VAL B N   1 
ATOM   2416 C CA  . VAL B 2 107 ? 58.294 106.024 33.144 1.00 30.51  ? 107 VAL B CA  1 
ATOM   2417 C C   . VAL B 2 107 ? 59.012 105.221 34.219 1.00 30.58  ? 107 VAL B C   1 
ATOM   2418 O O   . VAL B 2 107 ? 59.671 105.770 35.096 1.00 32.05  ? 107 VAL B O   1 
ATOM   2419 C CB  . VAL B 2 107 ? 57.895 107.415 33.686 1.00 29.90  ? 107 VAL B CB  1 
ATOM   2420 C CG1 . VAL B 2 107 ? 59.108 108.331 33.703 1.00 28.17  ? 107 VAL B CG1 1 
ATOM   2421 C CG2 . VAL B 2 107 ? 56.817 108.019 32.822 1.00 29.72  ? 107 VAL B CG2 1 
ATOM   2422 N N   . SER B 2 108 ? 58.880 103.903 34.130 1.00 30.72  ? 108 SER B N   1 
ATOM   2423 C CA  . SER B 2 108 ? 59.511 102.992 35.074 1.00 30.05  ? 108 SER B CA  1 
ATOM   2424 C C   . SER B 2 108 ? 61.031 103.086 35.032 1.00 30.29  ? 108 SER B C   1 
ATOM   2425 O O   . SER B 2 108 ? 61.622 103.487 34.024 1.00 29.27  ? 108 SER B O   1 
ATOM   2426 C CB  . SER B 2 108 ? 59.099 101.550 34.768 1.00 29.65  ? 108 SER B CB  1 
ATOM   2427 O OG  . SER B 2 108 ? 57.690 101.408 34.777 1.00 29.85  ? 108 SER B OG  1 
ATOM   2428 N N   . PHE B 2 109 ? 61.647 102.703 36.145 1.00 30.21  ? 109 PHE B N   1 
ATOM   2429 C CA  . PHE B 2 109 ? 63.095 102.689 36.296 1.00 30.82  ? 109 PHE B CA  1 
ATOM   2430 C C   . PHE B 2 109 ? 63.804 103.951 35.871 1.00 31.49  ? 109 PHE B C   1 
ATOM   2431 O O   . PHE B 2 109 ? 64.646 103.958 34.970 1.00 32.78  ? 109 PHE B O   1 
ATOM   2432 C CB  . PHE B 2 109 ? 63.695 101.478 35.572 1.00 31.41  ? 109 PHE B CB  1 
ATOM   2433 C CG  . PHE B 2 109 ? 63.234 100.165 36.133 1.00 31.94  ? 109 PHE B CG  1 
ATOM   2434 C CD1 . PHE B 2 109 ? 62.105 99.535  35.625 1.00 33.45  ? 109 PHE B CD1 1 
ATOM   2435 C CD2 . PHE B 2 109 ? 63.872 99.608  37.234 1.00 33.14  ? 109 PHE B CD2 1 
ATOM   2436 C CE1 . PHE B 2 109 ? 61.613 98.373  36.207 1.00 35.10  ? 109 PHE B CE1 1 
ATOM   2437 C CE2 . PHE B 2 109 ? 63.389 98.444  37.828 1.00 34.75  ? 109 PHE B CE2 1 
ATOM   2438 C CZ  . PHE B 2 109 ? 62.257 97.825  37.316 1.00 35.40  ? 109 PHE B CZ  1 
ATOM   2439 N N   . ASN B 2 110 ? 63.448 105.028 36.546 1.00 31.20  ? 110 ASN B N   1 
ATOM   2440 C CA  . ASN B 2 110 ? 64.052 106.316 36.312 1.00 31.59  ? 110 ASN B CA  1 
ATOM   2441 C C   . ASN B 2 110 ? 64.527 106.758 37.691 1.00 31.96  ? 110 ASN B C   1 
ATOM   2442 O O   . ASN B 2 110 ? 64.912 105.921 38.503 1.00 31.43  ? 110 ASN B O   1 
ATOM   2443 C CB  . ASN B 2 110 ? 63.017 107.274 35.731 1.00 30.70  ? 110 ASN B CB  1 
ATOM   2444 C CG  . ASN B 2 110 ? 63.100 107.366 34.219 1.00 31.74  ? 110 ASN B CG  1 
ATOM   2445 O OD1 . ASN B 2 110 ? 63.845 108.186 33.679 1.00 34.09  ? 110 ASN B OD1 1 
ATOM   2446 N ND2 . ASN B 2 110 ? 62.351 106.512 33.526 1.00 30.58  ? 110 ASN B ND2 1 
ATOM   2447 N N   . ARG B 2 111 ? 64.500 108.054 37.967 1.00 32.55  ? 111 ARG B N   1 
ATOM   2448 C CA  . ARG B 2 111 ? 64.936 108.551 39.264 1.00 31.39  ? 111 ARG B CA  1 
ATOM   2449 C C   . ARG B 2 111 ? 63.883 109.434 39.927 1.00 30.25  ? 111 ARG B C   1 
ATOM   2450 O O   . ARG B 2 111 ? 64.209 110.433 40.564 1.00 30.38  ? 111 ARG B O   1 
ATOM   2451 C CB  . ARG B 2 111 ? 66.248 109.312 39.095 1.00 32.89  ? 111 ARG B CB  1 
ATOM   2452 C CG  . ARG B 2 111 ? 67.432 108.403 38.842 1.00 36.60  ? 111 ARG B CG  1 
ATOM   2453 C CD  . ARG B 2 111 ? 68.616 109.138 38.228 1.00 38.81  ? 111 ARG B CD  1 
ATOM   2454 N NE  . ARG B 2 111 ? 68.935 110.387 38.914 1.00 45.07  ? 111 ARG B NE  1 
ATOM   2455 C CZ  . ARG B 2 111 ? 69.333 110.472 40.178 1.00 45.41  ? 111 ARG B CZ  1 
ATOM   2456 N NH1 . ARG B 2 111 ? 69.467 109.374 40.900 1.00 47.19  ? 111 ARG B NH1 1 
ATOM   2457 N NH2 . ARG B 2 111 ? 69.583 111.653 40.720 1.00 43.64  ? 111 ARG B NH2 1 
ATOM   2458 N N   . LEU B 2 112 ? 62.620 109.045 39.775 1.00 29.31  ? 112 LEU B N   1 
ATOM   2459 C CA  . LEU B 2 112 ? 61.494 109.777 40.348 1.00 29.79  ? 112 LEU B CA  1 
ATOM   2460 C C   . LEU B 2 112 ? 61.425 109.567 41.861 1.00 30.51  ? 112 LEU B C   1 
ATOM   2461 O O   . LEU B 2 112 ? 61.316 108.436 42.328 1.00 31.84  ? 112 LEU B O   1 
ATOM   2462 C CB  . LEU B 2 112 ? 60.183 109.299 39.710 1.00 27.99  ? 112 LEU B CB  1 
ATOM   2463 C CG  . LEU B 2 112 ? 60.001 109.435 38.193 1.00 29.56  ? 112 LEU B CG  1 
ATOM   2464 C CD1 . LEU B 2 112 ? 58.636 108.877 37.793 1.00 28.31  ? 112 LEU B CD1 1 
ATOM   2465 C CD2 . LEU B 2 112 ? 60.128 110.894 37.773 1.00 26.85  ? 112 LEU B CD2 1 
ATOM   2466 N N   . THR B 2 113 ? 61.482 110.650 42.628 1.00 30.98  ? 113 THR B N   1 
ATOM   2467 C CA  . THR B 2 113 ? 61.431 110.541 44.083 1.00 31.23  ? 113 THR B CA  1 
ATOM   2468 C C   . THR B 2 113 ? 60.102 111.036 44.626 1.00 33.39  ? 113 THR B C   1 
ATOM   2469 O O   . THR B 2 113 ? 59.869 111.015 45.837 1.00 33.04  ? 113 THR B O   1 
ATOM   2470 C CB  . THR B 2 113 ? 62.546 111.354 44.749 1.00 27.14  ? 113 THR B CB  1 
ATOM   2471 O OG1 . THR B 2 113 ? 62.413 112.729 44.377 1.00 30.90  ? 113 THR B OG1 1 
ATOM   2472 C CG2 . THR B 2 113 ? 63.905 110.848 44.319 1.00 21.69  ? 113 THR B CG2 1 
ATOM   2473 N N   . SER B 2 114 ? 59.239 111.486 43.721 1.00 34.22  ? 114 SER B N   1 
ATOM   2474 C CA  . SER B 2 114 ? 57.924 111.981 44.092 1.00 34.42  ? 114 SER B CA  1 
ATOM   2475 C C   . SER B 2 114 ? 57.135 112.255 42.825 1.00 35.08  ? 114 SER B C   1 
ATOM   2476 O O   . SER B 2 114 ? 57.686 112.257 41.724 1.00 36.84  ? 114 SER B O   1 
ATOM   2477 C CB  . SER B 2 114 ? 58.038 113.271 44.910 1.00 34.95  ? 114 SER B CB  1 
ATOM   2478 O OG  . SER B 2 114 ? 58.442 114.359 44.098 1.00 39.80  ? 114 SER B OG  1 
ATOM   2479 N N   . LEU B 2 115 ? 55.836 112.467 42.989 1.00 34.58  ? 115 LEU B N   1 
ATOM   2480 C CA  . LEU B 2 115 ? 54.947 112.758 41.873 1.00 34.92  ? 115 LEU B CA  1 
ATOM   2481 C C   . LEU B 2 115 ? 54.253 114.075 42.230 1.00 35.01  ? 115 LEU B C   1 
ATOM   2482 O O   . LEU B 2 115 ? 53.778 114.259 43.352 1.00 37.35  ? 115 LEU B O   1 
ATOM   2483 C CB  . LEU B 2 115 ? 53.933 111.612 41.684 1.00 31.57  ? 115 LEU B CB  1 
ATOM   2484 C CG  . LEU B 2 115 ? 54.215 110.523 40.628 1.00 27.36  ? 115 LEU B CG  1 
ATOM   2485 C CD1 . LEU B 2 115 ? 55.655 110.054 40.678 1.00 24.81  ? 115 LEU B CD1 1 
ATOM   2486 C CD2 . LEU B 2 115 ? 53.275 109.356 40.854 1.00 24.12  ? 115 LEU B CD2 1 
ATOM   2487 N N   . PRO B 2 116 ? 54.210 115.019 41.283 1.00 34.00  ? 116 PRO B N   1 
ATOM   2488 C CA  . PRO B 2 116 ? 53.582 116.321 41.519 1.00 34.14  ? 116 PRO B CA  1 
ATOM   2489 C C   . PRO B 2 116 ? 52.059 116.360 41.549 1.00 32.25  ? 116 PRO B C   1 
ATOM   2490 O O   . PRO B 2 116 ? 51.387 115.571 40.896 1.00 33.66  ? 116 PRO B O   1 
ATOM   2491 C CB  . PRO B 2 116 ? 54.149 117.176 40.389 1.00 35.50  ? 116 PRO B CB  1 
ATOM   2492 C CG  . PRO B 2 116 ? 54.265 116.188 39.267 1.00 35.04  ? 116 PRO B CG  1 
ATOM   2493 C CD  . PRO B 2 116 ? 54.859 114.978 39.959 1.00 35.20  ? 116 PRO B CD  1 
ATOM   2494 N N   . LEU B 2 117 ? 51.519 117.293 42.320 1.00 31.00  ? 117 LEU B N   1 
ATOM   2495 C CA  . LEU B 2 117 ? 50.077 117.463 42.401 1.00 29.26  ? 117 LEU B CA  1 
ATOM   2496 C C   . LEU B 2 117 ? 49.593 117.792 40.998 1.00 27.40  ? 117 LEU B C   1 
ATOM   2497 O O   . LEU B 2 117 ? 50.253 118.519 40.264 1.00 27.36  ? 117 LEU B O   1 
ATOM   2498 C CB  . LEU B 2 117 ? 49.741 118.624 43.326 1.00 33.63  ? 117 LEU B CB  1 
ATOM   2499 C CG  . LEU B 2 117 ? 49.918 118.403 44.823 1.00 35.13  ? 117 LEU B CG  1 
ATOM   2500 C CD1 . LEU B 2 117 ? 50.287 119.710 45.481 1.00 35.99  ? 117 LEU B CD1 1 
ATOM   2501 C CD2 . LEU B 2 117 ? 48.630 117.834 45.401 1.00 35.81  ? 117 LEU B CD2 1 
ATOM   2502 N N   . GLY B 2 118 ? 48.442 117.257 40.625 1.00 25.19  ? 118 GLY B N   1 
ATOM   2503 C CA  . GLY B 2 118 ? 47.919 117.524 39.302 1.00 24.21  ? 118 GLY B CA  1 
ATOM   2504 C C   . GLY B 2 118 ? 48.862 117.081 38.205 1.00 23.51  ? 118 GLY B C   1 
ATOM   2505 O O   . GLY B 2 118 ? 48.824 117.610 37.093 1.00 27.03  ? 118 GLY B O   1 
ATOM   2506 N N   . ALA B 2 119 ? 49.696 116.096 38.510 1.00 21.48  ? 119 ALA B N   1 
ATOM   2507 C CA  . ALA B 2 119 ? 50.661 115.577 37.550 1.00 23.95  ? 119 ALA B CA  1 
ATOM   2508 C C   . ALA B 2 119 ? 50.059 115.043 36.239 1.00 25.42  ? 119 ALA B C   1 
ATOM   2509 O O   . ALA B 2 119 ? 50.674 115.169 35.178 1.00 24.26  ? 119 ALA B O   1 
ATOM   2510 C CB  . ALA B 2 119 ? 51.494 114.486 38.210 1.00 21.39  ? 119 ALA B CB  1 
ATOM   2511 N N   . LEU B 2 120 ? 48.867 114.454 36.301 1.00 26.72  ? 120 LEU B N   1 
ATOM   2512 C CA  . LEU B 2 120 ? 48.248 113.877 35.106 1.00 29.35  ? 120 LEU B CA  1 
ATOM   2513 C C   . LEU B 2 120 ? 47.059 114.662 34.544 1.00 31.96  ? 120 LEU B C   1 
ATOM   2514 O O   . LEU B 2 120 ? 46.232 114.113 33.811 1.00 30.84  ? 120 LEU B O   1 
ATOM   2515 C CB  . LEU B 2 120 ? 47.816 112.439 35.405 1.00 28.16  ? 120 LEU B CB  1 
ATOM   2516 C CG  . LEU B 2 120 ? 48.905 111.550 36.013 1.00 30.74  ? 120 LEU B CG  1 
ATOM   2517 C CD1 . LEU B 2 120 ? 48.280 110.292 36.614 1.00 29.61  ? 120 LEU B CD1 1 
ATOM   2518 C CD2 . LEU B 2 120 ? 49.941 111.207 34.947 1.00 27.84  ? 120 LEU B CD2 1 
ATOM   2519 N N   . ARG B 2 121 ? 46.987 115.950 34.868 1.00 33.24  ? 121 ARG B N   1 
ATOM   2520 C CA  . ARG B 2 121 ? 45.898 116.790 34.392 1.00 33.23  ? 121 ARG B CA  1 
ATOM   2521 C C   . ARG B 2 121 ? 45.878 116.877 32.869 1.00 30.92  ? 121 ARG B C   1 
ATOM   2522 O O   . ARG B 2 121 ? 46.891 117.163 32.244 1.00 30.56  ? 121 ARG B O   1 
ATOM   2523 C CB  . ARG B 2 121 ? 46.039 118.182 34.984 1.00 37.50  ? 121 ARG B CB  1 
ATOM   2524 C CG  . ARG B 2 121 ? 44.762 118.970 34.996 1.00 44.35  ? 121 ARG B CG  1 
ATOM   2525 C CD  . ARG B 2 121 ? 44.894 120.194 34.131 1.00 52.25  ? 121 ARG B CD  1 
ATOM   2526 N NE  . ARG B 2 121 ? 46.147 120.899 34.385 1.00 55.75  ? 121 ARG B NE  1 
ATOM   2527 C CZ  . ARG B 2 121 ? 46.514 122.012 33.751 1.00 59.04  ? 121 ARG B CZ  1 
ATOM   2528 N NH1 . ARG B 2 121 ? 45.720 122.553 32.827 1.00 56.64  ? 121 ARG B NH1 1 
ATOM   2529 N NH2 . ARG B 2 121 ? 47.684 122.579 34.022 1.00 59.81  ? 121 ARG B NH2 1 
ATOM   2530 N N   . GLY B 2 122 ? 44.718 116.627 32.278 1.00 30.53  ? 122 GLY B N   1 
ATOM   2531 C CA  . GLY B 2 122 ? 44.595 116.687 30.834 1.00 27.90  ? 122 GLY B CA  1 
ATOM   2532 C C   . GLY B 2 122 ? 44.767 115.353 30.131 1.00 28.03  ? 122 GLY B C   1 
ATOM   2533 O O   . GLY B 2 122 ? 44.456 115.237 28.944 1.00 28.41  ? 122 GLY B O   1 
ATOM   2534 N N   . LEU B 2 123 ? 45.257 114.346 30.853 1.00 26.63  ? 123 LEU B N   1 
ATOM   2535 C CA  . LEU B 2 123 ? 45.480 113.022 30.276 1.00 25.94  ? 123 LEU B CA  1 
ATOM   2536 C C   . LEU B 2 123 ? 44.256 112.112 30.380 1.00 26.25  ? 123 LEU B C   1 
ATOM   2537 O O   . LEU B 2 123 ? 44.381 110.919 30.625 1.00 26.65  ? 123 LEU B O   1 
ATOM   2538 C CB  . LEU B 2 123 ? 46.684 112.357 30.953 1.00 24.14  ? 123 LEU B CB  1 
ATOM   2539 C CG  . LEU B 2 123 ? 48.038 113.056 30.775 1.00 22.04  ? 123 LEU B CG  1 
ATOM   2540 C CD1 . LEU B 2 123 ? 49.111 112.292 31.512 1.00 22.67  ? 123 LEU B CD1 1 
ATOM   2541 C CD2 . LEU B 2 123 ? 48.390 113.146 29.297 1.00 24.33  ? 123 LEU B CD2 1 
ATOM   2542 N N   . GLY B 2 124 ? 43.079 112.686 30.156 1.00 29.19  ? 124 GLY B N   1 
ATOM   2543 C CA  . GLY B 2 124 ? 41.828 111.949 30.245 1.00 31.22  ? 124 GLY B CA  1 
ATOM   2544 C C   . GLY B 2 124 ? 41.647 110.658 29.463 1.00 33.43  ? 124 GLY B C   1 
ATOM   2545 O O   . GLY B 2 124 ? 40.697 109.914 29.723 1.00 35.93  ? 124 GLY B O   1 
ATOM   2546 N N   . GLU B 2 125 ? 42.527 110.379 28.508 1.00 34.69  ? 125 GLU B N   1 
ATOM   2547 C CA  . GLU B 2 125 ? 42.421 109.160 27.708 1.00 33.99  ? 125 GLU B CA  1 
ATOM   2548 C C   . GLU B 2 125 ? 43.423 108.087 28.148 1.00 33.81  ? 125 GLU B C   1 
ATOM   2549 O O   . GLU B 2 125 ? 43.524 107.023 27.538 1.00 34.38  ? 125 GLU B O   1 
ATOM   2550 C CB  . GLU B 2 125 ? 42.662 109.481 26.236 1.00 35.56  ? 125 GLU B CB  1 
ATOM   2551 C CG  . GLU B 2 125 ? 41.632 110.398 25.591 1.00 38.39  ? 125 GLU B CG  1 
ATOM   2552 C CD  . GLU B 2 125 ? 40.233 109.814 25.592 1.00 40.55  ? 125 GLU B CD  1 
ATOM   2553 O OE1 . GLU B 2 125 ? 40.078 108.595 25.365 1.00 40.74  ? 125 GLU B OE1 1 
ATOM   2554 O OE2 . GLU B 2 125 ? 39.278 110.586 25.804 1.00 45.89  ? 125 GLU B OE2 1 
ATOM   2555 N N   . LEU B 2 126 ? 44.166 108.374 29.207 1.00 33.78  ? 126 LEU B N   1 
ATOM   2556 C CA  . LEU B 2 126 ? 45.166 107.448 29.713 1.00 34.66  ? 126 LEU B CA  1 
ATOM   2557 C C   . LEU B 2 126 ? 44.542 106.149 30.221 1.00 35.69  ? 126 LEU B C   1 
ATOM   2558 O O   . LEU B 2 126 ? 43.655 106.166 31.069 1.00 38.03  ? 126 LEU B O   1 
ATOM   2559 C CB  . LEU B 2 126 ? 45.955 108.119 30.838 1.00 32.80  ? 126 LEU B CB  1 
ATOM   2560 C CG  . LEU B 2 126 ? 47.266 107.441 31.226 1.00 32.08  ? 126 LEU B CG  1 
ATOM   2561 C CD1 . LEU B 2 126 ? 48.171 107.360 29.998 1.00 33.04  ? 126 LEU B CD1 1 
ATOM   2562 C CD2 . LEU B 2 126 ? 47.940 108.217 32.344 1.00 29.70  ? 126 LEU B CD2 1 
ATOM   2563 N N   . GLN B 2 127 ? 45.014 105.020 29.710 1.00 36.23  ? 127 GLN B N   1 
ATOM   2564 C CA  . GLN B 2 127 ? 44.486 103.724 30.128 1.00 36.77  ? 127 GLN B CA  1 
ATOM   2565 C C   . GLN B 2 127 ? 45.513 102.909 30.899 1.00 36.57  ? 127 GLN B C   1 
ATOM   2566 O O   . GLN B 2 127 ? 45.156 102.073 31.730 1.00 37.36  ? 127 GLN B O   1 
ATOM   2567 C CB  . GLN B 2 127 ? 44.033 102.923 28.914 1.00 38.29  ? 127 GLN B CB  1 
ATOM   2568 C CG  . GLN B 2 127 ? 42.742 103.402 28.295 1.00 42.96  ? 127 GLN B CG  1 
ATOM   2569 C CD  . GLN B 2 127 ? 42.538 102.825 26.912 1.00 48.76  ? 127 GLN B CD  1 
ATOM   2570 O OE1 . GLN B 2 127 ? 43.189 103.239 25.949 1.00 51.97  ? 127 GLN B OE1 1 
ATOM   2571 N NE2 . GLN B 2 127 ? 41.643 101.854 26.805 1.00 52.22  ? 127 GLN B NE2 1 
ATOM   2572 N N   . GLU B 2 128 ? 46.788 103.155 30.617 1.00 34.94  ? 128 GLU B N   1 
ATOM   2573 C CA  . GLU B 2 128 ? 47.874 102.436 31.270 1.00 32.02  ? 128 GLU B CA  1 
ATOM   2574 C C   . GLU B 2 128 ? 48.952 103.396 31.785 1.00 31.15  ? 128 GLU B C   1 
ATOM   2575 O O   . GLU B 2 128 ? 49.336 104.349 31.096 1.00 29.79  ? 128 GLU B O   1 
ATOM   2576 C CB  . GLU B 2 128 ? 48.483 101.430 30.290 1.00 29.92  ? 128 GLU B CB  1 
ATOM   2577 C CG  . GLU B 2 128 ? 47.549 100.289 29.919 1.00 31.02  ? 128 GLU B CG  1 
ATOM   2578 C CD  . GLU B 2 128 ? 48.167 99.315  28.930 1.00 32.59  ? 128 GLU B CD  1 
ATOM   2579 O OE1 . GLU B 2 128 ? 49.347 98.945  29.115 1.00 35.20  ? 128 GLU B OE1 1 
ATOM   2580 O OE2 . GLU B 2 128 ? 47.473 98.907  27.972 1.00 33.46  ? 128 GLU B OE2 1 
ATOM   2581 N N   . LEU B 2 129 ? 49.430 103.137 33.001 1.00 27.85  ? 129 LEU B N   1 
ATOM   2582 C CA  . LEU B 2 129 ? 50.454 103.964 33.627 1.00 25.07  ? 129 LEU B CA  1 
ATOM   2583 C C   . LEU B 2 129 ? 51.454 103.118 34.397 1.00 26.36  ? 129 LEU B C   1 
ATOM   2584 O O   . LEU B 2 129 ? 51.102 102.510 35.405 1.00 26.42  ? 129 LEU B O   1 
ATOM   2585 C CB  . LEU B 2 129 ? 49.805 104.951 34.588 1.00 23.42  ? 129 LEU B CB  1 
ATOM   2586 C CG  . LEU B 2 129 ? 50.803 105.815 35.352 1.00 22.09  ? 129 LEU B CG  1 
ATOM   2587 C CD1 . LEU B 2 129 ? 51.645 106.572 34.343 1.00 21.47  ? 129 LEU B CD1 1 
ATOM   2588 C CD2 . LEU B 2 129 ? 50.086 106.757 36.305 1.00 19.56  ? 129 LEU B CD2 1 
ATOM   2589 N N   . TYR B 2 130 ? 52.702 103.087 33.935 1.00 27.47  ? 130 TYR B N   1 
ATOM   2590 C CA  . TYR B 2 130 ? 53.735 102.305 34.607 1.00 28.34  ? 130 TYR B CA  1 
ATOM   2591 C C   . TYR B 2 130 ? 54.823 103.190 35.209 1.00 31.33  ? 130 TYR B C   1 
ATOM   2592 O O   . TYR B 2 130 ? 55.499 103.949 34.502 1.00 32.27  ? 130 TYR B O   1 
ATOM   2593 C CB  . TYR B 2 130 ? 54.353 101.298 33.636 1.00 29.30  ? 130 TYR B CB  1 
ATOM   2594 C CG  . TYR B 2 130 ? 53.325 100.416 32.965 1.00 32.06  ? 130 TYR B CG  1 
ATOM   2595 C CD1 . TYR B 2 130 ? 52.871 100.695 31.674 1.00 32.98  ? 130 TYR B CD1 1 
ATOM   2596 C CD2 . TYR B 2 130 ? 52.780 99.319  33.631 1.00 32.60  ? 130 TYR B CD2 1 
ATOM   2597 C CE1 . TYR B 2 130 ? 51.896 99.898  31.059 1.00 32.88  ? 130 TYR B CE1 1 
ATOM   2598 C CE2 . TYR B 2 130 ? 51.806 98.521  33.031 1.00 33.17  ? 130 TYR B CE2 1 
ATOM   2599 C CZ  . TYR B 2 130 ? 51.372 98.817  31.747 1.00 33.34  ? 130 TYR B CZ  1 
ATOM   2600 O OH  . TYR B 2 130 ? 50.417 98.028  31.157 1.00 34.59  ? 130 TYR B OH  1 
ATOM   2601 N N   . LEU B 2 131 ? 54.979 103.090 36.527 1.00 30.00  ? 131 LEU B N   1 
ATOM   2602 C CA  . LEU B 2 131 ? 55.973 103.870 37.249 1.00 28.61  ? 131 LEU B CA  1 
ATOM   2603 C C   . LEU B 2 131 ? 56.785 102.941 38.136 1.00 29.80  ? 131 LEU B C   1 
ATOM   2604 O O   . LEU B 2 131 ? 57.206 103.319 39.224 1.00 30.95  ? 131 LEU B O   1 
ATOM   2605 C CB  . LEU B 2 131 ? 55.284 104.930 38.112 1.00 26.60  ? 131 LEU B CB  1 
ATOM   2606 C CG  . LEU B 2 131 ? 54.559 106.071 37.395 1.00 26.00  ? 131 LEU B CG  1 
ATOM   2607 C CD1 . LEU B 2 131 ? 53.803 106.897 38.405 1.00 25.49  ? 131 LEU B CD1 1 
ATOM   2608 C CD2 . LEU B 2 131 ? 55.562 106.942 36.657 1.00 27.34  ? 131 LEU B CD2 1 
ATOM   2609 N N   . LYS B 2 132 ? 57.008 101.723 37.661 1.00 31.38  ? 132 LYS B N   1 
ATOM   2610 C CA  . LYS B 2 132 ? 57.747 100.723 38.425 1.00 32.69  ? 132 LYS B CA  1 
ATOM   2611 C C   . LYS B 2 132 ? 59.262 100.946 38.536 1.00 33.84  ? 132 LYS B C   1 
ATOM   2612 O O   . LYS B 2 132 ? 59.914 101.376 37.583 1.00 34.41  ? 132 LYS B O   1 
ATOM   2613 C CB  . LYS B 2 132 ? 57.482 99.330  37.834 1.00 31.35  ? 132 LYS B CB  1 
ATOM   2614 C CG  . LYS B 2 132 ? 58.365 98.246  38.427 1.00 35.21  ? 132 LYS B CG  1 
ATOM   2615 C CD  . LYS B 2 132 ? 57.967 96.831  38.011 1.00 37.52  ? 132 LYS B CD  1 
ATOM   2616 C CE  . LYS B 2 132 ? 58.947 95.814  38.614 1.00 36.29  ? 132 LYS B CE  1 
ATOM   2617 N NZ  . LYS B 2 132 ? 58.567 94.399  38.381 1.00 35.06  ? 132 LYS B NZ  1 
ATOM   2618 N N   . GLY B 2 133 ? 59.810 100.648 39.713 1.00 33.21  ? 133 GLY B N   1 
ATOM   2619 C CA  . GLY B 2 133 ? 61.240 100.769 39.917 1.00 32.73  ? 133 GLY B CA  1 
ATOM   2620 C C   . GLY B 2 133 ? 61.802 102.140 40.236 1.00 34.31  ? 133 GLY B C   1 
ATOM   2621 O O   . GLY B 2 133 ? 63.015 102.351 40.106 1.00 34.90  ? 133 GLY B O   1 
ATOM   2622 N N   . ASN B 2 134 ? 60.951 103.083 40.630 1.00 31.36  ? 134 ASN B N   1 
ATOM   2623 C CA  . ASN B 2 134 ? 61.453 104.398 40.989 1.00 31.46  ? 134 ASN B CA  1 
ATOM   2624 C C   . ASN B 2 134 ? 61.598 104.455 42.503 1.00 33.08  ? 134 ASN B C   1 
ATOM   2625 O O   . ASN B 2 134 ? 61.691 103.410 43.155 1.00 33.53  ? 134 ASN B O   1 
ATOM   2626 C CB  . ASN B 2 134 ? 60.530 105.509 40.488 1.00 31.65  ? 134 ASN B CB  1 
ATOM   2627 C CG  . ASN B 2 134 ? 60.586 105.685 38.970 1.00 31.90  ? 134 ASN B CG  1 
ATOM   2628 O OD1 . ASN B 2 134 ? 59.802 105.081 38.230 1.00 29.20  ? 134 ASN B OD1 1 
ATOM   2629 N ND2 . ASN B 2 134 ? 61.519 106.514 38.502 1.00 29.09  ? 134 ASN B ND2 1 
ATOM   2630 N N   . GLU B 2 135 ? 61.608 105.661 43.068 1.00 32.92  ? 135 GLU B N   1 
ATOM   2631 C CA  . GLU B 2 135 ? 61.780 105.826 44.512 1.00 32.12  ? 135 GLU B CA  1 
ATOM   2632 C C   . GLU B 2 135 ? 60.625 106.550 45.194 1.00 31.30  ? 135 GLU B C   1 
ATOM   2633 O O   . GLU B 2 135 ? 60.832 107.337 46.118 1.00 32.38  ? 135 GLU B O   1 
ATOM   2634 C CB  . GLU B 2 135 ? 63.076 106.590 44.786 1.00 33.63  ? 135 GLU B CB  1 
ATOM   2635 C CG  . GLU B 2 135 ? 64.303 105.987 44.137 1.00 37.61  ? 135 GLU B CG  1 
ATOM   2636 C CD  . GLU B 2 135 ? 65.475 106.945 44.124 1.00 42.22  ? 135 GLU B CD  1 
ATOM   2637 O OE1 . GLU B 2 135 ? 65.901 107.385 45.215 1.00 45.42  ? 135 GLU B OE1 1 
ATOM   2638 O OE2 . GLU B 2 135 ? 65.971 107.261 43.020 1.00 44.48  ? 135 GLU B OE2 1 
ATOM   2639 N N   . LEU B 2 136 ? 59.407 106.285 44.749 1.00 29.90  ? 136 LEU B N   1 
ATOM   2640 C CA  . LEU B 2 136 ? 58.247 106.936 45.335 1.00 29.75  ? 136 LEU B CA  1 
ATOM   2641 C C   . LEU B 2 136 ? 57.997 106.464 46.765 1.00 29.63  ? 136 LEU B C   1 
ATOM   2642 O O   . LEU B 2 136 ? 57.955 105.268 47.031 1.00 31.28  ? 136 LEU B O   1 
ATOM   2643 C CB  . LEU B 2 136 ? 57.020 106.666 44.465 1.00 27.92  ? 136 LEU B CB  1 
ATOM   2644 C CG  . LEU B 2 136 ? 57.180 107.137 43.017 1.00 26.74  ? 136 LEU B CG  1 
ATOM   2645 C CD1 . LEU B 2 136 ? 56.012 106.667 42.169 1.00 21.44  ? 136 LEU B CD1 1 
ATOM   2646 C CD2 . LEU B 2 136 ? 57.305 108.651 43.003 1.00 23.15  ? 136 LEU B CD2 1 
ATOM   2647 N N   . LYS B 2 137 ? 57.849 107.411 47.684 1.00 31.99  ? 137 LYS B N   1 
ATOM   2648 C CA  . LYS B 2 137 ? 57.583 107.092 49.088 1.00 33.27  ? 137 LYS B CA  1 
ATOM   2649 C C   . LYS B 2 137 ? 56.084 107.187 49.360 1.00 32.35  ? 137 LYS B C   1 
ATOM   2650 O O   . LYS B 2 137 ? 55.521 106.369 50.087 1.00 30.45  ? 137 LYS B O   1 
ATOM   2651 C CB  . LYS B 2 137 ? 58.318 108.058 50.011 1.00 35.23  ? 137 LYS B CB  1 
ATOM   2652 C CG  . LYS B 2 137 ? 59.820 107.877 50.055 1.00 40.54  ? 137 LYS B CG  1 
ATOM   2653 C CD  . LYS B 2 137 ? 60.399 108.644 51.244 1.00 44.88  ? 137 LYS B CD  1 
ATOM   2654 C CE  . LYS B 2 137 ? 61.873 108.313 51.490 1.00 48.83  ? 137 LYS B CE  1 
ATOM   2655 N NZ  . LYS B 2 137 ? 62.370 108.923 52.766 1.00 48.48  ? 137 LYS B NZ  1 
ATOM   2656 N N   . THR B 2 138 ? 55.455 108.203 48.775 1.00 30.86  ? 138 THR B N   1 
ATOM   2657 C CA  . THR B 2 138 ? 54.020 108.420 48.911 1.00 32.09  ? 138 THR B CA  1 
ATOM   2658 C C   . THR B 2 138 ? 53.460 108.982 47.595 1.00 34.82  ? 138 THR B C   1 
