data_1SSF
# 
_entry.id   1SSF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.355 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1SSF         pdb_00001ssf 10.2210/pdb1ssf/pdb 
RCSB  RCSB021963   ?            ?                   
WWPDB D_1000021963 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SSF 
_pdbx_database_status.recvd_initial_deposition_date   2004-03-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Charier, G.'     1 
'Couprie, J.'     2 
'Alpha-Bazin, B.' 3 
'Meyer, V.'       4 
'Quemeneur, E.'   5 
'Guerois, R.'     6 
'Callebaut, I.'   7 
'Gilquin, B.'     8 
'Zinn-Justin, S.' 9 
# 
_citation.id                        primary 
_citation.title                     'The Tudor Tandem of 53BP1; A New Structural Motif Involved in DNA and RG-Rich Peptide Binding' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            12 
_citation.page_first                1551 
_citation.page_last                 1562 
_citation.year                      2004 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15341721 
_citation.pdbx_database_id_DOI      10.1016/j.str.2004.06.014 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Charier, G.'     1 ? 
primary 'Couprie, J.'     2 ? 
primary 'Alpha-Bazin, B.' 3 ? 
primary 'Meyer, V.'       4 ? 
primary 'Quemeneur, E.'   5 ? 
primary 'Guerois, R.'     6 ? 
primary 'Callebaut, I.'   7 ? 
primary 'Gilquin, B.'     8 ? 
primary 'Zinn-Justin, S.' 9 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Transformation related protein 53 binding protein 1' 
_entity.formula_weight             17426.572 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'Residues 1463-1617' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'murine p53-binding protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GDSSSSGNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAG
VVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGPYEAVTPLTKAADISLDNLVEGKRKRRSN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GDSSSSGNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAG
VVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGPYEAVTPLTKAADISLDNLVEGKRKRRSN
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ASP n 
1 3   SER n 
1 4   SER n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   ASN n 
1 9   SER n 
1 10  PHE n 
1 11  VAL n 
1 12  GLY n 
1 13  LEU n 
1 14  ARG n 
1 15  VAL n 
1 16  VAL n 
1 17  ALA n 
1 18  LYS n 
1 19  TRP n 
1 20  SER n 
1 21  SER n 
1 22  ASN n 
1 23  GLY n 
1 24  TYR n 
1 25  PHE n 
1 26  TYR n 
1 27  SER n 
1 28  GLY n 
1 29  LYS n 
1 30  ILE n 
1 31  THR n 
1 32  ARG n 
1 33  ASP n 
1 34  VAL n 
1 35  GLY n 
1 36  ALA n 
1 37  GLY n 
1 38  LYS n 
1 39  TYR n 
1 40  LYS n 
1 41  LEU n 
1 42  LEU n 
1 43  PHE n 
1 44  ASP n 
1 45  ASP n 
1 46  GLY n 
1 47  TYR n 
1 48  GLU n 
1 49  CYS n 
1 50  ASP n 
1 51  VAL n 
1 52  LEU n 
1 53  GLY n 
1 54  LYS n 
1 55  ASP n 
1 56  ILE n 
1 57  LEU n 
1 58  LEU n 
1 59  CYS n 
1 60  ASP n 
1 61  PRO n 
1 62  ILE n 
1 63  PRO n 
1 64  LEU n 
1 65  ASP n 
1 66  THR n 
1 67  GLU n 
1 68  VAL n 
1 69  THR n 
1 70  ALA n 
1 71  LEU n 
1 72  SER n 
1 73  GLU n 
1 74  ASP n 
1 75  GLU n 
1 76  TYR n 
1 77  PHE n 
1 78  SER n 
1 79  ALA n 
1 80  GLY n 
1 81  VAL n 
1 82  VAL n 
1 83  LYS n 
1 84  GLY n 
1 85  HIS n 
1 86  ARG n 
1 87  LYS n 
1 88  GLU n 
1 89  SER n 
1 90  GLY n 
1 91  GLU n 
1 92  LEU n 
1 93  TYR n 
1 94  TYR n 
1 95  SER n 
1 96  ILE n 
1 97  GLU n 
1 98  LYS n 
1 99  GLU n 
1 100 GLY n 
1 101 GLN n 
1 102 ARG n 
1 103 LYS n 
1 104 TRP n 
1 105 TYR n 
1 106 LYS n 
1 107 ARG n 
1 108 MET n 
1 109 ALA n 
1 110 VAL n 
1 111 ILE n 
1 112 LEU n 
1 113 SER n 
1 114 LEU n 
1 115 GLU n 
1 116 GLN n 
1 117 GLY n 
1 118 ASN n 
1 119 ARG n 
1 120 LEU n 
1 121 ARG n 
1 122 GLU n 
1 123 GLN n 
1 124 TYR n 
1 125 GLY n 
1 126 LEU n 
1 127 GLY n 
1 128 PRO n 
1 129 TYR n 
1 130 GLU n 
1 131 ALA n 
1 132 VAL n 
1 133 THR n 
1 134 PRO n 
1 135 LEU n 
1 136 THR n 
1 137 LYS n 
1 138 ALA n 
1 139 ALA n 
1 140 ASP n 
1 141 ILE n 
1 142 SER n 
1 143 LEU n 
1 144 ASP n 
1 145 ASN n 
1 146 LEU n 
1 147 VAL n 
1 148 GLU n 
1 149 GLY n 
1 150 LYS n 
1 151 ARG n 
1 152 LYS n 
1 153 ARG n 
1 154 ARG n 
1 155 SER n 
1 156 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21-Gold(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pDEST15 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q91YC9_MOUSE 
_struct_ref.pdbx_db_accession          Q91YC9 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DSSSSGNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGV
VKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGPYEAVTPLTKAADISLDNLVEGKRKRRSN
;
_struct_ref.pdbx_align_begin           1463 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1SSF 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 156 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q91YC9 
_struct_ref_seq.db_align_beg                  1463 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1617 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       155 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1SSF 
_struct_ref_seq_dif.mon_id                       GLY 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q91YC9 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'cloning artifact' 
_struct_ref_seq_dif.pdbx_auth_seq_num            0 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_15N-separated_NOESY 
2 2 1 3D_13C-separated_NOESY 
3 3 1 3D_13C-separated_NOESY 
4 2 1 3D_13C_NOESY_aromatic  
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         300 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.2 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '50mM Tris-Hcl, 150mM NaCl' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '0.6mM mouse 53BP1 (1463-1617) fragment, U-15N, 50mM Tris-HCl buffer, 150mM NaCl, 90% H2O, 10% D2O'     '90% H2O/10% D2O' 
2 '0.9mM mouse 53BP1 (1463-1617) fragment, U-15N,13C, 50mM Tris-HCl buffer, 150mM NaCl, 90% H2O, 10% D2O' '90% H2O/10% D2O' 
3 '0.9mM mouse 53BP1 (1463-1617) fragment, U-15N,13C, 50mM Tris-HCl buffer, 150mM NaCl, 100% D2O'         '100% D2O'        
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker DRX 750 
2 ? Bruker DRX 600 
# 
_pdbx_nmr_refine.entry_id           1SSF 
_pdbx_nmr_refine.method             'distance geometry, simulated annealing' 
_pdbx_nmr_refine.details            
;the structures are based on a total of 2337 NOE-derived restraints, 206 dihedral angle restraints, and 60 distance restraints from hydrogen bonds.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1SSF 
_pdbx_nmr_details.text       'The structure was determined using triple-resonance NMR spectroscopy' 
# 
_pdbx_nmr_ensemble.entry_id                                      1SSF 
_pdbx_nmr_ensemble.conformers_calculated_total_number            1000 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
;back calculated data agree with experimental NOESY spectrum, structures with acceptable covalent geometry, structures with favorable non-bond energy, structures with the least restraint violations, structures with the lowest energy
;
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1SSF 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy conformer' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XwinNMR 2.5    collection           ? 1 
NMRPipe 2.0    processing           ? 2 
Felix   2000.1 'data analysis'      ? 3 
CNS     1.0    refinement           ? 4 
CNS     1.0    'structure solution' ? 5 
# 
_exptl.entry_id          1SSF 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1SSF 
_struct.title                     'Solution structure of the mouse 53BP1 fragment (residues 1463-1617)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SSF 
_struct_keywords.pdbx_keywords   'CELL CYCLE' 
_struct_keywords.text            'Tudor domains, tandem, SH3-like fold, Beta barrel, alpha-helix, CELL CYCLE' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 106 ? MET A 108 ? LYS A 105 MET A 107 5 ? 3 
HELX_P HELX_P2 2 LEU A 114 ? ARG A 119 ? LEU A 113 ARG A 118 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ASP 60 A . ? ASP 59 A PRO 61 A ? PRO 60 A 1  2.82  
2  ASP 60 A . ? ASP 59 A PRO 61 A ? PRO 60 A 2  2.57  
3  ASP 60 A . ? ASP 59 A PRO 61 A ? PRO 60 A 3  0.01  
4  ASP 60 A . ? ASP 59 A PRO 61 A ? PRO 60 A 4  5.45  
5  ASP 60 A . ? ASP 59 A PRO 61 A ? PRO 60 A 5  5.45  
6  ASP 60 A . ? ASP 59 A PRO 61 A ? PRO 60 A 6  -0.30 
7  ASP 60 A . ? ASP 59 A PRO 61 A ? PRO 60 A 7  7.26  
8  ASP 60 A . ? ASP 59 A PRO 61 A ? PRO 60 A 8  5.12  
9  ASP 60 A . ? ASP 59 A PRO 61 A ? PRO 60 A 9  0.93  
10 ASP 60 A . ? ASP 59 A PRO 61 A ? PRO 60 A 10 8.22  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 48  ? LEU A 52  ? GLU A 47  LEU A 51  
A 2 LYS A 38  ? LEU A 42  ? LYS A 37  LEU A 41  
A 3 TYR A 24  ? ARG A 32  ? TYR A 23  ARG A 31  
A 4 ARG A 14  ? ALA A 17  ? ARG A 13  ALA A 16  
A 5 ILE A 56  ? CYS A 59  ? ILE A 55  CYS A 58  
B 1 GLU A 48  ? LEU A 52  ? GLU A 47  LEU A 51  
B 2 LYS A 38  ? LEU A 42  ? LYS A 37  LEU A 41  
B 3 TYR A 24  ? ARG A 32  ? TYR A 23  ARG A 31  
B 4 VAL A 110 ? SER A 113 ? VAL A 109 SER A 112 
B 5 THR A 66  ? ALA A 70  ? THR A 65  ALA A 69  
B 6 SER A 78  ? GLU A 88  ? SER A 77  GLU A 87  
B 7 GLU A 91  ? LYS A 98  ? GLU A 90  LYS A 97  
B 8 GLN A 101 ? TYR A 105 ? GLN A 100 TYR A 104 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O CYS A 49  ? O CYS A 48  N LEU A 41  ? N LEU A 40  
A 2 3 O LYS A 40  ? O LYS A 39  N THR A 31  ? N THR A 30  
A 3 4 O TYR A 26  ? O TYR A 25  N ALA A 17  ? N ALA A 16  
A 4 5 N ARG A 14  ? N ARG A 13  O CYS A 59  ? O CYS A 58  
B 1 2 O CYS A 49  ? O CYS A 48  N LEU A 41  ? N LEU A 40  
B 2 3 O LYS A 40  ? O LYS A 39  N THR A 31  ? N THR A 30  
B 3 4 N PHE A 25  ? N PHE A 24  O LEU A 112 ? O LEU A 111 
B 4 5 O ILE A 111 ? O ILE A 110 N THR A 69  ? N THR A 68  
B 5 6 N ALA A 70  ? N ALA A 69  O SER A 78  ? O SER A 77  
B 6 7 N VAL A 81  ? N VAL A 80  O GLU A 97  ? O GLU A 96  
B 7 8 N LYS A 98  ? N LYS A 97  O GLN A 101 ? O GLN A 100 
# 
_database_PDB_matrix.entry_id          1SSF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SSF 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ASN A 1 8   ? -15.282 16.926  -3.789  1.00 0.00 ? 7   ASN A N    1  
ATOM 2     C CA   . ASN A 1 8   ? -15.024 15.516  -3.824  1.00 0.00 ? 7   ASN A CA   1  
ATOM 3     C C    . ASN A 1 8   ? -13.513 15.405  -3.975  1.00 0.00 ? 7   ASN A C    1  
ATOM 4     O O    . ASN A 1 8   ? -12.873 16.368  -4.405  1.00 0.00 ? 7   ASN A O    1  
ATOM 5     C CB   . ASN A 1 8   ? -15.865 14.861  -4.961  1.00 0.00 ? 7   ASN A CB   1  
ATOM 6     C CG   . ASN A 1 8   ? -16.024 13.360  -4.741  1.00 0.00 ? 7   ASN A CG   1  
ATOM 7     O OD1  . ASN A 1 8   ? -15.384 12.772  -3.865  1.00 0.00 ? 7   ASN A OD1  1  
ATOM 8     N ND2  . ASN A 1 8   ? -16.900 12.709  -5.544  1.00 0.00 ? 7   ASN A ND2  1  
ATOM 9     H H    . ASN A 1 8   ? -14.523 17.492  -4.121  1.00 0.00 ? 7   ASN A H    1  
ATOM 10    H HA   . ASN A 1 8   ? -15.307 15.134  -2.853  1.00 0.00 ? 7   ASN A HA   1  
ATOM 11    H HB2  . ASN A 1 8   ? -16.880 15.316  -4.931  1.00 0.00 ? 7   ASN A HB2  1  
ATOM 12    H HB3  . ASN A 1 8   ? -15.428 15.059  -5.960  1.00 0.00 ? 7   ASN A HB3  1  
ATOM 13    H HD21 . ASN A 1 8   ? -17.447 13.227  -6.212  1.00 0.00 ? 7   ASN A HD21 1  
ATOM 14    H HD22 . ASN A 1 8   ? -16.958 11.717  -5.385  1.00 0.00 ? 7   ASN A HD22 1  
ATOM 15    N N    . SER A 1 9   ? -12.881 14.254  -3.601  1.00 0.00 ? 8   SER A N    1  
ATOM 16    C CA   . SER A 1 9   ? -11.419 14.069  -3.681  1.00 0.00 ? 8   SER A CA   1  
ATOM 17    C C    . SER A 1 9   ? -10.983 12.609  -3.614  1.00 0.00 ? 8   SER A C    1  
ATOM 18    O O    . SER A 1 9   ? -11.291 11.836  -4.514  1.00 0.00 ? 8   SER A O    1  
ATOM 19    C CB   . SER A 1 9   ? -10.584 14.966  -2.705  1.00 0.00 ? 8   SER A CB   1  
ATOM 20    O OG   . SER A 1 9   ? -10.627 16.333  -3.103  1.00 0.00 ? 8   SER A OG   1  
ATOM 21    H H    . SER A 1 9   ? -13.441 13.484  -3.282  1.00 0.00 ? 8   SER A H    1  
ATOM 22    H HA   . SER A 1 9   ? -11.126 14.331  -4.682  1.00 0.00 ? 8   SER A HA   1  
ATOM 23    H HB2  . SER A 1 9   ? -10.988 14.884  -1.672  1.00 0.00 ? 8   SER A HB2  1  
ATOM 24    H HB3  . SER A 1 9   ? -9.506  14.694  -2.696  1.00 0.00 ? 8   SER A HB3  1  
ATOM 25    H HG   . SER A 1 9   ? -11.463 16.452  -3.609  1.00 0.00 ? 8   SER A HG   1  
ATOM 26    N N    . PHE A 1 10  ? -10.221 12.183  -2.568  1.00 0.00 ? 9   PHE A N    1  
ATOM 27    C CA   . PHE A 1 10  ? -9.663  10.836  -2.422  1.00 0.00 ? 9   PHE A CA   1  
ATOM 28    C C    . PHE A 1 10  ? -10.279 10.122  -1.241  1.00 0.00 ? 9   PHE A C    1  
ATOM 29    O O    . PHE A 1 10  ? -9.644  9.378   -0.512  1.00 0.00 ? 9   PHE A O    1  
ATOM 30    C CB   . PHE A 1 10  ? -8.094  10.771  -2.480  1.00 0.00 ? 9   PHE A CB   1  
ATOM 31    C CG   . PHE A 1 10  ? -7.340  11.617  -1.502  1.00 0.00 ? 9   PHE A CG   1  
ATOM 32    C CD1  . PHE A 1 10  ? -6.956  11.007  -0.328  1.00 0.00 ? 9   PHE A CD1  1  
ATOM 33    C CD2  . PHE A 1 10  ? -6.819  12.858  -1.809  1.00 0.00 ? 9   PHE A CD2  1  
ATOM 34    C CE1  . PHE A 1 10  ? -5.971  11.535  0.453   1.00 0.00 ? 9   PHE A CE1  1  
ATOM 35    C CE2  . PHE A 1 10  ? -5.891  13.445  -0.967  1.00 0.00 ? 9   PHE A CE2  1  
ATOM 36    C CZ   . PHE A 1 10  ? -5.437  12.769  0.150   1.00 0.00 ? 9   PHE A CZ   1  
ATOM 37    H H    . PHE A 1 10  ? -9.986  12.806  -1.830  1.00 0.00 ? 9   PHE A H    1  
ATOM 38    H HA   . PHE A 1 10  ? -9.983  10.157  -3.209  1.00 0.00 ? 9   PHE A HA   1  
ATOM 39    H HB2  . PHE A 1 10  ? -7.768  9.754   -2.228  1.00 0.00 ? 9   PHE A HB2  1  
ATOM 40    H HB3  . PHE A 1 10  ? -7.660  10.897  -3.499  1.00 0.00 ? 9   PHE A HB3  1  
ATOM 41    H HD1  . PHE A 1 10  ? -7.342  10.031  -0.073  1.00 0.00 ? 9   PHE A HD1  1  
ATOM 42    H HD2  . PHE A 1 10  ? -7.080  13.340  -2.741  1.00 0.00 ? 9   PHE A HD2  1  
ATOM 43    H HE1  . PHE A 1 10  ? -5.586  10.893  1.232   1.00 0.00 ? 9   PHE A HE1  1  
ATOM 44    H HE2  . PHE A 1 10  ? -5.468  14.404  -1.225  1.00 0.00 ? 9   PHE A HE2  1  
ATOM 45    H HZ   . PHE A 1 10  ? -4.648  13.186  0.764   1.00 0.00 ? 9   PHE A HZ   1  
ATOM 46    N N    . VAL A 1 11  ? -11.604 10.267  -1.038  1.00 0.00 ? 10  VAL A N    1  
ATOM 47    C CA   . VAL A 1 11  ? -12.348 9.532   -0.005  1.00 0.00 ? 10  VAL A CA   1  
ATOM 48    C C    . VAL A 1 11  ? -12.679 8.050   -0.272  1.00 0.00 ? 10  VAL A C    1  
ATOM 49    O O    . VAL A 1 11  ? -13.344 7.406   0.525   1.00 0.00 ? 10  VAL A O    1  
ATOM 50    C CB   . VAL A 1 11  ? -13.506 10.349  0.514   1.00 0.00 ? 10  VAL A CB   1  
ATOM 51    C CG1  . VAL A 1 11  ? -12.919 11.750  0.694   1.00 0.00 ? 10  VAL A CG1  1  
ATOM 52    C CG2  . VAL A 1 11  ? -14.698 10.413  -0.444  1.00 0.00 ? 10  VAL A CG2  1  
ATOM 53    H H    . VAL A 1 11  ? -12.118 10.980  -1.547  1.00 0.00 ? 10  VAL A H    1  
ATOM 54    H HA   . VAL A 1 11  ? -11.713 9.486   0.869   1.00 0.00 ? 10  VAL A HA   1  
ATOM 55    H HB   . VAL A 1 11  ? -13.838 9.954   1.496   1.00 0.00 ? 10  VAL A HB   1  
ATOM 56    H HG11 . VAL A 1 11  ? -13.578 12.399  1.302   1.00 0.00 ? 10  VAL A HG11 1  
ATOM 57    H HG12 . VAL A 1 11  ? -12.799 12.202  -0.313  1.00 0.00 ? 10  VAL A HG12 1  
ATOM 58    H HG13 . VAL A 1 11  ? -11.911 11.664  1.148   1.00 0.00 ? 10  VAL A HG13 1  
ATOM 59    H HG21 . VAL A 1 11  ? -14.372 10.820  -1.427  1.00 0.00 ? 10  VAL A HG21 1  
ATOM 60    H HG22 . VAL A 1 11  ? -15.452 11.097  0.005   1.00 0.00 ? 10  VAL A HG22 1  
ATOM 61    H HG23 . VAL A 1 11  ? -15.160 9.414   -0.574  1.00 0.00 ? 10  VAL A HG23 1  
ATOM 62    N N    . GLY A 1 12  ? -12.159 7.480   -1.385  1.00 0.00 ? 11  GLY A N    1  
ATOM 63    C CA   . GLY A 1 12  ? -12.272 6.091   -1.833  1.00 0.00 ? 11  GLY A CA   1  
ATOM 64    C C    . GLY A 1 12  ? -10.941 5.608   -2.370  1.00 0.00 ? 11  GLY A C    1  
ATOM 65    O O    . GLY A 1 12  ? -10.873 4.775   -3.267  1.00 0.00 ? 11  GLY A O    1  
ATOM 66    H H    . GLY A 1 12  ? -11.605 8.082   -1.937  1.00 0.00 ? 11  GLY A H    1  
ATOM 67    H HA2  . GLY A 1 12  ? -12.514 5.449   -0.975  1.00 0.00 ? 11  GLY A HA2  1  
ATOM 68    H HA3  . GLY A 1 12  ? -12.970 6.086   -2.680  1.00 0.00 ? 11  GLY A HA3  1  
ATOM 69    N N    . LEU A 1 13  ? -9.841  6.157   -1.796  1.00 0.00 ? 12  LEU A N    1  
ATOM 70    C CA   . LEU A 1 13  ? -8.405  5.973   -1.993  1.00 0.00 ? 12  LEU A CA   1  
ATOM 71    C C    . LEU A 1 13  ? -7.855  4.538   -1.750  1.00 0.00 ? 12  LEU A C    1  
ATOM 72    O O    . LEU A 1 13  ? -8.547  3.657   -1.249  1.00 0.00 ? 12  LEU A O    1  
ATOM 73    C CB   . LEU A 1 13  ? -7.823  7.261   -1.290  1.00 0.00 ? 12  LEU A CB   1  
ATOM 74    C CG   . LEU A 1 13  ? -6.417  7.512   -0.741  1.00 0.00 ? 12  LEU A CG   1  
ATOM 75    C CD1  . LEU A 1 13  ? -6.541  7.071   0.719   1.00 0.00 ? 12  LEU A CD1  1  
ATOM 76    C CD2  . LEU A 1 13  ? -5.427  6.924   -1.681  1.00 0.00 ? 12  LEU A CD2  1  
ATOM 77    H H    . LEU A 1 13  ? -10.006 6.836   -1.087  1.00 0.00 ? 12  LEU A H    1  
ATOM 78    H HA   . LEU A 1 13  ? -8.234  6.120   -3.053  1.00 0.00 ? 12  LEU A HA   1  
ATOM 79    H HB2  . LEU A 1 13  ? -8.062  8.018   -2.047  1.00 0.00 ? 12  LEU A HB2  1  
ATOM 80    H HB3  . LEU A 1 13  ? -8.428  7.467   -0.383  1.00 0.00 ? 12  LEU A HB3  1  
ATOM 81    H HG   . LEU A 1 13  ? -5.972  8.550   -0.680  1.00 0.00 ? 12  LEU A HG   1  
ATOM 82    H HD11 . LEU A 1 13  ? -5.630  7.033   1.317   1.00 0.00 ? 12  LEU A HD11 1  
ATOM 83    H HD12 . LEU A 1 13  ? -7.027  6.079   0.741   1.00 0.00 ? 12  LEU A HD12 1  
ATOM 84    H HD13 . LEU A 1 13  ? -7.204  7.792   1.239   1.00 0.00 ? 12  LEU A HD13 1  
ATOM 85    H HD21 . LEU A 1 13  ? -4.519  7.559   -1.675  1.00 0.00 ? 12  LEU A HD21 1  
ATOM 86    H HD22 . LEU A 1 13  ? -5.869  6.988   -2.703  1.00 0.00 ? 12  LEU A HD22 1  
ATOM 87    H HD23 . LEU A 1 13  ? -5.278  5.912   -1.254  1.00 0.00 ? 12  LEU A HD23 1  
ATOM 88    N N    . ARG A 1 14  ? -6.591  4.274   -2.182  1.00 0.00 ? 13  ARG A N    1  
ATOM 89    C CA   . ARG A 1 14  ? -5.811  3.036   -2.217  1.00 0.00 ? 13  ARG A CA   1  
ATOM 90    C C    . ARG A 1 14  ? -4.764  3.150   -1.113  1.00 0.00 ? 13  ARG A C    1  
ATOM 91    O O    . ARG A 1 14  ? -3.967  4.081   -1.151  1.00 0.00 ? 13  ARG A O    1  
ATOM 92    C CB   . ARG A 1 14  ? -5.110  2.911   -3.595  1.00 0.00 ? 13  ARG A CB   1  
ATOM 93    C CG   . ARG A 1 14  ? -6.079  2.780   -4.789  1.00 0.00 ? 13  ARG A CG   1  
ATOM 94    C CD   . ARG A 1 14  ? -5.319  2.585   -6.109  1.00 0.00 ? 13  ARG A CD   1  
ATOM 95    N NE   . ARG A 1 14  ? -6.291  2.440   -7.245  1.00 0.00 ? 13  ARG A NE   1  
ATOM 96    C CZ   . ARG A 1 14  ? -5.911  2.038   -8.498  1.00 0.00 ? 13  ARG A CZ   1  
ATOM 97    N NH1  . ARG A 1 14  ? -4.624  1.664   -8.757  1.00 0.00 ? 13  ARG A NH1  1  
ATOM 98    N NH2  . ARG A 1 14  ? -6.836  2.008   -9.502  1.00 0.00 ? 13  ARG A NH2  1  
ATOM 99    H H    . ARG A 1 14  ? -6.024  5.062   -2.453  1.00 0.00 ? 13  ARG A H    1  
ATOM 100   H HA   . ARG A 1 14  ? -6.433  2.171   -2.097  1.00 0.00 ? 13  ARG A HA   1  
ATOM 101   H HB2  . ARG A 1 14  ? -4.460  3.795   -3.783  1.00 0.00 ? 13  ARG A HB2  1  
ATOM 102   H HB3  . ARG A 1 14  ? -4.452  2.013   -3.598  1.00 0.00 ? 13  ARG A HB3  1  
ATOM 103   H HG2  . ARG A 1 14  ? -6.746  1.909   -4.615  1.00 0.00 ? 13  ARG A HG2  1  
ATOM 104   H HG3  . ARG A 1 14  ? -6.712  3.692   -4.853  1.00 0.00 ? 13  ARG A HG3  1  
ATOM 105   H HD2  . ARG A 1 14  ? -4.669  3.465   -6.308  1.00 0.00 ? 13  ARG A HD2  1  
ATOM 106   H HD3  . ARG A 1 14  ? -4.692  1.667   -6.039  1.00 0.00 ? 13  ARG A HD3  1  
ATOM 107   H HE   . ARG A 1 14  ? -7.245  2.701   -7.092  1.00 0.00 ? 13  ARG A HE   1  
ATOM 108   H HH11 . ARG A 1 14  ? -3.943  1.683   -8.025  1.00 0.00 ? 13  ARG A HH11 1  
ATOM 109   H HH12 . ARG A 1 14  ? -4.363  1.369   -9.676  1.00 0.00 ? 13  ARG A HH12 1  
ATOM 110   H HH21 . ARG A 1 14  ? -7.781  2.279   -9.320  1.00 0.00 ? 13  ARG A HH21 1  
ATOM 111   H HH22 . ARG A 1 14  ? -6.568  1.713   -10.419 1.00 0.00 ? 13  ARG A HH22 1  
ATOM 112   N N    . VAL A 1 15  ? -4.712  2.304   -0.047  1.00 0.00 ? 14  VAL A N    1  
ATOM 113   C CA   . VAL A 1 15  ? -3.846  2.585   1.113   1.00 0.00 ? 14  VAL A CA   1  
ATOM 114   C C    . VAL A 1 15  ? -2.832  1.530   1.487   1.00 0.00 ? 14  VAL A C    1  
ATOM 115   O O    . VAL A 1 15  ? -2.793  0.395   1.018   1.00 0.00 ? 14  VAL A O    1  
ATOM 116   C CB   . VAL A 1 15  ? -4.582  3.203   2.331   1.00 0.00 ? 14  VAL A CB   1  
ATOM 117   C CG1  . VAL A 1 15  ? -5.313  4.427   1.817   1.00 0.00 ? 14  VAL A CG1  1  
ATOM 118   C CG2  . VAL A 1 15  ? -5.664  2.430   3.066   1.00 0.00 ? 14  VAL A CG2  1  
ATOM 119   H H    . VAL A 1 15  ? -5.285  1.486   0.051   1.00 0.00 ? 14  VAL A H    1  
ATOM 120   H HA   . VAL A 1 15  ? -3.167  3.386   0.852   1.00 0.00 ? 14  VAL A HA   1  
ATOM 121   H HB   . VAL A 1 15  ? -3.848  3.516   3.105   1.00 0.00 ? 14  VAL A HB   1  
ATOM 122   H HG11 . VAL A 1 15  ? -5.652  5.059   2.666   1.00 0.00 ? 14  VAL A HG11 1  
ATOM 123   H HG12 . VAL A 1 15  ? -6.190  4.111   1.210   1.00 0.00 ? 14  VAL A HG12 1  
ATOM 124   H HG13 . VAL A 1 15  ? -4.656  5.026   1.161   1.00 0.00 ? 14  VAL A HG13 1  
ATOM 125   H HG21 . VAL A 1 15  ? -5.260  1.550   3.588   1.00 0.00 ? 14  VAL A HG21 1  
ATOM 126   H HG22 . VAL A 1 15  ? -6.462  2.151   2.362   1.00 0.00 ? 14  VAL A HG22 1  
ATOM 127   H HG23 . VAL A 1 15  ? -6.141  3.089   3.826   1.00 0.00 ? 14  VAL A HG23 1  
ATOM 128   N N    . VAL A 1 16  ? -1.897  1.915   2.376   1.00 0.00 ? 15  VAL A N    1  
ATOM 129   C CA   . VAL A 1 16  ? -0.804  1.127   2.934   1.00 0.00 ? 15  VAL A CA   1  
ATOM 130   C C    . VAL A 1 16  ? -1.058  1.062   4.404   1.00 0.00 ? 15  VAL A C    1  
ATOM 131   O O    . VAL A 1 16  ? -1.626  2.007   4.937   1.00 0.00 ? 15  VAL A O    1  
ATOM 132   C CB   . VAL A 1 16  ? 0.564   1.718   2.685   1.00 0.00 ? 15  VAL A CB   1  
ATOM 133   C CG1  . VAL A 1 16  ? 0.994   1.243   1.281   1.00 0.00 ? 15  VAL A CG1  1  
ATOM 134   C CG2  . VAL A 1 16  ? 0.484   3.243   2.868   1.00 0.00 ? 15  VAL A CG2  1  
ATOM 135   H H    . VAL A 1 16  ? -1.923  2.848   2.726   1.00 0.00 ? 15  VAL A H    1  
ATOM 136   H HA   . VAL A 1 16  ? -0.815  0.122   2.559   1.00 0.00 ? 15  VAL A HA   1  
ATOM 137   H HB   . VAL A 1 16  ? 1.331   1.327   3.399   1.00 0.00 ? 15  VAL A HB   1  
ATOM 138   H HG11 . VAL A 1 16  ? 0.277   1.614   0.521   1.00 0.00 ? 15  VAL A HG11 1  
ATOM 139   H HG12 . VAL A 1 16  ? 0.995   0.122   1.263   1.00 0.00 ? 15  VAL A HG12 1  
ATOM 140   H HG13 . VAL A 1 16  ? 2.007   1.619   1.043   1.00 0.00 ? 15  VAL A HG13 1  
ATOM 141   H HG21 . VAL A 1 16  ? 1.487   3.679   2.837   1.00 0.00 ? 15  VAL A HG21 1  
ATOM 142   H HG22 . VAL A 1 16  ? 0.062   3.541   3.851   1.00 0.00 ? 15  VAL A HG22 1  
ATOM 143   H HG23 . VAL A 1 16  ? -0.107  3.721   2.062   1.00 0.00 ? 15  VAL A HG23 1  
ATOM 144   N N    . ALA A 1 17  ? -0.653  -0.060  5.043   1.00 0.00 ? 16  ALA A N    1  
ATOM 145   C CA   . ALA A 1 17  ? -0.945  -0.417  6.403   1.00 0.00 ? 16  ALA A CA   1  
ATOM 146   C C    . ALA A 1 17  ? 0.291   -0.772  7.214   1.00 0.00 ? 16  ALA A C    1  
ATOM 147   O O    . ALA A 1 17  ? 0.895   -1.833  7.085   1.00 0.00 ? 16  ALA A O    1  
ATOM 148   C CB   . ALA A 1 17  ? -1.939  -1.605  6.321   1.00 0.00 ? 16  ALA A CB   1  
ATOM 149   H H    . ALA A 1 17  ? -0.163  -0.773  4.533   1.00 0.00 ? 16  ALA A H    1  
ATOM 150   H HA   . ALA A 1 17  ? -1.402  0.413   6.921   1.00 0.00 ? 16  ALA A HA   1  
ATOM 151   H HB1  . ALA A 1 17  ? -1.634  -2.369  5.565   1.00 0.00 ? 16  ALA A HB1  1  
ATOM 152   H HB2  . ALA A 1 17  ? -2.925  -1.240  5.959   1.00 0.00 ? 16  ALA A HB2  1  
ATOM 153   H HB3  . ALA A 1 17  ? -2.086  -2.113  7.295   1.00 0.00 ? 16  ALA A HB3  1  
ATOM 154   N N    . LYS A 1 18  ? 0.650   0.140   8.131   1.00 0.00 ? 17  LYS A N    1  
ATOM 155   C CA   . LYS A 1 18  ? 1.740   0.072   9.069   1.00 0.00 ? 17  LYS A CA   1  
ATOM 156   C C    . LYS A 1 18  ? 1.100   0.446   10.396  1.00 0.00 ? 17  LYS A C    1  
ATOM 157   O O    . LYS A 1 18  ? 0.506   1.502   10.477  1.00 0.00 ? 17  LYS A O    1  
ATOM 158   C CB   . LYS A 1 18  ? 2.870   1.108   8.720   1.00 0.00 ? 17  LYS A CB   1  
ATOM 159   C CG   . LYS A 1 18  ? 2.744   1.941   7.416   1.00 0.00 ? 17  LYS A CG   1  
ATOM 160   C CD   . LYS A 1 18  ? 3.354   3.347   7.575   1.00 0.00 ? 17  LYS A CD   1  
ATOM 161   C CE   . LYS A 1 18  ? 4.745   3.474   6.961   1.00 0.00 ? 17  LYS A CE   1  
ATOM 162   N NZ   . LYS A 1 18  ? 5.296   4.838   7.107   1.00 0.00 ? 17  LYS A NZ   1  
ATOM 163   H H    . LYS A 1 18  ? 0.143   1.003   8.198   1.00 0.00 ? 17  LYS A H    1  
ATOM 164   H HA   . LYS A 1 18  ? 2.157   -0.922  9.145   1.00 0.00 ? 17  LYS A HA   1  
ATOM 165   H HB2  . LYS A 1 18  ? 3.000   1.855   9.540   1.00 0.00 ? 17  LYS A HB2  1  
ATOM 166   H HB3  . LYS A 1 18  ? 3.801   0.520   8.677   1.00 0.00 ? 17  LYS A HB3  1  
ATOM 167   H HG2  . LYS A 1 18  ? 3.151   1.456   6.490   1.00 0.00 ? 17  LYS A HG2  1  
ATOM 168   H HG3  . LYS A 1 18  ? 1.682   2.123   7.188   1.00 0.00 ? 17  LYS A HG3  1  
ATOM 169   H HD2  . LYS A 1 18  ? 2.669   4.070   7.076   1.00 0.00 ? 17  LYS A HD2  1  
ATOM 170   H HD3  . LYS A 1 18  ? 3.381   3.637   8.648   1.00 0.00 ? 17  LYS A HD3  1  
ATOM 171   H HE2  . LYS A 1 18  ? 5.447   2.777   7.467   1.00 0.00 ? 17  LYS A HE2  1  
ATOM 172   H HE3  . LYS A 1 18  ? 4.685   3.224   5.868   1.00 0.00 ? 17  LYS A HE3  1  
ATOM 173   H HZ1  . LYS A 1 18  ? 6.242   4.877   6.677   1.00 0.00 ? 17  LYS A HZ1  1  
ATOM 174   H HZ2  . LYS A 1 18  ? 5.362   5.080   8.116   1.00 0.00 ? 17  LYS A HZ2  1  
ATOM 175   H HZ3  . LYS A 1 18  ? 4.670   5.517   6.627   1.00 0.00 ? 17  LYS A HZ3  1  
ATOM 176   N N    . TRP A 1 19  ? 1.176   -0.338  11.494  1.00 0.00 ? 18  TRP A N    1  
ATOM 177   C CA   . TRP A 1 19  ? 0.672   0.096   12.812  1.00 0.00 ? 18  TRP A CA   1  
ATOM 178   C C    . TRP A 1 19  ? 1.769   0.805   13.631  1.00 0.00 ? 18  TRP A C    1  
ATOM 179   O O    . TRP A 1 19  ? 1.630   1.946   14.070  1.00 0.00 ? 18  TRP A O    1  
ATOM 180   C CB   . TRP A 1 19  ? -0.066  -1.038  13.568  1.00 0.00 ? 18  TRP A CB   1  
ATOM 181   C CG   . TRP A 1 19  ? -1.293  -1.537  12.832  1.00 0.00 ? 18  TRP A CG   1  
ATOM 182   C CD1  . TRP A 1 19  ? -1.558  -2.680  12.122  1.00 0.00 ? 18  TRP A CD1  1  
ATOM 183   C CD2  . TRP A 1 19  ? -2.502  -0.783  12.867  1.00 0.00 ? 18  TRP A CD2  1  
ATOM 184   N NE1  . TRP A 1 19  ? -2.882  -2.681  11.713  1.00 0.00 ? 18  TRP A NE1  1  
ATOM 185   C CE2  . TRP A 1 19  ? -3.469  -1.520  12.178  1.00 0.00 ? 18  TRP A CE2  1  
ATOM 186   C CE3  . TRP A 1 19  ? -2.780  0.412   13.459  1.00 0.00 ? 18  TRP A CE3  1  
ATOM 187   C CZ2  . TRP A 1 19  ? -4.747  -1.063  12.077  1.00 0.00 ? 18  TRP A CZ2  1  
ATOM 188   C CZ3  . TRP A 1 19  ? -4.086  0.807   13.447  1.00 0.00 ? 18  TRP A CZ3  1  
ATOM 189   C CH2  . TRP A 1 19  ? -5.049  0.100   12.757  1.00 0.00 ? 18  TRP A CH2  1  
ATOM 190   H H    . TRP A 1 19  ? 1.640   -1.212  11.440  1.00 0.00 ? 18  TRP A H    1  
ATOM 191   H HA   . TRP A 1 19  ? -0.085  0.865   12.678  1.00 0.00 ? 18  TRP A HA   1  
ATOM 192   H HB2  . TRP A 1 19  ? 0.576   -1.903  13.749  1.00 0.00 ? 18  TRP A HB2  1  
ATOM 193   H HB3  . TRP A 1 19  ? -0.411  -0.658  14.559  1.00 0.00 ? 18  TRP A HB3  1  
ATOM 194   H HD1  . TRP A 1 19  ? -0.838  -3.465  11.942  1.00 0.00 ? 18  TRP A HD1  1  
ATOM 195   H HE1  . TRP A 1 19  ? -3.380  -3.413  11.289  1.00 0.00 ? 18  TRP A HE1  1  
ATOM 196   H HE3  . TRP A 1 19  ? -2.046  1.036   13.964  1.00 0.00 ? 18  TRP A HE3  1  
ATOM 197   H HZ2  . TRP A 1 19  ? -5.516  -1.610  11.550  1.00 0.00 ? 18  TRP A HZ2  1  
ATOM 198   H HZ3  . TRP A 1 19  ? -4.326  1.688   14.012  1.00 0.00 ? 18  TRP A HZ3  1  
ATOM 199   H HH2  . TRP A 1 19  ? -6.062  0.465   12.754  1.00 0.00 ? 18  TRP A HH2  1  
ATOM 200   N N    . SER A 1 20  ? 2.938   0.150   13.807  1.00 0.00 ? 19  SER A N    1  
ATOM 201   C CA   . SER A 1 20  ? 4.145   0.713   14.392  1.00 0.00 ? 19  SER A CA   1  
ATOM 202   C C    . SER A 1 20  ? 5.150   0.778   13.252  1.00 0.00 ? 19  SER A C    1  
ATOM 203   O O    . SER A 1 20  ? 5.149   -0.091  12.376  1.00 0.00 ? 19  SER A O    1  
ATOM 204   C CB   . SER A 1 20  ? 4.689   -0.138  15.595  1.00 0.00 ? 19  SER A CB   1  
ATOM 205   O OG   . SER A 1 20  ? 4.858   -1.534  15.303  1.00 0.00 ? 19  SER A OG   1  
ATOM 206   H H    . SER A 1 20  ? 3.067   -0.778  13.466  1.00 0.00 ? 19  SER A H    1  
ATOM 207   H HA   . SER A 1 20  ? 3.979   1.728   14.734  1.00 0.00 ? 19  SER A HA   1  
ATOM 208   H HB2  . SER A 1 20  ? 5.638   0.284   15.995  1.00 0.00 ? 19  SER A HB2  1  
ATOM 209   H HB3  . SER A 1 20  ? 3.930   -0.068  16.407  1.00 0.00 ? 19  SER A HB3  1  
ATOM 210   H HG   . SER A 1 20  ? 5.820   -1.724  15.164  1.00 0.00 ? 19  SER A HG   1  
ATOM 211   N N    . SER A 1 21  ? 6.083   1.786   13.209  1.00 0.00 ? 20  SER A N    1  
ATOM 212   C CA   . SER A 1 21  ? 7.115   1.799   12.153  1.00 0.00 ? 20  SER A CA   1  
ATOM 213   C C    . SER A 1 21  ? 8.245   0.872   12.584  1.00 0.00 ? 20  SER A C    1  
ATOM 214   O O    . SER A 1 21  ? 9.020   1.134   13.496  1.00 0.00 ? 20  SER A O    1  
ATOM 215   C CB   . SER A 1 21  ? 7.688   3.213   11.833  1.00 0.00 ? 20  SER A CB   1  
ATOM 216   O OG   . SER A 1 21  ? 6.761   3.922   11.014  1.00 0.00 ? 20  SER A OG   1  
ATOM 217   H H    . SER A 1 21  ? 6.116   2.516   13.882  1.00 0.00 ? 20  SER A H    1  
ATOM 218   H HA   . SER A 1 21  ? 6.706   1.426   11.219  1.00 0.00 ? 20  SER A HA   1  
ATOM 219   H HB2  . SER A 1 21  ? 7.883   3.772   12.774  1.00 0.00 ? 20  SER A HB2  1  
ATOM 220   H HB3  . SER A 1 21  ? 8.633   3.149   11.247  1.00 0.00 ? 20  SER A HB3  1  
ATOM 221   H HG   . SER A 1 21  ? 6.954   4.868   11.038  1.00 0.00 ? 20  SER A HG   1  
ATOM 222   N N    . ASN A 1 22  ? 8.275   -0.270  11.870  1.00 0.00 ? 21  ASN A N    1  
ATOM 223   C CA   . ASN A 1 22  ? 9.082   -1.451  12.117  1.00 0.00 ? 21  ASN A CA   1  
ATOM 224   C C    . ASN A 1 22  ? 9.836   -1.864  10.874  1.00 0.00 ? 21  ASN A C    1  
ATOM 225   O O    . ASN A 1 22  ? 10.462  -2.918  10.792  1.00 0.00 ? 21  ASN A O    1  
ATOM 226   C CB   . ASN A 1 22  ? 8.075   -2.555  12.542  1.00 0.00 ? 21  ASN A CB   1  
ATOM 227   C CG   . ASN A 1 22  ? 8.127   -2.788  14.053  1.00 0.00 ? 21  ASN A CG   1  
ATOM 228   O OD1  . ASN A 1 22  ? 7.299   -2.306  14.830  1.00 0.00 ? 21  ASN A OD1  1  
ATOM 229   N ND2  . ASN A 1 22  ? 9.155   -3.557  14.497  1.00 0.00 ? 21  ASN A ND2  1  
ATOM 230   H H    . ASN A 1 22  ? 7.551   -0.385  11.192  1.00 0.00 ? 21  ASN A H    1  
ATOM 231   H HA   . ASN A 1 22  ? 9.838   -1.230  12.857  1.00 0.00 ? 21  ASN A HA   1  
ATOM 232   H HB2  . ASN A 1 22  ? 7.069   -2.173  12.235  1.00 0.00 ? 21  ASN A HB2  1  
ATOM 233   H HB3  . ASN A 1 22  ? 8.236   -3.518  12.020  1.00 0.00 ? 21  ASN A HB3  1  
ATOM 234   H HD21 . ASN A 1 22  ? 9.785   -3.970  13.836  1.00 0.00 ? 21  ASN A HD21 1  
ATOM 235   H HD22 . ASN A 1 22  ? 9.223   -3.712  15.484  1.00 0.00 ? 21  ASN A HD22 1  
ATOM 236   N N    . GLY A 1 23  ? 9.766   -0.970  9.885   1.00 0.00 ? 22  GLY A N    1  
ATOM 237   C CA   . GLY A 1 23  ? 10.450  -1.002  8.617   1.00 0.00 ? 22  GLY A CA   1  
ATOM 238   C C    . GLY A 1 23  ? 9.686   -1.463  7.420   1.00 0.00 ? 22  GLY A C    1  
ATOM 239   O O    . GLY A 1 23  ? 10.148  -1.112  6.352   1.00 0.00 ? 22  GLY A O    1  
ATOM 240   H H    . GLY A 1 23  ? 9.241   -0.153  10.106  1.00 0.00 ? 22  GLY A H    1  
ATOM 241   H HA2  . GLY A 1 23  ? 10.784  -0.005  8.412   1.00 0.00 ? 22  GLY A HA2  1  
ATOM 242   H HA3  . GLY A 1 23  ? 11.299  -1.671  8.684   1.00 0.00 ? 22  GLY A HA3  1  
ATOM 243   N N    . TYR A 1 24  ? 8.536   -2.189  7.497   1.00 0.00 ? 23  TYR A N    1  
ATOM 244   C CA   . TYR A 1 24  ? 7.669   -2.577  6.365   1.00 0.00 ? 23  TYR A CA   1  
ATOM 245   C C    . TYR A 1 24  ? 6.161   -2.427  6.560   1.00 0.00 ? 23  TYR A C    1  
ATOM 246   O O    . TYR A 1 24  ? 5.662   -2.554  7.674   1.00 0.00 ? 23  TYR A O    1  
ATOM 247   C CB   . TYR A 1 24  ? 8.054   -3.893  5.641   1.00 0.00 ? 23  TYR A CB   1  
ATOM 248   C CG   . TYR A 1 24  ? 8.672   -4.922  6.529   1.00 0.00 ? 23  TYR A CG   1  
ATOM 249   C CD1  . TYR A 1 24  ? 7.918   -5.614  7.460   1.00 0.00 ? 23  TYR A CD1  1  
ATOM 250   C CD2  . TYR A 1 24  ? 9.996   -5.260  6.341   1.00 0.00 ? 23  TYR A CD2  1  
ATOM 251   C CE1  . TYR A 1 24  ? 8.481   -6.657  8.168   1.00 0.00 ? 23  TYR A CE1  1  
ATOM 252   C CE2  . TYR A 1 24  ? 10.550  -6.319  7.028   1.00 0.00 ? 23  TYR A CE2  1  
ATOM 253   C CZ   . TYR A 1 24  ? 9.791   -7.022  7.941   1.00 0.00 ? 23  TYR A CZ   1  
ATOM 254   O OH   . TYR A 1 24  ? 10.318  -8.156  8.584   1.00 0.00 ? 23  TYR A OH   1  
ATOM 255   H H    . TYR A 1 24  ? 8.178   -2.455  8.385   1.00 0.00 ? 23  TYR A H    1  
ATOM 256   H HA   . TYR A 1 24  ? 7.825   -1.824  5.606   1.00 0.00 ? 23  TYR A HA   1  
ATOM 257   H HB2  . TYR A 1 24  ? 7.206   -4.377  5.107   1.00 0.00 ? 23  TYR A HB2  1  
ATOM 258   H HB3  . TYR A 1 24  ? 8.798   -3.602  4.863   1.00 0.00 ? 23  TYR A HB3  1  
ATOM 259   H HD1  . TYR A 1 24  ? 6.872   -5.365  7.595   1.00 0.00 ? 23  TYR A HD1  1  