ATOM   2659 O O   . THR B 2 138 ? 54.217 109.305 46.676 1.00 34.75  ? 138 THR B O   1 
ATOM   2660 C CB  . THR B 2 138 ? 53.704 109.412 50.044 1.00 30.65  ? 138 THR B CB  1 
ATOM   2661 O OG1 . THR B 2 138 ? 54.260 110.694 49.727 1.00 31.75  ? 138 THR B OG1 1 
ATOM   2662 C CG2 . THR B 2 138 ? 54.284 108.921 51.357 1.00 31.32  ? 138 THR B CG2 1 
ATOM   2663 N N   . LEU B 2 139 ? 52.138 109.098 47.510 1.00 33.90  ? 139 LEU B N   1 
ATOM   2664 C CA  . LEU B 2 139 ? 51.497 109.613 46.313 1.00 33.13  ? 139 LEU B CA  1 
ATOM   2665 C C   . LEU B 2 139 ? 50.619 110.804 46.673 1.00 34.99  ? 139 LEU B C   1 
ATOM   2666 O O   . LEU B 2 139 ? 50.036 110.851 47.756 1.00 34.95  ? 139 LEU B O   1 
ATOM   2667 C CB  . LEU B 2 139 ? 50.640 108.519 45.670 1.00 31.40  ? 139 LEU B CB  1 
ATOM   2668 C CG  . LEU B 2 139 ? 51.376 107.229 45.296 1.00 33.17  ? 139 LEU B CG  1 
ATOM   2669 C CD1 . LEU B 2 139 ? 50.391 106.085 45.103 1.00 31.93  ? 139 LEU B CD1 1 
ATOM   2670 C CD2 . LEU B 2 139 ? 52.192 107.463 44.046 1.00 29.45  ? 139 LEU B CD2 1 
ATOM   2671 N N   . PRO B 2 140 ? 50.518 111.791 45.773 1.00 35.42  ? 140 PRO B N   1 
ATOM   2672 C CA  . PRO B 2 140 ? 49.687 112.957 46.057 1.00 36.62  ? 140 PRO B CA  1 
ATOM   2673 C C   . PRO B 2 140 ? 48.205 112.612 45.910 1.00 39.58  ? 140 PRO B C   1 
ATOM   2674 O O   . PRO B 2 140 ? 47.821 111.747 45.115 1.00 38.96  ? 140 PRO B O   1 
ATOM   2675 C CB  . PRO B 2 140 ? 50.153 113.963 45.017 1.00 36.12  ? 140 PRO B CB  1 
ATOM   2676 C CG  . PRO B 2 140 ? 50.435 113.087 43.837 1.00 37.03  ? 140 PRO B CG  1 
ATOM   2677 C CD  . PRO B 2 140 ? 51.188 111.931 44.468 1.00 37.59  ? 140 PRO B CD  1 
ATOM   2678 N N   . PRO B 2 141 ? 47.348 113.283 46.687 1.00 42.00  ? 141 PRO B N   1 
ATOM   2679 C CA  . PRO B 2 141 ? 45.907 113.021 46.614 1.00 42.80  ? 141 PRO B CA  1 
ATOM   2680 C C   . PRO B 2 141 ? 45.322 113.442 45.260 1.00 42.41  ? 141 PRO B C   1 
ATOM   2681 O O   . PRO B 2 141 ? 45.733 114.450 44.676 1.00 42.52  ? 141 PRO B O   1 
ATOM   2682 C CB  . PRO B 2 141 ? 45.353 113.852 47.770 1.00 43.46  ? 141 PRO B CB  1 
ATOM   2683 C CG  . PRO B 2 141 ? 46.294 115.041 47.792 1.00 42.09  ? 141 PRO B CG  1 
ATOM   2684 C CD  . PRO B 2 141 ? 47.643 114.376 47.634 1.00 42.17  ? 141 PRO B CD  1 
ATOM   2685 N N   . GLY B 2 142 ? 44.370 112.659 44.767 1.00 40.69  ? 142 GLY B N   1 
ATOM   2686 C CA  . GLY B 2 142 ? 43.742 112.970 43.497 1.00 39.19  ? 142 GLY B CA  1 
ATOM   2687 C C   . GLY B 2 142 ? 44.600 112.667 42.283 1.00 37.70  ? 142 GLY B C   1 
ATOM   2688 O O   . GLY B 2 142 ? 44.284 113.121 41.188 1.00 39.83  ? 142 GLY B O   1 
ATOM   2689 N N   . LEU B 2 143 ? 45.674 111.902 42.469 1.00 34.79  ? 143 LEU B N   1 
ATOM   2690 C CA  . LEU B 2 143 ? 46.569 111.553 41.372 1.00 32.34  ? 143 LEU B CA  1 
ATOM   2691 C C   . LEU B 2 143 ? 45.854 110.963 40.166 1.00 31.66  ? 143 LEU B C   1 
ATOM   2692 O O   . LEU B 2 143 ? 46.220 111.237 39.026 1.00 32.83  ? 143 LEU B O   1 
ATOM   2693 C CB  . LEU B 2 143 ? 47.636 110.558 41.845 1.00 31.44  ? 143 LEU B CB  1 
ATOM   2694 C CG  . LEU B 2 143 ? 48.481 109.852 40.766 1.00 31.96  ? 143 LEU B CG  1 
ATOM   2695 C CD1 . LEU B 2 143 ? 49.241 110.876 39.932 1.00 30.77  ? 143 LEU B CD1 1 
ATOM   2696 C CD2 . LEU B 2 143 ? 49.453 108.877 41.423 1.00 27.74  ? 143 LEU B CD2 1 
ATOM   2697 N N   . LEU B 2 144 ? 44.827 110.162 40.409 1.00 30.94  ? 144 LEU B N   1 
ATOM   2698 C CA  . LEU B 2 144 ? 44.133 109.521 39.303 1.00 30.76  ? 144 LEU B CA  1 
ATOM   2699 C C   . LEU B 2 144 ? 42.722 110.020 39.045 1.00 30.35  ? 144 LEU B C   1 
ATOM   2700 O O   . LEU B 2 144 ? 41.915 109.326 38.429 1.00 29.12  ? 144 LEU B O   1 
ATOM   2701 C CB  . LEU B 2 144 ? 44.123 108.008 39.519 1.00 30.37  ? 144 LEU B CB  1 
ATOM   2702 C CG  . LEU B 2 144 ? 45.531 107.469 39.774 1.00 30.33  ? 144 LEU B CG  1 
ATOM   2703 C CD1 . LEU B 2 144 ? 45.493 105.958 39.933 1.00 29.65  ? 144 LEU B CD1 1 
ATOM   2704 C CD2 . LEU B 2 144 ? 46.445 107.885 38.627 1.00 29.20  ? 144 LEU B CD2 1 
ATOM   2705 N N   . THR B 2 145 ? 42.420 111.222 39.517 1.00 30.13  ? 145 THR B N   1 
ATOM   2706 C CA  . THR B 2 145 ? 41.106 111.790 39.277 1.00 30.11  ? 145 THR B CA  1 
ATOM   2707 C C   . THR B 2 145 ? 41.001 112.100 37.774 1.00 30.91  ? 145 THR B C   1 
ATOM   2708 O O   . THR B 2 145 ? 40.014 111.757 37.126 1.00 32.47  ? 145 THR B O   1 
ATOM   2709 C CB  . THR B 2 145 ? 40.901 113.077 40.101 1.00 28.49  ? 145 THR B CB  1 
ATOM   2710 O OG1 . THR B 2 145 ? 41.303 112.844 41.455 1.00 32.65  ? 145 THR B OG1 1 
ATOM   2711 C CG2 . THR B 2 145 ? 39.447 113.478 40.101 1.00 25.87  ? 145 THR B CG2 1 
ATOM   2712 N N   . PRO B 2 146 ? 42.037 112.729 37.196 1.00 31.78  ? 146 PRO B N   1 
ATOM   2713 C CA  . PRO B 2 146 ? 42.070 113.087 35.770 1.00 32.48  ? 146 PRO B CA  1 
ATOM   2714 C C   . PRO B 2 146 ? 42.075 111.907 34.800 1.00 33.09  ? 146 PRO B C   1 
ATOM   2715 O O   . PRO B 2 146 ? 41.737 112.053 33.624 1.00 33.44  ? 146 PRO B O   1 
ATOM   2716 C CB  . PRO B 2 146 ? 43.355 113.897 35.647 1.00 33.28  ? 146 PRO B CB  1 
ATOM   2717 C CG  . PRO B 2 146 ? 43.534 114.465 37.028 1.00 35.63  ? 146 PRO B CG  1 
ATOM   2718 C CD  . PRO B 2 146 ? 43.199 113.304 37.897 1.00 31.05  ? 146 PRO B CD  1 
ATOM   2719 N N   . THR B 2 147 ? 42.472 110.742 35.290 1.00 32.48  ? 147 THR B N   1 
ATOM   2720 C CA  . THR B 2 147 ? 42.541 109.556 34.449 1.00 32.71  ? 147 THR B CA  1 
ATOM   2721 C C   . THR B 2 147 ? 41.525 108.508 34.869 1.00 32.64  ? 147 THR B C   1 
ATOM   2722 O O   . THR B 2 147 ? 41.894 107.454 35.379 1.00 33.06  ? 147 THR B O   1 
ATOM   2723 C CB  . THR B 2 147 ? 43.961 108.918 34.498 1.00 34.12  ? 147 THR B CB  1 
ATOM   2724 O OG1 . THR B 2 147 ? 44.380 108.768 35.863 1.00 34.78  ? 147 THR B OG1 1 
ATOM   2725 C CG2 . THR B 2 147 ? 44.968 109.782 33.752 1.00 31.60  ? 147 THR B CG2 1 
ATOM   2726 N N   . PRO B 2 148 ? 40.229 108.782 34.653 1.00 34.18  ? 148 PRO B N   1 
ATOM   2727 C CA  . PRO B 2 148 ? 39.126 107.877 35.004 1.00 34.41  ? 148 PRO B CA  1 
ATOM   2728 C C   . PRO B 2 148 ? 39.081 106.549 34.237 1.00 34.44  ? 148 PRO B C   1 
ATOM   2729 O O   . PRO B 2 148 ? 38.542 105.561 34.732 1.00 35.41  ? 148 PRO B O   1 
ATOM   2730 C CB  . PRO B 2 148 ? 37.883 108.723 34.721 1.00 34.17  ? 148 PRO B CB  1 
ATOM   2731 C CG  . PRO B 2 148 ? 38.368 110.121 34.896 1.00 35.91  ? 148 PRO B CG  1 
ATOM   2732 C CD  . PRO B 2 148 ? 39.697 110.074 34.193 1.00 34.68  ? 148 PRO B CD  1 
ATOM   2733 N N   . LYS B 2 149 ? 39.637 106.531 33.033 1.00 32.99  ? 149 LYS B N   1 
ATOM   2734 C CA  . LYS B 2 149 ? 39.621 105.333 32.204 1.00 34.72  ? 149 LYS B CA  1 
ATOM   2735 C C   . LYS B 2 149 ? 40.798 104.391 32.439 1.00 35.60  ? 149 LYS B C   1 
ATOM   2736 O O   . LYS B 2 149 ? 41.009 103.455 31.663 1.00 35.11  ? 149 LYS B O   1 
ATOM   2737 C CB  . LYS B 2 149 ? 39.613 105.723 30.726 1.00 34.04  ? 149 LYS B CB  1 
ATOM   2738 C CG  . LYS B 2 149 ? 38.515 106.683 30.332 1.00 36.00  ? 149 LYS B CG  1 
ATOM   2739 C CD  . LYS B 2 149 ? 38.567 106.953 28.843 1.00 36.84  ? 149 LYS B CD  1 
ATOM   2740 C CE  . LYS B 2 149 ? 37.476 107.903 28.414 1.00 37.41  ? 149 LYS B CE  1 
ATOM   2741 N NZ  . LYS B 2 149 ? 37.489 108.087 26.937 1.00 41.03  ? 149 LYS B NZ  1 
ATOM   2742 N N   . LEU B 2 150 ? 41.555 104.616 33.505 1.00 34.27  ? 150 LEU B N   1 
ATOM   2743 C CA  . LEU B 2 150 ? 42.719 103.784 33.762 1.00 34.26  ? 150 LEU B CA  1 
ATOM   2744 C C   . LEU B 2 150 ? 42.392 102.304 33.942 1.00 35.08  ? 150 LEU B C   1 
ATOM   2745 O O   . LEU B 2 150 ? 41.508 101.941 34.721 1.00 33.37  ? 150 LEU B O   1 
ATOM   2746 C CB  . LEU B 2 150 ? 43.478 104.296 34.985 1.00 33.04  ? 150 LEU B CB  1 
ATOM   2747 C CG  . LEU B 2 150 ? 44.960 103.924 34.959 1.00 32.13  ? 150 LEU B CG  1 
ATOM   2748 C CD1 . LEU B 2 150 ? 45.642 104.703 33.840 1.00 27.57  ? 150 LEU B CD1 1 
ATOM   2749 C CD2 . LEU B 2 150 ? 45.606 104.223 36.302 1.00 32.27  ? 150 LEU B CD2 1 
ATOM   2750 N N   . GLU B 2 151 ? 43.130 101.461 33.219 1.00 34.15  ? 151 GLU B N   1 
ATOM   2751 C CA  . GLU B 2 151 ? 42.960 100.008 33.265 1.00 33.79  ? 151 GLU B CA  1 
ATOM   2752 C C   . GLU B 2 151 ? 44.114 99.295  33.985 1.00 33.13  ? 151 GLU B C   1 
ATOM   2753 O O   . GLU B 2 151 ? 43.899 98.304  34.686 1.00 33.14  ? 151 GLU B O   1 
ATOM   2754 C CB  . GLU B 2 151 ? 42.835 99.450  31.843 1.00 33.61  ? 151 GLU B CB  1 
ATOM   2755 C CG  . GLU B 2 151 ? 41.495 99.707  31.167 1.00 34.93  ? 151 GLU B CG  1 
ATOM   2756 C CD  . GLU B 2 151 ? 41.536 99.445  29.668 1.00 35.48  ? 151 GLU B CD  1 
ATOM   2757 O OE1 . GLU B 2 151 ? 42.372 98.632  29.223 1.00 34.51  ? 151 GLU B OE1 1 
ATOM   2758 O OE2 . GLU B 2 151 ? 40.723 100.043 28.932 1.00 38.01  ? 151 GLU B OE2 1 
ATOM   2759 N N   . LYS B 2 152 ? 45.336 99.787  33.800 1.00 30.98  ? 152 LYS B N   1 
ATOM   2760 C CA  . LYS B 2 152 ? 46.501 99.178  34.438 1.00 27.95  ? 152 LYS B CA  1 
ATOM   2761 C C   . LYS B 2 152 ? 47.378 100.228 35.100 1.00 28.46  ? 152 LYS B C   1 
ATOM   2762 O O   . LYS B 2 152 ? 47.739 101.229 34.481 1.00 28.54  ? 152 LYS B O   1 
ATOM   2763 C CB  . LYS B 2 152 ? 47.337 98.413  33.415 1.00 25.96  ? 152 LYS B CB  1 
ATOM   2764 C CG  . LYS B 2 152 ? 46.566 97.385  32.619 1.00 26.77  ? 152 LYS B CG  1 
ATOM   2765 C CD  . LYS B 2 152 ? 47.501 96.469  31.849 1.00 24.39  ? 152 LYS B CD  1 
ATOM   2766 C CE  . LYS B 2 152 ? 46.721 95.514  30.956 1.00 26.25  ? 152 LYS B CE  1 
ATOM   2767 N NZ  . LYS B 2 152 ? 45.515 94.980  31.632 1.00 26.85  ? 152 LYS B NZ  1 
ATOM   2768 N N   . LEU B 2 153 ? 47.709 99.993  36.365 1.00 28.49  ? 153 LEU B N   1 
ATOM   2769 C CA  . LEU B 2 153 ? 48.560 100.896 37.127 1.00 28.58  ? 153 LEU B CA  1 
ATOM   2770 C C   . LEU B 2 153 ? 49.671 100.085 37.779 1.00 29.67  ? 153 LEU B C   1 
ATOM   2771 O O   . LEU B 2 153 ? 49.420 99.006  38.314 1.00 29.89  ? 153 LEU B O   1 
ATOM   2772 C CB  . LEU B 2 153 ? 47.762 101.606 38.223 1.00 29.21  ? 153 LEU B CB  1 
ATOM   2773 C CG  . LEU B 2 153 ? 48.604 102.442 39.202 1.00 31.18  ? 153 LEU B CG  1 
ATOM   2774 C CD1 . LEU B 2 153 ? 49.249 103.599 38.451 1.00 28.75  ? 153 LEU B CD1 1 
ATOM   2775 C CD2 . LEU B 2 153 ? 47.735 102.962 40.347 1.00 31.27  ? 153 LEU B CD2 1 
ATOM   2776 N N   . SER B 2 154 ? 50.896 100.597 37.725 1.00 28.49  ? 154 SER B N   1 
ATOM   2777 C CA  . SER B 2 154 ? 52.018 99.910  38.344 1.00 28.24  ? 154 SER B CA  1 
ATOM   2778 C C   . SER B 2 154 ? 52.864 100.875 39.156 1.00 28.37  ? 154 SER B C   1 
ATOM   2779 O O   . SER B 2 154 ? 53.340 101.891 38.650 1.00 26.50  ? 154 SER B O   1 
ATOM   2780 C CB  . SER B 2 154 ? 52.901 99.226  37.296 1.00 29.21  ? 154 SER B CB  1 
ATOM   2781 O OG  . SER B 2 154 ? 53.975 98.534  37.920 1.00 25.12  ? 154 SER B OG  1 
ATOM   2782 N N   . LEU B 2 155 ? 53.042 100.534 40.426 1.00 28.99  ? 155 LEU B N   1 
ATOM   2783 C CA  . LEU B 2 155 ? 53.829 101.328 41.352 1.00 28.83  ? 155 LEU B CA  1 
ATOM   2784 C C   . LEU B 2 155 ? 54.750 100.356 42.055 1.00 29.99  ? 155 LEU B C   1 
ATOM   2785 O O   . LEU B 2 155 ? 55.326 100.668 43.098 1.00 33.42  ? 155 LEU B O   1 
ATOM   2786 C CB  . LEU B 2 155 ? 52.920 101.998 42.375 1.00 26.99  ? 155 LEU B CB  1 
ATOM   2787 C CG  . LEU B 2 155 ? 51.924 103.014 41.833 1.00 26.28  ? 155 LEU B CG  1 
ATOM   2788 C CD1 . LEU B 2 155 ? 50.994 103.435 42.943 1.00 29.47  ? 155 LEU B CD1 1 
ATOM   2789 C CD2 . LEU B 2 155 ? 52.667 104.206 41.262 1.00 26.59  ? 155 LEU B CD2 1 
ATOM   2790 N N   . ALA B 2 156 ? 54.868 99.166  41.477 1.00 28.94  ? 156 ALA B N   1 
ATOM   2791 C CA  . ALA B 2 156 ? 55.709 98.118  42.033 1.00 29.45  ? 156 ALA B CA  1 
ATOM   2792 C C   . ALA B 2 156 ? 57.167 98.554  42.182 1.00 30.04  ? 156 ALA B C   1 
ATOM   2793 O O   . ALA B 2 156 ? 57.668 99.387  41.423 1.00 28.35  ? 156 ALA B O   1 
ATOM   2794 C CB  . ALA B 2 156 ? 55.624 96.878  41.162 1.00 27.98  ? 156 ALA B CB  1 
ATOM   2795 N N   . ASN B 2 157 ? 57.826 97.992  43.188 1.00 30.68  ? 157 ASN B N   1 
ATOM   2796 C CA  . ASN B 2 157 ? 59.227 98.261  43.483 1.00 32.13  ? 157 ASN B CA  1 
ATOM   2797 C C   . ASN B 2 157 ? 59.663 99.693  43.783 1.00 33.60  ? 157 ASN B C   1 
ATOM   2798 O O   . ASN B 2 157 ? 60.776 100.090 43.444 1.00 35.52  ? 157 ASN B O   1 
ATOM   2799 C CB  . ASN B 2 157 ? 60.104 97.681  42.379 1.00 32.86  ? 157 ASN B CB  1 
ATOM   2800 C CG  . ASN B 2 157 ? 60.154 96.166  42.420 1.00 33.78  ? 157 ASN B CG  1 
ATOM   2801 O OD1 . ASN B 2 157 ? 59.145 95.487  42.216 1.00 31.61  ? 157 ASN B OD1 1 
ATOM   2802 N ND2 . ASN B 2 157 ? 61.333 95.628  42.699 1.00 33.57  ? 157 ASN B ND2 1 
ATOM   2803 N N   . ASN B 2 158 ? 58.789 100.472 44.406 1.00 33.76  ? 158 ASN B N   1 
ATOM   2804 C CA  . ASN B 2 158 ? 59.144 101.825 44.813 1.00 34.16  ? 158 ASN B CA  1 
ATOM   2805 C C   . ASN B 2 158 ? 59.341 101.684 46.322 1.00 34.53  ? 158 ASN B C   1 
ATOM   2806 O O   . ASN B 2 158 ? 59.517 100.571 46.820 1.00 33.31  ? 158 ASN B O   1 
ATOM   2807 C CB  . ASN B 2 158 ? 58.013 102.811 44.502 1.00 36.05  ? 158 ASN B CB  1 
ATOM   2808 C CG  . ASN B 2 158 ? 57.988 103.233 43.039 1.00 35.47  ? 158 ASN B CG  1 
ATOM   2809 O OD1 . ASN B 2 158 ? 58.840 103.997 42.584 1.00 33.12  ? 158 ASN B OD1 1 
ATOM   2810 N ND2 . ASN B 2 158 ? 57.006 102.733 42.297 1.00 34.81  ? 158 ASN B ND2 1 
ATOM   2811 N N   . ASP B 2 159 ? 59.308 102.785 47.059 1.00 33.86  ? 159 ASP B N   1 
ATOM   2812 C CA  . ASP B 2 159 ? 59.488 102.696 48.503 1.00 33.47  ? 159 ASP B CA  1 
ATOM   2813 C C   . ASP B 2 159 ? 58.300 103.317 49.228 1.00 33.76  ? 159 ASP B C   1 
ATOM   2814 O O   . ASP B 2 159 ? 58.466 104.070 50.194 1.00 33.79  ? 159 ASP B O   1 
ATOM   2815 C CB  . ASP B 2 159 ? 60.764 103.442 48.877 1.00 34.34  ? 159 ASP B CB  1 
ATOM   2816 C CG  . ASP B 2 159 ? 61.953 102.774 48.211 1.00 37.16  ? 159 ASP B CG  1 
ATOM   2817 O OD1 . ASP B 2 159 ? 62.419 103.293 47.196 1.00 41.66  ? 159 ASP B OD1 1 
ATOM   2818 O OD2 . ASP B 2 159 ? 62.399 101.746 48.713 1.00 20.00  ? 159 ASP B OD2 1 
ATOM   2819 N N   . LEU B 2 160 ? 57.100 102.976 48.747 1.00 32.85  ? 160 LEU B N   1 
ATOM   2820 C CA  . LEU B 2 160 ? 55.840 103.496 49.279 1.00 29.85  ? 160 LEU B CA  1 
ATOM   2821 C C   . LEU B 2 160 ? 55.539 103.034 50.700 1.00 29.38  ? 160 LEU B C   1 
ATOM   2822 O O   . LEU B 2 160 ? 55.576 101.841 50.989 1.00 28.18  ? 160 LEU B O   1 
ATOM   2823 C CB  . LEU B 2 160 ? 54.683 103.098 48.358 1.00 27.46  ? 160 LEU B CB  1 
ATOM   2824 C CG  . LEU B 2 160 ? 54.784 103.576 46.911 1.00 28.92  ? 160 LEU B CG  1 
ATOM   2825 C CD1 . LEU B 2 160 ? 53.705 102.915 46.059 1.00 26.32  ? 160 LEU B CD1 1 
ATOM   2826 C CD2 . LEU B 2 160 ? 54.671 105.094 46.873 1.00 29.56  ? 160 LEU B CD2 1 
ATOM   2827 N N   . THR B 2 161 ? 55.230 103.993 51.575 1.00 29.15  ? 161 THR B N   1 
ATOM   2828 C CA  . THR B 2 161 ? 54.918 103.718 52.979 1.00 29.65  ? 161 THR B CA  1 
ATOM   2829 C C   . THR B 2 161 ? 53.419 103.726 53.269 1.00 31.67  ? 161 THR B C   1 
ATOM   2830 O O   . THR B 2 161 ? 52.983 103.310 54.341 1.00 29.83  ? 161 THR B O   1 
ATOM   2831 C CB  . THR B 2 161 ? 55.583 104.743 53.911 1.00 27.09  ? 161 THR B CB  1 
ATOM   2832 O OG1 . THR B 2 161 ? 55.127 106.061 53.582 1.00 28.24  ? 161 THR B OG1 1 
ATOM   2833 C CG2 . THR B 2 161 ? 57.075 104.680 53.773 1.00 28.40  ? 161 THR B CG2 1 
ATOM   2834 N N   . GLU B 2 162 ? 52.636 104.210 52.314 1.00 33.57  ? 162 GLU B N   1 
ATOM   2835 C CA  . GLU B 2 162 ? 51.191 104.244 52.474 1.00 38.03  ? 162 GLU B CA  1 
ATOM   2836 C C   . GLU B 2 162 ? 50.519 104.722 51.200 1.00 38.13  ? 162 GLU B C   1 
ATOM   2837 O O   . GLU B 2 162 ? 51.153 105.338 50.346 1.00 37.42  ? 162 GLU B O   1 
ATOM   2838 C CB  . GLU B 2 162 ? 50.795 105.148 53.641 1.00 39.11  ? 162 GLU B CB  1 
ATOM   2839 C CG  . GLU B 2 162 ? 51.084 106.605 53.422 1.00 43.74  ? 162 GLU B CG  1 
ATOM   2840 C CD  . GLU B 2 162 ? 51.685 107.251 54.652 1.00 48.09  ? 162 GLU B CD  1 
ATOM   2841 O OE1 . GLU B 2 162 ? 51.241 108.366 55.016 1.00 47.46  ? 162 GLU B OE1 1 
ATOM   2842 O OE2 . GLU B 2 162 ? 52.610 106.639 55.237 1.00 46.66  ? 162 GLU B OE2 1 
ATOM   2843 N N   . LEU B 2 163 ? 49.230 104.430 51.082 1.00 38.14  ? 163 LEU B N   1 
ATOM   2844 C CA  . LEU B 2 163 ? 48.468 104.808 49.911 1.00 38.33  ? 163 LEU B CA  1 
ATOM   2845 C C   . LEU B 2 163 ? 47.284 105.662 50.330 1.00 38.43  ? 163 LEU B C   1 
ATOM   2846 O O   . LEU B 2 163 ? 46.652 105.405 51.349 1.00 39.89  ? 163 LEU B O   1 
ATOM   2847 C CB  . LEU B 2 163 ? 47.966 103.557 49.176 1.00 38.73  ? 163 LEU B CB  1 
ATOM   2848 C CG  . LEU B 2 163 ? 49.006 102.569 48.642 1.00 38.41  ? 163 LEU B CG  1 
ATOM   2849 C CD1 . LEU B 2 163 ? 48.322 101.286 48.182 1.00 39.11  ? 163 LEU B CD1 1 
ATOM   2850 C CD2 . LEU B 2 163 ? 49.790 103.219 47.515 1.00 38.44  ? 163 LEU B CD2 1 
ATOM   2851 N N   . PRO B 2 164 ? 46.980 106.712 49.553 1.00 37.81  ? 164 PRO B N   1 
ATOM   2852 C CA  . PRO B 2 164 ? 45.852 107.592 49.868 1.00 35.49  ? 164 PRO B CA  1 
ATOM   2853 C C   . PRO B 2 164 ? 44.554 106.798 49.836 1.00 34.16  ? 164 PRO B C   1 
ATOM   2854 O O   . PRO B 2 164 ? 44.295 106.064 48.890 1.00 36.18  ? 164 PRO B O   1 
ATOM   2855 C CB  . PRO B 2 164 ? 45.927 108.659 48.771 1.00 35.40  ? 164 PRO B CB  1 
ATOM   2856 C CG  . PRO B 2 164 ? 46.600 107.950 47.644 1.00 37.05  ? 164 PRO B CG  1 
ATOM   2857 C CD  . PRO B 2 164 ? 47.667 107.163 48.332 1.00 38.10  ? 164 PRO B CD  1 
ATOM   2858 N N   . ALA B 2 165 ? 43.750 106.939 50.883 1.00 32.56  ? 165 ALA B N   1 
ATOM   2859 C CA  . ALA B 2 165 ? 42.490 106.211 51.002 1.00 30.41  ? 165 ALA B CA  1 
ATOM   2860 C C   . ALA B 2 165 ? 41.605 106.269 49.763 1.00 28.25  ? 165 ALA B C   1 
ATOM   2861 O O   . ALA B 2 165 ? 40.910 105.301 49.467 1.00 30.65  ? 165 ALA B O   1 
ATOM   2862 C CB  . ALA B 2 165 ? 41.709 106.701 52.231 1.00 30.67  ? 165 ALA B CB  1 
ATOM   2863 N N   . GLY B 2 166 ? 41.636 107.383 49.034 1.00 26.05  ? 166 GLY B N   1 
ATOM   2864 C CA  . GLY B 2 166 ? 40.805 107.501 47.847 1.00 25.28  ? 166 GLY B CA  1 
ATOM   2865 C C   . GLY B 2 166 ? 41.506 107.271 46.517 1.00 26.54  ? 166 GLY B C   1 
ATOM   2866 O O   . GLY B 2 166 ? 40.925 107.510 45.459 1.00 28.43  ? 166 GLY B O   1 
ATOM   2867 N N   . LEU B 2 167 ? 42.744 106.792 46.559 1.00 24.22  ? 167 LEU B N   1 
ATOM   2868 C CA  . LEU B 2 167 ? 43.516 106.555 45.350 1.00 23.71  ? 167 LEU B CA  1 
ATOM   2869 C C   . LEU B 2 167 ? 42.782 105.969 44.144 1.00 27.39  ? 167 LEU B C   1 
ATOM   2870 O O   . LEU B 2 167 ? 42.873 106.500 43.043 1.00 29.72  ? 167 LEU B O   1 
ATOM   2871 C CB  . LEU B 2 167 ? 44.709 105.658 45.668 1.00 22.27  ? 167 LEU B CB  1 
ATOM   2872 C CG  . LEU B 2 167 ? 45.565 105.280 44.454 1.00 21.14  ? 167 LEU B CG  1 
ATOM   2873 C CD1 . LEU B 2 167 ? 46.138 106.527 43.800 1.00 20.28  ? 167 LEU B CD1 1 
ATOM   2874 C CD2 . LEU B 2 167 ? 46.681 104.372 44.893 1.00 18.49  ? 167 LEU B CD2 1 
ATOM   2875 N N   . LEU B 2 168 ? 42.053 104.877 44.348 1.00 31.22  ? 168 LEU B N   1 
ATOM   2876 C CA  . LEU B 2 168 ? 41.374 104.200 43.247 1.00 31.45  ? 168 LEU B CA  1 
ATOM   2877 C C   . LEU B 2 168 ? 39.946 104.630 42.957 1.00 33.95  ? 168 LEU B C   1 
ATOM   2878 O O   . LEU B 2 168 ? 39.248 103.966 42.188 1.00 36.38  ? 168 LEU B O   1 
ATOM   2879 C CB  . LEU B 2 168 ? 41.387 102.694 43.497 1.00 30.25  ? 168 LEU B CB  1 
ATOM   2880 C CG  . LEU B 2 168 ? 42.725 102.067 43.901 1.00 29.75  ? 168 LEU B CG  1 
ATOM   2881 C CD1 . LEU B 2 168 ? 42.515 100.594 44.240 1.00 30.62  ? 168 LEU B CD1 1 
ATOM   2882 C CD2 . LEU B 2 168 ? 43.734 102.215 42.777 1.00 28.20  ? 168 LEU B CD2 1 
ATOM   2883 N N   . ASN B 2 169 ? 39.499 105.729 43.555 1.00 35.12  ? 169 ASN B N   1 
ATOM   2884 C CA  . ASN B 2 169 ? 38.133 106.184 43.322 1.00 34.53  ? 169 ASN B CA  1 
ATOM   2885 C C   . ASN B 2 169 ? 37.889 106.550 41.873 1.00 32.69  ? 169 ASN B C   1 
ATOM   2886 O O   . ASN B 2 169 ? 38.752 107.119 41.212 1.00 33.75  ? 169 ASN B O   1 
ATOM   2887 C CB  . ASN B 2 169 ? 37.800 107.389 44.201 1.00 36.71  ? 169 ASN B CB  1 
ATOM   2888 C CG  . ASN B 2 169 ? 37.744 107.036 45.665 1.00 39.52  ? 169 ASN B CG  1 
ATOM   2889 O OD1 . ASN B 2 169 ? 37.543 105.871 46.026 1.00 39.82  ? 169 ASN B OD1 1 
ATOM   2890 N ND2 . ASN B 2 169 ? 37.903 108.041 46.524 1.00 39.89  ? 169 ASN B ND2 1 
ATOM   2891 N N   . GLY B 2 170 ? 36.699 106.219 41.388 1.00 31.19  ? 170 GLY B N   1 
ATOM   2892 C CA  . GLY B 2 170 ? 36.339 106.536 40.023 1.00 30.66  ? 170 GLY B CA  1 
ATOM   2893 C C   . GLY B 2 170 ? 36.908 105.608 38.971 1.00 30.62  ? 170 GLY B C   1 
ATOM   2894 O O   . GLY B 2 170 ? 36.483 105.673 37.824 1.00 34.06  ? 170 GLY B O   1 
ATOM   2895 N N   . LEU B 2 171 ? 37.855 104.750 39.342 1.00 29.46  ? 171 LEU B N   1 
ATOM   2896 C CA  . LEU B 2 171 ? 38.458 103.831 38.379 1.00 29.12  ? 171 LEU B CA  1 
ATOM   2897 C C   . LEU B 2 171 ? 37.656 102.552 38.209 1.00 31.08  ? 171 LEU B C   1 
ATOM   2898 O O   . LEU B 2 171 ? 38.068 101.478 38.655 1.00 31.50  ? 171 LEU B O   1 
ATOM   2899 C CB  . LEU B 2 171 ? 39.882 103.497 38.797 1.00 25.69  ? 171 LEU B CB  1 
ATOM   2900 C CG  . LEU B 2 171 ? 40.790 104.720 38.873 1.00 25.25  ? 171 LEU B CG  1 
ATOM   2901 C CD1 . LEU B 2 171 ? 42.232 104.276 38.944 1.00 26.05  ? 171 LEU B CD1 1 
ATOM   2902 C CD2 . LEU B 2 171 ? 40.585 105.587 37.645 1.00 28.53  ? 171 LEU B CD2 1 
ATOM   2903 N N   . GLU B 2 172 ? 36.514 102.684 37.538 1.00 32.91  ? 172 GLU B N   1 
ATOM   2904 C CA  . GLU B 2 172 ? 35.589 101.576 37.303 1.00 33.96  ? 172 GLU B CA  1 
ATOM   2905 C C   . GLU B 2 172 ? 36.024 100.601 36.201 1.00 32.71  ? 172 GLU B C   1 
ATOM   2906 O O   . GLU B 2 172 ? 35.268 99.703  35.833 1.00 30.09  ? 172 GLU B O   1 
ATOM   2907 C CB  . GLU B 2 172 ? 34.204 102.132 36.962 1.00 35.49  ? 172 GLU B CB  1 
ATOM   2908 C CG  . GLU B 2 172 ? 33.778 103.366 37.764 1.00 40.34  ? 172 GLU B CG  1 
ATOM   2909 C CD  . GLU B 2 172 ? 33.644 103.106 39.254 1.00 43.82  ? 172 GLU B CD  1 
ATOM   2910 O OE1 . GLU B 2 172 ? 33.719 101.932 39.674 1.00 47.76  ? 172 GLU B OE1 1 
ATOM   2911 O OE2 . GLU B 2 172 ? 33.456 104.084 40.007 1.00 44.16  ? 172 GLU B OE2 1 
ATOM   2912 N N   . ASN B 2 173 ? 37.234 100.780 35.679 1.00 32.25  ? 173 ASN B N   1 
ATOM   2913 C CA  . ASN B 2 173 ? 37.751 99.911  34.626 1.00 31.59  ? 173 ASN B CA  1 
ATOM   2914 C C   . ASN B 2 173 ? 39.105 99.311  34.969 1.00 30.00  ? 173 ASN B C   1 
ATOM   2915 O O   . ASN B 2 173 ? 39.758 98.723  34.110 1.00 28.36  ? 173 ASN B O   1 
ATOM   2916 C CB  . ASN B 2 173 ? 37.895 100.683 33.314 1.00 34.76  ? 173 ASN B CB  1 
ATOM   2917 C CG  . ASN B 2 173 ? 36.566 101.017 32.683 1.00 38.01  ? 173 ASN B CG  1 
ATOM   2918 O OD1 . ASN B 2 173 ? 36.514 101.538 31.565 1.00 39.89  ? 173 ASN B OD1 1 
ATOM   2919 N ND2 . ASN B 2 173 ? 35.482 100.720 33.389 1.00 41.67  ? 173 ASN B ND2 1 
ATOM   2920 N N   . LEU B 2 174 ? 39.531 99.464  36.217 1.00 29.02  ? 174 LEU B N   1 
ATOM   2921 C CA  . LEU B 2 174 ? 40.827 98.950  36.636 1.00 29.36  ? 174 LEU B CA  1 
ATOM   2922 C C   . LEU B 2 174 ? 40.844 97.413  36.677 1.00 30.84  ? 174 LEU B C   1 
ATOM   2923 O O   . LEU B 2 174 ? 39.998 96.800  37.331 1.00 34.21  ? 174 LEU B O   1 
ATOM   2924 C CB  . LEU B 2 174 ? 41.177 99.522  38.014 1.00 29.35  ? 174 LEU B CB  1 
ATOM   2925 C CG  . LEU B 2 174 ? 42.630 99.424  38.481 1.00 30.55  ? 174 LEU B CG  1 
ATOM   2926 C CD1 . LEU B 2 174 ? 43.512 100.281 37.575 1.00 32.03  ? 174 LEU B CD1 1 
ATOM   2927 C CD2 . LEU B 2 174 ? 42.745 99.883  39.921 1.00 27.82  ? 174 LEU B CD2 1 
ATOM   2928 N N   . ASP B 2 175 ? 41.790 96.794  35.968 1.00 29.68  ? 175 ASP B N   1 
ATOM   2929 C CA  . ASP B 2 175 ? 41.900 95.338  35.961 1.00 26.52  ? 175 ASP B CA  1 
ATOM   2930 C C   . ASP B 2 175 ? 43.248 94.835  36.487 1.00 26.55  ? 175 ASP B C   1 
ATOM   2931 O O   . ASP B 2 175 ? 43.339 93.704  36.974 1.00 26.29  ? 175 ASP B O   1 
ATOM   2932 C CB  . ASP B 2 175 ? 41.602 94.758  34.558 1.00 26.56  ? 175 ASP B CB  1 
ATOM   2933 C CG  . ASP B 2 175 ? 42.608 95.183  33.500 1.00 27.72  ? 175 ASP B CG  1 
ATOM   2934 O OD1 . ASP B 2 175 ? 43.801 94.868  33.651 1.00 25.50  ? 175 ASP B OD1 1 
ATOM   2935 O OD2 . ASP B 2 175 ? 42.202 95.822  32.503 1.00 28.68  ? 175 ASP B OD2 1 
ATOM   2936 N N   . THR B 2 176 ? 44.287 95.669  36.409 1.00 25.59  ? 176 THR B N   1 
ATOM   2937 C CA  . THR B 2 176 ? 45.609 95.281  36.911 1.00 24.68  ? 176 THR B CA  1 
ATOM   2938 C C   . THR B 2 176 ? 46.203 96.353  37.833 1.00 26.84  ? 176 THR B C   1 
ATOM   2939 O O   . THR B 2 176 ? 46.403 97.495  37.422 1.00 26.48  ? 176 THR B O   1 
ATOM   2940 C CB  . THR B 2 176 ? 46.629 95.027  35.769 1.00 25.22  ? 176 THR B CB  1 
ATOM   2941 O OG1 . THR B 2 176 ? 46.086 94.115  34.808 1.00 24.25  ? 176 THR B OG1 1 
ATOM   2942 C CG2 . THR B 2 176 ? 47.901 94.413  36.334 1.00 26.42  ? 176 THR B CG2 1 
ATOM   2943 N N   . LEU B 2 177 ? 46.475 95.967  39.082 1.00 27.97  ? 177 LEU B N   1 
ATOM   2944 C CA  . LEU B 2 177 ? 47.067 96.848  40.096 1.00 24.36  ? 177 LEU B CA  1 
ATOM   2945 C C   . LEU B 2 177 ? 48.319 96.172  40.678 1.00 25.50  ? 177 LEU B C   1 
ATOM   2946 O O   . LEU B 2 177 ? 48.221 95.190  41.408 1.00 27.24  ? 177 LEU B O   1 
ATOM   2947 C CB  . LEU B 2 177 ? 46.053 97.132  41.211 1.00 18.73  ? 177 LEU B CB  1 
ATOM   2948 C CG  . LEU B 2 177 ? 46.472 97.949  42.447 1.00 17.96  ? 177 LEU B CG  1 
ATOM   2949 C CD1 . LEU B 2 177 ? 47.094 99.259  42.038 1.00 16.48  ? 177 LEU B CD1 1 
ATOM   2950 C CD2 . LEU B 2 177 ? 45.261 98.210  43.327 1.00 14.12  ? 177 LEU B CD2 1 
ATOM   2951 N N   . LEU B 2 178 ? 49.493 96.698  40.341 1.00 26.32  ? 178 LEU B N   1 
ATOM   2952 C CA  . LEU B 2 178 ? 50.761 96.142  40.816 1.00 24.61  ? 178 LEU B CA  1 
ATOM   2953 C C   . LEU B 2 178 ? 51.374 97.036  41.894 1.00 25.23  ? 178 LEU B C   1 
ATOM   2954 O O   . LEU B 2 178 ? 51.907 98.107  41.594 1.00 24.80  ? 178 LEU B O   1 
ATOM   2955 C CB  . LEU B 2 178 ? 51.742 96.003  39.644 1.00 22.10  ? 178 LEU B CB  1 
ATOM   2956 C CG  . LEU B 2 178 ? 51.262 95.195  38.427 1.00 19.73  ? 178 LEU B CG  1 
ATOM   2957 C CD1 . LEU B 2 178 ? 51.381 96.047  37.194 1.00 17.04  ? 178 LEU B CD1 1 
ATOM   2958 C CD2 . LEU B 2 178 ? 52.067 93.914  38.268 1.00 14.65  ? 178 LEU B CD2 1 
ATOM   2959 N N   . LEU B 2 179 ? 51.290 96.592  43.146 1.00 25.84  ? 179 LEU B N   1 
ATOM   2960 C CA  . LEU B 2 179 ? 51.829 97.341  44.282 1.00 27.38  ? 179 LEU B CA  1 
ATOM   2961 C C   . LEU B 2 179 ? 52.862 96.541  45.061 1.00 28.03  ? 179 LEU B C   1 
ATOM   2962 O O   . LEU B 2 179 ? 53.165 96.878  46.205 1.00 28.35  ? 179 LEU B O   1 
ATOM   2963 C CB  . LEU B 2 179 ? 50.704 97.724  45.238 1.00 25.85  ? 179 LEU B CB  1 
ATOM   2964 C CG  . LEU B 2 179 ? 49.648 98.682  44.689 1.00 29.73  ? 179 LEU B CG  1 
ATOM   2965 C CD1 . LEU B 2 179 ? 48.475 98.794  45.659 1.00 29.31  ? 179 LEU B CD1 1 
ATOM   2966 C CD2 . LEU B 2 179 ? 50.292 100.043 44.457 1.00 29.46  ? 179 LEU B CD2 1 
ATOM   2967 N N   . GLN B 2 180 ? 53.409 95.495  44.443 1.00 27.59  ? 180 GLN B N   1 
ATOM   2968 C CA  . GLN B 2 180 ? 54.375 94.634  45.116 1.00 27.79  ? 180 GLN B CA  1 
ATOM   2969 C C   . GLN B 2 180 ? 55.744 95.268  45.307 1.00 29.90  ? 180 GLN B C   1 
ATOM   2970 O O   . GLN B 2 180 ? 56.116 96.201  44.595 1.00 31.14  ? 180 GLN B O   1 
ATOM   2971 C CB  . GLN B 2 180 ? 54.534 93.305  44.357 1.00 25.41  ? 180 GLN B CB  1 
ATOM   2972 C CG  . GLN B 2 180 ? 55.414 93.369  43.113 1.00 20.38  ? 180 GLN B CG  1 
ATOM   2973 C CD  . GLN B 2 180 ? 54.682 93.838  41.862 1.00 22.32  ? 180 GLN B CD  1 
ATOM   2974 O OE1 . GLN B 2 180 ? 53.676 94.549  41.934 1.00 21.15  ? 180 GLN B OE1 1 
ATOM   2975 N NE2 . GLN B 2 180 ? 55.206 93.458  40.703 1.00 18.86  ? 180 GLN B NE2 1 
ATOM   2976 N N   . GLU B 2 181 ? 56.479 94.756  46.288 1.00 31.18  ? 181 GLU B N   1 
ATOM   2977 C CA  . GLU B 2 181 ? 57.826 95.220  46.583 1.00 33.85  ? 181 GLU B CA  1 
ATOM   2978 C C   . GLU B 2 181 ? 57.957 96.678  47.028 1.00 34.60  ? 181 GLU B C   1 
ATOM   2979 O O   . GLU B 2 181 ? 58.830 97.418  46.555 1.00 31.34  ? 181 GLU B O   1 
ATOM   2980 C CB  . GLU B 2 181 ? 58.729 94.959  45.375 1.00 36.32  ? 181 GLU B CB  1 
ATOM   2981 C CG  . GLU B 2 181 ? 58.942 93.476  45.070 1.00 40.79  ? 181 GLU B CG  1 
ATOM   2982 C CD  . GLU B 2 181 ? 59.560 92.710  46.240 1.00 43.75  ? 181 GLU B CD  1 
ATOM   2983 O OE1 . GLU B 2 181 ? 59.883 91.517  46.061 1.00 42.66  ? 181 GLU B OE1 1 
ATOM   2984 O OE2 . GLU B 2 181 ? 59.716 93.296  47.338 1.00 46.04  ? 181 GLU B OE2 1 
ATOM   2985 N N   . ASN B 2 182 ? 57.086 97.078  47.947 1.00 34.86  ? 182 ASN B N   1 
ATOM   2986 C CA  . ASN B 2 182 ? 57.107 98.424  48.501 1.00 36.16  ? 182 ASN B CA  1 
ATOM   2987 C C   . ASN B 2 182 ? 57.238 98.318  50.023 1.00 36.43  ? 182 ASN B C   1 
ATOM   2988 O O   . ASN B 2 182 ? 57.663 97.280  50.543 1.00 35.75  ? 182 ASN B O   1 
ATOM   2989 C CB  . ASN B 2 182 ? 55.837 99.179  48.101 1.00 37.68  ? 182 ASN B CB  1 
ATOM   2990 C CG  . ASN B 2 182 ? 55.934 99.778  46.704 1.00 40.03  ? 182 ASN B CG  1 
ATOM   2991 O OD1 . ASN B 2 182 ? 56.457 100.872 46.525 1.00 40.63  ? 182 ASN B OD1 1 
ATOM   2992 N ND2 . ASN B 2 182 ? 55.447 99.050  45.706 1.00 40.36  ? 182 ASN B ND2 1 
ATOM   2993 N N   . SER B 2 183 ? 56.874 99.375  50.738 1.00 34.88  ? 183 SER B N   1 
ATOM   2994 C CA  . SER B 2 183 ? 56.988 99.366  52.190 1.00 34.47  ? 183 SER B CA  1 
ATOM   2995 C C   . SER B 2 183 ? 55.648 99.601  52.870 1.00 34.83  ? 183 SER B C   1 
ATOM   2996 O O   . SER B 2 183 ? 55.562 100.299 53.886 1.00 34.39  ? 183 SER B O   1 
ATOM   2997 C CB  . SER B 2 183 ? 57.986 100.437 52.630 1.00 34.88  ? 183 SER B CB  1 
ATOM   2998 O OG  . SER B 2 183 ? 59.250 100.219 52.027 1.00 39.36  ? 183 SER B OG  1 
ATOM   2999 N N   . LEU B 2 184 ? 54.602 99.002  52.313 1.00 34.01  ? 184 LEU B N   1 
ATOM   3000 C CA  . LEU B 2 184 ? 53.257 99.159  52.850 1.00 33.65  ? 184 LEU B CA  1 
ATOM   3001 C C   . LEU B 2 184 ? 53.023 98.269  54.066 1.00 33.85  ? 184 LEU B C   1 
ATOM   3002 O O   . LEU B 2 184 ? 53.477 97.123  54.115 1.00 33.33  ? 184 LEU B O   1 
ATOM   3003 C CB  . LEU B 2 184 ? 52.239 98.852  51.752 1.00 30.86  ? 184 LEU B CB  1 
ATOM   3004 C CG  . LEU B 2 184 ? 52.511 99.699  50.508 1.00 28.33  ? 184 LEU B CG  1 
ATOM   3005 C CD1 . LEU B 2 184 ? 51.745 99.133  49.323 1.00 25.87  ? 184 LEU B CD1 1 
ATOM   3006 C CD2 . LEU B 2 184 ? 52.142 101.151 50.784 1.00 20.97  ? 184 LEU B CD2 1 
ATOM   3007 N N   . TYR B 2 185 ? 52.312 98.802  55.050 1.00 32.98  ? 185 TYR B N   1 
ATOM   3008 C CA  . TYR B 2 185 ? 52.045 98.044  56.261 1.00 34.36  ? 185 TYR B CA  1 
ATOM   3009 C C   . TYR B 2 185 ? 50.556 97.995  56.612 1.00 32.84  ? 185 TYR B C   1 
ATOM   3010 O O   . TYR B 2 185 ? 50.158 97.313  57.554 1.00 33.77  ? 185 TYR B O   1 
ATOM   3011 C CB  . TYR B 2 185 ? 52.861 98.639  57.410 1.00 35.02  ? 185 TYR B CB  1 
ATOM   3012 C CG  . TYR B 2 185 ? 52.614 100.115 57.587 1.00 37.98  ? 185 TYR B CG  1 
ATOM   3013 C CD1 . TYR B 2 185 ? 51.425 100.575 58.156 1.00 37.23  ? 185 TYR B CD1 1 
ATOM   3014 C CD2 . TYR B 2 185 ? 53.537 101.059 57.134 1.00 37.67  ? 185 TYR B CD2 1 
ATOM   3015 C CE1 . TYR B 2 185 ? 51.155 101.932 58.267 1.00 36.66  ? 185 TYR B CE1 1 
ATOM   3016 C CE2 . TYR B 2 185 ? 53.272 102.427 57.242 1.00 38.31  ? 185 TYR B CE2 1 
ATOM   3017 C CZ  . TYR B 2 185 ? 52.076 102.852 57.811 1.00 37.69  ? 185 TYR B CZ  1 
ATOM   3018 O OH  . TYR B 2 185 ? 51.784 104.193 57.925 1.00 39.35  ? 185 TYR B OH  1 
ATOM   3019 N N   . THR B 2 186 ? 49.735 98.721  55.862 1.00 30.46  ? 186 THR B N   1 
ATOM   3020 C CA  . THR B 2 186 ? 48.297 98.704  56.105 1.00 31.53  ? 186 THR B CA  1 
ATOM   3021 C C   . THR B 2 186 ? 47.527 99.294  54.926 1.00 32.39  ? 186 THR B C   1 
ATOM   3022 O O   . THR B 2 186 ? 48.055 100.111 54.179 1.00 33.54  ? 186 THR B O   1 
ATOM   3023 C CB  . THR B 2 186 ? 47.919 99.486  57.395 1.00 31.92  ? 186 THR B CB  1 
ATOM   3024 O OG1 . THR B 2 186 ? 46.555 99.203  57.739 1.00 27.88  ? 186 THR B OG1 1 
ATOM   3025 C CG2 . THR B 2 186 ? 48.073 100.994 57.185 1.00 26.32  ? 186 THR B CG2 1 
ATOM   3026 N N   . ILE B 2 187 ? 46.285 98.861  54.748 1.00 31.27  ? 187 ILE B N   1 
ATOM   3027 C CA  . ILE B 2 187 ? 45.460 99.375  53.668 1.00 33.91  ? 187 ILE B CA  1 
ATOM   3028 C C   . ILE B 2 187 ? 44.343 100.171 54.299 1.00 34.88  ? 187 ILE B C   1 
ATOM   3029 O O   . ILE B 2 187 ? 43.652 99.685  55.191 1.00 35.72  ? 187 ILE B O   1 
ATOM   3030 C CB  . ILE B 2 187 ? 44.837 98.242  52.801 1.00 35.82  ? 187 ILE B CB  1 
ATOM   3031 C CG1 . ILE B 2 187 ? 45.601 98.090  51.484 1.00 35.97  ? 187 ILE B CG1 1 
ATOM   3032 C CG2 . ILE B 2 187 ? 43.389 98.583  52.447 1.00 35.84  ? 187 ILE B CG2 1 
ATOM   3033 C CD1 . ILE B 2 187 ? 47.083 97.973  51.639 1.00 38.19  ? 187 ILE B CD1 1 
ATOM   3034 N N   . PRO B 2 188 ? 44.156 101.416 53.850 1.00 35.82  ? 188 PRO B N   1 
ATOM   3035 C CA  . PRO B 2 188 ? 43.092 102.244 54.410 1.00 36.99  ? 188 PRO B CA  1 
ATOM   3036 C C   . PRO B 2 188 ? 41.730 101.578 54.197 1.00 38.81  ? 188 PRO B C   1 
ATOM   3037 O O   . PRO B 2 188 ? 41.469 101.000 53.137 1.00 39.20  ? 188 PRO B O   1 
ATOM   3038 C CB  . PRO B 2 188 ? 43.246 103.556 53.645 1.00 37.18  ? 188 PRO B CB  1 
ATOM   3039 C CG  . PRO B 2 188 ? 43.815 103.114 52.333 1.00 35.82  ? 188 PRO B CG  1 
ATOM   3040 C CD  . PRO B 2 188 ? 44.846 102.116 52.756 1.00 35.31  ? 188 PRO B CD  1 
ATOM   3041 N N   . LYS B 2 189 ? 40.876 101.650 55.214 1.00 39.16  ? 189 LYS B N   1 
ATOM   3042 C CA  . LYS B 2 189 ? 39.549 101.049 55.150 1.00 39.72  ? 189 LYS B CA  1 
ATOM   3043 C C   . LYS B 2 189 ? 38.745 101.572 53.957 1.00 38.88  ? 189 LYS B C   1 
ATOM   3044 O O   . LYS B 2 189 ? 38.644 102.781 53.735 1.00 36.08  ? 189 LYS B O   1 
ATOM   3045 C CB  . LYS B 2 189 ? 38.797 101.326 56.457 1.00 42.30  ? 189 LYS B CB  1 
ATOM   3046 C CG  . LYS B 2 189 ? 37.380 100.788 56.504 1.00 43.23  ? 189 LYS B CG  1 
ATOM   3047 C CD  . LYS B 2 189 ? 36.696 101.171 57.812 1.00 45.80  ? 189 LYS B CD  1 
ATOM   3048 C CE  . LYS B 2 189 ? 35.291 100.573 57.908 1.00 49.20  ? 189 LYS B CE  1 
ATOM   3049 N NZ  . LYS B 2 189 ? 34.625 100.863 59.215 1.00 51.22  ? 189 LYS B NZ  1 
ATOM   3050 N N   . GLY B 2 190 ? 38.184 100.644 53.188 1.00 38.22  ? 190 GLY B N   1 
ATOM   3051 C CA  . GLY B 2 190 ? 37.388 101.014 52.031 1.00 36.33  ? 190 GLY B CA  1 
ATOM   3052 C C   . GLY B 2 190 ? 38.212 101.329 50.799 1.00 36.00  ? 190 GLY B C   1 
ATOM   3053 O O   . GLY B 2 190 ? 37.678 101.752 49.777 1.00 35.89  ? 190 GLY B O   1 
ATOM   3054 N N   . PHE B 2 191 ? 39.518 101.113 50.892 1.00 34.82  ? 191 PHE B N   1 
ATOM   3055 C CA  . PHE B 2 191 ? 40.422 101.396 49.789 1.00 33.67  ? 191 PHE B CA  1 
ATOM   3056 C C   . PHE B 2 191 ? 39.987 100.821 48.445 1.00 32.88  ? 191 PHE B C   1 
ATOM   3057 O O   . PHE B 2 191 ? 39.962 101.529 47.446 1.00 32.81  ? 191 PHE B O   1 
ATOM   3058 C CB  . PHE B 2 191 ? 41.824 100.880 50.120 1.00 33.73  ? 191 PHE B CB  1 
ATOM   3059 C CG  . PHE B 2 191 ? 42.829 101.130 49.035 1.00 34.39  ? 191 PHE B CG  1 
ATOM   3060 C CD1 . PHE B 2 191 ? 43.374 102.393 48.852 1.00 34.42  ? 191 PHE B CD1 1 
ATOM   3061 C CD2 . PHE B 2 191 ? 43.213 100.104 48.179 1.00 36.90  ? 191 PHE B CD2 1 
ATOM   3062 C CE1 . PHE B 2 191 ? 44.287 102.634 47.830 1.00 35.91  ? 191 PHE B CE1 1 
ATOM   3063 C CE2 . PHE B 2 191 ? 44.127 100.333 47.152 1.00 37.49  ? 191 PHE B CE2 1 
ATOM   3064 C CZ  . PHE B 2 191 ? 44.666 101.599 46.978 1.00 37.04  ? 191 PHE B CZ  1 
ATOM   3065 N N   . PHE B 2 192 ? 39.643 99.538  48.421 1.00 34.35  ? 192 PHE B N   1 
ATOM   3066 C CA  . PHE B 2 192 ? 39.260 98.875  47.176 1.00 33.86  ? 192 PHE B CA  1 
ATOM   3067 C C   . PHE B 2 192 ? 37.842 99.116  46.691 1.00 35.07  ? 192 PHE B C   1 
ATOM   3068 O O   . PHE B 2 192 ? 37.545 98.877  45.516 1.00 36.66  ? 192 PHE B O   1 
ATOM   3069 C CB  . PHE B 2 192 ? 39.479 97.364  47.287 1.00 33.39  ? 192 PHE B CB  1 
ATOM   3070 C CG  . PHE B 2 192 ? 40.912 96.972  47.479 1.00 32.47  ? 192 PHE B CG  1 
ATOM   3071 C CD1 . PHE B 2 192 ? 41.419 96.747  48.756 1.00 30.58  ? 192 PHE B CD1 1 
ATOM   3072 C CD2 . PHE B 2 192 ? 41.762 96.839  46.380 1.00 32.83  ? 192 PHE B CD2 1 
ATOM   3073 C CE1 . PHE B 2 192 ? 42.749 96.395  48.942 1.00 31.52  ? 192 PHE B CE1 1 
ATOM   3074 C CE2 . PHE B 2 192 ? 43.100 96.488  46.552 1.00 33.97  ? 192 PHE B CE2 1 
ATOM   3075 C CZ  . PHE B 2 192 ? 43.595 96.264  47.838 1.00 34.27  ? 192 PHE B CZ  1 
ATOM   3076 N N   . GLY B 2 193 ? 36.965 99.573  47.583 1.00 35.01  ? 193 GLY B N   1 
ATOM   3077 C CA  . GLY B 2 193 ? 35.584 99.817  47.202 1.00 32.05  ? 193 GLY B CA  1 
ATOM   3078 C C   . GLY B 2 193 ? 34.893 98.507  46.884 1.00 32.36  ? 193 GLY B C   1 
ATOM   3079 O O   . GLY B 2 193 ? 35.243 97.478  47.455 1.00 34.47  ? 193 GLY B O   1 
ATOM   3080 N N   . SER B 2 194 ? 33.929 98.532  45.967 1.00 31.33  ? 194 SER B N   1 
ATOM   3081 C CA  . SER B 2 194 ? 33.198 97.326  45.591 1.00 30.54  ? 194 SER B CA  1 
ATOM   3082 C C   . SER B 2 194 ? 33.534 96.847  44.178 1.00 31.80  ? 194 SER B C   1 
ATOM   3083 O O   . SER B 2 194 ? 33.058 95.800  43.738 1.00 32.18  ? 194 SER B O   1 
ATOM   3084 C CB  . SER B 2 194 ? 31.690 97.568  45.704 1.00 30.28  ? 194 SER B CB  1 
ATOM   3085 O OG  . SER B 2 194 ? 31.255 98.580  44.810 1.00 30.91  ? 194 SER B OG  1 
ATOM   3086 N N   . HIS B 2 195 ? 34.355 97.620  43.478 1.00 31.77  ? 195 HIS B N   1 
ATOM   3087 C CA  . HIS B 2 195 ? 34.776 97.305  42.117 1.00 33.07  ? 195 HIS B CA  1 
ATOM   3088 C C   . HIS B 2 195 ? 35.566 95.994  42.032 1.00 36.28  ? 195 HIS B C   1 
ATOM   3089 O O   . HIS B 2 195 ? 36.391 95.691  42.895 1.00 37.91  ? 195 HIS B O   1 
ATOM   3090 C CB  . HIS B 2 195 ? 35.641 98.451  41.586 1.00 34.73  ? 195 HIS B CB  1 
ATOM   3091 C CG  . HIS B 2 195 ? 36.271 98.180  40.255 1.00 33.98  ? 195 HIS B CG  1 
ATOM   3092 N ND1 . HIS B 2 195 ? 35.538 98.070  39.093 1.00 33.51  ? 195 HIS B ND1 1 
ATOM   3093 C CD2 . HIS B 2 195 ? 37.568 98.017  39.900 1.00 32.96  ? 195 HIS B CD2 1 
ATOM   3094 C CE1 . HIS B 2 195 ? 36.356 97.853  38.079 1.00 34.75  ? 195 HIS B CE1 1 
ATOM   3095 N NE2 . HIS B 2 195 ? 37.594 97.816  38.541 1.00 35.50  ? 195 HIS B NE2 1 
ATOM   3096 N N   . LEU B 2 196 ? 35.311 95.216  40.984 1.00 36.77  ? 196 LEU B N   1 
ATOM   3097 C CA  . LEU B 2 196 ? 36.018 93.959  40.788 1.00 35.46  ? 196 LEU B CA  1 
ATOM   3098 C C   . LEU B 2 196 ? 37.416 94.277  40.259 1.00 35.78  ? 196 LEU B C   1 
ATOM   3099 O O   . LEU B 2 196 ? 37.573 95.158  39.418 1.00 38.39  ? 196 LEU B O   1 
ATOM   3100 C CB  . LEU B 2 196 ? 35.271 93.088  39.778 1.00 35.57  ? 196 LEU B CB  1 
ATOM   3101 C CG  . LEU B 2 196 ? 35.724 91.628  39.700 1.00 38.75  ? 196 LEU B CG  1 
ATOM   3102 C CD1 . LEU B 2 196 ? 35.464 90.941  41.036 1.00 37.09  ? 196 LEU B CD1 1 
ATOM   3103 C CD2 . LEU B 2 196 ? 34.974 90.912  38.587 1.00 39.28  ? 196 LEU B CD2 1 
ATOM   3104 N N   . LEU B 2 197 ? 38.430 93.564  40.741 1.00 34.04  ? 197 LEU B N   1 
ATOM   3105 C CA  . LEU B 2 197 ? 39.799 93.809  40.296 1.00 30.08  ? 197 LEU B CA  1 
ATOM   3106 C C   . LEU B 2 197 ? 40.512 92.518  39.896 1.00 29.57  ? 197 LEU B C   1 
ATOM   3107 O O   . LEU B 2 197 ? 41.185 91.891  40.714 1.00 28.48  ? 197 LEU B O   1 
ATOM   3108 C CB  . LEU B 2 197 ? 40.578 94.512  41.405 1.00 31.01  ? 197 LEU B CB  1 
ATOM   3109 C CG  . LEU B 2 197 ? 42.022 94.919  41.103 1.00 30.60  ? 197 LEU B CG  1 
ATOM   3110 C CD1 . LEU B 2 197 ? 42.100 95.690  39.787 1.00 28.20  ? 197 LEU B CD1 1 
ATOM   3111 C CD2 . LEU B 2 197 ? 42.540 95.760  42.256 1.00 29.81  ? 197 LEU B CD2 1 
ATOM   3112 N N   . PRO B 2 198 ? 40.386 92.118  38.617 1.00 29.14  ? 198 PRO B N   1 
ATOM   3113 C CA  . PRO B 2 198 ? 41.007 90.900  38.091 1.00 27.92  ? 198 PRO B CA  1 
ATOM   3114 C C   . PRO B 2 198 ? 42.405 90.572  38.632 1.00 28.55  ? 198 PRO B C   1 
ATOM   3115 O O   . PRO B 2 198 ? 42.625 89.468  39.138 1.00 30.55  ? 198 PRO B O   1 
ATOM   3116 C CB  . PRO B 2 198 ? 41.005 91.141  36.582 1.00 26.14  ? 198 PRO B CB  1 
ATOM   3117 C CG  . PRO B 2 198 ? 39.738 91.873  36.383 1.00 26.44  ? 198 PRO B CG  1 
ATOM   3118 C CD  . PRO B 2 198 ? 39.739 92.877  37.530 1.00 26.41  ? 198 PRO B CD  1 
ATOM   3119 N N   . PHE B 2 199 ? 43.346 91.512  38.535 1.00 26.19  ? 199 PHE B N   1 
ATOM   3120 C CA  . PHE B 2 199 ? 44.709 91.249  39.006 1.00 26.91  ? 199 PHE B CA  1 
ATOM   3121 C C   . PHE B 2 199 ? 45.248 92.275  40.001 1.00 26.21  ? 199 PHE B C   1 
ATOM   3122 O O   . PHE B 2 199 ? 45.362 93.456  39.688 1.00 28.80  ? 199 PHE B O   1 
ATOM   3123 C CB  . PHE B 2 199 ? 45.697 91.183  37.823 1.00 26.97  ? 199 PHE B CB  1 
ATOM   3124 C CG  . PHE B 2 199 ? 45.373 90.130  36.789 1.00 27.77  ? 199 PHE B CG  1 
ATOM   3125 C CD1 . PHE B 2 199 ? 44.362 90.330  35.858 1.00 27.98  ? 199 PHE B CD1 1 
ATOM   3126 C CD2 . PHE B 2 199 ? 46.107 88.946  36.729 1.00 29.97  ? 199 PHE B CD2 1 
ATOM   3127 C CE1 . PHE B 2 199 ? 44.092 89.368  34.881 1.00 30.35  ? 199 PHE B CE1 1 
ATOM   3128 C CE2 . PHE B 2 199 ? 45.843 87.979  35.759 1.00 27.72  ? 199 PHE B CE2 1 
ATOM   3129 C CZ  . PHE B 2 199 ? 44.837 88.189  34.834 1.00 28.33  ? 199 PHE B CZ  1 
ATOM   3130 N N   . ALA B 2 200 ? 45.606 91.820  41.193 1.00 25.07  ? 200 ALA B N   1 
ATOM   3131 C CA  . ALA B 2 200 ? 46.172 92.706  42.203 1.00 25.01  ? 200 ALA B CA  1 
ATOM   3132 C C   . ALA B 2 200 ? 47.383 92.022  42.848 1.00 26.19  ? 200 ALA B C   1 
ATOM   3133 O O   . ALA B 2 200 ? 47.269 90.930  43.401 1.00 27.75  ? 200 ALA B O   1 
ATOM   3134 C CB  . ALA B 2 200 ? 45.130 93.043  43.250 1.00 23.24  ? 200 ALA B CB  1 
ATOM   3135 N N   . PHE B 2 201 ? 48.543 92.664  42.756 1.00 26.57  ? 201 PHE B N   1 
ATOM   3136 C CA  . PHE B 2 201 ? 49.773 92.119  43.315 1.00 24.98  ? 201 PHE B CA  1 
ATOM   3137 C C   . PHE B 2 201 ? 50.091 92.899  44.585 1.00 25.45  ? 201 PHE B C   1 
ATOM   3138 O O   . PHE B 2 201 ? 50.311 94.107  44.536 1.00 25.18  ? 201 PHE B O   1 
ATOM   3139 C CB  . PHE B 2 201 ? 50.913 92.263  42.301 1.00 27.27  ? 201 PHE B CB  1 
ATOM   3140 C CG  . PHE B 2 201 ? 50.631 91.622  40.956 1.00 28.02  ? 201 PHE B CG  1 
ATOM   3141 C CD1 . PHE B 2 201 ? 49.660 92.144  40.105 1.00 24.90  ? 201 PHE B CD1 1 
ATOM   3142 C CD2 . PHE B 2 201 ? 51.338 90.492  40.544 1.00 27.10  ? 201 PHE B CD2 1 
ATOM   3143 C CE1 . PHE B 2 201 ? 49.397 91.554  38.869 1.00 24.01  ? 201 PHE B CE1 1 
ATOM   3144 C CE2 . PHE B 2 201 ? 51.080 89.895  39.304 1.00 24.88  ? 201 PHE B CE2 1 
ATOM   3145 C CZ  . PHE B 2 201 ? 50.107 90.427  38.469 1.00 23.29  ? 201 PHE B CZ  1 