ATOM 260   H HD2  . TYR A 1 24  ? 10.586  -4.734  5.601   1.00 0.00 ? 23  TYR A HD2  1  
ATOM 261   H HE1  . TYR A 1 24  ? 7.881   -7.225  8.864   1.00 0.00 ? 23  TYR A HE1  1  
ATOM 262   H HE2  . TYR A 1 24  ? 11.554  -6.623  6.774   1.00 0.00 ? 23  TYR A HE2  1  
ATOM 263   H HH   . TYR A 1 24  ? 10.205  -8.918  7.980   1.00 0.00 ? 23  TYR A HH   1  
ATOM 264   N N    . PHE A 1 25  ? 5.393   -2.159  5.451   1.00 0.00 ? 24  PHE A N    1  
ATOM 265   C CA   . PHE A 1 25  ? 3.934   -1.948  5.375   1.00 0.00 ? 24  PHE A CA   1  
ATOM 266   C C    . PHE A 1 25  ? 3.272   -3.002  4.505   1.00 0.00 ? 24  PHE A C    1  
ATOM 267   O O    . PHE A 1 25  ? 3.792   -3.460  3.485   1.00 0.00 ? 24  PHE A O    1  
ATOM 268   C CB   . PHE A 1 25  ? 3.361   -0.537  4.891   1.00 0.00 ? 24  PHE A CB   1  
ATOM 269   C CG   . PHE A 1 25  ? 4.354   0.588   4.682   1.00 0.00 ? 24  PHE A CG   1  
ATOM 270   C CD1  . PHE A 1 25  ? 5.421   0.715   5.545   1.00 0.00 ? 24  PHE A CD1  1  
ATOM 271   C CD2  . PHE A 1 25  ? 4.237   1.519   3.640   1.00 0.00 ? 24  PHE A CD2  1  
ATOM 272   C CE1  . PHE A 1 25  ? 6.510   1.467   5.225   1.00 0.00 ? 24  PHE A CE1  1  
ATOM 273   C CE2  . PHE A 1 25  ? 5.330   2.291   3.319   1.00 0.00 ? 24  PHE A CE2  1  
ATOM 274   C CZ   . PHE A 1 25  ? 6.458   2.234   4.093   1.00 0.00 ? 24  PHE A CZ   1  
ATOM 275   H H    . PHE A 1 25  ? 5.851   -2.083  4.558   1.00 0.00 ? 24  PHE A H    1  
ATOM 276   H HA   . PHE A 1 25  ? 3.508   -2.078  6.362   1.00 0.00 ? 24  PHE A HA   1  
ATOM 277   H HB2  . PHE A 1 25  ? 2.775   -0.597  3.949   1.00 0.00 ? 24  PHE A HB2  1  
ATOM 278   H HB3  . PHE A 1 25  ? 2.634   -0.207  5.657   1.00 0.00 ? 24  PHE A HB3  1  
ATOM 279   H HD1  . PHE A 1 25  ? 5.431   0.177   6.478   1.00 0.00 ? 24  PHE A HD1  1  
ATOM 280   H HD2  . PHE A 1 25  ? 3.442   1.492   2.890   1.00 0.00 ? 24  PHE A HD2  1  
ATOM 281   H HE1  . PHE A 1 25  ? 7.370   1.466   5.878   1.00 0.00 ? 24  PHE A HE1  1  
ATOM 282   H HE2  . PHE A 1 25  ? 5.314   2.897   2.425   1.00 0.00 ? 24  PHE A HE2  1  
ATOM 283   H HZ   . PHE A 1 25  ? 7.298   2.823   3.843   1.00 0.00 ? 24  PHE A HZ   1  
ATOM 284   N N    . TYR A 1 26  ? 2.021   -3.287  4.909   1.00 0.00 ? 25  TYR A N    1  
ATOM 285   C CA   . TYR A 1 26  ? 0.980   -4.122  4.358   1.00 0.00 ? 25  TYR A CA   1  
ATOM 286   C C    . TYR A 1 26  ? 0.044   -3.229  3.550   1.00 0.00 ? 25  TYR A C    1  
ATOM 287   O O    . TYR A 1 26  ? 0.307   -2.058  3.307   1.00 0.00 ? 25  TYR A O    1  
ATOM 288   C CB   . TYR A 1 26  ? 0.282   -4.907  5.508   1.00 0.00 ? 25  TYR A CB   1  
ATOM 289   C CG   . TYR A 1 26  ? 1.315   -5.875  6.020   1.00 0.00 ? 25  TYR A CG   1  
ATOM 290   C CD1  . TYR A 1 26  ? 1.548   -7.030  5.299   1.00 0.00 ? 25  TYR A CD1  1  
ATOM 291   C CD2  . TYR A 1 26  ? 2.154   -5.561  7.079   1.00 0.00 ? 25  TYR A CD2  1  
ATOM 292   C CE1  . TYR A 1 26  ? 2.647   -7.817  5.564   1.00 0.00 ? 25  TYR A CE1  1  
ATOM 293   C CE2  . TYR A 1 26  ? 3.261   -6.347  7.345   1.00 0.00 ? 25  TYR A CE2  1  
ATOM 294   C CZ   . TYR A 1 26  ? 3.519   -7.456  6.567   1.00 0.00 ? 25  TYR A CZ   1  
ATOM 295   O OH   . TYR A 1 26  ? 4.679   -8.223  6.780   1.00 0.00 ? 25  TYR A OH   1  
ATOM 296   H H    . TYR A 1 26  ? 1.687   -2.808  5.727   1.00 0.00 ? 25  TYR A H    1  
ATOM 297   H HA   . TYR A 1 26  ? 1.414   -4.813  3.641   1.00 0.00 ? 25  TYR A HA   1  
ATOM 298   H HB2  . TYR A 1 26  ? -0.031  -4.227  6.331   1.00 0.00 ? 25  TYR A HB2  1  
ATOM 299   H HB3  . TYR A 1 26  ? -0.592  -5.498  5.163   1.00 0.00 ? 25  TYR A HB3  1  
ATOM 300   H HD1  . TYR A 1 26  ? 0.898   -7.285  4.471   1.00 0.00 ? 25  TYR A HD1  1  
ATOM 301   H HD2  . TYR A 1 26  ? 1.999   -4.648  7.641   1.00 0.00 ? 25  TYR A HD2  1  
ATOM 302   H HE1  . TYR A 1 26  ? 2.832   -8.693  4.957   1.00 0.00 ? 25  TYR A HE1  1  
ATOM 303   H HE2  . TYR A 1 26  ? 3.946   -6.068  8.136   1.00 0.00 ? 25  TYR A HE2  1  
ATOM 304   H HH   . TYR A 1 26  ? 4.641   -8.965  6.168   1.00 0.00 ? 25  TYR A HH   1  
ATOM 305   N N    . SER A 1 27  ? -1.068  -3.764  3.022   1.00 0.00 ? 26  SER A N    1  
ATOM 306   C CA   . SER A 1 27  ? -2.063  -3.039  2.240   1.00 0.00 ? 26  SER A CA   1  
ATOM 307   C C    . SER A 1 27  ? -3.421  -2.820  2.936   1.00 0.00 ? 26  SER A C    1  
ATOM 308   O O    . SER A 1 27  ? -3.880  -3.619  3.752   1.00 0.00 ? 26  SER A O    1  
ATOM 309   C CB   . SER A 1 27  ? -2.286  -3.825  0.951   1.00 0.00 ? 26  SER A CB   1  
ATOM 310   O OG   . SER A 1 27  ? -3.049  -3.100  -0.015  1.00 0.00 ? 26  SER A OG   1  
ATOM 311   H H    . SER A 1 27  ? -1.248  -4.720  3.171   1.00 0.00 ? 26  SER A H    1  
ATOM 312   H HA   . SER A 1 27  ? -1.689  -2.073  1.945   1.00 0.00 ? 26  SER A HA   1  
ATOM 313   H HB2  . SER A 1 27  ? -1.299  -4.084  0.505   1.00 0.00 ? 26  SER A HB2  1  
ATOM 314   H HB3  . SER A 1 27  ? -2.781  -4.770  1.264   1.00 0.00 ? 26  SER A HB3  1  
ATOM 315   H HG   . SER A 1 27  ? -2.637  -2.232  -0.137  1.00 0.00 ? 26  SER A HG   1  
ATOM 316   N N    . GLY A 1 28  ? -4.074  -1.687  2.570   1.00 0.00 ? 27  GLY A N    1  
ATOM 317   C CA   . GLY A 1 28  ? -5.364  -1.150  2.980   1.00 0.00 ? 27  GLY A CA   1  
ATOM 318   C C    . GLY A 1 28  ? -6.149  -0.534  1.825   1.00 0.00 ? 27  GLY A C    1  
ATOM 319   O O    . GLY A 1 28  ? -5.599  -0.280  0.760   1.00 0.00 ? 27  GLY A O    1  
ATOM 320   H H    . GLY A 1 28  ? -3.630  -1.082  1.895   1.00 0.00 ? 27  GLY A H    1  
ATOM 321   H HA2  . GLY A 1 28  ? -5.959  -1.973  3.333   1.00 0.00 ? 27  GLY A HA2  1  
ATOM 322   H HA3  . GLY A 1 28  ? -5.188  -0.405  3.739   1.00 0.00 ? 27  GLY A HA3  1  
ATOM 323   N N    . LYS A 1 29  ? -7.468  -0.238  1.991   1.00 0.00 ? 28  LYS A N    1  
ATOM 324   C CA   . LYS A 1 29  ? -8.255  0.593   1.051   1.00 0.00 ? 28  LYS A CA   1  
ATOM 325   C C    . LYS A 1 29  ? -9.139  1.629   1.784   1.00 0.00 ? 28  LYS A C    1  
ATOM 326   O O    . LYS A 1 29  ? -9.778  1.241   2.761   1.00 0.00 ? 28  LYS A O    1  
ATOM 327   C CB   . LYS A 1 29  ? -9.093  -0.280  0.085   1.00 0.00 ? 28  LYS A CB   1  
ATOM 328   C CG   . LYS A 1 29  ? -10.049 -1.286  0.753   1.00 0.00 ? 28  LYS A CG   1  
ATOM 329   C CD   . LYS A 1 29  ? -10.733 -2.208  -0.267  1.00 0.00 ? 28  LYS A CD   1  
ATOM 330   C CE   . LYS A 1 29  ? -11.616 -3.278  0.387   1.00 0.00 ? 28  LYS A CE   1  
ATOM 331   N NZ   . LYS A 1 29  ? -12.214 -4.170  -0.634  1.00 0.00 ? 28  LYS A NZ   1  
ATOM 332   H H    . LYS A 1 29  ? -7.953  -0.469  2.851   1.00 0.00 ? 28  LYS A H    1  
ATOM 333   H HA   . LYS A 1 29  ? -7.584  1.195   0.480   1.00 0.00 ? 28  LYS A HA   1  
ATOM 334   H HB2  . LYS A 1 29  ? -9.667  0.362   -0.619  1.00 0.00 ? 28  LYS A HB2  1  
ATOM 335   H HB3  . LYS A 1 29  ? -8.374  -0.872  -0.529  1.00 0.00 ? 28  LYS A HB3  1  
ATOM 336   H HG2  . LYS A 1 29  ? -9.474  -1.914  1.469   1.00 0.00 ? 28  LYS A HG2  1  
ATOM 337   H HG3  . LYS A 1 29  ? -10.823 -0.748  1.343   1.00 0.00 ? 28  LYS A HG3  1  
ATOM 338   H HD2  . LYS A 1 29  ? -11.363 -1.590  -0.945  1.00 0.00 ? 28  LYS A HD2  1  
ATOM 339   H HD3  . LYS A 1 29  ? -9.949  -2.705  -0.883  1.00 0.00 ? 28  LYS A HD3  1  
ATOM 340   H HE2  . LYS A 1 29  ? -11.020 -3.910  1.079   1.00 0.00 ? 28  LYS A HE2  1  
ATOM 341   H HE3  . LYS A 1 29  ? -12.446 -2.801  0.947   1.00 0.00 ? 28  LYS A HE3  1  
ATOM 342   H HZ1  . LYS A 1 29  ? -12.815 -4.877  -0.166  1.00 0.00 ? 28  LYS A HZ1  1  
ATOM 343   H HZ2  . LYS A 1 29  ? -11.457 -4.651  -1.160  1.00 0.00 ? 28  LYS A HZ2  1  
ATOM 344   H HZ3  . LYS A 1 29  ? -12.788 -3.605  -1.291  1.00 0.00 ? 28  LYS A HZ3  1  
ATOM 345   N N    . ILE A 1 30  ? -9.252  2.976   1.424   1.00 0.00 ? 29  ILE A N    1  
ATOM 346   C CA   . ILE A 1 30  ? -10.206 3.823   2.221   1.00 0.00 ? 29  ILE A CA   1  
ATOM 347   C C    . ILE A 1 30  ? -11.696 3.792   1.818   1.00 0.00 ? 29  ILE A C    1  
ATOM 348   O O    . ILE A 1 30  ? -12.059 3.474   0.690   1.00 0.00 ? 29  ILE A O    1  
ATOM 349   C CB   . ILE A 1 30  ? -9.765  5.213   2.679   1.00 0.00 ? 29  ILE A CB   1  
ATOM 350   C CG1  . ILE A 1 30  ? -10.066 6.365   1.710   1.00 0.00 ? 29  ILE A CG1  1  
ATOM 351   C CG2  . ILE A 1 30  ? -8.284  5.127   3.068   1.00 0.00 ? 29  ILE A CG2  1  
ATOM 352   C CD1  . ILE A 1 30  ? -9.738  7.713   2.349   1.00 0.00 ? 29  ILE A CD1  1  
ATOM 353   H H    . ILE A 1 30  ? -8.752  3.458   0.643   1.00 0.00 ? 29  ILE A H    1  
ATOM 354   H HA   . ILE A 1 30  ? -10.230 3.410   3.212   1.00 0.00 ? 29  ILE A HA   1  
ATOM 355   H HB   . ILE A 1 30  ? -10.310 5.475   3.617   1.00 0.00 ? 29  ILE A HB   1  
ATOM 356   H HG12 . ILE A 1 30  ? -9.489  6.203   0.784   1.00 0.00 ? 29  ILE A HG12 1  
ATOM 357   H HG13 . ILE A 1 30  ? -11.143 6.375   1.439   1.00 0.00 ? 29  ILE A HG13 1  
ATOM 358   H HG21 . ILE A 1 30  ? -7.727  4.859   2.162   1.00 0.00 ? 29  ILE A HG21 1  
ATOM 359   H HG22 . ILE A 1 30  ? -8.099  4.344   3.828   1.00 0.00 ? 29  ILE A HG22 1  
ATOM 360   H HG23 . ILE A 1 30  ? -7.893  6.093   3.436   1.00 0.00 ? 29  ILE A HG23 1  
ATOM 361   H HD11 . ILE A 1 30  ? -10.238 7.813   3.330   1.00 0.00 ? 29  ILE A HD11 1  
ATOM 362   H HD12 . ILE A 1 30  ? -10.052 8.558   1.710   1.00 0.00 ? 29  ILE A HD12 1  
ATOM 363   H HD13 . ILE A 1 30  ? -8.656  7.816   2.529   1.00 0.00 ? 29  ILE A HD13 1  
ATOM 364   N N    . THR A 1 31  ? -12.570 4.119   2.813   1.00 0.00 ? 30  THR A N    1  
ATOM 365   C CA   . THR A 1 31  ? -14.032 4.210   2.735   1.00 0.00 ? 30  THR A CA   1  
ATOM 366   C C    . THR A 1 31  ? -14.505 5.661   2.861   1.00 0.00 ? 30  THR A C    1  
ATOM 367   O O    . THR A 1 31  ? -15.504 6.047   2.248   1.00 0.00 ? 30  THR A O    1  
ATOM 368   C CB   . THR A 1 31  ? -14.724 3.348   3.799   1.00 0.00 ? 30  THR A CB   1  
ATOM 369   O OG1  . THR A 1 31  ? -14.248 2.014   3.708   1.00 0.00 ? 30  THR A OG1  1  
ATOM 370   C CG2  . THR A 1 31  ? -16.253 3.273   3.615   1.00 0.00 ? 30  THR A CG2  1  
ATOM 371   H H    . THR A 1 31  ? -12.176 4.371   3.706   1.00 0.00 ? 30  THR A H    1  
ATOM 372   H HA   . THR A 1 31  ? -14.368 3.863   1.766   1.00 0.00 ? 30  THR A HA   1  
ATOM 373   H HB   . THR A 1 31  ? -14.493 3.712   4.826   1.00 0.00 ? 30  THR A HB   1  
ATOM 374   H HG1  . THR A 1 31  ? -13.290 2.068   3.632   1.00 0.00 ? 30  THR A HG1  1  
ATOM 375   H HG21 . THR A 1 31  ? -16.494 2.920   2.591   1.00 0.00 ? 30  THR A HG21 1  
ATOM 376   H HG22 . THR A 1 31  ? -16.750 4.249   3.786   1.00 0.00 ? 30  THR A HG22 1  
ATOM 377   H HG23 . THR A 1 31  ? -16.677 2.543   4.338   1.00 0.00 ? 30  THR A HG23 1  
ATOM 378   N N    . ARG A 1 32  ? -13.820 6.508   3.699   1.00 0.00 ? 31  ARG A N    1  
ATOM 379   C CA   . ARG A 1 32  ? -14.202 7.904   3.873   1.00 0.00 ? 31  ARG A CA   1  
ATOM 380   C C    . ARG A 1 32  ? -12.933 8.564   4.370   1.00 0.00 ? 31  ARG A C    1  
ATOM 381   O O    . ARG A 1 32  ? -12.022 7.878   4.836   1.00 0.00 ? 31  ARG A O    1  
ATOM 382   C CB   . ARG A 1 32  ? -15.319 8.162   4.948   1.00 0.00 ? 31  ARG A CB   1  
ATOM 383   C CG   . ARG A 1 32  ? -16.719 7.588   4.648   1.00 0.00 ? 31  ARG A CG   1  
ATOM 384   C CD   . ARG A 1 32  ? -17.732 7.918   5.752   1.00 0.00 ? 31  ARG A CD   1  
ATOM 385   N NE   . ARG A 1 32  ? -19.043 7.276   5.391   1.00 0.00 ? 31  ARG A NE   1  
ATOM 386   C CZ   . ARG A 1 32  ? -20.163 7.365   6.175   1.00 0.00 ? 31  ARG A CZ   1  
ATOM 387   N NH1  . ARG A 1 32  ? -20.143 8.057   7.350   1.00 0.00 ? 31  ARG A NH1  1  
ATOM 388   N NH2  . ARG A 1 32  ? -21.315 6.753   5.769   1.00 0.00 ? 31  ARG A NH2  1  
ATOM 389   H H    . ARG A 1 32  ? -12.996 6.277   4.264   1.00 0.00 ? 31  ARG A H    1  
ATOM 390   H HA   . ARG A 1 32  ? -14.467 8.344   2.920   1.00 0.00 ? 31  ARG A HA   1  
ATOM 391   H HB2  . ARG A 1 32  ? -15.004 7.741   5.929   1.00 0.00 ? 31  ARG A HB2  1  
ATOM 392   H HB3  . ARG A 1 32  ? -15.466 9.260   5.081   1.00 0.00 ? 31  ARG A HB3  1  
ATOM 393   H HG2  . ARG A 1 32  ? -17.083 7.985   3.673   1.00 0.00 ? 31  ARG A HG2  1  
ATOM 394   H HG3  . ARG A 1 32  ? -16.641 6.481   4.562   1.00 0.00 ? 31  ARG A HG3  1  
ATOM 395   H HD2  . ARG A 1 32  ? -17.378 7.511   6.725   1.00 0.00 ? 31  ARG A HD2  1  
ATOM 396   H HD3  . ARG A 1 32  ? -17.869 9.019   5.831   1.00 0.00 ? 31  ARG A HD3  1  
ATOM 397   H HE   . ARG A 1 32  ? -19.098 6.760   4.536   1.00 0.00 ? 31  ARG A HE   1  
ATOM 398   H HH11 . ARG A 1 32  ? -19.302 8.508   7.649   1.00 0.00 ? 31  ARG A HH11 1  
ATOM 399   H HH12 . ARG A 1 32  ? -20.970 8.115   7.910   1.00 0.00 ? 31  ARG A HH12 1  
ATOM 400   H HH21 . ARG A 1 32  ? -21.335 6.245   4.908   1.00 0.00 ? 31  ARG A HH21 1  
ATOM 401   H HH22 . ARG A 1 32  ? -22.138 6.813   6.334   1.00 0.00 ? 31  ARG A HH22 1  
ATOM 402   N N    . ASP A 1 33  ? -12.835 9.919   4.365   1.00 0.00 ? 32  ASP A N    1  
ATOM 403   C CA   . ASP A 1 33  ? -11.710 10.638  4.990   1.00 0.00 ? 32  ASP A CA   1  
ATOM 404   C C    . ASP A 1 33  ? -12.103 11.094  6.410   1.00 0.00 ? 32  ASP A C    1  
ATOM 405   O O    . ASP A 1 33  ? -13.176 11.661  6.602   1.00 0.00 ? 32  ASP A O    1  
ATOM 406   C CB   . ASP A 1 33  ? -11.283 11.859  4.114   1.00 0.00 ? 32  ASP A CB   1  
ATOM 407   C CG   . ASP A 1 33  ? -9.957  12.501  4.550   1.00 0.00 ? 32  ASP A CG   1  
ATOM 408   O OD1  . ASP A 1 33  ? -8.911  11.805  4.464   1.00 0.00 ? 32  ASP A OD1  1  
ATOM 409   O OD2  . ASP A 1 33  ? -9.979  13.687  4.971   1.00 0.00 ? 32  ASP A OD2  1  
ATOM 410   H H    . ASP A 1 33  ? -13.566 10.501  4.002   1.00 0.00 ? 32  ASP A H    1  
ATOM 411   H HA   . ASP A 1 33  ? -10.843 9.993   5.078   1.00 0.00 ? 32  ASP A HA   1  
ATOM 412   H HB2  . ASP A 1 33  ? -11.138 11.491  3.075   1.00 0.00 ? 32  ASP A HB2  1  
ATOM 413   H HB3  . ASP A 1 33  ? -12.088 12.625  4.090   1.00 0.00 ? 32  ASP A HB3  1  
ATOM 414   N N    . VAL A 1 34  ? -11.236 10.865  7.440   1.00 0.00 ? 33  VAL A N    1  
ATOM 415   C CA   . VAL A 1 34  ? -11.456 11.320  8.820   1.00 0.00 ? 33  VAL A CA   1  
ATOM 416   C C    . VAL A 1 34  ? -10.476 12.464  9.020   1.00 0.00 ? 33  VAL A C    1  
ATOM 417   O O    . VAL A 1 34  ? -9.299  12.289  8.767   1.00 0.00 ? 33  VAL A O    1  
ATOM 418   C CB   . VAL A 1 34  ? -11.379 10.243  9.954   1.00 0.00 ? 33  VAL A CB   1  
ATOM 419   C CG1  . VAL A 1 34  ? -12.824 9.764   10.198  1.00 0.00 ? 33  VAL A CG1  1  
ATOM 420   C CG2  . VAL A 1 34  ? -10.435 9.032   9.711   1.00 0.00 ? 33  VAL A CG2  1  
ATOM 421   H H    . VAL A 1 34  ? -10.355 10.426  7.273   1.00 0.00 ? 33  VAL A H    1  
ATOM 422   H HA   . VAL A 1 34  ? -12.434 11.778  8.912   1.00 0.00 ? 33  VAL A HA   1  
ATOM 423   H HB   . VAL A 1 34  ? -11.054 10.722  10.908  1.00 0.00 ? 33  VAL A HB   1  
ATOM 424   H HG11 . VAL A 1 34  ? -13.494 10.615  10.444  1.00 0.00 ? 33  VAL A HG11 1  
ATOM 425   H HG12 . VAL A 1 34  ? -12.853 9.041   11.040  1.00 0.00 ? 33  VAL A HG12 1  
ATOM 426   H HG13 . VAL A 1 34  ? -13.218 9.255   9.292   1.00 0.00 ? 33  VAL A HG13 1  
ATOM 427   H HG21 . VAL A 1 34  ? -9.970  8.584   10.620  1.00 0.00 ? 33  VAL A HG21 1  
ATOM 428   H HG22 . VAL A 1 34  ? -9.556  9.306   9.104   1.00 0.00 ? 33  VAL A HG22 1  
ATOM 429   H HG23 . VAL A 1 34  ? -10.936 8.186   9.204   1.00 0.00 ? 33  VAL A HG23 1  
ATOM 430   N N    . GLY A 1 35  ? -10.930 13.672  9.457   1.00 0.00 ? 34  GLY A N    1  
ATOM 431   C CA   . GLY A 1 35  ? -10.173 14.913  9.750   1.00 0.00 ? 34  GLY A CA   1  
ATOM 432   C C    . GLY A 1 35  ? -8.958  15.335  8.922   1.00 0.00 ? 34  GLY A C    1  
ATOM 433   O O    . GLY A 1 35  ? -8.873  15.115  7.720   1.00 0.00 ? 34  GLY A O    1  
ATOM 434   H H    . GLY A 1 35  ? -11.904 13.758  9.630   1.00 0.00 ? 34  GLY A H    1  
ATOM 435   H HA2  . GLY A 1 35  ? -10.884 15.723  9.655   1.00 0.00 ? 34  GLY A HA2  1  
ATOM 436   H HA3  . GLY A 1 35  ? -9.818  14.801  10.766  1.00 0.00 ? 34  GLY A HA3  1  
ATOM 437   N N    . ALA A 1 36  ? -7.956  15.961  9.583   1.00 0.00 ? 35  ALA A N    1  
ATOM 438   C CA   . ALA A 1 36  ? -6.667  16.333  9.014   1.00 0.00 ? 35  ALA A CA   1  
ATOM 439   C C    . ALA A 1 36  ? -5.621  15.371  9.529   1.00 0.00 ? 35  ALA A C    1  
ATOM 440   O O    . ALA A 1 36  ? -5.313  15.323  10.718  1.00 0.00 ? 35  ALA A O    1  
ATOM 441   C CB   . ALA A 1 36  ? -6.326  17.800  9.352   1.00 0.00 ? 35  ALA A CB   1  
ATOM 442   H H    . ALA A 1 36  ? -8.030  16.142  10.559  1.00 0.00 ? 35  ALA A H    1  
ATOM 443   H HA   . ALA A 1 36  ? -6.626  16.183  7.935   1.00 0.00 ? 35  ALA A HA   1  
ATOM 444   H HB1  . ALA A 1 36  ? -6.296  17.959  10.452  1.00 0.00 ? 35  ALA A HB1  1  
ATOM 445   H HB2  . ALA A 1 36  ? -7.098  18.476  8.926   1.00 0.00 ? 35  ALA A HB2  1  
ATOM 446   H HB3  . ALA A 1 36  ? -5.341  18.090  8.928   1.00 0.00 ? 35  ALA A HB3  1  
ATOM 447   N N    . GLY A 1 37  ? -5.084  14.554  8.592   1.00 0.00 ? 36  GLY A N    1  
ATOM 448   C CA   . GLY A 1 37  ? -4.086  13.536  8.825   1.00 0.00 ? 36  GLY A CA   1  
ATOM 449   C C    . GLY A 1 37  ? -4.653  12.156  8.879   1.00 0.00 ? 36  GLY A C    1  
ATOM 450   O O    . GLY A 1 37  ? -3.889  11.202  8.843   1.00 0.00 ? 36  GLY A O    1  
ATOM 451   H H    . GLY A 1 37  ? -5.385  14.643  7.646   1.00 0.00 ? 36  GLY A H    1  
ATOM 452   H HA2  . GLY A 1 37  ? -3.409  13.562  7.985   1.00 0.00 ? 36  GLY A HA2  1  
ATOM 453   H HA3  . GLY A 1 37  ? -3.577  13.696  9.769   1.00 0.00 ? 36  GLY A HA3  1  
ATOM 454   N N    . LYS A 1 38  ? -5.989  11.974  9.012   1.00 0.00 ? 37  LYS A N    1  
ATOM 455   C CA   . LYS A 1 38  ? -6.587  10.659  9.195   1.00 0.00 ? 37  LYS A CA   1  
ATOM 456   C C    . LYS A 1 38  ? -7.297  10.131  7.947   1.00 0.00 ? 37  LYS A C    1  
ATOM 457   O O    . LYS A 1 38  ? -7.578  10.836  6.978   1.00 0.00 ? 37  LYS A O    1  
ATOM 458   C CB   . LYS A 1 38  ? -7.341  10.544  10.571  1.00 0.00 ? 37  LYS A CB   1  
ATOM 459   C CG   . LYS A 1 38  ? -7.601  11.848  11.349  1.00 0.00 ? 37  LYS A CG   1  
ATOM 460   C CD   . LYS A 1 38  ? -8.456  11.604  12.599  1.00 0.00 ? 37  LYS A CD   1  
ATOM 461   C CE   . LYS A 1 38  ? -8.773  12.900  13.354  1.00 0.00 ? 37  LYS A CE   1  
ATOM 462   N NZ   . LYS A 1 38  ? -9.646  12.636  14.521  1.00 0.00 ? 37  LYS A NZ   1  
ATOM 463   H H    . LYS A 1 38  ? -6.643  12.732  9.031   1.00 0.00 ? 37  LYS A H    1  
ATOM 464   H HA   . LYS A 1 38  ? -5.830  9.902   9.296   1.00 0.00 ? 37  LYS A HA   1  
ATOM 465   H HB2  . LYS A 1 38  ? -8.320  10.054  10.455  1.00 0.00 ? 37  LYS A HB2  1  
ATOM 466   H HB3  . LYS A 1 38  ? -6.766  9.859   11.249  1.00 0.00 ? 37  LYS A HB3  1  
ATOM 467   H HG2  . LYS A 1 38  ? -6.652  12.335  11.649  1.00 0.00 ? 37  LYS A HG2  1  
ATOM 468   H HG3  . LYS A 1 38  ? -8.137  12.574  10.711  1.00 0.00 ? 37  LYS A HG3  1  
ATOM 469   H HD2  . LYS A 1 38  ? -9.408  11.116  12.293  1.00 0.00 ? 37  LYS A HD2  1  
ATOM 470   H HD3  . LYS A 1 38  ? -7.914  10.906  13.275  1.00 0.00 ? 37  LYS A HD3  1  
ATOM 471   H HE2  . LYS A 1 38  ? -7.837  13.362  13.730  1.00 0.00 ? 37  LYS A HE2  1  
ATOM 472   H HE3  . LYS A 1 38  ? -9.299  13.619  12.694  1.00 0.00 ? 37  LYS A HE3  1  
ATOM 473   H HZ1  . LYS A 1 38  ? -9.842  13.529  15.017  1.00 0.00 ? 37  LYS A HZ1  1  
ATOM 474   H HZ2  . LYS A 1 38  ? -9.170  11.975  15.168  1.00 0.00 ? 37  LYS A HZ2  1  
ATOM 475   H HZ3  . LYS A 1 38  ? -10.540 12.216  14.195  1.00 0.00 ? 37  LYS A HZ3  1  
ATOM 476   N N    . TYR A 1 39  ? -7.581  8.799   7.956   1.00 0.00 ? 38  TYR A N    1  
ATOM 477   C CA   . TYR A 1 39  ? -8.217  8.001   6.911   1.00 0.00 ? 38  TYR A CA   1  
ATOM 478   C C    . TYR A 1 39  ? -9.167  6.984   7.595   1.00 0.00 ? 38  TYR A C    1  
ATOM 479   O O    . TYR A 1 39  ? -8.799  6.434   8.638   1.00 0.00 ? 38  TYR A O    1  
ATOM 480   C CB   . TYR A 1 39  ? -7.112  7.291   6.081   1.00 0.00 ? 38  TYR A CB   1  
ATOM 481   C CG   . TYR A 1 39  ? -6.274  8.335   5.358   1.00 0.00 ? 38  TYR A CG   1  
ATOM 482   C CD1  . TYR A 1 39  ? -6.820  9.136   4.375   1.00 0.00 ? 38  TYR A CD1  1  
ATOM 483   C CD2  . TYR A 1 39  ? -4.984  8.615   5.772   1.00 0.00 ? 38  TYR A CD2  1  
ATOM 484   C CE1  . TYR A 1 39  ? -6.110  10.209  3.869   1.00 0.00 ? 38  TYR A CE1  1  
ATOM 485   C CE2  . TYR A 1 39  ? -4.218  9.614   5.186   1.00 0.00 ? 38  TYR A CE2  1  
ATOM 486   C CZ   . TYR A 1 39  ? -4.809  10.456  4.259   1.00 0.00 ? 38  TYR A CZ   1  
ATOM 487   O OH   . TYR A 1 39  ? -4.124  11.582  3.722   1.00 0.00 ? 38  TYR A OH   1  
ATOM 488   H H    . TYR A 1 39  ? -7.338  8.244   8.760   1.00 0.00 ? 38  TYR A H    1  
ATOM 489   H HA   . TYR A 1 39  ? -8.791  8.633   6.247   1.00 0.00 ? 38  TYR A HA   1  
ATOM 490   H HB2  . TYR A 1 39  ? -6.444  6.699   6.746   1.00 0.00 ? 38  TYR A HB2  1  
ATOM 491   H HB3  . TYR A 1 39  ? -7.552  6.612   5.326   1.00 0.00 ? 38  TYR A HB3  1  
ATOM 492   H HD1  . TYR A 1 39  ? -7.849  8.996   4.081   1.00 0.00 ? 38  TYR A HD1  1  
ATOM 493   H HD2  . TYR A 1 39  ? -4.610  8.063   6.621   1.00 0.00 ? 38  TYR A HD2  1  
ATOM 494   H HE1  . TYR A 1 39  ? -6.584  10.877  3.168   1.00 0.00 ? 38  TYR A HE1  1  
ATOM 495   H HE2  . TYR A 1 39  ? -3.182  9.742   5.492   1.00 0.00 ? 38  TYR A HE2  1  
ATOM 496   H HH   . TYR A 1 39  ? -3.174  11.426  3.756   1.00 0.00 ? 38  TYR A HH   1  
ATOM 497   N N    . LYS A 1 40  ? -10.431 6.733   7.072   1.00 0.00 ? 39  LYS A N    1  
ATOM 498   C CA   . LYS A 1 40  ? -11.463 5.793   7.585   1.00 0.00 ? 39  LYS A CA   1  
ATOM 499   C C    . LYS A 1 40  ? -11.448 4.743   6.534   1.00 0.00 ? 39  LYS A C    1  
ATOM 500   O O    . LYS A 1 40  ? -11.757 4.921   5.351   1.00 0.00 ? 39  LYS A O    1  
ATOM 501   C CB   . LYS A 1 40  ? -12.864 6.451   7.768   1.00 0.00 ? 39  LYS A CB   1  
ATOM 502   C CG   . LYS A 1 40  ? -14.111 5.554   7.589   1.00 0.00 ? 39  LYS A CG   1  
ATOM 503   C CD   . LYS A 1 40  ? -14.261 4.381   8.567   1.00 0.00 ? 39  LYS A CD   1  
ATOM 504   C CE   . LYS A 1 40  ? -15.438 3.482   8.177   1.00 0.00 ? 39  LYS A CE   1  
ATOM 505   N NZ   . LYS A 1 40  ? -16.735 4.184   8.296   1.00 0.00 ? 39  LYS A NZ   1  
ATOM 506   H H    . LYS A 1 40  ? -10.794 7.138   6.209   1.00 0.00 ? 39  LYS A H    1  
ATOM 507   H HA   . LYS A 1 40  ? -11.177 5.230   8.489   1.00 0.00 ? 39  LYS A HA   1  
ATOM 508   H HB2  . LYS A 1 40  ? -12.898 6.910   8.779   1.00 0.00 ? 39  LYS A HB2  1  
ATOM 509   H HB3  . LYS A 1 40  ? -12.949 7.284   7.035   1.00 0.00 ? 39  LYS A HB3  1  
ATOM 510   H HG2  . LYS A 1 40  ? -15.013 6.201   7.680   1.00 0.00 ? 39  LYS A HG2  1  
ATOM 511   H HG3  . LYS A 1 40  ? -14.110 5.136   6.553   1.00 0.00 ? 39  LYS A HG3  1  
ATOM 512   H HD2  . LYS A 1 40  ? -13.346 3.747   8.551   1.00 0.00 ? 39  LYS A HD2  1  
ATOM 513   H HD3  . LYS A 1 40  ? -14.394 4.750   9.606   1.00 0.00 ? 39  LYS A HD3  1  
ATOM 514   H HE2  . LYS A 1 40  ? -15.311 3.170   7.116   1.00 0.00 ? 39  LYS A HE2  1  
ATOM 515   H HE3  . LYS A 1 40  ? -15.472 2.580   8.824   1.00 0.00 ? 39  LYS A HE3  1  
ATOM 516   H HZ1  . LYS A 1 40  ? -16.880 4.479   9.283   1.00 0.00 ? 39  LYS A HZ1  1  
ATOM 517   H HZ2  . LYS A 1 40  ? -17.503 3.545   8.009   1.00 0.00 ? 39  LYS A HZ2  1  
ATOM 518   H HZ3  . LYS A 1 40  ? -16.733 5.022   7.681   1.00 0.00 ? 39  LYS A HZ3  1  
ATOM 519   N N    . LEU A 1 41  ? -10.885 3.622   6.991   1.00 0.00 ? 40  LEU A N    1  
ATOM 520   C CA   . LEU A 1 41  ? -10.388 2.618   6.103   1.00 0.00 ? 40  LEU A CA   1  
ATOM 521   C C    . LEU A 1 41  ? -10.715 1.219   6.404   1.00 0.00 ? 40  LEU A C    1  
ATOM 522   O O    . LEU A 1 41  ? -11.002 0.820   7.525   1.00 0.00 ? 40  LEU A O    1  
ATOM 523   C CB   . LEU A 1 41  ? -8.868  2.822   6.007   1.00 0.00 ? 40  LEU A CB   1  
ATOM 524   C CG   . LEU A 1 41  ? -8.038  2.422   7.252   1.00 0.00 ? 40  LEU A CG   1  
ATOM 525   C CD1  . LEU A 1 41  ? -8.667  2.590   8.631   1.00 0.00 ? 40  LEU A CD1  1  
ATOM 526   C CD2  . LEU A 1 41  ? -7.477  1.000   7.081   1.00 0.00 ? 40  LEU A CD2  1  
ATOM 527   H H    . LEU A 1 41  ? -10.692 3.484   7.987   1.00 0.00 ? 40  LEU A H    1  
ATOM 528   H HA   . LEU A 1 41  ? -10.873 2.742   5.151   1.00 0.00 ? 40  LEU A HA   1  
ATOM 529   H HB2  . LEU A 1 41  ? -8.460  2.289   5.117   1.00 0.00 ? 40  LEU A HB2  1  
ATOM 530   H HB3  . LEU A 1 41  ? -8.694  3.909   5.831   1.00 0.00 ? 40  LEU A HB3  1  
ATOM 531   H HG   . LEU A 1 41  ? -7.245  3.176   7.338   1.00 0.00 ? 40  LEU A HG   1  
ATOM 532   H HD11 . LEU A 1 41  ? -9.033  3.633   8.798   1.00 0.00 ? 40  LEU A HD11 1  
ATOM 533   H HD12 . LEU A 1 41  ? -7.921  2.380   9.418   1.00 0.00 ? 40  LEU A HD12 1  
ATOM 534   H HD13 . LEU A 1 41  ? -9.498  1.849   8.714   1.00 0.00 ? 40  LEU A HD13 1  
ATOM 535   H HD21 . LEU A 1 41  ? -8.264  0.239   7.263   1.00 0.00 ? 40  LEU A HD21 1  
ATOM 536   H HD22 . LEU A 1 41  ? -6.668  0.820   7.817   1.00 0.00 ? 40  LEU A HD22 1  
ATOM 537   H HD23 . LEU A 1 41  ? -7.106  0.828   6.043   1.00 0.00 ? 40  LEU A HD23 1  
ATOM 538   N N    . LEU A 1 42  ? -10.634 0.363   5.390   1.00 0.00 ? 41  LEU A N    1  
ATOM 539   C CA   . LEU A 1 42  ? -10.798 -1.041  5.625   1.00 0.00 ? 41  LEU A CA   1  
ATOM 540   C C    . LEU A 1 42  ? -9.656  -1.726  4.985   1.00 0.00 ? 41  LEU A C    1  
ATOM 541   O O    . LEU A 1 42  ? -9.258  -1.296  3.920   1.00 0.00 ? 41  LEU A O    1  
ATOM 542   C CB   . LEU A 1 42  ? -12.225 -1.231  5.119   1.00 0.00 ? 41  LEU A CB   1  
ATOM 543   C CG   . LEU A 1 42  ? -12.923 -2.594  5.272   1.00 0.00 ? 41  LEU A CG   1  
ATOM 544   C CD1  . LEU A 1 42  ? -14.456 -2.460  5.321   1.00 0.00 ? 41  LEU A CD1  1  
ATOM 545   C CD2  . LEU A 1 42  ? -12.640 -3.468  4.059   1.00 0.00 ? 41  LEU A CD2  1  
ATOM 546   H H    . LEU A 1 42  ? -10.370 0.631   4.451   1.00 0.00 ? 41  LEU A H    1  
ATOM 547   H HA   . LEU A 1 42  ? -10.692 -1.295  6.674   1.00 0.00 ? 41  LEU A HA   1  
ATOM 548   H HB2  . LEU A 1 42  ? -12.673 -0.461  5.812   1.00 0.00 ? 41  LEU A HB2  1  
ATOM 549   H HB3  . LEU A 1 42  ? -12.348 -0.859  4.081   1.00 0.00 ? 41  LEU A HB3  1  
ATOM 550   H HG   . LEU A 1 42  ? -12.571 -3.062  6.237   1.00 0.00 ? 41  LEU A HG   1  
ATOM 551   H HD11 . LEU A 1 42  ? -14.929 -3.455  5.459   1.00 0.00 ? 41  LEU A HD11 1  
ATOM 552   H HD12 . LEU A 1 42  ? -14.839 -2.019  4.375   1.00 0.00 ? 41  LEU A HD12 1  
ATOM 553   H HD13 . LEU A 1 42  ? -14.777 -1.814  6.156   1.00 0.00 ? 41  LEU A HD13 1  
ATOM 554   H HD21 . LEU A 1 42  ? -12.884 -2.917  3.125   1.00 0.00 ? 41  LEU A HD21 1  
ATOM 555   H HD22 . LEU A 1 42  ? -13.275 -4.379  4.075   1.00 0.00 ? 41  LEU A HD22 1  
ATOM 556   H HD23 . LEU A 1 42  ? -11.585 -3.765  4.024   1.00 0.00 ? 41  LEU A HD23 1  
ATOM 557   N N    . PHE A 1 43  ? -9.045  -2.818  5.522   1.00 0.00 ? 42  PHE A N    1  
ATOM 558   C CA   . PHE A 1 43  ? -7.949  -3.525  4.809   1.00 0.00 ? 42  PHE A CA   1  
ATOM 559   C C    . PHE A 1 43  ? -8.453  -4.213  3.520   1.00 0.00 ? 42  PHE A C    1  
ATOM 560   O O    . PHE A 1 43  ? -9.611  -4.600  3.449   1.00 0.00 ? 42  PHE A O    1  
ATOM 561   C CB   . PHE A 1 43  ? -7.185  -4.605  5.661   1.00 0.00 ? 42  PHE A CB   1  
ATOM 562   C CG   . PHE A 1 43  ? -6.193  -4.030  6.657   1.00 0.00 ? 42  PHE A CG   1  
ATOM 563   C CD1  . PHE A 1 43  ? -6.426  -2.905  7.443   1.00 0.00 ? 42  PHE A CD1  1  
ATOM 564   C CD2  . PHE A 1 43  ? -4.981  -4.685  6.819   1.00 0.00 ? 42  PHE A CD2  1  
ATOM 565   C CE1  . PHE A 1 43  ? -5.467  -2.437  8.320   1.00 0.00 ? 42  PHE A CE1  1  
ATOM 566   C CE2  . PHE A 1 43  ? -4.025  -4.225  7.700   1.00 0.00 ? 42  PHE A CE2  1  
ATOM 567   C CZ   . PHE A 1 43  ? -4.261  -3.089  8.444   1.00 0.00 ? 42  PHE A CZ   1  
ATOM 568   H H    . PHE A 1 43  ? -9.336  -3.135  6.432   1.00 0.00 ? 42  PHE A H    1  
ATOM 569   H HA   . PHE A 1 43  ? -7.236  -2.778  4.503   1.00 0.00 ? 42  PHE A HA   1  
ATOM 570   H HB2  . PHE A 1 43  ? -7.905  -5.235  6.225   1.00 0.00 ? 42  PHE A HB2  1  
ATOM 571   H HB3  . PHE A 1 43  ? -6.581  -5.279  4.992   1.00 0.00 ? 42  PHE A HB3  1  
ATOM 572   H HD1  . PHE A 1 43  ? -7.361  -2.365  7.389   1.00 0.00 ? 42  PHE A HD1  1  
ATOM 573   H HD2  . PHE A 1 43  ? -4.764  -5.567  6.228   1.00 0.00 ? 42  PHE A HD2  1  
ATOM 574   H HE1  . PHE A 1 43  ? -5.661  -1.555  8.917   1.00 0.00 ? 42  PHE A HE1  1  
ATOM 575   H HE2  . PHE A 1 43  ? -3.089  -4.758  7.808   1.00 0.00 ? 42  PHE A HE2  1  
ATOM 576   H HZ   . PHE A 1 43  ? -3.492  -2.700  9.098   1.00 0.00 ? 42  PHE A HZ   1  
ATOM 577   N N    . ASP A 1 44  ? -7.617  -4.443  2.466   1.00 0.00 ? 43  ASP A N    1  
ATOM 578   C CA   . ASP A 1 44  ? -7.965  -5.090  1.171   1.00 0.00 ? 43  ASP A CA   1  
ATOM 579   C C    . ASP A 1 44  ? -8.550  -6.516  1.246   1.00 0.00 ? 43  ASP A C    1  
ATOM 580   O O    . ASP A 1 44  ? -9.077  -7.099  0.301   1.00 0.00 ? 43  ASP A O    1  
ATOM 581   C CB   . ASP A 1 44  ? -6.761  -5.043  0.171   1.00 0.00 ? 43  ASP A CB   1  
ATOM 582   C CG   . ASP A 1 44  ? -5.550  -5.916  0.552   1.00 0.00 ? 43  ASP A CG   1  
ATOM 583   O OD1  . ASP A 1 44  ? -5.049  -5.788  1.699   1.00 0.00 ? 43  ASP A OD1  1  
ATOM 584   O OD2  . ASP A 1 44  ? -5.121  -6.727  -0.312  1.00 0.00 ? 43  ASP A OD2  1  
ATOM 585   H H    . ASP A 1 44  ? -6.669  -4.135  2.519   1.00 0.00 ? 43  ASP A H    1  
ATOM 586   H HA   . ASP A 1 44  ? -8.745  -4.484  0.727   1.00 0.00 ? 43  ASP A HA   1  
ATOM 587   H HB2  . ASP A 1 44  ? -7.113  -5.346  -0.837  1.00 0.00 ? 43  ASP A HB2  1  
ATOM 588   H HB3  . ASP A 1 44  ? -6.414  -3.989  0.100   1.00 0.00 ? 43  ASP A HB3  1  
ATOM 589   N N    . ASP A 1 45  ? -8.439  -7.044  2.475   1.00 0.00 ? 44  ASP A N    1  
ATOM 590   C CA   . ASP A 1 45  ? -8.836  -8.300  3.023   1.00 0.00 ? 44  ASP A CA   1  
ATOM 591   C C    . ASP A 1 45  ? -9.931  -8.171  4.122   1.00 0.00 ? 44  ASP A C    1  
ATOM 592   O O    . ASP A 1 45  ? -10.363 -9.190  4.651   1.00 0.00 ? 44  ASP A O    1  
ATOM 593   C CB   . ASP A 1 45  ? -7.503  -9.018  3.418   1.00 0.00 ? 44  ASP A CB   1  
ATOM 594   C CG   . ASP A 1 45  ? -6.729  -8.353  4.572   1.00 0.00 ? 44  ASP A CG   1  
ATOM 595   O OD1  . ASP A 1 45  ? -7.171  -8.476  5.745   1.00 0.00 ? 44  ASP A OD1  1  
ATOM 596   O OD2  . ASP A 1 45  ? -5.673  -7.725  4.286   1.00 0.00 ? 44  ASP A OD2  1  
ATOM 597   H H    . ASP A 1 45  ? -7.990  -6.439  3.124   1.00 0.00 ? 44  ASP A H    1  
ATOM 598   H HA   . ASP A 1 45  ? -9.286  -8.898  2.239   1.00 0.00 ? 44  ASP A HA   1  
ATOM 599   H HB2  . ASP A 1 45  ? -7.677  -10.088 3.646   1.00 0.00 ? 44  ASP A HB2  1  
ATOM 600   H HB3  . ASP A 1 45  ? -6.833  -8.930  2.509   1.00 0.00 ? 44  ASP A HB3  1  
ATOM 601   N N    . GLY A 1 46  ? -10.470 -6.947  4.466   1.00 0.00 ? 45  GLY A N    1  
ATOM 602   C CA   . GLY A 1 46  ? -11.667 -6.774  5.304   1.00 0.00 ? 45  GLY A CA   1  
ATOM 603   C C    . GLY A 1 46  ? -11.520 -6.475  6.774   1.00 0.00 ? 45  GLY A C    1  
ATOM 604   O O    . GLY A 1 46  ? -12.305 -6.976  7.571   1.00 0.00 ? 45  GLY A O    1  
ATOM 605   H H    . GLY A 1 46  ? -10.171 -6.066  4.055   1.00 0.00 ? 45  GLY A H    1  
ATOM 606   H HA2  . GLY A 1 46  ? -12.147 -5.883  4.901   1.00 0.00 ? 45  GLY A HA2  1  
ATOM 607   H HA3  . GLY A 1 46  ? -12.284 -7.678  5.269   1.00 0.00 ? 45  GLY A HA3  1  
ATOM 608   N N    . TYR A 1 47  ? -10.550 -5.632  7.203   1.00 0.00 ? 46  TYR A N    1  
ATOM 609   C CA   . TYR A 1 47  ? -10.372 -5.280  8.619   1.00 0.00 ? 46  TYR A CA   1  
ATOM 610   C C    . TYR A 1 47  ? -10.487 -3.766  8.723   1.00 0.00 ? 46  TYR A C    1  
ATOM 611   O O    . TYR A 1 47  ? -9.554  -3.053  8.362   1.00 0.00 ? 46  TYR A O    1  
ATOM 612   C CB   . TYR A 1 47  ? -9.007  -5.827  9.160   1.00 0.00 ? 46  TYR A CB   1  
ATOM 613   C CG   . TYR A 1 47  ? -8.866  -5.757  10.669  1.00 0.00 ? 46  TYR A CG   1  
ATOM 614   C CD1  . TYR A 1 47  ? -9.466  -6.712  11.472  1.00 0.00 ? 46  TYR A CD1  1  
ATOM 615   C CD2  . TYR A 1 47  ? -8.116  -4.760  11.275  1.00 0.00 ? 46  TYR A CD2  1  
ATOM 616   C CE1  . TYR A 1 47  ? -9.329  -6.666  12.846  1.00 0.00 ? 46  TYR A CE1  1  
ATOM 617   C CE2  . TYR A 1 47  ? -7.970  -4.715  12.653  1.00 0.00 ? 46  TYR A CE2  1  
ATOM 618   C CZ   . TYR A 1 47  ? -8.586  -5.670  13.440  1.00 0.00 ? 46  TYR A CZ   1  
ATOM 619   O OH   . TYR A 1 47  ? -8.463  -5.660  14.848  1.00 0.00 ? 46  TYR A OH   1  
ATOM 620   H H    . TYR A 1 47  ? -9.923  -5.226  6.545   1.00 0.00 ? 46  TYR A H    1  
ATOM 621   H HA   . TYR A 1 47  ? -11.167 -5.692  9.233   1.00 0.00 ? 46  TYR A HA   1  
ATOM 622   H HB2  . TYR A 1 47  ? -8.933  -6.900  8.875   1.00 0.00 ? 46  TYR A HB2  1  
ATOM 623   H HB3  . TYR A 1 47  ? -8.150  -5.298  8.689   1.00 0.00 ? 46  TYR A HB3  1  
ATOM 624   H HD1  . TYR A 1 47  ? -10.044 -7.508  11.020  1.00 0.00 ? 46  TYR A HD1  1  
ATOM 625   H HD2  . TYR A 1 47  ? -7.633  -4.008  10.664  1.00 0.00 ? 46  TYR A HD2  1  
ATOM 626   H HE1  . TYR A 1 47  ? -9.799  -7.420  13.465  1.00 0.00 ? 46  TYR A HE1  1  
ATOM 627   H HE2  . TYR A 1 47  ? -7.372  -3.933  13.106  1.00 0.00 ? 46  TYR A HE2  1  
ATOM 628   H HH   . TYR A 1 47  ? -7.829  -4.982  15.090  1.00 0.00 ? 46  TYR A HH   1  
ATOM 629   N N    . GLU A 1 48  ? -11.647 -3.218  9.187   1.00 0.00 ? 47  GLU A N    1  
ATOM 630   C CA   . GLU A 1 48  ? -11.921 -1.775  9.257   1.00 0.00 ? 47  GLU A CA   1  
ATOM 631   C C    . GLU A 1 48  ? -11.729 -1.083  10.572  1.00 0.00 ? 47  GLU A C    1  
ATOM 632   O O    . GLU A 1 48  ? -11.828 -1.657  11.657  1.00 0.00 ? 47  GLU A O    1  