ATOM   3146 N N   . LEU B 2 202 ? 50.122 92.218  45.725 1.00 25.52  ? 202 LEU B N   1 
ATOM   3147 C CA  . LEU B 2 202 ? 50.378 92.906  46.986 1.00 25.62  ? 202 LEU B CA  1 
ATOM   3148 C C   . LEU B 2 202 ? 51.536 92.378  47.823 1.00 25.87  ? 202 LEU B C   1 
ATOM   3149 O O   . LEU B 2 202 ? 51.796 92.903  48.902 1.00 27.41  ? 202 LEU B O   1 
ATOM   3150 C CB  . LEU B 2 202 ? 49.095 92.914  47.822 1.00 25.03  ? 202 LEU B CB  1 
ATOM   3151 C CG  . LEU B 2 202 ? 47.957 93.748  47.210 1.00 25.59  ? 202 LEU B CG  1 
ATOM   3152 C CD1 . LEU B 2 202 ? 46.600 93.194  47.599 1.00 21.03  ? 202 LEU B CD1 1 
ATOM   3153 C CD2 . LEU B 2 202 ? 48.111 95.194  47.641 1.00 21.69  ? 202 LEU B CD2 1 
ATOM   3154 N N   . HIS B 2 203 ? 52.238 91.361  47.328 1.00 27.86  ? 203 HIS B N   1 
ATOM   3155 C CA  . HIS B 2 203 ? 53.374 90.772  48.052 1.00 28.94  ? 203 HIS B CA  1 
ATOM   3156 C C   . HIS B 2 203 ? 54.598 91.683  48.137 1.00 29.74  ? 203 HIS B C   1 
ATOM   3157 O O   . HIS B 2 203 ? 54.632 92.763  47.545 1.00 29.79  ? 203 HIS B O   1 
ATOM   3158 C CB  . HIS B 2 203 ? 53.793 89.428  47.423 1.00 28.26  ? 203 HIS B CB  1 
ATOM   3159 C CG  . HIS B 2 203 ? 54.298 89.536  46.015 1.00 31.60  ? 203 HIS B CG  1 
ATOM   3160 N ND1 . HIS B 2 203 ? 53.460 89.572  44.921 1.00 33.14  ? 203 HIS B ND1 1 
ATOM   3161 C CD2 . HIS B 2 203 ? 55.559 89.603  45.523 1.00 33.50  ? 203 HIS B CD2 1 
ATOM   3162 C CE1 . HIS B 2 203 ? 54.183 89.653  43.817 1.00 33.76  ? 203 HIS B CE1 1 
ATOM   3163 N NE2 . HIS B 2 203 ? 55.459 89.673  44.155 1.00 32.30  ? 203 HIS B NE2 1 
ATOM   3164 N N   . GLY B 2 204 ? 55.608 91.230  48.871 1.00 30.30  ? 204 GLY B N   1 
ATOM   3165 C CA  . GLY B 2 204 ? 56.815 92.017  49.031 1.00 31.27  ? 204 GLY B CA  1 
ATOM   3166 C C   . GLY B 2 204 ? 56.636 93.237  49.922 1.00 32.81  ? 204 GLY B C   1 
ATOM   3167 O O   . GLY B 2 204 ? 57.438 94.161  49.854 1.00 36.05  ? 204 GLY B O   1 
ATOM   3168 N N   . ASN B 2 205 ? 55.599 93.246  50.758 1.00 33.06  ? 205 ASN B N   1 
ATOM   3169 C CA  . ASN B 2 205 ? 55.327 94.369  51.657 1.00 35.50  ? 205 ASN B CA  1 
ATOM   3170 C C   . ASN B 2 205 ? 55.262 93.952  53.132 1.00 36.71  ? 205 ASN B C   1 
ATOM   3171 O O   . ASN B 2 205 ? 54.825 92.850  53.454 1.00 37.97  ? 205 ASN B O   1 
ATOM   3172 C CB  . ASN B 2 205 ? 54.012 95.042  51.259 1.00 36.61  ? 205 ASN B CB  1 
ATOM   3173 C CG  . ASN B 2 205 ? 54.135 95.866  49.991 1.00 37.47  ? 205 ASN B CG  1 
ATOM   3174 O OD1 . ASN B 2 205 ? 54.722 96.945  50.000 1.00 39.50  ? 205 ASN B OD1 1 
ATOM   3175 N ND2 . ASN B 2 205 ? 53.587 95.358  48.891 1.00 35.19  ? 205 ASN B ND2 1 
ATOM   3176 N N   . PRO B 2 206 ? 55.683 94.847  54.049 1.00 38.09  ? 206 PRO B N   1 
ATOM   3177 C CA  . PRO B 2 206 ? 55.697 94.620  55.504 1.00 36.20  ? 206 PRO B CA  1 
ATOM   3178 C C   . PRO B 2 206 ? 54.349 94.811  56.200 1.00 36.15  ? 206 PRO B C   1 
ATOM   3179 O O   . PRO B 2 206 ? 54.245 95.573  57.157 1.00 38.24  ? 206 PRO B O   1 
ATOM   3180 C CB  . PRO B 2 206 ? 56.721 95.638  56.017 1.00 35.13  ? 206 PRO B CB  1 
ATOM   3181 C CG  . PRO B 2 206 ? 57.392 96.184  54.769 1.00 38.79  ? 206 PRO B CG  1 
ATOM   3182 C CD  . PRO B 2 206 ? 56.322 96.134  53.731 1.00 36.75  ? 206 PRO B CD  1 
ATOM   3183 N N   . TRP B 2 207 ? 53.325 94.117  55.722 1.00 36.82  ? 207 TRP B N   1 
ATOM   3184 C CA  . TRP B 2 207 ? 51.990 94.208  56.304 1.00 36.30  ? 207 TRP B CA  1 
ATOM   3185 C C   . TRP B 2 207 ? 51.998 94.068  57.824 1.00 36.95  ? 207 TRP B C   1 
ATOM   3186 O O   . TRP B 2 207 ? 52.463 93.063  58.360 1.00 38.04  ? 207 TRP B O   1 
ATOM   3187 C CB  . TRP B 2 207 ? 51.098 93.133  55.689 1.00 34.22  ? 207 TRP B CB  1 
ATOM   3188 C CG  . TRP B 2 207 ? 51.057 93.253  54.216 1.00 35.19  ? 207 TRP B CG  1 
ATOM   3189 C CD1 . TRP B 2 207 ? 51.573 92.376  53.303 1.00 37.24  ? 207 TRP B CD1 1 
ATOM   3190 C CD2 . TRP B 2 207 ? 50.531 94.348  53.468 1.00 34.24  ? 207 TRP B CD2 1 
ATOM   3191 N NE1 . TRP B 2 207 ? 51.405 92.863  52.027 1.00 36.13  ? 207 TRP B NE1 1 
ATOM   3192 C CE2 . TRP B 2 207 ? 50.774 94.076  52.101 1.00 33.46  ? 207 TRP B CE2 1 
ATOM   3193 C CE3 . TRP B 2 207 ? 49.893 95.545  53.818 1.00 35.19  ? 207 TRP B CE3 1 
ATOM   3194 C CZ2 . TRP B 2 207 ? 50.384 94.949  51.085 1.00 34.62  ? 207 TRP B CZ2 1 
ATOM   3195 C CZ3 . TRP B 2 207 ? 49.507 96.414  52.808 1.00 36.81  ? 207 TRP B CZ3 1 
ATOM   3196 C CH2 . TRP B 2 207 ? 49.761 96.114  51.457 1.00 36.08  ? 207 TRP B CH2 1 
ATOM   3197 N N   . LEU B 2 208 ? 51.478 95.084  58.509 1.00 37.08  ? 208 LEU B N   1 
ATOM   3198 C CA  . LEU B 2 208 ? 51.414 95.086  59.965 1.00 37.83  ? 208 LEU B CA  1 
ATOM   3199 C C   . LEU B 2 208 ? 50.096 94.478  60.415 1.00 38.76  ? 208 LEU B C   1 
ATOM   3200 O O   . LEU B 2 208 ? 49.081 95.165  60.458 1.00 38.23  ? 208 LEU B O   1 
ATOM   3201 C CB  . LEU B 2 208 ? 51.510 96.515  60.500 1.00 37.45  ? 208 LEU B CB  1 
ATOM   3202 C CG  . LEU B 2 208 ? 51.430 96.625  62.029 1.00 39.68  ? 208 LEU B CG  1 
ATOM   3203 C CD1 . LEU B 2 208 ? 52.635 95.917  62.641 1.00 36.31  ? 208 LEU B CD1 1 
ATOM   3204 C CD2 . LEU B 2 208 ? 51.377 98.086  62.458 1.00 33.62  ? 208 LEU B CD2 1 
ATOM   3205 N N   . CYS B 2 209 ? 50.109 93.197  60.766 1.00 40.48  ? 209 CYS B N   1 
ATOM   3206 C CA  . CYS B 2 209 ? 48.882 92.540  61.185 1.00 42.10  ? 209 CYS B CA  1 
ATOM   3207 C C   . CYS B 2 209 ? 48.411 92.887  62.584 1.00 43.29  ? 209 CYS B C   1 
ATOM   3208 O O   . CYS B 2 209 ? 48.902 92.359  63.584 1.00 43.67  ? 209 CYS B O   1 
ATOM   3209 C CB  . CYS B 2 209 ? 49.001 91.023  61.018 1.00 41.63  ? 209 CYS B CB  1 
ATOM   3210 S SG  . CYS B 2 209 ? 49.069 90.583  59.251 1.00 45.36  ? 209 CYS B SG  1 
ATOM   3211 N N   . ASN B 2 210 ? 47.451 93.804  62.622 1.00 44.43  ? 210 ASN B N   1 
ATOM   3212 C CA  . ASN B 2 210 ? 46.824 94.270  63.848 1.00 46.30  ? 210 ASN B CA  1 
ATOM   3213 C C   . ASN B 2 210 ? 45.379 94.595  63.493 1.00 47.22  ? 210 ASN B C   1 
ATOM   3214 O O   . ASN B 2 210 ? 44.957 94.418  62.352 1.00 47.39  ? 210 ASN B O   1 
ATOM   3215 C CB  . ASN B 2 210 ? 47.521 95.523  64.400 1.00 45.68  ? 210 ASN B CB  1 
ATOM   3216 C CG  . ASN B 2 210 ? 47.483 96.703  63.434 1.00 44.82  ? 210 ASN B CG  1 
ATOM   3217 O OD1 . ASN B 2 210 ? 46.565 96.836  62.624 1.00 44.60  ? 210 ASN B OD1 1 
ATOM   3218 N ND2 . ASN B 2 210 ? 48.479 97.579  63.534 1.00 43.83  ? 210 ASN B ND2 1 
ATOM   3219 N N   . CYS B 2 211 ? 44.626 95.086  64.464 1.00 47.77  ? 211 CYS B N   1 
ATOM   3220 C CA  . CYS B 2 211 ? 43.229 95.409  64.236 1.00 49.40  ? 211 CYS B CA  1 
ATOM   3221 C C   . CYS B 2 211 ? 42.938 96.184  62.962 1.00 48.79  ? 211 CYS B C   1 
ATOM   3222 O O   . CYS B 2 211 ? 41.893 95.990  62.345 1.00 49.10  ? 211 CYS B O   1 
ATOM   3223 C CB  . CYS B 2 211 ? 42.675 96.163  65.440 1.00 51.52  ? 211 CYS B CB  1 
ATOM   3224 S SG  . CYS B 2 211 ? 42.506 95.098  66.909 1.00 54.56  ? 211 CYS B SG  1 
ATOM   3225 N N   . GLU B 2 212 ? 43.860 97.049  62.556 1.00 49.16  ? 212 GLU B N   1 
ATOM   3226 C CA  . GLU B 2 212 ? 43.657 97.854  61.357 1.00 50.19  ? 212 GLU B CA  1 
ATOM   3227 C C   . GLU B 2 212 ? 43.762 97.090  60.043 1.00 48.53  ? 212 GLU B C   1 
ATOM   3228 O O   . GLU B 2 212 ? 43.252 97.549  59.026 1.00 48.98  ? 212 GLU B O   1 
ATOM   3229 C CB  . GLU B 2 212 ? 44.637 99.028  61.333 1.00 52.85  ? 212 GLU B CB  1 
ATOM   3230 C CG  . GLU B 2 212 ? 44.282 100.171 62.276 1.00 58.54  ? 212 GLU B CG  1 
ATOM   3231 C CD  . GLU B 2 212 ? 44.041 99.707  63.706 1.00 62.42  ? 212 GLU B CD  1 
ATOM   3232 O OE1 . GLU B 2 212 ? 42.861 99.579  64.105 1.00 63.60  ? 212 GLU B OE1 1 
ATOM   3233 O OE2 . GLU B 2 212 ? 45.034 99.464  64.429 1.00 63.26  ? 212 GLU B OE2 1 
ATOM   3234 N N   . ILE B 2 213 ? 44.411 95.931  60.055 1.00 46.53  ? 213 ILE B N   1 
ATOM   3235 C CA  . ILE B 2 213 ? 44.566 95.151  58.831 1.00 45.37  ? 213 ILE B CA  1 
ATOM   3236 C C   . ILE B 2 213 ? 43.315 94.317  58.524 1.00 44.63  ? 213 ILE B C   1 
ATOM   3237 O O   . ILE B 2 213 ? 43.249 93.632  57.501 1.00 43.47  ? 213 ILE B O   1 
ATOM   3238 C CB  . ILE B 2 213 ? 45.806 94.209  58.926 1.00 44.26  ? 213 ILE B CB  1 
ATOM   3239 C CG1 . ILE B 2 213 ? 46.274 93.801  57.530 1.00 42.67  ? 213 ILE B CG1 1 
ATOM   3240 C CG2 . ILE B 2 213 ? 45.461 92.961  59.706 1.00 44.37  ? 213 ILE B CG2 1 
ATOM   3241 C CD1 . ILE B 2 213 ? 46.835 94.951  56.724 1.00 41.80  ? 213 ILE B CD1 1 
ATOM   3242 N N   . LEU B 2 214 ? 42.319 94.391  59.402 1.00 44.66  ? 214 LEU B N   1 
ATOM   3243 C CA  . LEU B 2 214 ? 41.099 93.610  59.222 1.00 44.05  ? 214 LEU B CA  1 
ATOM   3244 C C   . LEU B 2 214 ? 40.324 93.911  57.941 1.00 43.66  ? 214 LEU B C   1 
ATOM   3245 O O   . LEU B 2 214 ? 39.750 92.991  57.344 1.00 42.29  ? 214 LEU B O   1 
ATOM   3246 C CB  . LEU B 2 214 ? 40.181 93.760  60.436 1.00 44.66  ? 214 LEU B CB  1 
ATOM   3247 C CG  . LEU B 2 214 ? 40.679 93.115  61.734 1.00 44.10  ? 214 LEU B CG  1 
ATOM   3248 C CD1 . LEU B 2 214 ? 39.576 93.138  62.766 1.00 44.97  ? 214 LEU B CD1 1 
ATOM   3249 C CD2 . LEU B 2 214 ? 41.097 91.687  61.474 1.00 45.16  ? 214 LEU B CD2 1 
ATOM   3250 N N   . TYR B 2 215 ? 40.286 95.175  57.518 1.00 41.82  ? 215 TYR B N   1 
ATOM   3251 C CA  . TYR B 2 215 ? 39.584 95.506  56.280 1.00 40.68  ? 215 TYR B CA  1 
ATOM   3252 C C   . TYR B 2 215 ? 40.259 94.756  55.142 1.00 39.98  ? 215 TYR B C   1 
ATOM   3253 O O   . TYR B 2 215 ? 39.607 94.141  54.300 1.00 39.13  ? 215 TYR B O   1 
ATOM   3254 C CB  . TYR B 2 215 ? 39.661 96.998  55.963 1.00 40.38  ? 215 TYR B CB  1 
ATOM   3255 C CG  . TYR B 2 215 ? 39.309 97.292  54.514 1.00 42.24  ? 215 TYR B CG  1 
ATOM   3256 C CD1 . TYR B 2 215 ? 37.995 97.177  54.053 1.00 40.99  ? 215 TYR B CD1 1 
ATOM   3257 C CD2 . TYR B 2 215 ? 40.300 97.620  53.589 1.00 42.35  ? 215 TYR B CD2 1 
ATOM   3258 C CE1 . TYR B 2 215 ? 37.679 97.375  52.713 1.00 41.98  ? 215 TYR B CE1 1 
ATOM   3259 C CE2 . TYR B 2 215 ? 39.993 97.819  52.243 1.00 43.81  ? 215 TYR B CE2 1 
ATOM   3260 C CZ  . TYR B 2 215 ? 38.682 97.693  51.810 1.00 43.93  ? 215 TYR B CZ  1 
ATOM   3261 O OH  . TYR B 2 215 ? 38.380 97.861  50.473 1.00 42.80  ? 215 TYR B OH  1 
ATOM   3262 N N   . PHE B 2 216 ? 41.582 94.831  55.130 1.00 37.89  ? 216 PHE B N   1 
ATOM   3263 C CA  . PHE B 2 216 ? 42.383 94.189  54.109 1.00 36.95  ? 216 PHE B CA  1 
ATOM   3264 C C   . PHE B 2 216 ? 42.130 92.687  54.100 1.00 37.92  ? 216 PHE B C   1 
ATOM   3265 O O   . PHE B 2 216 ? 41.937 92.093  53.037 1.00 35.40  ? 216 PHE B O   1 
ATOM   3266 C CB  . PHE B 2 216 ? 43.859 94.485  54.372 1.00 35.96  ? 216 PHE B CB  1 
ATOM   3267 C CG  . PHE B 2 216 ? 44.776 94.095  53.250 1.00 35.91  ? 216 PHE B CG  1 
ATOM   3268 C CD1 . PHE B 2 216 ? 44.335 94.102  51.932 1.00 36.80  ? 216 PHE B CD1 1 
ATOM   3269 C CD2 . PHE B 2 216 ? 46.103 93.782  53.505 1.00 35.07  ? 216 PHE B CD2 1 
ATOM   3270 C CE1 . PHE B 2 216 ? 45.206 93.807  50.888 1.00 34.91  ? 216 PHE B CE1 1 
ATOM   3271 C CE2 . PHE B 2 216 ? 46.978 93.488  52.469 1.00 36.63  ? 216 PHE B CE2 1 
ATOM   3272 C CZ  . PHE B 2 216 ? 46.529 93.502  51.156 1.00 36.31  ? 216 PHE B CZ  1 
ATOM   3273 N N   . ARG B 2 217 ? 42.116 92.079  55.285 1.00 40.31  ? 217 ARG B N   1 
ATOM   3274 C CA  . ARG B 2 217 ? 41.895 90.642  55.390 1.00 40.97  ? 217 ARG B CA  1 
ATOM   3275 C C   . ARG B 2 217 ? 40.568 90.187  54.811 1.00 41.29  ? 217 ARG B C   1 
ATOM   3276 O O   . ARG B 2 217 ? 40.514 89.184  54.105 1.00 42.02  ? 217 ARG B O   1 
ATOM   3277 C CB  . ARG B 2 217 ? 41.975 90.163  56.840 1.00 42.14  ? 217 ARG B CB  1 
ATOM   3278 C CG  . ARG B 2 217 ? 41.536 88.702  56.972 1.00 44.85  ? 217 ARG B CG  1 
ATOM   3279 C CD  . ARG B 2 217 ? 42.022 88.047  58.244 1.00 48.08  ? 217 ARG B CD  1 
ATOM   3280 N NE  . ARG B 2 217 ? 41.308 88.497  59.435 1.00 51.49  ? 217 ARG B NE  1 
ATOM   3281 C CZ  . ARG B 2 217 ? 40.001 88.354  59.626 1.00 52.76  ? 217 ARG B CZ  1 
ATOM   3282 N NH1 . ARG B 2 217 ? 39.246 87.777  58.698 1.00 55.42  ? 217 ARG B NH1 1 
ATOM   3283 N NH2 . ARG B 2 217 ? 39.450 88.775  60.756 1.00 51.94  ? 217 ARG B NH2 1 
ATOM   3284 N N   . ARG B 2 218 ? 39.492 90.900  55.117 1.00 40.78  ? 218 ARG B N   1 
ATOM   3285 C CA  . ARG B 2 218 ? 38.196 90.501  54.593 1.00 41.74  ? 218 ARG B CA  1 
ATOM   3286 C C   . ARG B 2 218 ? 38.226 90.631  53.069 1.00 40.88  ? 218 ARG B C   1 
ATOM   3287 O O   . ARG B 2 218 ? 37.628 89.825  52.350 1.00 42.22  ? 218 ARG B O   1 
ATOM   3288 C CB  . ARG B 2 218 ? 37.083 91.375  55.191 1.00 45.58  ? 218 ARG B CB  1 
ATOM   3289 C CG  . ARG B 2 218 ? 35.773 90.629  55.510 1.00 53.28  ? 218 ARG B CG  1 
ATOM   3290 C CD  . ARG B 2 218 ? 34.586 91.111  54.623 1.00 59.64  ? 218 ARG B CD  1 
ATOM   3291 N NE  . ARG B 2 218 ? 33.659 91.954  55.398 1.00 63.95  ? 218 ARG B NE  1 
ATOM   3292 C CZ  . ARG B 2 218 ? 33.684 93.283  55.513 1.00 66.21  ? 218 ARG B CZ  1 
ATOM   3293 N NH1 . ARG B 2 218 ? 34.582 94.028  54.867 1.00 65.72  ? 218 ARG B NH1 1 
ATOM   3294 N NH2 . ARG B 2 218 ? 32.867 93.849  56.402 1.00 66.05  ? 218 ARG B NH2 1 
ATOM   3295 N N   . TRP B 2 219 ? 38.942 91.637  52.576 1.00 38.16  ? 219 TRP B N   1 
ATOM   3296 C CA  . TRP B 2 219 ? 39.035 91.856  51.138 1.00 35.35  ? 219 TRP B CA  1 
ATOM   3297 C C   . TRP B 2 219 ? 39.769 90.678  50.516 1.00 34.30  ? 219 TRP B C   1 
ATOM   3298 O O   . TRP B 2 219 ? 39.350 90.127  49.498 1.00 34.21  ? 219 TRP B O   1 
ATOM   3299 C CB  . TRP B 2 219 ? 39.793 93.151  50.841 1.00 32.37  ? 219 TRP B CB  1 
ATOM   3300 C CG  . TRP B 2 219 ? 39.923 93.416  49.384 1.00 30.14  ? 219 TRP B CG  1 
ATOM   3301 C CD1 . TRP B 2 219 ? 38.967 93.929  48.555 1.00 30.63  ? 219 TRP B CD1 1 
ATOM   3302 C CD2 . TRP B 2 219 ? 41.045 93.105  48.557 1.00 29.46  ? 219 TRP B CD2 1 
ATOM   3303 N NE1 . TRP B 2 219 ? 39.421 93.954  47.259 1.00 28.23  ? 219 TRP B NE1 1 
ATOM   3304 C CE2 . TRP B 2 219 ? 40.696 93.453  47.230 1.00 29.28  ? 219 TRP B CE2 1 
ATOM   3305 C CE3 . TRP B 2 219 ? 42.313 92.566  48.805 1.00 29.37  ? 219 TRP B CE3 1 
ATOM   3306 C CZ2 . TRP B 2 219 ? 41.572 93.273  46.151 1.00 28.20  ? 219 TRP B CZ2 1 
ATOM   3307 C CZ3 . TRP B 2 219 ? 43.186 92.388  47.734 1.00 30.54  ? 219 TRP B CZ3 1 
ATOM   3308 C CH2 . TRP B 2 219 ? 42.809 92.742  46.422 1.00 30.02  ? 219 TRP B CH2 1 
ATOM   3309 N N   . LEU B 2 220 ? 40.867 90.298  51.153 1.00 32.54  ? 220 LEU B N   1 
ATOM   3310 C CA  . LEU B 2 220 ? 41.680 89.189  50.686 1.00 30.65  ? 220 LEU B CA  1 
ATOM   3311 C C   . LEU B 2 220 ? 40.900 87.885  50.564 1.00 29.18  ? 220 LEU B C   1 
ATOM   3312 O O   . LEU B 2 220 ? 41.059 87.160  49.592 1.00 27.82  ? 220 LEU B O   1 
ATOM   3313 C CB  . LEU B 2 220 ? 42.873 88.991  51.622 1.00 27.85  ? 220 LEU B CB  1 
ATOM   3314 C CG  . LEU B 2 220 ? 43.975 90.047  51.548 1.00 24.32  ? 220 LEU B CG  1 
ATOM   3315 C CD1 . LEU B 2 220 ? 44.968 89.796  52.669 1.00 25.62  ? 220 LEU B CD1 1 
ATOM   3316 C CD2 . LEU B 2 220 ? 44.663 90.007  50.184 1.00 20.16  ? 220 LEU B CD2 1 
ATOM   3317 N N   . GLN B 2 221 ? 40.059 87.593  51.549 1.00 31.18  ? 221 GLN B N   1 
ATOM   3318 C CA  . GLN B 2 221 ? 39.275 86.362  51.544 1.00 34.23  ? 221 GLN B CA  1 
ATOM   3319 C C   . GLN B 2 221 ? 38.236 86.359  50.432 1.00 34.53  ? 221 GLN B C   1 
ATOM   3320 O O   . GLN B 2 221 ? 37.953 85.317  49.833 1.00 36.93  ? 221 GLN B O   1 
ATOM   3321 C CB  . GLN B 2 221 ? 38.595 86.174  52.902 1.00 33.65  ? 221 GLN B CB  1 
ATOM   3322 C CG  . GLN B 2 221 ? 39.568 86.319  54.054 1.00 34.87  ? 221 GLN B CG  1 
ATOM   3323 C CD  . GLN B 2 221 ? 38.965 85.988  55.400 1.00 33.15  ? 221 GLN B CD  1 
ATOM   3324 O OE1 . GLN B 2 221 ? 37.857 86.417  55.721 1.00 35.86  ? 221 GLN B OE1 1 
ATOM   3325 N NE2 . GLN B 2 221 ? 39.707 85.241  56.209 1.00 34.47  ? 221 GLN B NE2 1 
ATOM   3326 N N   . ASP B 2 222 ? 37.675 87.529  50.156 1.00 34.04  ? 222 ASP B N   1 
ATOM   3327 C CA  . ASP B 2 222 ? 36.669 87.660  49.113 1.00 34.73  ? 222 ASP B CA  1 
ATOM   3328 C C   . ASP B 2 222 ? 37.300 87.737  47.733 1.00 33.71  ? 222 ASP B C   1 
ATOM   3329 O O   . ASP B 2 222 ? 36.613 87.588  46.729 1.00 33.07  ? 222 ASP B O   1 
ATOM   3330 C CB  . ASP B 2 222 ? 35.836 88.920  49.331 1.00 37.20  ? 222 ASP B CB  1 
ATOM   3331 C CG  . ASP B 2 222 ? 34.901 88.805  50.506 1.00 39.42  ? 222 ASP B CG  1 
ATOM   3332 O OD1 . ASP B 2 222 ? 34.145 89.770  50.753 1.00 41.75  ? 222 ASP B OD1 1 
ATOM   3333 O OD2 . ASP B 2 222 ? 34.919 87.755  51.182 1.00 40.35  ? 222 ASP B OD2 1 
ATOM   3334 N N   . ASN B 2 223 ? 38.609 87.964  47.689 1.00 33.56  ? 223 ASN B N   1 
ATOM   3335 C CA  . ASN B 2 223 ? 39.316 88.104  46.423 1.00 33.07  ? 223 ASN B CA  1 
ATOM   3336 C C   . ASN B 2 223 ? 40.526 87.199  46.271 1.00 32.05  ? 223 ASN B C   1 
ATOM   3337 O O   . ASN B 2 223 ? 41.421 87.489  45.478 1.00 33.37  ? 223 ASN B O   1 
ATOM   3338 C CB  . ASN B 2 223 ? 39.757 89.562  46.263 1.00 32.38  ? 223 ASN B CB  1 
ATOM   3339 C CG  . ASN B 2 223 ? 38.593 90.498  46.079 1.00 30.96  ? 223 ASN B CG  1 
ATOM   3340 O OD1 . ASN B 2 223 ? 38.037 90.596  44.986 1.00 32.87  ? 223 ASN B OD1 1 
ATOM   3341 N ND2 . ASN B 2 223 ? 38.204 91.186  47.148 1.00 30.40  ? 223 ASN B ND2 1 
ATOM   3342 N N   . ALA B 2 224 ? 40.552 86.102  47.013 1.00 31.34  ? 224 ALA B N   1 
ATOM   3343 C CA  . ALA B 2 224 ? 41.686 85.183  46.965 1.00 33.70  ? 224 ALA B CA  1 
ATOM   3344 C C   . ALA B 2 224 ? 42.182 84.821  45.561 1.00 35.59  ? 224 ALA B C   1 
ATOM   3345 O O   . ALA B 2 224 ? 43.374 84.574  45.360 1.00 37.21  ? 224 ALA B O   1 
ATOM   3346 C CB  . ALA B 2 224 ? 41.353 83.920  47.729 1.00 31.51  ? 224 ALA B CB  1 
ATOM   3347 N N   . GLU B 2 225 ? 41.280 84.801  44.590 1.00 35.57  ? 225 GLU B N   1 
ATOM   3348 C CA  . GLU B 2 225 ? 41.658 84.434  43.236 1.00 36.27  ? 225 GLU B CA  1 
ATOM   3349 C C   . GLU B 2 225 ? 42.050 85.605  42.343 1.00 34.75  ? 225 GLU B C   1 
ATOM   3350 O O   . GLU B 2 225 ? 42.314 85.426  41.152 1.00 34.21  ? 225 GLU B O   1 
ATOM   3351 C CB  . GLU B 2 225 ? 40.515 83.668  42.600 1.00 40.84  ? 225 GLU B CB  1 
ATOM   3352 C CG  . GLU B 2 225 ? 39.239 84.460  42.594 1.00 49.98  ? 225 GLU B CG  1 
ATOM   3353 C CD  . GLU B 2 225 ? 38.061 83.638  42.147 1.00 55.98  ? 225 GLU B CD  1 
ATOM   3354 O OE1 . GLU B 2 225 ? 36.989 84.240  41.910 1.00 59.42  ? 225 GLU B OE1 1 
ATOM   3355 O OE2 . GLU B 2 225 ? 38.209 82.396  42.042 1.00 56.75  ? 225 GLU B OE2 1 
ATOM   3356 N N   . ASN B 2 226 ? 42.085 86.803  42.913 1.00 32.44  ? 226 ASN B N   1 
ATOM   3357 C CA  . ASN B 2 226 ? 42.461 87.975  42.144 1.00 31.81  ? 226 ASN B CA  1 
ATOM   3358 C C   . ASN B 2 226 ? 43.766 88.550  42.657 1.00 31.62  ? 226 ASN B C   1 
ATOM   3359 O O   . ASN B 2 226 ? 44.255 89.554  42.143 1.00 32.32  ? 226 ASN B O   1 
ATOM   3360 C CB  . ASN B 2 226 ? 41.368 89.034  42.206 1.00 32.97  ? 226 ASN B CB  1 
ATOM   3361 C CG  . ASN B 2 226 ? 40.065 88.557  41.590 1.00 38.48  ? 226 ASN B CG  1 
ATOM   3362 O OD1 . ASN B 2 226 ? 40.053 87.927  40.519 1.00 35.58  ? 226 ASN B OD1 1 
ATOM   3363 N ND2 . ASN B 2 226 ? 38.954 88.862  42.259 1.00 40.34  ? 226 ASN B ND2 1 
ATOM   3364 N N   . VAL B 2 227 ? 44.318 87.910  43.681 1.00 29.33  ? 227 VAL B N   1 
ATOM   3365 C CA  . VAL B 2 227 ? 45.581 88.339  44.257 1.00 30.01  ? 227 VAL B CA  1 
ATOM   3366 C C   . VAL B 2 227 ? 46.692 87.510  43.614 1.00 30.09  ? 227 VAL B C   1 
ATOM   3367 O O   . VAL B 2 227 ? 46.742 86.294  43.778 1.00 29.53  ? 227 VAL B O   1 
ATOM   3368 C CB  . VAL B 2 227 ? 45.578 88.136  45.777 1.00 29.31  ? 227 VAL B CB  1 
ATOM   3369 C CG1 . VAL B 2 227 ? 46.943 88.472  46.357 1.00 25.60  ? 227 VAL B CG1 1 
ATOM   3370 C CG2 . VAL B 2 227 ? 44.488 89.001  46.398 1.00 28.68  ? 227 VAL B CG2 1 
ATOM   3371 N N   . TYR B 2 228 ? 47.575 88.171  42.872 1.00 28.96  ? 228 TYR B N   1 
ATOM   3372 C CA  . TYR B 2 228 ? 48.648 87.471  42.173 1.00 30.39  ? 228 TYR B CA  1 
ATOM   3373 C C   . TYR B 2 228 ? 50.065 87.784  42.617 1.00 31.05  ? 228 TYR B C   1 
ATOM   3374 O O   . TYR B 2 228 ? 50.330 88.783  43.277 1.00 33.00  ? 228 TYR B O   1 
ATOM   3375 C CB  . TYR B 2 228 ? 48.552 87.719  40.669 1.00 29.94  ? 228 TYR B CB  1 
ATOM   3376 C CG  . TYR B 2 228 ? 47.367 87.079  39.976 1.00 29.32  ? 228 TYR B CG  1 
ATOM   3377 C CD1 . TYR B 2 228 ? 46.085 87.640  40.058 1.00 28.54  ? 228 TYR B CD1 1 
ATOM   3378 C CD2 . TYR B 2 228 ? 47.536 85.939  39.195 1.00 28.46  ? 228 TYR B CD2 1 
ATOM   3379 C CE1 . TYR B 2 228 ? 45.010 87.075  39.369 1.00 26.36  ? 228 TYR B CE1 1 
ATOM   3380 C CE2 . TYR B 2 228 ? 46.472 85.369  38.511 1.00 28.52  ? 228 TYR B CE2 1 
ATOM   3381 C CZ  . TYR B 2 228 ? 45.218 85.938  38.598 1.00 27.17  ? 228 TYR B CZ  1 
ATOM   3382 O OH  . TYR B 2 228 ? 44.188 85.352  37.902 1.00 29.16  ? 228 TYR B OH  1 
ATOM   3383 N N   . VAL B 2 229 ? 50.981 86.906  42.229 1.00 31.82  ? 229 VAL B N   1 
ATOM   3384 C CA  . VAL B 2 229 ? 52.400 87.036  42.545 1.00 30.49  ? 229 VAL B CA  1 
ATOM   3385 C C   . VAL B 2 229 ? 53.075 87.274  41.197 1.00 31.30  ? 229 VAL B C   1 
ATOM   3386 O O   . VAL B 2 229 ? 52.788 86.581  40.219 1.00 31.44  ? 229 VAL B O   1 
ATOM   3387 C CB  . VAL B 2 229 ? 52.959 85.728  43.124 1.00 29.60  ? 229 VAL B CB  1 
ATOM   3388 C CG1 . VAL B 2 229 ? 54.424 85.887  43.444 1.00 27.25  ? 229 VAL B CG1 1 
ATOM   3389 C CG2 . VAL B 2 229 ? 52.174 85.369  44.382 1.00 32.14  ? 229 VAL B CG2 1 