ATOM 633   C CB   . GLU A 1 48  ? -13.268 -1.397  8.586   1.00 0.00 ? 47  GLU A CB   1  
ATOM 634   C CG   . GLU A 1 48  ? -13.789 0.062   8.678   1.00 0.00 ? 47  GLU A CG   1  
ATOM 635   C CD   . GLU A 1 48  ? -14.950 0.225   7.703   1.00 0.00 ? 47  GLU A CD   1  
ATOM 636   O OE1  . GLU A 1 48  ? -16.077 -0.225  8.046   1.00 0.00 ? 47  GLU A OE1  1  
ATOM 637   O OE2  . GLU A 1 48  ? -14.727 0.788   6.600   1.00 0.00 ? 47  GLU A OE2  1  
ATOM 638   H H    . GLU A 1 48  ? -12.393 -3.803  9.487   1.00 0.00 ? 47  GLU A H    1  
ATOM 639   H HA   . GLU A 1 48  ? -11.163 -1.277  8.690   1.00 0.00 ? 47  GLU A HA   1  
ATOM 640   H HB2  . GLU A 1 48  ? -13.063 -1.537  7.520   1.00 0.00 ? 47  GLU A HB2  1  
ATOM 641   H HB3  . GLU A 1 48  ? -14.031 -2.165  8.791   1.00 0.00 ? 47  GLU A HB3  1  
ATOM 642   H HG2  . GLU A 1 48  ? -14.148 0.280   9.706   1.00 0.00 ? 47  GLU A HG2  1  
ATOM 643   H HG3  . GLU A 1 48  ? -12.960 0.793   8.432   1.00 0.00 ? 47  GLU A HG3  1  
ATOM 644   N N    . CYS A 1 49  ? -11.394 0.234   10.439  1.00 0.00 ? 48  CYS A N    1  
ATOM 645   C CA   . CYS A 1 49  ? -11.035 1.061   11.553  1.00 0.00 ? 48  CYS A CA   1  
ATOM 646   C C    . CYS A 1 49  ? -11.093 2.488   11.072  1.00 0.00 ? 48  CYS A C    1  
ATOM 647   O O    . CYS A 1 49  ? -11.295 2.741   9.885   1.00 0.00 ? 48  CYS A O    1  
ATOM 648   C CB   . CYS A 1 49  ? -9.590  0.692   12.049  1.00 0.00 ? 48  CYS A CB   1  
ATOM 649   S SG   . CYS A 1 49  ? -8.354  0.114   10.824  1.00 0.00 ? 48  CYS A SG   1  
ATOM 650   H H    . CYS A 1 49  ? -11.327 0.727   9.524   1.00 0.00 ? 48  CYS A H    1  
ATOM 651   H HA   . CYS A 1 49  ? -11.760 0.966   12.351  1.00 0.00 ? 48  CYS A HA   1  
ATOM 652   H HB2  . CYS A 1 49  ? -9.150  1.551   12.579  1.00 0.00 ? 48  CYS A HB2  1  
ATOM 653   H HB3  . CYS A 1 49  ? -9.730  -0.151  12.754  1.00 0.00 ? 48  CYS A HB3  1  
ATOM 654   H HG   . CYS A 1 49  ? -9.013  -0.979  10.466  1.00 0.00 ? 48  CYS A HG   1  
ATOM 655   N N    . ASP A 1 50  ? -10.829 3.464   11.975  1.00 0.00 ? 49  ASP A N    1  
ATOM 656   C CA   . ASP A 1 50  ? -10.529 4.836   11.590  1.00 0.00 ? 49  ASP A CA   1  
ATOM 657   C C    . ASP A 1 50  ? -9.206  5.022   12.305  1.00 0.00 ? 49  ASP A C    1  
ATOM 658   O O    . ASP A 1 50  ? -9.061  4.578   13.451  1.00 0.00 ? 49  ASP A O    1  
ATOM 659   C CB   . ASP A 1 50  ? -11.425 5.998   12.127  1.00 0.00 ? 49  ASP A CB   1  
ATOM 660   C CG   . ASP A 1 50  ? -12.925 5.706   12.036  1.00 0.00 ? 49  ASP A CG   1  
ATOM 661   O OD1  . ASP A 1 50  ? -13.403 4.773   12.733  1.00 0.00 ? 49  ASP A OD1  1  
ATOM 662   O OD2  . ASP A 1 50  ? -13.620 6.443   11.286  1.00 0.00 ? 49  ASP A OD2  1  
ATOM 663   H H    . ASP A 1 50  ? -10.649 3.269   12.938  1.00 0.00 ? 49  ASP A H    1  
ATOM 664   H HA   . ASP A 1 50  ? -10.386 4.888   10.496  1.00 0.00 ? 49  ASP A HA   1  
ATOM 665   H HB2  . ASP A 1 50  ? -11.169 6.290   13.176  1.00 0.00 ? 49  ASP A HB2  1  
ATOM 666   H HB3  . ASP A 1 50  ? -11.201 6.887   11.496  1.00 0.00 ? 49  ASP A HB3  1  
ATOM 667   N N    . VAL A 1 51  ? -8.208  5.640   11.647  1.00 0.00 ? 50  VAL A N    1  
ATOM 668   C CA   . VAL A 1 51  ? -6.879  5.801   12.199  1.00 0.00 ? 50  VAL A CA   1  
ATOM 669   C C    . VAL A 1 51  ? -6.273  7.066   11.712  1.00 0.00 ? 50  VAL A C    1  
ATOM 670   O O    . VAL A 1 51  ? -6.725  7.621   10.711  1.00 0.00 ? 50  VAL A O    1  
ATOM 671   C CB   . VAL A 1 51  ? -5.907  4.719   11.724  1.00 0.00 ? 50  VAL A CB   1  
ATOM 672   C CG1  . VAL A 1 51  ? -6.262  3.422   12.434  1.00 0.00 ? 50  VAL A CG1  1  
ATOM 673   C CG2  . VAL A 1 51  ? -5.950  4.577   10.182  1.00 0.00 ? 50  VAL A CG2  1  
ATOM 674   H H    . VAL A 1 51  ? -8.308  6.011   10.717  1.00 0.00 ? 50  VAL A H    1  
ATOM 675   H HA   . VAL A 1 51  ? -6.962  5.874   13.279  1.00 0.00 ? 50  VAL A HA   1  
ATOM 676   H HB   . VAL A 1 51  ? -4.846  4.914   12.026  1.00 0.00 ? 50  VAL A HB   1  
ATOM 677   H HG11 . VAL A 1 51  ? -6.313  3.619   13.526  1.00 0.00 ? 50  VAL A HG11 1  
ATOM 678   H HG12 . VAL A 1 51  ? -5.480  2.673   12.213  1.00 0.00 ? 50  VAL A HG12 1  
ATOM 679   H HG13 . VAL A 1 51  ? -7.243  3.050   12.081  1.00 0.00 ? 50  VAL A HG13 1  
ATOM 680   H HG21 . VAL A 1 51  ? -5.695  3.530   9.919   1.00 0.00 ? 50  VAL A HG21 1  
ATOM 681   H HG22 . VAL A 1 51  ? -5.199  5.260   9.723   1.00 0.00 ? 50  VAL A HG22 1  
ATOM 682   H HG23 . VAL A 1 51  ? -6.939  4.843   9.744   1.00 0.00 ? 50  VAL A HG23 1  
ATOM 683   N N    . LEU A 1 52  ? -5.143  7.494   12.352  1.00 0.00 ? 51  LEU A N    1  
ATOM 684   C CA   . LEU A 1 52  ? -4.294  8.577   11.888  1.00 0.00 ? 51  LEU A CA   1  
ATOM 685   C C    . LEU A 1 52  ? -3.318  8.011   10.879  1.00 0.00 ? 51  LEU A C    1  
ATOM 686   O O    . LEU A 1 52  ? -2.957  6.837   10.897  1.00 0.00 ? 51  LEU A O    1  
ATOM 687   C CB   . LEU A 1 52  ? -3.661  9.289   13.114  1.00 0.00 ? 51  LEU A CB   1  
ATOM 688   C CG   . LEU A 1 52  ? -3.230  10.769  12.984  1.00 0.00 ? 51  LEU A CG   1  
ATOM 689   C CD1  . LEU A 1 52  ? -2.042  11.054  12.051  1.00 0.00 ? 51  LEU A CD1  1  
ATOM 690   C CD2  . LEU A 1 52  ? -4.414  11.659  12.617  1.00 0.00 ? 51  LEU A CD2  1  
ATOM 691   H H    . LEU A 1 52  ? -4.778  7.026   13.154  1.00 0.00 ? 51  LEU A H    1  
ATOM 692   H HA   . LEU A 1 52  ? -4.899  9.218   11.265  1.00 0.00 ? 51  LEU A HA   1  
ATOM 693   H HB2  . LEU A 1 52  ? -4.477  9.316   13.879  1.00 0.00 ? 51  LEU A HB2  1  
ATOM 694   H HB3  . LEU A 1 52  ? -2.829  8.688   13.540  1.00 0.00 ? 51  LEU A HB3  1  
ATOM 695   H HG   . LEU A 1 52  ? -2.914  11.054  14.018  1.00 0.00 ? 51  LEU A HG   1  
ATOM 696   H HD11 . LEU A 1 52  ? -2.305  10.893  10.989  1.00 0.00 ? 51  LEU A HD11 1  
ATOM 697   H HD12 . LEU A 1 52  ? -1.187  10.407  12.323  1.00 0.00 ? 51  LEU A HD12 1  
ATOM 698   H HD13 . LEU A 1 52  ? -1.727  12.112  12.162  1.00 0.00 ? 51  LEU A HD13 1  
ATOM 699   H HD21 . LEU A 1 52  ? -4.120  12.731  12.611  1.00 0.00 ? 51  LEU A HD21 1  
ATOM 700   H HD22 . LEU A 1 52  ? -5.245  11.520  13.343  1.00 0.00 ? 51  LEU A HD22 1  
ATOM 701   H HD23 . LEU A 1 52  ? -4.788  11.393  11.609  1.00 0.00 ? 51  LEU A HD23 1  
ATOM 702   N N    . GLY A 1 53  ? -3.080  8.813   9.817   1.00 0.00 ? 52  GLY A N    1  
ATOM 703   C CA   . GLY A 1 53  ? -2.743  8.339   8.491   1.00 0.00 ? 52  GLY A CA   1  
ATOM 704   C C    . GLY A 1 53  ? -1.367  7.821   8.305   1.00 0.00 ? 52  GLY A C    1  
ATOM 705   O O    . GLY A 1 53  ? -1.161  6.921   7.520   1.00 0.00 ? 52  GLY A O    1  
ATOM 706   H H    . GLY A 1 53  ? -3.374  9.773   9.818   1.00 0.00 ? 52  GLY A H    1  
ATOM 707   H HA2  . GLY A 1 53  ? -3.529  7.609   8.258   1.00 0.00 ? 52  GLY A HA2  1  
ATOM 708   H HA3  . GLY A 1 53  ? -2.767  9.141   7.776   1.00 0.00 ? 52  GLY A HA3  1  
ATOM 709   N N    . LYS A 1 54  ? -0.344  8.307   9.062   1.00 0.00 ? 53  LYS A N    1  
ATOM 710   C CA   . LYS A 1 54  ? 1.090   7.925   9.006   1.00 0.00 ? 53  LYS A CA   1  
ATOM 711   C C    . LYS A 1 54  ? 1.392   6.424   9.318   1.00 0.00 ? 53  LYS A C    1  
ATOM 712   O O    . LYS A 1 54  ? 2.530   5.966   9.309   1.00 0.00 ? 53  LYS A O    1  
ATOM 713   C CB   . LYS A 1 54  ? 1.901   8.839   9.994   1.00 0.00 ? 53  LYS A CB   1  
ATOM 714   C CG   . LYS A 1 54  ? 1.378   9.043   11.452  1.00 0.00 ? 53  LYS A CG   1  
ATOM 715   C CD   . LYS A 1 54  ? 0.977   7.767   12.229  1.00 0.00 ? 53  LYS A CD   1  
ATOM 716   C CE   . LYS A 1 54  ? 0.825   7.831   13.758  1.00 0.00 ? 53  LYS A CE   1  
ATOM 717   N NZ   . LYS A 1 54  ? -0.124  8.879   14.183  1.00 0.00 ? 53  LYS A NZ   1  
ATOM 718   H H    . LYS A 1 54  ? -0.537  9.017   9.732   1.00 0.00 ? 53  LYS A H    1  
ATOM 719   H HA   . LYS A 1 54  ? 1.464   8.141   7.989   1.00 0.00 ? 53  LYS A HA   1  
ATOM 720   H HB2  . LYS A 1 54  ? 2.954   8.480   10.053  1.00 0.00 ? 53  LYS A HB2  1  
ATOM 721   H HB3  . LYS A 1 54  ? 1.956   9.853   9.536   1.00 0.00 ? 53  LYS A HB3  1  
ATOM 722   H HG2  . LYS A 1 54  ? 2.184   9.561   12.021  1.00 0.00 ? 53  LYS A HG2  1  
ATOM 723   H HG3  . LYS A 1 54  ? 0.513   9.735   11.427  1.00 0.00 ? 53  LYS A HG3  1  
ATOM 724   H HD2  . LYS A 1 54  ? 0.012   7.395   11.814  1.00 0.00 ? 53  LYS A HD2  1  
ATOM 725   H HD3  . LYS A 1 54  ? 1.761   6.998   12.039  1.00 0.00 ? 53  LYS A HD3  1  
ATOM 726   H HE2  . LYS A 1 54  ? 0.428   6.846   14.117  1.00 0.00 ? 53  LYS A HE2  1  
ATOM 727   H HE3  . LYS A 1 54  ? 1.801   8.032   14.243  1.00 0.00 ? 53  LYS A HE3  1  
ATOM 728   H HZ1  . LYS A 1 54  ? 0.220   9.807   13.863  1.00 0.00 ? 53  LYS A HZ1  1  
ATOM 729   H HZ2  . LYS A 1 54  ? -0.203  8.877   15.220  1.00 0.00 ? 53  LYS A HZ2  1  
ATOM 730   H HZ3  . LYS A 1 54  ? -1.058  8.694   13.764  1.00 0.00 ? 53  LYS A HZ3  1  
ATOM 731   N N    . ASP A 1 55  ? 0.287   5.690   9.589   1.00 0.00 ? 54  ASP A N    1  
ATOM 732   C CA   . ASP A 1 55  ? 0.015   4.303   9.817   1.00 0.00 ? 54  ASP A CA   1  
ATOM 733   C C    . ASP A 1 55  ? -0.753  3.800   8.591   1.00 0.00 ? 54  ASP A C    1  
ATOM 734   O O    . ASP A 1 55  ? -0.219  3.085   7.754   1.00 0.00 ? 54  ASP A O    1  
ATOM 735   C CB   . ASP A 1 55  ? -0.858  4.093   11.099  1.00 0.00 ? 54  ASP A CB   1  
ATOM 736   C CG   . ASP A 1 55  ? -0.066  4.352   12.384  1.00 0.00 ? 54  ASP A CG   1  
ATOM 737   O OD1  . ASP A 1 55  ? 1.191   4.416   12.329  1.00 0.00 ? 54  ASP A OD1  1  
ATOM 738   O OD2  . ASP A 1 55  ? -0.724  4.465   13.453  1.00 0.00 ? 54  ASP A OD2  1  
ATOM 739   H H    . ASP A 1 55  ? -0.548  6.229   9.576   1.00 0.00 ? 54  ASP A H    1  
ATOM 740   H HA   . ASP A 1 55  ? 0.946   3.754   9.860   1.00 0.00 ? 54  ASP A HA   1  
ATOM 741   H HB2  . ASP A 1 55  ? -1.742  4.767   11.072  1.00 0.00 ? 54  ASP A HB2  1  
ATOM 742   H HB3  . ASP A 1 55  ? -1.233  3.051   11.167  1.00 0.00 ? 54  ASP A HB3  1  
ATOM 743   N N    . ILE A 1 56  ? -2.067  4.124   8.422   1.00 0.00 ? 55  ILE A N    1  
ATOM 744   C CA   . ILE A 1 56  ? -2.861  3.670   7.259   1.00 0.00 ? 55  ILE A CA   1  
ATOM 745   C C    . ILE A 1 56  ? -3.319  4.866   6.389   1.00 0.00 ? 55  ILE A C    1  
ATOM 746   O O    . ILE A 1 56  ? -4.237  5.603   6.743   1.00 0.00 ? 55  ILE A O    1  
ATOM 747   C CB   . ILE A 1 56  ? -4.003  2.695   7.567   1.00 0.00 ? 55  ILE A CB   1  
ATOM 748   C CG1  . ILE A 1 56  ? -3.648  1.325   8.239   1.00 0.00 ? 55  ILE A CG1  1  
ATOM 749   C CG2  . ILE A 1 56  ? -4.675  2.339   6.219   1.00 0.00 ? 55  ILE A CG2  1  
ATOM 750   C CD1  . ILE A 1 56  ? -2.611  1.216   9.370   1.00 0.00 ? 55  ILE A CD1  1  
ATOM 751   H H    . ILE A 1 56  ? -2.528  4.704   9.083   1.00 0.00 ? 55  ILE A H    1  
ATOM 752   H HA   . ILE A 1 56  ? -2.226  3.101   6.634   1.00 0.00 ? 55  ILE A HA   1  
ATOM 753   H HB   . ILE A 1 56  ? -4.747  3.198   8.217   1.00 0.00 ? 55  ILE A HB   1  
ATOM 754   H HG12 . ILE A 1 56  ? -4.610  0.932   8.646   1.00 0.00 ? 55  ILE A HG12 1  
ATOM 755   H HG13 . ILE A 1 56  ? -3.358  0.624   7.430   1.00 0.00 ? 55  ILE A HG13 1  
ATOM 756   H HG21 . ILE A 1 56  ? -5.085  1.314   6.268   1.00 0.00 ? 55  ILE A HG21 1  
ATOM 757   H HG22 . ILE A 1 56  ? -3.936  2.315   5.396   1.00 0.00 ? 55  ILE A HG22 1  
ATOM 758   H HG23 . ILE A 1 56  ? -5.482  3.057   5.967   1.00 0.00 ? 55  ILE A HG23 1  
ATOM 759   H HD11 . ILE A 1 56  ? -2.695  0.238   9.887   1.00 0.00 ? 55  ILE A HD11 1  
ATOM 760   H HD12 . ILE A 1 56  ? -2.749  2.013   10.128  1.00 0.00 ? 55  ILE A HD12 1  
ATOM 761   H HD13 . ILE A 1 56  ? -1.558  1.253   8.991   1.00 0.00 ? 55  ILE A HD13 1  
ATOM 762   N N    . LEU A 1 57  ? -2.606  5.080   5.240   1.00 0.00 ? 56  LEU A N    1  
ATOM 763   C CA   . LEU A 1 57  ? -2.685  6.261   4.344   1.00 0.00 ? 56  LEU A CA   1  
ATOM 764   C C    . LEU A 1 57  ? -2.750  6.110   2.858   1.00 0.00 ? 56  LEU A C    1  
ATOM 765   O O    . LEU A 1 57  ? -2.321  5.086   2.335   1.00 0.00 ? 56  LEU A O    1  
ATOM 766   C CB   . LEU A 1 57  ? -1.679  7.390   4.603   1.00 0.00 ? 56  LEU A CB   1  
ATOM 767   C CG   . LEU A 1 57  ? -0.206  6.986   4.452   1.00 0.00 ? 56  LEU A CG   1  
ATOM 768   C CD1  . LEU A 1 57  ? 0.262   6.793   2.982   1.00 0.00 ? 56  LEU A CD1  1  
ATOM 769   C CD2  . LEU A 1 57  ? 0.642   8.026   5.185   1.00 0.00 ? 56  LEU A CD2  1  
ATOM 770   H H    . LEU A 1 57  ? -1.909  4.380   5.025   1.00 0.00 ? 56  LEU A H    1  
ATOM 771   H HA   . LEU A 1 57  ? -3.647  6.708   4.556   1.00 0.00 ? 56  LEU A HA   1  
ATOM 772   H HB2  . LEU A 1 57  ? -1.874  8.287   3.981   1.00 0.00 ? 56  LEU A HB2  1  
ATOM 773   H HB3  . LEU A 1 57  ? -1.889  7.751   5.626   1.00 0.00 ? 56  LEU A HB3  1  
ATOM 774   H HG   . LEU A 1 57  ? -0.073  6.020   5.000   1.00 0.00 ? 56  LEU A HG   1  
ATOM 775   H HD11 . LEU A 1 57  ? 1.351   6.759   2.842   1.00 0.00 ? 56  LEU A HD11 1  
ATOM 776   H HD12 . LEU A 1 57  ? -0.118  7.598   2.329   1.00 0.00 ? 56  LEU A HD12 1  
ATOM 777   H HD13 . LEU A 1 57  ? -0.078  5.841   2.544   1.00 0.00 ? 56  LEU A HD13 1  
ATOM 778   H HD21 . LEU A 1 57  ? 0.161   8.387   6.106   1.00 0.00 ? 56  LEU A HD21 1  
ATOM 779   H HD22 . LEU A 1 57  ? 0.809   8.894   4.538   1.00 0.00 ? 56  LEU A HD22 1  
ATOM 780   H HD23 . LEU A 1 57  ? 1.628   7.608   5.460   1.00 0.00 ? 56  LEU A HD23 1  
ATOM 781   N N    . LEU A 1 58  ? -3.206  7.202   2.160   1.00 0.00 ? 57  LEU A N    1  
ATOM 782   C CA   . LEU A 1 58  ? -3.277  7.491   0.738   1.00 0.00 ? 57  LEU A CA   1  
ATOM 783   C C    . LEU A 1 58  ? -2.047  7.307   -0.091  1.00 0.00 ? 57  LEU A C    1  
ATOM 784   O O    . LEU A 1 58  ? -1.079  8.033   -0.112  1.00 0.00 ? 57  LEU A O    1  
ATOM 785   C CB   . LEU A 1 58  ? -3.733  8.991   0.623   1.00 0.00 ? 57  LEU A CB   1  
ATOM 786   C CG   . LEU A 1 58  ? -2.833  10.245  0.933   1.00 0.00 ? 57  LEU A CG   1  
ATOM 787   C CD1  . LEU A 1 58  ? -1.883  10.135  2.132   1.00 0.00 ? 57  LEU A CD1  1  
ATOM 788   C CD2  . LEU A 1 58  ? -2.162  10.891  -0.303  1.00 0.00 ? 57  LEU A CD2  1  
ATOM 789   H H    . LEU A 1 58  ? -3.581  7.980   2.639   1.00 0.00 ? 57  LEU A H    1  
ATOM 790   H HA   . LEU A 1 58  ? -3.995  6.801   0.289   1.00 0.00 ? 57  LEU A HA   1  
ATOM 791   H HB2  . LEU A 1 58  ? -4.137  9.133   -0.397  1.00 0.00 ? 57  LEU A HB2  1  
ATOM 792   H HB3  . LEU A 1 58  ? -4.600  9.068   1.321   1.00 0.00 ? 57  LEU A HB3  1  
ATOM 793   H HG   . LEU A 1 58  ? -3.557  11.031  1.253   1.00 0.00 ? 57  LEU A HG   1  
ATOM 794   H HD11 . LEU A 1 58  ? -1.147  9.327   1.972   1.00 0.00 ? 57  LEU A HD11 1  
ATOM 795   H HD12 . LEU A 1 58  ? -2.449  9.890   3.043   1.00 0.00 ? 57  LEU A HD12 1  
ATOM 796   H HD13 . LEU A 1 58  ? -1.329  11.085  2.292   1.00 0.00 ? 57  LEU A HD13 1  
ATOM 797   H HD21 . LEU A 1 58  ? -1.735  11.878  -0.025  1.00 0.00 ? 57  LEU A HD21 1  
ATOM 798   H HD22 . LEU A 1 58  ? -2.906  11.039  -1.112  1.00 0.00 ? 57  LEU A HD22 1  
ATOM 799   H HD23 . LEU A 1 58  ? -1.339  10.268  -0.699  1.00 0.00 ? 57  LEU A HD23 1  
ATOM 800   N N    . CYS A 1 59  ? -2.066  6.196   -0.793  1.00 0.00 ? 58  CYS A N    1  
ATOM 801   C CA   . CYS A 1 59  ? -1.050  5.671   -1.592  1.00 0.00 ? 58  CYS A CA   1  
ATOM 802   C C    . CYS A 1 59  ? -1.641  5.455   -2.985  1.00 0.00 ? 58  CYS A C    1  
ATOM 803   O O    . CYS A 1 59  ? -2.828  5.609   -3.258  1.00 0.00 ? 58  CYS A O    1  
ATOM 804   C CB   . CYS A 1 59  ? -0.553  4.461   -0.747  1.00 0.00 ? 58  CYS A CB   1  
ATOM 805   S SG   . CYS A 1 59  ? 1.257   4.505   -0.469  1.00 0.00 ? 58  CYS A SG   1  
ATOM 806   H H    . CYS A 1 59  ? -2.834  5.567   -0.834  1.00 0.00 ? 58  CYS A H    1  
ATOM 807   H HA   . CYS A 1 59  ? -0.248  6.393   -1.716  1.00 0.00 ? 58  CYS A HA   1  
ATOM 808   H HB2  . CYS A 1 59  ? -1.024  4.530   0.265   1.00 0.00 ? 58  CYS A HB2  1  
ATOM 809   H HB3  . CYS A 1 59  ? -0.920  3.489   -1.148  1.00 0.00 ? 58  CYS A HB3  1  
ATOM 810   H HG   . CYS A 1 59  ? 1.635   4.532   -1.742  1.00 0.00 ? 58  CYS A HG   1  
ATOM 811   N N    . ASP A 1 60  ? -0.757  5.041   -3.892  1.00 0.00 ? 59  ASP A N    1  
ATOM 812   C CA   . ASP A 1 60  ? -1.001  4.455   -5.221  1.00 0.00 ? 59  ASP A CA   1  
ATOM 813   C C    . ASP A 1 60  ? -1.227  2.927   -5.018  1.00 0.00 ? 59  ASP A C    1  
ATOM 814   O O    . ASP A 1 60  ? -2.157  2.416   -5.634  1.00 0.00 ? 59  ASP A O    1  
ATOM 815   C CB   . ASP A 1 60  ? 0.075   4.749   -6.345  1.00 0.00 ? 59  ASP A CB   1  
ATOM 816   C CG   . ASP A 1 60  ? -0.550  4.749   -7.753  1.00 0.00 ? 59  ASP A CG   1  
ATOM 817   O OD1  . ASP A 1 60  ? -1.042  3.679   -8.194  1.00 0.00 ? 59  ASP A OD1  1  
ATOM 818   O OD2  . ASP A 1 60  ? -0.534  5.829   -8.402  1.00 0.00 ? 59  ASP A OD2  1  
ATOM 819   H H    . ASP A 1 60  ? 0.138   4.978   -3.470  1.00 0.00 ? 59  ASP A H    1  
ATOM 820   H HA   . ASP A 1 60  ? -1.942  4.856   -5.581  1.00 0.00 ? 59  ASP A HA   1  
ATOM 821   H HB2  . ASP A 1 60  ? 0.544   5.753   -6.207  1.00 0.00 ? 59  ASP A HB2  1  
ATOM 822   H HB3  . ASP A 1 60  ? 0.904   4.006   -6.339  1.00 0.00 ? 59  ASP A HB3  1  
ATOM 823   N N    . PRO A 1 61  ? -0.490  2.110   -4.192  1.00 0.00 ? 60  PRO A N    1  
ATOM 824   C CA   . PRO A 1 61  ? 0.616   2.407   -3.271  1.00 0.00 ? 60  PRO A CA   1  
ATOM 825   C C    . PRO A 1 61  ? 1.812   3.095   -3.837  1.00 0.00 ? 60  PRO A C    1  
ATOM 826   O O    . PRO A 1 61  ? 1.961   4.280   -3.542  1.00 0.00 ? 60  PRO A O    1  
ATOM 827   C CB   . PRO A 1 61  ? 0.936   1.091   -2.505  1.00 0.00 ? 60  PRO A CB   1  
ATOM 828   C CG   . PRO A 1 61  ? 0.200   0.014   -3.297  1.00 0.00 ? 60  PRO A CG   1  
ATOM 829   C CD   . PRO A 1 61  ? -0.984  0.766   -3.917  1.00 0.00 ? 60  PRO A CD   1  
ATOM 830   H HA   . PRO A 1 61  ? 0.335   3.135   -2.542  1.00 0.00 ? 60  PRO A HA   1  
ATOM 831   H HB2  . PRO A 1 61  ? 2.015   0.844   -2.403  1.00 0.00 ? 60  PRO A HB2  1  
ATOM 832   H HB3  . PRO A 1 61  ? 0.551   1.124   -1.461  1.00 0.00 ? 60  PRO A HB3  1  
ATOM 833   H HG2  . PRO A 1 61  ? 0.878   -0.345  -4.099  1.00 0.00 ? 60  PRO A HG2  1  
ATOM 834   H HG3  . PRO A 1 61  ? -0.113  -0.847  -2.679  1.00 0.00 ? 60  PRO A HG3  1  
ATOM 835   H HD2  . PRO A 1 61  ? -1.375  0.246   -4.817  1.00 0.00 ? 60  PRO A HD2  1  
ATOM 836   H HD3  . PRO A 1 61  ? -1.797  0.843   -3.160  1.00 0.00 ? 60  PRO A HD3  1  
ATOM 837   N N    . ILE A 1 62  ? 2.722   2.407   -4.529  1.00 0.00 ? 61  ILE A N    1  
ATOM 838   C CA   . ILE A 1 62  ? 4.068   2.928   -4.702  1.00 0.00 ? 61  ILE A CA   1  
ATOM 839   C C    . ILE A 1 62  ? 4.519   3.047   -6.150  1.00 0.00 ? 61  ILE A C    1  
ATOM 840   O O    . ILE A 1 62  ? 3.879   2.446   -7.007  1.00 0.00 ? 61  ILE A O    1  
ATOM 841   C CB   . ILE A 1 62  ? 4.929   2.138   -3.701  1.00 0.00 ? 61  ILE A CB   1  
ATOM 842   C CG1  . ILE A 1 62  ? 4.677   2.792   -2.312  1.00 0.00 ? 61  ILE A CG1  1  
ATOM 843   C CG2  . ILE A 1 62  ? 6.436   2.036   -4.006  1.00 0.00 ? 61  ILE A CG2  1  
ATOM 844   C CD1  . ILE A 1 62  ? 5.918   3.079   -1.476  1.00 0.00 ? 61  ILE A CD1  1  
ATOM 845   H H    . ILE A 1 62  ? 2.579   1.449   -4.762  1.00 0.00 ? 61  ILE A H    1  
ATOM 846   H HA   . ILE A 1 62  ? 4.097   3.954   -4.365  1.00 0.00 ? 61  ILE A HA   1  
ATOM 847   H HB   . ILE A 1 62  ? 4.519   1.086   -3.646  1.00 0.00 ? 61  ILE A HB   1  
ATOM 848   H HG12 . ILE A 1 62  ? 4.147   3.757   -2.424  1.00 0.00 ? 61  ILE A HG12 1  
ATOM 849   H HG13 . ILE A 1 62  ? 3.952   2.163   -1.764  1.00 0.00 ? 61  ILE A HG13 1  
ATOM 850   H HG21 . ILE A 1 62  ? 6.637   1.669   -5.030  1.00 0.00 ? 61  ILE A HG21 1  
ATOM 851   H HG22 . ILE A 1 62  ? 6.889   1.317   -3.291  1.00 0.00 ? 61  ILE A HG22 1  
ATOM 852   H HG23 . ILE A 1 62  ? 6.956   3.005   -3.849  1.00 0.00 ? 61  ILE A HG23 1  
ATOM 853   H HD11 . ILE A 1 62  ? 6.491   3.914   -1.937  1.00 0.00 ? 61  ILE A HD11 1  
ATOM 854   H HD12 . ILE A 1 62  ? 6.578   2.186   -1.395  1.00 0.00 ? 61  ILE A HD12 1  
ATOM 855   H HD13 . ILE A 1 62  ? 5.616   3.382   -0.453  1.00 0.00 ? 61  ILE A HD13 1  
ATOM 856   N N    . PRO A 1 63  ? 5.572   3.857   -6.503  1.00 0.00 ? 62  PRO A N    1  
ATOM 857   C CA   . PRO A 1 63  ? 5.976   4.271   -7.845  1.00 0.00 ? 62  PRO A CA   1  
ATOM 858   C C    . PRO A 1 63  ? 6.202   3.193   -8.908  1.00 0.00 ? 62  PRO A C    1  
ATOM 859   O O    . PRO A 1 63  ? 6.971   2.272   -8.702  1.00 0.00 ? 62  PRO A O    1  
ATOM 860   C CB   . PRO A 1 63  ? 7.391   4.878   -7.519  1.00 0.00 ? 62  PRO A CB   1  
ATOM 861   C CG   . PRO A 1 63  ? 7.366   5.374   -6.069  1.00 0.00 ? 62  PRO A CG   1  
ATOM 862   C CD   . PRO A 1 63  ? 6.006   4.920   -5.589  1.00 0.00 ? 62  PRO A CD   1  
ATOM 863   H HA   . PRO A 1 63  ? 5.255   4.979   -8.223  1.00 0.00 ? 62  PRO A HA   1  
ATOM 864   H HB2  . PRO A 1 63  ? 8.211   4.106   -7.488  1.00 0.00 ? 62  PRO A HB2  1  
ATOM 865   H HB3  . PRO A 1 63  ? 7.663   5.682   -8.230  1.00 0.00 ? 62  PRO A HB3  1  
ATOM 866   H HG2  . PRO A 1 63  ? 8.141   4.881   -5.439  1.00 0.00 ? 62  PRO A HG2  1  
ATOM 867   H HG3  . PRO A 1 63  ? 7.510   6.467   -5.991  1.00 0.00 ? 62  PRO A HG3  1  
ATOM 868   H HD2  . PRO A 1 63  ? 6.052   4.643   -4.517  1.00 0.00 ? 62  PRO A HD2  1  
ATOM 869   H HD3  . PRO A 1 63  ? 5.292   5.770   -5.710  1.00 0.00 ? 62  PRO A HD3  1  
ATOM 870   N N    . LEU A 1 64  ? 5.555   3.306   -10.084 1.00 0.00 ? 63  LEU A N    1  
ATOM 871   C CA   . LEU A 1 64  ? 5.468   2.535   -11.347 1.00 0.00 ? 63  LEU A CA   1  
ATOM 872   C C    . LEU A 1 64  ? 6.689   1.978   -12.090 1.00 0.00 ? 63  LEU A C    1  
ATOM 873   O O    . LEU A 1 64  ? 6.706   1.666   -13.282 1.00 0.00 ? 63  LEU A O    1  
ATOM 874   C CB   . LEU A 1 64  ? 4.322   3.151   -12.164 1.00 0.00 ? 63  LEU A CB   1  
ATOM 875   C CG   . LEU A 1 64  ? 3.020   3.104   -11.311 1.00 0.00 ? 63  LEU A CG   1  
ATOM 876   C CD1  . LEU A 1 64  ? 2.524   4.454   -10.730 1.00 0.00 ? 63  LEU A CD1  1  
ATOM 877   C CD2  . LEU A 1 64  ? 1.990   2.337   -12.136 1.00 0.00 ? 63  LEU A CD2  1  
ATOM 878   H H    . LEU A 1 64  ? 4.961   4.102   -10.146 1.00 0.00 ? 63  LEU A H    1  
ATOM 879   H HA   . LEU A 1 64  ? 5.128   1.558   -11.023 1.00 0.00 ? 63  LEU A HA   1  
ATOM 880   H HB2  . LEU A 1 64  ? 4.560   4.197   -12.448 1.00 0.00 ? 63  LEU A HB2  1  
ATOM 881   H HB3  . LEU A 1 64  ? 4.165   2.569   -13.101 1.00 0.00 ? 63  LEU A HB3  1  
ATOM 882   H HG   . LEU A 1 64  ? 3.205   2.448   -10.423 1.00 0.00 ? 63  LEU A HG   1  
ATOM 883   H HD11 . LEU A 1 64  ? 1.702   4.301   -9.987  1.00 0.00 ? 63  LEU A HD11 1  
ATOM 884   H HD12 . LEU A 1 64  ? 2.147   5.110   -11.540 1.00 0.00 ? 63  LEU A HD12 1  
ATOM 885   H HD13 . LEU A 1 64  ? 3.331   4.993   -10.194 1.00 0.00 ? 63  LEU A HD13 1  
ATOM 886   H HD21 . LEU A 1 64  ? 1.020   2.265   -11.613 1.00 0.00 ? 63  LEU A HD21 1  
ATOM 887   H HD22 . LEU A 1 64  ? 2.412   1.316   -12.291 1.00 0.00 ? 63  LEU A HD22 1  
ATOM 888   H HD23 . LEU A 1 64  ? 1.856   2.818   -13.125 1.00 0.00 ? 63  LEU A HD23 1  
ATOM 889   N N    . ASP A 1 65  ? 7.757   1.994   -11.313 1.00 0.00 ? 64  ASP A N    1  
ATOM 890   C CA   . ASP A 1 65  ? 9.149   1.724   -11.528 1.00 0.00 ? 64  ASP A CA   1  
ATOM 891   C C    . ASP A 1 65  ? 9.708   1.047   -10.284 1.00 0.00 ? 64  ASP A C    1  
ATOM 892   O O    . ASP A 1 65  ? 10.873  1.258   -9.948  1.00 0.00 ? 64  ASP A O    1  
ATOM 893   C CB   . ASP A 1 65  ? 9.751   3.154   -11.500 1.00 0.00 ? 64  ASP A CB   1  
ATOM 894   C CG   . ASP A 1 65  ? 9.530   3.871   -12.833 1.00 0.00 ? 64  ASP A CG   1  
ATOM 895   O OD1  . ASP A 1 65  ? 10.088  3.397   -13.858 1.00 0.00 ? 64  ASP A OD1  1  
ATOM 896   O OD2  . ASP A 1 65  ? 8.802   4.900   -12.841 1.00 0.00 ? 64  ASP A OD2  1  
ATOM 897   H H    . ASP A 1 65  ? 7.486   2.236   -10.375 1.00 0.00 ? 64  ASP A H    1  
ATOM 898   H HA   . ASP A 1 65  ? 9.351   1.142   -12.418 1.00 0.00 ? 64  ASP A HA   1  
ATOM 899   H HB2  . ASP A 1 65  ? 9.167   3.672   -10.689 1.00 0.00 ? 64  ASP A HB2  1  
ATOM 900   H HB3  . ASP A 1 65  ? 10.828  3.200   -11.249 1.00 0.00 ? 64  ASP A HB3  1  
ATOM 901   N N    . THR A 1 66  ? 8.892   0.301   -9.485  1.00 0.00 ? 65  THR A N    1  
ATOM 902   C CA   . THR A 1 66  ? 9.335   -0.017  -8.125  1.00 0.00 ? 65  THR A CA   1  
ATOM 903   C C    . THR A 1 66  ? 9.595   -1.422  -7.922  1.00 0.00 ? 65  THR A C    1  
ATOM 904   O O    . THR A 1 66  ? 8.720   -2.208  -7.606  1.00 0.00 ? 65  THR A O    1  
ATOM 905   C CB   . THR A 1 66  ? 8.513   0.444   -6.899  1.00 0.00 ? 65  THR A CB   1  
ATOM 906   O OG1  . THR A 1 66  ? 8.525   1.846   -6.795  1.00 0.00 ? 65  THR A OG1  1  
ATOM 907   C CG2  . THR A 1 66  ? 9.136   0.062   -5.545  1.00 0.00 ? 65  THR A CG2  1  
ATOM 908   H H    . THR A 1 66  ? 7.966   0.027   -9.730  1.00 0.00 ? 65  THR A H    1  
ATOM 909   H HA   . THR A 1 66  ? 10.274  0.445   -7.903  1.00 0.00 ? 65  THR A HA   1  
ATOM 910   H HB   . THR A 1 66  ? 7.459   0.093   -6.956  1.00 0.00 ? 65  THR A HB   1  
ATOM 911   H HG1  . THR A 1 66  ? 7.975   2.132   -7.559  1.00 0.00 ? 65  THR A HG1  1  
ATOM 912   H HG21 . THR A 1 66  ? 9.054   -1.018  -5.345  1.00 0.00 ? 65  THR A HG21 1  
ATOM 913   H HG22 . THR A 1 66  ? 8.618   0.583   -4.717  1.00 0.00 ? 65  THR A HG22 1  
ATOM 914   H HG23 . THR A 1 66  ? 10.203  0.368   -5.528  1.00 0.00 ? 65  THR A HG23 1  
ATOM 915   N N    . GLU A 1 67  ? 10.897  -1.723  -7.849  1.00 0.00 ? 66  GLU A N    1  
ATOM 916   C CA   . GLU A 1 67  ? 11.439  -2.941  -7.247  1.00 0.00 ? 66  GLU A CA   1  
ATOM 917   C C    . GLU A 1 67  ? 11.162  -2.908  -5.718  1.00 0.00 ? 66  GLU A C    1  
ATOM 918   O O    . GLU A 1 67  ? 11.918  -2.337  -4.946  1.00 0.00 ? 66  GLU A O    1  
ATOM 919   C CB   . GLU A 1 67  ? 12.974  -2.883  -7.528  1.00 0.00 ? 66  GLU A CB   1  
ATOM 920   C CG   . GLU A 1 67  ? 13.861  -4.038  -7.015  1.00 0.00 ? 66  GLU A CG   1  
ATOM 921   C CD   . GLU A 1 67  ? 13.856  -5.218  -7.985  1.00 0.00 ? 66  GLU A CD   1  
ATOM 922   O OE1  . GLU A 1 67  ? 12.755  -5.754  -8.272  1.00 0.00 ? 66  GLU A OE1  1  
ATOM 923   O OE2  . GLU A 1 67  ? 14.961  -5.598  -8.458  1.00 0.00 ? 66  GLU A OE2  1  
ATOM 924   H H    . GLU A 1 67  ? 11.491  -0.985  -8.140  1.00 0.00 ? 66  GLU A H    1  
ATOM 925   H HA   . GLU A 1 67  ? 10.985  -3.816  -7.675  1.00 0.00 ? 66  GLU A HA   1  
ATOM 926   H HB2  . GLU A 1 67  ? 13.121  -2.782  -8.626  1.00 0.00 ? 66  GLU A HB2  1  
ATOM 927   H HB3  . GLU A 1 67  ? 13.376  -1.949  -7.068  1.00 0.00 ? 66  GLU A HB3  1  
ATOM 928   H HG2  . GLU A 1 67  ? 14.904  -3.658  -6.935  1.00 0.00 ? 66  GLU A HG2  1  
ATOM 929   H HG3  . GLU A 1 67  ? 13.547  -4.359  -6.003  1.00 0.00 ? 66  GLU A HG3  1  
ATOM 930   N N    . VAL A 1 68  ? 10.020  -3.545  -5.346  1.00 0.00 ? 67  VAL A N    1  
ATOM 931   C CA   . VAL A 1 68  ? 9.281   -3.733  -4.101  1.00 0.00 ? 67  VAL A CA   1  
ATOM 932   C C    . VAL A 1 68  ? 9.477   -5.138  -3.747  1.00 0.00 ? 67  VAL A C    1  
ATOM 933   O O    . VAL A 1 68  ? 10.048  -5.910  -4.497  1.00 0.00 ? 67  VAL A O    1  
ATOM 934   C CB   . VAL A 1 68  ? 7.764   -3.464  -4.051  1.00 0.00 ? 67  VAL A CB   1  
ATOM 935   C CG1  . VAL A 1 68  ? 7.521   -2.290  -3.092  1.00 0.00 ? 67  VAL A CG1  1  
ATOM 936   C CG2  . VAL A 1 68  ? 7.125   -3.283  -5.411  1.00 0.00 ? 67  VAL A CG2  1  
ATOM 937   H H    . VAL A 1 68  ? 9.525   -3.970  -6.117  1.00 0.00 ? 67  VAL A H    1  
ATOM 938   H HA   . VAL A 1 68  ? 9.740   -3.176  -3.302  1.00 0.00 ? 67  VAL A HA   1  
ATOM 939   H HB   . VAL A 1 68  ? 7.159   -4.297  -3.630  1.00 0.00 ? 67  VAL A HB   1  
ATOM 940   H HG11 . VAL A 1 68  ? 6.440   -2.030  -3.049  1.00 0.00 ? 67  VAL A HG11 1  
ATOM 941   H HG12 . VAL A 1 68  ? 8.093   -1.385  -3.380  1.00 0.00 ? 67  VAL A HG12 1  
ATOM 942   H HG13 . VAL A 1 68  ? 7.845   -2.619  -2.076  1.00 0.00 ? 67  VAL A HG13 1  
ATOM 943   H HG21 . VAL A 1 68  ? 7.373   -2.266  -5.769  1.00 0.00 ? 67  VAL A HG21 1  
ATOM 944   H HG22 . VAL A 1 68  ? 6.019   -3.349  -5.299  1.00 0.00 ? 67  VAL A HG22 1  
ATOM 945   H HG23 . VAL A 1 68  ? 7.451   -4.052  -6.143  1.00 0.00 ? 67  VAL A HG23 1  
ATOM 946   N N    . THR A 1 69  ? 9.005   -5.509  -2.551  1.00 0.00 ? 68  THR A N    1  
ATOM 947   C CA   . THR A 1 69  ? 9.186   -6.860  -2.053  1.00 0.00 ? 68  THR A CA   1  
ATOM 948   C C    . THR A 1 69  ? 7.905   -7.645  -2.305  1.00 0.00 ? 68  THR A C    1  
ATOM 949   O O    . THR A 1 69  ? 6.806   -7.095  -2.277  1.00 0.00 ? 68  THR A O    1  
ATOM 950   C CB   . THR A 1 69  ? 9.763   -6.798  -0.649  1.00 0.00 ? 68  THR A CB   1  
ATOM 951   O OG1  . THR A 1 69  ? 9.905   -8.046  0.000   1.00 0.00 ? 68  THR A OG1  1  
ATOM 952   C CG2  . THR A 1 69  ? 8.834   -5.962  0.189   1.00 0.00 ? 68  THR A CG2  1  
ATOM 953   H H    . THR A 1 69  ? 8.419   -4.885  -1.980  1.00 0.00 ? 68  THR A H    1  
ATOM 954   H HA   . THR A 1 69  ? 9.948   -7.375  -2.592  1.00 0.00 ? 68  THR A HA   1  
ATOM 955   H HB   . THR A 1 69  ? 10.765  -6.307  -0.702  1.00 0.00 ? 68  THR A HB   1  
ATOM 956   H HG1  . THR A 1 69  ? 10.333  -7.847  0.842   1.00 0.00 ? 68  THR A HG1  1  
ATOM 957   H HG21 . THR A 1 69  ? 9.201   -5.836  1.228   1.00 0.00 ? 68  THR A HG21 1  
ATOM 958   H HG22 . THR A 1 69  ? 7.868   -6.505  0.183   1.00 0.00 ? 68  THR A HG22 1  
ATOM 959   H HG23 . THR A 1 69  ? 8.651   -4.974  -0.295  1.00 0.00 ? 68  THR A HG23 1  
ATOM 960   N N    . ALA A 1 70  ? 8.043   -8.949  -2.615  1.00 0.00 ? 69  ALA A N    1  
ATOM 961   C CA   . ALA A 1 70  ? 6.995   -9.889  -2.953  1.00 0.00 ? 69  ALA A CA   1  
ATOM 962   C C    . ALA A 1 70  ? 6.874   -10.943 -1.867  1.00 0.00 ? 69  ALA A C    1  
ATOM 963   O O    . ALA A 1 70  ? 7.891   -11.358 -1.305  1.00 0.00 ? 69  ALA A O    1  
ATOM 964   C CB   . ALA A 1 70  ? 7.353   -10.496 -4.311  1.00 0.00 ? 69  ALA A CB   1  
ATOM 965   H H    . ALA A 1 70  ? 8.976   -9.339  -2.657  1.00 0.00 ? 69  ALA A H    1  
ATOM 966   H HA   . ALA A 1 70  ? 6.043   -9.385  -3.026  1.00 0.00 ? 69  ALA A HA   1  
ATOM 967   H HB1  . ALA A 1 70  ? 6.600   -11.236 -4.656  1.00 0.00 ? 69  ALA A HB1  1  
ATOM 968   H HB2  . ALA A 1 70  ? 8.360   -10.960 -4.256  1.00 0.00 ? 69  ALA A HB2  1  
ATOM 969   H HB3  . ALA A 1 70  ? 7.408   -9.659  -5.043  1.00 0.00 ? 69  ALA A HB3  1  
ATOM 970   N N    . LEU A 1 71  ? 5.636   -11.394 -1.499  1.00 0.00 ? 70  LEU A N    1  
ATOM 971   C CA   . LEU A 1 71  ? 5.414   -12.314 -0.370  1.00 0.00 ? 70  LEU A CA   1  
ATOM 972   C C    . LEU A 1 71  ? 5.995   -13.728 -0.498  1.00 0.00 ? 70  LEU A C    1  
ATOM 973   O O    . LEU A 1 71  ? 5.491   -14.684 -1.086  1.00 0.00 ? 70  LEU A O    1  
ATOM 974   C CB   . LEU A 1 71  ? 3.973   -12.375 0.138   1.00 0.00 ? 70  LEU A CB   1  
ATOM 975   C CG   . LEU A 1 71  ? 3.783   -12.542 1.680   1.00 0.00 ? 70  LEU A CG   1  
ATOM 976   C CD1  . LEU A 1 71  ? 4.536   -13.684 2.395   1.00 0.00 ? 70  LEU A CD1  1  
ATOM 977   C CD2  . LEU A 1 71  ? 4.049   -11.235 2.445   1.00 0.00 ? 70  LEU A CD2  1  
ATOM 978   H H    . LEU A 1 71  ? 4.806   -11.040 -1.955  1.00 0.00 ? 70  LEU A H    1  
ATOM 979   H HA   . LEU A 1 71  ? 5.912   -11.845 0.468   1.00 0.00 ? 70  LEU A HA   1  
ATOM 980   H HB2  . LEU A 1 71  ? 3.473   -11.420 -0.141  1.00 0.00 ? 70  LEU A HB2  1  
ATOM 981   H HB3  . LEU A 1 71  ? 3.469   -13.188 -0.414  1.00 0.00 ? 70  LEU A HB3  1  
ATOM 982   H HG   . LEU A 1 71  ? 2.712   -12.776 1.797   1.00 0.00 ? 70  LEU A HG   1  
ATOM 983   H HD11 . LEU A 1 71  ? 4.127   -13.832 3.417   1.00 0.00 ? 70  LEU A HD11 1  
ATOM 984   H HD12 . LEU A 1 71  ? 5.604   -13.408 2.520   1.00 0.00 ? 70  LEU A HD12 1  
ATOM 985   H HD13 . LEU A 1 71  ? 4.459   -14.641 1.840   1.00 0.00 ? 70  LEU A HD13 1  
ATOM 986   H HD21 . LEU A 1 71  ? 5.139   -11.010 2.426   1.00 0.00 ? 70  LEU A HD21 1  
ATOM 987   H HD22 . LEU A 1 71  ? 3.743   -11.346 3.507   1.00 0.00 ? 70  LEU A HD22 1  
ATOM 988   H HD23 . LEU A 1 71  ? 3.494   -10.386 1.993   1.00 0.00 ? 70  LEU A HD23 1  
ATOM 989   N N    . SER A 1 72  ? 7.160   -13.745 0.140   1.00 0.00 ? 71  SER A N    1  
ATOM 990   C CA   . SER A 1 72  ? 8.191   -14.695 0.435   1.00 0.00 ? 71  SER A CA   1  
ATOM 991   C C    . SER A 1 72  ? 8.446   -14.313 1.887   1.00 0.00 ? 71  SER A C    1  
ATOM 992   O O    . SER A 1 72  ? 7.901   -13.310 2.346   1.00 0.00 ? 71  SER A O    1  
ATOM 993   C CB   . SER A 1 72  ? 9.406   -14.651 -0.547  1.00 0.00 ? 71  SER A CB   1  
ATOM 994   O OG   . SER A 1 72  ? 9.748   -13.338 -0.996  1.00 0.00 ? 71  SER A OG   1  
ATOM 995   H H    . SER A 1 72  ? 7.344   -12.885 0.613   1.00 0.00 ? 71  SER A H    1  
ATOM 996   H HA   . SER A 1 72  ? 7.769   -15.691 0.434   1.00 0.00 ? 71  SER A HA   1  
ATOM 997   H HB2  . SER A 1 72  ? 10.305  -15.133 -0.108  1.00 0.00 ? 71  SER A HB2  1  
ATOM 998   H HB3  . SER A 1 72  ? 9.126   -15.234 -1.453  1.00 0.00 ? 71  SER A HB3  1  
ATOM 999   H HG   . SER A 1 72  ? 8.916   -12.837 -1.125  1.00 0.00 ? 71  SER A HG   1  
ATOM 1000  N N    . GLU A 1 73  ? 9.192   -15.107 2.678   1.00 0.00 ? 72  GLU A N    1  
ATOM 1001  C CA   . GLU A 1 73  ? 9.454   -14.999 4.120   1.00 0.00 ? 72  GLU A CA   1  
ATOM 1002  C C    . GLU A 1 73  ? 9.670   -13.639 4.826   1.00 0.00 ? 72  GLU A C    1  
ATOM 1003  O O    . GLU A 1 73  ? 10.005  -12.613 4.252   1.00 0.00 ? 72  GLU A O    1  
ATOM 1004  C CB   . GLU A 1 73  ? 10.675  -15.887 4.470   1.00 0.00 ? 72  GLU A CB   1  
ATOM 1005  C CG   . GLU A 1 73  ? 11.513  -16.353 3.266   1.00 0.00 ? 72  GLU A CG   1  
ATOM 1006  C CD   . GLU A 1 73  ? 10.940  -17.577 2.549   1.00 0.00 ? 72  GLU A CD   1  