ATOM   3390 N N   . TRP B 2 230 ? 53.984 88.232  41.132 1.00 31.41  ? 230 TRP B N   1 
ATOM   3391 C CA  . TRP B 2 230 ? 54.679 88.501  39.889 1.00 32.20  ? 230 TRP B CA  1 
ATOM   3392 C C   . TRP B 2 230 ? 56.119 87.999  40.032 1.00 33.64  ? 230 TRP B C   1 
ATOM   3393 O O   . TRP B 2 230 ? 56.861 88.484  40.875 1.00 36.77  ? 230 TRP B O   1 
ATOM   3394 C CB  . TRP B 2 230 ? 54.671 90.005  39.634 1.00 32.79  ? 230 TRP B CB  1 
ATOM   3395 C CG  . TRP B 2 230 ? 55.132 90.390  38.251 1.00 35.59  ? 230 TRP B CG  1 
ATOM   3396 C CD1 . TRP B 2 230 ? 54.372 90.447  37.097 1.00 35.10  ? 230 TRP B CD1 1 
ATOM   3397 C CD2 . TRP B 2 230 ? 56.498 90.681  37.870 1.00 33.11  ? 230 TRP B CD2 1 
ATOM   3398 N NE1 . TRP B 2 230 ? 55.207 90.755  36.030 1.00 34.52  ? 230 TRP B NE1 1 
ATOM   3399 C CE2 . TRP B 2 230 ? 56.503 90.910  36.484 1.00 35.37  ? 230 TRP B CE2 1 
ATOM   3400 C CE3 . TRP B 2 230 ? 57.708 90.777  38.588 1.00 30.88  ? 230 TRP B CE3 1 
ATOM   3401 C CZ2 . TRP B 2 230 ? 57.662 91.213  35.794 1.00 36.36  ? 230 TRP B CZ2 1 
ATOM   3402 C CZ3 . TRP B 2 230 ? 58.879 91.081  37.903 1.00 36.20  ? 230 TRP B CZ3 1 
ATOM   3403 C CH2 . TRP B 2 230 ? 58.838 91.305  36.505 1.00 38.29  ? 230 TRP B CH2 1 
ATOM   3404 N N   . LYS B 2 231 ? 56.499 87.029  39.204 1.00 34.20  ? 231 LYS B N   1 
ATOM   3405 C CA  . LYS B 2 231 ? 57.850 86.471  39.214 1.00 35.45  ? 231 LYS B CA  1 
ATOM   3406 C C   . LYS B 2 231 ? 58.560 86.791  37.904 1.00 35.11  ? 231 LYS B C   1 
ATOM   3407 O O   . LYS B 2 231 ? 57.983 86.712  36.823 1.00 31.97  ? 231 LYS B O   1 
ATOM   3408 C CB  . LYS B 2 231 ? 57.807 84.952  39.427 1.00 38.81  ? 231 LYS B CB  1 
ATOM   3409 C CG  . LYS B 2 231 ? 58.899 84.431  40.336 1.00 43.02  ? 231 LYS B CG  1 
ATOM   3410 C CD  . LYS B 2 231 ? 58.630 84.814  41.796 1.00 46.39  ? 231 LYS B CD  1 
ATOM   3411 C CE  . LYS B 2 231 ? 57.768 83.758  42.492 1.00 48.74  ? 231 LYS B CE  1 
ATOM   3412 N NZ  . LYS B 2 231 ? 57.321 84.148  43.850 1.00 52.44  ? 231 LYS B NZ  1 
ATOM   3413 N N   . GLN B 2 232 ? 59.832 87.143  38.045 1.00 37.42  ? 232 GLN B N   1 
ATOM   3414 C CA  . GLN B 2 232 ? 60.688 87.515  36.933 1.00 38.71  ? 232 GLN B CA  1 
ATOM   3415 C C   . GLN B 2 232 ? 61.824 86.530  36.840 1.00 39.38  ? 232 GLN B C   1 
ATOM   3416 O O   . GLN B 2 232 ? 62.329 86.052  37.852 1.00 40.41  ? 232 GLN B O   1 
ATOM   3417 C CB  . GLN B 2 232 ? 61.284 88.903  37.162 1.00 40.10  ? 232 GLN B CB  1 
ATOM   3418 C CG  . GLN B 2 232 ? 62.361 89.287  36.148 1.00 44.52  ? 232 GLN B CG  1 
ATOM   3419 C CD  . GLN B 2 232 ? 61.862 90.300  35.120 1.00 47.27  ? 232 GLN B CD  1 
ATOM   3420 O OE1 . GLN B 2 232 ? 61.456 91.414  35.464 1.00 49.21  ? 232 GLN B OE1 1 
ATOM   3421 N NE2 . GLN B 2 232 ? 61.886 89.904  33.842 1.00 48.63  ? 232 GLN B NE2 1 
ATOM   3422 N N   . GLY B 2 233 ? 62.240 86.252  35.612 1.00 40.00  ? 233 GLY B N   1 
ATOM   3423 C CA  . GLY B 2 233 ? 63.334 85.322  35.396 1.00 41.99  ? 233 GLY B CA  1 
ATOM   3424 C C   . GLY B 2 233 ? 64.008 85.545  34.056 1.00 42.69  ? 233 GLY B C   1 
ATOM   3425 O O   . GLY B 2 233 ? 63.712 86.515  33.350 1.00 43.80  ? 233 GLY B O   1 
ATOM   3426 N N   . VAL B 2 234 ? 64.915 84.635  33.702 1.00 41.11  ? 234 VAL B N   1 
ATOM   3427 C CA  . VAL B 2 234 ? 65.619 84.731  32.423 1.00 39.28  ? 234 VAL B CA  1 
ATOM   3428 C C   . VAL B 2 234 ? 64.668 84.442  31.277 1.00 39.39  ? 234 VAL B C   1 
ATOM   3429 O O   . VAL B 2 234 ? 64.361 83.280  31.005 1.00 40.84  ? 234 VAL B O   1 
ATOM   3430 C CB  . VAL B 2 234 ? 66.791 83.730  32.321 1.00 35.66  ? 234 VAL B CB  1 
ATOM   3431 C CG1 . VAL B 2 234 ? 67.425 83.830  30.921 1.00 29.64  ? 234 VAL B CG1 1 
ATOM   3432 C CG2 . VAL B 2 234 ? 67.820 84.014  33.403 1.00 35.38  ? 234 VAL B CG2 1 
ATOM   3433 N N   . ASP B 2 235 ? 64.213 85.518  30.635 1.00 39.71  ? 235 ASP B N   1 
ATOM   3434 C CA  . ASP B 2 235 ? 63.284 85.454  29.510 1.00 40.25  ? 235 ASP B CA  1 
ATOM   3435 C C   . ASP B 2 235 ? 61.837 85.146  29.893 1.00 38.25  ? 235 ASP B C   1 
ATOM   3436 O O   . ASP B 2 235 ? 60.953 85.149  29.051 1.00 39.28  ? 235 ASP B O   1 
ATOM   3437 C CB  . ASP B 2 235 ? 63.734 84.417  28.472 1.00 44.27  ? 235 ASP B CB  1 
ATOM   3438 C CG  . ASP B 2 235 ? 64.841 84.933  27.593 1.00 49.79  ? 235 ASP B CG  1 
ATOM   3439 O OD1 . ASP B 2 235 ? 66.012 84.774  27.977 1.00 51.25  ? 235 ASP B OD1 1 
ATOM   3440 O OD2 . ASP B 2 235 ? 64.560 85.512  26.523 1.00 53.46  ? 235 ASP B OD2 1 
ATOM   3441 N N   . VAL B 2 236 ? 61.591 84.878  31.163 1.00 36.16  ? 236 VAL B N   1 
ATOM   3442 C CA  . VAL B 2 236 ? 60.249 84.546  31.561 1.00 33.98  ? 236 VAL B CA  1 
ATOM   3443 C C   . VAL B 2 236 ? 59.669 85.574  32.539 1.00 34.73  ? 236 VAL B C   1 
ATOM   3444 O O   . VAL B 2 236 ? 60.378 86.088  33.401 1.00 33.64  ? 236 VAL B O   1 
ATOM   3445 C CB  . VAL B 2 236 ? 60.223 83.122  32.174 1.00 30.75  ? 236 VAL B CB  1 
ATOM   3446 C CG1 . VAL B 2 236 ? 61.137 83.075  33.412 1.00 30.35  ? 236 VAL B CG1 1 
ATOM   3447 C CG2 . VAL B 2 236 ? 58.801 82.727  32.489 1.00 28.09  ? 236 VAL B CG2 1 
ATOM   3448 N N   . LYS B 2 237 ? 58.397 85.923  32.338 1.00 33.68  ? 237 LYS B N   1 
ATOM   3449 C CA  . LYS B 2 237 ? 57.684 86.837  33.232 1.00 33.39  ? 237 LYS B CA  1 
ATOM   3450 C C   . LYS B 2 237 ? 56.344 86.194  33.549 1.00 31.57  ? 237 LYS B C   1 
ATOM   3451 O O   . LYS B 2 237 ? 55.474 86.152  32.703 1.00 31.12  ? 237 LYS B O   1 
ATOM   3452 C CB  . LYS B 2 237 ? 57.425 88.174  32.551 1.00 35.12  ? 237 LYS B CB  1 
ATOM   3453 C CG  . LYS B 2 237 ? 58.643 89.016  32.451 1.00 37.48  ? 237 LYS B CG  1 
ATOM   3454 C CD  . LYS B 2 237 ? 58.316 90.384  31.887 1.00 38.80  ? 237 LYS B CD  1 
ATOM   3455 C CE  . LYS B 2 237 ? 59.576 91.233  31.786 1.00 39.60  ? 237 LYS B CE  1 
ATOM   3456 N NZ  . LYS B 2 237 ? 59.285 92.608  31.344 1.00 37.54  ? 237 LYS B NZ  1 
ATOM   3457 N N   . ALA B 2 238 ? 56.184 85.733  34.785 1.00 31.28  ? 238 ALA B N   1 
ATOM   3458 C CA  . ALA B 2 238 ? 54.973 85.054  35.224 1.00 30.58  ? 238 ALA B CA  1 
ATOM   3459 C C   . ALA B 2 238 ? 54.043 85.766  36.223 1.00 30.89  ? 238 ALA B C   1 
ATOM   3460 O O   . ALA B 2 238 ? 54.457 86.614  37.020 1.00 31.38  ? 238 ALA B O   1 
ATOM   3461 C CB  . ALA B 2 238 ? 55.357 83.684  35.750 1.00 29.19  ? 238 ALA B CB  1 
ATOM   3462 N N   . MET B 2 239 ? 52.773 85.389  36.137 1.00 29.27  ? 239 MET B N   1 
ATOM   3463 C CA  . MET B 2 239 ? 51.742 85.918  37.011 1.00 28.35  ? 239 MET B CA  1 
ATOM   3464 C C   . MET B 2 239 ? 51.039 84.686  37.547 1.00 27.49  ? 239 MET B C   1 
ATOM   3465 O O   . MET B 2 239 ? 50.489 83.892  36.776 1.00 27.06  ? 239 MET B O   1 
ATOM   3466 C CB  . MET B 2 239 ? 50.760 86.768  36.197 1.00 26.44  ? 239 MET B CB  1 
ATOM   3467 C CG  . MET B 2 239 ? 51.253 88.199  35.895 1.00 28.13  ? 239 MET B CG  1 
ATOM   3468 S SD  . MET B 2 239 ? 49.955 89.332  35.252 1.00 28.78  ? 239 MET B SD  1 
ATOM   3469 C CE  . MET B 2 239 ? 50.766 90.028  33.857 1.00 27.87  ? 239 MET B CE  1 
ATOM   3470 N N   . THR B 2 240 ? 51.050 84.520  38.861 1.00 27.45  ? 240 THR B N   1 
ATOM   3471 C CA  . THR B 2 240 ? 50.442 83.355  39.470 1.00 27.09  ? 240 THR B CA  1 
ATOM   3472 C C   . THR B 2 240 ? 49.495 83.755  40.575 1.00 25.98  ? 240 THR B C   1 
ATOM   3473 O O   . THR B 2 240 ? 49.853 84.529  41.457 1.00 27.79  ? 240 THR B O   1 
ATOM   3474 C CB  . THR B 2 240 ? 51.513 82.411  40.072 1.00 27.13  ? 240 THR B CB  1 
ATOM   3475 O OG1 . THR B 2 240 ? 52.566 82.181  39.124 1.00 27.32  ? 240 THR B OG1 1 
ATOM   3476 C CG2 . THR B 2 240 ? 50.878 81.087  40.424 1.00 25.75  ? 240 THR B CG2 1 
ATOM   3477 N N   . SER B 2 241 ? 48.288 83.207  40.521 1.00 26.93  ? 241 SER B N   1 
ATOM   3478 C CA  . SER B 2 241 ? 47.269 83.467  41.528 1.00 29.14  ? 241 SER B CA  1 
ATOM   3479 C C   . SER B 2 241 ? 47.641 82.819  42.863 1.00 28.86  ? 241 SER B C   1 
ATOM   3480 O O   . SER B 2 241 ? 47.808 81.609  42.956 1.00 30.04  ? 241 SER B O   1 
ATOM   3481 C CB  . SER B 2 241 ? 45.924 82.922  41.056 1.00 32.25  ? 241 SER B CB  1 
ATOM   3482 O OG  . SER B 2 241 ? 44.917 83.135  42.032 1.00 39.71  ? 241 SER B OG  1 
ATOM   3483 N N   . ASN B 2 242 ? 47.754 83.630  43.903 1.00 30.70  ? 242 ASN B N   1 
ATOM   3484 C CA  . ASN B 2 242 ? 48.122 83.116  45.218 1.00 31.06  ? 242 ASN B CA  1 
ATOM   3485 C C   . ASN B 2 242 ? 47.923 84.158  46.323 1.00 30.89  ? 242 ASN B C   1 
ATOM   3486 O O   . ASN B 2 242 ? 48.800 84.992  46.569 1.00 29.72  ? 242 ASN B O   1 
ATOM   3487 C CB  . ASN B 2 242 ? 49.580 82.684  45.189 1.00 31.12  ? 242 ASN B CB  1 
ATOM   3488 C CG  . ASN B 2 242 ? 50.077 82.269  46.539 1.00 31.54  ? 242 ASN B CG  1 
ATOM   3489 O OD1 . ASN B 2 242 ? 51.278 82.159  46.754 1.00 33.45  ? 242 ASN B OD1 1 
ATOM   3490 N ND2 . ASN B 2 242 ? 49.152 82.020  47.464 1.00 32.61  ? 242 ASN B ND2 1 
ATOM   3491 N N   . VAL B 2 243 ? 46.780 84.101  46.999 1.00 30.70  ? 243 VAL B N   1 
ATOM   3492 C CA  . VAL B 2 243 ? 46.483 85.061  48.059 1.00 31.34  ? 243 VAL B CA  1 
ATOM   3493 C C   . VAL B 2 243 ? 47.470 85.005  49.221 1.00 29.04  ? 243 VAL B C   1 
ATOM   3494 O O   . VAL B 2 243 ? 47.736 86.010  49.862 1.00 29.33  ? 243 VAL B O   1 
ATOM   3495 C CB  . VAL B 2 243 ? 45.051 84.857  48.621 1.00 32.73  ? 243 VAL B CB  1 
ATOM   3496 C CG1 . VAL B 2 243 ? 44.945 83.507  49.342 1.00 31.13  ? 243 VAL B CG1 1 
ATOM   3497 C CG2 . VAL B 2 243 ? 44.697 86.002  49.560 1.00 32.65  ? 243 VAL B CG2 1 
ATOM   3498 N N   . ALA B 2 244 ? 48.024 83.830  49.475 1.00 29.43  ? 244 ALA B N   1 
ATOM   3499 C CA  . ALA B 2 244 ? 48.957 83.652  50.580 1.00 31.49  ? 244 ALA B CA  1 
ATOM   3500 C C   . ALA B 2 244 ? 50.264 84.427  50.448 1.00 32.04  ? 244 ALA B C   1 
ATOM   3501 O O   . ALA B 2 244 ? 51.041 84.485  51.399 1.00 32.61  ? 244 ALA B O   1 
ATOM   3502 C CB  . ALA B 2 244 ? 49.252 82.166  50.774 1.00 30.96  ? 244 ALA B CB  1 
ATOM   3503 N N   . SER B 2 245 ? 50.512 85.019  49.281 1.00 32.23  ? 245 SER B N   1 
ATOM   3504 C CA  . SER B 2 245 ? 51.742 85.785  49.074 1.00 31.05  ? 245 SER B CA  1 
ATOM   3505 C C   . SER B 2 245 ? 51.709 87.058  49.914 1.00 29.60  ? 245 SER B C   1 
ATOM   3506 O O   . SER B 2 245 ? 52.743 87.585  50.306 1.00 28.11  ? 245 SER B O   1 
ATOM   3507 C CB  . SER B 2 245 ? 51.915 86.132  47.592 1.00 29.77  ? 245 SER B CB  1 
ATOM   3508 O OG  . SER B 2 245 ? 50.774 86.807  47.089 1.00 31.93  ? 245 SER B OG  1 
ATOM   3509 N N   . VAL B 2 246 ? 50.507 87.544  50.184 1.00 31.07  ? 246 VAL B N   1 
ATOM   3510 C CA  . VAL B 2 246 ? 50.313 88.737  50.993 1.00 33.60  ? 246 VAL B CA  1 
ATOM   3511 C C   . VAL B 2 246 ? 50.482 88.292  52.448 1.00 34.84  ? 246 VAL B C   1 
ATOM   3512 O O   . VAL B 2 246 ? 49.639 87.576  52.982 1.00 30.93  ? 246 VAL B O   1 
ATOM   3513 C CB  . VAL B 2 246 ? 48.899 89.288  50.762 1.00 35.26  ? 246 VAL B CB  1 
ATOM   3514 C CG1 . VAL B 2 246 ? 48.640 90.490  51.652 1.00 39.78  ? 246 VAL B CG1 1 
ATOM   3515 C CG2 . VAL B 2 246 ? 48.742 89.664  49.303 1.00 36.83  ? 246 VAL B CG2 1 
ATOM   3516 N N   . GLN B 2 247 ? 51.560 88.718  53.097 1.00 36.89  ? 247 GLN B N   1 
ATOM   3517 C CA  . GLN B 2 247 ? 51.799 88.270  54.465 1.00 41.42  ? 247 GLN B CA  1 
ATOM   3518 C C   . GLN B 2 247 ? 52.298 89.263  55.513 1.00 41.81  ? 247 GLN B C   1 
ATOM   3519 O O   . GLN B 2 247 ? 52.974 90.249  55.206 1.00 41.23  ? 247 GLN B O   1 
ATOM   3520 C CB  . GLN B 2 247 ? 52.735 87.061  54.419 1.00 43.28  ? 247 GLN B CB  1 
ATOM   3521 C CG  . GLN B 2 247 ? 53.842 87.207  53.400 1.00 44.69  ? 247 GLN B CG  1 
ATOM   3522 C CD  . GLN B 2 247 ? 54.461 85.884  53.002 1.00 46.13  ? 247 GLN B CD  1 
ATOM   3523 O OE1 . GLN B 2 247 ? 53.771 84.970  52.547 1.00 45.73  ? 247 GLN B OE1 1 
ATOM   3524 N NE2 . GLN B 2 247 ? 55.776 85.779  53.160 1.00 46.11  ? 247 GLN B NE2 1 
ATOM   3525 N N   . CYS B 2 248 ? 51.945 88.967  56.762 1.00 44.13  ? 248 CYS B N   1 
ATOM   3526 C CA  . CYS B 2 248 ? 52.310 89.776  57.926 1.00 47.77  ? 248 CYS B CA  1 
ATOM   3527 C C   . CYS B 2 248 ? 53.824 89.865  58.072 1.00 51.66  ? 248 CYS B C   1 
ATOM   3528 O O   . CYS B 2 248 ? 54.518 88.859  57.951 1.00 51.47  ? 248 CYS B O   1 
ATOM   3529 C CB  . CYS B 2 248 ? 51.740 89.152  59.197 1.00 45.65  ? 248 CYS B CB  1 
ATOM   3530 S SG  . CYS B 2 248 ? 49.960 88.761  59.196 1.00 44.15  ? 248 CYS B SG  1 
ATOM   3531 N N   . ASP B 2 249 ? 54.330 91.063  58.353 1.00 56.54  ? 249 ASP B N   1 
ATOM   3532 C CA  . ASP B 2 249 ? 55.769 91.286  58.501 1.00 62.17  ? 249 ASP B CA  1 
ATOM   3533 C C   . ASP B 2 249 ? 56.530 90.883  57.241 1.00 65.86  ? 249 ASP B C   1 
ATOM   3534 O O   . ASP B 2 249 ? 57.757 90.990  57.200 1.00 67.53  ? 249 ASP B O   1 
ATOM   3535 C CB  . ASP B 2 249 ? 56.339 90.494  59.683 1.00 63.76  ? 249 ASP B CB  1 
ATOM   3536 C CG  . ASP B 2 249 ? 55.705 90.870  61.002 1.00 67.86  ? 249 ASP B CG  1 
ATOM   3537 O OD1 . ASP B 2 249 ? 55.132 91.978  61.089 1.00 70.05  ? 249 ASP B OD1 1 
ATOM   3538 O OD2 . ASP B 2 249 ? 55.790 90.061  61.955 1.00 69.33  ? 249 ASP B OD2 1 
ATOM   3539 N N   . ASN B 2 250 ? 55.798 90.416  56.227 1.00 68.94  ? 250 ASN B N   1 
ATOM   3540 C CA  . ASN B 2 250 ? 56.366 89.979  54.947 1.00 71.31  ? 250 ASN B CA  1 
ATOM   3541 C C   . ASN B 2 250 ? 56.875 88.535  55.043 1.00 73.41  ? 250 ASN B C   1 
ATOM   3542 O O   . ASN B 2 250 ? 57.530 88.028  54.129 1.00 74.18  ? 250 ASN B O   1 
ATOM   3543 C CB  . ASN B 2 250 ? 57.521 90.898  54.524 1.00 71.33  ? 250 ASN B CB  1 
ATOM   3544 C CG  . ASN B 2 250 ? 57.796 90.848  53.032 1.00 70.63  ? 250 ASN B CG  1 
ATOM   3545 O OD1 . ASN B 2 250 ? 57.592 89.826  52.380 1.00 69.77  ? 250 ASN B OD1 1 
ATOM   3546 N ND2 . ASN B 2 250 ? 58.278 91.957  52.488 1.00 71.83  ? 250 ASN B ND2 1 
ATOM   3547 N N   . SER B 2 251 ? 56.565 87.874  56.152 1.00 74.47  ? 251 SER B N   1 
ATOM   3548 C CA  . SER B 2 251 ? 56.998 86.500  56.361 1.00 75.73  ? 251 SER B CA  1 
ATOM   3549 C C   . SER B 2 251 ? 55.901 85.500  55.995 1.00 76.68  ? 251 SER B C   1 
ATOM   3550 O O   . SER B 2 251 ? 54.732 85.690  56.328 1.00 76.84  ? 251 SER B O   1 
ATOM   3551 C CB  . SER B 2 251 ? 57.429 86.312  57.820 1.00 75.63  ? 251 SER B CB  1 
ATOM   3552 O OG  . SER B 2 251 ? 56.686 85.286  58.449 1.00 76.37  ? 251 SER B OG  1 
ATOM   3553 N N   . ASP B 2 252 ? 56.289 84.435  55.301 1.00 77.02  ? 252 ASP B N   1 
ATOM   3554 C CA  . ASP B 2 252 ? 55.349 83.403  54.878 1.00 77.27  ? 252 ASP B CA  1 
ATOM   3555 C C   . ASP B 2 252 ? 54.817 82.594  56.051 1.00 76.71  ? 252 ASP B C   1 
ATOM   3556 O O   . ASP B 2 252 ? 53.981 81.709  55.878 1.00 76.52  ? 252 ASP B O   1 
ATOM   3557 C CB  . ASP B 2 252 ? 56.017 82.476  53.852 1.00 79.14  ? 252 ASP B CB  1 
ATOM   3558 C CG  . ASP B 2 252 ? 57.387 81.983  54.302 1.00 80.76  ? 252 ASP B CG  1 
ATOM   3559 O OD1 . ASP B 2 252 ? 58.224 82.823  54.701 1.00 81.86  ? 252 ASP B OD1 1 
ATOM   3560 O OD2 . ASP B 2 252 ? 57.631 80.757  54.244 1.00 80.50  ? 252 ASP B OD2 1 
ATOM   3561 N N   . LYS B 2 253 ? 55.303 82.913  57.246 1.00 76.22  ? 253 LYS B N   1 
ATOM   3562 C CA  . LYS B 2 253 ? 54.891 82.227  58.466 1.00 74.68  ? 253 LYS B CA  1 
ATOM   3563 C C   . LYS B 2 253 ? 53.410 82.445  58.739 1.00 72.34  ? 253 LYS B C   1 
ATOM   3564 O O   . LYS B 2 253 ? 52.765 81.639  59.412 1.00 71.27  ? 253 LYS B O   1 
ATOM   3565 C CB  . LYS B 2 253 ? 55.700 82.753  59.651 1.00 76.55  ? 253 LYS B CB  1 
ATOM   3566 C CG  . LYS B 2 253 ? 57.198 82.660  59.456 1.00 81.02  ? 253 LYS B CG  1 
ATOM   3567 C CD  . LYS B 2 253 ? 57.935 83.491  60.489 1.00 84.53  ? 253 LYS B CD  1 
ATOM   3568 C CE  . LYS B 2 253 ? 59.427 83.508  60.202 1.00 87.48  ? 253 LYS B CE  1 
ATOM   3569 N NZ  . LYS B 2 253 ? 60.165 84.425  61.117 1.00 89.36  ? 253 LYS B NZ  1 
ATOM   3570 N N   . PHE B 2 254 ? 52.873 83.540  58.213 1.00 70.17  ? 254 PHE B N   1 
ATOM   3571 C CA  . PHE B 2 254 ? 51.473 83.859  58.431 1.00 68.12  ? 254 PHE B CA  1 
ATOM   3572 C C   . PHE B 2 254 ? 50.859 84.795  57.388 1.00 62.79  ? 254 PHE B C   1 
ATOM   3573 O O   . PHE B 2 254 ? 51.198 85.973  57.311 1.00 62.39  ? 254 PHE B O   1 
ATOM   3574 C CB  . PHE B 2 254 ? 51.303 84.447  59.842 1.00 72.67  ? 254 PHE B CB  1 
ATOM   3575 C CG  . PHE B 2 254 ? 52.586 84.989  60.439 1.00 76.83  ? 254 PHE B CG  1 
ATOM   3576 C CD1 . PHE B 2 254 ? 53.226 86.092  59.877 1.00 78.13  ? 254 PHE B CD1 1 
ATOM   3577 C CD2 . PHE B 2 254 ? 53.162 84.381  61.555 1.00 78.82  ? 254 PHE B CD2 1 
ATOM   3578 C CE1 . PHE B 2 254 ? 54.426 86.581  60.413 1.00 80.02  ? 254 PHE B CE1 1 
ATOM   3579 C CE2 . PHE B 2 254 ? 54.360 84.862  62.097 1.00 80.58  ? 254 PHE B CE2 1 
ATOM   3580 C CZ  . PHE B 2 254 ? 54.993 85.966  61.523 1.00 80.33  ? 254 PHE B CZ  1 
ATOM   3581 N N   . PRO B 2 255 ? 49.956 84.264  56.552 1.00 57.29  ? 255 PRO B N   1 
ATOM   3582 C CA  . PRO B 2 255 ? 49.289 85.058  55.519 1.00 53.16  ? 255 PRO B CA  1 
ATOM   3583 C C   . PRO B 2 255 ? 48.355 86.061  56.196 1.00 50.27  ? 255 PRO B C   1 
ATOM   3584 O O   . PRO B 2 255 ? 47.804 85.778  57.260 1.00 51.33  ? 255 PRO B O   1 
ATOM   3585 C CB  . PRO B 2 255 ? 48.511 84.010  54.727 1.00 53.36  ? 255 PRO B CB  1 
ATOM   3586 C CG  . PRO B 2 255 ? 49.329 82.779  54.892 1.00 54.07  ? 255 PRO B CG  1 
ATOM   3587 C CD  . PRO B 2 255 ? 49.699 82.829  56.349 1.00 56.55  ? 255 PRO B CD  1 
ATOM   3588 N N   . VAL B 2 256 ? 48.176 87.228  55.588 1.00 44.83  ? 256 VAL B N   1 
ATOM   3589 C CA  . VAL B 2 256 ? 47.298 88.238  56.158 1.00 40.46  ? 256 VAL B CA  1 
ATOM   3590 C C   . VAL B 2 256 ? 45.844 87.776  56.044 1.00 40.38  ? 256 VAL B C   1 
ATOM   3591 O O   . VAL B 2 256 ? 45.014 88.061  56.912 1.00 37.09  ? 256 VAL B O   1 
ATOM   3592 C CB  . VAL B 2 256 ? 47.473 89.594  55.426 1.00 39.31  ? 256 VAL B CB  1 
ATOM   3593 C CG1 . VAL B 2 256 ? 46.526 90.640  56.003 1.00 37.44  ? 256 VAL B CG1 1 
ATOM   3594 C CG2 . VAL B 2 256 ? 48.910 90.064  55.550 1.00 37.57  ? 256 VAL B CG2 1 
ATOM   3595 N N   . TYR B 2 257 ? 45.557 87.033  54.980 1.00 40.45  ? 257 TYR B N   1 
ATOM   3596 C CA  . TYR B 2 257 ? 44.209 86.549  54.716 1.00 42.07  ? 257 TYR B CA  1 
ATOM   3597 C C   . TYR B 2 257 ? 43.706 85.567  55.762 1.00 42.84  ? 257 TYR B C   1 
ATOM   3598 O O   . TYR B 2 257 ? 42.522 85.232  55.796 1.00 42.97  ? 257 TYR B O   1 
ATOM   3599 C CB  . TYR B 2 257 ? 44.145 85.932  53.313 1.00 42.57  ? 257 TYR B CB  1 
ATOM   3600 C CG  . TYR B 2 257 ? 44.310 84.435  53.252 1.00 41.19  ? 257 TYR B CG  1 
ATOM   3601 C CD1 . TYR B 2 257 ? 43.211 83.595  53.379 1.00 42.50  ? 257 TYR B CD1 1 
ATOM   3602 C CD2 . TYR B 2 257 ? 45.559 83.858  53.044 1.00 41.93  ? 257 TYR B CD2 1 
ATOM   3603 C CE1 . TYR B 2 257 ? 43.345 82.219  53.295 1.00 43.18  ? 257 TYR B CE1 1 
ATOM   3604 C CE2 . TYR B 2 257 ? 45.709 82.478  52.959 1.00 42.37  ? 257 TYR B CE2 1 
ATOM   3605 C CZ  . TYR B 2 257 ? 44.594 81.666  53.083 1.00 43.53  ? 257 TYR B CZ  1 
ATOM   3606 O OH  . TYR B 2 257 ? 44.711 80.303  52.976 1.00 41.79  ? 257 TYR B OH  1 
ATOM   3607 N N   . LYS B 2 258 ? 44.595 85.103  56.626 1.00 44.67  ? 258 LYS B N   1 
ATOM   3608 C CA  . LYS B 2 258 ? 44.159 84.189  57.662 1.00 48.74  ? 258 LYS B CA  1 
ATOM   3609 C C   . LYS B 2 258 ? 44.625 84.654  59.046 1.00 49.06  ? 258 LYS B C   1 
ATOM   3610 O O   . LYS B 2 258 ? 45.044 83.863  59.889 1.00 49.07  ? 258 LYS B O   1 
ATOM   3611 C CB  . LYS B 2 258 ? 44.646 82.774  57.344 1.00 52.20  ? 258 LYS B CB  1 
ATOM   3612 C CG  . LYS B 2 258 ? 46.110 82.529  57.614 1.00 57.13  ? 258 LYS B CG  1 
ATOM   3613 C CD  . LYS B 2 258 ? 46.591 81.193  57.053 1.00 59.23  ? 258 LYS B CD  1 
ATOM   3614 C CE  . LYS B 2 258 ? 45.538 80.100  57.120 1.00 60.85  ? 258 LYS B CE  1 
ATOM   3615 N NZ  . LYS B 2 258 ? 44.853 79.967  55.805 1.00 62.23  ? 258 LYS B NZ  1 
ATOM   3616 N N   . TYR B 2 259 ? 44.530 85.960  59.266 1.00 49.38  ? 259 TYR B N   1 
ATOM   3617 C CA  . TYR B 2 259 ? 44.918 86.579  60.527 1.00 49.43  ? 259 TYR B CA  1 
ATOM   3618 C C   . TYR B 2 259 ? 43.692 86.698  61.422 1.00 50.71  ? 259 TYR B C   1 
ATOM   3619 O O   . TYR B 2 259 ? 42.738 87.398  61.098 1.00 51.81  ? 259 TYR B O   1 
ATOM   3620 C CB  . TYR B 2 259 ? 45.503 87.960  60.255 1.00 48.20  ? 259 TYR B CB  1 
ATOM   3621 C CG  . TYR B 2 259 ? 45.599 88.844  61.472 1.00 47.29  ? 259 TYR B CG  1 
ATOM   3622 C CD1 . TYR B 2 259 ? 46.403 88.495  62.555 1.00 47.60  ? 259 TYR B CD1 1 
ATOM   3623 C CD2 . TYR B 2 259 ? 44.870 90.026  61.551 1.00 45.87  ? 259 TYR B CD2 1 
ATOM   3624 C CE1 . TYR B 2 259 ? 46.475 89.305  63.690 1.00 46.57  ? 259 TYR B CE1 1 
ATOM   3625 C CE2 . TYR B 2 259 ? 44.935 90.839  62.680 1.00 46.22  ? 259 TYR B CE2 1 
ATOM   3626 C CZ  . TYR B 2 259 ? 45.737 90.473  63.743 1.00 45.60  ? 259 TYR B CZ  1 
ATOM   3627 O OH  . TYR B 2 259 ? 45.789 91.274  64.861 1.00 46.03  ? 259 TYR B OH  1 
ATOM   3628 N N   . PRO B 2 260 ? 43.705 86.022  62.572 1.00 51.64  ? 260 PRO B N   1 
ATOM   3629 C CA  . PRO B 2 260 ? 42.569 86.061  63.502 1.00 52.88  ? 260 PRO B CA  1 
ATOM   3630 C C   . PRO B 2 260 ? 42.075 87.431  64.008 1.00 54.70  ? 260 PRO B C   1 
ATOM   3631 O O   . PRO B 2 260 ? 40.918 87.807  63.762 1.00 55.37  ? 260 PRO B O   1 
ATOM   3632 C CB  . PRO B 2 260 ? 43.027 85.146  64.638 1.00 52.84  ? 260 PRO B CB  1 