ATOM 1007  O OE1  . GLU A 1 73  ? 10.699  -18.606 3.235   1.00 0.00 ? 72  GLU A OE1  1  
ATOM 1008  O OE2  . GLU A 1 73  ? 10.747  -17.502 1.307   1.00 0.00 ? 72  GLU A OE2  1  
ATOM 1009  H H    . GLU A 1 73  ? 9.610   -15.909 2.266   1.00 0.00 ? 72  GLU A H    1  
ATOM 1010  H HA   . GLU A 1 73  ? 8.582   -15.434 4.593   1.00 0.00 ? 72  GLU A HA   1  
ATOM 1011  H HB2  . GLU A 1 73  ? 11.436  -15.331 5.076   1.00 0.00 ? 72  GLU A HB2  1  
ATOM 1012  H HB3  . GLU A 1 73  ? 10.348  -16.760 5.071   1.00 0.00 ? 72  GLU A HB3  1  
ATOM 1013  H HG2  . GLU A 1 73  ? 11.669  -15.488 2.580   1.00 0.00 ? 72  GLU A HG2  1  
ATOM 1014  H HG3  . GLU A 1 73  ? 12.484  -16.636 3.717   1.00 0.00 ? 72  GLU A HG3  1  
ATOM 1015  N N    . ASP A 1 74  ? 9.465   -13.660 6.168   1.00 0.00 ? 73  ASP A N    1  
ATOM 1016  C CA   . ASP A 1 74  ? 9.327   -12.524 7.098   1.00 0.00 ? 73  ASP A CA   1  
ATOM 1017  C C    . ASP A 1 74  ? 10.387  -11.424 7.133   1.00 0.00 ? 73  ASP A C    1  
ATOM 1018  O O    . ASP A 1 74  ? 10.059  -10.244 7.027   1.00 0.00 ? 73  ASP A O    1  
ATOM 1019  C CB   . ASP A 1 74  ? 9.060   -13.065 8.544   1.00 0.00 ? 73  ASP A CB   1  
ATOM 1020  C CG   . ASP A 1 74  ? 8.399   -12.043 9.485   1.00 0.00 ? 73  ASP A CG   1  
ATOM 1021  O OD1  . ASP A 1 74  ? 7.270   -11.585 9.163   1.00 0.00 ? 73  ASP A OD1  1  
ATOM 1022  O OD2  . ASP A 1 74  ? 9.020   -11.711 10.531  1.00 0.00 ? 73  ASP A OD2  1  
ATOM 1023  H H    . ASP A 1 74  ? 9.279   -14.560 6.544   1.00 0.00 ? 73  ASP A H    1  
ATOM 1024  H HA   . ASP A 1 74  ? 8.432   -12.025 6.771   1.00 0.00 ? 73  ASP A HA   1  
ATOM 1025  H HB2  . ASP A 1 74  ? 8.363   -13.928 8.460   1.00 0.00 ? 73  ASP A HB2  1  
ATOM 1026  H HB3  . ASP A 1 74  ? 9.998   -13.447 8.996   1.00 0.00 ? 73  ASP A HB3  1  
ATOM 1027  N N    . GLU A 1 75  ? 11.681  -11.784 7.244   1.00 0.00 ? 74  GLU A N    1  
ATOM 1028  C CA   . GLU A 1 75  ? 12.805  -10.855 7.156   1.00 0.00 ? 74  GLU A CA   1  
ATOM 1029  C C    . GLU A 1 75  ? 13.576  -11.105 5.873   1.00 0.00 ? 74  GLU A C    1  
ATOM 1030  O O    . GLU A 1 75  ? 14.579  -10.459 5.592   1.00 0.00 ? 74  GLU A O    1  
ATOM 1031  C CB   . GLU A 1 75  ? 13.765  -11.001 8.375   1.00 0.00 ? 74  GLU A CB   1  
ATOM 1032  C CG   . GLU A 1 75  ? 13.024  -11.235 9.706   1.00 0.00 ? 74  GLU A CG   1  
ATOM 1033  C CD   . GLU A 1 75  ? 13.985  -11.276 10.896  1.00 0.00 ? 74  GLU A CD   1  
ATOM 1034  O OE1  . GLU A 1 75  ? 15.220  -11.131 10.694  1.00 0.00 ? 74  GLU A OE1  1  
ATOM 1035  O OE2  . GLU A 1 75  ? 13.481  -11.461 12.038  1.00 0.00 ? 74  GLU A OE2  1  
ATOM 1036  H H    . GLU A 1 75  ? 11.927  -12.738 7.375   1.00 0.00 ? 74  GLU A H    1  
ATOM 1037  H HA   . GLU A 1 75  ? 12.470  -9.827  7.113   1.00 0.00 ? 74  GLU A HA   1  
ATOM 1038  H HB2  . GLU A 1 75  ? 14.454  -11.866 8.242   1.00 0.00 ? 74  GLU A HB2  1  
ATOM 1039  H HB3  . GLU A 1 75  ? 14.391  -10.081 8.449   1.00 0.00 ? 74  GLU A HB3  1  
ATOM 1040  H HG2  . GLU A 1 75  ? 12.276  -10.430 9.861   1.00 0.00 ? 74  GLU A HG2  1  
ATOM 1041  H HG3  . GLU A 1 75  ? 12.498  -12.215 9.646   1.00 0.00 ? 74  GLU A HG3  1  
ATOM 1042  N N    . TYR A 1 76  ? 13.161  -12.165 5.138   1.00 0.00 ? 75  TYR A N    1  
ATOM 1043  C CA   . TYR A 1 76  ? 13.955  -12.807 4.106   1.00 0.00 ? 75  TYR A CA   1  
ATOM 1044  C C    . TYR A 1 76  ? 13.351  -12.771 2.708   1.00 0.00 ? 75  TYR A C    1  
ATOM 1045  O O    . TYR A 1 76  ? 13.931  -13.358 1.797   1.00 0.00 ? 75  TYR A O    1  
ATOM 1046  C CB   . TYR A 1 76  ? 14.279  -14.268 4.552   1.00 0.00 ? 75  TYR A CB   1  
ATOM 1047  C CG   . TYR A 1 76  ? 14.729  -14.345 5.992   1.00 0.00 ? 75  TYR A CG   1  
ATOM 1048  C CD1  . TYR A 1 76  ? 16.051  -14.109 6.314   1.00 0.00 ? 75  TYR A CD1  1  
ATOM 1049  C CD2  . TYR A 1 76  ? 13.823  -14.614 7.016   1.00 0.00 ? 75  TYR A CD2  1  
ATOM 1050  C CE1  . TYR A 1 76  ? 16.466  -14.134 7.630   1.00 0.00 ? 75  TYR A CE1  1  
ATOM 1051  C CE2  . TYR A 1 76  ? 14.246  -14.667 8.332   1.00 0.00 ? 75  TYR A CE2  1  
ATOM 1052  C CZ   . TYR A 1 76  ? 15.569  -14.418 8.636   1.00 0.00 ? 75  TYR A CZ   1  
ATOM 1053  O OH   . TYR A 1 76  ? 16.021  -14.424 9.971   1.00 0.00 ? 75  TYR A OH   1  
ATOM 1054  H H    . TYR A 1 76  ? 12.334  -12.644 5.413   1.00 0.00 ? 75  TYR A H    1  
ATOM 1055  H HA   . TYR A 1 76  ? 14.906  -12.295 4.005   1.00 0.00 ? 75  TYR A HA   1  
ATOM 1056  H HB2  . TYR A 1 76  ? 13.376  -14.892 4.483   1.00 0.00 ? 75  TYR A HB2  1  
ATOM 1057  H HB3  . TYR A 1 76  ? 15.070  -14.710 3.909   1.00 0.00 ? 75  TYR A HB3  1  
ATOM 1058  H HD1  . TYR A 1 76  ? 16.760  -13.880 5.530   1.00 0.00 ? 75  TYR A HD1  1  
ATOM 1059  H HD2  . TYR A 1 76  ? 12.771  -14.750 6.786   1.00 0.00 ? 75  TYR A HD2  1  
ATOM 1060  H HE1  . TYR A 1 76  ? 17.501  -13.934 7.876   1.00 0.00 ? 75  TYR A HE1  1  
ATOM 1061  H HE2  . TYR A 1 76  ? 13.537  -14.878 9.121   1.00 0.00 ? 75  TYR A HE2  1  
ATOM 1062  H HH   . TYR A 1 76  ? 15.358  -14.837 10.527  1.00 0.00 ? 75  TYR A HH   1  
ATOM 1063  N N    . PHE A 1 77  ? 12.209  -12.044 2.527   1.00 0.00 ? 76  PHE A N    1  
ATOM 1064  C CA   . PHE A 1 77  ? 11.486  -11.760 1.272   1.00 0.00 ? 76  PHE A CA   1  
ATOM 1065  C C    . PHE A 1 77  ? 12.266  -11.113 0.117   1.00 0.00 ? 76  PHE A C    1  
ATOM 1066  O O    . PHE A 1 77  ? 13.291  -10.456 0.286   1.00 0.00 ? 76  PHE A O    1  
ATOM 1067  C CB   . PHE A 1 77  ? 10.113  -11.022 1.423   1.00 0.00 ? 76  PHE A CB   1  
ATOM 1068  C CG   . PHE A 1 77  ? 9.874   -10.072 2.566   1.00 0.00 ? 76  PHE A CG   1  
ATOM 1069  C CD1  . PHE A 1 77  ? 10.798  -9.153  3.031   1.00 0.00 ? 76  PHE A CD1  1  
ATOM 1070  C CD2  . PHE A 1 77  ? 8.603   -10.072 3.119   1.00 0.00 ? 76  PHE A CD2  1  
ATOM 1071  C CE1  . PHE A 1 77  ? 10.439  -8.252  4.015   1.00 0.00 ? 76  PHE A CE1  1  
ATOM 1072  C CE2  . PHE A 1 77  ? 8.237   -9.178  4.095   1.00 0.00 ? 76  PHE A CE2  1  
ATOM 1073  C CZ   . PHE A 1 77  ? 9.157   -8.253  4.534   1.00 0.00 ? 76  PHE A CZ   1  
ATOM 1074  H H    . PHE A 1 77  ? 11.775  -11.737 3.374   1.00 0.00 ? 76  PHE A H    1  
ATOM 1075  H HA   . PHE A 1 77  ? 11.206  -12.736 0.904   1.00 0.00 ? 76  PHE A HA   1  
ATOM 1076  H HB2  . PHE A 1 77  ? 9.765   -10.511 0.499   1.00 0.00 ? 76  PHE A HB2  1  
ATOM 1077  H HB3  . PHE A 1 77  ? 9.392   -11.832 1.575   1.00 0.00 ? 76  PHE A HB3  1  
ATOM 1078  H HD1  . PHE A 1 77  ? 11.794  -9.121  2.608   1.00 0.00 ? 76  PHE A HD1  1  
ATOM 1079  H HD2  . PHE A 1 77  ? 7.874   -10.791 2.771   1.00 0.00 ? 76  PHE A HD2  1  
ATOM 1080  H HE1  . PHE A 1 77  ? 11.169  -7.542  4.379   1.00 0.00 ? 76  PHE A HE1  1  
ATOM 1081  H HE2  . PHE A 1 77  ? 7.231   -9.200  4.499   1.00 0.00 ? 76  PHE A HE2  1  
ATOM 1082  H HZ   . PHE A 1 77  ? 8.863   -7.539  5.289   1.00 0.00 ? 76  PHE A HZ   1  
ATOM 1083  N N    . SER A 1 78  ? 11.796  -11.371 -1.132  1.00 0.00 ? 77  SER A N    1  
ATOM 1084  C CA   . SER A 1 78  ? 12.525  -11.029 -2.367  1.00 0.00 ? 77  SER A CA   1  
ATOM 1085  C C    . SER A 1 78  ? 11.797  -10.011 -3.228  1.00 0.00 ? 77  SER A C    1  
ATOM 1086  O O    . SER A 1 78  ? 10.578  -9.903  -3.160  1.00 0.00 ? 77  SER A O    1  
ATOM 1087  C CB   . SER A 1 78  ? 12.832  -12.313 -3.188  1.00 0.00 ? 77  SER A CB   1  
ATOM 1088  O OG   . SER A 1 78  ? 13.639  -13.201 -2.416  1.00 0.00 ? 77  SER A OG   1  
ATOM 1089  H H    . SER A 1 78  ? 10.915  -11.881 -1.226  1.00 0.00 ? 77  SER A H    1  
ATOM 1090  H HA   . SER A 1 78  ? 13.483  -10.579 -2.130  1.00 0.00 ? 77  SER A HA   1  
ATOM 1091  H HB2  . SER A 1 78  ? 11.885  -12.841 -3.451  1.00 0.00 ? 77  SER A HB2  1  
ATOM 1092  H HB3  . SER A 1 78  ? 13.385  -12.081 -4.125  1.00 0.00 ? 77  SER A HB3  1  
ATOM 1093  H HG   . SER A 1 78  ? 13.337  -13.118 -1.502  1.00 0.00 ? 77  SER A HG   1  
ATOM 1094  N N    . ALA A 1 79  ? 12.537  -9.210  -4.052  1.00 0.00 ? 78  ALA A N    1  
ATOM 1095  C CA   . ALA A 1 79  ? 12.004  -8.110  -4.865  1.00 0.00 ? 78  ALA A CA   1  
ATOM 1096  C C    . ALA A 1 79  ? 11.612  -8.367  -6.327  1.00 0.00 ? 78  ALA A C    1  
ATOM 1097  O O    . ALA A 1 79  ? 12.134  -9.245  -7.010  1.00 0.00 ? 78  ALA A O    1  
ATOM 1098  C CB   . ALA A 1 79  ? 12.851  -6.813  -4.689  1.00 0.00 ? 78  ALA A CB   1  
ATOM 1099  H H    . ALA A 1 79  ? 13.527  -9.318  -4.075  1.00 0.00 ? 78  ALA A H    1  
ATOM 1100  H HA   . ALA A 1 79  ? 11.048  -7.877  -4.452  1.00 0.00 ? 78  ALA A HA   1  
ATOM 1101  H HB1  . ALA A 1 79  ? 12.365  -5.923  -5.150  1.00 0.00 ? 78  ALA A HB1  1  
ATOM 1102  H HB2  . ALA A 1 79  ? 13.872  -6.918  -5.105  1.00 0.00 ? 78  ALA A HB2  1  
ATOM 1103  H HB3  . ALA A 1 79  ? 12.920  -6.565  -3.607  1.00 0.00 ? 78  ALA A HB3  1  
ATOM 1104  N N    . GLY A 1 80  ? 10.621  -7.555  -6.796  1.00 0.00 ? 79  GLY A N    1  
ATOM 1105  C CA   . GLY A 1 80  ? 10.006  -7.553  -8.118  1.00 0.00 ? 79  GLY A CA   1  
ATOM 1106  C C    . GLY A 1 80  ? 9.385   -6.202  -8.257  1.00 0.00 ? 79  GLY A C    1  
ATOM 1107  O O    . GLY A 1 80  ? 9.306   -5.459  -7.291  1.00 0.00 ? 79  GLY A O    1  
ATOM 1108  H H    . GLY A 1 80  ? 10.259  -6.840  -6.176  1.00 0.00 ? 79  GLY A H    1  
ATOM 1109  H HA2  . GLY A 1 80  ? 10.806  -7.617  -8.875  1.00 0.00 ? 79  GLY A HA2  1  
ATOM 1110  H HA3  . GLY A 1 80  ? 9.180   -8.261  -8.147  1.00 0.00 ? 79  GLY A HA3  1  
ATOM 1111  N N    . VAL A 1 81  ? 9.000   -5.815  -9.480  1.00 0.00 ? 80  VAL A N    1  
ATOM 1112  C CA   . VAL A 1 81  ? 8.683   -4.456  -9.854  1.00 0.00 ? 80  VAL A CA   1  
ATOM 1113  C C    . VAL A 1 81  ? 7.232   -4.105  -10.035 1.00 0.00 ? 80  VAL A C    1  
ATOM 1114  O O    . VAL A 1 81  ? 6.620   -4.645  -10.945 1.00 0.00 ? 80  VAL A O    1  
ATOM 1115  C CB   . VAL A 1 81  ? 9.434   -4.209  -11.171 1.00 0.00 ? 80  VAL A CB   1  
ATOM 1116  C CG1  . VAL A 1 81  ? 9.182   -2.833  -11.837 1.00 0.00 ? 80  VAL A CG1  1  
ATOM 1117  C CG2  . VAL A 1 81  ? 10.926  -4.251  -10.825 1.00 0.00 ? 80  VAL A CG2  1  
ATOM 1118  H H    . VAL A 1 81  ? 9.089   -6.454  -10.248 1.00 0.00 ? 80  VAL A H    1  
ATOM 1119  H HA   . VAL A 1 81  ? 9.090   -3.776  -9.140  1.00 0.00 ? 80  VAL A HA   1  
ATOM 1120  H HB   . VAL A 1 81  ? 9.218   -5.054  -11.872 1.00 0.00 ? 80  VAL A HB   1  
ATOM 1121  H HG11 . VAL A 1 81  ? 9.804   -2.736  -12.753 1.00 0.00 ? 80  VAL A HG11 1  
ATOM 1122  H HG12 . VAL A 1 81  ? 9.463   -2.012  -11.144 1.00 0.00 ? 80  VAL A HG12 1  
ATOM 1123  H HG13 . VAL A 1 81  ? 8.129   -2.689  -12.133 1.00 0.00 ? 80  VAL A HG13 1  
ATOM 1124  H HG21 . VAL A 1 81  ? 11.524  -4.067  -11.740 1.00 0.00 ? 80  VAL A HG21 1  
ATOM 1125  H HG22 . VAL A 1 81  ? 11.211  -5.227  -10.369 1.00 0.00 ? 80  VAL A HG22 1  
ATOM 1126  H HG23 . VAL A 1 81  ? 11.114  -3.416  -10.116 1.00 0.00 ? 80  VAL A HG23 1  
ATOM 1127  N N    . VAL A 1 82  ? 6.635   -3.117  -9.285  1.00 0.00 ? 81  VAL A N    1  
ATOM 1128  C CA   . VAL A 1 82  ? 5.312   -2.560  -9.717  1.00 0.00 ? 81  VAL A CA   1  
ATOM 1129  C C    . VAL A 1 82  ? 5.402   -1.809  -11.070 1.00 0.00 ? 81  VAL A C    1  
ATOM 1130  O O    . VAL A 1 82  ? 6.306   -0.970  -11.214 1.00 0.00 ? 81  VAL A O    1  
ATOM 1131  C CB   . VAL A 1 82  ? 4.572   -1.618  -8.729  1.00 0.00 ? 81  VAL A CB   1  
ATOM 1132  C CG1  . VAL A 1 82  ? 4.914   -2.003  -7.303  1.00 0.00 ? 81  VAL A CG1  1  
ATOM 1133  C CG2  . VAL A 1 82  ? 4.864   -0.100  -8.854  1.00 0.00 ? 81  VAL A CG2  1  
ATOM 1134  H H    . VAL A 1 82  ? 7.138   -2.712  -8.481  1.00 0.00 ? 81  VAL A H    1  
ATOM 1135  H HA   . VAL A 1 82  ? 4.674   -3.426  -9.876  1.00 0.00 ? 81  VAL A HA   1  
ATOM 1136  H HB   . VAL A 1 82  ? 3.474   -1.758  -8.868  1.00 0.00 ? 81  VAL A HB   1  
ATOM 1137  H HG11 . VAL A 1 82  ? 4.748   -3.087  -7.128  1.00 0.00 ? 81  VAL A HG11 1  
ATOM 1138  H HG12 . VAL A 1 82  ? 4.320   -1.405  -6.579  1.00 0.00 ? 81  VAL A HG12 1  
ATOM 1139  H HG13 . VAL A 1 82  ? 5.979   -1.722  -7.150  1.00 0.00 ? 81  VAL A HG13 1  
ATOM 1140  H HG21 . VAL A 1 82  ? 4.306   0.352   -9.696  1.00 0.00 ? 81  VAL A HG21 1  
ATOM 1141  H HG22 . VAL A 1 82  ? 5.948   0.134   -8.987  1.00 0.00 ? 81  VAL A HG22 1  
ATOM 1142  H HG23 . VAL A 1 82  ? 4.519   0.427   -7.944  1.00 0.00 ? 81  VAL A HG23 1  
ATOM 1143  N N    . LYS A 1 83  ? 4.504   -2.169  -12.040 1.00 0.00 ? 82  LYS A N    1  
ATOM 1144  C CA   . LYS A 1 83  ? 4.430   -1.592  -13.385 1.00 0.00 ? 82  LYS A CA   1  
ATOM 1145  C C    . LYS A 1 83  ? 2.997   -1.251  -13.773 1.00 0.00 ? 82  LYS A C    1  
ATOM 1146  O O    . LYS A 1 83  ? 2.744   -0.139  -14.229 1.00 0.00 ? 82  LYS A O    1  
ATOM 1147  C CB   . LYS A 1 83  ? 5.001   -2.513  -14.504 1.00 0.00 ? 82  LYS A CB   1  
ATOM 1148  C CG   . LYS A 1 83  ? 6.517   -2.730  -14.430 1.00 0.00 ? 82  LYS A CG   1  
ATOM 1149  C CD   . LYS A 1 83  ? 7.038   -3.553  -15.614 1.00 0.00 ? 82  LYS A CD   1  
ATOM 1150  C CE   . LYS A 1 83  ? 8.562   -3.722  -15.596 1.00 0.00 ? 82  LYS A CE   1  
ATOM 1151  N NZ   . LYS A 1 83  ? 9.018   -4.537  -16.745 1.00 0.00 ? 82  LYS A NZ   1  
ATOM 1152  H H    . LYS A 1 83  ? 3.834   -2.885  -11.828 1.00 0.00 ? 82  LYS A H    1  
ATOM 1153  H HA   . LYS A 1 83  ? 4.976   -0.655  -13.417 1.00 0.00 ? 82  LYS A HA   1  
ATOM 1154  H HB2  . LYS A 1 83  ? 4.503   -3.506  -14.469 1.00 0.00 ? 82  LYS A HB2  1  
ATOM 1155  H HB3  . LYS A 1 83  ? 4.806   -2.058  -15.505 1.00 0.00 ? 82  LYS A HB3  1  
ATOM 1156  H HG2  . LYS A 1 83  ? 7.029   -1.741  -14.402 1.00 0.00 ? 82  LYS A HG2  1  
ATOM 1157  H HG3  . LYS A 1 83  ? 6.758   -3.269  -13.487 1.00 0.00 ? 82  LYS A HG3  1  
ATOM 1158  H HD2  . LYS A 1 83  ? 6.555   -4.556  -15.594 1.00 0.00 ? 82  LYS A HD2  1  
ATOM 1159  H HD3  . LYS A 1 83  ? 6.741   -3.048  -16.561 1.00 0.00 ? 82  LYS A HD3  1  
ATOM 1160  H HE2  . LYS A 1 83  ? 9.064   -2.734  -15.660 1.00 0.00 ? 82  LYS A HE2  1  
ATOM 1161  H HE3  . LYS A 1 83  ? 8.886   -4.237  -14.667 1.00 0.00 ? 82  LYS A HE3  1  
ATOM 1162  H HZ1  . LYS A 1 83  ? 8.747   -4.068  -17.633 1.00 0.00 ? 82  LYS A HZ1  1  
ATOM 1163  H HZ2  . LYS A 1 83  ? 8.576   -5.477  -16.699 1.00 0.00 ? 82  LYS A HZ2  1  
ATOM 1164  H HZ3  . LYS A 1 83  ? 10.053  -4.639  -16.709 1.00 0.00 ? 82  LYS A HZ3  1  
ATOM 1165  N N    . GLY A 1 84  ? 1.998   -2.164  -13.591 1.00 0.00 ? 83  GLY A N    1  
ATOM 1166  C CA   . GLY A 1 84  ? 0.607   -1.854  -13.945 1.00 0.00 ? 83  GLY A CA   1  
ATOM 1167  C C    . GLY A 1 84  ? -0.332  -2.319  -12.873 1.00 0.00 ? 83  GLY A C    1  
ATOM 1168  O O    . GLY A 1 84  ? -0.268  -3.471  -12.441 1.00 0.00 ? 83  GLY A O    1  
ATOM 1169  H H    . GLY A 1 84  ? 2.152   -3.096  -13.244 1.00 0.00 ? 83  GLY A H    1  
ATOM 1170  H HA2  . GLY A 1 84  ? 0.443   -0.790  -14.073 1.00 0.00 ? 83  GLY A HA2  1  
ATOM 1171  H HA3  . GLY A 1 84  ? 0.379   -2.424  -14.834 1.00 0.00 ? 83  GLY A HA3  1  
ATOM 1172  N N    . HIS A 1 85  ? -1.267  -1.460  -12.404 1.00 0.00 ? 84  HIS A N    1  
ATOM 1173  C CA   . HIS A 1 85  ? -2.202  -1.837  -11.359 1.00 0.00 ? 84  HIS A CA   1  
ATOM 1174  C C    . HIS A 1 85  ? -3.557  -1.213  -11.512 1.00 0.00 ? 84  HIS A C    1  
ATOM 1175  O O    . HIS A 1 85  ? -3.744  -0.211  -12.206 1.00 0.00 ? 84  HIS A O    1  
ATOM 1176  C CB   . HIS A 1 85  ? -1.651  -1.583  -9.947  1.00 0.00 ? 84  HIS A CB   1  
ATOM 1177  C CG   . HIS A 1 85  ? -0.563  -0.572  -9.792  1.00 0.00 ? 84  HIS A CG   1  
ATOM 1178  N ND1  . HIS A 1 85  ? -0.709  0.794   -9.699  1.00 0.00 ? 84  HIS A ND1  1  
ATOM 1179  C CD2  . HIS A 1 85  ? 0.743   -0.829  -9.523  1.00 0.00 ? 84  HIS A CD2  1  
ATOM 1180  C CE1  . HIS A 1 85  ? 0.512   1.296   -9.393  1.00 0.00 ? 84  HIS A CE1  1  
ATOM 1181  N NE2  . HIS A 1 85  ? 1.417   0.345   -9.255  1.00 0.00 ? 84  HIS A NE2  1  
ATOM 1182  H H    . HIS A 1 85  ? -1.367  -0.522  -12.732 1.00 0.00 ? 84  HIS A H    1  
ATOM 1183  H HA   . HIS A 1 85  ? -2.419  -2.896  -11.437 1.00 0.00 ? 84  HIS A HA   1  
ATOM 1184  H HB2  . HIS A 1 85  ? -2.437  -1.425  -9.174  1.00 0.00 ? 84  HIS A HB2  1  
ATOM 1185  H HB3  . HIS A 1 85  ? -1.117  -2.513  -9.679  1.00 0.00 ? 84  HIS A HB3  1  
ATOM 1186  H HD1  . HIS A 1 85  ? -1.572  1.305   -9.727  1.00 0.00 ? 84  HIS A HD1  1  
ATOM 1187  H HD2  . HIS A 1 85  ? 1.238   -1.781  -9.383  1.00 0.00 ? 84  HIS A HD2  1  
ATOM 1188  H HE1  . HIS A 1 85  ? 0.704   2.362   -9.264  1.00 0.00 ? 84  HIS A HE1  1  
ATOM 1189  N N    . ARG A 1 86  ? -4.565  -1.859  -10.858 1.00 0.00 ? 85  ARG A N    1  
ATOM 1190  C CA   . ARG A 1 86  ? -5.938  -1.453  -11.021 1.00 0.00 ? 85  ARG A CA   1  
ATOM 1191  C C    . ARG A 1 86  ? -6.699  -1.815  -9.778  1.00 0.00 ? 85  ARG A C    1  
ATOM 1192  O O    . ARG A 1 86  ? -6.290  -2.700  -9.022  1.00 0.00 ? 85  ARG A O    1  
ATOM 1193  C CB   . ARG A 1 86  ? -6.540  -2.275  -12.199 1.00 0.00 ? 85  ARG A CB   1  
ATOM 1194  C CG   . ARG A 1 86  ? -6.681  -3.791  -11.897 1.00 0.00 ? 85  ARG A CG   1  
ATOM 1195  C CD   . ARG A 1 86  ? -8.151  -4.240  -11.772 1.00 0.00 ? 85  ARG A CD   1  
ATOM 1196  N NE   . ARG A 1 86  ? -8.789  -4.300  -13.139 1.00 0.00 ? 85  ARG A NE   1  
ATOM 1197  C CZ   . ARG A 1 86  ? -9.814  -3.497  -13.566 1.00 0.00 ? 85  ARG A CZ   1  
ATOM 1198  N NH1  . ARG A 1 86  ? -10.306 -2.496  -12.781 1.00 0.00 ? 85  ARG A NH1  1  
ATOM 1199  N NH2  . ARG A 1 86  ? -10.350 -3.702  -14.805 1.00 0.00 ? 85  ARG A NH2  1  
ATOM 1200  H H    . ARG A 1 86  ? -4.442  -2.696  -10.278 1.00 0.00 ? 85  ARG A H    1  
ATOM 1201  H HA   . ARG A 1 86  ? -6.030  -0.384  -11.183 1.00 0.00 ? 85  ARG A HA   1  
ATOM 1202  H HB2  . ARG A 1 86  ? -7.530  -1.855  -12.486 1.00 0.00 ? 85  ARG A HB2  1  
ATOM 1203  H HB3  . ARG A 1 86  ? -5.872  -2.154  -13.083 1.00 0.00 ? 85  ARG A HB3  1  
ATOM 1204  H HG2  . ARG A 1 86  ? -6.171  -4.387  -12.684 1.00 0.00 ? 85  ARG A HG2  1  
ATOM 1205  H HG3  . ARG A 1 86  ? -6.165  -4.016  -10.918 1.00 0.00 ? 85  ARG A HG3  1  
ATOM 1206  H HD2  . ARG A 1 86  ? -8.186  -5.262  -11.347 1.00 0.00 ? 85  ARG A HD2  1  
ATOM 1207  H HD3  . ARG A 1 86  ? -8.712  -3.569  -11.087 1.00 0.00 ? 85  ARG A HD3  1  
ATOM 1208  H HE   . ARG A 1 86  ? -8.465  -5.011  -13.764 1.00 0.00 ? 85  ARG A HE   1  
ATOM 1209  H HH11 . ARG A 1 86  ? -9.917  -2.337  -11.872 1.00 0.00 ? 85  ARG A HH11 1  
ATOM 1210  H HH12 . ARG A 1 86  ? -11.053 -1.920  -13.113 1.00 0.00 ? 85  ARG A HH12 1  
ATOM 1211  H HH21 . ARG A 1 86  ? -9.994  -4.433  -15.388 1.00 0.00 ? 85  ARG A HH21 1  
ATOM 1212  H HH22 . ARG A 1 86  ? -11.098 -3.122  -15.129 1.00 0.00 ? 85  ARG A HH22 1  
ATOM 1213  N N    . LYS A 1 87  ? -7.879  -1.215  -9.560  1.00 0.00 ? 86  LYS A N    1  
ATOM 1214  C CA   . LYS A 1 87  ? -8.775  -1.729  -8.555  1.00 0.00 ? 86  LYS A CA   1  
ATOM 1215  C C    . LYS A 1 87  ? -10.173 -1.680  -9.144  1.00 0.00 ? 86  LYS A C    1  
ATOM 1216  O O    . LYS A 1 87  ? -10.622 -0.657  -9.666  1.00 0.00 ? 86  LYS A O    1  
ATOM 1217  C CB   . LYS A 1 87  ? -8.484  -0.955  -7.268  1.00 0.00 ? 86  LYS A CB   1  
ATOM 1218  C CG   . LYS A 1 87  ? -9.409  -1.197  -6.074  1.00 0.00 ? 86  LYS A CG   1  
ATOM 1219  C CD   . LYS A 1 87  ? -8.885  -0.461  -4.827  1.00 0.00 ? 86  LYS A CD   1  
ATOM 1220  C CE   . LYS A 1 87  ? -9.676  -0.778  -3.555  1.00 0.00 ? 86  LYS A CE   1  
ATOM 1221  N NZ   . LYS A 1 87  ? -11.095 -0.373  -3.676  1.00 0.00 ? 86  LYS A NZ   1  
ATOM 1222  H H    . LYS A 1 87  ? -8.263  -0.502  -10.148 1.00 0.00 ? 86  LYS A H    1  
ATOM 1223  H HA   . LYS A 1 87  ? -8.587  -2.803  -8.354  1.00 0.00 ? 86  LYS A HA   1  
ATOM 1224  H HB2  . LYS A 1 87  ? -7.443  -1.299  -7.025  1.00 0.00 ? 86  LYS A HB2  1  
ATOM 1225  H HB3  . LYS A 1 87  ? -8.425  0.129   -7.503  1.00 0.00 ? 86  LYS A HB3  1  
ATOM 1226  H HG2  . LYS A 1 87  ? -10.431 -0.821  -6.306  1.00 0.00 ? 86  LYS A HG2  1  
ATOM 1227  H HG3  . LYS A 1 87  ? -9.476  -2.288  -5.868  1.00 0.00 ? 86  LYS A HG3  1  
ATOM 1228  H HD2  . LYS A 1 87  ? -7.825  -0.758  -4.659  1.00 0.00 ? 86  LYS A HD2  1  
ATOM 1229  H HD3  . LYS A 1 87  ? -8.892  0.639   -5.000  1.00 0.00 ? 86  LYS A HD3  1  
ATOM 1230  H HE2  . LYS A 1 87  ? -9.649  -1.866  -3.335  1.00 0.00 ? 86  LYS A HE2  1  
ATOM 1231  H HE3  . LYS A 1 87  ? -9.240  -0.218  -2.702  1.00 0.00 ? 86  LYS A HE3  1  
ATOM 1232  H HZ1  . LYS A 1 87  ? -11.596 -0.593  -2.790  1.00 0.00 ? 86  LYS A HZ1  1  
ATOM 1233  H HZ2  . LYS A 1 87  ? -11.536 -0.892  -4.461  1.00 0.00 ? 86  LYS A HZ2  1  
ATOM 1234  H HZ3  . LYS A 1 87  ? -11.151 0.649   -3.862  1.00 0.00 ? 86  LYS A HZ3  1  
ATOM 1235  N N    . GLU A 1 88  ? -10.893 -2.827  -9.071  1.00 0.00 ? 87  GLU A N    1  
ATOM 1236  C CA   . GLU A 1 88  ? -12.248 -3.049  -9.535  1.00 0.00 ? 87  GLU A CA   1  
ATOM 1237  C C    . GLU A 1 88  ? -13.132 -3.120  -8.295  1.00 0.00 ? 87  GLU A C    1  
ATOM 1238  O O    . GLU A 1 88  ? -12.642 -3.380  -7.195  1.00 0.00 ? 87  GLU A O    1  
ATOM 1239  C CB   . GLU A 1 88  ? -12.283 -4.395  -10.316 1.00 0.00 ? 87  GLU A CB   1  
ATOM 1240  C CG   . GLU A 1 88  ? -13.550 -4.636  -11.154 1.00 0.00 ? 87  GLU A CG   1  
ATOM 1241  C CD   . GLU A 1 88  ? -13.412 -5.955  -11.916 1.00 0.00 ? 87  GLU A CD   1  
ATOM 1242  O OE1  . GLU A 1 88  ? -12.480 -6.059  -12.757 1.00 0.00 ? 87  GLU A OE1  1  
ATOM 1243  O OE2  . GLU A 1 88  ? -14.237 -6.874  -11.664 1.00 0.00 ? 87  GLU A OE2  1  
ATOM 1244  H H    . GLU A 1 88  ? -10.513 -3.656  -8.637  1.00 0.00 ? 87  GLU A H    1  
ATOM 1245  H HA   . GLU A 1 88  ? -12.584 -2.233  -10.165 1.00 0.00 ? 87  GLU A HA   1  
ATOM 1246  H HB2  . GLU A 1 88  ? -11.407 -4.428  -10.999 1.00 0.00 ? 87  GLU A HB2  1  
ATOM 1247  H HB3  . GLU A 1 88  ? -12.118 -5.236  -9.612  1.00 0.00 ? 87  GLU A HB3  1  
ATOM 1248  H HG2  . GLU A 1 88  ? -14.445 -4.681  -10.498 1.00 0.00 ? 87  GLU A HG2  1  
ATOM 1249  H HG3  . GLU A 1 88  ? -13.684 -3.806  -11.880 1.00 0.00 ? 87  GLU A HG3  1  
ATOM 1250  N N    . SER A 1 89  ? -14.468 -2.923  -8.415  1.00 0.00 ? 88  SER A N    1  
ATOM 1251  C CA   . SER A 1 89  ? -15.462 -2.954  -7.333  1.00 0.00 ? 88  SER A CA   1  
ATOM 1252  C C    . SER A 1 89  ? -15.676 -4.312  -6.646  1.00 0.00 ? 88  SER A C    1  
ATOM 1253  O O    . SER A 1 89  ? -16.738 -4.921  -6.740  1.00 0.00 ? 88  SER A O    1  
ATOM 1254  C CB   . SER A 1 89  ? -16.825 -2.430  -7.854  1.00 0.00 ? 88  SER A CB   1  
ATOM 1255  O OG   . SER A 1 89  ? -16.621 -1.179  -8.512  1.00 0.00 ? 88  SER A OG   1  
ATOM 1256  H H    . SER A 1 89  ? -14.864 -2.699  -9.300  1.00 0.00 ? 88  SER A H    1  
ATOM 1257  H HA   . SER A 1 89  ? -15.131 -2.262  -6.569  1.00 0.00 ? 88  SER A HA   1  
ATOM 1258  H HB2  . SER A 1 89  ? -17.262 -3.148  -8.585  1.00 0.00 ? 88  SER A HB2  1  
ATOM 1259  H HB3  . SER A 1 89  ? -17.541 -2.290  -7.013  1.00 0.00 ? 88  SER A HB3  1  
ATOM 1260  H HG   . SER A 1 89  ? -17.475 -0.842  -8.797  1.00 0.00 ? 88  SER A HG   1  
ATOM 1261  N N    . GLY A 1 90  ? -14.628 -4.795  -5.938  1.00 0.00 ? 89  GLY A N    1  
ATOM 1262  C CA   . GLY A 1 90  ? -14.546 -6.060  -5.227  1.00 0.00 ? 89  GLY A CA   1  
ATOM 1263  C C    . GLY A 1 90  ? -13.505 -6.995  -5.791  1.00 0.00 ? 89  GLY A C    1  
ATOM 1264  O O    . GLY A 1 90  ? -13.507 -8.175  -5.461  1.00 0.00 ? 89  GLY A O    1  
ATOM 1265  H H    . GLY A 1 90  ? -13.797 -4.226  -5.948  1.00 0.00 ? 89  GLY A H    1  
ATOM 1266  H HA2  . GLY A 1 90  ? -14.246 -5.832  -4.216  1.00 0.00 ? 89  GLY A HA2  1  
ATOM 1267  H HA3  . GLY A 1 90  ? -15.492 -6.587  -5.268  1.00 0.00 ? 89  GLY A HA3  1  
ATOM 1268  N N    . GLU A 1 91  ? -12.564 -6.527  -6.664  1.00 0.00 ? 90  GLU A N    1  
ATOM 1269  C CA   . GLU A 1 91  ? -11.483 -7.319  -7.203  1.00 0.00 ? 90  GLU A CA   1  
ATOM 1270  C C    . GLU A 1 91  ? -10.285 -6.388  -7.224  1.00 0.00 ? 90  GLU A C    1  
ATOM 1271  O O    . GLU A 1 91  ? -10.426 -5.208  -7.542  1.00 0.00 ? 90  GLU A O    1  
ATOM 1272  C CB   . GLU A 1 91  ? -11.858 -7.898  -8.588  1.00 0.00 ? 90  GLU A CB   1  
ATOM 1273  C CG   . GLU A 1 91  ? -10.737 -8.737  -9.199  1.00 0.00 ? 90  GLU A CG   1  
ATOM 1274  C CD   . GLU A 1 91  ? -11.265 -9.547  -10.379 1.00 0.00 ? 90  GLU A CD   1  
ATOM 1275  O OE1  . GLU A 1 91  ? -11.810 -8.928  -11.331 1.00 0.00 ? 90  GLU A OE1  1  
ATOM 1276  O OE2  . GLU A 1 91  ? -11.128 -10.799 -10.346 1.00 0.00 ? 90  GLU A OE2  1  
ATOM 1277  H H    . GLU A 1 91  ? -12.460 -5.572  -6.969  1.00 0.00 ? 90  GLU A H    1  
ATOM 1278  H HA   . GLU A 1 91  ? -11.235 -8.136  -6.530  1.00 0.00 ? 90  GLU A HA   1  
ATOM 1279  H HB2  . GLU A 1 91  ? -12.760 -8.536  -8.451  1.00 0.00 ? 90  GLU A HB2  1  
ATOM 1280  H HB3  . GLU A 1 91  ? -12.123 -7.089  -9.304  1.00 0.00 ? 90  GLU A HB3  1  
ATOM 1281  H HG2  . GLU A 1 91  ? -9.951  -8.023  -9.526  1.00 0.00 ? 90  GLU A HG2  1  
ATOM 1282  H HG3  . GLU A 1 91  ? -10.317 -9.409  -8.423  1.00 0.00 ? 90  GLU A HG3  1  
ATOM 1283  N N    . LEU A 1 92  ? -9.063  -6.848  -6.878  1.00 0.00 ? 91  LEU A N    1  
ATOM 1284  C CA   . LEU A 1 92  ? -7.908  -5.973  -6.807  1.00 0.00 ? 91  LEU A CA   1  
ATOM 1285  C C    . LEU A 1 92  ? -6.755  -6.632  -7.522  1.00 0.00 ? 91  LEU A C    1  
ATOM 1286  O O    . LEU A 1 92  ? -6.469  -7.797  -7.228  1.00 0.00 ? 91  LEU A O    1  
ATOM 1287  C CB   . LEU A 1 92  ? -7.530  -5.810  -5.309  1.00 0.00 ? 91  LEU A CB   1  
ATOM 1288  C CG   . LEU A 1 92  ? -6.937  -4.447  -4.905  1.00 0.00 ? 91  LEU A CG   1  
ATOM 1289  C CD1  . LEU A 1 92  ? -6.556  -4.525  -3.420  1.00 0.00 ? 91  LEU A CD1  1  
ATOM 1290  C CD2  . LEU A 1 92  ? -5.758  -3.981  -5.774  1.00 0.00 ? 91  LEU A CD2  1  
ATOM 1291  H H    . LEU A 1 92  ? -8.874  -7.791  -6.611  1.00 0.00 ? 91  LEU A H    1  
ATOM 1292  H HA   . LEU A 1 92  ? -8.088  -5.004  -7.262  1.00 0.00 ? 91  LEU A HA   1  
ATOM 1293  H HB2  . LEU A 1 92  ? -8.468  -5.924  -4.715  1.00 0.00 ? 91  LEU A HB2  1  
ATOM 1294  H HB3  . LEU A 1 92  ? -6.852  -6.630  -4.962  1.00 0.00 ? 91  LEU A HB3  1  
ATOM 1295  H HG   . LEU A 1 92  ? -7.739  -3.679  -5.014  1.00 0.00 ? 91  LEU A HG   1  
ATOM 1296  H HD11 . LEU A 1 92  ? -7.462  -4.748  -2.820  1.00 0.00 ? 91  LEU A HD11 1  
ATOM 1297  H HD12 . LEU A 1 92  ? -6.120  -3.574  -3.066  1.00 0.00 ? 91  LEU A HD12 1  
ATOM 1298  H HD13 . LEU A 1 92  ? -5.815  -5.335  -3.258  1.00 0.00 ? 91  LEU A HD13 1  
ATOM 1299  H HD21 . LEU A 1 92  ? -4.978  -4.769  -5.833  1.00 0.00 ? 91  LEU A HD21 1  
ATOM 1300  H HD22 . LEU A 1 92  ? -5.316  -3.058  -5.352  1.00 0.00 ? 91  LEU A HD22 1  
ATOM 1301  H HD23 . LEU A 1 92  ? -6.100  -3.736  -6.799  1.00 0.00 ? 91  LEU A HD23 1  
ATOM 1302  N N    . TYR A 1 93  ? -6.011  -5.927  -8.432  1.00 0.00 ? 92  TYR A N    1  
ATOM 1303  C CA   . TYR A 1 93  ? -4.803  -6.586  -8.931  1.00 0.00 ? 92  TYR A CA   1  
ATOM 1304  C C    . TYR A 1 93  ? -3.656  -5.620  -9.165  1.00 0.00 ? 92  TYR A C    1  
ATOM 1305  O O    . TYR A 1 93  ? -3.795  -4.596  -9.832  1.00 0.00 ? 92  TYR A O    1  
ATOM 1306  C CB   . TYR A 1 93  ? -5.002  -7.709  -10.022 1.00 0.00 ? 92  TYR A CB   1  
ATOM 1307  C CG   . TYR A 1 93  ? -6.077  -7.527  -11.080 1.00 0.00 ? 92  TYR A CG   1  
ATOM 1308  C CD1  . TYR A 1 93  ? -7.406  -7.830  -10.824 1.00 0.00 ? 92  TYR A CD1  1  
ATOM 1309  C CD2  . TYR A 1 93  ? -5.738  -7.236  -12.390 1.00 0.00 ? 92  TYR A CD2  1  
ATOM 1310  C CE1  . TYR A 1 93  ? -8.350  -7.813  -11.836 1.00 0.00 ? 92  TYR A CE1  1  
ATOM 1311  C CE2  . TYR A 1 93  ? -6.663  -7.261  -13.412 1.00 0.00 ? 92  TYR A CE2  1  
ATOM 1312  C CZ   . TYR A 1 93  ? -7.977  -7.554  -13.134 1.00 0.00 ? 92  TYR A CZ   1  
ATOM 1313  O OH   . TYR A 1 93  ? -8.944  -7.593  -14.158 1.00 0.00 ? 92  TYR A OH   1  
ATOM 1314  H H    . TYR A 1 93  ? -6.175  -4.952  -8.711  1.00 0.00 ? 92  TYR A H    1  
ATOM 1315  H HA   . TYR A 1 93  ? -4.370  -7.132  -8.088  1.00 0.00 ? 92  TYR A HA   1  
ATOM 1316  H HB2  . TYR A 1 93  ? -4.052  -7.971  -10.525 1.00 0.00 ? 92  TYR A HB2  1  
ATOM 1317  H HB3  . TYR A 1 93  ? -5.291  -8.627  -9.467  1.00 0.00 ? 92  TYR A HB3  1  
ATOM 1318  H HD1  . TYR A 1 93  ? -7.707  -8.111  -9.826  1.00 0.00 ? 92  TYR A HD1  1  
ATOM 1319  H HD2  . TYR A 1 93  ? -4.721  -7.023  -12.646 1.00 0.00 ? 92  TYR A HD2  1  
ATOM 1320  H HE1  . TYR A 1 93  ? -9.391  -7.999  -11.620 1.00 0.00 ? 92  TYR A HE1  1  
ATOM 1321  H HE2  . TYR A 1 93  ? -6.338  -7.055  -14.422 1.00 0.00 ? 92  TYR A HE2  1  
ATOM 1322  H HH   . TYR A 1 93  ? -8.489  -7.464  -14.991 1.00 0.00 ? 92  TYR A HH   1  
ATOM 1323  N N    . TYR A 1 94  ? -2.482  -5.962  -8.581  1.00 0.00 ? 93  TYR A N    1  
ATOM 1324  C CA   . TYR A 1 94  ? -1.211  -5.275  -8.661  1.00 0.00 ? 93  TYR A CA   1  
ATOM 1325  C C    . TYR A 1 94  ? -0.298  -6.149  -9.504  1.00 0.00 ? 93  TYR A C    1  
ATOM 1326  O O    . TYR A 1 94  ? -0.048  -7.286  -9.095  1.00 0.00 ? 93  TYR A O    1  
ATOM 1327  C CB   . TYR A 1 94  ? -0.591  -5.113  -7.219  1.00 0.00 ? 93  TYR A CB   1  
ATOM 1328  C CG   . TYR A 1 94  ? -0.309  -3.687  -6.861  1.00 0.00 ? 93  TYR A CG   1  
ATOM 1329  C CD1  . TYR A 1 94  ? -1.319  -2.749  -6.992  1.00 0.00 ? 93  TYR A CD1  1  
ATOM 1330  C CD2  . TYR A 1 94  ? 0.944   -3.272  -6.418  1.00 0.00 ? 93  TYR A CD2  1  
ATOM 1331  C CE1  . TYR A 1 94  ? -1.029  -1.407  -6.823  1.00 0.00 ? 93  TYR A CE1  1  
ATOM 1332  C CE2  . TYR A 1 94  ? 1.225   -1.941  -6.279  1.00 0.00 ? 93  TYR A CE2  1  
ATOM 1333  C CZ   . TYR A 1 94  ? 0.259   -1.017  -6.534  1.00 0.00 ? 93  TYR A CZ   1  
ATOM 1334  O OH   . TYR A 1 94  ? 0.680   0.312   -6.641  1.00 0.00 ? 93  TYR A OH   1  
ATOM 1335  H H    . TYR A 1 94  ? -2.448  -6.788  -8.001  1.00 0.00 ? 93  TYR A H    1  
ATOM 1336  H HA   . TYR A 1 94  ? -1.363  -4.342  -9.175  1.00 0.00 ? 93  TYR A HA   1  
ATOM 1337  H HB2  . TYR A 1 94  ? -1.292  -5.506  -6.462  1.00 0.00 ? 93  TYR A HB2  1  
ATOM 1338  H HB3  . TYR A 1 94  ? 0.335   -5.698  -7.065  1.00 0.00 ? 93  TYR A HB3  1  
ATOM 1339  H HD1  . TYR A 1 94  ? -2.315  -3.052  -7.321  1.00 0.00 ? 93  TYR A HD1  1  
ATOM 1340  H HD2  . TYR A 1 94  ? 1.777   -3.926  -6.219  1.00 0.00 ? 93  TYR A HD2  1  
ATOM 1341  H HE1  . TYR A 1 94  ? -1.786  -0.663  -7.023  1.00 0.00 ? 93  TYR A HE1  1  
ATOM 1342  H HE2  . TYR A 1 94  ? 2.231   -1.628  -6.033  1.00 0.00 ? 93  TYR A HE2  1  
ATOM 1343  H HH   . TYR A 1 94  ? 0.975   0.379   -7.578  1.00 0.00 ? 93  TYR A HH   1  
ATOM 1344  N N    . SER A 1 95  ? 0.232   -5.684  -10.686 1.00 0.00 ? 94  SER A N    1  
ATOM 1345  C CA   . SER A 1 95  ? 1.175   -6.457  -11.512 1.00 0.00 ? 94  SER A CA   1  
ATOM 1346  C C    . SER A 1 95  ? 2.580   -6.104  -11.111 1.00 0.00 ? 94  SER A C    1  
ATOM 1347  O O    . SER A 1 95  ? 3.103   -5.000  -11.302 1.00 0.00 ? 94  SER A O    1  
ATOM 1348  C CB   . SER A 1 95  ? 1.051   -6.498  -13.069 1.00 0.00 ? 94  SER A CB   1  
ATOM 1349  O OG   . SER A 1 95  ? 1.126   -5.236  -13.714 1.00 0.00 ? 94  SER A OG   1  
ATOM 1350  H H    . SER A 1 95  ? 0.040   -4.755  -11.026 1.00 0.00 ? 94  SER A H    1  
ATOM 1351  H HA   . SER A 1 95  ? 1.033   -7.505  -11.273 1.00 0.00 ? 94  SER A HA   1  
ATOM 1352  H HB2  . SER A 1 95  ? 1.828   -7.160  -13.510 1.00 0.00 ? 94  SER A HB2  1  
ATOM 1353  H HB3  . SER A 1 95  ? 0.090   -6.959  -13.342 1.00 0.00 ? 94  SER A HB3  1  
ATOM 1354  H HG   . SER A 1 95  ? 0.536   -4.630  -13.218 1.00 0.00 ? 94  SER A HG   1  
ATOM 1355  N N    . ILE A 1 96  ? 3.166   -7.127  -10.473 1.00 0.00 ? 95  ILE A N    1  
ATOM 1356  C CA   . ILE A 1 96  ? 4.485   -7.156  -9.892  1.00 0.00 ? 95  ILE A CA   1  
ATOM 1357  C C    . ILE A 1 96  ? 5.319   -7.874  -10.929 1.00 0.00 ? 95  ILE A C    1  
ATOM 1358  O O    . ILE A 1 96  ? 5.056   -9.043  -11.210 1.00 0.00 ? 95  ILE A O    1  
ATOM 1359  C CB   . ILE A 1 96  ? 4.441   -7.892  -8.543  1.00 0.00 ? 95  ILE A CB   1  
ATOM 1360  C CG1  . ILE A 1 96  ? 3.153   -7.569  -7.742  1.00 0.00 ? 95  ILE A CG1  1  
ATOM 1361  C CG2  . ILE A 1 96  ? 5.677   -7.550  -7.683  1.00 0.00 ? 95  ILE A CG2  1  
ATOM 1362  C CD1  . ILE A 1 96  ? 2.975   -6.095  -7.367  1.00 0.00 ? 95  ILE A CD1  1  
ATOM 1363  H H    . ILE A 1 96  ? 2.609   -7.974  -10.355 1.00 0.00 ? 95  ILE A H    1  
ATOM 1364  H HA   . ILE A 1 96  ? 4.869   -6.156  -9.747  1.00 0.00 ? 95  ILE A HA   1  
ATOM 1365  H HB   . ILE A 1 96  ? 4.411   -8.999  -8.698  1.00 0.00 ? 95  ILE A HB   1  
ATOM 1366  H HG12 . ILE A 1 96  ? 2.251   -7.930  -8.282  1.00 0.00 ? 95  ILE A HG12 1  
ATOM 1367  H HG13 . ILE A 1 96  ? 3.187   -8.176  -6.813  1.00 0.00 ? 95  ILE A HG13 1  
ATOM 1368  H HG21 . ILE A 1 96  ? 5.538   -7.966  -6.658  1.00 0.00 ? 95  ILE A HG21 1  
ATOM 1369  H HG22 . ILE A 1 96  ? 5.793   -6.452  -7.569  1.00 0.00 ? 95  ILE A HG22 1  
ATOM 1370  H HG23 . ILE A 1 96  ? 6.600   -7.977  -8.126  1.00 0.00 ? 95  ILE A HG23 1  
ATOM 1371  H HD11 . ILE A 1 96  ? 2.244   -6.019  -6.536  1.00 0.00 ? 95  ILE A HD11 1  
ATOM 1372  H HD12 . ILE A 1 96  ? 2.597   -5.501  -8.224  1.00 0.00 ? 95  ILE A HD12 1  
ATOM 1373  H HD13 . ILE A 1 96  ? 3.916   -5.629  -7.016  1.00 0.00 ? 95  ILE A HD13 1  
ATOM 1374  N N    . GLU A 1 97  ? 6.327   -7.219  -11.574 1.00 0.00 ? 96  GLU A N    1  
ATOM 1375  C CA   . GLU A 1 97  ? 7.148   -7.873  -12.605 1.00 0.00 ? 96  GLU A CA   1  
ATOM 1376  C C    . GLU A 1 97  ? 8.309   -8.571  -11.949 1.00 0.00 ? 96  GLU A C    1  
ATOM 1377  O O    . GLU A 1 97  ? 9.179   -7.973  -11.324 1.00 0.00 ? 96  GLU A O    1  
ATOM 1378  C CB   . GLU A 1 97  ? 7.550   -6.986  -13.801 1.00 0.00 ? 96  GLU A CB   1  
ATOM 1379  C CG   . GLU A 1 97  ? 8.208   -7.779  -14.955 1.00 0.00 ? 96  GLU A CG   1  