ATOM   3633 C CG  . PRO B 2 260 ? 44.541 85.232  64.568 1.00 55.47  ? 260 PRO B CG  1 
ATOM   3634 C CD  . PRO B 2 260 ? 44.796 85.184  63.094 1.00 52.39  ? 260 PRO B CD  1 
ATOM   3635 N N   . GLY B 2 261 ? 42.944 88.170  64.702 1.00 55.21  ? 261 GLY B N   1 
ATOM   3636 C CA  . GLY B 2 261 ? 42.566 89.466  65.245 1.00 56.07  ? 261 GLY B CA  1 
ATOM   3637 C C   . GLY B 2 261 ? 41.614 89.214  66.391 1.00 58.21  ? 261 GLY B C   1 
ATOM   3638 O O   . GLY B 2 261 ? 40.477 89.707  66.403 1.00 57.64  ? 261 GLY B O   1 
ATOM   3639 N N   . LYS B 2 262 ? 42.098 88.417  67.343 1.00 60.14  ? 262 LYS B N   1 
ATOM   3640 C CA  . LYS B 2 262 ? 41.342 88.028  68.518 1.00 61.81  ? 262 LYS B CA  1 
ATOM   3641 C C   . LYS B 2 262 ? 40.325 89.051  68.983 1.00 63.03  ? 262 LYS B C   1 
ATOM   3642 O O   . LYS B 2 262 ? 39.116 88.892  68.796 1.00 64.00  ? 262 LYS B O   1 
ATOM   3643 C CB  . LYS B 2 262 ? 42.285 87.740  69.700 1.00 63.30  ? 262 LYS B CB  1 
ATOM   3644 C CG  . LYS B 2 262 ? 42.826 86.317  69.784 1.00 64.72  ? 262 LYS B CG  1 
ATOM   3645 C CD  . LYS B 2 262 ? 41.682 85.381  70.164 1.00 65.97  ? 262 LYS B CD  1 
ATOM   3646 C CE  . LYS B 2 262 ? 42.131 84.049  70.779 1.00 66.72  ? 262 LYS B CE  1 
ATOM   3647 N NZ  . LYS B 2 262 ? 42.488 84.164  72.232 1.00 66.95  ? 262 LYS B NZ  1 
ATOM   3648 N N   . GLY B 2 263 ? 40.824 90.127  69.575 1.00 64.28  ? 263 GLY B N   1 
ATOM   3649 C CA  . GLY B 2 263 ? 39.910 91.086  70.178 1.00 65.53  ? 263 GLY B CA  1 
ATOM   3650 C C   . GLY B 2 263 ? 39.491 92.365  69.496 1.00 66.90  ? 263 GLY B C   1 
ATOM   3651 O O   . GLY B 2 263 ? 38.961 93.297  70.127 1.00 66.18  ? 263 GLY B O   1 
ATOM   3652 N N   . CYS B 2 264 ? 39.733 92.383  68.192 1.00 67.57  ? 264 CYS B N   1 
ATOM   3653 C CA  . CYS B 2 264 ? 39.431 93.514  67.347 1.00 67.08  ? 264 CYS B CA  1 
ATOM   3654 C C   . CYS B 2 264 ? 37.926 93.578  67.167 1.00 69.27  ? 264 CYS B C   1 
ATOM   3655 O O   . CYS B 2 264 ? 37.273 92.590  66.846 1.00 70.10  ? 264 CYS B O   1 
ATOM   3656 C CB  . CYS B 2 264 ? 40.155 93.371  66.012 1.00 62.81  ? 264 CYS B CB  1 
ATOM   3657 S SG  . CYS B 2 264 ? 41.959 93.279  66.176 1.00 55.90  ? 264 CYS B SG  1 
ATOM   3658 N N   . PRO B 2 265 ? 37.344 94.751  67.419 1.00 70.70  ? 265 PRO B N   1 
ATOM   3659 C CA  . PRO B 2 265 ? 35.899 94.928  67.282 1.00 72.30  ? 265 PRO B CA  1 
ATOM   3660 C C   . PRO B 2 265 ? 35.410 94.732  65.850 1.00 73.25  ? 265 PRO B C   1 
ATOM   3661 O O   . PRO B 2 265 ? 36.196 94.303  64.973 1.00 72.99  ? 265 PRO B O   1 
ATOM   3662 C CB  . PRO B 2 265 ? 35.674 96.359  67.765 1.00 72.15  ? 265 PRO B CB  1 
ATOM   3663 C CG  . PRO B 2 265 ? 36.820 96.574  68.722 1.00 72.00  ? 265 PRO B CG  1 
ATOM   3664 C CD  . PRO B 2 265 ? 37.964 95.944  68.017 1.00 70.97  ? 265 PRO B CD  1 
HETATM 3665 O O   . HOH C 3 .   ? 29.377 84.441  29.865 1.00 44.31  ? 2   HOH A O   1 
HETATM 3666 O O   . HOH C 3 .   ? 45.482 58.768  35.692 1.00 15.69  ? 5   HOH A O   1 
HETATM 3667 O O   . HOH C 3 .   ? 56.494 68.284  16.063 1.00 29.42  ? 6   HOH A O   1 
HETATM 3668 O O   . HOH C 3 .   ? 33.308 76.173  15.946 1.00 21.29  ? 7   HOH A O   1 
HETATM 3669 O O   . HOH C 3 .   ? 32.415 79.230  32.673 1.00 26.44  ? 8   HOH A O   1 
HETATM 3670 O O   . HOH C 3 .   ? 37.961 80.682  36.484 1.00 30.65  ? 13  HOH A O   1 
HETATM 3671 O O   . HOH C 3 .   ? 45.426 72.305  29.232 1.00 14.57  ? 14  HOH A O   1 
HETATM 3672 O O   . HOH C 3 .   ? 55.139 65.591  16.631 1.00 31.74  ? 18  HOH A O   1 
HETATM 3673 O O   . HOH C 3 .   ? 56.266 69.914  14.057 1.00 52.02  ? 20  HOH A O   1 
HETATM 3674 O O   . HOH C 3 .   ? 45.921 65.013  39.052 1.00 40.67  ? 24  HOH A O   1 
HETATM 3675 O O   . HOH C 3 .   ? 55.749 72.008  31.185 1.00 20.50  ? 28  HOH A O   1 
HETATM 3676 O O   . HOH C 3 .   ? 37.955 68.206  36.232 1.00 42.01  ? 32  HOH A O   1 
HETATM 3677 O O   . HOH C 3 .   ? 35.680 89.110  32.033 1.00 27.32  ? 36  HOH A O   1 
HETATM 3678 O O   . HOH C 3 .   ? 54.045 70.096  30.317 1.00 32.13  ? 39  HOH A O   1 
HETATM 3679 O O   . HOH C 3 .   ? 68.937 74.948  29.601 1.00 32.46  ? 40  HOH A O   1 
HETATM 3680 O O   . HOH C 3 .   ? 52.794 79.359  37.914 1.00 24.04  ? 41  HOH A O   1 
HETATM 3681 O O   . HOH C 3 .   ? 36.102 82.721  21.759 1.00 28.35  ? 42  HOH A O   1 
HETATM 3682 O O   . HOH C 3 .   ? 40.181 90.344  10.531 1.00 43.77  ? 43  HOH A O   1 
HETATM 3683 O O   . HOH C 3 .   ? 62.190 64.749  23.520 1.00 33.10  ? 45  HOH A O   1 
HETATM 3684 O O   . HOH C 3 .   ? 49.841 62.304  25.475 1.00 49.99  ? 46  HOH A O   1 
HETATM 3685 O O   . HOH C 3 .   ? 38.961 84.666  38.754 1.00 59.59  ? 47  HOH A O   1 
HETATM 3686 O O   . HOH C 3 .   ? 44.223 71.927  31.799 1.00 21.40  ? 52  HOH A O   1 
HETATM 3687 O O   . HOH C 3 .   ? 61.197 87.878  24.399 1.00 39.41  ? 53  HOH A O   1 
HETATM 3688 O O   . HOH C 3 .   ? 36.027 89.021  35.287 1.00 28.46  ? 54  HOH A O   1 
HETATM 3689 O O   . HOH C 3 .   ? 37.761 64.313  29.807 1.00 51.41  ? 56  HOH A O   1 
HETATM 3690 O O   . HOH C 3 .   ? 41.083 90.717  13.147 1.00 52.26  ? 58  HOH A O   1 
HETATM 3691 O O   . HOH C 3 .   ? 38.319 87.840  36.753 1.00 26.56  ? 76  HOH A O   1 
HETATM 3692 O O   . HOH C 3 .   ? 40.976 81.708  37.325 1.00 43.39  ? 77  HOH A O   1 
HETATM 3693 O O   . HOH C 3 .   ? 47.393 83.858  35.309 1.00 27.36  ? 78  HOH A O   1 
HETATM 3694 O O   . HOH C 3 .   ? 60.773 70.058  28.444 1.00 38.56  ? 86  HOH A O   1 
HETATM 3695 O O   . HOH C 3 .   ? 41.499 71.957  31.892 1.00 26.12  ? 89  HOH A O   1 
HETATM 3696 O O   . HOH C 3 .   ? 52.091 70.976  41.100 1.00 40.37  ? 90  HOH A O   1 
HETATM 3697 O O   . HOH C 3 .   ? 66.214 87.591  25.003 1.00 23.07  ? 97  HOH A O   1 
HETATM 3698 O O   . HOH C 3 .   ? 34.888 76.256  12.885 1.00 49.53  ? 98  HOH A O   1 
HETATM 3699 O O   . HOH C 3 .   ? 46.308 58.011  16.344 1.00 60.19  ? 99  HOH A O   1 
HETATM 3700 O O   . HOH C 3 .   ? 48.474 63.537  39.205 1.00 58.17  ? 100 HOH A O   1 
HETATM 3701 O O   . HOH C 3 .   ? 56.978 96.951  19.578 1.00 39.26  ? 110 HOH A O   1 
HETATM 3702 O O   . HOH C 3 .   ? 65.248 72.720  23.837 1.00 34.84  ? 111 HOH A O   1 
HETATM 3703 O O   . HOH C 3 .   ? 58.629 67.581  15.687 1.00 35.45  ? 112 HOH A O   1 
HETATM 3704 O O   . HOH C 3 .   ? 62.949 72.904  19.601 1.00 49.41  ? 113 HOH A O   1 
HETATM 3705 O O   . HOH C 3 .   ? 48.071 95.121  27.524 1.00 48.90  ? 115 HOH A O   1 
HETATM 3706 O O   . HOH C 3 .   ? 40.212 97.867  26.392 1.00 59.59  ? 116 HOH A O   1 
HETATM 3707 O O   . HOH C 3 .   ? 43.691 66.091  33.938 1.00 38.52  ? 117 HOH A O   1 
HETATM 3708 O O   . HOH C 3 .   ? 40.573 87.856  14.074 1.00 33.19  ? 118 HOH A O   1 
HETATM 3709 O O   . HOH C 3 .   ? 53.058 67.450  7.935  1.00 44.09  ? 119 HOH A O   1 
HETATM 3710 O O   . HOH C 3 .   ? 48.082 67.807  8.174  1.00 34.12  ? 120 HOH A O   1 
HETATM 3711 O O   . HOH C 3 .   ? 61.517 92.507  14.894 1.00 66.78  ? 121 HOH A O   1 
HETATM 3712 O O   . HOH C 3 .   ? 57.730 77.127  31.981 1.00 29.34  ? 123 HOH A O   1 
HETATM 3713 O O   . HOH C 3 .   ? 48.545 66.533  36.044 1.00 63.69  ? 124 HOH A O   1 
HETATM 3714 O O   . HOH C 3 .   ? 46.327 64.415  27.606 1.00 27.99  ? 125 HOH A O   1 
HETATM 3715 O O   . HOH C 3 .   ? 35.380 91.760  35.508 1.00 32.41  ? 140 HOH A O   1 
HETATM 3716 O O   . HOH C 3 .   ? 60.477 99.559  23.463 1.00 33.40  ? 142 HOH A O   1 
HETATM 3717 O O   . HOH C 3 .   ? 30.701 82.663  35.332 1.00 44.94  ? 144 HOH A O   1 
HETATM 3718 O O   . HOH C 3 .   ? 66.201 68.038  33.316 1.00 42.38  ? 147 HOH A O   1 
HETATM 3719 O O   . HOH C 3 .   ? 56.299 77.419  38.605 1.00 47.07  ? 152 HOH A O   1 
HETATM 3720 O O   . HOH C 3 .   ? 42.857 63.961  22.661 1.00 44.49  ? 155 HOH A O   1 
HETATM 3721 O O   . HOH C 3 .   ? 57.099 88.744  18.060 1.00 34.26  ? 156 HOH A O   1 
HETATM 3722 O O   . HOH C 3 .   ? 54.400 92.043  24.244 1.00 31.22  ? 157 HOH A O   1 
HETATM 3723 O O   . HOH C 3 .   ? 61.527 93.774  22.441 1.00 53.53  ? 159 HOH A O   1 
HETATM 3724 O O   . HOH C 3 .   ? 67.187 85.636  12.017 1.00 35.88  ? 160 HOH A O   1 
HETATM 3725 O O   . HOH C 3 .   ? 65.536 76.360  18.289 1.00 38.66  ? 161 HOH A O   1 
HETATM 3726 O O   . HOH C 3 .   ? 41.302 64.179  32.819 1.00 46.29  ? 163 HOH A O   1 
HETATM 3727 O O   . HOH C 3 .   ? 29.895 84.974  34.592 1.00 31.78  ? 164 HOH A O   1 
HETATM 3728 O O   . HOH C 3 .   ? 31.858 88.190  29.033 1.00 33.48  ? 165 HOH A O   1 
HETATM 3729 O O   . HOH C 3 .   ? 41.962 66.534  14.437 1.00 73.58  ? 166 HOH A O   1 
HETATM 3730 O O   . HOH C 3 .   ? 48.677 82.606  -0.209 1.00 46.64  ? 167 HOH A O   1 
HETATM 3731 O O   . HOH C 3 .   ? 49.048 84.064  -3.754 1.00 50.01  ? 168 HOH A O   1 
HETATM 3732 O O   . HOH C 3 .   ? 51.938 62.535  24.374 1.00 30.12  ? 182 HOH A O   1 
HETATM 3733 O O   . HOH C 3 .   ? 52.229 89.226  28.093 1.00 31.90  ? 188 HOH A O   1 
HETATM 3734 O O   . HOH C 3 .   ? 37.124 70.023  15.011 1.00 56.29  ? 194 HOH A O   1 
HETATM 3735 O O   . HOH C 3 .   ? 60.105 97.095  24.248 1.00 40.94  ? 195 HOH A O   1 
HETATM 3736 O O   . HOH C 3 .   ? 40.935 80.116  39.588 1.00 40.46  ? 196 HOH A O   1 
HETATM 3737 O O   . HOH C 3 .   ? 57.004 63.258  16.090 1.00 35.13  ? 197 HOH A O   1 
HETATM 3738 O O   . HOH C 3 .   ? 44.959 70.521  35.437 1.00 45.74  ? 198 HOH A O   1 
HETATM 3739 O O   . HOH C 3 .   ? 39.761 61.801  31.580 1.00 47.80  ? 199 HOH A O   1 
HETATM 3740 O O   . HOH C 3 .   ? 36.183 67.904  19.027 1.00 37.63  ? 200 HOH A O   1 
HETATM 3741 O O   . HOH C 3 .   ? 45.513 61.526  16.786 1.00 41.93  ? 201 HOH A O   1 
HETATM 3742 O O   . HOH C 3 .   ? 29.596 86.033  32.189 1.00 28.94  ? 206 HOH A O   1 
HETATM 3743 O O   . HOH C 3 .   ? 66.686 81.593  27.113 1.00 35.79  ? 207 HOH A O   1 
HETATM 3744 O O   . HOH C 3 .   ? 44.673 57.612  33.704 1.00 32.06  ? 209 HOH A O   1 
HETATM 3745 O O   . HOH C 3 .   ? 59.279 89.214  27.549 1.00 35.58  ? 217 HOH A O   1 
HETATM 3746 O O   . HOH C 3 .   ? 64.763 93.230  14.440 1.00 57.79  ? 218 HOH A O   1 
HETATM 3747 O O   . HOH C 3 .   ? 56.697 88.610  28.072 1.00 42.50  ? 223 HOH A O   1 
HETATM 3748 O O   . HOH C 3 .   ? 37.173 71.394  33.994 1.00 38.88  ? 231 HOH A O   1 
HETATM 3749 O O   . HOH C 3 .   ? 64.440 83.327  8.916  1.00 52.57  ? 236 HOH A O   1 
HETATM 3750 O O   . HOH C 3 .   ? 45.695 61.864  12.642 1.00 42.36  ? 237 HOH A O   1 
HETATM 3751 O O   . HOH C 3 .   ? 31.746 73.368  16.155 1.00 56.33  ? 239 HOH A O   1 
HETATM 3752 O O   . HOH C 3 .   ? 51.075 58.646  18.186 1.00 49.66  ? 240 HOH A O   1 
HETATM 3753 O O   . HOH C 3 .   ? 50.767 59.921  25.753 1.00 32.79  ? 241 HOH A O   1 
HETATM 3754 O O   . HOH C 3 .   ? 33.610 68.019  20.318 1.00 32.57  ? 246 HOH A O   1 
HETATM 3755 O O   . HOH C 3 .   ? 63.761 79.413  29.647 1.00 51.85  ? 247 HOH A O   1 
HETATM 3756 O O   . HOH C 3 .   ? 57.931 89.575  13.056 1.00 35.67  ? 249 HOH A O   1 
HETATM 3757 O O   . HOH C 3 .   ? 56.977 91.735  14.532 1.00 57.38  ? 250 HOH A O   1 
HETATM 3758 O O   . HOH C 3 .   ? 29.843 72.313  19.504 1.00 57.03  ? 253 HOH A O   1 
HETATM 3759 O O   . HOH C 3 .   ? 47.922 93.769  20.659 1.00 43.96  ? 255 HOH A O   1 
HETATM 3760 O O   . HOH C 3 .   ? 57.669 89.474  15.645 1.00 37.31  ? 261 HOH A O   1 
HETATM 3761 O O   . HOH C 3 .   ? 68.010 76.443  18.929 1.00 52.22  ? 262 HOH A O   1 
HETATM 3762 O O   . HOH C 3 .   ? 62.699 94.886  13.457 1.00 57.05  ? 264 HOH A O   1 
HETATM 3763 O O   . HOH C 3 .   ? 49.232 57.880  20.019 1.00 39.23  ? 266 HOH A O   1 
HETATM 3764 O O   . HOH C 3 .   ? 59.004 81.157  35.266 1.00 29.49  ? 270 HOH A O   1 
HETATM 3765 O O   . HOH C 3 .   ? 59.742 82.551  37.149 1.00 45.51  ? 271 HOH A O   1 
HETATM 3766 O O   . HOH C 3 .   ? 39.990 63.676  28.148 1.00 53.86  ? 276 HOH A O   1 
HETATM 3767 O O   . HOH C 3 .   ? 68.408 73.582  19.534 1.00 47.58  ? 277 HOH A O   1 
HETATM 3768 O O   . HOH C 3 .   ? 66.648 72.561  21.115 1.00 38.38  ? 278 HOH A O   1 
HETATM 3769 O O   . HOH C 3 .   ? 35.053 86.113  16.725 1.00 50.37  ? 282 HOH A O   1 
HETATM 3770 O O   . HOH C 3 .   ? 38.743 93.050  28.763 1.00 50.94  ? 283 HOH A O   1 
HETATM 3771 O O   . HOH C 3 .   ? 58.964 80.483  38.397 1.00 47.51  ? 284 HOH A O   1 
HETATM 3772 O O   . HOH C 3 .   ? 41.525 71.207  8.842  1.00 50.14  ? 285 HOH A O   1 
HETATM 3773 O O   . HOH C 3 .   ? 62.068 79.276  7.537  1.00 50.57  ? 290 HOH A O   1 
HETATM 3774 O O   . HOH C 3 .   ? 62.635 72.024  34.004 1.00 53.72  ? 294 HOH A O   1 
HETATM 3775 O O   . HOH C 3 .   ? 39.856 69.552  13.070 1.00 77.41  ? 297 HOH A O   1 
HETATM 3776 O O   . HOH C 3 .   ? 63.298 81.732  5.887  1.00 54.36  ? 298 HOH A O   1 
HETATM 3777 O O   . HOH C 3 .   ? 42.077 67.717  38.272 1.00 53.17  ? 300 HOH A O   1 
HETATM 3778 O O   . HOH C 3 .   ? 40.368 65.513  37.065 1.00 60.32  ? 301 HOH A O   1 
HETATM 3779 O O   . HOH C 3 .   ? 53.570 88.726  32.051 1.00 47.10  ? 307 HOH A O   1 
HETATM 3780 O O   . HOH C 3 .   ? 68.481 78.794  17.970 1.00 53.20  ? 310 HOH A O   1 
HETATM 3781 O O   . HOH C 3 .   ? 66.404 83.069  10.755 1.00 46.25  ? 312 HOH A O   1 
HETATM 3782 O O   . HOH C 3 .   ? 54.199 77.278  40.116 1.00 45.37  ? 313 HOH A O   1 
HETATM 3783 O O   . HOH D 3 .   ? 55.958 93.907  37.536 1.00 12.25  ? 289 HOH B O   1 
HETATM 3784 O O   . HOH D 3 .   ? 63.933 97.137  41.982 1.00 18.18  ? 290 HOH B O   1 
HETATM 3785 O O   . HOH D 3 .   ? 40.271 97.629  59.452 1.00 26.20  ? 291 HOH B O   1 
HETATM 3786 O O   . HOH D 3 .   ? 42.860 114.473 26.705 1.00 25.15  ? 292 HOH B O   1 
HETATM 3787 O O   . HOH D 3 .   ? 53.729 110.992 10.911 1.00 20.51  ? 293 HOH B O   1 
HETATM 3788 O O   . HOH D 3 .   ? 41.578 107.927 31.837 1.00 14.51  ? 294 HOH B O   1 
HETATM 3789 O O   . HOH D 3 .   ? 68.509 98.888  35.267 1.00 21.71  ? 295 HOH B O   1 
HETATM 3790 O O   . HOH D 3 .   ? 41.089 108.302 41.806 1.00 31.97  ? 296 HOH B O   1 
HETATM 3791 O O   . HOH D 3 .   ? 68.500 114.851 21.371 1.00 45.70  ? 297 HOH B O   1 
HETATM 3792 O O   . HOH D 3 .   ? 48.340 113.052 22.426 1.00 27.63  ? 298 HOH B O   1 
HETATM 3793 O O   . HOH D 3 .   ? 61.183 113.022 41.692 1.00 51.25  ? 299 HOH B O   1 
HETATM 3794 O O   . HOH D 3 .   ? 51.962 121.685 32.644 1.00 47.73  ? 300 HOH B O   1 
HETATM 3795 O O   . HOH D 3 .   ? 45.811 98.280  66.480 1.00 45.78  ? 301 HOH B O   1 
HETATM 3796 O O   . HOH D 3 .   ? 59.716 95.506  50.396 1.00 25.88  ? 302 HOH B O   1 
HETATM 3797 O O   . HOH D 3 .   ? 38.838 97.675  29.779 1.00 35.94  ? 303 HOH B O   1 
HETATM 3798 O O   . HOH D 3 .   ? 39.233 103.158 35.253 1.00 32.41  ? 304 HOH B O   1 
HETATM 3799 O O   . HOH D 3 .   ? 39.331 108.838 38.546 1.00 37.69  ? 305 HOH B O   1 
HETATM 3800 O O   . HOH D 3 .   ? 40.963 104.091 47.133 1.00 28.81  ? 306 HOH B O   1 
HETATM 3801 O O   . HOH D 3 .   ? 57.594 110.262 47.358 1.00 39.25  ? 307 HOH B O   1 
HETATM 3802 O O   . HOH D 3 .   ? 60.353 116.941 40.688 1.00 55.09  ? 308 HOH B O   1 
HETATM 3803 O O   . HOH D 3 .   ? 69.999 105.934 31.210 1.00 50.46  ? 309 HOH B O   1 
HETATM 3804 O O   . HOH D 3 .   ? 67.360 101.015 34.680 1.00 37.73  ? 310 HOH B O   1 
HETATM 3805 O O   . HOH D 3 .   ? 45.386 120.921 38.180 1.00 38.56  ? 311 HOH B O   1 
HETATM 3806 O O   . HOH D 3 .   ? 38.475 97.627  43.523 1.00 38.66  ? 312 HOH B O   1 
HETATM 3807 O O   . HOH D 3 .   ? 35.501 92.907  47.489 1.00 42.07  ? 313 HOH B O   1 
HETATM 3808 O O   . HOH D 3 .   ? 61.544 92.324  42.625 1.00 25.75  ? 314 HOH B O   1 
HETATM 3809 O O   . HOH D 3 .   ? 64.765 101.061 5.368  1.00 44.73  ? 315 HOH B O   1 
HETATM 3810 O O   . HOH D 3 .   ? 49.052 111.499 50.153 1.00 30.47  ? 316 HOH B O   1 
HETATM 3811 O O   . HOH D 3 .   ? 45.141 123.710 39.895 1.00 29.94  ? 317 HOH B O   1 
HETATM 3812 O O   . HOH D 3 .   ? 57.458 118.808 31.921 1.00 26.82  ? 318 HOH B O   1 
HETATM 3813 O O   . HOH D 3 .   ? 47.035 112.249 12.170 1.00 52.36  ? 319 HOH B O   1 
HETATM 3814 O O   . HOH D 3 .   ? 52.542 91.958  61.586 1.00 51.00  ? 320 HOH B O   1 
HETATM 3815 O O   . HOH D 3 .   ? 53.702 97.315  13.505 1.00 64.57  ? 321 HOH B O   1 
HETATM 3816 O O   . HOH D 3 .   ? 48.348 103.468 19.981 1.00 49.98  ? 322 HOH B O   1 
HETATM 3817 O O   . HOH D 3 .   ? 46.764 104.845 21.724 1.00 43.93  ? 323 HOH B O   1 
HETATM 3818 O O   . HOH D 3 .   ? 68.421 107.553 42.365 1.00 20.58  ? 324 HOH B O   1 
HETATM 3819 O O   . HOH D 3 .   ? 39.233 102.170 30.122 1.00 37.92  ? 325 HOH B O   1 
HETATM 3820 O O   . HOH D 3 .   ? 35.719 104.461 34.796 1.00 14.09  ? 326 HOH B O   1 
HETATM 3821 O O   . HOH D 3 .   ? 62.282 97.114  50.140 1.00 34.65  ? 327 HOH B O   1 
HETATM 3822 O O   . HOH D 3 .   ? 39.836 96.839  32.175 1.00 25.82  ? 328 HOH B O   1 
HETATM 3823 O O   . HOH D 3 .   ? 51.218 101.588 54.485 1.00 32.66  ? 329 HOH B O   1 
HETATM 3824 O O   . HOH D 3 .   ? 47.405 97.723  59.898 1.00 25.65  ? 330 HOH B O   1 
HETATM 3825 O O   . HOH D 3 .   ? 44.473 100.968 57.867 1.00 38.31  ? 331 HOH B O   1 
HETATM 3826 O O   . HOH D 3 .   ? 48.590 102.676 53.430 1.00 27.74  ? 332 HOH B O   1 
HETATM 3827 O O   . HOH D 3 .   ? 39.193 105.355 54.941 1.00 49.69  ? 333 HOH B O   1 
HETATM 3828 O O   . HOH D 3 .   ? 43.224 97.150  56.267 1.00 51.92  ? 334 HOH B O   1 
HETATM 3829 O O   . HOH D 3 .   ? 36.882 94.707  45.554 1.00 43.28  ? 335 HOH B O   1 
HETATM 3830 O O   . HOH D 3 .   ? 35.452 96.735  57.418 1.00 30.83  ? 336 HOH B O   1 
HETATM 3831 O O   . HOH D 3 .   ? 53.778 90.509  51.663 1.00 32.91  ? 337 HOH B O   1 
HETATM 3832 O O   . HOH D 3 .   ? 54.346 83.800  39.167 1.00 20.18  ? 338 HOH B O   1 
HETATM 3833 O O   . HOH D 3 .   ? 61.217 88.397  40.457 1.00 41.70  ? 339 HOH B O   1 
HETATM 3834 O O   . HOH D 3 .   ? 47.198 86.864  52.592 1.00 21.67  ? 340 HOH B O   1 
HETATM 3835 O O   . HOH D 3 .   ? 50.042 89.711  45.755 1.00 30.58  ? 341 HOH B O   1 
HETATM 3836 O O   . HOH D 3 .   ? 44.860 82.135  45.686 1.00 26.44  ? 342 HOH B O   1 
HETATM 3837 O O   . HOH D 3 .   ? 55.684 88.716  51.123 1.00 38.09  ? 343 HOH B O   1 
HETATM 3838 O O   . HOH D 3 .   ? 63.619 95.595  40.032 1.00 32.33  ? 344 HOH B O   1 
HETATM 3839 O O   . HOH D 3 .   ? 56.492 97.978  34.159 1.00 21.79  ? 345 HOH B O   1 
HETATM 3840 O O   . HOH D 3 .   ? 44.981 111.403 27.596 1.00 21.73  ? 346 HOH B O   1 
HETATM 3841 O O   . HOH D 3 .   ? 63.918 115.969 9.142  1.00 44.96  ? 347 HOH B O   1 
HETATM 3842 O O   . HOH D 3 .   ? 39.779 99.170  41.608 1.00 37.25  ? 348 HOH B O   1 
HETATM 3843 O O   . HOH D 3 .   ? 55.356 100.760 20.357 1.00 44.35  ? 349 HOH B O   1 
HETATM 3844 O O   . HOH D 3 .   ? 50.942 112.903 17.259 1.00 40.43  ? 350 HOH B O   1 
HETATM 3845 O O   . HOH D 3 .   ? 47.521 114.049 38.324 1.00 34.51  ? 351 HOH B O   1 
HETATM 3846 O O   . HOH D 3 .   ? 64.990 116.555 20.259 1.00 25.46  ? 352 HOH B O   1 
HETATM 3847 O O   . HOH D 3 .   ? 67.321 114.792 18.797 1.00 24.50  ? 353 HOH B O   1 
HETATM 3848 O O   . HOH D 3 .   ? 67.086 118.067 21.766 1.00 45.28  ? 354 HOH B O   1 
HETATM 3849 O O   . HOH D 3 .   ? 71.339 113.821 23.172 1.00 26.78  ? 355 HOH B O   1 
HETATM 3850 O O   . HOH D 3 .   ? 61.136 115.216 44.223 1.00 46.41  ? 356 HOH B O   1 
HETATM 3851 O O   . HOH D 3 .   ? 52.023 119.338 28.578 1.00 29.38  ? 357 HOH B O   1 
HETATM 3852 O O   . HOH D 3 .   ? 42.539 122.638 33.330 1.00 45.52  ? 358 HOH B O   1 
HETATM 3853 O O   . HOH D 3 .   ? 50.135 121.570 35.332 1.00 28.53  ? 359 HOH B O   1 
HETATM 3854 O O   . HOH D 3 .   ? 49.243 116.727 32.772 1.00 36.19  ? 360 HOH B O   1 
HETATM 3855 O O   . HOH D 3 .   ? 39.081 82.281  50.839 1.00 38.43  ? 361 HOH B O   1 
HETATM 3856 O O   . HOH D 3 .   ? 42.632 98.900  25.708 1.00 36.97  ? 362 HOH B O   1 
HETATM 3857 O O   . HOH D 3 .   ? 69.205 97.769  27.533 1.00 36.47  ? 363 HOH B O   1 
HETATM 3858 O O   . HOH D 3 .   ? 63.625 113.757 11.853 1.00 51.30  ? 364 HOH B O   1 
HETATM 3859 O O   . HOH D 3 .   ? 69.532 113.111 35.778 1.00 40.40  ? 365 HOH B O   1 
HETATM 3860 O O   . HOH D 3 .   ? 52.099 114.064 32.738 1.00 30.16  ? 366 HOH B O   1 
HETATM 3861 O O   . HOH D 3 .   ? 54.670 111.699 45.202 1.00 43.73  ? 367 HOH B O   1 
HETATM 3862 O O   . HOH D 3 .   ? 44.250 122.410 36.004 1.00 51.11  ? 368 HOH B O   1 
HETATM 3863 O O   . HOH D 3 .   ? 54.625 96.449  35.566 1.00 24.31  ? 369 HOH B O   1 
HETATM 3864 O O   . HOH D 3 .   ? 53.692 105.768 57.380 1.00 33.77  ? 370 HOH B O   1 
HETATM 3865 O O   . HOH D 3 .   ? 46.717 115.657 42.513 1.00 54.49  ? 371 HOH B O   1 
HETATM 3866 O O   . HOH D 3 .   ? 46.665 102.569 60.177 1.00 35.03  ? 372 HOH B O   1 
HETATM 3867 O O   . HOH D 3 .   ? 47.931 100.049 60.968 1.00 35.86  ? 373 HOH B O   1 
HETATM 3868 O O   . HOH D 3 .   ? 48.883 104.650 58.126 1.00 40.36  ? 374 HOH B O   1 
HETATM 3869 O O   . HOH D 3 .   ? 45.101 103.151 56.568 1.00 31.25  ? 375 HOH B O   1 
HETATM 3870 O O   . HOH D 3 .   ? 37.981 108.248 49.479 1.00 50.35  ? 376 HOH B O   1 
HETATM 3871 O O   . HOH D 3 .   ? 37.186 95.647  35.483 1.00 31.63  ? 377 HOH B O   1 
HETATM 3872 O O   . HOH D 3 .   ? 53.626 118.287 44.546 1.00 34.97  ? 378 HOH B O   1 
HETATM 3873 O O   . HOH D 3 .   ? 71.028 117.400 30.867 1.00 36.67  ? 379 HOH B O   1 
HETATM 3874 O O   . HOH D 3 .   ? 63.235 94.245  46.077 1.00 48.74  ? 380 HOH B O   1 
HETATM 3875 O O   . HOH D 3 .   ? 63.703 91.664  46.955 1.00 34.88  ? 381 HOH B O   1 
HETATM 3876 O O   . HOH D 3 .   ? 43.840 114.858 19.613 1.00 38.35  ? 382 HOH B O   1 