ATOM 1380  C CD   . GLU A 1 97  ? 9.732   -7.859  -14.823 1.00 0.00 ? 96  GLU A CD   1  
ATOM 1381  O OE1  . GLU A 1 97  ? 10.382  -6.780  -14.763 1.00 0.00 ? 96  GLU A OE1  1  
ATOM 1382  O OE2  . GLU A 1 97  ? 10.265  -9.000  -14.781 1.00 0.00 ? 96  GLU A OE2  1  
ATOM 1383  H H    . GLU A 1 97  ? 6.511   -6.240  -11.355 1.00 0.00 ? 96  GLU A H    1  
ATOM 1384  H HA   . GLU A 1 97  ? 6.557   -8.664  -13.031 1.00 0.00 ? 96  GLU A HA   1  
ATOM 1385  H HB2  . GLU A 1 97  ? 6.602   -6.559  -14.205 1.00 0.00 ? 96  GLU A HB2  1  
ATOM 1386  H HB3  . GLU A 1 97  ? 8.179   -6.136  -13.474 1.00 0.00 ? 96  GLU A HB3  1  
ATOM 1387  H HG2  . GLU A 1 97  ? 7.776   -8.801  -14.998 1.00 0.00 ? 96  GLU A HG2  1  
ATOM 1388  H HG3  . GLU A 1 97  ? 7.967   -7.292  -15.914 1.00 0.00 ? 96  GLU A HG3  1  
ATOM 1389  N N    . LYS A 1 98  ? 8.227   -9.906  -11.993 1.00 0.00 ? 97  LYS A N    1  
ATOM 1390  C CA   . LYS A 1 98  ? 8.995   -10.746 -11.102 1.00 0.00 ? 97  LYS A CA   1  
ATOM 1391  C C    . LYS A 1 98  ? 9.457   -12.000 -11.786 1.00 0.00 ? 97  LYS A C    1  
ATOM 1392  O O    . LYS A 1 98  ? 8.668   -12.694 -12.428 1.00 0.00 ? 97  LYS A O    1  
ATOM 1393  C CB   . LYS A 1 98  ? 7.976   -11.174 -10.017 1.00 0.00 ? 97  LYS A CB   1  
ATOM 1394  C CG   . LYS A 1 98  ? 8.401   -12.204 -8.956  1.00 0.00 ? 97  LYS A CG   1  
ATOM 1395  C CD   . LYS A 1 98  ? 9.503   -11.736 -8.003  1.00 0.00 ? 97  LYS A CD   1  
ATOM 1396  C CE   . LYS A 1 98  ? 10.116  -12.932 -7.268  1.00 0.00 ? 97  LYS A CE   1  
ATOM 1397  N NZ   . LYS A 1 98  ? 11.210  -12.506 -6.368  1.00 0.00 ? 97  LYS A NZ   1  
ATOM 1398  H H    . LYS A 1 98  ? 7.507   -10.342 -12.596 1.00 0.00 ? 97  LYS A H    1  
ATOM 1399  H HA   . LYS A 1 98  ? 9.851   -10.206 -10.704 1.00 0.00 ? 97  LYS A HA   1  
ATOM 1400  H HB2  . LYS A 1 98  ? 7.588   -10.266 -9.501  1.00 0.00 ? 97  LYS A HB2  1  
ATOM 1401  H HB3  . LYS A 1 98  ? 7.146   -11.614 -10.622 1.00 0.00 ? 97  LYS A HB3  1  
ATOM 1402  H HG2  . LYS A 1 98  ? 7.504   -12.480 -8.361  1.00 0.00 ? 97  LYS A HG2  1  
ATOM 1403  H HG3  . LYS A 1 98  ? 8.732   -13.148 -9.443  1.00 0.00 ? 97  LYS A HG3  1  
ATOM 1404  H HD2  . LYS A 1 98  ? 10.310  -11.226 -8.575  1.00 0.00 ? 97  LYS A HD2  1  
ATOM 1405  H HD3  . LYS A 1 98  ? 9.090   -11.014 -7.263  1.00 0.00 ? 97  LYS A HD3  1  
ATOM 1406  H HE2  . LYS A 1 98  ? 9.345   -13.447 -6.658  1.00 0.00 ? 97  LYS A HE2  1  
ATOM 1407  H HE3  . LYS A 1 98  ? 10.532  -13.648 -8.011  1.00 0.00 ? 97  LYS A HE3  1  
ATOM 1408  H HZ1  . LYS A 1 98  ? 11.957  -12.045 -6.926  1.00 0.00 ? 97  LYS A HZ1  1  
ATOM 1409  H HZ2  . LYS A 1 98  ? 11.603  -13.338 -5.882  1.00 0.00 ? 97  LYS A HZ2  1  
ATOM 1410  H HZ3  . LYS A 1 98  ? 10.839  -11.836 -5.664  1.00 0.00 ? 97  LYS A HZ3  1  
ATOM 1411  N N    . GLU A 1 99  ? 10.767  -12.356 -11.680 1.00 0.00 ? 98  GLU A N    1  
ATOM 1412  C CA   . GLU A 1 99  ? 11.400  -13.573 -12.216 1.00 0.00 ? 98  GLU A CA   1  
ATOM 1413  C C    . GLU A 1 99  ? 11.448  -13.640 -13.760 1.00 0.00 ? 98  GLU A C    1  
ATOM 1414  O O    . GLU A 1 99  ? 11.946  -14.573 -14.383 1.00 0.00 ? 98  GLU A O    1  
ATOM 1415  C CB   . GLU A 1 99  ? 10.754  -14.825 -11.522 1.00 0.00 ? 98  GLU A CB   1  
ATOM 1416  C CG   . GLU A 1 99  ? 11.372  -16.207 -11.797 1.00 0.00 ? 98  GLU A CG   1  
ATOM 1417  C CD   . GLU A 1 99  ? 12.871  -16.215 -11.490 1.00 0.00 ? 98  GLU A CD   1  
ATOM 1418  O OE1  . GLU A 1 99  ? 13.237  -15.950 -10.314 1.00 0.00 ? 98  GLU A OE1  1  
ATOM 1419  O OE2  . GLU A 1 99  ? 13.667  -16.492 -12.427 1.00 0.00 ? 98  GLU A OE2  1  
ATOM 1420  H H    . GLU A 1 99  ? 11.382  -11.772 -11.158 1.00 0.00 ? 98  GLU A H    1  
ATOM 1421  H HA   . GLU A 1 99  ? 12.436  -13.532 -11.904 1.00 0.00 ? 98  GLU A HA   1  
ATOM 1422  H HB2  . GLU A 1 99  ? 10.872  -14.690 -10.416 1.00 0.00 ? 98  GLU A HB2  1  
ATOM 1423  H HB3  . GLU A 1 99  ? 9.651   -14.861 -11.750 1.00 0.00 ? 98  GLU A HB3  1  
ATOM 1424  H HG2  . GLU A 1 99  ? 10.865  -16.922 -11.116 1.00 0.00 ? 98  GLU A HG2  1  
ATOM 1425  H HG3  . GLU A 1 99  ? 11.188  -16.518 -12.845 1.00 0.00 ? 98  GLU A HG3  1  
ATOM 1426  N N    . GLY A 1 100 ? 10.969  -12.538 -14.385 1.00 0.00 ? 99  GLY A N    1  
ATOM 1427  C CA   . GLY A 1 100 ? 10.929  -12.286 -15.822 1.00 0.00 ? 99  GLY A CA   1  
ATOM 1428  C C    . GLY A 1 100 ? 9.513   -12.208 -16.320 1.00 0.00 ? 99  GLY A C    1  
ATOM 1429  O O    . GLY A 1 100 ? 9.272   -11.925 -17.488 1.00 0.00 ? 99  GLY A O    1  
ATOM 1430  H H    . GLY A 1 100 ? 10.554  -11.865 -13.761 1.00 0.00 ? 99  GLY A H    1  
ATOM 1431  H HA2  . GLY A 1 100 ? 11.387  -11.323 -15.998 1.00 0.00 ? 99  GLY A HA2  1  
ATOM 1432  H HA3  . GLY A 1 100 ? 11.415  -13.084 -16.371 1.00 0.00 ? 99  GLY A HA3  1  
ATOM 1433  N N    . GLN A 1 101 ? 8.518   -12.462 -15.431 1.00 0.00 ? 100 GLN A N    1  
ATOM 1434  C CA   . GLN A 1 101 ? 7.101   -12.482 -15.757 1.00 0.00 ? 100 GLN A CA   1  
ATOM 1435  C C    . GLN A 1 101 ? 6.278   -11.664 -14.802 1.00 0.00 ? 100 GLN A C    1  
ATOM 1436  O O    . GLN A 1 101 ? 6.756   -11.169 -13.794 1.00 0.00 ? 100 GLN A O    1  
ATOM 1437  C CB   . GLN A 1 101 ? 6.577   -13.937 -15.991 1.00 0.00 ? 100 GLN A CB   1  
ATOM 1438  C CG   . GLN A 1 101 ? 6.945   -15.033 -14.948 1.00 0.00 ? 100 GLN A CG   1  
ATOM 1439  C CD   . GLN A 1 101 ? 6.038   -15.059 -13.714 1.00 0.00 ? 100 GLN A CD   1  
ATOM 1440  O OE1  . GLN A 1 101 ? 4.973   -15.688 -13.682 1.00 0.00 ? 100 GLN A OE1  1  
ATOM 1441  N NE2  . GLN A 1 101 ? 6.464   -14.339 -12.643 1.00 0.00 ? 100 GLN A NE2  1  
ATOM 1442  H H    . GLN A 1 101 ? 8.738   -12.669 -14.478 1.00 0.00 ? 100 GLN A H    1  
ATOM 1443  H HA   . GLN A 1 101 ? 6.959   -11.900 -16.647 1.00 0.00 ? 100 GLN A HA   1  
ATOM 1444  H HB2  . GLN A 1 101 ? 5.481   -13.950 -16.171 1.00 0.00 ? 100 GLN A HB2  1  
ATOM 1445  H HB3  . GLN A 1 101 ? 7.059   -14.269 -16.942 1.00 0.00 ? 100 GLN A HB3  1  
ATOM 1446  H HG2  . GLN A 1 101 ? 6.806   -16.021 -15.440 1.00 0.00 ? 100 GLN A HG2  1  
ATOM 1447  H HG3  . GLN A 1 101 ? 8.009   -14.966 -14.648 1.00 0.00 ? 100 GLN A HG3  1  
ATOM 1448  H HE21 . GLN A 1 101 ? 7.356   -13.833 -12.655 1.00 0.00 ? 100 GLN A HE21 1  
ATOM 1449  H HE22 . GLN A 1 101 ? 5.787   -14.223 -11.913 1.00 0.00 ? 100 GLN A HE22 1  
ATOM 1450  N N    . ARG A 1 102 ? 4.983   -11.436 -15.110 1.00 0.00 ? 101 ARG A N    1  
ATOM 1451  C CA   . ARG A 1 102 ? 4.117   -10.578 -14.328 1.00 0.00 ? 101 ARG A CA   1  
ATOM 1452  C C    . ARG A 1 102 ? 3.248   -11.372 -13.395 1.00 0.00 ? 101 ARG A C    1  
ATOM 1453  O O    . ARG A 1 102 ? 2.519   -12.269 -13.807 1.00 0.00 ? 101 ARG A O    1  
ATOM 1454  C CB   . ARG A 1 102 ? 3.234   -9.639  -15.209 1.00 0.00 ? 101 ARG A CB   1  
ATOM 1455  C CG   . ARG A 1 102 ? 4.009   -8.744  -16.200 1.00 0.00 ? 101 ARG A CG   1  
ATOM 1456  C CD   . ARG A 1 102 ? 4.349   -9.412  -17.546 1.00 0.00 ? 101 ARG A CD   1  
ATOM 1457  N NE   . ARG A 1 102 ? 5.099   -8.424  -18.404 1.00 0.00 ? 101 ARG A NE   1  
ATOM 1458  C CZ   . ARG A 1 102 ? 6.464   -8.397  -18.537 1.00 0.00 ? 101 ARG A CZ   1  
ATOM 1459  N NH1  . ARG A 1 102 ? 7.252   -9.329  -17.929 1.00 0.00 ? 101 ARG A NH1  1  
ATOM 1460  N NH2  . ARG A 1 102 ? 7.042   -7.416  -19.290 1.00 0.00 ? 101 ARG A NH2  1  
ATOM 1461  H H    . ARG A 1 102 ? 4.554   -11.819 -15.921 1.00 0.00 ? 101 ARG A H    1  
ATOM 1462  H HA   . ARG A 1 102 ? 4.714   -9.966  -13.677 1.00 0.00 ? 101 ARG A HA   1  
ATOM 1463  H HB2  . ARG A 1 102 ? 2.472   -10.216 -15.778 1.00 0.00 ? 101 ARG A HB2  1  
ATOM 1464  H HB3  . ARG A 1 102 ? 2.695   -8.937  -14.531 1.00 0.00 ? 101 ARG A HB3  1  
ATOM 1465  H HG2  . ARG A 1 102 ? 3.369   -7.857  -16.419 1.00 0.00 ? 101 ARG A HG2  1  
ATOM 1466  H HG3  . ARG A 1 102 ? 4.932   -8.371  -15.706 1.00 0.00 ? 101 ARG A HG3  1  
ATOM 1467  H HD2  . ARG A 1 102 ? 4.938   -10.344 -17.406 1.00 0.00 ? 101 ARG A HD2  1  
ATOM 1468  H HD3  . ARG A 1 102 ? 3.410   -9.673  -18.078 1.00 0.00 ? 101 ARG A HD3  1  
ATOM 1469  H HE   . ARG A 1 102 ? 4.567   -7.720  -18.875 1.00 0.00 ? 101 ARG A HE   1  
ATOM 1470  H HH11 . ARG A 1 102 ? 6.837   -10.048 -17.372 1.00 0.00 ? 101 ARG A HH11 1  
ATOM 1471  H HH12 . ARG A 1 102 ? 8.245   -9.290  -18.036 1.00 0.00 ? 101 ARG A HH12 1  
ATOM 1472  H HH21 . ARG A 1 102 ? 6.472   -6.728  -19.738 1.00 0.00 ? 101 ARG A HH21 1  
ATOM 1473  H HH22 . ARG A 1 102 ? 8.036   -7.386  -19.392 1.00 0.00 ? 101 ARG A HH22 1  
ATOM 1474  N N    . LYS A 1 103 ? 3.311   -11.042 -12.088 1.00 0.00 ? 102 LYS A N    1  
ATOM 1475  C CA   . LYS A 1 103 ? 2.461   -11.678 -11.093 1.00 0.00 ? 102 LYS A CA   1  
ATOM 1476  C C    . LYS A 1 103 ? 1.402   -10.662 -10.758 1.00 0.00 ? 102 LYS A C    1  
ATOM 1477  O O    . LYS A 1 103 ? 1.700   -9.586  -10.251 1.00 0.00 ? 102 LYS A O    1  
ATOM 1478  C CB   . LYS A 1 103 ? 3.291   -12.139 -9.861  1.00 0.00 ? 102 LYS A CB   1  
ATOM 1479  C CG   . LYS A 1 103 ? 3.857   -13.554 -10.118 1.00 0.00 ? 102 LYS A CG   1  
ATOM 1480  C CD   . LYS A 1 103 ? 5.173   -13.884 -9.398  1.00 0.00 ? 102 LYS A CD   1  
ATOM 1481  C CE   . LYS A 1 103 ? 5.447   -15.393 -9.321  1.00 0.00 ? 102 LYS A CE   1  
ATOM 1482  N NZ   . LYS A 1 103 ? 6.741   -15.662 -8.652  1.00 0.00 ? 102 LYS A NZ   1  
ATOM 1483  H H    . LYS A 1 103 ? 3.946   -10.303 -11.778 1.00 0.00 ? 102 LYS A H    1  
ATOM 1484  H HA   . LYS A 1 103 ? 1.953   -12.555 -11.477 1.00 0.00 ? 102 LYS A HA   1  
ATOM 1485  H HB2  . LYS A 1 103 ? 4.116   -11.414 -9.688  1.00 0.00 ? 102 LYS A HB2  1  
ATOM 1486  H HB3  . LYS A 1 103 ? 2.685   -12.166 -8.917  1.00 0.00 ? 102 LYS A HB3  1  
ATOM 1487  H HG2  . LYS A 1 103 ? 3.079   -14.292 -9.817  1.00 0.00 ? 102 LYS A HG2  1  
ATOM 1488  H HG3  . LYS A 1 103 ? 4.020   -13.685 -11.211 1.00 0.00 ? 102 LYS A HG3  1  
ATOM 1489  H HD2  . LYS A 1 103 ? 6.026   -13.409 -9.942  1.00 0.00 ? 102 LYS A HD2  1  
ATOM 1490  H HD3  . LYS A 1 103 ? 5.133   -13.472 -8.365  1.00 0.00 ? 102 LYS A HD3  1  
ATOM 1491  H HE2  . LYS A 1 103 ? 4.652   -15.903 -8.737  1.00 0.00 ? 102 LYS A HE2  1  
ATOM 1492  H HE3  . LYS A 1 103 ? 5.496   -15.833 -10.339 1.00 0.00 ? 102 LYS A HE3  1  
ATOM 1493  H HZ1  . LYS A 1 103 ? 7.510   -15.212 -9.191  1.00 0.00 ? 102 LYS A HZ1  1  
ATOM 1494  H HZ2  . LYS A 1 103 ? 6.903   -16.688 -8.609  1.00 0.00 ? 102 LYS A HZ2  1  
ATOM 1495  H HZ3  . LYS A 1 103 ? 6.720   -15.272 -7.688  1.00 0.00 ? 102 LYS A HZ3  1  
ATOM 1496  N N    . TRP A 1 104 ? 0.111   -10.979 -11.032 1.00 0.00 ? 103 TRP A N    1  
ATOM 1497  C CA   . TRP A 1 104 ? -1.018  -10.117 -10.748 1.00 0.00 ? 103 TRP A CA   1  
ATOM 1498  C C    . TRP A 1 104 ? -1.613  -10.636 -9.439  1.00 0.00 ? 103 TRP A C    1  
ATOM 1499  O O    . TRP A 1 104 ? -2.216  -11.709 -9.388  1.00 0.00 ? 103 TRP A O    1  
ATOM 1500  C CB   . TRP A 1 104 ? -2.113  -10.169 -11.870 1.00 0.00 ? 103 TRP A CB   1  
ATOM 1501  C CG   . TRP A 1 104 ? -1.850  -9.419  -13.177 1.00 0.00 ? 103 TRP A CG   1  
ATOM 1502  C CD1  . TRP A 1 104 ? -1.610  -9.914  -14.430 1.00 0.00 ? 103 TRP A CD1  1  
ATOM 1503  C CD2  . TRP A 1 104 ? -2.037  -7.999  -13.345 1.00 0.00 ? 103 TRP A CD2  1  
ATOM 1504  N NE1  . TRP A 1 104 ? -1.651  -8.891  -15.360 1.00 0.00 ? 103 TRP A NE1  1  
ATOM 1505  C CE2  . TRP A 1 104 ? -1.931  -7.717  -14.705 1.00 0.00 ? 103 TRP A CE2  1  
ATOM 1506  C CE3  . TRP A 1 104 ? -2.273  -7.004  -12.441 1.00 0.00 ? 103 TRP A CE3  1  
ATOM 1507  C CZ2  . TRP A 1 104 ? -2.094  -6.446  -15.182 1.00 0.00 ? 103 TRP A CZ2  1  
ATOM 1508  C CZ3  . TRP A 1 104 ? -2.454  -5.721  -12.919 1.00 0.00 ? 103 TRP A CZ3  1  
ATOM 1509  C CH2  . TRP A 1 104 ? -2.374  -5.446  -14.272 1.00 0.00 ? 103 TRP A CH2  1  
ATOM 1510  H H    . TRP A 1 104 ? -0.119  -11.852 -11.451 1.00 0.00 ? 103 TRP A H    1  
ATOM 1511  H HA   . TRP A 1 104 ? -0.644  -9.097  -10.602 1.00 0.00 ? 103 TRP A HA   1  
ATOM 1512  H HB2  . TRP A 1 104 ? -2.330  -11.231 -12.115 1.00 0.00 ? 103 TRP A HB2  1  
ATOM 1513  H HB3  . TRP A 1 104 ? -3.058  -9.721  -11.491 1.00 0.00 ? 103 TRP A HB3  1  
ATOM 1514  H HD1  . TRP A 1 104 ? -1.452  -10.960 -14.657 1.00 0.00 ? 103 TRP A HD1  1  
ATOM 1515  H HE1  . TRP A 1 104 ? -1.470  -8.967  -16.317 1.00 0.00 ? 103 TRP A HE1  1  
ATOM 1516  H HE3  . TRP A 1 104 ? -2.313  -7.199  -11.384 1.00 0.00 ? 103 TRP A HE3  1  
ATOM 1517  H HZ2  . TRP A 1 104 ? -2.035  -6.221  -16.237 1.00 0.00 ? 103 TRP A HZ2  1  
ATOM 1518  H HZ3  . TRP A 1 104 ? -2.688  -4.927  -12.222 1.00 0.00 ? 103 TRP A HZ3  1  
ATOM 1519  H HH2  . TRP A 1 104 ? -2.530  -4.431  -14.620 1.00 0.00 ? 103 TRP A HH2  1  
ATOM 1520  N N    . TYR A 1 105 ? -1.409  -9.871  -8.355  1.00 0.00 ? 104 TYR A N    1  
ATOM 1521  C CA   . TYR A 1 105 ? -1.834  -10.217 -7.010  1.00 0.00 ? 104 TYR A CA   1  
ATOM 1522  C C    . TYR A 1 105 ? -2.661  -9.110  -6.461  1.00 0.00 ? 104 TYR A C    1  
ATOM 1523  O O    . TYR A 1 105 ? -2.277  -7.959  -6.601  1.00 0.00 ? 104 TYR A O    1  
ATOM 1524  C CB   . TYR A 1 105 ? -0.631  -10.318 -6.041  1.00 0.00 ? 104 TYR A CB   1  
ATOM 1525  C CG   . TYR A 1 105 ? 0.426   -11.326 -6.435  1.00 0.00 ? 104 TYR A CG   1  
ATOM 1526  C CD1  . TYR A 1 105 ? 0.096   -12.624 -6.793  1.00 0.00 ? 104 TYR A CD1  1  
ATOM 1527  C CD2  . TYR A 1 105 ? 1.761   -11.012 -6.231  1.00 0.00 ? 104 TYR A CD2  1  
ATOM 1528  C CE1  . TYR A 1 105 ? 1.069   -13.607 -6.874  1.00 0.00 ? 104 TYR A CE1  1  
ATOM 1529  C CE2  . TYR A 1 105 ? 2.725   -11.998 -6.276  1.00 0.00 ? 104 TYR A CE2  1  
ATOM 1530  C CZ   . TYR A 1 105 ? 2.376   -13.299 -6.561  1.00 0.00 ? 104 TYR A CZ   1  
ATOM 1531  O OH   . TYR A 1 105 ? 3.358   -14.308 -6.493  1.00 0.00 ? 104 TYR A OH   1  
ATOM 1532  H H    . TYR A 1 105 ? -0.882  -9.018  -8.468  1.00 0.00 ? 104 TYR A H    1  
ATOM 1533  H HA   . TYR A 1 105 ? -2.379  -11.130 -6.876  1.00 0.00 ? 104 TYR A HA   1  
ATOM 1534  H HB2  . TYR A 1 105 ? -0.151  -9.326  -5.882  1.00 0.00 ? 104 TYR A HB2  1  
ATOM 1535  H HB3  . TYR A 1 105 ? -1.006  -10.670 -5.049  1.00 0.00 ? 104 TYR A HB3  1  
ATOM 1536  H HD1  . TYR A 1 105 ? -0.938  -12.905 -6.942  1.00 0.00 ? 104 TYR A HD1  1  
ATOM 1537  H HD2  . TYR A 1 105 ? 2.035   -10.015 -5.911  1.00 0.00 ? 104 TYR A HD2  1  
ATOM 1538  H HE1  . TYR A 1 105 ? 0.779   -14.622 -7.108  1.00 0.00 ? 104 TYR A HE1  1  
ATOM 1539  H HE2  . TYR A 1 105 ? 3.752   -11.753 -6.049  1.00 0.00 ? 104 TYR A HE2  1  
ATOM 1540  H HH   . TYR A 1 105 ? 3.040   -15.076 -6.978  1.00 0.00 ? 104 TYR A HH   1  
ATOM 1541  N N    . LYS A 1 106 ? -3.738  -9.383  -5.655  1.00 0.00 ? 105 LYS A N    1  
ATOM 1542  C CA   . LYS A 1 106 ? -4.352  -8.376  -4.801  1.00 0.00 ? 105 LYS A CA   1  
ATOM 1543  C C    . LYS A 1 106 ? -3.347  -8.011  -3.704  1.00 0.00 ? 105 LYS A C    1  
ATOM 1544  O O    . LYS A 1 106 ? -2.693  -8.878  -3.126  1.00 0.00 ? 105 LYS A O    1  
ATOM 1545  C CB   . LYS A 1 106 ? -5.696  -8.832  -4.175  1.00 0.00 ? 105 LYS A CB   1  
ATOM 1546  C CG   . LYS A 1 106 ? -5.732  -10.160 -3.405  1.00 0.00 ? 105 LYS A CG   1  
ATOM 1547  C CD   . LYS A 1 106 ? -6.997  -10.262 -2.539  1.00 0.00 ? 105 LYS A CD   1  
ATOM 1548  C CE   . LYS A 1 106 ? -7.124  -11.616 -1.829  1.00 0.00 ? 105 LYS A CE   1  
ATOM 1549  N NZ   . LYS A 1 106 ? -8.299  -11.634 -0.926  1.00 0.00 ? 105 LYS A NZ   1  
ATOM 1550  H H    . LYS A 1 106 ? -4.122  -10.280 -5.490  1.00 0.00 ? 105 LYS A H    1  
ATOM 1551  H HA   . LYS A 1 106 ? -4.510  -7.490  -5.415  1.00 0.00 ? 105 LYS A HA   1  
ATOM 1552  H HB2  . LYS A 1 106 ? -6.029  -8.026  -3.489  1.00 0.00 ? 105 LYS A HB2  1  
ATOM 1553  H HB3  . LYS A 1 106 ? -6.453  -8.902  -4.990  1.00 0.00 ? 105 LYS A HB3  1  
ATOM 1554  H HG2  . LYS A 1 106 ? -5.711  -11.013 -4.119  1.00 0.00 ? 105 LYS A HG2  1  
ATOM 1555  H HG3  . LYS A 1 106 ? -4.853  -10.254 -2.731  1.00 0.00 ? 105 LYS A HG3  1  
ATOM 1556  H HD2  . LYS A 1 106 ? -6.969  -9.451  -1.775  1.00 0.00 ? 105 LYS A HD2  1  
ATOM 1557  H HD3  . LYS A 1 106 ? -7.889  -10.094 -3.184  1.00 0.00 ? 105 LYS A HD3  1  
ATOM 1558  H HE2  . LYS A 1 106 ? -7.252  -12.434 -2.569  1.00 0.00 ? 105 LYS A HE2  1  
ATOM 1559  H HE3  . LYS A 1 106 ? -6.225  -11.818 -1.212  1.00 0.00 ? 105 LYS A HE3  1  
ATOM 1560  H HZ1  . LYS A 1 106 ? -8.203  -10.878 -0.218  1.00 0.00 ? 105 LYS A HZ1  1  
ATOM 1561  H HZ2  . LYS A 1 106 ? -8.351  -12.555 -0.446  1.00 0.00 ? 105 LYS A HZ2  1  
ATOM 1562  H HZ3  . LYS A 1 106 ? -9.166  -11.483 -1.482  1.00 0.00 ? 105 LYS A HZ3  1  
ATOM 1563  N N    . ARG A 1 107 ? -3.125  -6.689  -3.546  1.00 0.00 ? 106 ARG A N    1  
ATOM 1564  C CA   . ARG A 1 107 ? -2.034  -5.963  -2.913  1.00 0.00 ? 106 ARG A CA   1  
ATOM 1565  C C    . ARG A 1 107 ? -1.273  -6.523  -1.730  1.00 0.00 ? 106 ARG A C    1  
ATOM 1566  O O    . ARG A 1 107 ? -0.106  -6.207  -1.570  1.00 0.00 ? 106 ARG A O    1  
ATOM 1567  C CB   . ARG A 1 107 ? -2.561  -4.570  -2.532  1.00 0.00 ? 106 ARG A CB   1  
ATOM 1568  C CG   . ARG A 1 107 ? -2.828  -3.681  -3.757  1.00 0.00 ? 106 ARG A CG   1  
ATOM 1569  C CD   . ARG A 1 107 ? -2.842  -2.175  -3.456  1.00 0.00 ? 106 ARG A CD   1  
ATOM 1570  N NE   . ARG A 1 107 ? -4.056  -1.795  -2.650  1.00 0.00 ? 106 ARG A NE   1  
ATOM 1571  C CZ   . ARG A 1 107 ? -5.066  -0.994  -3.113  1.00 0.00 ? 106 ARG A CZ   1  
ATOM 1572  N NH1  . ARG A 1 107 ? -5.073  -0.546  -4.401  1.00 0.00 ? 106 ARG A NH1  1  
ATOM 1573  N NH2  . ARG A 1 107 ? -6.093  -0.659  -2.279  1.00 0.00 ? 106 ARG A NH2  1  
ATOM 1574  H H    . ARG A 1 107 ? -3.695  -6.096  -4.096  1.00 0.00 ? 106 ARG A H    1  
ATOM 1575  H HA   . ARG A 1 107 ? -1.281  -5.825  -3.679  1.00 0.00 ? 106 ARG A HA   1  
ATOM 1576  H HB2  . ARG A 1 107 ? -3.471  -4.711  -1.879  1.00 0.00 ? 106 ARG A HB2  1  
ATOM 1577  H HB3  . ARG A 1 107 ? -1.789  -3.998  -1.960  1.00 0.00 ? 106 ARG A HB3  1  
ATOM 1578  H HG2  . ARG A 1 107 ? -1.995  -3.843  -4.480  1.00 0.00 ? 106 ARG A HG2  1  
ATOM 1579  H HG3  . ARG A 1 107 ? -3.758  -3.988  -4.256  1.00 0.00 ? 106 ARG A HG3  1  
ATOM 1580  H HD2  . ARG A 1 107 ? -1.952  -1.917  -2.846  1.00 0.00 ? 106 ARG A HD2  1  
ATOM 1581  H HD3  . ARG A 1 107 ? -2.790  -1.608  -4.411  1.00 0.00 ? 106 ARG A HD3  1  
ATOM 1582  H HE   . ARG A 1 107 ? -4.104  -2.114  -1.703  1.00 0.00 ? 106 ARG A HE   1  
ATOM 1583  H HH11 . ARG A 1 107 ? -4.329  -0.794  -5.021  1.00 0.00 ? 106 ARG A HH11 1  
ATOM 1584  H HH12 . ARG A 1 107 ? -5.822  0.033   -4.724  1.00 0.00 ? 106 ARG A HH12 1  
ATOM 1585  H HH21 . ARG A 1 107 ? -6.098  -0.990  -1.334  1.00 0.00 ? 106 ARG A HH21 1  
ATOM 1586  H HH22 . ARG A 1 107 ? -6.840  -0.083  -2.611  1.00 0.00 ? 106 ARG A HH22 1  
ATOM 1587  N N    . MET A 1 108 ? -1.881  -7.433  -0.934  1.00 0.00 ? 107 MET A N    1  
ATOM 1588  C CA   . MET A 1 108 ? -1.319  -8.161  0.197   1.00 0.00 ? 107 MET A CA   1  
ATOM 1589  C C    . MET A 1 108 ? -0.182  -9.148  -0.150  1.00 0.00 ? 107 MET A C    1  
ATOM 1590  O O    . MET A 1 108 ? 0.593   -9.518  0.734   1.00 0.00 ? 107 MET A O    1  
ATOM 1591  C CB   . MET A 1 108 ? -2.451  -8.831  1.031   1.00 0.00 ? 107 MET A CB   1  
ATOM 1592  C CG   . MET A 1 108 ? -3.208  -9.951  0.280   1.00 0.00 ? 107 MET A CG   1  
ATOM 1593  S SD   . MET A 1 108 ? -4.834  -10.345 0.981   1.00 0.00 ? 107 MET A SD   1  
ATOM 1594  C CE   . MET A 1 108 ? -4.238  -10.903 2.600   1.00 0.00 ? 107 MET A CE   1  
ATOM 1595  H H    . MET A 1 108 ? -2.812  -7.683  -1.198  1.00 0.00 ? 107 MET A H    1  
ATOM 1596  H HA   . MET A 1 108 ? -0.857  -7.428  0.845   1.00 0.00 ? 107 MET A HA   1  
ATOM 1597  H HB2  . MET A 1 108 ? -2.022  -9.269  1.961   1.00 0.00 ? 107 MET A HB2  1  
ATOM 1598  H HB3  . MET A 1 108 ? -3.181  -8.042  1.360   1.00 0.00 ? 107 MET A HB3  1  
ATOM 1599  H HG2  . MET A 1 108 ? -3.359  -9.643  -0.778  1.00 0.00 ? 107 MET A HG2  1  
ATOM 1600  H HG3  . MET A 1 108 ? -2.574  -10.867 0.268   1.00 0.00 ? 107 MET A HG3  1  
ATOM 1601  H HE1  . MET A 1 108 ? -3.454  -11.684 2.500   1.00 0.00 ? 107 MET A HE1  1  
ATOM 1602  H HE2  . MET A 1 108 ? -5.075  -11.341 3.184   1.00 0.00 ? 107 MET A HE2  1  
ATOM 1603  H HE3  . MET A 1 108 ? -3.829  -10.059 3.196   1.00 0.00 ? 107 MET A HE3  1  
ATOM 1604  N N    . ALA A 1 109 ? 0.012   -9.552  -1.465  1.00 0.00 ? 108 ALA A N    1  
ATOM 1605  C CA   . ALA A 1 109 ? 1.151   -10.386 -1.871  1.00 0.00 ? 108 ALA A CA   1  
ATOM 1606  C C    . ALA A 1 109 ? 2.366   -9.597  -2.298  1.00 0.00 ? 108 ALA A C    1  
ATOM 1607  O O    . ALA A 1 109 ? 3.363   -10.141 -2.765  1.00 0.00 ? 108 ALA A O    1  
ATOM 1608  C CB   . ALA A 1 109 ? 0.805   -11.453 -2.933  1.00 0.00 ? 108 ALA A CB   1  
ATOM 1609  H H    . ALA A 1 109 ? -0.589  -9.272  -2.234  1.00 0.00 ? 108 ALA A H    1  
ATOM 1610  H HA   . ALA A 1 109 ? 1.529   -10.853 -0.991  1.00 0.00 ? 108 ALA A HA   1  
ATOM 1611  H HB1  . ALA A 1 109 ? 0.627   -10.981 -3.913  1.00 0.00 ? 108 ALA A HB1  1  
ATOM 1612  H HB2  . ALA A 1 109 ? -0.098  -12.027 -2.643  1.00 0.00 ? 108 ALA A HB2  1  
ATOM 1613  H HB3  . ALA A 1 109 ? 1.644   -12.167 -3.101  1.00 0.00 ? 108 ALA A HB3  1  
ATOM 1614  N N    . VAL A 1 110 ? 2.301   -8.276  -2.072  1.00 0.00 ? 109 VAL A N    1  
ATOM 1615  C CA   . VAL A 1 110 ? 3.352   -7.316  -2.085  1.00 0.00 ? 109 VAL A CA   1  
ATOM 1616  C C    . VAL A 1 110 ? 3.298   -6.651  -0.751  1.00 0.00 ? 109 VAL A C    1  
ATOM 1617  O O    . VAL A 1 110 ? 2.286   -6.495  -0.070  1.00 0.00 ? 109 VAL A O    1  
ATOM 1618  C CB   . VAL A 1 110 ? 3.541   -6.356  -3.256  1.00 0.00 ? 109 VAL A CB   1  
ATOM 1619  C CG1  . VAL A 1 110 ? 4.013   -7.197  -4.445  1.00 0.00 ? 109 VAL A CG1  1  
ATOM 1620  C CG2  . VAL A 1 110 ? 2.289   -5.514  -3.556  1.00 0.00 ? 109 VAL A CG2  1  
ATOM 1621  H H    . VAL A 1 110 ? 1.517   -7.924  -1.591  1.00 0.00 ? 109 VAL A H    1  
ATOM 1622  H HA   . VAL A 1 110 ? 4.279   -7.862  -2.041  1.00 0.00 ? 109 VAL A HA   1  
ATOM 1623  H HB   . VAL A 1 110 ? 4.395   -5.662  -3.058  1.00 0.00 ? 109 VAL A HB   1  
ATOM 1624  H HG11 . VAL A 1 110 ? 3.174   -7.813  -4.826  1.00 0.00 ? 109 VAL A HG11 1  
ATOM 1625  H HG12 . VAL A 1 110 ? 4.843   -7.872  -4.159  1.00 0.00 ? 109 VAL A HG12 1  
ATOM 1626  H HG13 . VAL A 1 110 ? 4.401   -6.531  -5.238  1.00 0.00 ? 109 VAL A HG13 1  
ATOM 1627  H HG21 . VAL A 1 110 ? 2.507   -4.788  -4.366  1.00 0.00 ? 109 VAL A HG21 1  
ATOM 1628  H HG22 . VAL A 1 110 ? 1.974   -4.941  -2.657  1.00 0.00 ? 109 VAL A HG22 1  
ATOM 1629  H HG23 . VAL A 1 110 ? 1.450   -6.171  -3.866  1.00 0.00 ? 109 VAL A HG23 1  
ATOM 1630  N N    . ILE A 1 111 ? 4.506   -6.271  -0.403  1.00 0.00 ? 110 ILE A N    1  
ATOM 1631  C CA   . ILE A 1 111 ? 4.915   -5.545  0.782   1.00 0.00 ? 110 ILE A CA   1  
ATOM 1632  C C    . ILE A 1 111 ? 5.846   -4.446  0.264   1.00 0.00 ? 110 ILE A C    1  
ATOM 1633  O O    . ILE A 1 111 ? 6.362   -4.474  -0.861  1.00 0.00 ? 110 ILE A O    1  
ATOM 1634  C CB   . ILE A 1 111 ? 5.614   -6.409  1.877   1.00 0.00 ? 110 ILE A CB   1  
ATOM 1635  C CG1  . ILE A 1 111 ? 5.351   -7.933  1.782   1.00 0.00 ? 110 ILE A CG1  1  
ATOM 1636  C CG2  . ILE A 1 111 ? 5.204   -5.982  3.301   1.00 0.00 ? 110 ILE A CG2  1  
ATOM 1637  C CD1  . ILE A 1 111 ? 6.302   -8.677  0.850   1.00 0.00 ? 110 ILE A CD1  1  
ATOM 1638  H H    . ILE A 1 111 ? 5.148   -6.530  -1.124  1.00 0.00 ? 110 ILE A H    1  
ATOM 1639  H HA   . ILE A 1 111 ? 4.057   -5.056  1.228   1.00 0.00 ? 110 ILE A HA   1  
ATOM 1640  H HB   . ILE A 1 111 ? 6.711   -6.229  1.851   1.00 0.00 ? 110 ILE A HB   1  
ATOM 1641  H HG12 . ILE A 1 111 ? 5.480   -8.368  2.798   1.00 0.00 ? 110 ILE A HG12 1  
ATOM 1642  H HG13 . ILE A 1 111 ? 4.293   -8.127  1.506   1.00 0.00 ? 110 ILE A HG13 1  
ATOM 1643  H HG21 . ILE A 1 111 ? 4.100   -5.993  3.413   1.00 0.00 ? 110 ILE A HG21 1  
ATOM 1644  H HG22 . ILE A 1 111 ? 5.584   -4.966  3.527   1.00 0.00 ? 110 ILE A HG22 1  
ATOM 1645  H HG23 . ILE A 1 111 ? 5.630   -6.672  4.060   1.00 0.00 ? 110 ILE A HG23 1  
ATOM 1646  H HD11 . ILE A 1 111 ? 6.093   -8.407  -0.203  1.00 0.00 ? 110 ILE A HD11 1  
ATOM 1647  H HD12 . ILE A 1 111 ? 6.174   -9.771  0.963   1.00 0.00 ? 110 ILE A HD12 1  
ATOM 1648  H HD13 . ILE A 1 111 ? 7.361   -8.434  1.079   1.00 0.00 ? 110 ILE A HD13 1  
ATOM 1649  N N    . LEU A 1 112 ? 6.139   -3.462  1.133   1.00 0.00 ? 111 LEU A N    1  
ATOM 1650  C CA   . LEU A 1 112 ? 7.138   -2.424  0.879   1.00 0.00 ? 111 LEU A CA   1  
ATOM 1651  C C    . LEU A 1 112 ? 7.809   -2.073  2.193   1.00 0.00 ? 111 LEU A C    1  
ATOM 1652  O O    . LEU A 1 112 ? 7.204   -2.247  3.251   1.00 0.00 ? 111 LEU A O    1  
ATOM 1653  C CB   . LEU A 1 112 ? 6.551   -1.156  0.204   1.00 0.00 ? 111 LEU A CB   1  
ATOM 1654  C CG   . LEU A 1 112 ? 5.066   -0.870  0.513   1.00 0.00 ? 111 LEU A CG   1  
ATOM 1655  C CD1  . LEU A 1 112 ? 4.770   -0.809  1.979   1.00 0.00 ? 111 LEU A CD1  1  
ATOM 1656  C CD2  . LEU A 1 112 ? 4.699   0.484   -0.036  1.00 0.00 ? 111 LEU A CD2  1  
ATOM 1657  H H    . LEU A 1 112 ? 5.676   -3.424  2.028   1.00 0.00 ? 111 LEU A H    1  
ATOM 1658  H HA   . LEU A 1 112 ? 7.932   -2.809  0.254   1.00 0.00 ? 111 LEU A HA   1  
ATOM 1659  H HB2  . LEU A 1 112 ? 7.150   -0.242  0.424   1.00 0.00 ? 111 LEU A HB2  1  
ATOM 1660  H HB3  . LEU A 1 112 ? 6.615   -1.300  -0.892  1.00 0.00 ? 111 LEU A HB3  1  
ATOM 1661  H HG   . LEU A 1 112 ? 4.436   -1.651  0.025   1.00 0.00 ? 111 LEU A HG   1  
ATOM 1662  H HD11 . LEU A 1 112 ? 4.901   -1.777  2.482   1.00 0.00 ? 111 LEU A HD11 1  
ATOM 1663  H HD12 . LEU A 1 112 ? 3.740   -0.428  2.171   1.00 0.00 ? 111 LEU A HD12 1  
ATOM 1664  H HD13 . LEU A 1 112 ? 5.502   -0.098  2.442   1.00 0.00 ? 111 LEU A HD13 1  
ATOM 1665  H HD21 . LEU A 1 112 ? 5.189   0.502   -1.036  1.00 0.00 ? 111 LEU A HD21 1  
ATOM 1666  H HD22 . LEU A 1 112 ? 5.077   1.322   0.624   1.00 0.00 ? 111 LEU A HD22 1  
ATOM 1667  H HD23 . LEU A 1 112 ? 3.602   0.617   -0.151  1.00 0.00 ? 111 LEU A HD23 1  
ATOM 1668  N N    . SER A 1 113 ? 9.062   -1.549  2.149   1.00 0.00 ? 112 SER A N    1  
ATOM 1669  C CA   . SER A 1 113 ? 9.799   -1.120  3.344   1.00 0.00 ? 112 SER A CA   1  
ATOM 1670  C C    . SER A 1 113 ? 9.718   0.404   3.493   1.00 0.00 ? 112 SER A C    1  
ATOM 1671  O O    . SER A 1 113 ? 9.361   1.069   2.524   1.00 0.00 ? 112 SER A O    1  
ATOM 1672  C CB   . SER A 1 113 ? 11.246  -1.692  3.386   1.00 0.00 ? 112 SER A CB   1  
ATOM 1673  O OG   . SER A 1 113 ? 12.080  -1.254  2.314   1.00 0.00 ? 112 SER A OG   1  
ATOM 1674  H H    . SER A 1 113 ? 9.520   -1.415  1.268   1.00 0.00 ? 112 SER A H    1  
ATOM 1675  H HA   . SER A 1 113 ? 9.332   -1.537  4.222   1.00 0.00 ? 112 SER A HA   1  
ATOM 1676  H HB2  . SER A 1 113 ? 11.736  -1.420  4.347   1.00 0.00 ? 112 SER A HB2  1  
ATOM 1677  H HB3  . SER A 1 113 ? 11.173  -2.804  3.361   1.00 0.00 ? 112 SER A HB3  1  
ATOM 1678  H HG   . SER A 1 113 ? 11.795  -1.662  1.480   1.00 0.00 ? 112 SER A HG   1  
ATOM 1679  N N    . LEU A 1 114 ? 10.049  1.039   4.680   1.00 0.00 ? 113 LEU A N    1  
ATOM 1680  C CA   . LEU A 1 114 ? 9.976   2.509   4.921   1.00 0.00 ? 113 LEU A CA   1  
ATOM 1681  C C    . LEU A 1 114 ? 10.721  3.335   3.932   1.00 0.00 ? 113 LEU A C    1  
ATOM 1682  O O    . LEU A 1 114 ? 10.121  4.221   3.385   1.00 0.00 ? 113 LEU A O    1  
ATOM 1683  C CB   . LEU A 1 114 ? 10.437  3.118   6.269   1.00 0.00 ? 113 LEU A CB   1  
ATOM 1684  C CG   . LEU A 1 114 ? 9.883   2.469   7.544   1.00 0.00 ? 113 LEU A CG   1  
ATOM 1685  C CD1  . LEU A 1 114 ? 10.967  2.552   8.624   1.00 0.00 ? 113 LEU A CD1  1  
ATOM 1686  C CD2  . LEU A 1 114 ? 8.564   3.043   8.078   1.00 0.00 ? 113 LEU A CD2  1  
ATOM 1687  H H    . LEU A 1 114 ? 10.338  0.465   5.455   1.00 0.00 ? 113 LEU A H    1  
ATOM 1688  H HA   . LEU A 1 114 ? 8.944   2.860   4.826   1.00 0.00 ? 113 LEU A HA   1  
ATOM 1689  H HB2  . LEU A 1 114 ? 11.548  3.086   6.363   1.00 0.00 ? 113 LEU A HB2  1  
ATOM 1690  H HB3  . LEU A 1 114 ? 10.163  4.213   6.236   1.00 0.00 ? 113 LEU A HB3  1  
ATOM 1691  H HG   . LEU A 1 114 ? 9.694   1.399   7.317   1.00 0.00 ? 113 LEU A HG   1  
ATOM 1692  H HD11 . LEU A 1 114 ? 11.209  3.619   8.823   1.00 0.00 ? 113 LEU A HD11 1  
ATOM 1693  H HD12 . LEU A 1 114 ? 11.903  2.077   8.255   1.00 0.00 ? 113 LEU A HD12 1  
ATOM 1694  H HD13 . LEU A 1 114 ? 10.621  2.026   9.550   1.00 0.00 ? 113 LEU A HD13 1  
ATOM 1695  H HD21 . LEU A 1 114 ? 7.775   3.031   7.299   1.00 0.00 ? 113 LEU A HD21 1  
ATOM 1696  H HD22 . LEU A 1 114 ? 8.697   4.087   8.428   1.00 0.00 ? 113 LEU A HD22 1  
ATOM 1697  H HD23 . LEU A 1 114 ? 8.219   2.425   8.943   1.00 0.00 ? 113 LEU A HD23 1  
ATOM 1698  N N    . GLU A 1 115 ? 12.012  3.114   3.631   1.00 0.00 ? 114 GLU A N    1  
ATOM 1699  C CA   . GLU A 1 115 ? 12.741  3.961   2.656   1.00 0.00 ? 114 GLU A CA   1  
ATOM 1700  C C    . GLU A 1 115 ? 12.320  3.927   1.184   1.00 0.00 ? 114 GLU A C    1  
ATOM 1701  O O    . GLU A 1 115 ? 12.516  4.893   0.454   1.00 0.00 ? 114 GLU A O    1  
ATOM 1702  C CB   . GLU A 1 115 ? 14.250  4.185   2.900   1.00 0.00 ? 114 GLU A CB   1  
ATOM 1703  C CG   . GLU A 1 115 ? 14.448  5.669   3.293   1.00 0.00 ? 114 GLU A CG   1  
ATOM 1704  C CD   . GLU A 1 115 ? 15.926  5.983   3.479   1.00 0.00 ? 114 GLU A CD   1  
ATOM 1705  O OE1  . GLU A 1 115 ? 16.679  5.908   2.471   1.00 0.00 ? 114 GLU A OE1  1  
ATOM 1706  O OE2  . GLU A 1 115 ? 16.325  6.305   4.630   1.00 0.00 ? 114 GLU A OE2  1  
ATOM 1707  H H    . GLU A 1 115 ? 12.441  2.388   4.153   1.00 0.00 ? 114 GLU A H    1  
ATOM 1708  H HA   . GLU A 1 115 ? 12.393  4.958   2.896   1.00 0.00 ? 114 GLU A HA   1  
ATOM 1709  H HB2  . GLU A 1 115 ? 14.597  3.538   3.735   1.00 0.00 ? 114 GLU A HB2  1  
ATOM 1710  H HB3  . GLU A 1 115 ? 14.864  3.943   2.005   1.00 0.00 ? 114 GLU A HB3  1  
ATOM 1711  H HG2  . GLU A 1 115 ? 14.000  6.350   2.503   1.00 0.00 ? 114 GLU A HG2  1  
ATOM 1712  H HG3  . GLU A 1 115 ? 13.894  5.790   4.266   1.00 0.00 ? 114 GLU A HG3  1  
ATOM 1713  N N    . GLN A 1 116 ? 11.574  2.859   0.784   1.00 0.00 ? 115 GLN A N    1  
ATOM 1714  C CA   . GLN A 1 116 ? 10.835  2.750   -0.478  1.00 0.00 ? 115 GLN A CA   1  
ATOM 1715  C C    . GLN A 1 116 ? 9.466   3.446   -0.402  1.00 0.00 ? 115 GLN A C    1  
ATOM 1716  O O    . GLN A 1 116 ? 8.830   3.697   -1.417  1.00 0.00 ? 115 GLN A O    1  
ATOM 1717  C CB   . GLN A 1 116 ? 10.588  1.278   -0.859  1.00 0.00 ? 115 GLN A CB   1  
ATOM 1718  C CG   . GLN A 1 116 ? 11.896  0.490   -0.997  1.00 0.00 ? 115 GLN A CG   1  
ATOM 1719  C CD   . GLN A 1 116 ? 11.551  -0.939  -1.386  1.00 0.00 ? 115 GLN A CD   1  
ATOM 1720  O OE1  . GLN A 1 116 ? 11.555  -1.835  -0.528  1.00 0.00 ? 115 GLN A OE1  1  
ATOM 1721  N NE2  . GLN A 1 116 ? 11.213  -1.153  -2.683  1.00 0.00 ? 115 GLN A NE2  1  
ATOM 1722  H H    . GLN A 1 116 ? 11.446  2.097   1.423   1.00 0.00 ? 115 GLN A H    1  
ATOM 1723  H HA   . GLN A 1 116 ? 11.400  3.223   -1.270  1.00 0.00 ? 115 GLN A HA   1  
ATOM 1724  H HB2  . GLN A 1 116 ? 9.980   0.788   -0.050  1.00 0.00 ? 115 GLN A HB2  1  
ATOM 1725  H HB3  . GLN A 1 116 ? 10.040  1.235   -1.839  1.00 0.00 ? 115 GLN A HB3  1  
ATOM 1726  H HG2  . GLN A 1 116 ? 12.564  0.948   -1.757  1.00 0.00 ? 115 GLN A HG2  1  
ATOM 1727  H HG3  . GLN A 1 116 ? 12.438  0.455   -0.026  1.00 0.00 ? 115 GLN A HG3  1  
ATOM 1728  H HE21 . GLN A 1 116 ? 11.039  -0.398  -3.337  1.00 0.00 ? 115 GLN A HE21 1  
ATOM 1729  H HE22 . GLN A 1 116 ? 11.376  -2.077  -3.050  1.00 0.00 ? 115 GLN A HE22 1  
ATOM 1730  N N    . GLY A 1 117 ? 9.064   3.797   0.838   1.00 0.00 ? 116 GLY A N    1  
ATOM 1731  C CA   . GLY A 1 117 ? 7.930   4.564   1.323   1.00 0.00 ? 116 GLY A CA   1  
ATOM 1732  C C    . GLY A 1 117 ? 8.286   6.027   1.546   1.00 0.00 ? 116 GLY A C    1  
ATOM 1733  O O    . GLY A 1 117 ? 7.509   6.909   1.226   1.00 0.00 ? 116 GLY A O    1  
ATOM 1734  H H    . GLY A 1 117 ? 9.700   3.531   1.561   1.00 0.00 ? 116 GLY A H    1  
ATOM 1735  H HA2  . GLY A 1 117 ? 7.079   4.447   0.666   1.00 0.00 ? 116 GLY A HA2  1  
ATOM 1736  H HA3  . GLY A 1 117 ? 7.705   4.171   2.301   1.00 0.00 ? 116 GLY A HA3  1  
ATOM 1737  N N    . ASN A 1 118 ? 9.488   6.337   2.125   1.00 0.00 ? 117 ASN A N    1  
ATOM 1738  C CA   . ASN A 1 118 ? 10.043  7.647   2.517   1.00 0.00 ? 117 ASN A CA   1  
ATOM 1739  C C    . ASN A 1 118 ? 10.488  8.518   1.383   1.00 0.00 ? 117 ASN A C    1  
ATOM 1740  O O    . ASN A 1 118 ? 10.449  9.746   1.445   1.00 0.00 ? 117 ASN A O    1  
ATOM 1741  C CB   . ASN A 1 118 ? 11.204  7.617   3.549   1.00 0.00 ? 117 ASN A CB   1  
ATOM 1742  C CG   . ASN A 1 118 ? 10.811  6.847   4.801   1.00 0.00 ? 117 ASN A CG   1  
ATOM 1743  O OD1  . ASN A 1 118 ? 11.624  6.140   5.391   1.00 0.00 ? 117 ASN A OD1  1  
ATOM 1744  N ND2  . ASN A 1 118 ? 9.530   6.983   5.214   1.00 0.00 ? 117 ASN A ND2  1  
ATOM 1745  H H    . ASN A 1 118 ? 10.028  5.535   2.427   1.00 0.00 ? 117 ASN A H    1  
ATOM 1746  H HA   . ASN A 1 118 ? 9.238   8.183   2.968   1.00 0.00 ? 117 ASN A HA   1  
ATOM 1747  H HB2  . ASN A 1 118 ? 12.102  7.125   3.125   1.00 0.00 ? 117 ASN A HB2  1  
ATOM 1748  H HB3  . ASN A 1 118 ? 11.483  8.649   3.872   1.00 0.00 ? 117 ASN A HB3  1  
ATOM 1749  H HD21 . ASN A 1 118 ? 8.888   7.492   4.641   1.00 0.00 ? 117 ASN A HD21 1  
ATOM 1750  H HD22 . ASN A 1 118 ? 9.271   6.544   6.075   1.00 0.00 ? 117 ASN A HD22 1  
ATOM 1751  N N    . ARG A 1 119 ? 10.857  7.862   0.257   1.00 0.00 ? 118 ARG A N    1  
ATOM 1752  C CA   . ARG A 1 119 ? 11.226  8.496   -0.991  1.00 0.00 ? 118 ARG A CA   1  
ATOM 1753  C C    . ARG A 1 119 ? 10.025  9.280   -1.615  1.00 0.00 ? 118 ARG A C    1  
ATOM 1754  O O    . ARG A 1 119 ? 10.153  10.334  -2.230  1.00 0.00 ? 118 ARG A O    1  
ATOM 1755  C CB   . ARG A 1 119 ? 11.678  7.429   -2.018  1.00 0.00 ? 118 ARG A CB   1  
ATOM 1756  C CG   . ARG A 1 119 ? 10.651  6.307   -2.265  1.00 0.00 ? 118 ARG A CG   1  
ATOM 1757  C CD   . ARG A 1 119 ? 10.852  5.575   -3.596  1.00 0.00 ? 118 ARG A CD   1  
ATOM 1758  N NE   . ARG A 1 119 ? 12.109  4.749   -3.525  1.00 0.00 ? 118 ARG A NE   1  
ATOM 1759  C CZ   . ARG A 1 119 ? 12.285  3.577   -4.214  1.00 0.00 ? 118 ARG A CZ   1  
ATOM 1760  N NH1  . ARG A 1 119 ? 11.314  3.091   -5.039  1.00 0.00 ? 118 ARG A NH1  1  
ATOM 1761  N NH2  . ARG A 1 119 ? 13.451  2.882   -4.063  1.00 0.00 ? 118 ARG A NH2  1  
ATOM 1762  H H    . ARG A 1 119 ? 10.891  6.865   0.257   1.00 0.00 ? 118 ARG A H    1  
ATOM 1763  H HA   . ARG A 1 119 ? 12.092  9.097   -0.715  1.00 0.00 ? 118 ARG A HA   1  
ATOM 1764  H HB2  . ARG A 1 119 ? 11.934  7.919   -2.987  1.00 0.00 ? 118 ARG A HB2  1  
ATOM 1765  H HB3  . ARG A 1 119 ? 12.619  6.957   -1.651  1.00 0.00 ? 118 ARG A HB3  1  
ATOM 1766  H HG2  . ARG A 1 119 ? 10.665  5.608   -1.411  1.00 0.00 ? 118 ARG A HG2  1  
ATOM 1767  H HG3  . ARG A 1 119 ? 9.601   6.679   -2.301  1.00 0.00 ? 118 ARG A HG3  1  
ATOM 1768  H HD2  . ARG A 1 119 ? 9.963   4.931   -3.773  1.00 0.00 ? 118 ARG A HD2  1  
ATOM 1769  H HD3  . ARG A 1 119 ? 10.947  6.330   -4.408  1.00 0.00 ? 118 ARG A HD3  1  
ATOM 1770  H HE   . ARG A 1 119 ? 12.848  5.067   -2.930  1.00 0.00 ? 118 ARG A HE   1  
ATOM 1771  H HH11 . ARG A 1 119 ? 10.456  3.593   -5.149  1.00 0.00 ? 118 ARG A HH11 1  
ATOM 1772  H HH12 . ARG A 1 119 ? 11.459  2.231   -5.530  1.00 0.00 ? 118 ARG A HH12 1  
ATOM 1773  H HH21 . ARG A 1 119 ? 14.167  3.232   -3.459  1.00 0.00 ? 118 ARG A HH21 1  
ATOM 1774  H HH22 . ARG A 1 119 ? 13.589  2.025   -4.559  1.00 0.00 ? 118 ARG A HH22 1  
ATOM 1775  N N    . LEU A 1 120 ? 8.820   8.672   -1.379  1.00 0.00 ? 119 LEU A N    1  
ATOM 1776  C CA   . LEU A 1 120 ? 7.426   8.922   -1.691  1.00 0.00 ? 119 LEU A CA   1  
ATOM 1777  C C    . LEU A 1 120 ? 6.776   9.777   -0.658  1.00 0.00 ? 119 LEU A C    1  
ATOM 1778  O O    . LEU A 1 120 ? 6.011   10.647  -1.045  1.00 0.00 ? 119 LEU A O    1  
ATOM 1779  C CB   . LEU A 1 120 ? 6.606   7.583   -1.820  1.00 0.00 ? 119 LEU A CB   1  
ATOM 1780  C CG   . LEU A 1 120 ? 5.072   7.703   -1.957  1.00 0.00 ? 119 LEU A CG   1  
ATOM 1781  C CD1  . LEU A 1 120 ? 4.459   6.472   -2.637  1.00 0.00 ? 119 LEU A CD1  1  
ATOM 1782  C CD2  . LEU A 1 120 ? 4.350   7.746   -0.618  1.00 0.00 ? 119 LEU A CD2  1  
ATOM 1783  H H    . LEU A 1 120 ? 8.912   7.829   -0.855  1.00 0.00 ? 119 LEU A H    1  
ATOM 1784  H HA   . LEU A 1 120 ? 7.291   9.483   -2.603  1.00 0.00 ? 119 LEU A HA   1  
ATOM 1785  H HB2  . LEU A 1 120 ? 6.927   7.057   -2.729  1.00 0.00 ? 119 LEU A HB2  1  
ATOM 1786  H HB3  . LEU A 1 120 ? 6.840   6.868   -1.010  1.00 0.00 ? 119 LEU A HB3  1  
ATOM 1787  H HG   . LEU A 1 120 ? 4.898   8.648   -2.543  1.00 0.00 ? 119 LEU A HG   1  
ATOM 1788  H HD11 . LEU A 1 120 ? 4.944   6.280   -3.607  1.00 0.00 ? 119 LEU A HD11 1  
ATOM 1789  H HD12 . LEU A 1 120 ? 3.363   6.601   -2.788  1.00 0.00 ? 119 LEU A HD12 1  
ATOM 1790  H HD13 . LEU A 1 120 ? 4.605   5.604   -1.964  1.00 0.00 ? 119 LEU A HD13 1  
ATOM 1791  H HD21 . LEU A 1 120 ? 4.350   8.775   -0.224  1.00 0.00 ? 119 LEU A HD21 1  
ATOM 1792  H HD22 . LEU A 1 120 ? 4.864   7.052   0.080   1.00 0.00 ? 119 LEU A HD22 1  
ATOM 1793  H HD23 . LEU A 1 120 ? 3.293   7.437   -0.751  1.00 0.00 ? 119 LEU A HD23 1  
ATOM 1794  N N    . ARG A 1 121 ? 6.963   9.519   0.666   1.00 0.00 ? 120 ARG A N    1  
ATOM 1795  C CA   . ARG A 1 121 ? 6.251   10.074  1.822   1.00 0.00 ? 120 ARG A CA   1  
ATOM 1796  C C    . ARG A 1 121 ? 5.861   11.563  1.842   1.00 0.00 ? 120 ARG A C    1  
ATOM 1797  O O    . ARG A 1 121 ? 4.840   11.959  2.388   1.00 0.00 ? 120 ARG A O    1  
ATOM 1798  C CB   . ARG A 1 121 ? 6.991   9.701   3.181   1.00 0.00 ? 120 ARG A CB   1  
ATOM 1799  C CG   . ARG A 1 121 ? 8.233   10.562  3.542   1.00 0.00 ? 120 ARG A CG   1  
ATOM 1800  C CD   . ARG A 1 121 ? 7.980   11.720  4.526   1.00 0.00 ? 120 ARG A CD   1  
ATOM 1801  N NE   . ARG A 1 121 ? 9.245   12.530  4.617   1.00 0.00 ? 120 ARG A NE   1  
ATOM 1802  C CZ   . ARG A 1 121 ? 9.300   13.780  5.172   1.00 0.00 ? 120 ARG A CZ   1  
ATOM 1803  N NH1  . ARG A 1 121 ? 8.192   14.354  5.722   1.00 0.00 ? 120 ARG A NH1  1  
ATOM 1804  N NH2  . ARG A 1 121 ? 10.484  14.463  5.168   1.00 0.00 ? 120 ARG A NH2  1  
ATOM 1805  H H    . ARG A 1 121 ? 7.544   8.745   0.917   1.00 0.00 ? 120 ARG A H    1  
ATOM 1806  H HA   . ARG A 1 121 ? 5.293   9.566   1.662   1.00 0.00 ? 120 ARG A HA   1  
ATOM 1807  H HB2  . ARG A 1 121 ? 6.301   9.860   4.032   1.00 0.00 ? 120 ARG A HB2  1  
ATOM 1808  H HB3  . ARG A 1 121 ? 7.291   8.611   3.231   1.00 0.00 ? 120 ARG A HB3  1  
ATOM 1809  H HG2  . ARG A 1 121 ? 8.994   9.916   4.030   1.00 0.00 ? 120 ARG A HG2  1  
ATOM 1810  H HG3  . ARG A 1 121 ? 8.685   10.951  2.602   1.00 0.00 ? 120 ARG A HG3  1  
ATOM 1811  H HD2  . ARG A 1 121 ? 7.154   12.372  4.169   1.00 0.00 ? 120 ARG A HD2  1  
ATOM 1812  H HD3  . ARG A 1 121 ? 7.730   11.323  5.533   1.00 0.00 ? 120 ARG A HD3  1  
ATOM 1813  H HE   . ARG A 1 121 ? 10.081  12.144  4.226   1.00 0.00 ? 120 ARG A HE   1  
ATOM 1814  H HH11 . ARG A 1 121 ? 7.323   13.858  5.726   1.00 0.00 ? 120 ARG A HH11 1  
ATOM 1815  H HH12 . ARG A 1 121 ? 8.248   15.269  6.122   1.00 0.00 ? 120 ARG A HH12 1  
ATOM 1816  H HH21 . ARG A 1 121 ? 11.299  14.048  4.764   1.00 0.00 ? 120 ARG A HH21 1  
ATOM 1817  H HH22 . ARG A 1 121 ? 10.534  15.378  5.569   1.00 0.00 ? 120 ARG A HH22 1  
ATOM 1818  N N    . GLU A 1 122 ? 6.712   12.383  1.184   1.00 0.00 ? 121 GLU A N    1  
ATOM 1819  C CA   . GLU A 1 122 ? 6.655   13.808  0.968   1.00 0.00 ? 121 GLU A CA   1  
ATOM 1820  C C    . GLU A 1 122 ? 5.888   14.212  -0.300  1.00 0.00 ? 121 GLU A C    1  
ATOM 1821  O O    . GLU A 1 122 ? 5.284   15.282  -0.339  1.00 0.00 ? 121 GLU A O    1  
ATOM 1822  C CB   . GLU A 1 122 ? 8.128   14.322  0.931   1.00 0.00 ? 121 GLU A CB   1  
ATOM 1823  C CG   . GLU A 1 122 ? 9.071   13.560  -0.034  1.00 0.00 ? 121 GLU A CG   1  
ATOM 1824  C CD   . GLU A 1 122 ? 10.491  14.107  0.111   1.00 0.00 ? 121 GLU A CD   1  
ATOM 1825  O OE1  . GLU A 1 122 ? 11.071  13.956  1.219   1.00 0.00 ? 121 GLU A OE1  1  
ATOM 1826  O OE2  . GLU A 1 122 ? 11.014  14.676  -0.884  1.00 0.00 ? 121 GLU A OE2  1  
ATOM 1827  H H    . GLU A 1 122 ? 7.501   11.940  0.768   1.00 0.00 ? 121 GLU A H    1  
ATOM 1828  H HA   . GLU A 1 122 ? 6.147   14.280  1.802   1.00 0.00 ? 121 GLU A HA   1  
ATOM 1829  H HB2  . GLU A 1 122 ? 8.149   15.412  0.701   1.00 0.00 ? 121 GLU A HB2  1  
ATOM 1830  H HB3  . GLU A 1 122 ? 8.534   14.201  1.961   1.00 0.00 ? 121 GLU A HB3  1  
ATOM 1831  H HG2  . GLU A 1 122 ? 9.104   12.464  0.176   1.00 0.00 ? 121 GLU A HG2  1  
ATOM 1832  H HG3  . GLU A 1 122 ? 8.727   13.700  -1.081  1.00 0.00 ? 121 GLU A HG3  1  
ATOM 1833  N N    . GLN A 1 123 ? 5.917   13.358  -1.362  1.00 0.00 ? 122 GLN A N    1  
ATOM 1834  C CA   . GLN A 1 123 ? 5.314   13.538  -2.672  1.00 0.00 ? 122 GLN A CA   1  
ATOM 1835  C C    . GLN A 1 123 ? 3.985   12.810  -2.857  1.00 0.00 ? 122 GLN A C    1  
ATOM 1836  O O    . GLN A 1 123 ? 3.085   13.388  -3.464  1.00 0.00 ? 122 GLN A O    1  
ATOM 1837  C CB   . GLN A 1 123 ? 6.311   13.202  -3.843  1.00 0.00 ? 122 GLN A CB   1  
ATOM 1838  C CG   . GLN A 1 123 ? 7.029   11.827  -3.781  1.00 0.00 ? 122 GLN A CG   1  
ATOM 1839  C CD   . GLN A 1 123 ? 8.019   11.615  -4.949  1.00 0.00 ? 122 GLN A CD   1  
ATOM 1840  O OE1  . GLN A 1 123 ? 7.726   11.859  -6.125  1.00 0.00 ? 122 GLN A OE1  1  
ATOM 1841  N NE2  . GLN A 1 123 ? 9.243   11.122  -4.632  1.00 0.00 ? 122 GLN A NE2  1  
ATOM 1842  H H    . GLN A 1 123 ? 6.368   12.470  -1.267  1.00 0.00 ? 122 GLN A H    1  
ATOM 1843  H HA   . GLN A 1 123 ? 5.064   14.584  -2.797  1.00 0.00 ? 122 GLN A HA   1  
ATOM 1844  H HB2  . GLN A 1 123 ? 5.787   13.294  -4.822  1.00 0.00 ? 122 GLN A HB2  1  
ATOM 1845  H HB3  . GLN A 1 123 ? 7.101   13.991  -3.823  1.00 0.00 ? 122 GLN A HB3  1  
ATOM 1846  H HG2  . GLN A 1 123 ? 7.616   11.810  -2.838  1.00 0.00 ? 122 GLN A HG2  1  
ATOM 1847  H HG3  . GLN A 1 123 ? 6.298   10.972  -3.741  1.00 0.00 ? 122 GLN A HG3  1  
ATOM 1848  H HE21 . GLN A 1 123 ? 9.486   10.935  -3.664  1.00 0.00 ? 122 GLN A HE21 1  
ATOM 1849  H HE22 . GLN A 1 123 ? 9.877   10.944  -5.385  1.00 0.00 ? 122 GLN A HE22 1  
ATOM 1850  N N    . TYR A 1 124 ? 3.804   11.528  -2.394  1.00 0.00 ? 123 TYR A N    1  
ATOM 1851  C CA   . TYR A 1 124 ? 2.536   10.837  -2.703  1.00 0.00 ? 123 TYR A CA   1  
ATOM 1852  C C    . TYR A 1 124 ? 1.803   10.188  -1.557  1.00 0.00 ? 123 TYR A C    1  
ATOM 1853  O O    . TYR A 1 124 ? 0.835   9.506   -1.881  1.00 0.00 ? 123 TYR A O    1  
ATOM 1854  C CB   . TYR A 1 124 ? 2.588   9.711   -3.809  1.00 0.00 ? 123 TYR A CB   1  
ATOM 1855  C CG   . TYR A 1 124 ? 3.498   10.011  -4.950  1.00 0.00 ? 123 TYR A CG   1  
ATOM 1856  C CD1  . TYR A 1 124 ? 3.331   11.073  -5.815  1.00 0.00 ? 123 TYR A CD1  1  
ATOM 1857  C CD2  . TYR A 1 124 ? 4.556   9.163   -5.151  1.00 0.00 ? 123 TYR A CD2  1  
ATOM 1858  C CE1  . TYR A 1 124 ? 4.231   11.262  -6.847  1.00 0.00 ? 123 TYR A CE1  1  
ATOM 1859  C CE2  . TYR A 1 124 ? 5.477   9.361   -6.131  1.00 0.00 ? 123 TYR A CE2  1  
ATOM 1860  C CZ   . TYR A 1 124 ? 5.303   10.406  -7.017  1.00 0.00 ? 123 TYR A CZ   1  
ATOM 1861  O OH   . TYR A 1 124 ? 6.279   10.711  -7.986  1.00 0.00 ? 123 TYR A OH   1  
ATOM 1862  H H    . TYR A 1 124 ? 4.535   11.032  -1.871  1.00 0.00 ? 123 TYR A H    1  
ATOM 1863  H HA   . TYR A 1 124 ? 1.796   11.535  -3.083  1.00 0.00 ? 123 TYR A HA   1  
ATOM 1864  H HB2  . TYR A 1 124 ? 2.925   8.744   -3.376  1.00 0.00 ? 123 TYR A HB2  1  
ATOM 1865  H HB3  . TYR A 1 124 ? 1.582   9.518   -4.257  1.00 0.00 ? 123 TYR A HB3  1  
ATOM 1866  H HD1  . TYR A 1 124 ? 2.516   11.768  -5.669  1.00 0.00 ? 123 TYR A HD1  1  
ATOM 1867  H HD2  . TYR A 1 124 ? 4.699   8.316   -4.512  1.00 0.00 ? 123 TYR A HD2  1  
ATOM 1868  H HE1  . TYR A 1 124 ? 4.116   12.116  -7.497  1.00 0.00 ? 123 TYR A HE1  1  
ATOM 1869  H HE2  . TYR A 1 124 ? 6.309   8.676   -6.086  1.00 0.00 ? 123 TYR A HE2  1  
ATOM 1870  H HH   . TYR A 1 124 ? 6.958   11.207  -7.481  1.00 0.00 ? 123 TYR A HH   1  
ATOM 1871  N N    . GLY A 1 125 ? 2.132   10.273  -0.230  1.00 0.00 ? 124 GLY A N    1  
ATOM 1872  C CA   . GLY A 1 125 ? 1.276   9.502   0.612   1.00 0.00 ? 124 GLY A CA   1  
ATOM 1873  C C    . GLY A 1 125 ? 1.883   9.412   1.937   1.00 0.00 ? 124 GLY A C    1  
ATOM 1874  O O    . GLY A 1 125 ? 1.326   10.063  2.805   1.00 0.00 ? 124 GLY A O    1  
ATOM 1875  H H    . GLY A 1 125 ? 2.844   10.751  0.319   1.00 0.00 ? 124 GLY A H    1  
ATOM 1876  H HA2  . GLY A 1 125 ? 0.393   10.106  0.754   1.00 0.00 ? 124 GLY A HA2  1  
ATOM 1877  H HA3  . GLY A 1 125 ? 0.984   8.498   0.242   1.00 0.00 ? 124 GLY A HA3  1  
ATOM 1878  N N    . LEU A 1 126 ? 3.000   8.619   2.142   1.00 0.00 ? 125 LEU A N    1  
ATOM 1879  C CA   . LEU A 1 126 ? 3.613   8.090   3.405   1.00 0.00 ? 125 LEU A CA   1  
ATOM 1880  C C    . LEU A 1 126 ? 3.879   9.009   4.608   1.00 0.00 ? 125 LEU A C    1  
ATOM 1881  O O    . LEU A 1 126 ? 4.496   8.600   5.590   1.00 0.00 ? 125 LEU A O    1  
ATOM 1882  C CB   . LEU A 1 126 ? 4.604   6.835   3.280   1.00 0.00 ? 125 LEU A CB   1  
ATOM 1883  C CG   . LEU A 1 126 ? 3.939   5.441   3.446   1.00 0.00 ? 125 LEU A CG   1  
ATOM 1884  C CD1  . LEU A 1 126 ? 2.920   5.286   4.617   1.00 0.00 ? 125 LEU A CD1  1  
ATOM 1885  C CD2  . LEU A 1 126 ? 3.473   4.972   2.050   1.00 0.00 ? 125 LEU A CD2  1  
ATOM 1886  H H    . LEU A 1 126 ? 3.375   8.172   1.337   1.00 0.00 ? 125 LEU A H    1  
ATOM 1887  H HA   . LEU A 1 126 ? 2.774   7.594   3.810   1.00 0.00 ? 125 LEU A HA   1  
ATOM 1888  H HB2  . LEU A 1 126 ? 5.030   6.758   2.248   1.00 0.00 ? 125 LEU A HB2  1  
ATOM 1889  H HB3  . LEU A 1 126 ? 5.481   6.817   3.988   1.00 0.00 ? 125 LEU A HB3  1  
ATOM 1890  H HG   . LEU A 1 126 ? 4.768   4.745   3.721   1.00 0.00 ? 125 LEU A HG   1  
ATOM 1891  H HD11 . LEU A 1 126 ? 1.984   5.846   4.491   1.00 0.00 ? 125 LEU A HD11 1  
ATOM 1892  H HD12 . LEU A 1 126 ? 3.347   5.685   5.561   1.00 0.00 ? 125 LEU A HD12 1  
ATOM 1893  H HD13 . LEU A 1 126 ? 2.634   4.228   4.768   1.00 0.00 ? 125 LEU A HD13 1  
ATOM 1894  H HD21 . LEU A 1 126 ? 4.261   5.115   1.279   1.00 0.00 ? 125 LEU A HD21 1  
ATOM 1895  H HD22 . LEU A 1 126 ? 2.570   5.531   1.738   1.00 0.00 ? 125 LEU A HD22 1  
ATOM 1896  H HD23 . LEU A 1 126 ? 3.249   3.887   2.054   1.00 0.00 ? 125 LEU A HD23 1  
ATOM 1897  N N    . GLY A 1 127 ? 3.269   10.227  4.584   1.00 0.00 ? 126 GLY A N    1  
ATOM 1898  C CA   . GLY A 1 127 ? 3.023   11.026  5.792   1.00 0.00 ? 126 GLY A CA   1  
ATOM 1899  C C    . GLY A 1 127 ? 2.288   12.341  5.586   1.00 0.00 ? 126 GLY A C    1  
ATOM 1900  O O    . GLY A 1 127 ? 2.985   13.294  5.255   1.00 0.00 ? 126 GLY A O    1  
ATOM 1901  H H    . GLY A 1 127 ? 2.774   10.461  3.707   1.00 0.00 ? 126 GLY A H    1  
ATOM 1902  H HA2  . GLY A 1 127 ? 2.431   10.441  6.483   1.00 0.00 ? 126 GLY A HA2  1  
ATOM 1903  H HA3  . GLY A 1 127 ? 3.990   11.293  6.199   1.00 0.00 ? 126 GLY A HA3  1  
ATOM 1904  N N    . PRO A 1 128 ? 0.957   12.598  5.757   1.00 0.00 ? 127 PRO A N    1  
ATOM 1905  C CA   . PRO A 1 128 ? 0.399   13.958  5.618   1.00 0.00 ? 127 PRO A CA   1  
ATOM 1906  C C    . PRO A 1 128 ? 0.580   14.802  6.908   1.00 0.00 ? 127 PRO A C    1  
ATOM 1907  O O    . PRO A 1 128 ? 0.550   16.030  6.854   1.00 0.00 ? 127 PRO A O    1  
ATOM 1908  C CB   . PRO A 1 128 ? -1.092  13.660  5.346   1.00 0.00 ? 127 PRO A CB   1  
ATOM 1909  C CG   . PRO A 1 128 ? -1.397  12.440  6.230   1.00 0.00 ? 127 PRO A CG   1  
ATOM 1910  C CD   . PRO A 1 128 ? -0.086  11.623  6.126   1.00 0.00 ? 127 PRO A CD   1  
ATOM 1911  H HA   . PRO A 1 128 ? 0.852   14.500  4.795   1.00 0.00 ? 127 PRO A HA   1  
ATOM 1912  H HB2  . PRO A 1 128 ? -1.767  14.517  5.549   1.00 0.00 ? 127 PRO A HB2  1  
ATOM 1913  H HB3  . PRO A 1 128 ? -1.209  13.367  4.276   1.00 0.00 ? 127 PRO A HB3  1  
ATOM 1914  H HG2  . PRO A 1 128 ? -1.595  12.800  7.267   1.00 0.00 ? 127 PRO A HG2  1  
ATOM 1915  H HG3  . PRO A 1 128 ? -2.313  11.913  5.901   1.00 0.00 ? 127 PRO A HG3  1  
ATOM 1916  H HD2  . PRO A 1 128 ? 0.153   11.123  7.090   1.00 0.00 ? 127 PRO A HD2  1  
ATOM 1917  H HD3  . PRO A 1 128 ? -0.182  10.864  5.319   1.00 0.00 ? 127 PRO A HD3  1  
ATOM 1918  N N    . TYR A 1 129 ? 0.711   14.129  8.075   1.00 0.00 ? 128 TYR A N    1  
ATOM 1919  C CA   . TYR A 1 129 ? 0.860   14.632  9.419   1.00 0.00 ? 128 TYR A CA   1  
ATOM 1920  C C    . TYR A 1 129 ? 2.200   14.165  9.981   1.00 0.00 ? 128 TYR A C    1  
ATOM 1921  O O    . TYR A 1 129 ? 2.761   13.164  9.532   1.00 0.00 ? 128 TYR A O    1  
ATOM 1922  C CB   . TYR A 1 129 ? -0.360  14.137  10.256  1.00 0.00 ? 128 TYR A CB   1  
ATOM 1923  C CG   . TYR A 1 129 ? -0.653  15.019  11.441  1.00 0.00 ? 128 TYR A CG   1  
ATOM 1924  C CD1  . TYR A 1 129 ? -1.263  16.249  11.262  1.00 0.00 ? 128 TYR A CD1  1  
ATOM 1925  C CD2  . TYR A 1 129 ? -0.337  14.611  12.723  1.00 0.00 ? 128 TYR A CD2  1  
ATOM 1926  C CE1  . TYR A 1 129 ? -1.556  17.048  12.350  1.00 0.00 ? 128 TYR A CE1  1  
ATOM 1927  C CE2  . TYR A 1 129 ? -0.630  15.407  13.812  1.00 0.00 ? 128 TYR A CE2  1  
ATOM 1928  C CZ   . TYR A 1 129 ? -1.242  16.628  13.622  1.00 0.00 ? 128 TYR A CZ   1  
ATOM 1929  O OH   . TYR A 1 129 ? -1.557  17.450  14.719  1.00 0.00 ? 128 TYR A OH   1  
ATOM 1930  H H    . TYR A 1 129 ? 0.736   13.139  7.989   1.00 0.00 ? 128 TYR A H    1  
ATOM 1931  H HA   . TYR A 1 129 ? 0.880   15.716  9.392   1.00 0.00 ? 128 TYR A HA   1  
ATOM 1932  H HB2  . TYR A 1 129 ? -1.261  14.189  9.608   1.00 0.00 ? 128 TYR A HB2  1  
ATOM 1933  H HB3  . TYR A 1 129 ? -0.245  13.081  10.584  1.00 0.00 ? 128 TYR A HB3  1  
ATOM 1934  H HD1  . TYR A 1 129 ? -1.523  16.586  10.267  1.00 0.00 ? 128 TYR A HD1  1  
ATOM 1935  H HD2  . TYR A 1 129 ? 0.148   13.654  12.874  1.00 0.00 ? 128 TYR A HD2  1  
ATOM 1936  H HE1  . TYR A 1 129 ? -2.042  18.006  12.210  1.00 0.00 ? 128 TYR A HE1  1  
ATOM 1937  H HE2  . TYR A 1 129 ? -0.372  15.065  14.805  1.00 0.00 ? 128 TYR A HE2  1  
ATOM 1938  H HH   . TYR A 1 129 ? -1.419  16.943  15.522  1.00 0.00 ? 128 TYR A HH   1  
ATOM 1939  N N    . GLU A 1 130 ? 2.722   14.877  11.013  1.00 0.00 ? 129 GLU A N    1  
ATOM 1940  C CA   . GLU A 1 130 ? 3.971   14.592  11.707  1.00 0.00 ? 129 GLU A CA   1  
ATOM 1941  C C    . GLU A 1 130 ? 3.741   13.924  13.062  1.00 0.00 ? 129 GLU A C    1  
ATOM 1942  O O    . GLU A 1 130 ? 2.658   13.413  13.355  1.00 0.00 ? 129 GLU A O    1  
ATOM 1943  C CB   . GLU A 1 130 ? 4.796   15.900  11.876  1.00 0.00 ? 129 GLU A CB   1  
ATOM 1944  C CG   . GLU A 1 130 ? 4.075   17.032  12.642  1.00 0.00 ? 129 GLU A CG   1  
ATOM 1945  C CD   . GLU A 1 130 ? 4.923   18.308  12.695  1.00 0.00 ? 129 GLU A CD   1  
ATOM 1946  O OE1  . GLU A 1 130 ? 6.060   18.312  12.153  1.00 0.00 ? 129 GLU A OE1  1  
ATOM 1947  O OE2  . GLU A 1 130 ? 4.428   19.305  13.286  1.00 0.00 ? 129 GLU A OE2  1  
ATOM 1948  H H    . GLU A 1 130 ? 2.227   15.668  11.361  1.00 0.00 ? 129 GLU A H    1  
ATOM 1949  H HA   . GLU A 1 130 ? 4.573   13.904  11.124  1.00 0.00 ? 129 GLU A HA   1  
ATOM 1950  H HB2  . GLU A 1 130 ? 5.772   15.682  12.363  1.00 0.00 ? 129 GLU A HB2  1  
ATOM 1951  H HB3  . GLU A 1 130 ? 5.024   16.275  10.851  1.00 0.00 ? 129 GLU A HB3  1  
ATOM 1952  H HG2  . GLU A 1 130 ? 3.112   17.270  12.141  1.00 0.00 ? 129 GLU A HG2  1  
ATOM 1953  H HG3  . GLU A 1 130 ? 3.859   16.713  13.684  1.00 0.00 ? 129 GLU A HG3  1  
ATOM 1954  N N    . ASN A 1 8   ? -16.901 10.215  -3.619  1.00 0.00 ? 7   ASN A N    2  
ATOM 1955  C CA   . ASN A 1 8   ? -16.168 9.342   -4.505  1.00 0.00 ? 7   ASN A CA   2  
ATOM 1956  C C    . ASN A 1 8   ? -14.821 9.965   -4.781  1.00 0.00 ? 7   ASN A C    2  
ATOM 1957  O O    . ASN A 1 8   ? -14.006 9.446   -5.540  1.00 0.00 ? 7   ASN A O    2  
ATOM 1958  C CB   . ASN A 1 8   ? -16.920 9.104   -5.845  1.00 0.00 ? 7   ASN A CB   2  
ATOM 1959  C CG   . ASN A 1 8   ? -18.256 8.418   -5.575  1.00 0.00 ? 7   ASN A CG   2  
ATOM 1960  O OD1  . ASN A 1 8   ? -18.493 7.864   -4.500  1.00 0.00 ? 7   ASN A OD1  2  
ATOM 1961  N ND2  . ASN A 1 8   ? -19.163 8.455   -6.581  1.00 0.00 ? 7   ASN A ND2  2  
ATOM 1962  H H    . ASN A 1 8   ? -17.857 9.952   -3.459  1.00 0.00 ? 7   ASN A H    2  
ATOM 1963  H HA   . ASN A 1 8   ? -15.998 8.410   -3.983  1.00 0.00 ? 7   ASN A HA   2  
ATOM 1964  H HB2  . ASN A 1 8   ? -17.107 10.072  -6.357  1.00 0.00 ? 7   ASN A HB2  2  
ATOM 1965  H HB3  . ASN A 1 8   ? -16.330 8.441   -6.515  1.00 0.00 ? 7   ASN A HB3  2  
ATOM 1966  H HD21 . ASN A 1 8   ? -18.928 8.954   -7.421  1.00 0.00 ? 7   ASN A HD21 2  
ATOM 1967  H HD22 . ASN A 1 8   ? -20.033 7.978   -6.406  1.00 0.00 ? 7   ASN A HD22 2  
ATOM 1968  N N    . SER A 1 9   ? -14.546 11.135  -4.154  1.00 0.00 ? 8   SER A N    2  
ATOM 1969  C CA   . SER A 1 9   ? -13.335 11.951  -4.325  1.00 0.00 ? 8   SER A CA   2  
ATOM 1970  C C    . SER A 1 9   ? -12.145 11.463  -3.514  1.00 0.00 ? 8   SER A C    2  
ATOM 1971  O O    . SER A 1 9   ? -11.753 12.079  -2.528  1.00 0.00 ? 8   SER A O    2  
ATOM 1972  C CB   . SER A 1 9   ? -13.579 13.451  -4.009  1.00 0.00 ? 8   SER A CB   2  
ATOM 1973  O OG   . SER A 1 9   ? -14.559 13.985  -4.897  1.00 0.00 ? 8   SER A OG   2  
ATOM 1974  H H    . SER A 1 9   ? -15.254 11.466  -3.533  1.00 0.00 ? 8   SER A H    2  
ATOM 1975  H HA   . SER A 1 9   ? -13.038 11.905  -5.366  1.00 0.00 ? 8   SER A HA   2  
ATOM 1976  H HB2  . SER A 1 9   ? -13.923 13.586  -2.958  1.00 0.00 ? 8   SER A HB2  2  
ATOM 1977  H HB3  . SER A 1 9   ? -12.649 14.048  -4.146  1.00 0.00 ? 8   SER A HB3  2  
ATOM 1978  H HG   . SER A 1 9   ? -15.328 13.408  -4.860  1.00 0.00 ? 8   SER A HG   2  
ATOM 1979  N N    . PHE A 1 10  ? -11.579 10.308  -3.946  1.00 0.00 ? 9   PHE A N    2  
ATOM 1980  C CA   . PHE A 1 10  ? -10.429 9.580   -3.409  1.00 0.00 ? 9   PHE A CA   2  
ATOM 1981  C C    . PHE A 1 10  ? -10.659 8.747   -2.177  1.00 0.00 ? 9   PHE A C    2  
ATOM 1982  O O    . PHE A 1 10  ? -9.821  7.948   -1.797  1.00 0.00 ? 9   PHE A O    2  
ATOM 1983  C CB   . PHE A 1 10  ? -9.025  10.283  -3.537  1.00 0.00 ? 9   PHE A CB   2  
ATOM 1984  C CG   . PHE A 1 10  ? -8.558  11.095  -2.345  1.00 0.00 ? 9   PHE A CG   2  
ATOM 1985  C CD1  . PHE A 1 10  ? -7.909  10.469  -1.291  1.00 0.00 ? 9   PHE A CD1  2  
ATOM 1986  C CD2  . PHE A 1 10  ? -8.728  12.466  -2.296  1.00 0.00 ? 9   PHE A CD2  2  
ATOM 1987  C CE1  . PHE A 1 10  ? -7.468  11.190  -0.202  1.00 0.00 ? 9   PHE A CE1  2  
ATOM 1988  C CE2  . PHE A 1 10  ? -8.290  13.195  -1.207  1.00 0.00 ? 9   PHE A CE2  2  
ATOM 1989  C CZ   . PHE A 1 10  ? -7.666  12.556  -0.156  1.00 0.00 ? 9   PHE A CZ   2  
ATOM 1990  H H    . PHE A 1 10  ? -12.012 9.876   -4.743  1.00 0.00 ? 9   PHE A H    2  
ATOM 1991  H HA   . PHE A 1 10  ? -10.326 8.742   -4.078  1.00 0.00 ? 9   PHE A HA   2  
ATOM 1992  H HB2  . PHE A 1 10  ? -8.257  9.498   -3.709  1.00 0.00 ? 9   PHE A HB2  2  
ATOM 1993  H HB3  . PHE A 1 10  ? -9.029  10.948  -4.430  1.00 0.00 ? 9   PHE A HB3  2  
ATOM 1994  H HD1  . PHE A 1 10  ? -7.759  9.393   -1.323  1.00 0.00 ? 9   PHE A HD1  2  
ATOM 1995  H HD2  . PHE A 1 10  ? -9.221  12.973  -3.115  1.00 0.00 ? 9   PHE A HD2  2  
ATOM 1996  H HE1  . PHE A 1 10  ? -6.967  10.684  0.611   1.00 0.00 ? 9   PHE A HE1  2  
ATOM 1997  H HE2  . PHE A 1 10  ? -8.444  14.265  -1.180  1.00 0.00 ? 9   PHE A HE2  2  
ATOM 1998  H HZ   . PHE A 1 10  ? -7.332  13.126  0.701   1.00 0.00 ? 9   PHE A HZ   2  
ATOM 1999  N N    . VAL A 1 11  ? -11.822 8.825   -1.510  1.00 0.00 ? 10  VAL A N    2  
ATOM 2000  C CA   . VAL A 1 11  ? -12.167 8.040   -0.314  1.00 0.00 ? 10  VAL A CA   2  
ATOM 2001  C C    . VAL A 1 11  ? -12.350 6.518   -0.451  1.00 0.00 ? 10  VAL A C    2  
ATOM 2002  O O    . VAL A 1 11  ? -12.650 5.834   0.517   1.00 0.00 ? 10  VAL A O    2  
ATOM 2003  C CB   . VAL A 1 11  ? -13.268 8.698   0.486   1.00 0.00 ? 10  VAL A CB   2  
ATOM 2004  C CG1  . VAL A 1 11  ? -12.985 10.203  0.428   1.00 0.00 ? 10  VAL A CG1  2  
ATOM 2005  C CG2  . VAL A 1 11  ? -14.673 8.424   -0.068  1.00 0.00 ? 10  VAL A CG2  2  
ATOM 2006  H H    . VAL A 1 11  ? -12.478 9.536   -1.787  1.00 0.00 ? 10  VAL A H    2  
ATOM 2007  H HA   . VAL A 1 11  ? -11.311 8.128   0.344   1.00 0.00 ? 10  VAL A HA   2  
ATOM 2008  H HB   . VAL A 1 11  ? -13.205 8.350   1.540   1.00 0.00 ? 10  VAL A HB   2  
ATOM 2009  H HG11 . VAL A 1 11  ? -11.899 10.385  0.572   1.00 0.00 ? 10  VAL A HG11 2  
ATOM 2010  H HG12 . VAL A 1 11  ? -13.578 10.758  1.178   1.00 0.00 ? 10  VAL A HG12 2  
ATOM 2011  H HG13 . VAL A 1 11  ? -13.274 10.580  -0.575  1.00 0.00 ? 10  VAL A HG13 2  
ATOM 2012  H HG21 . VAL A 1 11  ? -15.392 9.067   0.488   1.00 0.00 ? 10  VAL A HG21 2  
ATOM 2013  H HG22 . VAL A 1 11  ? -14.962 7.363   0.097   1.00 0.00 ? 10  VAL A HG22 2  
ATOM 2014  H HG23 . VAL A 1 11  ? -14.705 8.656   -1.155  1.00 0.00 ? 10  VAL A HG23 2  
ATOM 2015  N N    . GLY A 1 12  ? -12.064 5.977   -1.658  1.00 0.00 ? 11  GLY A N    2  
ATOM 2016  C CA   . GLY A 1 12  ? -11.957 4.571   -2.036  1.00 0.00 ? 11  GLY A CA   2  
ATOM 2017  C C    . GLY A 1 12  ? -10.583 4.241   -2.603  1.00 0.00 ? 11  GLY A C    2  
ATOM 2018  O O    . GLY A 1 12  ? -10.445 3.286   -3.363  1.00 0.00 ? 11  GLY A O    2  
ATOM 2019  H H    . GLY A 1 12  ? -11.823 6.646   -2.350  1.00 0.00 ? 11  GLY A H    2  
ATOM 2020  H HA2  . GLY A 1 12  ? -12.081 3.940   -1.145  1.00 0.00 ? 11  GLY A HA2  2  
ATOM 2021  H HA3  . GLY A 1 12  ? -12.672 4.421   -2.854  1.00 0.00 ? 11  GLY A HA3  2  
ATOM 2022  N N    . LEU A 1 13  ? -9.522  5.028   -2.231  1.00 0.00 ? 12  LEU A N    2  
ATOM 2023  C CA   . LEU A 1 13  ? -8.089  4.903   -2.567  1.00 0.00 ? 12  LEU A CA   2  
ATOM 2024  C C    . LEU A 1 13  ? -7.328  3.734   -1.985  1.00 0.00 ? 12  LEU A C    2  
ATOM 2025  O O    . LEU A 1 13  ? -7.794  2.958   -1.144  1.00 0.00 ? 12  LEU A O    2  
ATOM 2026  C CB   . LEU A 1 13  ? -7.258  6.221   -2.731  1.00 0.00 ? 12  LEU A CB   2  
ATOM 2027  C CG   . LEU A 1 13  ? -6.096  6.711   -1.858  1.00 0.00 ? 12  LEU A CG   2  
ATOM 2028  C CD1  . LEU A 1 13  ? -5.779  8.094   -2.474  1.00 0.00 ? 12  LEU A CD1  2  
ATOM 2029  C CD2  . LEU A 1 13  ? -6.666  6.752   -0.430  1.00 0.00 ? 12  LEU A CD2  2  
ATOM 2030  H H    . LEU A 1 13  ? -9.715  5.801   -1.628  1.00 0.00 ? 12  LEU A H    2  
ATOM 2031  H HA   . LEU A 1 13  ? -8.137  4.606   -3.608  1.00 0.00 ? 12  LEU A HA   2  
ATOM 2032  H HB2  . LEU A 1 13  ? -6.991  6.350   -3.802  1.00 0.00 ? 12  LEU A HB2  2  
ATOM 2033  H HB3  . LEU A 1 13  ? -7.926  7.044   -2.421  1.00 0.00 ? 12  LEU A HB3  2  
ATOM 2034  H HG   . LEU A 1 13  ? -5.117  6.154   -1.886  1.00 0.00 ? 12  LEU A HG   2  
ATOM 2035  H HD11 . LEU A 1 13  ? -4.812  8.053   -3.019  1.00 0.00 ? 12  LEU A HD11 2  
ATOM 2036  H HD12 . LEU A 1 13  ? -5.704  8.874   -1.690  1.00 0.00 ? 12  LEU A HD12 2  
ATOM 2037  H HD13 . LEU A 1 13  ? -6.551  8.424   -3.196  1.00 0.00 ? 12  LEU A HD13 2  
ATOM 2038  H HD21 . LEU A 1 13  ? -7.659  7.248   -0.426  1.00 0.00 ? 12  LEU A HD21 2  
ATOM 2039  H HD22 . LEU A 1 13  ? -6.069  7.292   0.305   1.00 0.00 ? 12  LEU A HD22 2  
ATOM 2040  H HD23 . LEU A 1 13  ? -6.771  5.722   -0.038  1.00 0.00 ? 12  LEU A HD23 2  
ATOM 2041  N N    . ARG A 1 14  ? -6.112  3.563   -2.538  1.00 0.00 ? 13  ARG A N    2  
ATOM 2042  C CA   . ARG A 1 14  ? -5.216  2.431   -2.422  1.00 0.00 ? 13  ARG A CA   2  
ATOM 2043  C C    . ARG A 1 14  ? -4.301  2.714   -1.262  1.00 0.00 ? 13  ARG A C    2  
ATOM 2044  O O    . ARG A 1 14  ? -3.668  3.765   -1.221  1.00 0.00 ? 13  ARG A O    2  
ATOM 2045  C CB   . ARG A 1 14  ? -4.439  2.241   -3.758  1.00 0.00 ? 13  ARG A CB   2  
ATOM 2046  C CG   . ARG A 1 14  ? -5.317  2.251   -5.037  1.00 0.00 ? 13  ARG A CG   2  
ATOM 2047  C CD   . ARG A 1 14  ? -5.718  3.611   -5.652  1.00 0.00 ? 13  ARG A CD   2  
ATOM 2048  N NE   . ARG A 1 14  ? -4.506  4.491   -5.801  1.00 0.00 ? 13  ARG A NE   2  
ATOM 2049  C CZ   . ARG A 1 14  ? -4.587  5.823   -6.115  1.00 0.00 ? 13  ARG A CZ   2  
ATOM 2050  N NH1  . ARG A 1 14  ? -5.791  6.409   -6.375  1.00 0.00 ? 13  ARG A NH1  2  
ATOM 2051  N NH2  . ARG A 1 14  ? -3.449  6.575   -6.163  1.00 0.00 ? 13  ARG A NH2  2  
ATOM 2052  H H    . ARG A 1 14  ? -5.734  4.335   -3.055  1.00 0.00 ? 13  ARG A H    2  
ATOM 2053  H HA   . ARG A 1 14  ? -5.798  1.540   -2.202  1.00 0.00 ? 13  ARG A HA   2  
ATOM 2054  H HB2  . ARG A 1 14  ? -3.644  3.009   -3.880  1.00 0.00 ? 13  ARG A HB2  2  
ATOM 2055  H HB3  . ARG A 1 14  ? -3.925  1.254   -3.721  1.00 0.00 ? 13  ARG A HB3  2  
ATOM 2056  H HG2  . ARG A 1 14  ? -4.759  1.717   -5.835  1.00 0.00 ? 13  ARG A HG2  2  
ATOM 2057  H HG3  . ARG A 1 14  ? -6.233  1.661   -4.831  1.00 0.00 ? 13  ARG A HG3  2  
ATOM 2058  H HD2  . ARG A 1 14  ? -6.161  3.444   -6.658  1.00 0.00 ? 13  ARG A HD2  2  
ATOM 2059  H HD3  . ARG A 1 14  ? -6.467  4.121   -5.013  1.00 0.00 ? 13  ARG A HD3  2  
ATOM 2060  H HE   . ARG A 1 14  ? -3.605  4.098   -5.615  1.00 0.00 ? 13  ARG A HE   2  
ATOM 2061  H HH11 . ARG A 1 14  ? -6.629  5.864   -6.339  1.00 0.00 ? 13  ARG A HH11 2  
ATOM 2062  H HH12 . ARG A 1 14  ? -5.836  7.382   -6.601  1.00 0.00 ? 13  ARG A HH12 2  
ATOM 2063  H HH21 . ARG A 1 14  ? -2.563  6.155   -5.970  1.00 0.00 ? 13  ARG A HH21 2  
ATOM 2064  H HH22 . ARG A 1 14  ? -3.502  7.548   -6.388  1.00 0.00 ? 13  ARG A HH22 2  
ATOM 2065  N N    . VAL A 1 15  ? -4.278  1.840   -0.228  1.00 0.00 ? 14  VAL A N    2  
ATOM 2066  C CA   . VAL A 1 15  ? -3.667  2.215   1.032   1.00 0.00 ? 14  VAL A CA   2  
ATOM 2067  C C    . VAL A 1 15  ? -2.607  1.224   1.504   1.00 0.00 ? 14  VAL A C    2  
ATOM 2068  O O    . VAL A 1 15  ? -2.589  0.046   1.155   1.00 0.00 ? 14  VAL A O    2  
ATOM 2069  C CB   . VAL A 1 15  ? -4.842  2.477   1.998   1.00 0.00 ? 14  VAL A CB   2  
ATOM 2070  C CG1  . VAL A 1 15  ? -4.508  2.472   3.491   1.00 0.00 ? 14  VAL A CG1  2  
ATOM 2071  C CG2  . VAL A 1 15  ? -5.591  3.771   1.621   1.00 0.00 ? 14  VAL A CG2  2  
ATOM 2072  H H    . VAL A 1 15  ? -4.775  0.967   -0.191  1.00 0.00 ? 14  VAL A H    2  
ATOM 2073  H HA   . VAL A 1 15  ? -3.110  3.136   0.929   1.00 0.00 ? 14  VAL A HA   2  
ATOM 2074  H HB   . VAL A 1 15  ? -5.588  1.683   1.832   1.00 0.00 ? 14  VAL A HB   2  
ATOM 2075  H HG11 . VAL A 1 15  ? -3.692  3.182   3.698   1.00 0.00 ? 14  VAL A HG11 2  
ATOM 2076  H HG12 . VAL A 1 15  ? -4.179  1.477   3.841   1.00 0.00 ? 14  VAL A HG12 2  
ATOM 2077  H HG13 . VAL A 1 15  ? -5.403  2.776   4.077   1.00 0.00 ? 14  VAL A HG13 2  
ATOM 2078  H HG21 . VAL A 1 15  ? -6.001  4.262   2.527   1.00 0.00 ? 14  VAL A HG21 2  
ATOM 2079  H HG22 . VAL A 1 15  ? -6.437  3.540   0.943   1.00 0.00 ? 14  VAL A HG22 2  
ATOM 2080  H HG23 . VAL A 1 15  ? -4.925  4.478   1.093   1.00 0.00 ? 14  VAL A HG23 2  
ATOM 2081  N N    . VAL A 1 16  ? -1.671  1.724   2.344   1.00 0.00 ? 15  VAL A N    2  
ATOM 2082  C CA   . VAL A 1 16  ? -0.540  1.070   2.992   1.00 0.00 ? 15  VAL A CA   2  
ATOM 2083  C C    . VAL A 1 16  ? -0.837  1.152   4.439   1.00 0.00 ? 15  VAL A C    2  
ATOM 2084  O O    . VAL A 1 16  ? -1.329  2.178   4.903   1.00 0.00 ? 15  VAL A O    2  
ATOM 2085  C CB   . VAL A 1 16  ? 0.792   1.733   2.687   1.00 0.00 ? 15  VAL A CB   2  
ATOM 2086  C CG1  . VAL A 1 16  ? 1.178   1.073   1.346   1.00 0.00 ? 15  VAL A CG1  2  
ATOM 2087  C CG2  . VAL A 1 16  ? 0.598   3.259   2.736   1.00 0.00 ? 15  VAL A CG2  2  
ATOM 2088  H H    . VAL A 1 16  ? -1.755  2.686   2.600   1.00 0.00 ? 15  VAL A H    2  
ATOM 2089  H HA   . VAL A 1 16  ? -0.510  0.020   2.727   1.00 0.00 ? 15  VAL A HA   2  
ATOM 2090  H HB   . VAL A 1 16  ? 1.636   1.556   3.407   1.00 0.00 ? 15  VAL A HB   2  
ATOM 2091  H HG11 . VAL A 1 16  ? 0.429   1.316   0.565   1.00 0.00 ? 15  VAL A HG11 2  
ATOM 2092  H HG12 . VAL A 1 16  ? 1.168   -0.046  1.489   1.00 0.00 ? 15  VAL A HG12 2  
ATOM 2093  H HG13 . VAL A 1 16  ? 2.189   1.382   1.012   1.00 0.00 ? 15  VAL A HG13 2  
ATOM 2094  H HG21 . VAL A 1 16  ? 1.501   3.763   2.397   1.00 0.00 ? 15  VAL A HG21 2  
ATOM 2095  H HG22 . VAL A 1 16  ? 0.396   3.624   3.767   1.00 0.00 ? 15  VAL A HG22 2  
ATOM 2096  H HG23 . VAL A 1 16  ? -0.210  3.615   2.077   1.00 0.00 ? 15  VAL A HG23 2  
ATOM 2097  N N    . ALA A 1 17  ? -0.586  0.021   5.134   1.00 0.00 ? 16  ALA A N    2  
ATOM 2098  C CA   . ALA A 1 17  ? -0.989  -0.239  6.481   1.00 0.00 ? 16  ALA A CA   2  
ATOM 2099  C C    . ALA A 1 17  ? 0.220   -0.545  7.322   1.00 0.00 ? 16  ALA A C    2  
ATOM 2100  O O    . ALA A 1 17  ? 0.828   -1.605  7.271   1.00 0.00 ? 16  ALA A O    2  
ATOM 2101  C CB   . ALA A 1 17  ? -1.991  -1.419  6.349   1.00 0.00 ? 16  ALA A CB   2  
ATOM 2102  H H    . ALA A 1 17  ? -0.143  -0.763  4.690   1.00 0.00 ? 16  ALA A H    2  
ATOM 2103  H HA   . ALA A 1 17  ? -1.453  0.621   6.933   1.00 0.00 ? 16  ALA A HA   2  
ATOM 2104  H HB1  . ALA A 1 17  ? -2.441  -1.712  7.315   1.00 0.00 ? 16  ALA A HB1  2  
ATOM 2105  H HB2  . ALA A 1 17  ? -1.533  -2.313  5.871   1.00 0.00 ? 16  ALA A HB2  2  
ATOM 2106  H HB3  . ALA A 1 17  ? -2.806  -1.137  5.642   1.00 0.00 ? 16  ALA A HB3  2  
ATOM 2107  N N    . LYS A 1 18  ? 0.585   0.424   8.170   1.00 0.00 ? 17  LYS A N    2  
ATOM 2108  C CA   . LYS A 1 18  ? 1.750   0.430   9.015   1.00 0.00 ? 17  LYS A CA   2  
ATOM 2109  C C    . LYS A 1 18  ? 1.362   0.950   10.394  1.00 0.00 ? 17  LYS A C    2  
ATOM 2110  O O    . LYS A 1 18  ? 0.888   2.062   10.515  1.00 0.00 ? 17  LYS A O    2  
ATOM 2111  C CB   . LYS A 1 18  ? 2.870   1.346   8.394   1.00 0.00 ? 17  LYS A CB   2  
ATOM 2112  C CG   . LYS A 1 18  ? 2.547   2.264   7.172   1.00 0.00 ? 17  LYS A CG   2  
ATOM 2113  C CD   . LYS A 1 18  ? 2.924   3.730   7.462   1.00 0.00 ? 17  LYS A CD   2  
ATOM 2114  C CE   . LYS A 1 18  ? 4.405   4.078   7.282   1.00 0.00 ? 17  LYS A CE   2  
ATOM 2115  N NZ   . LYS A 1 18  ? 4.679   5.486   7.656   1.00 0.00 ? 17  LYS A NZ   2  
ATOM 2116  H H    . LYS A 1 18  ? 0.086   1.301   8.183   1.00 0.00 ? 17  LYS A H    2  
ATOM 2117  H HA   . LYS A 1 18  ? 2.144   -0.571  9.152   1.00 0.00 ? 17  LYS A HA   2  
ATOM 2118  H HB2  . LYS A 1 18  ? 3.239   2.049   9.174   1.00 0.00 ? 17  LYS A HB2  2  
ATOM 2119  H HB3  . LYS A 1 18  ? 3.711   0.670   8.147   1.00 0.00 ? 17  LYS A HB3  2  
ATOM 2120  H HG2  . LYS A 1 18  ? 2.978   1.939   6.191   1.00 0.00 ? 17  LYS A HG2  2  
ATOM 2121  H HG3  . LYS A 1 18  ? 1.471   2.267   6.950   1.00 0.00 ? 17  LYS A HG3  2  
ATOM 2122  H HD2  . LYS A 1 18  ? 2.316   4.387   6.804   1.00 0.00 ? 17  LYS A HD2  2  
ATOM 2123  H HD3  . LYS A 1 18  ? 2.630   3.964   8.509   1.00 0.00 ? 17  LYS A HD3  2  
ATOM 2124  H HE2  . LYS A 1 18  ? 5.045   3.432   7.917   1.00 0.00 ? 17  LYS A HE2  2  
ATOM 2125  H HE3  . LYS A 1 18  ? 4.685   3.959   6.214   1.00 0.00 ? 17  LYS A HE3  2  
ATOM 2126  H HZ1  . LYS A 1 18  ? 5.689   5.693   7.513   1.00 0.00 ? 17  LYS A HZ1  2  