HETATM 3877 O O   . HOH D 3 .   ? 45.392 100.224 26.440 1.00 54.10  ? 383 HOH B O   1 
HETATM 3878 O O   . HOH D 3 .   ? 42.745 110.208 49.047 1.00 33.63  ? 384 HOH B O   1 
HETATM 3879 O O   . HOH D 3 .   ? 34.920 104.095 42.707 1.00 41.07  ? 385 HOH B O   1 
HETATM 3880 O O   . HOH D 3 .   ? 42.479 116.702 33.311 1.00 34.58  ? 386 HOH B O   1 
HETATM 3881 O O   . HOH D 3 .   ? 32.088 101.729 41.932 1.00 35.99  ? 387 HOH B O   1 
HETATM 3882 O O   . HOH D 3 .   ? 29.235 101.593 40.176 1.00 41.27  ? 388 HOH B O   1 
HETATM 3883 O O   . HOH D 3 .   ? 45.815 101.663 24.490 1.00 39.91  ? 389 HOH B O   1 
HETATM 3884 O O   . HOH D 3 .   ? 62.231 105.450 3.650  1.00 46.94  ? 390 HOH B O   1 
HETATM 3885 O O   . HOH D 3 .   ? 73.255 102.498 20.824 1.00 32.84  ? 391 HOH B O   1 
HETATM 3886 O O   . HOH D 3 .   ? 66.347 118.907 24.240 1.00 52.36  ? 392 HOH B O   1 
HETATM 3887 O O   . HOH D 3 .   ? 58.484 119.433 34.842 1.00 26.18  ? 393 HOH B O   1 
HETATM 3888 O O   . HOH D 3 .   ? 55.243 120.398 30.513 1.00 42.68  ? 394 HOH B O   1 
HETATM 3889 O O   . HOH D 3 .   ? 43.297 101.891 22.888 1.00 56.50  ? 395 HOH B O   1 
HETATM 3890 O O   . HOH D 3 .   ? 64.104 113.809 42.195 1.00 29.23  ? 396 HOH B O   1 
HETATM 3891 O O   . HOH D 3 .   ? 48.044 120.587 37.219 1.00 28.82  ? 397 HOH B O   1 
HETATM 3892 O O   . HOH D 3 .   ? 66.198 105.283 41.438 1.00 41.86  ? 398 HOH B O   1 
HETATM 3893 O O   . HOH D 3 .   ? 58.396 93.279  40.784 1.00 32.68  ? 399 HOH B O   1 
HETATM 3894 O O   . HOH D 3 .   ? 43.786 105.435 57.196 1.00 36.45  ? 400 HOH B O   1 
HETATM 3895 O O   . HOH D 3 .   ? 33.001 98.113  35.358 1.00 35.41  ? 401 HOH B O   1 
HETATM 3896 O O   . HOH D 3 .   ? 60.334 91.654  49.650 1.00 30.94  ? 402 HOH B O   1 
HETATM 3897 O O   . HOH D 3 .   ? 59.946 117.388 31.536 1.00 40.98  ? 403 HOH B O   1 
HETATM 3898 O O   . HOH D 3 .   ? 57.898 98.796  32.315 1.00 26.23  ? 404 HOH B O   1 
HETATM 3899 O O   . HOH D 3 .   ? 37.714 105.977 50.858 1.00 50.66  ? 405 HOH B O   1 
HETATM 3900 O O   . HOH D 3 .   ? 37.189 105.125 48.533 1.00 55.99  ? 406 HOH B O   1 
HETATM 3901 O O   . HOH D 3 .   ? 62.515 89.631  46.345 1.00 50.38  ? 407 HOH B O   1 
HETATM 3902 O O   . HOH D 3 .   ? 72.292 106.935 37.755 1.00 38.60  ? 408 HOH B O   1 
HETATM 3903 O O   . HOH D 3 .   ? 41.838 95.348  29.448 1.00 58.60  ? 409 HOH B O   1 
HETATM 3904 O O   . HOH D 3 .   ? 70.825 100.115 35.300 1.00 47.29  ? 410 HOH B O   1 
HETATM 3905 O O   . HOH D 3 .   ? 58.720 114.089 39.843 1.00 25.25  ? 411 HOH B O   1 
HETATM 3906 O O   . HOH D 3 .   ? 41.562 115.557 29.774 1.00 38.35  ? 412 HOH B O   1 
HETATM 3907 O O   . HOH D 3 .   ? 38.346 111.437 30.648 1.00 42.79  ? 413 HOH B O   1 
HETATM 3908 O O   . HOH D 3 .   ? 44.298 109.205 43.007 1.00 57.06  ? 414 HOH B O   1 
HETATM 3909 O O   . HOH D 3 .   ? 41.440 110.672 45.901 1.00 54.79  ? 415 HOH B O   1 
HETATM 3910 O O   . HOH D 3 .   ? 44.874 97.593  29.180 1.00 34.12  ? 416 HOH B O   1 
HETATM 3911 O O   . HOH D 3 .   ? 40.366 84.056  59.656 1.00 39.99  ? 417 HOH B O   1 
HETATM 3912 O O   . HOH D 3 .   ? 50.682 120.060 16.248 1.00 46.43  ? 418 HOH B O   1 
HETATM 3913 O O   . HOH D 3 .   ? 64.919 88.004  31.417 1.00 57.54  ? 419 HOH B O   1 
HETATM 3914 O O   . HOH D 3 .   ? 58.324 86.900  44.235 1.00 39.27  ? 420 HOH B O   1 
HETATM 3915 O O   . HOH D 3 .   ? 63.203 116.824 44.605 1.00 53.53  ? 421 HOH B O   1 
HETATM 3916 O O   . HOH D 3 .   ? 36.631 103.397 28.937 1.00 41.81  ? 422 HOH B O   1 
HETATM 3917 O O   . HOH D 3 .   ? 29.404 104.951 39.354 1.00 34.68  ? 423 HOH B O   1 
HETATM 3918 O O   . HOH D 3 .   ? 71.213 111.337 14.499 1.00 39.49  ? 424 HOH B O   1 
HETATM 3919 O O   . HOH D 3 .   ? 45.347 91.907  68.596 1.00 43.16  ? 425 HOH B O   1 
HETATM 3920 O O   . HOH D 3 .   ? 48.142 90.158  67.092 1.00 38.63  ? 426 HOH B O   1 
HETATM 3921 O O   . HOH D 3 .   ? 66.967 97.334  30.244 1.00 30.66  ? 427 HOH B O   1 
HETATM 3922 O O   . HOH D 3 .   ? 54.417 117.002 7.300  1.00 35.32  ? 428 HOH B O   1 
HETATM 3923 O O   . HOH D 3 .   ? 67.748 97.781  10.710 1.00 45.10  ? 429 HOH B O   1 
HETATM 3924 O O   . HOH D 3 .   ? 32.665 106.773 39.416 1.00 32.69  ? 430 HOH B O   1 
HETATM 3925 O O   . HOH D 3 .   ? 46.676 106.383 54.027 1.00 40.18  ? 431 HOH B O   1 
HETATM 3926 O O   . HOH D 3 .   ? 54.642 116.474 45.491 1.00 34.98  ? 432 HOH B O   1 
HETATM 3927 O O   . HOH D 3 .   ? 71.073 110.835 37.661 1.00 52.34  ? 433 HOH B O   1 
HETATM 3928 O O   . HOH D 3 .   ? 55.634 95.745  60.058 1.00 44.21  ? 434 HOH B O   1 
HETATM 3929 O O   . HOH D 3 .   ? 37.840 100.892 60.629 1.00 53.26  ? 435 HOH B O   1 
HETATM 3930 O O   . HOH D 3 .   ? 50.497 107.786 49.647 1.00 45.44  ? 436 HOH B O   1 
HETATM 3931 O O   . HOH D 3 .   ? 44.006 109.286 52.672 1.00 49.20  ? 437 HOH B O   1 
HETATM 3932 O O   . HOH D 3 .   ? 46.992 99.971  23.039 1.00 45.44  ? 438 HOH B O   1 
HETATM 3933 O O   . HOH D 3 .   ? 63.425 116.377 11.968 1.00 37.47  ? 439 HOH B O   1 
HETATM 3934 O O   . HOH D 3 .   ? 51.840 115.017 15.774 1.00 75.03  ? 440 HOH B O   1 
HETATM 3935 O O   . HOH D 3 .   ? 45.437 114.762 13.033 1.00 35.13  ? 441 HOH B O   1 
HETATM 3936 O O   . HOH D 3 .   ? 51.386 123.282 31.300 1.00 62.92  ? 442 HOH B O   1 
HETATM 3937 O O   . HOH D 3 .   ? 40.385 114.820 43.403 1.00 56.01  ? 443 HOH B O   1 
HETATM 3938 O O   . HOH D 3 .   ? 59.831 120.750 30.853 1.00 64.03  ? 444 HOH B O   1 
HETATM 3939 O O   . HOH D 3 .   ? 50.210 106.016 7.562  1.00 40.58  ? 445 HOH B O   1 
HETATM 3940 O O   . HOH D 3 .   ? 56.744 95.161  16.540 1.00 47.06  ? 446 HOH B O   1 
HETATM 3941 O O   . HOH D 3 .   ? 60.005 97.093  13.567 1.00 39.16  ? 447 HOH B O   1 
HETATM 3942 O O   . HOH D 3 .   ? 38.194 101.190 42.083 1.00 45.50  ? 448 HOH B O   1 
HETATM 3943 O O   . HOH D 3 .   ? 43.987 110.469 45.976 1.00 42.70  ? 449 HOH B O   1 
HETATM 3944 O O   . HOH D 3 .   ? 44.114 106.911 54.283 1.00 48.57  ? 450 HOH B O   1 
HETATM 3945 O O   . HOH D 3 .   ? 46.713 109.554 52.628 1.00 75.49  ? 451 HOH B O   1 
HETATM 3946 O O   . HOH D 3 .   ? 51.881 117.328 14.586 1.00 46.49  ? 452 HOH B O   1 
HETATM 3947 O O   . HOH D 3 .   ? 48.854 107.438 4.774  1.00 61.36  ? 453 HOH B O   1 
HETATM 3948 O O   . HOH D 3 .   ? 71.426 98.007  13.982 1.00 48.66  ? 454 HOH B O   1 
HETATM 3949 O O   . HOH D 3 .   ? 65.039 96.158  17.052 1.00 52.37  ? 455 HOH B O   1 
HETATM 3950 O O   . HOH D 3 .   ? 48.918 108.327 53.116 1.00 77.97  ? 456 HOH B O   1 
HETATM 3951 O O   . HOH D 3 .   ? 47.084 104.318 55.518 1.00 51.57  ? 457 HOH B O   1 
HETATM 3952 O O   . HOH D 3 .   ? 42.258 80.900  42.083 1.00 51.14  ? 458 HOH B O   1 
HETATM 3953 O O   . HOH D 3 .   ? 55.882 85.452  47.292 1.00 42.66  ? 459 HOH B O   1 
HETATM 3954 O O   . HOH D 3 .   ? 67.416 87.191  27.998 1.00 44.69  ? 460 HOH B O   1 
HETATM 3955 O O   . HOH D 3 .   ? 33.701 91.304  48.627 1.00 47.31  ? 461 HOH B O   1 
HETATM 3956 O O   . HOH D 3 .   ? 48.167 115.066 13.795 1.00 44.45  ? 462 HOH B O   1 
HETATM 3957 O O   . HOH D 3 .   ? 47.263 82.126  38.387 1.00 41.34  ? 463 HOH B O   1 
HETATM 3958 O O   . HOH D 3 .   ? 57.297 117.766 36.463 1.00 73.64  ? 464 HOH B O   1 
HETATM 3959 O O   . HOH D 3 .   ? 47.149 79.741  52.772 1.00 36.97  ? 465 HOH B O   1 
HETATM 3960 O O   . HOH D 3 .   ? 50.112 118.902 35.081 1.00 49.29  ? 466 HOH B O   1 
HETATM 3961 O O   . HOH D 3 .   ? 59.066 97.041  34.076 1.00 41.11  ? 467 HOH B O   1 
HETATM 3962 O O   . HOH D 3 .   ? 44.413 104.213 21.029 1.00 54.26  ? 468 HOH B O   1 
HETATM 3963 O O   . HOH D 3 .   ? 52.743 116.032 5.469  1.00 53.42  ? 469 HOH B O   1 
HETATM 3964 O O   . HOH D 3 .   ? 37.407 83.683  46.367 1.00 47.19  ? 470 HOH B O   1 
HETATM 3965 O O   . HOH D 3 .   ? 47.655 108.375 12.574 1.00 40.27  ? 471 HOH B O   1 
HETATM 3966 O O   . HOH D 3 .   ? 42.409 117.121 27.679 1.00 48.08  ? 472 HOH B O   1 
HETATM 3967 O O   . HOH D 3 .   ? 45.334 95.938  67.164 1.00 59.02  ? 473 HOH B O   1 
HETATM 3968 O O   . HOH D 3 .   ? 34.762 102.614 49.373 1.00 48.40  ? 474 HOH B O   1 
HETATM 3969 O O   . HOH D 3 .   ? 53.691 112.950 47.567 1.00 72.60  ? 475 HOH B O   1 
HETATM 3970 O O   . HOH D 3 .   ? 76.188 102.773 23.791 1.00 49.62  ? 476 HOH B O   1 
HETATM 3971 O O   . HOH D 3 .   ? 49.381 117.723 13.684 1.00 48.29  ? 477 HOH B O   1 
HETATM 3972 O O   . HOH D 3 .   ? 58.160 107.342 53.767 1.00 32.49  ? 478 HOH B O   1 
HETATM 3973 O O   . HOH D 3 .   ? 45.595 115.478 39.445 1.00 45.64  ? 479 HOH B O   1 
HETATM 3974 O O   . HOH D 3 .   ? 50.353 123.026 23.996 1.00 46.25  ? 480 HOH B O   1 
HETATM 3975 O O   . HOH D 3 .   ? 41.286 114.582 32.368 1.00 51.40  ? 481 HOH B O   1 
HETATM 3976 O O   . HOH D 3 .   ? 42.022 116.975 36.022 1.00 69.66  ? 482 HOH B O   1 
HETATM 3977 O O   . HOH D 3 .   ? 47.475 103.250 11.800 1.00 50.50  ? 483 HOH B O   1 
HETATM 3978 O O   . HOH D 3 .   ? 48.943 86.636  65.070 1.00 59.96  ? 484 HOH B O   1 
HETATM 3979 O O   . HOH D 3 .   ? 49.394 89.747  64.837 1.00 55.64  ? 485 HOH B O   1 
HETATM 3980 O O   . HOH D 3 .   ? 36.463 94.142  37.345 1.00 43.42  ? 486 HOH B O   1 
HETATM 3981 O O   . HOH D 3 .   ? 34.532 87.120  53.745 1.00 70.13  ? 487 HOH B O   1 
HETATM 3982 O O   . HOH D 3 .   ? 37.162 89.464  64.299 1.00 48.33  ? 488 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   496 ?   ?   ?   A . n 
A 1 2   GLU 2   497 ?   ?   ?   A . n 
A 1 3   ASP 3   498 ?   ?   ?   A . n 
A 1 4   ILE 4   499 ?   ?   ?   A . n 
A 1 5   SER 5   500 ?   ?   ?   A . n 
A 1 6   GLU 6   501 ?   ?   ?   A . n 
A 1 7   PRO 7   502 ?   ?   ?   A . n 
A 1 8   PRO 8   503 ?   ?   ?   A . n 
A 1 9   LEU 9   504 ?   ?   ?   A . n 
A 1 10  HIS 10  505 ?   ?   ?   A . n 
A 1 11  ASP 11  506 506 ASP ASP A . n 
A 1 12  PHE 12  507 507 PHE PHE A . n 
A 1 13  TYR 13  508 508 TYR TYR A . n 
A 1 14  CYS 14  509 509 CYS CYS A . n 
A 1 15  SER 15  510 510 SER SER A . n 
A 1 16  ARG 16  511 511 ARG ARG A . n 
A 1 17  LEU 17  512 512 LEU LEU A . n 
A 1 18  LEU 18  513 513 LEU LEU A . n 
A 1 19  ASP 19  514 514 ASP ASP A . n 
A 1 20  LEU 20  515 515 LEU LEU A . n 
A 1 21  VAL 21  516 516 VAL VAL A . n 
A 1 22  PHE 22  517 517 PHE PHE A . n 
A 1 23  LEU 23  518 518 LEU LEU A . n 
A 1 24  LEU 24  519 519 LEU LEU A . n 
A 1 25  ASP 25  520 520 ASP ASP A . n 
A 1 26  GLY 26  521 521 GLY GLY A . n 
A 1 27  SER 27  522 522 SER SER A . n 
A 1 28  SER 28  523 523 SER SER A . n 
A 1 29  ARG 29  524 524 ARG ARG A . n 
A 1 30  LEU 30  525 525 LEU LEU A . n 
A 1 31  SER 31  526 526 SER SER A . n 
A 1 32  GLU 32  527 527 GLU GLU A . n 
A 1 33  ALA 33  528 528 ALA ALA A . n 
A 1 34  GLU 34  529 529 GLU GLU A . n 
A 1 35  PHE 35  530 530 PHE PHE A . n 
A 1 36  GLU 36  531 531 GLU GLU A . n 
A 1 37  VAL 37  532 532 VAL VAL A . n 
A 1 38  LEU 38  533 533 LEU LEU A . n 
A 1 39  LYS 39  534 534 LYS LYS A . n 
A 1 40  ALA 40  535 535 ALA ALA A . n 
A 1 41  PHE 41  536 536 PHE PHE A . n 
A 1 42  VAL 42  537 537 VAL VAL A . n 
A 1 43  VAL 43  538 538 VAL VAL A . n 
A 1 44  ASP 44  539 539 ASP ASP A . n 
A 1 45  MET 45  540 540 MET MET A . n 
A 1 46  MET 46  541 541 MET MET A . n 
A 1 47  GLU 47  542 542 GLU GLU A . n 
A 1 48  ARG 48  543 543 ARG ARG A . n 
A 1 49  LEU 49  544 544 LEU LEU A . n 
A 1 50  ARG 50  545 545 ARG ARG A . n 
A 1 51  ILE 51  546 546 ILE ILE A . n 
A 1 52  SER 52  547 547 SER SER A . n 
A 1 53  GLN 53  548 548 GLN GLN A . n 
A 1 54  LYS 54  549 549 LYS LYS A . n 
A 1 55  TRP 55  550 550 TRP TRP A . n 
A 1 56  VAL 56  551 551 VAL VAL A . n 
A 1 57  ARG 57  552 552 ARG ARG A . n 
A 1 58  VAL 58  553 553 VAL VAL A . n 
A 1 59  ALA 59  554 554 ALA ALA A . n 
A 1 60  VAL 60  555 555 VAL VAL A . n 
A 1 61  VAL 61  556 556 VAL VAL A . n 
A 1 62  GLU 62  557 557 GLU GLU A . n 
A 1 63  TYR 63  558 558 TYR TYR A . n 
A 1 64  HIS 64  559 559 HIS HIS A . n 
A 1 65  ASP 65  560 560 ASP ASP A . n 
A 1 66  GLY 66  561 561 GLY GLY A . n 
A 1 67  SER 67  562 562 SER SER A . n 
A 1 68  HIS 68  563 563 HIS HIS A . n 
A 1 69  ALA 69  564 564 ALA ALA A . n 
A 1 70  TYR 70  565 565 TYR TYR A . n 
A 1 71  ILE 71  566 566 ILE ILE A . n 
A 1 72  GLY 72  567 567 GLY GLY A . n 
A 1 73  LEU 73  568 568 LEU LEU A . n 
A 1 74  LYS 74  569 569 LYS LYS A . n 
A 1 75  ASP 75  570 570 ASP ASP A . n 
A 1 76  ARG 76  571 571 ARG ARG A . n 
A 1 77  LYS 77  572 572 LYS LYS A . n 
A 1 78  ARG 78  573 573 ARG ARG A . n 
A 1 79  PRO 79  574 574 PRO PRO A . n 
A 1 80  SER 80  575 575 SER SER A . n 
A 1 81  GLU 81  576 576 GLU GLU A . n 
A 1 82  LEU 82  577 577 LEU LEU A . n 
A 1 83  ARG 83  578 578 ARG ARG A . n 
A 1 84  ARG 84  579 579 ARG ARG A . n 
A 1 85  ILE 85  580 580 ILE ILE A . n 
A 1 86  ALA 86  581 581 ALA ALA A . n 
A 1 87  SER 87  582 582 SER SER A . n 
A 1 88  GLN 88  583 583 GLN GLN A . n 
A 1 89  VAL 89  584 584 VAL VAL A . n 
A 1 90  LYS 90  585 585 LYS LYS A . n 
A 1 91  TYR 91  586 586 TYR TYR A . n 
A 1 92  ALA 92  587 587 ALA ALA A . n 
A 1 93  GLY 93  588 588 GLY GLY A . n 
A 1 94  SER 94  589 589 SER SER A . n 
A 1 95  GLN 95  590 590 GLN GLN A . n 
A 1 96  VAL 96  591 591 VAL VAL A . n 
A 1 97  ALA 97  592 592 ALA ALA A . n 
A 1 98  SER 98  593 593 SER SER A . n 
A 1 99  THR 99  594 594 THR THR A . n 
A 1 100 SER 100 595 595 SER SER A . n 
A 1 101 GLU 101 596 596 GLU GLU A . n 
A 1 102 VAL 102 597 597 VAL VAL A . n 
A 1 103 LEU 103 598 598 LEU LEU A . n 
A 1 104 LYS 104 599 599 LYS LYS A . n 
A 1 105 TYR 105 600 600 TYR TYR A . n 
A 1 106 THR 106 601 601 THR THR A . n 
A 1 107 LEU 107 602 602 LEU LEU A . n 
A 1 108 PHE 108 603 603 PHE PHE A . n 
A 1 109 GLN 109 604 604 GLN GLN A . n 
A 1 110 ILE 110 605 605 ILE ILE A . n 
A 1 111 PHE 111 606 606 PHE PHE A . n 
A 1 112 SER 112 607 607 SER SER A . n 
A 1 113 LYS 113 608 608 LYS LYS A . n 
A 1 114 ILE 114 609 609 ILE ILE A . n 
A 1 115 ASP 115 610 610 ASP ASP A . n 
A 1 116 ARG 116 611 611 ARG ARG A . n 
A 1 117 PRO 117 612 612 PRO PRO A . n 
A 1 118 GLU 118 613 613 GLU GLU A . n 
A 1 119 ALA 119 614 614 ALA ALA A . n 
A 1 120 SER 120 615 615 SER SER A . n 
A 1 121 ARG 121 616 616 ARG ARG A . n 
A 1 122 ILE 122 617 617 ILE ILE A . n 
A 1 123 ALA 123 618 618 ALA ALA A . n 
A 1 124 LEU 124 619 619 LEU LEU A . n 
A 1 125 LEU 125 620 620 LEU LEU A . n 
A 1 126 LEU 126 621 621 LEU LEU A . n 
A 1 127 MET 127 622 622 MET MET A . n 
A 1 128 ALA 128 623 623 ALA ALA A . n 
A 1 129 SER 129 624 624 SER SER A . n 
A 1 130 GLN 130 625 625 GLN GLN A . n 
A 1 131 GLU 131 626 626 GLU GLU A . n 
A 1 132 PRO 132 627 627 PRO PRO A . n 
A 1 133 GLN 133 628 628 GLN GLN A . n 
A 1 134 ARG 134 629 629 ARG ARG A . n 
A 1 135 MET 135 630 630 MET MET A . n 
A 1 136 SER 136 631 631 SER SER A . n 
A 1 137 ARG 137 632 632 ARG ARG A . n 
A 1 138 ASN 138 633 633 ASN ASN A . n 
A 1 139 PHE 139 634 634 PHE PHE A . n 
A 1 140 VAL 140 635 635 VAL VAL A . n 
A 1 141 ARG 141 636 636 ARG ARG A . n 
A 1 142 TYR 142 637 637 TYR TYR A . n 
A 1 143 VAL 143 638 638 VAL VAL A . n 
A 1 144 GLN 144 639 639 GLN GLN A . n 
A 1 145 GLY 145 640 640 GLY GLY A . n 
A 1 146 LEU 146 641 641 LEU LEU A . n 
A 1 147 LYS 147 642 642 LYS LYS A . n 
A 1 148 LYS 148 643 643 LYS LYS A . n 
A 1 149 LYS 149 644 644 LYS LYS A . n 
A 1 150 LYS 150 645 645 LYS LYS A . n 
A 1 151 VAL 151 646 646 VAL VAL A . n 
A 1 152 ILE 152 647 647 ILE ILE A . n 
A 1 153 VAL 153 648 648 VAL VAL A . n 
A 1 154 ILE 154 649 649 ILE ILE A . n 
A 1 155 PRO 155 650 650 PRO PRO A . n 
A 1 156 VAL 156 651 651 VAL VAL A . n 
A 1 157 GLY 157 652 652 GLY GLY A . n 
A 1 158 ILE 158 653 653 ILE ILE A . n 
A 1 159 GLY 159 654 654 GLY GLY A . n 
A 1 160 PRO 160 655 655 PRO PRO A . n 
A 1 161 HIS 161 656 656 HIS HIS A . n 
A 1 162 ALA 162 657 657 ALA ALA A . n 
A 1 163 ASN 163 658 658 ASN ASN A . n 
A 1 164 LEU 164 659 659 LEU LEU A . n 
A 1 165 LYS 165 660 660 LYS LYS A . n 
A 1 166 GLN 166 661 661 GLN GLN A . n 
A 1 167 ILE 167 662 662 ILE ILE A . n 
A 1 168 ARG 168 663 663 ARG ARG A . n 
A 1 169 LEU 169 664 664 LEU LEU A . n 
A 1 170 ILE 170 665 665 ILE ILE A . n 
A 1 171 GLU 171 666 666 GLU GLU A . n 
A 1 172 LYS 172 667 667 LYS LYS A . n 
A 1 173 GLN 173 668 668 GLN GLN A . n 
A 1 174 ALA 174 669 669 ALA ALA A . n 
A 1 175 PRO 175 670 670 PRO PRO A . n 
A 1 176 GLU 176 671 671 GLU GLU A . n 
A 1 177 ASN 177 672 672 ASN ASN A . n 
A 1 178 LYS 178 673 673 LYS LYS A . n 
A 1 179 ALA 179 674 674 ALA ALA A . n 
A 1 180 PHE 180 675 675 PHE PHE A . n 
A 1 181 VAL 181 676 676 VAL VAL A . n 
A 1 182 LEU 182 677 677 LEU LEU A . n 
A 1 183 SER 183 678 678 SER SER A . n 
A 1 184 SER 184 679 679 SER SER A . n 
A 1 185 VAL 185 680 680 VAL VAL A . n 
A 1 186 ASP 186 681 681 ASP ASP A . n 
A 1 187 GLU 187 682 682 GLU GLU A . n 
A 1 188 LEU 188 683 683 LEU LEU A . n 
A 1 189 GLU 189 684 684 GLU GLU A . n 
A 1 190 GLN 190 685 685 GLN GLN A . n 
A 1 191 GLN 191 686 686 GLN GLN A . n 
A 1 192 ARG 192 687 687 ARG ARG A . n 
A 1 193 ASP 193 688 688 ASP ASP A . n 
A 1 194 GLU 194 689 689 GLU GLU A . n 
A 1 195 ILE 195 690 690 ILE ILE A . n 
A 1 196 VAL 196 691 691 VAL VAL A . n 
A 1 197 SER 197 692 692 SER SER A . n 
A 1 198 TYR 198 693 693 TYR TYR A . n 
A 1 199 LEU 199 694 694 LEU LEU A . n 
A 1 200 CYS 200 695 695 CYS CYS A . n 
A 1 201 ASP 201 696 696 ASP ASP A . n 
A 1 202 LEU 202 697 697 LEU LEU A . n 
A 1 203 ALA 203 698 698 ALA ALA A . n 
A 1 204 PRO 204 699 699 PRO PRO A . n 
A 1 205 GLU 205 700 700 GLU GLU A . n 
A 1 206 ALA 206 701 701 ALA ALA A . n 
A 1 207 PRO 207 702 702 PRO PRO A . n 
A 1 208 PRO 208 703 703 PRO PRO A . n 
A 1 209 PRO 209 704 ?   ?   ?   A . n 
A 1 210 THR 210 705 ?   ?   ?   A . n 
A 1 211 LEU 211 706 ?   ?   ?   A . n 
A 1 212 PRO 212 707 ?   ?   ?   A . n 
A 1 213 PRO 213 708 ?   ?   ?   A . n 
A 1 214 HIS 214 709 ?   ?   ?   A . n 
B 2 1   HIS 1   1   1   HIS HIS B . n 
B 2 2   PRO 2   2   2   PRO PRO B . n 
B 2 3   ILE 3   3   3   ILE ILE B . n 
B 2 4   CYS 4   4   4   CYS CYS B . n 
B 2 5   GLU 5   5   5   GLU GLU B . n 
B 2 6   VAL 6   6   6   VAL VAL B . n 
B 2 7   SER 7   7   7   SER SER B . n 
B 2 8   LYS 8   8   8   LYS LYS B . n 
B 2 9   VAL 9   9   9   VAL VAL B . n 
B 2 10  ALA 10  10  10  ALA ALA B . n 
B 2 11  SER 11  11  11  SER SER B . n 
B 2 12  HIS 12  12  12  HIS HIS B . n 
B 2 13  LEU 13  13  13  LEU LEU B . n 
B 2 14  GLU 14  14  14  GLU GLU B . n 
B 2 15  VAL 15  15  15  VAL VAL B . n 
B 2 16  ASN 16  16  16  ASN ASN B . n 
B 2 17  CYS 17  17  17  CYS CYS B . n 
B 2 18  ASP 18  18  18  ASP ASP B . n 
B 2 19  LYS 19  19  19  LYS LYS B . n 
B 2 20  ARG 20  20  20  ARG ARG B . n 
B 2 21  ASP 21  21  21  ASP ASP B . n 
B 2 22  LEU 22  22  22  LEU LEU B . n 
B 2 23  THR 23  23  23  THR THR B . n 
B 2 24  ALA 24  24  24  ALA ALA B . n 
B 2 25  LEU 25  25  25  LEU LEU B . n 
B 2 26  PRO 26  26  26  PRO PRO B . n 
B 2 27  PRO 27  27  27  PRO PRO B . n 
B 2 28  ASP 28  28  28  ASP ASP B . n 
B 2 29  LEU 29  29  29  LEU LEU B . n 
B 2 30  PRO 30  30  30  PRO PRO B . n 
B 2 31  LYS 31  31  31  LYS LYS B . n 
B 2 32  ASP 32  32  32  ASP ASP B . n 
B 2 33  THR 33  33  33  THR THR B . n 
B 2 34  THR 34  34  34  THR THR B . n 
B 2 35  ILE 35  35  35  ILE ILE B . n 
B 2 36  LEU 36  36  36  LEU LEU B . n 
B 2 37  HIS 37  37  37  HIS HIS B . n 
B 2 38  LEU 38  38  38  LEU LEU B . n 
B 2 39  SER 39  39  39  SER SER B . n 
B 2 40  GLU 40  40  40  GLU GLU B . n 
B 2 41  ASN 41  41  41  ASN ASN B . n 
B 2 42  LEU 42  42  42  LEU LEU B . n 
B 2 43  LEU 43  43  43  LEU LEU B . n 
B 2 44  TYR 44  44  44  TYR TYR B . n 
B 2 45  THR 45  45  45  THR THR B . n 
B 2 46  PHE 46  46  46  PHE PHE B . n 
B 2 47  SER 47  47  47  SER SER B . n 
B 2 48  LEU 48  48  48  LEU LEU B . n 
B 2 49  ALA 49  49  49  ALA ALA B . n 
B 2 50  THR 50  50  50  THR THR B . n 
B 2 51  LEU 51  51  51  LEU LEU B . n 
B 2 52  MET 52  52  52  MET MET B . n 
B 2 53  PRO 53  53  53  PRO PRO B . n 
B 2 54  TYR 54  54  54  TYR TYR B . n 
B 2 55  THR 55  55  55  THR THR B . n 
B 2 56  ARG 56  56  56  ARG ARG B . n 
B 2 57  LEU 57  57  57  LEU LEU B . n 
B 2 58  THR 58  58  58  THR THR B . n 
B 2 59  GLN 59  59  59  GLN GLN B . n 
B 2 60  LEU 60  60  60  LEU LEU B . n 
B 2 61  ASN 61  61  61  ASN ASN B . n 
B 2 62  LEU 62  62  62  LEU LEU B . n 
B 2 63  ASP 63  63  63  ASP ASP B . n 
B 2 64  ARG 64  64  64  ARG ARG B . n 
B 2 65  CYS 65  65  65  CYS CYS B . n 
B 2 66  GLU 66  66  66  GLU GLU B . n 
B 2 67  LEU 67  67  67  LEU LEU B . n 
B 2 68  THR 68  68  68  THR THR B . n 
B 2 69  LYS 69  69  69  LYS LYS B . n 
B 2 70  LEU 70  70  70  LEU LEU B . n 
B 2 71  GLN 71  71  71  GLN GLN B . n 
B 2 72  VAL 72  72  72  VAL VAL B . n 
B 2 73  ASP 73  73  73  ASP ASP B . n 
B 2 74  GLY 74  74  74  GLY GLY B . n 
B 2 75  THR 75  75  75  THR THR B . n 
B 2 76  LEU 76  76  76  LEU LEU B . n 
B 2 77  PRO 77  77  77  PRO PRO B . n 
B 2 78  VAL 78  78  78  VAL VAL B . n 
B 2 79  LEU 79  79  79  LEU LEU B . n 
B 2 80  GLY 80  80  80  GLY GLY B . n 
B 2 81  THR 81  81  81  THR THR B . n 
B 2 82  LEU 82  82  82  LEU LEU B . n 
B 2 83  ASP 83  83  83  ASP ASP B . n 
B 2 84  LEU 84  84  84  LEU LEU B . n 
B 2 85  SER 85  85  85  SER SER B . n 
B 2 86  HIS 86  86  86  HIS HIS B . n 
B 2 87  ASN 87  87  87  ASN ASN B . n 
B 2 88  GLN 88  88  88  GLN GLN B . n 
B 2 89  LEU 89  89  89  LEU LEU B . n 
B 2 90  GLN 90  90  90  GLN GLN B . n 
B 2 91  SER 91  91  91  SER SER B . n 
B 2 92  LEU 92  92  92  LEU LEU B . n 