ATOM 2127  H HZ2  . LYS A 1 18  ? 4.433   5.634   8.655   1.00 0.00 ? 17  LYS A HZ2  2  
ATOM 2128  H HZ3  . LYS A 1 18  ? 4.107   6.119   7.061   1.00 0.00 ? 17  LYS A HZ3  2  
ATOM 2129  N N    . TRP A 1 19  ? 1.546   0.197   11.493  1.00 0.00 ? 18  TRP A N    2  
ATOM 2130  C CA   . TRP A 1 19  ? 1.354   0.674   12.863  1.00 0.00 ? 18  TRP A CA   2  
ATOM 2131  C C    . TRP A 1 19  ? 2.626   1.235   13.536  1.00 0.00 ? 18  TRP A C    2  
ATOM 2132  O O    . TRP A 1 19  ? 2.852   2.442   13.604  1.00 0.00 ? 18  TRP A O    2  
ATOM 2133  C CB   . TRP A 1 19  ? 0.544   -0.337  13.707  1.00 0.00 ? 18  TRP A CB   2  
ATOM 2134  C CG   . TRP A 1 19  ? -0.813  -0.645  13.099  1.00 0.00 ? 18  TRP A CG   2  
ATOM 2135  C CD1  . TRP A 1 19  ? -1.277  -1.683  12.334  1.00 0.00 ? 18  TRP A CD1  2  
ATOM 2136  C CD2  . TRP A 1 19  ? -1.928  0.209   13.347  1.00 0.00 ? 18  TRP A CD2  2  
ATOM 2137  N NE1  . TRP A 1 19  ? -2.636  -1.542  12.123  1.00 0.00 ? 18  TRP A NE1  2  
ATOM 2138  C CE2  . TRP A 1 19  ? -3.048  -0.395  12.773  1.00 0.00 ? 18  TRP A CE2  2  
ATOM 2139  C CE3  . TRP A 1 19  ? -2.006  1.389   14.025  1.00 0.00 ? 18  TRP A CE3  2  
ATOM 2140  C CZ2  . TRP A 1 19  ? -4.284  0.160   12.914  1.00 0.00 ? 18  TRP A CZ2  2  
ATOM 2141  C CZ3  . TRP A 1 19  ? -3.261  1.881   14.256  1.00 0.00 ? 18  TRP A CZ3  2  
ATOM 2142  C CH2  . TRP A 1 19  ? -4.380  1.275   13.719  1.00 0.00 ? 18  TRP A CH2  2  
ATOM 2143  H H    . TRP A 1 19  ? 1.907   -0.719  11.395  1.00 0.00 ? 18  TRP A H    2  
ATOM 2144  H HA   . TRP A 1 19  ? 0.704   1.545   12.839  1.00 0.00 ? 18  TRP A HA   2  
ATOM 2145  H HB2  . TRP A 1 19  ? 1.057   -1.296  13.828  1.00 0.00 ? 18  TRP A HB2  2  
ATOM 2146  H HB3  . TRP A 1 19  ? 0.362   0.085   14.722  1.00 0.00 ? 18  TRP A HB3  2  
ATOM 2147  H HD1  . TRP A 1 19  ? -0.662  -2.490  11.962  1.00 0.00 ? 18  TRP A HD1  2  
ATOM 2148  H HE1  . TRP A 1 19  ? -3.222  -2.139  11.617  1.00 0.00 ? 18  TRP A HE1  2  
ATOM 2149  H HE3  . TRP A 1 19  ? -1.141  1.931   14.396  1.00 0.00 ? 18  TRP A HE3  2  
ATOM 2150  H HZ2  . TRP A 1 19  ? -5.168  -0.283  12.482  1.00 0.00 ? 18  TRP A HZ2  2  
ATOM 2151  H HZ3  . TRP A 1 19  ? -3.340  2.750   14.884  1.00 0.00 ? 18  TRP A HZ3  2  
ATOM 2152  H HH2  . TRP A 1 19  ? -5.351  1.701   13.919  1.00 0.00 ? 18  TRP A HH2  2  
ATOM 2153  N N    . SER A 1 20  ? 3.499   0.352   14.081  1.00 0.00 ? 19  SER A N    2  
ATOM 2154  C CA   . SER A 1 20  ? 4.717   0.697   14.810  1.00 0.00 ? 19  SER A CA   2  
ATOM 2155  C C    . SER A 1 20  ? 5.909   0.361   13.930  1.00 0.00 ? 19  SER A C    2  
ATOM 2156  O O    . SER A 1 20  ? 5.817   -0.530  13.082  1.00 0.00 ? 19  SER A O    2  
ATOM 2157  C CB   . SER A 1 20  ? 4.788   -0.056  16.172  1.00 0.00 ? 19  SER A CB   2  
ATOM 2158  O OG   . SER A 1 20  ? 3.611   0.191   16.947  1.00 0.00 ? 19  SER A OG   2  
ATOM 2159  H H    . SER A 1 20  ? 3.335   -0.629  14.019  1.00 0.00 ? 19  SER A H    2  
ATOM 2160  H HA   . SER A 1 20  ? 4.755   1.761   15.010  1.00 0.00 ? 19  SER A HA   2  
ATOM 2161  H HB2  . SER A 1 20  ? 4.860   -1.157  16.014  1.00 0.00 ? 19  SER A HB2  2  
ATOM 2162  H HB3  . SER A 1 20  ? 5.677   0.270   16.757  1.00 0.00 ? 19  SER A HB3  2  
ATOM 2163  H HG   . SER A 1 20  ? 3.492   1.146   16.977  1.00 0.00 ? 19  SER A HG   2  
ATOM 2164  N N    . SER A 1 21  ? 7.076   1.070   14.062  1.00 0.00 ? 20  SER A N    2  
ATOM 2165  C CA   . SER A 1 21  ? 8.236   0.857   13.169  1.00 0.00 ? 20  SER A CA   2  
ATOM 2166  C C    . SER A 1 21  ? 8.901   -0.523  13.264  1.00 0.00 ? 20  SER A C    2  
ATOM 2167  O O    . SER A 1 21  ? 9.531   -0.894  14.247  1.00 0.00 ? 20  SER A O    2  
ATOM 2168  C CB   . SER A 1 21  ? 9.309   1.956   13.369  1.00 0.00 ? 20  SER A CB   2  
ATOM 2169  O OG   . SER A 1 21  ? 8.696   3.227   13.161  1.00 0.00 ? 20  SER A OG   2  
ATOM 2170  H H    . SER A 1 21  ? 7.185   1.816   14.716  1.00 0.00 ? 20  SER A H    2  
ATOM 2171  H HA   . SER A 1 21  ? 7.882   0.974   12.153  1.00 0.00 ? 20  SER A HA   2  
ATOM 2172  H HB2  . SER A 1 21  ? 9.726   1.912   14.400  1.00 0.00 ? 20  SER A HB2  2  
ATOM 2173  H HB3  . SER A 1 21  ? 10.140  1.843   12.634  1.00 0.00 ? 20  SER A HB3  2  
ATOM 2174  H HG   . SER A 1 21  ? 9.371   3.910   13.230  1.00 0.00 ? 20  SER A HG   2  
ATOM 2175  N N    . ASN A 1 22  ? 8.676   -1.296  12.174  1.00 0.00 ? 21  ASN A N    2  
ATOM 2176  C CA   . ASN A 1 22  ? 8.936   -2.717  12.006  1.00 0.00 ? 21  ASN A CA   2  
ATOM 2177  C C    . ASN A 1 22  ? 9.829   -2.998  10.835  1.00 0.00 ? 21  ASN A C    2  
ATOM 2178  O O    . ASN A 1 22  ? 10.265  -4.117  10.586  1.00 0.00 ? 21  ASN A O    2  
ATOM 2179  C CB   . ASN A 1 22  ? 7.490   -3.307  11.774  1.00 0.00 ? 21  ASN A CB   2  
ATOM 2180  C CG   . ASN A 1 22  ? 7.287   -4.794  11.424  1.00 0.00 ? 21  ASN A CG   2  
ATOM 2181  O OD1  . ASN A 1 22  ? 6.655   -5.100  10.405  1.00 0.00 ? 21  ASN A OD1  2  
ATOM 2182  N ND2  . ASN A 1 22  ? 7.775   -5.718  12.284  1.00 0.00 ? 21  ASN A ND2  2  
ATOM 2183  H H    . ASN A 1 22  ? 8.090   -0.907  11.471  1.00 0.00 ? 21  ASN A H    2  
ATOM 2184  H HA   . ASN A 1 22  ? 9.496   -3.071  12.847  1.00 0.00 ? 21  ASN A HA   2  
ATOM 2185  H HB2  . ASN A 1 22  ? 6.883   -3.085  12.675  1.00 0.00 ? 21  ASN A HB2  2  
ATOM 2186  H HB3  . ASN A 1 22  ? 7.023   -2.728  10.939  1.00 0.00 ? 21  ASN A HB3  2  
ATOM 2187  H HD21 . ASN A 1 22  ? 8.251   -5.425  13.115  1.00 0.00 ? 21  ASN A HD21 2  
ATOM 2188  H HD22 . ASN A 1 22  ? 7.656   -6.683  12.036  1.00 0.00 ? 21  ASN A HD22 2  
ATOM 2189  N N    . GLY A 1 23  ? 10.039  -1.940  10.050  1.00 0.00 ? 22  GLY A N    2  
ATOM 2190  C CA   . GLY A 1 23  ? 10.719  -1.914  8.785   1.00 0.00 ? 22  GLY A CA   2  
ATOM 2191  C C    . GLY A 1 23  ? 9.811   -2.008  7.601   1.00 0.00 ? 22  GLY A C    2  
ATOM 2192  O O    . GLY A 1 23  ? 10.242  -1.607  6.533   1.00 0.00 ? 22  GLY A O    2  
ATOM 2193  H H    . GLY A 1 23  ? 9.664   -1.076  10.367  1.00 0.00 ? 22  GLY A H    2  
ATOM 2194  H HA2  . GLY A 1 23  ? 11.269  -1.010  8.720   1.00 0.00 ? 22  GLY A HA2  2  
ATOM 2195  H HA3  . GLY A 1 23  ? 11.383  -2.768  8.708   1.00 0.00 ? 22  GLY A HA3  2  
ATOM 2196  N N    . TYR A 1 24  ? 8.547   -2.494  7.715   1.00 0.00 ? 23  TYR A N    2  
ATOM 2197  C CA   . TYR A 1 24  ? 7.580   -2.539  6.616   1.00 0.00 ? 23  TYR A CA   2  
ATOM 2198  C C    . TYR A 1 24  ? 6.143   -2.156  6.878   1.00 0.00 ? 23  TYR A C    2  
ATOM 2199  O O    . TYR A 1 24  ? 5.653   -2.126  8.009   1.00 0.00 ? 23  TYR A O    2  
ATOM 2200  C CB   . TYR A 1 24  ? 7.757   -3.716  5.628   1.00 0.00 ? 23  TYR A CB   2  
ATOM 2201  C CG   . TYR A 1 24  ? 8.007   -5.036  6.286   1.00 0.00 ? 23  TYR A CG   2  
ATOM 2202  C CD1  . TYR A 1 24  ? 9.241   -5.369  6.815   1.00 0.00 ? 23  TYR A CD1  2  
ATOM 2203  C CD2  . TYR A 1 24  ? 6.995   -5.972  6.309   1.00 0.00 ? 23  TYR A CD2  2  
ATOM 2204  C CE1  . TYR A 1 24  ? 9.442   -6.590  7.416   1.00 0.00 ? 23  TYR A CE1  2  
ATOM 2205  C CE2  . TYR A 1 24  ? 7.222   -7.227  6.838   1.00 0.00 ? 23  TYR A CE2  2  
ATOM 2206  C CZ   . TYR A 1 24  ? 8.433   -7.527  7.422   1.00 0.00 ? 23  TYR A CZ   2  
ATOM 2207  O OH   . TYR A 1 24  ? 8.675   -8.789  7.992   1.00 0.00 ? 23  TYR A OH   2  
ATOM 2208  H H    . TYR A 1 24  ? 8.213   -2.824  8.593   1.00 0.00 ? 23  TYR A H    2  
ATOM 2209  H HA   . TYR A 1 24  ? 7.835   -1.698  5.977   1.00 0.00 ? 23  TYR A HA   2  
ATOM 2210  H HB2  . TYR A 1 24  ? 6.901   -3.850  4.929   1.00 0.00 ? 23  TYR A HB2  2  
ATOM 2211  H HB3  . TYR A 1 24  ? 8.629   -3.404  5.005   1.00 0.00 ? 23  TYR A HB3  2  
ATOM 2212  H HD1  . TYR A 1 24  ? 10.066  -4.675  6.760   1.00 0.00 ? 23  TYR A HD1  2  
ATOM 2213  H HD2  . TYR A 1 24  ? 6.026   -5.737  5.884   1.00 0.00 ? 23  TYR A HD2  2  
ATOM 2214  H HE1  . TYR A 1 24  ? 10.411  -6.812  7.834   1.00 0.00 ? 23  TYR A HE1  2  
ATOM 2215  H HE2  . TYR A 1 24  ? 6.430   -7.959  6.801   1.00 0.00 ? 23  TYR A HE2  2  
ATOM 2216  H HH   . TYR A 1 24  ? 8.397   -9.480  7.354   1.00 0.00 ? 23  TYR A HH   2  
ATOM 2217  N N    . PHE A 1 25  ? 5.412   -1.901  5.747   1.00 0.00 ? 24  PHE A N    2  
ATOM 2218  C CA   . PHE A 1 25  ? 3.990   -1.623  5.659   1.00 0.00 ? 24  PHE A CA   2  
ATOM 2219  C C    . PHE A 1 25  ? 3.406   -2.772  4.883   1.00 0.00 ? 24  PHE A C    2  
ATOM 2220  O O    . PHE A 1 25  ? 3.964   -3.233  3.889   1.00 0.00 ? 24  PHE A O    2  
ATOM 2221  C CB   . PHE A 1 25  ? 3.497   -0.288  4.970   1.00 0.00 ? 24  PHE A CB   2  
ATOM 2222  C CG   . PHE A 1 25  ? 4.522   0.816   4.840   1.00 0.00 ? 24  PHE A CG   2  
ATOM 2223  C CD1  . PHE A 1 25  ? 5.382   1.020   5.899   1.00 0.00 ? 24  PHE A CD1  2  
ATOM 2224  C CD2  . PHE A 1 25  ? 4.553   1.769   3.814   1.00 0.00 ? 24  PHE A CD2  2  
ATOM 2225  C CE1  . PHE A 1 25  ? 6.416   1.898   5.840   1.00 0.00 ? 24  PHE A CE1  2  
ATOM 2226  C CE2  . PHE A 1 25  ? 5.569   2.691   3.795   1.00 0.00 ? 24  PHE A CE2  2  
ATOM 2227  C CZ   . PHE A 1 25  ? 6.559   2.692   4.750   1.00 0.00 ? 24  PHE A CZ   2  
ATOM 2228  H H    . PHE A 1 25  ? 5.848   -1.952  4.833   1.00 0.00 ? 24  PHE A H    2  
ATOM 2229  H HA   . PHE A 1 25  ? 3.551   -1.645  6.649   1.00 0.00 ? 24  PHE A HA   2  
ATOM 2230  H HB2  . PHE A 1 25  ? 3.044   -0.443  3.976   1.00 0.00 ? 24  PHE A HB2  2  
ATOM 2231  H HB3  . PHE A 1 25  ? 2.662   0.094   5.590   1.00 0.00 ? 24  PHE A HB3  2  
ATOM 2232  H HD1  . PHE A 1 25  ? 5.278   0.456   6.805   1.00 0.00 ? 24  PHE A HD1  2  
ATOM 2233  H HD2  . PHE A 1 25  ? 3.907   1.802   2.922   1.00 0.00 ? 24  PHE A HD2  2  
ATOM 2234  H HE1  . PHE A 1 25  ? 7.073   2.013   6.674   1.00 0.00 ? 24  PHE A HE1  2  
ATOM 2235  H HE2  . PHE A 1 25  ? 5.578   3.390   2.978   1.00 0.00 ? 24  PHE A HE2  2  
ATOM 2236  H HZ   . PHE A 1 25  ? 7.450   3.283   4.695   1.00 0.00 ? 24  PHE A HZ   2  
ATOM 2237  N N    . TYR A 1 26  ? 2.218   -3.161  5.352   1.00 0.00 ? 25  TYR A N    2  
ATOM 2238  C CA   . TYR A 1 26  ? 1.255   -4.126  4.923   1.00 0.00 ? 25  TYR A CA   2  
ATOM 2239  C C    . TYR A 1 26  ? 0.269   -3.333  4.065   1.00 0.00 ? 25  TYR A C    2  
ATOM 2240  O O    . TYR A 1 26  ? 0.480   -2.173  3.734   1.00 0.00 ? 25  TYR A O    2  
ATOM 2241  C CB   . TYR A 1 26  ? 0.633   -4.823  6.182   1.00 0.00 ? 25  TYR A CB   2  
ATOM 2242  C CG   . TYR A 1 26  ? 1.759   -5.390  7.046   1.00 0.00 ? 25  TYR A CG   2  
ATOM 2243  C CD1  . TYR A 1 26  ? 2.383   -4.621  8.023   1.00 0.00 ? 25  TYR A CD1  2  
ATOM 2244  C CD2  . TYR A 1 26  ? 2.251   -6.667  6.829   1.00 0.00 ? 25  TYR A CD2  2  
ATOM 2245  C CE1  . TYR A 1 26  ? 3.520   -5.066  8.676   1.00 0.00 ? 25  TYR A CE1  2  
ATOM 2246  C CE2  . TYR A 1 26  ? 3.359   -7.134  7.516   1.00 0.00 ? 25  TYR A CE2  2  
ATOM 2247  C CZ   . TYR A 1 26  ? 4.020   -6.323  8.415   1.00 0.00 ? 25  TYR A CZ   2  
ATOM 2248  O OH   . TYR A 1 26  ? 5.195   -6.792  9.048   1.00 0.00 ? 25  TYR A OH   2  
ATOM 2249  H H    . TYR A 1 26  ? 1.864   -2.659  6.148   1.00 0.00 ? 25  TYR A H    2  
ATOM 2250  H HA   . TYR A 1 26  ? 1.733   -4.845  4.267   1.00 0.00 ? 25  TYR A HA   2  
ATOM 2251  H HB2  . TYR A 1 26  ? 0.064   -4.094  6.802   1.00 0.00 ? 25  TYR A HB2  2  
ATOM 2252  H HB3  . TYR A 1 26  ? -0.040  -5.658  5.890   1.00 0.00 ? 25  TYR A HB3  2  
ATOM 2253  H HD1  . TYR A 1 26  ? 2.028   -3.621  8.230   1.00 0.00 ? 25  TYR A HD1  2  
ATOM 2254  H HD2  . TYR A 1 26  ? 1.781   -7.309  6.097   1.00 0.00 ? 25  TYR A HD2  2  
ATOM 2255  H HE1  . TYR A 1 26  ? 4.021   -4.417  9.381   1.00 0.00 ? 25  TYR A HE1  2  
ATOM 2256  H HE2  . TYR A 1 26  ? 3.734   -8.130  7.330   1.00 0.00 ? 25  TYR A HE2  2  
ATOM 2257  H HH   . TYR A 1 26  ? 5.672   -6.037  9.464   1.00 0.00 ? 25  TYR A HH   2  
ATOM 2258  N N    . SER A 1 27  ? -0.806  -3.951  3.597   1.00 0.00 ? 26  SER A N    2  
ATOM 2259  C CA   . SER A 1 27  ? -1.841  -3.405  2.749   1.00 0.00 ? 26  SER A CA   2  
ATOM 2260  C C    . SER A 1 27  ? -3.203  -3.080  3.404   1.00 0.00 ? 26  SER A C    2  
ATOM 2261  O O    . SER A 1 27  ? -3.686  -3.837  4.243   1.00 0.00 ? 26  SER A O    2  
ATOM 2262  C CB   . SER A 1 27  ? -2.047  -4.477  1.682   1.00 0.00 ? 26  SER A CB   2  
ATOM 2263  O OG   . SER A 1 27  ? -2.492  -5.731  2.221   1.00 0.00 ? 26  SER A OG   2  
ATOM 2264  H H    . SER A 1 27  ? -0.931  -4.899  3.796   1.00 0.00 ? 26  SER A H    2  
ATOM 2265  H HA   . SER A 1 27  ? -1.496  -2.502  2.260   1.00 0.00 ? 26  SER A HA   2  
ATOM 2266  H HB2  . SER A 1 27  ? -2.801  -4.064  0.997   1.00 0.00 ? 26  SER A HB2  2  
ATOM 2267  H HB3  . SER A 1 27  ? -1.050  -4.633  1.175   1.00 0.00 ? 26  SER A HB3  2  
ATOM 2268  H HG   . SER A 1 27  ? -3.196  -5.561  2.868   1.00 0.00 ? 26  SER A HG   2  
ATOM 2269  N N    . GLY A 1 28  ? -3.832  -1.944  2.997   1.00 0.00 ? 27  GLY A N    2  
ATOM 2270  C CA   . GLY A 1 28  ? -5.068  -1.344  3.515   1.00 0.00 ? 27  GLY A CA   2  
ATOM 2271  C C    . GLY A 1 28  ? -5.954  -0.813  2.398   1.00 0.00 ? 27  GLY A C    2  
ATOM 2272  O O    . GLY A 1 28  ? -5.452  -0.672  1.284   1.00 0.00 ? 27  GLY A O    2  
ATOM 2273  H H    . GLY A 1 28  ? -3.413  -1.374  2.274   1.00 0.00 ? 27  GLY A H    2  
ATOM 2274  H HA2  . GLY A 1 28  ? -5.608  -2.097  4.062   1.00 0.00 ? 27  GLY A HA2  2  
ATOM 2275  H HA3  . GLY A 1 28  ? -4.786  -0.505  4.133   1.00 0.00 ? 27  GLY A HA3  2  
ATOM 2276  N N    . LYS A 1 29  ? -7.276  -0.469  2.613   1.00 0.00 ? 28  LYS A N    2  
ATOM 2277  C CA   . LYS A 1 29  ? -8.017  0.336   1.622   1.00 0.00 ? 28  LYS A CA   2  
ATOM 2278  C C    . LYS A 1 29  ? -8.610  1.488   2.436   1.00 0.00 ? 28  LYS A C    2  
ATOM 2279  O O    . LYS A 1 29  ? -8.642  1.403   3.664   1.00 0.00 ? 28  LYS A O    2  
ATOM 2280  C CB   . LYS A 1 29  ? -9.175  -0.380  0.874   1.00 0.00 ? 28  LYS A CB   2  
ATOM 2281  C CG   . LYS A 1 29  ? -8.821  -1.720  0.220   1.00 0.00 ? 28  LYS A CG   2  
ATOM 2282  C CD   . LYS A 1 29  ? -10.014 -2.316  -0.551  1.00 0.00 ? 28  LYS A CD   2  
ATOM 2283  C CE   . LYS A 1 29  ? -11.212 -2.698  0.335   1.00 0.00 ? 28  LYS A CE   2  
ATOM 2284  N NZ   . LYS A 1 29  ? -12.254 -3.395  -0.456  1.00 0.00 ? 28  LYS A NZ   2  
ATOM 2285  H H    . LYS A 1 29  ? -7.814  -0.513  3.481   1.00 0.00 ? 28  LYS A H    2  
ATOM 2286  H HA   . LYS A 1 29  ? -7.360  0.770   0.876   1.00 0.00 ? 28  LYS A HA   2  
ATOM 2287  H HB2  . LYS A 1 29  ? -10.030 -0.568  1.563   1.00 0.00 ? 28  LYS A HB2  2  
ATOM 2288  H HB3  . LYS A 1 29  ? -9.523  0.294   0.053   1.00 0.00 ? 28  LYS A HB3  2  
ATOM 2289  H HG2  . LYS A 1 29  ? -7.966  -1.570  -0.475  1.00 0.00 ? 28  LYS A HG2  2  
ATOM 2290  H HG3  . LYS A 1 29  ? -8.497  -2.441  0.998   1.00 0.00 ? 28  LYS A HG3  2  
ATOM 2291  H HD2  . LYS A 1 29  ? -10.355 -1.585  -1.317  1.00 0.00 ? 28  LYS A HD2  2  
ATOM 2292  H HD3  . LYS A 1 29  ? -9.660  -3.223  -1.086  1.00 0.00 ? 28  LYS A HD3  2  
ATOM 2293  H HE2  . LYS A 1 29  ? -10.896 -3.381  1.150   1.00 0.00 ? 28  LYS A HE2  2  
ATOM 2294  H HE3  . LYS A 1 29  ? -11.681 -1.796  0.779   1.00 0.00 ? 28  LYS A HE3  2  
ATOM 2295  H HZ1  . LYS A 1 29  ? -13.052 -3.641  0.165   1.00 0.00 ? 28  LYS A HZ1  2  
ATOM 2296  H HZ2  . LYS A 1 29  ? -11.854 -4.262  -0.866  1.00 0.00 ? 28  LYS A HZ2  2  
ATOM 2297  H HZ3  . LYS A 1 29  ? -12.587 -2.772  -1.217  1.00 0.00 ? 28  LYS A HZ3  2  
ATOM 2298  N N    . ILE A 1 30  ? -9.136  2.585   1.820   1.00 0.00 ? 29  ILE A N    2  
ATOM 2299  C CA   . ILE A 1 30  ? -9.828  3.645   2.585   1.00 0.00 ? 29  ILE A CA   2  
ATOM 2300  C C    . ILE A 1 30  ? -11.346 3.518   2.395   1.00 0.00 ? 29  ILE A C    2  
ATOM 2301  O O    . ILE A 1 30  ? -11.811 3.016   1.375   1.00 0.00 ? 29  ILE A O    2  
ATOM 2302  C CB   . ILE A 1 30  ? -9.283  5.052   2.312   1.00 0.00 ? 29  ILE A CB   2  
ATOM 2303  C CG1  . ILE A 1 30  ? -9.940  6.196   3.127   1.00 0.00 ? 29  ILE A CG1  2  
ATOM 2304  C CG2  . ILE A 1 30  ? -9.327  5.293   0.810   1.00 0.00 ? 29  ILE A CG2  2  
ATOM 2305  C CD1  . ILE A 1 30  ? -9.312  7.565   2.890   1.00 0.00 ? 29  ILE A CD1  2  
ATOM 2306  H H    . ILE A 1 30  ? -9.124  2.725   0.819   1.00 0.00 ? 29  ILE A H    2  
ATOM 2307  H HA   . ILE A 1 30  ? -9.643  3.544   3.633   1.00 0.00 ? 29  ILE A HA   2  
ATOM 2308  H HB   . ILE A 1 30  ? -8.212  5.050   2.618   1.00 0.00 ? 29  ILE A HB   2  
ATOM 2309  H HG12 . ILE A 1 30  ? -11.018 6.285   2.866   1.00 0.00 ? 29  ILE A HG12 2  
ATOM 2310  H HG13 . ILE A 1 30  ? -9.868  5.958   4.211   1.00 0.00 ? 29  ILE A HG13 2  
ATOM 2311  H HG21 . ILE A 1 30  ? -10.287 4.960   0.381   1.00 0.00 ? 29  ILE A HG21 2  
ATOM 2312  H HG22 . ILE A 1 30  ? -8.532  4.701   0.327   1.00 0.00 ? 29  ILE A HG22 2  
ATOM 2313  H HG23 . ILE A 1 30  ? -9.186  6.357   0.550   1.00 0.00 ? 29  ILE A HG23 2  
ATOM 2314  H HD11 . ILE A 1 30  ? -8.217  7.534   3.060   1.00 0.00 ? 29  ILE A HD11 2  
ATOM 2315  H HD12 . ILE A 1 30  ? -9.756  8.316   3.574   1.00 0.00 ? 29  ILE A HD12 2  
ATOM 2316  H HD13 . ILE A 1 30  ? -9.494  7.917   1.855   1.00 0.00 ? 29  ILE A HD13 2  
ATOM 2317  N N    . THR A 1 31  ? -12.154 4.001   3.380   1.00 0.00 ? 30  THR A N    2  
ATOM 2318  C CA   . THR A 1 31  ? -13.620 4.042   3.345   1.00 0.00 ? 30  THR A CA   2  
ATOM 2319  C C    . THR A 1 31  ? -14.106 5.486   3.317   1.00 0.00 ? 30  THR A C    2  
ATOM 2320  O O    . THR A 1 31  ? -14.996 5.817   2.534   1.00 0.00 ? 30  THR A O    2  
ATOM 2321  C CB   . THR A 1 31  ? -14.282 3.251   4.480   1.00 0.00 ? 30  THR A CB   2  
ATOM 2322  O OG1  . THR A 1 31  ? -13.930 1.879   4.371   1.00 0.00 ? 30  THR A OG1  2  
ATOM 2323  C CG2  . THR A 1 31  ? -15.822 3.284   4.415   1.00 0.00 ? 30  THR A CG2  2  
ATOM 2324  H H    . THR A 1 31  ? -11.729 4.422   4.186   1.00 0.00 ? 30  THR A H    2  
ATOM 2325  H HA   . THR A 1 31  ? -13.974 3.612   2.415   1.00 0.00 ? 30  THR A HA   2  
ATOM 2326  H HB   . THR A 1 31  ? -13.946 3.623   5.475   1.00 0.00 ? 30  THR A HB   2  
ATOM 2327  H HG1  . THR A 1 31  ? -13.070 1.753   4.784   1.00 0.00 ? 30  THR A HG1  2  
ATOM 2328  H HG21 . THR A 1 31  ? -16.158 3.019   3.391   1.00 0.00 ? 30  THR A HG21 2  
ATOM 2329  H HG22 . THR A 1 31  ? -16.231 4.277   4.685   1.00 0.00 ? 30  THR A HG22 2  
ATOM 2330  H HG23 . THR A 1 31  ? -16.251 2.541   5.122   1.00 0.00 ? 30  THR A HG23 2  
ATOM 2331  N N    . ARG A 1 32  ? -13.543 6.403   4.161   1.00 0.00 ? 31  ARG A N    2  
ATOM 2332  C CA   . ARG A 1 32  ? -13.931 7.811   4.211   1.00 0.00 ? 31  ARG A CA   2  
ATOM 2333  C C    . ARG A 1 32  ? -12.678 8.545   4.654   1.00 0.00 ? 31  ARG A C    2  
ATOM 2334  O O    . ARG A 1 32  ? -11.797 7.947   5.255   1.00 0.00 ? 31  ARG A O    2  
ATOM 2335  C CB   . ARG A 1 32  ? -15.049 8.127   5.257   1.00 0.00 ? 31  ARG A CB   2  
ATOM 2336  C CG   . ARG A 1 32  ? -16.430 7.496   4.998   1.00 0.00 ? 31  ARG A CG   2  
ATOM 2337  C CD   . ARG A 1 32  ? -17.379 7.754   6.177   1.00 0.00 ? 31  ARG A CD   2  
ATOM 2338  N NE   . ARG A 1 32  ? -18.678 7.043   5.912   1.00 0.00 ? 31  ARG A NE   2  
ATOM 2339  C CZ   . ARG A 1 32  ? -19.651 6.883   6.862   1.00 0.00 ? 31  ARG A CZ   2  
ATOM 2340  N NH1  . ARG A 1 32  ? -19.481 7.361   8.129   1.00 0.00 ? 31  ARG A NH1  2  
ATOM 2341  N NH2  . ARG A 1 32  ? -20.808 6.235   6.535   1.00 0.00 ? 31  ARG A NH2  2  
ATOM 2342  H H    . ARG A 1 32  ? -12.784 6.189   4.816   1.00 0.00 ? 31  ARG A H    2  
ATOM 2343  H HA   . ARG A 1 32  ? -14.239 8.168   3.241   1.00 0.00 ? 31  ARG A HA   2  
ATOM 2344  H HB2  . ARG A 1 32  ? -14.728 7.786   6.267   1.00 0.00 ? 31  ARG A HB2  2  
ATOM 2345  H HB3  . ARG A 1 32  ? -15.224 9.228   5.316   1.00 0.00 ? 31  ARG A HB3  2  
ATOM 2346  H HG2  . ARG A 1 32  ? -16.866 7.902   4.058   1.00 0.00 ? 31  ARG A HG2  2  
ATOM 2347  H HG3  . ARG A 1 32  ? -16.314 6.399   4.878   1.00 0.00 ? 31  ARG A HG3  2  
ATOM 2348  H HD2  . ARG A 1 32  ? -16.917 7.362   7.113   1.00 0.00 ? 31  ARG A HD2  2  
ATOM 2349  H HD3  . ARG A 1 32  ? -17.574 8.843   6.288   1.00 0.00 ? 31  ARG A HD3  2  
ATOM 2350  H HE   . ARG A 1 32  ? -18.839 6.679   4.995   1.00 0.00 ? 31  ARG A HE   2  
ATOM 2351  H HH11 . ARG A 1 32  ? -18.635 7.836   8.373   1.00 0.00 ? 31  ARG A HH11 2  
ATOM 2352  H HH12 . ARG A 1 32  ? -20.200 7.237   8.812   1.00 0.00 ? 31  ARG A HH12 2  
ATOM 2353  H HH21 . ARG A 1 32  ? -20.940 5.885   5.607   1.00 0.00 ? 31  ARG A HH21 2  
ATOM 2354  H HH22 . ARG A 1 32  ? -21.525 6.115   7.222   1.00 0.00 ? 31  ARG A HH22 2  
ATOM 2355  N N    . ASP A 1 33  ? -12.532 9.876   4.459   1.00 0.00 ? 32  ASP A N    2  
ATOM 2356  C CA   . ASP A 1 33  ? -11.409 10.635  5.053   1.00 0.00 ? 32  ASP A CA   2  
ATOM 2357  C C    . ASP A 1 33  ? -11.800 11.163  6.450   1.00 0.00 ? 32  ASP A C    2  
ATOM 2358  O O    . ASP A 1 33  ? -12.946 11.567  6.637   1.00 0.00 ? 32  ASP A O    2  
ATOM 2359  C CB   . ASP A 1 33  ? -10.871 11.775  4.126   1.00 0.00 ? 32  ASP A CB   2  
ATOM 2360  C CG   . ASP A 1 33  ? -11.904 12.851  3.749   1.00 0.00 ? 32  ASP A CG   2  
ATOM 2361  O OD1  . ASP A 1 33  ? -12.881 12.521  3.025   1.00 0.00 ? 32  ASP A OD1  2  
ATOM 2362  O OD2  . ASP A 1 33  ? -11.718 14.020  4.182   1.00 0.00 ? 32  ASP A OD2  2  
ATOM 2363  H H    . ASP A 1 33  ? -13.215 10.407  3.962   1.00 0.00 ? 32  ASP A H    2  
ATOM 2364  H HA   . ASP A 1 33  ? -10.552 9.989   5.200   1.00 0.00 ? 32  ASP A HA   2  
ATOM 2365  H HB2  . ASP A 1 33  ? -9.996  12.264  4.609   1.00 0.00 ? 32  ASP A HB2  2  
ATOM 2366  H HB3  . ASP A 1 33  ? -10.508 11.308  3.183   1.00 0.00 ? 32  ASP A HB3  2  
ATOM 2367  N N    . VAL A 1 34  ? -10.885 11.180  7.464   1.00 0.00 ? 33  VAL A N    2  
ATOM 2368  C CA   . VAL A 1 34  ? -11.184 11.746  8.786   1.00 0.00 ? 33  VAL A CA   2  
ATOM 2369  C C    . VAL A 1 34  ? -10.320 12.995  8.850   1.00 0.00 ? 33  VAL A C    2  
ATOM 2370  O O    . VAL A 1 34  ? -9.114  12.925  8.678   1.00 0.00 ? 33  VAL A O    2  
ATOM 2371  C CB   . VAL A 1 34  ? -11.074 10.808  10.034  1.00 0.00 ? 33  VAL A CB   2  
ATOM 2372  C CG1  . VAL A 1 34  ? -12.510 10.330  10.352  1.00 0.00 ? 33  VAL A CG1  2  
ATOM 2373  C CG2  . VAL A 1 34  ? -10.126 9.582   9.920   1.00 0.00 ? 33  VAL A CG2  2  
ATOM 2374  H H    . VAL A 1 34  ? -9.938  10.887  7.338   1.00 0.00 ? 33  VAL A H    2  
ATOM 2375  H HA   . VAL A 1 34  ? -12.198 12.126  8.817   1.00 0.00 ? 33  VAL A HA   2  
ATOM 2376  H HB   . VAL A 1 34  ? -10.738 11.400  10.917  1.00 0.00 ? 33  VAL A HB   2  
ATOM 2377  H HG11 . VAL A 1 34  ? -13.197 11.187  10.513  1.00 0.00 ? 33  VAL A HG11 2  
ATOM 2378  H HG12 . VAL A 1 34  ? -12.512 9.704   11.269  1.00 0.00 ? 33  VAL A HG12 2  
ATOM 2379  H HG13 . VAL A 1 34  ? -12.906 9.711   9.517   1.00 0.00 ? 33  VAL A HG13 2  
ATOM 2380  H HG21 . VAL A 1 34  ? -10.613 8.711   9.442   1.00 0.00 ? 33  VAL A HG21 2  
ATOM 2381  H HG22 . VAL A 1 34  ? -9.740  9.190   10.884  1.00 0.00 ? 33  VAL A HG22 2  
ATOM 2382  H HG23 . VAL A 1 34  ? -9.205  9.796   9.354   1.00 0.00 ? 33  VAL A HG23 2  
ATOM 2383  N N    . GLY A 1 35  ? -10.954 14.179  9.057   1.00 0.00 ? 34  GLY A N    2  
ATOM 2384  C CA   . GLY A 1 35  ? -10.442 15.569  9.097   1.00 0.00 ? 34  GLY A CA   2  
ATOM 2385  C C    . GLY A 1 35  ? -9.195  15.987  8.321   1.00 0.00 ? 34  GLY A C    2  
ATOM 2386  O O    . GLY A 1 35  ? -9.095  15.836  7.106   1.00 0.00 ? 34  GLY A O    2  
ATOM 2387  H H    . GLY A 1 35  ? -11.939 14.126  9.177   1.00 0.00 ? 34  GLY A H    2  
ATOM 2388  H HA2  . GLY A 1 35  ? -11.237 16.182  8.697   1.00 0.00 ? 34  GLY A HA2  2  
ATOM 2389  H HA3  . GLY A 1 35  ? -10.254 15.788  10.139  1.00 0.00 ? 34  GLY A HA3  2  
ATOM 2390  N N    . ALA A 1 36  ? -8.209  16.563  9.048   1.00 0.00 ? 35  ALA A N    2  
ATOM 2391  C CA   . ALA A 1 36  ? -6.872  16.899  8.591   1.00 0.00 ? 35  ALA A CA   2  
ATOM 2392  C C    . ALA A 1 36  ? -5.907  15.905  9.188   1.00 0.00 ? 35  ALA A C    2  
ATOM 2393  O O    . ALA A 1 36  ? -5.825  15.768  10.408  1.00 0.00 ? 35  ALA A O    2  
ATOM 2394  C CB   . ALA A 1 36  ? -6.507  18.347  8.989   1.00 0.00 ? 35  ALA A CB   2  
ATOM 2395  H H    . ALA A 1 36  ? -8.324  16.686  10.029  1.00 0.00 ? 35  ALA A H    2  
ATOM 2396  H HA   . ALA A 1 36  ? -6.754  16.750  7.516   1.00 0.00 ? 35  ALA A HA   2  
ATOM 2397  H HB1  . ALA A 1 36  ? -5.492  18.619  8.627   1.00 0.00 ? 35  ALA A HB1  2  
ATOM 2398  H HB2  . ALA A 1 36  ? -6.538  18.478  10.094  1.00 0.00 ? 35  ALA A HB2  2  
ATOM 2399  H HB3  . ALA A 1 36  ? -7.233  19.056  8.536   1.00 0.00 ? 35  ALA A HB3  2  
ATOM 2400  N N    . GLY A 1 37  ? -5.137  15.206  8.318   1.00 0.00 ? 36  GLY A N    2  
ATOM 2401  C CA   . GLY A 1 37  ? -4.077  14.283  8.697   1.00 0.00 ? 36  GLY A CA   2  
ATOM 2402  C C    . GLY A 1 37  ? -4.501  12.862  8.916   1.00 0.00 ? 36  GLY A C    2  
ATOM 2403  O O    . GLY A 1 37  ? -3.649  12.041  9.235   1.00 0.00 ? 36  GLY A O    2  
ATOM 2404  H H    . GLY A 1 37  ? -5.245  15.358  7.339   1.00 0.00 ? 36  GLY A H    2  
ATOM 2405  H HA2  . GLY A 1 37  ? -3.370  14.273  7.882   1.00 0.00 ? 36  GLY A HA2  2  
ATOM 2406  H HA3  . GLY A 1 37  ? -3.613  14.607  9.624   1.00 0.00 ? 36  GLY A HA3  2  
ATOM 2407  N N    . LYS A 1 38  ? -5.806  12.522  8.784   1.00 0.00 ? 37  LYS A N    2  
ATOM 2408  C CA   . LYS A 1 38  ? -6.299  11.184  9.070   1.00 0.00 ? 37  LYS A CA   2  
ATOM 2409  C C    . LYS A 1 38  ? -7.138  10.605  7.927   1.00 0.00 ? 37  LYS A C    2  
ATOM 2410  O O    . LYS A 1 38  ? -7.561  11.280  6.987   1.00 0.00 ? 37  LYS A O    2  
ATOM 2411  C CB   . LYS A 1 38  ? -6.924  11.100  10.512  1.00 0.00 ? 37  LYS A CB   2  
ATOM 2412  C CG   . LYS A 1 38  ? -7.250  12.424  11.227  1.00 0.00 ? 37  LYS A CG   2  
ATOM 2413  C CD   . LYS A 1 38  ? -8.084  12.191  12.494  1.00 0.00 ? 37  LYS A CD   2  
ATOM 2414  C CE   . LYS A 1 38  ? -8.502  13.482  13.212  1.00 0.00 ? 37  LYS A CE   2  
ATOM 2415  N NZ   . LYS A 1 38  ? -9.397  14.307  12.368  1.00 0.00 ? 37  LYS A NZ   2  
ATOM 2416  H H    . LYS A 1 38  ? -6.519  13.180  8.532   1.00 0.00 ? 37  LYS A H    2  
ATOM 2417  H HA   . LYS A 1 38  ? -5.488  10.475  9.075   1.00 0.00 ? 37  LYS A HA   2  
ATOM 2418  H HB2  . LYS A 1 38  ? -7.842  10.482  10.532  1.00 0.00 ? 37  LYS A HB2  2  
ATOM 2419  H HB3  . LYS A 1 38  ? -6.213  10.542  11.176  1.00 0.00 ? 37  LYS A HB3  2  
ATOM 2420  H HG2  . LYS A 1 38  ? -6.308  12.951  11.498  1.00 0.00 ? 37  LYS A HG2  2  
ATOM 2421  H HG3  . LYS A 1 38  ? -7.820  13.092  10.551  1.00 0.00 ? 37  LYS A HG3  2  
ATOM 2422  H HD2  . LYS A 1 38  ? -8.999  11.615  12.231  1.00 0.00 ? 37  LYS A HD2  2  
ATOM 2423  H HD3  . LYS A 1 38  ? -7.492  11.573  13.205  1.00 0.00 ? 37  LYS A HD3  2  
ATOM 2424  H HE2  . LYS A 1 38  ? -9.059  13.222  14.137  1.00 0.00 ? 37  LYS A HE2  2  
ATOM 2425  H HE3  . LYS A 1 38  ? -7.613  14.099  13.464  1.00 0.00 ? 37  LYS A HE3  2  
ATOM 2426  H HZ1  . LYS A 1 38  ? -8.904  14.569  11.492  1.00 0.00 ? 37  LYS A HZ1  2  
ATOM 2427  H HZ2  . LYS A 1 38  ? -9.666  15.167  12.885  1.00 0.00 ? 37  LYS A HZ2  2  
ATOM 2428  H HZ3  . LYS A 1 38  ? -10.252 13.761  12.134  1.00 0.00 ? 37  LYS A HZ3  2  
ATOM 2429  N N    . TYR A 1 39  ? -7.385  9.262   8.000   1.00 0.00 ? 38  TYR A N    2  
ATOM 2430  C CA   . TYR A 1 39  ? -8.143  8.423   7.076   1.00 0.00 ? 38  TYR A CA   2  
ATOM 2431  C C    . TYR A 1 39  ? -8.965  7.405   7.900   1.00 0.00 ? 38  TYR A C    2  
ATOM 2432  O O    . TYR A 1 39  ? -8.526  6.978   8.973   1.00 0.00 ? 38  TYR A O    2  
ATOM 2433  C CB   . TYR A 1 39  ? -7.174  7.723   6.080   1.00 0.00 ? 38  TYR A CB   2  
ATOM 2434  C CG   . TYR A 1 39  ? -6.376  8.766   5.315   1.00 0.00 ? 38  TYR A CG   2  
ATOM 2435  C CD1  . TYR A 1 39  ? -7.004  9.637   4.446   1.00 0.00 ? 38  TYR A CD1  2  
ATOM 2436  C CD2  . TYR A 1 39  ? -5.027  8.962   5.566   1.00 0.00 ? 38  TYR A CD2  2  
ATOM 2437  C CE1  . TYR A 1 39  ? -6.316  10.675  3.852   1.00 0.00 ? 38  TYR A CE1  2  
ATOM 2438  C CE2  . TYR A 1 39  ? -4.294  9.934   4.893   1.00 0.00 ? 38  TYR A CE2  2  
ATOM 2439  C CZ   . TYR A 1 39  ? -4.963  10.833  4.068   1.00 0.00 ? 38  TYR A CZ   2  
ATOM 2440  O OH   . TYR A 1 39  ? -4.308  11.938  3.465   1.00 0.00 ? 38  TYR A OH   2  
ATOM 2441  H H    . TYR A 1 39  ? -7.029  8.748   8.789   1.00 0.00 ? 38  TYR A H    2  
ATOM 2442  H HA   . TYR A 1 39  ? -8.854  9.034   6.536   1.00 0.00 ? 38  TYR A HA   2  
ATOM 2443  H HB2  . TYR A 1 39  ? -6.459  7.066   6.624   1.00 0.00 ? 38  TYR A HB2  2  
ATOM 2444  H HB3  . TYR A 1 39  ? -7.727  7.104   5.343   1.00 0.00 ? 38  TYR A HB3  2  
ATOM 2445  H HD1  . TYR A 1 39  ? -8.072  9.575   4.304   1.00 0.00 ? 38  TYR A HD1  2  
ATOM 2446  H HD2  . TYR A 1 39  ? -4.583  8.380   6.366   1.00 0.00 ? 38  TYR A HD2  2  
ATOM 2447  H HE1  . TYR A 1 39  ? -6.858  11.366  3.222   1.00 0.00 ? 38  TYR A HE1  2  
ATOM 2448  H HE2  . TYR A 1 39  ? -3.211  9.988   5.030   1.00 0.00 ? 38  TYR A HE2  2  
ATOM 2449  H HH   . TYR A 1 39  ? -4.970  12.443  2.978   1.00 0.00 ? 38  TYR A HH   2  
ATOM 2450  N N    . LYS A 1 40  ? -10.216 7.034   7.447   1.00 0.00 ? 39  LYS A N    2  
ATOM 2451  C CA   . LYS A 1 40  ? -11.211 6.111   8.033   1.00 0.00 ? 39  LYS A CA   2  
ATOM 2452  C C    . LYS A 1 40  ? -11.197 5.060   6.992   1.00 0.00 ? 39  LYS A C    2  
ATOM 2453  O O    . LYS A 1 40  ? -11.548 5.225   5.819   1.00 0.00 ? 39  LYS A O    2  
ATOM 2454  C CB   . LYS A 1 40  ? -12.617 6.752   8.215   1.00 0.00 ? 39  LYS A CB   2  
ATOM 2455  C CG   . LYS A 1 40  ? -13.857 5.845   8.034   1.00 0.00 ? 39  LYS A CG   2  
ATOM 2456  C CD   . LYS A 1 40  ? -14.043 4.695   9.035   1.00 0.00 ? 39  LYS A CD   2  
ATOM 2457  C CE   . LYS A 1 40  ? -15.179 3.755   8.596   1.00 0.00 ? 39  LYS A CE   2  
ATOM 2458  N NZ   . LYS A 1 40  ? -16.466 4.475   8.438   1.00 0.00 ? 39  LYS A NZ   2  
ATOM 2459  H H    . LYS A 1 40  ? -10.606 7.347   6.559   1.00 0.00 ? 39  LYS A H    2  
ATOM 2460  H HA   . LYS A 1 40  ? -10.881 5.585   8.936   1.00 0.00 ? 39  LYS A HA   2  
ATOM 2461  H HB2  . LYS A 1 40  ? -12.652 7.227   9.219   1.00 0.00 ? 39  LYS A HB2  2  
ATOM 2462  H HB3  . LYS A 1 40  ? -12.712 7.578   7.473   1.00 0.00 ? 39  LYS A HB3  2  
ATOM 2463  H HG2  . LYS A 1 40  ? -14.759 6.498   8.098   1.00 0.00 ? 39  LYS A HG2  2  
ATOM 2464  H HG3  . LYS A 1 40  ? -13.849 5.406   7.008   1.00 0.00 ? 39  LYS A HG3  2  
ATOM 2465  H HD2  . LYS A 1 40  ? -13.112 4.089   9.111   1.00 0.00 ? 39  LYS A HD2  2  
ATOM 2466  H HD3  . LYS A 1 40  ? -14.258 5.109   10.044  1.00 0.00 ? 39  LYS A HD3  2  
ATOM 2467  H HE2  . LYS A 1 40  ? -14.925 3.296   7.616   1.00 0.00 ? 39  LYS A HE2  2  
ATOM 2468  H HE3  . LYS A 1 40  ? -15.339 2.952   9.341   1.00 0.00 ? 39  LYS A HE3  2  
ATOM 2469  H HZ1  . LYS A 1 40  ? -17.201 3.807   8.132   1.00 0.00 ? 39  LYS A HZ1  2  
ATOM 2470  H HZ2  . LYS A 1 40  ? -16.357 5.225   7.726   1.00 0.00 ? 39  LYS A HZ2  2  
ATOM 2471  H HZ3  . LYS A 1 40  ? -16.738 4.899   9.348   1.00 0.00 ? 39  LYS A HZ3  2  
ATOM 2472  N N    . LEU A 1 41  ? -10.594 3.953   7.419   1.00 0.00 ? 40  LEU A N    2  
ATOM 2473  C CA   . LEU A 1 41  ? -10.064 3.012   6.473   1.00 0.00 ? 40  LEU A CA   2  
ATOM 2474  C C    . LEU A 1 41  ? -10.405 1.598   6.753   1.00 0.00 ? 40  LEU A C    2  
ATOM 2475  O O    . LEU A 1 41  ? -10.575 1.183   7.891   1.00 0.00 ? 40  LEU A O    2  
ATOM 2476  C CB   . LEU A 1 41  ? -8.548  3.321   6.401   1.00 0.00 ? 40  LEU A CB   2  
ATOM 2477  C CG   . LEU A 1 41  ? -7.692  2.898   7.624   1.00 0.00 ? 40  LEU A CG   2  
ATOM 2478  C CD1  . LEU A 1 41  ? -8.288  3.048   9.027   1.00 0.00 ? 40  LEU A CD1  2  
ATOM 2479  C CD2  . LEU A 1 41  ? -7.178  1.466   7.411   1.00 0.00 ? 40  LEU A CD2  2  
ATOM 2480  H H    . LEU A 1 41  ? -10.350 3.828   8.402   1.00 0.00 ? 40  LEU A H    2  
ATOM 2481  H HA   . LEU A 1 41  ? -10.546 3.159   5.522   1.00 0.00 ? 40  LEU A HA   2  
ATOM 2482  H HB2  . LEU A 1 41  ? -8.086  2.887   5.486   1.00 0.00 ? 40  LEU A HB2  2  
ATOM 2483  H HB3  . LEU A 1 41  ? -8.445  4.428   6.298   1.00 0.00 ? 40  LEU A HB3  2  
ATOM 2484  H HG   . LEU A 1 41  ? -6.869  3.632   7.677   1.00 0.00 ? 40  LEU A HG   2  
ATOM 2485  H HD11 . LEU A 1 41  ? -9.145  2.332   9.102   1.00 0.00 ? 40  LEU A HD11 2  
ATOM 2486  H HD12 . LEU A 1 41  ? -8.628  4.105   9.209   1.00 0.00 ? 40  LEU A HD12 2  
ATOM 2487  H HD13 . LEU A 1 41  ? -7.546  2.791   9.808   1.00 0.00 ? 40  LEU A HD13 2  
ATOM 2488  H HD21 . LEU A 1 41  ? -7.973  0.714   7.576   1.00 0.00 ? 40  LEU A HD21 2  
ATOM 2489  H HD22 . LEU A 1 41  ? -6.373  1.250   8.139   1.00 0.00 ? 40  LEU A HD22 2  
ATOM 2490  H HD23 . LEU A 1 41  ? -6.819  1.318   6.366   1.00 0.00 ? 40  LEU A HD23 2  
ATOM 2491  N N    . LEU A 1 42  ? -10.562 0.762   5.720   1.00 0.00 ? 41  LEU A N    2  
ATOM 2492  C CA   . LEU A 1 42  ? -10.806 -0.632  5.942   1.00 0.00 ? 41  LEU A CA   2  
ATOM 2493  C C    . LEU A 1 42  ? -9.858  -1.395  5.092   1.00 0.00 ? 41  LEU A C    2  
ATOM 2494  O O    . LEU A 1 42  ? -9.808  -1.163  3.897   1.00 0.00 ? 41  LEU A O    2  
ATOM 2495  C CB   . LEU A 1 42  ? -12.318 -0.802  5.884   1.00 0.00 ? 41  LEU A CB   2  
ATOM 2496  C CG   . LEU A 1 42  ? -12.877 -2.213  6.130   1.00 0.00 ? 41  LEU A CG   2  
ATOM 2497  C CD1  . LEU A 1 42  ? -14.367 -2.154  6.513   1.00 0.00 ? 41  LEU A CD1  2  
ATOM 2498  C CD2  . LEU A 1 42  ? -12.808 -3.101  4.881   1.00 0.00 ? 41  LEU A CD2  2  
ATOM 2499  H H    . LEU A 1 42  ? -10.349 1.015   4.762   1.00 0.00 ? 41  LEU A H    2  