B 2 93  PRO 93  93  93  PRO PRO B . n 
B 2 94  LEU 94  94  94  LEU LEU B . n 
B 2 95  LEU 95  95  95  LEU LEU B . n 
B 2 96  GLY 96  96  96  GLY GLY B . n 
B 2 97  GLN 97  97  97  GLN GLN B . n 
B 2 98  THR 98  98  98  THR THR B . n 
B 2 99  LEU 99  99  99  LEU LEU B . n 
B 2 100 PRO 100 100 100 PRO PRO B . n 
B 2 101 ALA 101 101 101 ALA ALA B . n 
B 2 102 LEU 102 102 102 LEU LEU B . n 
B 2 103 THR 103 103 103 THR THR B . n 
B 2 104 VAL 104 104 104 VAL VAL B . n 
B 2 105 LEU 105 105 105 LEU LEU B . n 
B 2 106 ASP 106 106 106 ASP ASP B . n 
B 2 107 VAL 107 107 107 VAL VAL B . n 
B 2 108 SER 108 108 108 SER SER B . n 
B 2 109 PHE 109 109 109 PHE PHE B . n 
B 2 110 ASN 110 110 110 ASN ASN B . n 
B 2 111 ARG 111 111 111 ARG ARG B . n 
B 2 112 LEU 112 112 112 LEU LEU B . n 
B 2 113 THR 113 113 113 THR THR B . n 
B 2 114 SER 114 114 114 SER SER B . n 
B 2 115 LEU 115 115 115 LEU LEU B . n 
B 2 116 PRO 116 116 116 PRO PRO B . n 
B 2 117 LEU 117 117 117 LEU LEU B . n 
B 2 118 GLY 118 118 118 GLY GLY B . n 
B 2 119 ALA 119 119 119 ALA ALA B . n 
B 2 120 LEU 120 120 120 LEU LEU B . n 
B 2 121 ARG 121 121 121 ARG ARG B . n 
B 2 122 GLY 122 122 122 GLY GLY B . n 
B 2 123 LEU 123 123 123 LEU LEU B . n 
B 2 124 GLY 124 124 124 GLY GLY B . n 
B 2 125 GLU 125 125 125 GLU GLU B . n 
B 2 126 LEU 126 126 126 LEU LEU B . n 
B 2 127 GLN 127 127 127 GLN GLN B . n 
B 2 128 GLU 128 128 128 GLU GLU B . n 
B 2 129 LEU 129 129 129 LEU LEU B . n 
B 2 130 TYR 130 130 130 TYR TYR B . n 
B 2 131 LEU 131 131 131 LEU LEU B . n 
B 2 132 LYS 132 132 132 LYS LYS B . n 
B 2 133 GLY 133 133 133 GLY GLY B . n 
B 2 134 ASN 134 134 134 ASN ASN B . n 
B 2 135 GLU 135 135 135 GLU GLU B . n 
B 2 136 LEU 136 136 136 LEU LEU B . n 
B 2 137 LYS 137 137 137 LYS LYS B . n 
B 2 138 THR 138 138 138 THR THR B . n 
B 2 139 LEU 139 139 139 LEU LEU B . n 
B 2 140 PRO 140 140 140 PRO PRO B . n 
B 2 141 PRO 141 141 141 PRO PRO B . n 
B 2 142 GLY 142 142 142 GLY GLY B . n 
B 2 143 LEU 143 143 143 LEU LEU B . n 
B 2 144 LEU 144 144 144 LEU LEU B . n 
B 2 145 THR 145 145 145 THR THR B . n 
B 2 146 PRO 146 146 146 PRO PRO B . n 
B 2 147 THR 147 147 147 THR THR B . n 
B 2 148 PRO 148 148 148 PRO PRO B . n 
B 2 149 LYS 149 149 149 LYS LYS B . n 
B 2 150 LEU 150 150 150 LEU LEU B . n 
B 2 151 GLU 151 151 151 GLU GLU B . n 
B 2 152 LYS 152 152 152 LYS LYS B . n 
B 2 153 LEU 153 153 153 LEU LEU B . n 
B 2 154 SER 154 154 154 SER SER B . n 
B 2 155 LEU 155 155 155 LEU LEU B . n 
B 2 156 ALA 156 156 156 ALA ALA B . n 
B 2 157 ASN 157 157 157 ASN ASN B . n 
B 2 158 ASN 158 158 158 ASN ASN B . n 
B 2 159 ASP 159 159 159 ASP ASP B . n 
B 2 160 LEU 160 160 160 LEU LEU B . n 
B 2 161 THR 161 161 161 THR THR B . n 
B 2 162 GLU 162 162 162 GLU GLU B . n 
B 2 163 LEU 163 163 163 LEU LEU B . n 
B 2 164 PRO 164 164 164 PRO PRO B . n 
B 2 165 ALA 165 165 165 ALA ALA B . n 
B 2 166 GLY 166 166 166 GLY GLY B . n 
B 2 167 LEU 167 167 167 LEU LEU B . n 
B 2 168 LEU 168 168 168 LEU LEU B . n 
B 2 169 ASN 169 169 169 ASN ASN B . n 
B 2 170 GLY 170 170 170 GLY GLY B . n 
B 2 171 LEU 171 171 171 LEU LEU B . n 
B 2 172 GLU 172 172 172 GLU GLU B . n 
B 2 173 ASN 173 173 173 ASN ASN B . n 
B 2 174 LEU 174 174 174 LEU LEU B . n 
B 2 175 ASP 175 175 175 ASP ASP B . n 
B 2 176 THR 176 176 176 THR THR B . n 
B 2 177 LEU 177 177 177 LEU LEU B . n 
B 2 178 LEU 178 178 178 LEU LEU B . n 
B 2 179 LEU 179 179 179 LEU LEU B . n 
B 2 180 GLN 180 180 180 GLN GLN B . n 
B 2 181 GLU 181 181 181 GLU GLU B . n 
B 2 182 ASN 182 182 182 ASN ASN B . n 
B 2 183 SER 183 183 183 SER SER B . n 
B 2 184 LEU 184 184 184 LEU LEU B . n 
B 2 185 TYR 185 185 185 TYR TYR B . n 
B 2 186 THR 186 186 186 THR THR B . n 
B 2 187 ILE 187 187 187 ILE ILE B . n 
B 2 188 PRO 188 188 188 PRO PRO B . n 
B 2 189 LYS 189 189 189 LYS LYS B . n 
B 2 190 GLY 190 190 190 GLY GLY B . n 
B 2 191 PHE 191 191 191 PHE PHE B . n 
B 2 192 PHE 192 192 192 PHE PHE B . n 
B 2 193 GLY 193 193 193 GLY GLY B . n 
B 2 194 SER 194 194 194 SER SER B . n 
B 2 195 HIS 195 195 195 HIS HIS B . n 
B 2 196 LEU 196 196 196 LEU LEU B . n 
B 2 197 LEU 197 197 197 LEU LEU B . n 
B 2 198 PRO 198 198 198 PRO PRO B . n 
B 2 199 PHE 199 199 199 PHE PHE B . n 
B 2 200 ALA 200 200 200 ALA ALA B . n 
B 2 201 PHE 201 201 201 PHE PHE B . n 
B 2 202 LEU 202 202 202 LEU LEU B . n 
B 2 203 HIS 203 203 203 HIS HIS B . n 
B 2 204 GLY 204 204 204 GLY GLY B . n 
B 2 205 ASN 205 205 205 ASN ASN B . n 
B 2 206 PRO 206 206 206 PRO PRO B . n 
B 2 207 TRP 207 207 207 TRP TRP B . n 
B 2 208 LEU 208 208 208 LEU LEU B . n 
B 2 209 CYS 209 209 209 CYS CYS B . n 
B 2 210 ASN 210 210 210 ASN ASN B . n 
B 2 211 CYS 211 211 211 CYS CYS B . n 
B 2 212 GLU 212 212 212 GLU GLU B . n 
B 2 213 ILE 213 213 213 ILE ILE B . n 
B 2 214 LEU 214 214 214 LEU LEU B . n 
B 2 215 TYR 215 215 215 TYR TYR B . n 
B 2 216 PHE 216 216 216 PHE PHE B . n 
B 2 217 ARG 217 217 217 ARG ARG B . n 
B 2 218 ARG 218 218 218 ARG ARG B . n 
B 2 219 TRP 219 219 219 TRP TRP B . n 
B 2 220 LEU 220 220 220 LEU LEU B . n 
B 2 221 GLN 221 221 221 GLN GLN B . n 
B 2 222 ASP 222 222 222 ASP ASP B . n 
B 2 223 ASN 223 223 223 ASN ASN B . n 
B 2 224 ALA 224 224 224 ALA ALA B . n 
B 2 225 GLU 225 225 225 GLU GLU B . n 
B 2 226 ASN 226 226 226 ASN ASN B . n 
B 2 227 VAL 227 227 227 VAL VAL B . n 
B 2 228 TYR 228 228 228 TYR TYR B . n 
B 2 229 VAL 229 229 229 VAL VAL B . n 
B 2 230 TRP 230 230 230 TRP TRP B . n 
B 2 231 LYS 231 231 231 LYS LYS B . n 
B 2 232 GLN 232 232 232 GLN GLN B . n 
B 2 233 GLY 233 233 233 GLY GLY B . n 
B 2 234 VAL 234 234 234 VAL VAL B . n 
B 2 235 ASP 235 235 235 ASP ASP B . n 
B 2 236 VAL 236 236 236 VAL VAL B . n 
B 2 237 LYS 237 237 237 LYS LYS B . n 
B 2 238 ALA 238 238 238 ALA ALA B . n 
B 2 239 MET 239 239 239 MET MET B . n 
B 2 240 THR 240 240 240 THR THR B . n 
B 2 241 SER 241 241 241 SER SER B . n 
B 2 242 ASN 242 242 242 ASN ASN B . n 
B 2 243 VAL 243 243 243 VAL VAL B . n 
B 2 244 ALA 244 244 244 ALA ALA B . n 
B 2 245 SER 245 245 245 SER SER B . n 
B 2 246 VAL 246 246 246 VAL VAL B . n 
B 2 247 GLN 247 247 247 GLN GLN B . n 
B 2 248 CYS 248 248 248 CYS CYS B . n 
B 2 249 ASP 249 249 249 ASP ASP B . n 
B 2 250 ASN 250 250 250 ASN ASN B . n 
B 2 251 SER 251 251 251 SER SER B . n 
B 2 252 ASP 252 252 252 ASP ASP B . n 
B 2 253 LYS 253 253 253 LYS LYS B . n 
B 2 254 PHE 254 254 254 PHE PHE B . n 
B 2 255 PRO 255 255 255 PRO PRO B . n 
B 2 256 VAL 256 256 256 VAL VAL B . n 
B 2 257 TYR 257 257 257 TYR TYR B . n 
B 2 258 LYS 258 258 258 LYS LYS B . n 
B 2 259 TYR 259 259 259 TYR TYR B . n 
B 2 260 PRO 260 260 260 PRO PRO B . n 
B 2 261 GLY 261 261 261 GLY GLY B . n 
B 2 262 LYS 262 262 262 LYS LYS B . n 
B 2 263 GLY 263 263 263 GLY GLY B . n 
B 2 264 CYS 264 264 264 CYS CYS B . n 
B 2 265 PRO 265 265 265 PRO PRO B . n 
B 2 266 THR 266 266 ?   ?   ?   B . n 
B 2 267 LEU 267 267 ?   ?   ?   B . n 
B 2 268 GLY 268 268 ?   ?   ?   B . n 
B 2 269 ASP 269 269 ?   ?   ?   B . n 
B 2 270 GLU 270 270 ?   ?   ?   B . n 
B 2 271 GLY 271 271 ?   ?   ?   B . n 
B 2 272 ASP 272 272 ?   ?   ?   B . n 
B 2 273 THR 273 273 ?   ?   ?   B . n 
B 2 274 ASP 274 274 ?   ?   ?   B . n 
B 2 275 LEU 275 275 ?   ?   ?   B . n 
B 2 276 TYR 276 276 ?   ?   ?   B . n 
B 2 277 ASP 277 277 ?   ?   ?   B . n 
B 2 278 TYR 278 278 ?   ?   ?   B . n 
B 2 279 TYR 279 279 ?   ?   ?   B . n 
B 2 280 PRO 280 280 ?   ?   ?   B . n 
B 2 281 GLU 281 281 ?   ?   ?   B . n 
B 2 282 GLU 282 282 ?   ?   ?   B . n 
B 2 283 ASP 283 283 ?   ?   ?   B . n 
B 2 284 THR 284 284 ?   ?   ?   B . n 
B 2 285 GLU 285 285 ?   ?   ?   B . n 
B 2 286 GLY 286 286 ?   ?   ?   B . n 
B 2 287 ASP 287 287 ?   ?   ?   B . n 
B 2 288 LYS 288 288 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1   2   2   HOH HOH A . 
C 3 HOH 2   5   5   HOH HOH A . 
C 3 HOH 3   6   6   HOH HOH A . 
C 3 HOH 4   7   7   HOH HOH A . 
C 3 HOH 5   8   8   HOH HOH A . 
C 3 HOH 6   13  13  HOH HOH A . 
C 3 HOH 7   14  14  HOH HOH A . 
C 3 HOH 8   18  18  HOH HOH A . 
C 3 HOH 9   20  20  HOH HOH A . 
C 3 HOH 10  24  24  HOH HOH A . 
C 3 HOH 11  28  28  HOH HOH A . 
C 3 HOH 12  32  32  HOH HOH A . 
C 3 HOH 13  36  36  HOH HOH A . 
C 3 HOH 14  39  39  HOH HOH A . 
C 3 HOH 15  40  40  HOH HOH A . 
C 3 HOH 16  41  41  HOH HOH A . 
C 3 HOH 17  42  42  HOH HOH A . 
C 3 HOH 18  43  43  HOH HOH A . 
C 3 HOH 19  45  45  HOH HOH A . 
C 3 HOH 20  46  46  HOH HOH A . 
C 3 HOH 21  47  47  HOH HOH A . 
C 3 HOH 22  52  52  HOH HOH A . 
C 3 HOH 23  53  53  HOH HOH A . 
C 3 HOH 24  54  54  HOH HOH A . 
C 3 HOH 25  56  56  HOH HOH A . 
C 3 HOH 26  58  58  HOH HOH A . 
C 3 HOH 27  76  76  HOH HOH A . 
C 3 HOH 28  77  77  HOH HOH A . 
C 3 HOH 29  78  78  HOH HOH A . 
C 3 HOH 30  86  86  HOH HOH A . 
C 3 HOH 31  89  89  HOH HOH A . 
C 3 HOH 32  90  90  HOH HOH A . 
C 3 HOH 33  97  97  HOH HOH A . 
C 3 HOH 34  98  98  HOH HOH A . 
C 3 HOH 35  99  99  HOH HOH A . 
C 3 HOH 36  100 100 HOH HOH A . 
C 3 HOH 37  110 110 HOH HOH A . 
C 3 HOH 38  111 111 HOH HOH A . 
C 3 HOH 39  112 112 HOH HOH A . 
C 3 HOH 40  113 113 HOH HOH A . 
C 3 HOH 41  115 115 HOH HOH A . 
C 3 HOH 42  116 116 HOH HOH A . 
C 3 HOH 43  117 117 HOH HOH A . 
C 3 HOH 44  118 118 HOH HOH A . 
C 3 HOH 45  119 119 HOH HOH A . 
C 3 HOH 46  120 120 HOH HOH A . 
C 3 HOH 47  121 121 HOH HOH A . 
C 3 HOH 48  123 123 HOH HOH A . 
C 3 HOH 49  124 124 HOH HOH A . 
C 3 HOH 50  125 125 HOH HOH A . 
C 3 HOH 51  140 140 HOH HOH A . 
C 3 HOH 52  142 142 HOH HOH A . 
C 3 HOH 53  144 144 HOH HOH A . 
C 3 HOH 54  147 147 HOH HOH A . 
C 3 HOH 55  152 152 HOH HOH A . 
C 3 HOH 56  155 155 HOH HOH A . 
C 3 HOH 57  156 156 HOH HOH A . 
C 3 HOH 58  157 157 HOH HOH A . 
C 3 HOH 59  159 159 HOH HOH A . 
C 3 HOH 60  160 160 HOH HOH A . 
C 3 HOH 61  161 161 HOH HOH A . 
C 3 HOH 62  163 163 HOH HOH A . 
C 3 HOH 63  164 164 HOH HOH A . 
C 3 HOH 64  165 165 HOH HOH A . 
C 3 HOH 65  166 166 HOH HOH A . 
C 3 HOH 66  167 167 HOH HOH A . 
C 3 HOH 67  168 168 HOH HOH A . 
C 3 HOH 68  182 182 HOH HOH A . 
C 3 HOH 69  188 188 HOH HOH A . 
C 3 HOH 70  194 194 HOH HOH A . 
C 3 HOH 71  195 195 HOH HOH A . 
C 3 HOH 72  196 196 HOH HOH A . 
C 3 HOH 73  197 197 HOH HOH A . 
C 3 HOH 74  198 198 HOH HOH A . 
C 3 HOH 75  199 199 HOH HOH A . 
C 3 HOH 76  200 200 HOH HOH A . 
C 3 HOH 77  201 201 HOH HOH A . 
C 3 HOH 78  206 206 HOH HOH A . 
C 3 HOH 79  207 207 HOH HOH A . 
C 3 HOH 80  209 209 HOH HOH A . 
C 3 HOH 81  217 217 HOH HOH A . 
C 3 HOH 82  218 218 HOH HOH A . 
C 3 HOH 83  223 223 HOH HOH A . 
C 3 HOH 84  231 231 HOH HOH A . 
C 3 HOH 85  236 236 HOH HOH A . 
C 3 HOH 86  237 237 HOH HOH A . 
C 3 HOH 87  239 239 HOH HOH A . 
C 3 HOH 88  240 240 HOH HOH A . 
C 3 HOH 89  241 241 HOH HOH A . 
C 3 HOH 90  246 246 HOH HOH A . 
C 3 HOH 91  247 247 HOH HOH A . 
C 3 HOH 92  249 249 HOH HOH A . 
C 3 HOH 93  250 250 HOH HOH A . 
C 3 HOH 94  253 253 HOH HOH A . 
C 3 HOH 95  255 255 HOH HOH A . 
C 3 HOH 96  261 261 HOH HOH A . 
C 3 HOH 97  262 262 HOH HOH A . 
C 3 HOH 98  264 264 HOH HOH A . 
C 3 HOH 99  266 266 HOH HOH A . 
C 3 HOH 100 270 270 HOH HOH A . 
C 3 HOH 101 271 271 HOH HOH A . 
C 3 HOH 102 276 276 HOH HOH A . 
C 3 HOH 103 277 277 HOH HOH A . 
C 3 HOH 104 278 278 HOH HOH A . 
C 3 HOH 105 282 282 HOH HOH A . 
C 3 HOH 106 283 283 HOH HOH A . 
C 3 HOH 107 284 284 HOH HOH A . 
C 3 HOH 108 285 285 HOH HOH A . 
C 3 HOH 109 290 290 HOH HOH A . 
C 3 HOH 110 294 294 HOH HOH A . 
C 3 HOH 111 297 297 HOH HOH A . 
C 3 HOH 112 298 298 HOH HOH A . 
C 3 HOH 113 300 300 HOH HOH A . 
C 3 HOH 114 301 301 HOH HOH A . 
C 3 HOH 115 307 307 HOH HOH A . 
C 3 HOH 116 310 310 HOH HOH A . 
C 3 HOH 117 312 312 HOH HOH A . 
C 3 HOH 118 313 313 HOH HOH A . 
D 3 HOH 1   289 1   HOH HOH B . 
D 3 HOH 2   290 3   HOH HOH B . 
D 3 HOH 3   291 4   HOH HOH B . 
D 3 HOH 4   292 9   HOH HOH B . 
D 3 HOH 5   293 10  HOH HOH B . 
D 3 HOH 6   294 11  HOH HOH B . 
D 3 HOH 7   295 12  HOH HOH B . 
D 3 HOH 8   296 15  HOH HOH B . 
D 3 HOH 9   297 16  HOH HOH B . 
D 3 HOH 10  298 17  HOH HOH B . 
D 3 HOH 11  299 19  HOH HOH B . 
D 3 HOH 12  300 21  HOH HOH B . 
D 3 HOH 13  301 22  HOH HOH B . 
D 3 HOH 14  302 23  HOH HOH B . 
D 3 HOH 15  303 25  HOH HOH B . 
D 3 HOH 16  304 26  HOH HOH B . 
D 3 HOH 17  305 27  HOH HOH B . 
D 3 HOH 18  306 29  HOH HOH B . 
D 3 HOH 19  307 30  HOH HOH B . 
D 3 HOH 20  308 31  HOH HOH B . 
D 3 HOH 21  309 33  HOH HOH B . 
D 3 HOH 22  310 34  HOH HOH B . 
D 3 HOH 23  311 35  HOH HOH B . 
D 3 HOH 24  312 37  HOH HOH B . 
D 3 HOH 25  313 38  HOH HOH B . 
D 3 HOH 26  314 44  HOH HOH B . 
D 3 HOH 27  315 48  HOH HOH B . 
D 3 HOH 28  316 49  HOH HOH B . 
D 3 HOH 29  317 50  HOH HOH B . 
D 3 HOH 30  318 51  HOH HOH B . 
D 3 HOH 31  319 55  HOH HOH B . 
D 3 HOH 32  320 57  HOH HOH B . 
D 3 HOH 33  321 59  HOH HOH B . 
D 3 HOH 34  322 60  HOH HOH B . 
D 3 HOH 35  323 61  HOH HOH B . 
D 3 HOH 36  324 62  HOH HOH B . 
D 3 HOH 37  325 63  HOH HOH B . 
D 3 HOH 38  326 64  HOH HOH B . 
D 3 HOH 39  327 65  HOH HOH B . 
D 3 HOH 40  328 66  HOH HOH B . 
D 3 HOH 41  329 67  HOH HOH B . 
D 3 HOH 42  330 68  HOH HOH B . 
D 3 HOH 43  331 69  HOH HOH B . 
D 3 HOH 44  332 70  HOH HOH B . 
D 3 HOH 45  333 71  HOH HOH B . 
D 3 HOH 46  334 72  HOH HOH B . 
D 3 HOH 47  335 73  HOH HOH B . 
D 3 HOH 48  336 74  HOH HOH B . 
D 3 HOH 49  337 75  HOH HOH B . 
D 3 HOH 50  338 79  HOH HOH B . 
D 3 HOH 51  339 80  HOH HOH B . 
D 3 HOH 52  340 81  HOH HOH B . 
D 3 HOH 53  341 82  HOH HOH B . 
D 3 HOH 54  342 83  HOH HOH B . 
D 3 HOH 55  343 84  HOH HOH B . 
D 3 HOH 56  344 85  HOH HOH B . 
D 3 HOH 57  345 87  HOH HOH B . 
D 3 HOH 58  346 88  HOH HOH B . 
D 3 HOH 59  347 91  HOH HOH B . 
D 3 HOH 60  348 92  HOH HOH B . 
D 3 HOH 61  349 93  HOH HOH B . 
D 3 HOH 62  350 94  HOH HOH B . 
D 3 HOH 63  351 95  HOH HOH B . 
D 3 HOH 64  352 96  HOH HOH B . 
D 3 HOH 65  353 101 HOH HOH B . 
D 3 HOH 66  354 102 HOH HOH B . 
D 3 HOH 67  355 103 HOH HOH B . 
D 3 HOH 68  356 104 HOH HOH B . 
D 3 HOH 69  357 105 HOH HOH B . 
D 3 HOH 70  358 106 HOH HOH B . 
D 3 HOH 71  359 107 HOH HOH B . 
D 3 HOH 72  360 108 HOH HOH B . 
D 3 HOH 73  361 109 HOH HOH B . 
D 3 HOH 74  362 114 HOH HOH B . 
D 3 HOH 75  363 122 HOH HOH B . 
D 3 HOH 76  364 126 HOH HOH B . 
D 3 HOH 77  365 127 HOH HOH B . 
D 3 HOH 78  366 128 HOH HOH B . 
D 3 HOH 79  367 129 HOH HOH B . 
D 3 HOH 80  368 130 HOH HOH B . 
D 3 HOH 81  369 131 HOH HOH B . 
D 3 HOH 82  370 132 HOH HOH B . 
D 3 HOH 83  371 133 HOH HOH B . 
D 3 HOH 84  372 134 HOH HOH B . 
D 3 HOH 85  373 135 HOH HOH B . 
D 3 HOH 86  374 136 HOH HOH B . 
D 3 HOH 87  375 137 HOH HOH B . 
D 3 HOH 88  376 138 HOH HOH B . 
D 3 HOH 89  377 139 HOH HOH B . 
D 3 HOH 90  378 141 HOH HOH B . 
D 3 HOH 91  379 143 HOH HOH B . 
D 3 HOH 92  380 145 HOH HOH B . 
D 3 HOH 93  381 146 HOH HOH B . 
D 3 HOH 94  382 148 HOH HOH B . 
D 3 HOH 95  383 149 HOH HOH B . 
D 3 HOH 96  384 150 HOH HOH B . 
D 3 HOH 97  385 151 HOH HOH B . 
D 3 HOH 98  386 153 HOH HOH B . 
D 3 HOH 99  387 154 HOH HOH B . 
D 3 HOH 100 388 158 HOH HOH B . 
D 3 HOH 101 389 162 HOH HOH B . 
D 3 HOH 102 390 169 HOH HOH B . 
D 3 HOH 103 391 170 HOH HOH B . 
D 3 HOH 104 392 171 HOH HOH B . 
D 3 HOH 105 393 172 HOH HOH B . 
D 3 HOH 106 394 173 HOH HOH B . 
D 3 HOH 107 395 174 HOH HOH B . 
D 3 HOH 108 396 175 HOH HOH B . 
D 3 HOH 109 397 176 HOH HOH B . 
D 3 HOH 110 398 177 HOH HOH B . 
D 3 HOH 111 399 178 HOH HOH B . 
D 3 HOH 112 400 179 HOH HOH B . 
D 3 HOH 113 401 180 HOH HOH B . 
D 3 HOH 114 402 181 HOH HOH B . 
D 3 HOH 115 403 183 HOH HOH B . 
D 3 HOH 116 404 184 HOH HOH B . 
D 3 HOH 117 405 185 HOH HOH B . 
D 3 HOH 118 406 186 HOH HOH B . 
D 3 HOH 119 407 187 HOH HOH B . 
D 3 HOH 120 408 189 HOH HOH B . 
D 3 HOH 121 409 190 HOH HOH B . 
D 3 HOH 122 410 191 HOH HOH B . 
D 3 HOH 123 411 192 HOH HOH B . 
D 3 HOH 124 412 193 HOH HOH B . 
D 3 HOH 125 413 202 HOH HOH B . 
D 3 HOH 126 414 203 HOH HOH B . 
D 3 HOH 127 415 204 HOH HOH B . 
D 3 HOH 128 416 205 HOH HOH B . 
D 3 HOH 129 417 208 HOH HOH B . 
D 3 HOH 130 418 210 HOH HOH B . 
D 3 HOH 131 419 211 HOH HOH B . 
D 3 HOH 132 420 212 HOH HOH B . 
D 3 HOH 133 421 213 HOH HOH B . 
D 3 HOH 134 422 214 HOH HOH B . 
D 3 HOH 135 423 215 HOH HOH B . 
D 3 HOH 136 424 216 HOH HOH B . 
D 3 HOH 137 425 219 HOH HOH B . 
D 3 HOH 138 426 220 HOH HOH B . 
D 3 HOH 139 427 221 HOH HOH B . 
D 3 HOH 140 428 222 HOH HOH B . 
D 3 HOH 141 429 224 HOH HOH B . 
D 3 HOH 142 430 225 HOH HOH B . 
D 3 HOH 143 431 226 HOH HOH B . 
D 3 HOH 144 432 227 HOH HOH B . 
D 3 HOH 145 433 228 HOH HOH B . 
D 3 HOH 146 434 229 HOH HOH B . 
D 3 HOH 147 435 230 HOH HOH B . 
D 3 HOH 148 436 232 HOH HOH B . 
D 3 HOH 149 437 233 HOH HOH B . 
D 3 HOH 150 438 234 HOH HOH B . 
D 3 HOH 151 439 235 HOH HOH B . 
D 3 HOH 152 440 238 HOH HOH B . 
D 3 HOH 153 441 242 HOH HOH B . 
D 3 HOH 154 442 243 HOH HOH B . 
D 3 HOH 155 443 244 HOH HOH B . 
D 3 HOH 156 444 245 HOH HOH B . 
D 3 HOH 157 445 248 HOH HOH B . 
D 3 HOH 158 446 251 HOH HOH B . 
D 3 HOH 159 447 252 HOH HOH B . 
D 3 HOH 160 448 254 HOH HOH B . 
D 3 HOH 161 449 256 HOH HOH B . 
D 3 HOH 162 450 257 HOH HOH B . 
D 3 HOH 163 451 258 HOH HOH B . 
D 3 HOH 164 452 259 HOH HOH B . 
D 3 HOH 165 453 260 HOH HOH B . 
D 3 HOH 166 454 263 HOH HOH B . 
D 3 HOH 167 455 265 HOH HOH B . 
D 3 HOH 168 456 267 HOH HOH B . 
D 3 HOH 169 457 268 HOH HOH B . 
D 3 HOH 170 458 269 HOH HOH B . 
D 3 HOH 171 459 272 HOH HOH B . 
D 3 HOH 172 460 273 HOH HOH B . 
D 3 HOH 173 461 274 HOH HOH B . 
D 3 HOH 174 462 275 HOH HOH B . 
D 3 HOH 175 463 279 HOH HOH B . 
D 3 HOH 176 464 280 HOH HOH B . 
D 3 HOH 177 465 281 HOH HOH B . 
D 3 HOH 178 466 286 HOH HOH B . 
D 3 HOH 179 467 287 HOH HOH B . 
D 3 HOH 180 468 288 HOH HOH B . 
D 3 HOH 181 469 289 HOH HOH B . 
D 3 HOH 182 470 291 HOH HOH B . 
D 3 HOH 183 471 292 HOH HOH B . 
D 3 HOH 184 472 293 HOH HOH B . 
D 3 HOH 185 473 295 HOH HOH B . 
D 3 HOH 186 474 296 HOH HOH B . 
D 3 HOH 187 475 299 HOH HOH B . 
D 3 HOH 188 476 302 HOH HOH B . 
D 3 HOH 189 477 303 HOH HOH B . 
D 3 HOH 190 478 304 HOH HOH B . 
D 3 HOH 191 479 305 HOH HOH B . 
D 3 HOH 192 480 306 HOH HOH B . 
D 3 HOH 193 481 308 HOH HOH B . 
D 3 HOH 194 482 309 HOH HOH B . 
D 3 HOH 195 483 311 HOH HOH B . 
D 3 HOH 196 484 314 HOH HOH B . 
D 3 HOH 197 485 315 HOH HOH B . 
D 3 HOH 198 486 316 HOH HOH B . 
D 3 HOH 199 487 317 HOH HOH B . 
D 3 HOH 200 488 318 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-04-13 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS    refinement       1.1       ? 1 
DENZO  'data reduction' .         ? 2 
CCP4   'data scaling'   '(SCALA)' ? 3 
SHELXS phasing          .         ? 4 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;SEQUENCE
ASN RESIDUES AT POSITIONS 21 AND 159 OF CHAIN B, WHICH ARE
SITES FOR N-LINKED GLYCOSYLATION, WERE MUTATED TO ASP.
;
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    300 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    442 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.17 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 CYS A 509 ? ? -179.31 146.68  
2  1 ARG A 545 ? ? 59.76   70.62   
3  1 HIS A 559 ? ? -125.70 -99.43  
4  1 LYS A 608 ? ? -111.86 -163.73 
5  1 ARG A 611 ? ? -157.81 66.75   
6  1 PRO A 612 ? ? -69.22  9.65    
7  1 ASN A 658 ? ? -57.44  80.57   
8  1 GLN A 686 ? ? -92.77  31.07   
9  1 ILE B 3   ? ? -121.27 -53.86  
10 1 ALA B 10  ? ? 60.80   -128.13 
11 1 LYS B 19  ? ? 38.24   62.70   
12 1 LEU B 42  ? ? -97.15  59.21   
13 1 THR B 55  ? ? -60.72  5.60    
14 1 CYS B 65  ? ? -119.05 -152.50 
15 1 LEU B 76  ? ? -118.93 71.51   
16 1 PRO B 77  ? ? -45.61  -17.06  
17 1 ASN B 87  ? ? -126.44 -169.49 
18 1 ASN B 110 ? ? -126.30 -146.78 
19 1 LEU B 123 ? ? -89.02  40.12   
20 1 ASN B 134 ? ? -97.36  -158.16 
21 1 THR B 147 ? ? -113.49 69.41   
22 1 ASN B 158 ? ? -104.58 -161.55 
23 1 ASN B 182 ? ? -123.47 -160.05 
24 1 ASP B 235 ? ? 75.36   -4.69   
25 1 ASN B 242 ? ? -168.50 96.03   
26 1 ASP B 249 ? ? 57.97   0.53    
27 1 ASN B 250 ? ? 82.86   8.95    
28 1 LYS B 262 ? ? -29.95  -73.52  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 496 ? A MET 1   
2  1 Y 1 A GLU 497 ? A GLU 2   
3  1 Y 1 A ASP 498 ? A ASP 3   
4  1 Y 1 A ILE 499 ? A ILE 4   
5  1 Y 1 A SER 500 ? A SER 5   
6  1 Y 1 A GLU 501 ? A GLU 6   
7  1 Y 1 A PRO 502 ? A PRO 7   
8  1 Y 1 A PRO 503 ? A PRO 8   
9  1 Y 1 A LEU 504 ? A LEU 9   
10 1 Y 1 A HIS 505 ? A HIS 10  
11 1 Y 1 A PRO 704 ? A PRO 209 
12 1 Y 1 A THR 705 ? A THR 210 
13 1 Y 1 A LEU 706 ? A LEU 211 
14 1 Y 1 A PRO 707 ? A PRO 212 
15 1 Y 1 A PRO 708 ? A PRO 213 
16 1 Y 1 A HIS 709 ? A HIS 214 
17 1 Y 1 B THR 266 ? B THR 266 
18 1 Y 1 B LEU 267 ? B LEU 267 
19 1 Y 1 B GLY 268 ? B GLY 268 
20 1 Y 1 B ASP 269 ? B ASP 269 
21 1 Y 1 B GLU 270 ? B GLU 270 
22 1 Y 1 B GLY 271 ? B GLY 271 
23 1 Y 1 B ASP 272 ? B ASP 272 
24 1 Y 1 B THR 273 ? B THR 273 
25 1 Y 1 B ASP 274 ? B ASP 274 
26 1 Y 1 B LEU 275 ? B LEU 275 
27 1 Y 1 B TYR 276 ? B TYR 276 
28 1 Y 1 B ASP 277 ? B ASP 277 
29 1 Y 1 B TYR 278 ? B TYR 278 
30 1 Y 1 B TYR 279 ? B TYR 279 
31 1 Y 1 B PRO 280 ? B PRO 280 
32 1 Y 1 B GLU 281 ? B GLU 281 
33 1 Y 1 B GLU 282 ? B GLU 282 
34 1 Y 1 B ASP 283 ? B ASP 283 
35 1 Y 1 B THR 284 ? B THR 284 
36 1 Y 1 B GLU 285 ? B GLU 285 
37 1 Y 1 B GLY 286 ? B GLY 286 
38 1 Y 1 B ASP 287 ? B ASP 287 
39 1 Y 1 B LYS 288 ? B LYS 288 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#