ATOM 2500  H HA   . LEU A 1 42  ? -10.527 -0.943  6.940   1.00 0.00 ? 41  LEU A HA   2  
ATOM 2501  H HB2  . LEU A 1 42  ? -12.581 -0.118  6.750   1.00 0.00 ? 41  LEU A HB2  2  
ATOM 2502  H HB3  . LEU A 1 42  ? -12.743 -0.382  4.951   1.00 0.00 ? 41  LEU A HB3  2  
ATOM 2503  H HG   . LEU A 1 42  ? -12.257 -2.654  6.960   1.00 0.00 ? 41  LEU A HG   2  
ATOM 2504  H HD11 . LEU A 1 42  ? -14.710 -3.138  6.897   1.00 0.00 ? 41  LEU A HD11 2  
ATOM 2505  H HD12 . LEU A 1 42  ? -14.978 -1.892  5.621   1.00 0.00 ? 41  LEU A HD12 2  
ATOM 2506  H HD13 . LEU A 1 42  ? -14.564 -1.385  7.286   1.00 0.00 ? 41  LEU A HD13 2  
ATOM 2507  H HD21 . LEU A 1 42  ? -13.348 -4.054  5.053   1.00 0.00 ? 41  LEU A HD21 2  
ATOM 2508  H HD22 . LEU A 1 42  ? -11.771 -3.336  4.591   1.00 0.00 ? 41  LEU A HD22 2  
ATOM 2509  H HD23 . LEU A 1 42  ? -13.293 -2.592  4.019   1.00 0.00 ? 41  LEU A HD23 2  
ATOM 2510  N N    . PHE A 1 43  ? -9.063  -2.350  5.623   1.00 0.00 ? 42  PHE A N    2  
ATOM 2511  C CA   . PHE A 1 43  ? -8.086  -3.146  4.849   1.00 0.00 ? 42  PHE A CA   2  
ATOM 2512  C C    . PHE A 1 43  ? -8.739  -4.070  3.811   1.00 0.00 ? 42  PHE A C    2  
ATOM 2513  O O    . PHE A 1 43  ? -9.859  -4.517  4.016   1.00 0.00 ? 42  PHE A O    2  
ATOM 2514  C CB   . PHE A 1 43  ? -7.132  -4.057  5.707   1.00 0.00 ? 42  PHE A CB   2  
ATOM 2515  C CG   . PHE A 1 43  ? -6.225  -3.404  6.737   1.00 0.00 ? 42  PHE A CG   2  
ATOM 2516  C CD1  . PHE A 1 43  ? -6.389  -2.148  7.309   1.00 0.00 ? 42  PHE A CD1  2  
ATOM 2517  C CD2  . PHE A 1 43  ? -5.180  -4.184  7.208   1.00 0.00 ? 42  PHE A CD2  2  
ATOM 2518  C CE1  . PHE A 1 43  ? -5.574  -1.728  8.341   1.00 0.00 ? 42  PHE A CE1  2  
ATOM 2519  C CE2  . PHE A 1 43  ? -4.341  -3.754  8.214   1.00 0.00 ? 42  PHE A CE2  2  
ATOM 2520  C CZ   . PHE A 1 43  ? -4.547  -2.524  8.792   1.00 0.00 ? 42  PHE A CZ   2  
ATOM 2521  H H    . PHE A 1 43  ? -9.149  -2.502  6.616   1.00 0.00 ? 42  PHE A H    2  
ATOM 2522  H HA   . PHE A 1 43  ? -7.486  -2.456  4.296   1.00 0.00 ? 42  PHE A HA   2  
ATOM 2523  H HB2  . PHE A 1 43  ? -7.741  -4.790  6.277   1.00 0.00 ? 42  PHE A HB2  2  
ATOM 2524  H HB3  . PHE A 1 43  ? -6.447  -4.637  5.027   1.00 0.00 ? 42  PHE A HB3  2  
ATOM 2525  H HD1  . PHE A 1 43  ? -7.186  -1.488  7.012   1.00 0.00 ? 42  PHE A HD1  2  
ATOM 2526  H HD2  . PHE A 1 43  ? -5.022  -5.162  6.778   1.00 0.00 ? 42  PHE A HD2  2  
ATOM 2527  H HE1  . PHE A 1 43  ? -5.749  -0.772  8.819   1.00 0.00 ? 42  PHE A HE1  2  
ATOM 2528  H HE2  . PHE A 1 43  ? -3.535  -4.392  8.561   1.00 0.00 ? 42  PHE A HE2  2  
ATOM 2529  H HZ   . PHE A 1 43  ? -3.912  -2.180  9.596   1.00 0.00 ? 42  PHE A HZ   2  
ATOM 2530  N N    . ASP A 1 44  ? -8.049  -4.456  2.698   1.00 0.00 ? 43  ASP A N    2  
ATOM 2531  C CA   . ASP A 1 44  ? -8.525  -5.378  1.628   1.00 0.00 ? 43  ASP A CA   2  
ATOM 2532  C C    . ASP A 1 44  ? -8.859  -6.824  2.057   1.00 0.00 ? 43  ASP A C    2  
ATOM 2533  O O    . ASP A 1 44  ? -9.333  -7.663  1.292   1.00 0.00 ? 43  ASP A O    2  
ATOM 2534  C CB   . ASP A 1 44  ? -7.586  -5.370  0.376   1.00 0.00 ? 43  ASP A CB   2  
ATOM 2535  C CG   . ASP A 1 44  ? -6.156  -5.859  0.650   1.00 0.00 ? 43  ASP A CG   2  
ATOM 2536  O OD1  . ASP A 1 44  ? -5.438  -5.200  1.445   1.00 0.00 ? 43  ASP A OD1  2  
ATOM 2537  O OD2  . ASP A 1 44  ? -5.768  -6.895  0.048   1.00 0.00 ? 43  ASP A OD2  2  
ATOM 2538  H H    . ASP A 1 44  ? -7.139  -4.082  2.539   1.00 0.00 ? 43  ASP A H    2  
ATOM 2539  H HA   . ASP A 1 44  ? -9.464  -4.976  1.276   1.00 0.00 ? 43  ASP A HA   2  
ATOM 2540  H HB2  . ASP A 1 44  ? -8.033  -5.973  -0.444  1.00 0.00 ? 43  ASP A HB2  2  
ATOM 2541  H HB3  . ASP A 1 44  ? -7.515  -4.326  0.002   1.00 0.00 ? 43  ASP A HB3  2  
ATOM 2542  N N    . ASP A 1 45  ? -8.620  -7.076  3.358   1.00 0.00 ? 44  ASP A N    2  
ATOM 2543  C CA   . ASP A 1 45  ? -8.858  -8.261  4.136   1.00 0.00 ? 44  ASP A CA   2  
ATOM 2544  C C    . ASP A 1 45  ? -9.929  -8.020  5.226   1.00 0.00 ? 44  ASP A C    2  
ATOM 2545  O O    . ASP A 1 45  ? -10.337 -8.968  5.890   1.00 0.00 ? 44  ASP A O    2  
ATOM 2546  C CB   . ASP A 1 45  ? -7.483  -8.804  4.646   1.00 0.00 ? 44  ASP A CB   2  
ATOM 2547  C CG   . ASP A 1 45  ? -6.692  -7.808  5.511   1.00 0.00 ? 44  ASP A CG   2  
ATOM 2548  O OD1  . ASP A 1 45  ? -7.083  -7.587  6.688   1.00 0.00 ? 44  ASP A OD1  2  
ATOM 2549  O OD2  . ASP A 1 45  ? -5.676  -7.265  4.998   1.00 0.00 ? 44  ASP A OD2  2  
ATOM 2550  H H    . ASP A 1 45  ? -8.250  -6.315  3.880   1.00 0.00 ? 44  ASP A H    2  
ATOM 2551  H HA   . ASP A 1 45  ? -9.276  -9.031  3.498   1.00 0.00 ? 44  ASP A HA   2  
ATOM 2552  H HB2  . ASP A 1 45  ? -7.608  -9.763  5.188   1.00 0.00 ? 44  ASP A HB2  2  
ATOM 2553  H HB3  . ASP A 1 45  ? -6.866  -8.987  3.725   1.00 0.00 ? 44  ASP A HB3  2  
ATOM 2554  N N    . GLY A 1 46  ? -10.460 -6.760  5.414   1.00 0.00 ? 45  GLY A N    2  
ATOM 2555  C CA   . GLY A 1 46  ? -11.613 -6.453  6.263   1.00 0.00 ? 45  GLY A CA   2  
ATOM 2556  C C    . GLY A 1 46  ? -11.354 -5.934  7.648   1.00 0.00 ? 45  GLY A C    2  
ATOM 2557  O O    . GLY A 1 46  ? -12.225 -6.052  8.504   1.00 0.00 ? 45  GLY A O    2  
ATOM 2558  H H    . GLY A 1 46  ? -10.183 -5.943  4.880   1.00 0.00 ? 45  GLY A H    2  
ATOM 2559  H HA2  . GLY A 1 46  ? -12.111 -5.626  5.751   1.00 0.00 ? 45  GLY A HA2  2  
ATOM 2560  H HA3  . GLY A 1 46  ? -12.229 -7.345  6.410   1.00 0.00 ? 45  GLY A HA3  2  
ATOM 2561  N N    . TYR A 1 47  ? -10.176 -5.319  7.934   1.00 0.00 ? 46  TYR A N    2  
ATOM 2562  C CA   . TYR A 1 47  ? -9.889  -4.735  9.244   1.00 0.00 ? 46  TYR A CA   2  
ATOM 2563  C C    . TYR A 1 47  ? -10.065 -3.222  9.136   1.00 0.00 ? 46  TYR A C    2  
ATOM 2564  O O    . TYR A 1 47  ? -9.302  -2.517  8.477   1.00 0.00 ? 46  TYR A O    2  
ATOM 2565  C CB   . TYR A 1 47  ? -8.496  -5.162  9.829   1.00 0.00 ? 46  TYR A CB   2  
ATOM 2566  C CG   . TYR A 1 47  ? -8.267  -4.577  11.214  1.00 0.00 ? 46  TYR A CG   2  
ATOM 2567  C CD1  . TYR A 1 47  ? -8.998  -5.011  12.310  1.00 0.00 ? 46  TYR A CD1  2  
ATOM 2568  C CD2  . TYR A 1 47  ? -7.458  -3.464  11.356  1.00 0.00 ? 46  TYR A CD2  2  
ATOM 2569  C CE1  . TYR A 1 47  ? -8.953  -4.314  13.506  1.00 0.00 ? 46  TYR A CE1  2  
ATOM 2570  C CE2  . TYR A 1 47  ? -7.432  -2.754  12.540  1.00 0.00 ? 46  TYR A CE2  2  
ATOM 2571  C CZ   . TYR A 1 47  ? -8.190  -3.170  13.611  1.00 0.00 ? 46  TYR A CZ   2  
ATOM 2572  O OH   . TYR A 1 47  ? -8.232  -2.382  14.782  1.00 0.00 ? 46  TYR A OH   2  
ATOM 2573  H H    . TYR A 1 47  ? -9.473  -5.236  7.236   1.00 0.00 ? 46  TYR A H    2  
ATOM 2574  H HA   . TYR A 1 47  ? -10.618 -5.071  9.974   1.00 0.00 ? 46  TYR A HA   2  
ATOM 2575  H HB2  . TYR A 1 47  ? -8.460  -6.270  9.916   1.00 0.00 ? 46  TYR A HB2  2  
ATOM 2576  H HB3  . TYR A 1 47  ? -7.676  -4.833  9.155   1.00 0.00 ? 46  TYR A HB3  2  
ATOM 2577  H HD1  . TYR A 1 47  ? -9.655  -5.864  12.209  1.00 0.00 ? 46  TYR A HD1  2  
ATOM 2578  H HD2  . TYR A 1 47  ? -6.906  -3.102  10.498  1.00 0.00 ? 46  TYR A HD2  2  
ATOM 2579  H HE1  . TYR A 1 47  ? -9.555  -4.633  14.347  1.00 0.00 ? 46  TYR A HE1  2  
ATOM 2580  H HE2  . TYR A 1 47  ? -6.850  -1.846  12.601  1.00 0.00 ? 46  TYR A HE2  2  
ATOM 2581  H HH   . TYR A 1 47  ? -7.946  -1.496  14.548  1.00 0.00 ? 46  TYR A HH   2  
ATOM 2582  N N    . GLU A 1 48  ? -11.096 -2.677  9.828   1.00 0.00 ? 47  GLU A N    2  
ATOM 2583  C CA   . GLU A 1 48  ? -11.388 -1.252  9.888   1.00 0.00 ? 47  GLU A CA   2  
ATOM 2584  C C    . GLU A 1 48  ? -10.971 -0.604  11.194  1.00 0.00 ? 47  GLU A C    2  
ATOM 2585  O O    . GLU A 1 48  ? -10.940 -1.216  12.264  1.00 0.00 ? 47  GLU A O    2  
ATOM 2586  C CB   . GLU A 1 48  ? -12.892 -0.950  9.663   1.00 0.00 ? 47  GLU A CB   2  
ATOM 2587  C CG   . GLU A 1 48  ? -13.272 0.541   9.429   1.00 0.00 ? 47  GLU A CG   2  
ATOM 2588  C CD   . GLU A 1 48  ? -14.068 1.064   10.629  1.00 0.00 ? 47  GLU A CD   2  
ATOM 2589  O OE1  . GLU A 1 48  ? -15.158 0.493   10.904  1.00 0.00 ? 47  GLU A OE1  2  
ATOM 2590  O OE2  . GLU A 1 48  ? -13.613 2.044   11.275  1.00 0.00 ? 47  GLU A OE2  2  
ATOM 2591  H H    . GLU A 1 48  ? -11.699 -3.255  10.368  1.00 0.00 ? 47  GLU A H    2  
ATOM 2592  H HA   . GLU A 1 48  ? -10.835 -0.764  9.098   1.00 0.00 ? 47  GLU A HA   2  
ATOM 2593  H HB2  . GLU A 1 48  ? -13.161 -1.496  8.741   1.00 0.00 ? 47  GLU A HB2  2  
ATOM 2594  H HB3  . GLU A 1 48  ? -13.511 -1.409  10.463  1.00 0.00 ? 47  GLU A HB3  2  
ATOM 2595  H HG2  . GLU A 1 48  ? -12.362 1.180   9.245   1.00 0.00 ? 47  GLU A HG2  2  
ATOM 2596  H HG3  . GLU A 1 48  ? -13.923 0.608   8.531   1.00 0.00 ? 47  GLU A HG3  2  
ATOM 2597  N N    . CYS A 1 49  ? -10.679 0.715   11.080  1.00 0.00 ? 48  CYS A N    2  
ATOM 2598  C CA   . CYS A 1 49  ? -10.291 1.561   12.200  1.00 0.00 ? 48  CYS A CA   2  
ATOM 2599  C C    . CYS A 1 49  ? -10.422 2.968   11.665  1.00 0.00 ? 48  CYS A C    2  
ATOM 2600  O O    . CYS A 1 49  ? -10.754 3.150   10.497  1.00 0.00 ? 48  CYS A O    2  
ATOM 2601  C CB   . CYS A 1 49  ? -8.840  1.280   12.725  1.00 0.00 ? 48  CYS A CB   2  
ATOM 2602  S SG   . CYS A 1 49  ? -8.520  1.857   14.437  1.00 0.00 ? 48  CYS A SG   2  
ATOM 2603  H H    . CYS A 1 49  ? -10.752 1.182   10.161  1.00 0.00 ? 48  CYS A H    2  
ATOM 2604  H HA   . CYS A 1 49  ? -11.014 1.440   12.996  1.00 0.00 ? 48  CYS A HA   2  
ATOM 2605  H HB2  . CYS A 1 49  ? -8.690  0.178   12.705  1.00 0.00 ? 48  CYS A HB2  2  
ATOM 2606  H HB3  . CYS A 1 49  ? -8.089  1.717   12.027  1.00 0.00 ? 48  CYS A HB3  2  
ATOM 2607  H HG   . CYS A 1 49  ? -9.468  1.125   15.011  1.00 0.00 ? 48  CYS A HG   2  
ATOM 2608  N N    . ASP A 1 50  ? -10.143 4.018   12.470  1.00 0.00 ? 49  ASP A N    2  
ATOM 2609  C CA   . ASP A 1 50  ? -9.935  5.365   11.946  1.00 0.00 ? 49  ASP A CA   2  
ATOM 2610  C C    . ASP A 1 50  ? -8.558  5.649   12.505  1.00 0.00 ? 49  ASP A C    2  
ATOM 2611  O O    . ASP A 1 50  ? -8.292  5.271   13.651  1.00 0.00 ? 49  ASP A O    2  
ATOM 2612  C CB   . ASP A 1 50  ? -10.822 6.526   12.496  1.00 0.00 ? 49  ASP A CB   2  
ATOM 2613  C CG   . ASP A 1 50  ? -12.315 6.188   12.471  1.00 0.00 ? 49  ASP A CG   2  
ATOM 2614  O OD1  . ASP A 1 50  ? -12.741 5.282   13.236  1.00 0.00 ? 49  ASP A OD1  2  
ATOM 2615  O OD2  . ASP A 1 50  ? -13.057 6.857   11.702  1.00 0.00 ? 49  ASP A OD2  2  
ATOM 2616  H H    . ASP A 1 50  ? -9.859  3.892   13.422  1.00 0.00 ? 49  ASP A H    2  
ATOM 2617  H HA   . ASP A 1 50  ? -9.893  5.336   10.843  1.00 0.00 ? 49  ASP A HA   2  
ATOM 2618  H HB2  . ASP A 1 50  ? -10.522 6.823   13.531  1.00 0.00 ? 49  ASP A HB2  2  
ATOM 2619  H HB3  . ASP A 1 50  ? -10.651 7.419   11.852  1.00 0.00 ? 49  ASP A HB3  2  
ATOM 2620  N N    . VAL A 1 51  ? -7.649  6.277   11.734  1.00 0.00 ? 50  VAL A N    2  
ATOM 2621  C CA   . VAL A 1 51  ? -6.283  6.523   12.171  1.00 0.00 ? 50  VAL A CA   2  
ATOM 2622  C C    . VAL A 1 51  ? -5.734  7.791   11.591  1.00 0.00 ? 50  VAL A C    2  
ATOM 2623  O O    . VAL A 1 51  ? -6.246  8.279   10.586  1.00 0.00 ? 50  VAL A O    2  
ATOM 2624  C CB   . VAL A 1 51  ? -5.317  5.433   11.680  1.00 0.00 ? 50  VAL A CB   2  
ATOM 2625  C CG1  . VAL A 1 51  ? -5.581  4.149   12.475  1.00 0.00 ? 50  VAL A CG1  2  
ATOM 2626  C CG2  . VAL A 1 51  ? -5.457  5.250   10.144  1.00 0.00 ? 50  VAL A CG2  2  
ATOM 2627  H H    . VAL A 1 51  ? -7.864  6.584   10.797  1.00 0.00 ? 50  VAL A H    2  
ATOM 2628  H HA   . VAL A 1 51  ? -6.296  6.644   13.249  1.00 0.00 ? 50  VAL A HA   2  
ATOM 2629  H HB   . VAL A 1 51  ? -4.245  5.675   11.897  1.00 0.00 ? 50  VAL A HB   2  
ATOM 2630  H HG11 . VAL A 1 51  ? -6.574  3.730   12.226  1.00 0.00 ? 50  VAL A HG11 2  
ATOM 2631  H HG12 . VAL A 1 51  ? -5.558  4.399   13.558  1.00 0.00 ? 50  VAL A HG12 2  
ATOM 2632  H HG13 . VAL A 1 51  ? -4.792  3.407   12.242  1.00 0.00 ? 50  VAL A HG13 2  
ATOM 2633  H HG21 . VAL A 1 51  ? -4.707  5.883   9.621   1.00 0.00 ? 50  VAL A HG21 2  
ATOM 2634  H HG22 . VAL A 1 51  ? -6.454  5.576   9.760   1.00 0.00 ? 50  VAL A HG22 2  
ATOM 2635  H HG23 . VAL A 1 51  ? -5.291  4.194   9.868   1.00 0.00 ? 50  VAL A HG23 2  
ATOM 2636  N N    . LEU A 1 52  ? -4.572  8.272   12.145  1.00 0.00 ? 51  LEU A N    2  
ATOM 2637  C CA   . LEU A 1 52  ? -3.726  9.342   11.594  1.00 0.00 ? 51  LEU A CA   2  
ATOM 2638  C C    . LEU A 1 52  ? -2.869  8.764   10.502  1.00 0.00 ? 51  LEU A C    2  
ATOM 2639  O O    . LEU A 1 52  ? -2.542  7.581   10.518  1.00 0.00 ? 51  LEU A O    2  
ATOM 2640  C CB   . LEU A 1 52  ? -2.811  10.016  12.675  1.00 0.00 ? 51  LEU A CB   2  
ATOM 2641  C CG   . LEU A 1 52  ? -3.426  11.146  13.536  1.00 0.00 ? 51  LEU A CG   2  
ATOM 2642  C CD1  . LEU A 1 52  ? -3.582  12.434  12.715  1.00 0.00 ? 51  LEU A CD1  2  
ATOM 2643  C CD2  . LEU A 1 52  ? -4.735  10.763  14.241  1.00 0.00 ? 51  LEU A CD2  2  
ATOM 2644  H H    . LEU A 1 52  ? -4.194  7.823   12.951  1.00 0.00 ? 51  LEU A H    2  
ATOM 2645  H HA   . LEU A 1 52  ? -4.349  9.977   10.980  1.00 0.00 ? 51  LEU A HA   2  
ATOM 2646  H HB2  . LEU A 1 52  ? -2.437  9.219   13.357  1.00 0.00 ? 51  LEU A HB2  2  
ATOM 2647  H HB3  . LEU A 1 52  ? -1.916  10.487  12.201  1.00 0.00 ? 51  LEU A HB3  2  
ATOM 2648  H HG   . LEU A 1 52  ? -2.680  11.371  14.339  1.00 0.00 ? 51  LEU A HG   2  
ATOM 2649  H HD11 . LEU A 1 52  ? -4.296  12.259  11.885  1.00 0.00 ? 51  LEU A HD11 2  
ATOM 2650  H HD12 . LEU A 1 52  ? -2.608  12.742  12.279  1.00 0.00 ? 51  LEU A HD12 2  
ATOM 2651  H HD13 . LEU A 1 52  ? -3.968  13.263  13.346  1.00 0.00 ? 51  LEU A HD13 2  
ATOM 2652  H HD21 . LEU A 1 52  ? -5.058  11.578  14.923  1.00 0.00 ? 51  LEU A HD21 2  
ATOM 2653  H HD22 . LEU A 1 52  ? -4.600  9.841   14.843  1.00 0.00 ? 51  LEU A HD22 2  
ATOM 2654  H HD23 . LEU A 1 52  ? -5.540  10.588  13.496  1.00 0.00 ? 51  LEU A HD23 2  
ATOM 2655  N N    . GLY A 1 53  ? -2.689  9.552   9.400   1.00 0.00 ? 52  GLY A N    2  
ATOM 2656  C CA   . GLY A 1 53  ? -2.542  8.980   8.061   1.00 0.00 ? 52  GLY A CA   2  
ATOM 2657  C C    . GLY A 1 53  ? -1.292  8.199   7.826   1.00 0.00 ? 52  GLY A C    2  
ATOM 2658  O O    . GLY A 1 53  ? -1.326  7.121   7.258   1.00 0.00 ? 52  GLY A O    2  
ATOM 2659  H H    . GLY A 1 53  ? -2.967  10.528  9.432   1.00 0.00 ? 52  GLY A H    2  
ATOM 2660  H HA2  . GLY A 1 53  ? -3.410  8.322   7.955   1.00 0.00 ? 52  GLY A HA2  2  
ATOM 2661  H HA3  . GLY A 1 53  ? -2.566  9.745   7.309   1.00 0.00 ? 52  GLY A HA3  2  
ATOM 2662  N N    . LYS A 1 54  ? -0.158  8.670   8.406   1.00 0.00 ? 53  LYS A N    2  
ATOM 2663  C CA   . LYS A 1 54  ? 1.199   8.105   8.466   1.00 0.00 ? 53  LYS A CA   2  
ATOM 2664  C C    . LYS A 1 54  ? 1.314   6.726   9.177   1.00 0.00 ? 53  LYS A C    2  
ATOM 2665  O O    . LYS A 1 54  ? 2.337   6.348   9.736   1.00 0.00 ? 53  LYS A O    2  
ATOM 2666  C CB   . LYS A 1 54  ? 2.113   9.125   9.228   1.00 0.00 ? 53  LYS A CB   2  
ATOM 2667  C CG   . LYS A 1 54  ? 1.482   9.922   10.407  1.00 0.00 ? 53  LYS A CG   2  
ATOM 2668  C CD   . LYS A 1 54  ? 0.901   9.155   11.616  1.00 0.00 ? 53  LYS A CD   2  
ATOM 2669  C CE   . LYS A 1 54  ? 1.915   8.383   12.482  1.00 0.00 ? 53  LYS A CE   2  
ATOM 2670  N NZ   . LYS A 1 54  ? 2.882   9.298   13.130  1.00 0.00 ? 53  LYS A NZ   2  
ATOM 2671  H H    . LYS A 1 54  ? -0.227  9.523   8.910   1.00 0.00 ? 53  LYS A H    2  
ATOM 2672  H HA   . LYS A 1 54  ? 1.572   8.015   7.441   1.00 0.00 ? 53  LYS A HA   2  
ATOM 2673  H HB2  . LYS A 1 54  ? 3.067   8.658   9.561   1.00 0.00 ? 53  LYS A HB2  2  
ATOM 2674  H HB3  . LYS A 1 54  ? 2.411   9.895   8.479   1.00 0.00 ? 53  LYS A HB3  2  
ATOM 2675  H HG2  . LYS A 1 54  ? 2.269   10.611  10.794  1.00 0.00 ? 53  LYS A HG2  2  
ATOM 2676  H HG3  . LYS A 1 54  ? 0.680   10.573  10.000  1.00 0.00 ? 53  LYS A HG3  2  
ATOM 2677  H HD2  . LYS A 1 54  ? 0.369   9.874   12.279  1.00 0.00 ? 53  LYS A HD2  2  
ATOM 2678  H HD3  . LYS A 1 54  ? 0.147   8.425   11.254  1.00 0.00 ? 53  LYS A HD3  2  
ATOM 2679  H HE2  . LYS A 1 54  ? 1.382   7.824   13.285  1.00 0.00 ? 53  LYS A HE2  2  
ATOM 2680  H HE3  . LYS A 1 54  ? 2.488   7.651   11.879  1.00 0.00 ? 53  LYS A HE3  2  
ATOM 2681  H HZ1  . LYS A 1 54  ? 2.370   9.972   13.735  1.00 0.00 ? 53  LYS A HZ1  2  
ATOM 2682  H HZ2  . LYS A 1 54  ? 3.409   9.818   12.400  1.00 0.00 ? 53  LYS A HZ2  2  
ATOM 2683  H HZ3  . LYS A 1 54  ? 3.545   8.745   13.709  1.00 0.00 ? 53  LYS A HZ3  2  
ATOM 2684  N N    . ASP A 1 55  ? 0.210   5.968   9.141   1.00 0.00 ? 54  ASP A N    2  
ATOM 2685  C CA   . ASP A 1 55  ? -0.070  4.668   9.648   1.00 0.00 ? 54  ASP A CA   2  
ATOM 2686  C C    . ASP A 1 55  ? -0.834  3.991   8.534   1.00 0.00 ? 54  ASP A C    2  
ATOM 2687  O O    . ASP A 1 55  ? -0.333  3.106   7.857   1.00 0.00 ? 54  ASP A O    2  
ATOM 2688  C CB   . ASP A 1 55  ? -0.917  4.628   10.959  1.00 0.00 ? 54  ASP A CB   2  
ATOM 2689  C CG   . ASP A 1 55  ? -0.149  5.241   12.129  1.00 0.00 ? 54  ASP A CG   2  
ATOM 2690  O OD1  . ASP A 1 55  ? 0.982   4.764   12.414  1.00 0.00 ? 54  ASP A OD1  2  
ATOM 2691  O OD2  . ASP A 1 55  ? -0.692  6.186   12.761  1.00 0.00 ? 54  ASP A OD2  2  
ATOM 2692  H H    . ASP A 1 55  ? -0.548  6.385   8.632   1.00 0.00 ? 54  ASP A H    2  
ATOM 2693  H HA   . ASP A 1 55  ? 0.866   4.149   9.765   1.00 0.00 ? 54  ASP A HA   2  
ATOM 2694  H HB2  . ASP A 1 55  ? -1.874  5.177   10.830  1.00 0.00 ? 54  ASP A HB2  2  
ATOM 2695  H HB3  . ASP A 1 55  ? -1.158  3.576   11.231  1.00 0.00 ? 54  ASP A HB3  2  
ATOM 2696  N N    . ILE A 1 56  ? -2.113  4.359   8.294   1.00 0.00 ? 55  ILE A N    2  
ATOM 2697  C CA   . ILE A 1 56  ? -2.903  3.712   7.243   1.00 0.00 ? 55  ILE A CA   2  
ATOM 2698  C C    . ILE A 1 56  ? -3.540  4.789   6.330   1.00 0.00 ? 55  ILE A C    2  
ATOM 2699  O O    . ILE A 1 56  ? -4.541  5.420   6.672   1.00 0.00 ? 55  ILE A O    2  
ATOM 2700  C CB   . ILE A 1 56  ? -3.892  2.691   7.840   1.00 0.00 ? 55  ILE A CB   2  
ATOM 2701  C CG1  . ILE A 1 56  ? -3.566  2.131   9.272   1.00 0.00 ? 55  ILE A CG1  2  
ATOM 2702  C CG2  . ILE A 1 56  ? -4.073  1.558   6.816   1.00 0.00 ? 55  ILE A CG2  2  
ATOM 2703  C CD1  . ILE A 1 56  ? -2.447  1.091   9.445   1.00 0.00 ? 55  ILE A CD1  2  
ATOM 2704  H H    . ILE A 1 56  ? -2.535  5.083   8.824   1.00 0.00 ? 55  ILE A H    2  
ATOM 2705  H HA   . ILE A 1 56  ? -2.265  3.146   6.603   1.00 0.00 ? 55  ILE A HA   2  
ATOM 2706  H HB   . ILE A 1 56  ? -4.874  3.195   7.991   1.00 0.00 ? 55  ILE A HB   2  
ATOM 2707  H HG12 . ILE A 1 56  ? -3.376  2.977   9.966   1.00 0.00 ? 55  ILE A HG12 2  
ATOM 2708  H HG13 . ILE A 1 56  ? -4.508  1.660   9.633   1.00 0.00 ? 55  ILE A HG13 2  
ATOM 2709  H HG21 . ILE A 1 56  ? -4.789  1.873   6.036   1.00 0.00 ? 55  ILE A HG21 2  
ATOM 2710  H HG22 . ILE A 1 56  ? -4.459  0.642   7.305   1.00 0.00 ? 55  ILE A HG22 2  
ATOM 2711  H HG23 . ILE A 1 56  ? -3.134  1.306   6.303   1.00 0.00 ? 55  ILE A HG23 2  
ATOM 2712  H HD11 . ILE A 1 56  ? -1.441  1.465   9.158   1.00 0.00 ? 55  ILE A HD11 2  
ATOM 2713  H HD12 . ILE A 1 56  ? -2.655  0.168   8.869   1.00 0.00 ? 55  ILE A HD12 2  
ATOM 2714  H HD13 . ILE A 1 56  ? -2.352  0.818   10.517  1.00 0.00 ? 55  ILE A HD13 2  
ATOM 2715  N N    . LEU A 1 57  ? -2.877  5.007   5.146   1.00 0.00 ? 56  LEU A N    2  
ATOM 2716  C CA   . LEU A 1 57  ? -3.046  6.081   4.126   1.00 0.00 ? 56  LEU A CA   2  
ATOM 2717  C C    . LEU A 1 57  ? -3.079  5.810   2.642   1.00 0.00 ? 56  LEU A C    2  
ATOM 2718  O O    . LEU A 1 57  ? -2.482  4.817   2.241   1.00 0.00 ? 56  LEU A O    2  
ATOM 2719  C CB   . LEU A 1 57  ? -2.023  7.217   4.249   1.00 0.00 ? 56  LEU A CB   2  
ATOM 2720  C CG   . LEU A 1 57  ? -0.530  6.854   4.058   1.00 0.00 ? 56  LEU A CG   2  
ATOM 2721  C CD1  . LEU A 1 57  ? 0.010   6.599   2.617   1.00 0.00 ? 56  LEU A CD1  2  
ATOM 2722  C CD2  . LEU A 1 57  ? 0.218   8.050   4.621   1.00 0.00 ? 56  LEU A CD2  2  
ATOM 2723  H H    . LEU A 1 57  ? -2.090  4.398   4.982   1.00 0.00 ? 56  LEU A H    2  
ATOM 2724  H HA   . LEU A 1 57  ? -4.015  6.523   4.328   1.00 0.00 ? 56  LEU A HA   2  
ATOM 2725  H HB2  . LEU A 1 57  ? -2.259  8.089   3.606   1.00 0.00 ? 56  LEU A HB2  2  
ATOM 2726  H HB3  . LEU A 1 57  ? -2.179  7.593   5.281   1.00 0.00 ? 56  LEU A HB3  2  
ATOM 2727  H HG   . LEU A 1 57  ? -0.319  5.960   4.688   1.00 0.00 ? 56  LEU A HG   2  
ATOM 2728  H HD11 . LEU A 1 57  ? -0.111  7.490   1.978   1.00 0.00 ? 56  LEU A HD11 2  
ATOM 2729  H HD12 . LEU A 1 57  ? -0.448  5.757   2.088   1.00 0.00 ? 56  LEU A HD12 2  
ATOM 2730  H HD13 . LEU A 1 57  ? 1.081   6.338   2.545   1.00 0.00 ? 56  LEU A HD13 2  
ATOM 2731  H HD21 . LEU A 1 57  ? -0.381  8.671   5.304   1.00 0.00 ? 56  LEU A HD21 2  
ATOM 2732  H HD22 . LEU A 1 57  ? 0.501   8.687   3.768   1.00 0.00 ? 56  LEU A HD22 2  
ATOM 2733  H HD23 . LEU A 1 57  ? 1.142   7.726   5.136   1.00 0.00 ? 56  LEU A HD23 2  
ATOM 2734  N N    . LEU A 1 58  ? -3.600  6.801   1.802   1.00 0.00 ? 57  LEU A N    2  
ATOM 2735  C CA   . LEU A 1 58  ? -3.470  6.974   0.353   1.00 0.00 ? 57  LEU A CA   2  
ATOM 2736  C C    . LEU A 1 58  ? -2.083  6.884   -0.254  1.00 0.00 ? 57  LEU A C    2  
ATOM 2737  O O    . LEU A 1 58  ? -1.163  7.684   -0.150  1.00 0.00 ? 57  LEU A O    2  
ATOM 2738  C CB   . LEU A 1 58  ? -3.832  8.498   0.018   1.00 0.00 ? 57  LEU A CB   2  
ATOM 2739  C CG   . LEU A 1 58  ? -2.972  9.766   0.352   1.00 0.00 ? 57  LEU A CG   2  
ATOM 2740  C CD1  . LEU A 1 58  ? -3.783  11.059  0.141   1.00 0.00 ? 57  LEU A CD1  2  
ATOM 2741  C CD2  . LEU A 1 58  ? -2.339  9.781   1.735   1.00 0.00 ? 57  LEU A CD2  2  
ATOM 2742  H H    . LEU A 1 58  ? -4.140  7.595   2.042   1.00 0.00 ? 57  LEU A H    2  
ATOM 2743  H HA   . LEU A 1 58  ? -4.098  6.243   -0.179  1.00 0.00 ? 57  LEU A HA   2  
ATOM 2744  H HB2  . LEU A 1 58  ? -3.876  8.566   -1.087  1.00 0.00 ? 57  LEU A HB2  2  
ATOM 2745  H HB3  . LEU A 1 58  ? -4.848  8.711   0.408   1.00 0.00 ? 57  LEU A HB3  2  
ATOM 2746  H HG   . LEU A 1 58  ? -2.136  9.815   -0.389  1.00 0.00 ? 57  LEU A HG   2  
ATOM 2747  H HD11 . LEU A 1 58  ? -4.608  11.109  0.879   1.00 0.00 ? 57  LEU A HD11 2  
ATOM 2748  H HD12 . LEU A 1 58  ? -4.211  11.090  -0.882  1.00 0.00 ? 57  LEU A HD12 2  
ATOM 2749  H HD13 . LEU A 1 58  ? -3.131  11.949  0.281   1.00 0.00 ? 57  LEU A HD13 2  
ATOM 2750  H HD21 . LEU A 1 58  ? -1.795  10.730  1.912   1.00 0.00 ? 57  LEU A HD21 2  
ATOM 2751  H HD22 . LEU A 1 58  ? -1.599  8.950   1.827   1.00 0.00 ? 57  LEU A HD22 2  
ATOM 2752  H HD23 . LEU A 1 58  ? -3.137  9.657   2.488   1.00 0.00 ? 57  LEU A HD23 2  
ATOM 2753  N N    . CYS A 1 59  ? -1.895  5.787   -0.931  1.00 0.00 ? 58  CYS A N    2  
ATOM 2754  C CA   . CYS A 1 59  ? -0.719  5.428   -1.592  1.00 0.00 ? 58  CYS A CA   2  
ATOM 2755  C C    . CYS A 1 59  ? -1.232  5.199   -3.023  1.00 0.00 ? 58  CYS A C    2  
ATOM 2756  O O    . CYS A 1 59  ? -2.422  5.197   -3.325  1.00 0.00 ? 58  CYS A O    2  
ATOM 2757  C CB   . CYS A 1 59  ? -0.237  4.208   -0.782  1.00 0.00 ? 58  CYS A CB   2  
ATOM 2758  S SG   . CYS A 1 59  ? 1.553   4.307   -0.522  1.00 0.00 ? 58  CYS A SG   2  
ATOM 2759  H H    . CYS A 1 59  ? -2.589  5.077   -1.074  1.00 0.00 ? 58  CYS A H    2  
ATOM 2760  H HA   . CYS A 1 59  ? 0.064   6.207   -1.542  1.00 0.00 ? 58  CYS A HA   2  
ATOM 2761  H HB2  . CYS A 1 59  ? -0.727  4.251   0.218   1.00 0.00 ? 58  CYS A HB2  2  
ATOM 2762  H HB3  . CYS A 1 59  ? -0.562  3.243   -1.231  1.00 0.00 ? 58  CYS A HB3  2  
ATOM 2763  H HG   . CYS A 1 59  ? 1.580   3.434   0.477   1.00 0.00 ? 58  CYS A HG   2  
ATOM 2764  N N    . ASP A 1 60  ? -0.302  4.939   -3.929  1.00 0.00 ? 59  ASP A N    2  
ATOM 2765  C CA   . ASP A 1 60  ? -0.487  4.360   -5.266  1.00 0.00 ? 59  ASP A CA   2  
ATOM 2766  C C    . ASP A 1 60  ? -0.595  2.810   -5.123  1.00 0.00 ? 59  ASP A C    2  
ATOM 2767  O O    . ASP A 1 60  ? -1.482  2.258   -5.770  1.00 0.00 ? 59  ASP A O    2  
ATOM 2768  C CB   . ASP A 1 60  ? 0.569   4.811   -6.352  1.00 0.00 ? 59  ASP A CB   2  
ATOM 2769  C CG   . ASP A 1 60  ? -0.096  5.430   -7.594  1.00 0.00 ? 59  ASP A CG   2  
ATOM 2770  O OD1  . ASP A 1 60  ? -1.232  5.021   -7.953  1.00 0.00 ? 59  ASP A OD1  2  
ATOM 2771  O OD2  . ASP A 1 60  ? 0.542   6.332   -8.200  1.00 0.00 ? 59  ASP A OD2  2  
ATOM 2772  H H    . ASP A 1 60  ? 0.595   4.966   -3.520  1.00 0.00 ? 59  ASP A H    2  
ATOM 2773  H HA   . ASP A 1 60  ? -1.466  4.672   -5.606  1.00 0.00 ? 59  ASP A HA   2  
ATOM 2774  H HB2  . ASP A 1 60  ? 1.220   5.617   -5.938  1.00 0.00 ? 59  ASP A HB2  2  
ATOM 2775  H HB3  . ASP A 1 60  ? 1.250   3.984   -6.671  1.00 0.00 ? 59  ASP A HB3  2  
ATOM 2776  N N    . PRO A 1 61  ? 0.197   2.043   -4.288  1.00 0.00 ? 60  PRO A N    2  
ATOM 2777  C CA   . PRO A 1 61  ? 1.228   2.475   -3.354  1.00 0.00 ? 60  PRO A CA   2  
ATOM 2778  C C    . PRO A 1 61  ? 2.428   3.097   -3.938  1.00 0.00 ? 60  PRO A C    2  
ATOM 2779  O O    . PRO A 1 61  ? 2.596   4.297   -3.755  1.00 0.00 ? 60  PRO A O    2  
ATOM 2780  C CB   . PRO A 1 61  ? 1.483   1.332   -2.356  1.00 0.00 ? 60  PRO A CB   2  
ATOM 2781  C CG   . PRO A 1 61  ? 0.240   0.480   -2.521  1.00 0.00 ? 60  PRO A CG   2  
ATOM 2782  C CD   . PRO A 1 61  ? -0.120  0.652   -3.999  1.00 0.00 ? 60  PRO A CD   2  
ATOM 2783  H HA   . PRO A 1 61  ? 0.888   3.252   -2.724  1.00 0.00 ? 60  PRO A HA   2  
ATOM 2784  H HB2  . PRO A 1 61  ? 2.443   0.781   -2.453  1.00 0.00 ? 60  PRO A HB2  2  
ATOM 2785  H HB3  . PRO A 1 61  ? 1.504   1.723   -1.319  1.00 0.00 ? 60  PRO A HB3  2  
ATOM 2786  H HG2  . PRO A 1 61  ? 0.435   -0.556  -2.219  1.00 0.00 ? 60  PRO A HG2  2  
ATOM 2787  H HG3  . PRO A 1 61  ? -0.583  0.889   -1.893  1.00 0.00 ? 60  PRO A HG3  2  
ATOM 2788  H HD2  . PRO A 1 61  ? 0.557   0.009   -4.603  1.00 0.00 ? 60  PRO A HD2  2  
ATOM 2789  H HD3  . PRO A 1 61  ? -1.186  0.376   -4.178  1.00 0.00 ? 60  PRO A HD3  2  
ATOM 2790  N N    . ILE A 1 62  ? 3.317   2.302   -4.525  1.00 0.00 ? 61  ILE A N    2  
ATOM 2791  C CA   . ILE A 1 62  ? 4.667   2.739   -4.759  1.00 0.00 ? 61  ILE A CA   2  
ATOM 2792  C C    . ILE A 1 62  ? 4.897   3.177   -6.195  1.00 0.00 ? 61  ILE A C    2  
ATOM 2793  O O    . ILE A 1 62  ? 4.117   2.794   -7.068  1.00 0.00 ? 61  ILE A O    2  
ATOM 2794  C CB   . ILE A 1 62  ? 5.472   1.649   -4.079  1.00 0.00 ? 61  ILE A CB   2  
ATOM 2795  C CG1  . ILE A 1 62  ? 5.260   1.891   -2.572  1.00 0.00 ? 61  ILE A CG1  2  
ATOM 2796  C CG2  . ILE A 1 62  ? 6.992   1.676   -4.210  1.00 0.00 ? 61  ILE A CG2  2  
ATOM 2797  C CD1  . ILE A 1 62  ? 6.118   3.011   -1.970  1.00 0.00 ? 61  ILE A CD1  2  
ATOM 2798  H H    . ILE A 1 62  ? 3.125   1.334   -4.642  1.00 0.00 ? 61  ILE A H    2  
ATOM 2799  H HA   . ILE A 1 62  ? 4.850   3.615   -4.162  1.00 0.00 ? 61  ILE A HA   2  
ATOM 2800  H HB   . ILE A 1 62  ? 5.037   0.650   -4.372  1.00 0.00 ? 61  ILE A HB   2  
ATOM 2801  H HG12 . ILE A 1 62  ? 4.224   2.166   -2.305  1.00 0.00 ? 61  ILE A HG12 2  
ATOM 2802  H HG13 . ILE A 1 62  ? 5.509   0.939   -2.062  1.00 0.00 ? 61  ILE A HG13 2  
ATOM 2803  H HG21 . ILE A 1 62  ? 7.388   1.057   -3.371  1.00 0.00 ? 61  ILE A HG21 2  
ATOM 2804  H HG22 . ILE A 1 62  ? 7.366   2.700   -4.004  1.00 0.00 ? 61  ILE A HG22 2  
ATOM 2805  H HG23 . ILE A 1 62  ? 7.348   1.326   -5.192  1.00 0.00 ? 61  ILE A HG23 2  
ATOM 2806  H HD11 . ILE A 1 62  ? 6.416   3.793   -2.693  1.00 0.00 ? 61  ILE A HD11 2  
ATOM 2807  H HD12 . ILE A 1 62  ? 7.054   2.542   -1.614  1.00 0.00 ? 61  ILE A HD12 2  
ATOM 2808  H HD13 . ILE A 1 62  ? 5.614   3.500   -1.113  1.00 0.00 ? 61  ILE A HD13 2  
ATOM 2809  N N    . PRO A 1 63  ? 5.919   4.031   -6.500  1.00 0.00 ? 62  PRO A N    2  
ATOM 2810  C CA   . PRO A 1 63  ? 6.104   4.729   -7.778  1.00 0.00 ? 62  PRO A CA   2  
ATOM 2811  C C    . PRO A 1 63  ? 6.346   3.762   -8.932  1.00 0.00 ? 62  PRO A C    2  
ATOM 2812  O O    . PRO A 1 63  ? 7.310   3.010   -8.927  1.00 0.00 ? 62  PRO A O    2  
ATOM 2813  C CB   . PRO A 1 63  ? 7.263   5.722   -7.490  1.00 0.00 ? 62  PRO A CB   2  
ATOM 2814  C CG   . PRO A 1 63  ? 7.159   5.965   -5.986  1.00 0.00 ? 62  PRO A CG   2  
ATOM 2815  C CD   . PRO A 1 63  ? 6.793   4.607   -5.491  1.00 0.00 ? 62  PRO A CD   2  
ATOM 2816  H HA   . PRO A 1 63  ? 5.197   5.277   -7.997  1.00 0.00 ? 62  PRO A HA   2  
ATOM 2817  H HB2  . PRO A 1 63  ? 8.255   5.268   -7.702  1.00 0.00 ? 62  PRO A HB2  2  
ATOM 2818  H HB3  . PRO A 1 63  ? 7.157   6.656   -8.077  1.00 0.00 ? 62  PRO A HB3  2  
ATOM 2819  H HG2  . PRO A 1 63  ? 8.033   6.325   -5.413  1.00 0.00 ? 62  PRO A HG2  2  
ATOM 2820  H HG3  . PRO A 1 63  ? 6.277   6.561   -5.714  1.00 0.00 ? 62  PRO A HG3  2  
ATOM 2821  H HD2  . PRO A 1 63  ? 7.715   4.028   -5.348  1.00 0.00 ? 62  PRO A HD2  2  
ATOM 2822  H HD3  . PRO A 1 63  ? 6.318   4.734   -4.515  1.00 0.00 ? 62  PRO A HD3  2  
ATOM 2823  N N    . LEU A 1 64  ? 5.443   3.754   -9.925  1.00 0.00 ? 63  LEU A N    2  
ATOM 2824  C CA   . LEU A 1 64  ? 5.173   2.857   -11.040 1.00 0.00 ? 63  LEU A CA   2  
ATOM 2825  C C    . LEU A 1 64  ? 6.203   2.125   -11.888 1.00 0.00 ? 63  LEU A C    2  
ATOM 2826  O O    . LEU A 1 64  ? 5.873   1.615   -12.949 1.00 0.00 ? 63  LEU A O    2  
ATOM 2827  C CB   . LEU A 1 64  ? 3.971   3.458   -11.798 1.00 0.00 ? 63  LEU A CB   2  
ATOM 2828  C CG   . LEU A 1 64  ? 2.680   3.216   -10.980 1.00 0.00 ? 63  LEU A CG   2  
ATOM 2829  C CD1  . LEU A 1 64  ? 1.823   4.474   -10.752 1.00 0.00 ? 63  LEU A CD1  2  
ATOM 2830  C CD2  . LEU A 1 64  ? 1.922   2.065   -11.646 1.00 0.00 ? 63  LEU A CD2  2  
ATOM 2831  H H    . LEU A 1 64  ? 4.667   4.376   -9.835  1.00 0.00 ? 63  LEU A H    2  
ATOM 2832  H HA   . LEU A 1 64  ? 4.816   1.956   -10.548 1.00 0.00 ? 63  LEU A HA   2  
ATOM 2833  H HB2  . LEU A 1 64  ? 4.142   4.548   -11.933 1.00 0.00 ? 63  LEU A HB2  2  
ATOM 2834  H HB3  . LEU A 1 64  ? 3.832   3.012   -12.809 1.00 0.00 ? 63  LEU A HB3  2  
ATOM 2835  H HG   . LEU A 1 64  ? 2.961   2.858   -9.957  1.00 0.00 ? 63  LEU A HG   2  
ATOM 2836  H HD11 . LEU A 1 64  ? 2.396   5.255   -10.210 1.00 0.00 ? 63  LEU A HD11 2  
ATOM 2837  H HD12 . LEU A 1 64  ? 0.954   4.226   -10.105 1.00 0.00 ? 63  LEU A HD12 2  
ATOM 2838  H HD13 . LEU A 1 64  ? 1.455   4.885   -11.714 1.00 0.00 ? 63  LEU A HD13 2  
ATOM 2839  H HD21 . LEU A 1 64  ? 1.681   2.310   -12.703 1.00 0.00 ? 63  LEU A HD21 2  
ATOM 2840  H HD22 . LEU A 1 64  ? 0.988   1.817   -11.109 1.00 0.00 ? 63  LEU A HD22 2  
ATOM 2841  H HD23 . LEU A 1 64  ? 2.575   1.162   -11.651 1.00 0.00 ? 63  LEU A HD23 2  
ATOM 2842  N N    . ASP A 1 65  ? 7.461   2.060   -11.423 1.00 0.00 ? 64  ASP A N    2  
ATOM 2843  C CA   . ASP A 1 65  ? 8.548   1.237   -11.954 1.00 0.00 ? 64  ASP A CA   2  
ATOM 2844  C C    . ASP A 1 65  ? 9.604   1.160   -10.872 1.00 0.00 ? 64  ASP A C    2  
ATOM 2845  O O    . ASP A 1 65  ? 10.781  1.461   -11.054 1.00 0.00 ? 64  ASP A O    2  
ATOM 2846  C CB   . ASP A 1 65  ? 8.992   1.788   -13.308 1.00 0.00 ? 64  ASP A CB   2  
ATOM 2847  C CG   . ASP A 1 65  ? 9.942   0.880   -14.091 1.00 0.00 ? 64  ASP A CG   2  
ATOM 2848  O OD1  . ASP A 1 65  ? 9.556   -0.288  -14.362 1.00 0.00 ? 64  ASP A OD1  2  
ATOM 2849  O OD2  . ASP A 1 65  ? 11.062  1.346   -14.430 1.00 0.00 ? 64  ASP A OD2  2  
ATOM 2850  H H    . ASP A 1 65  ? 7.587   2.496   -10.526 1.00 0.00 ? 64  ASP A H    2  
ATOM 2851  H HA   . ASP A 1 65  ? 8.192   0.234   -12.123 1.00 0.00 ? 64  ASP A HA   2  
ATOM 2852  H HB2  . ASP A 1 65  ? 8.004   1.808   -13.814 1.00 0.00 ? 64  ASP A HB2  2  
ATOM 2853  H HB3  . ASP A 1 65  ? 9.372   2.820   -13.196 1.00 0.00 ? 64  ASP A HB3  2  
ATOM 2854  N N    . THR A 1 66  ? 9.119   0.848   -9.648  1.00 0.00 ? 65  THR A N    2  
ATOM 2855  C CA   . THR A 1 66  ? 9.842   0.824   -8.404  1.00 0.00 ? 65  THR A CA   2  
ATOM 2856  C C    . THR A 1 66  ? 9.884   -0.513  -7.833  1.00 0.00 ? 65  THR A C    2  
ATOM 2857  O O    . THR A 1 66  ? 8.878   -1.174  -7.652  1.00 0.00 ? 65  THR A O    2  
ATOM 2858  C CB   . THR A 1 66  ? 9.416   1.853   -7.371  1.00 0.00 ? 65  THR A CB   2  
ATOM 2859  O OG1  . THR A 1 66  ? 9.641   3.139   -7.921  1.00 0.00 ? 65  THR A OG1  2  
ATOM 2860  C CG2  . THR A 1 66  ? 10.200  1.802   -6.055  1.00 0.00 ? 65  THR A CG2  2  
ATOM 2861  H H    . THR A 1 66  ? 8.196   0.501   -9.562  1.00 0.00 ? 65  THR A H    2  
ATOM 2862  H HA   . THR A 1 66  ? 10.863  1.011   -8.629  1.00 0.00 ? 65  THR A HA   2  
ATOM 2863  H HB   . THR A 1 66  ? 8.324   1.732   -7.153  1.00 0.00 ? 65  THR A HB   2  
ATOM 2864  H HG1  . THR A 1 66  ? 8.827   3.278   -8.449  1.00 0.00 ? 65  THR A HG1  2  
ATOM 2865  H HG21 . THR A 1 66  ? 9.915   2.666   -5.418  1.00 0.00 ? 65  THR A HG21 2  
ATOM 2866  H HG22 . THR A 1 66  ? 11.288  1.866   -6.264  1.00 0.00 ? 65  THR A HG22 2  
ATOM 2867  H HG23 . THR A 1 66  ? 9.986   0.870   -5.493  1.00 0.00 ? 65  THR A HG23 2  
ATOM 2868  N N    . GLU A 1 67  ? 11.083  -0.909  -7.433  1.00 0.00 ? 66  GLU A N    2  
ATOM 2869  C CA   . GLU A 1 67  ? 11.396  -2.146  -6.753  1.00 0.00 ? 66  GLU A CA   2  
ATOM 2870  C C    . GLU A 1 67  ? 10.761  -2.266  -5.360  1.00 0.00 ? 66  GLU A C    2  
ATOM 2871  O O    . GLU A 1 67  ? 11.305  -1.883  -4.343  1.00 0.00 ? 66  GLU A O    2  
ATOM 2872  C CB   . GLU A 1 67  ? 12.928  -2.381  -6.655  1.00 0.00 ? 66  GLU A CB   2  
ATOM 2873  C CG   . GLU A 1 67  ? 13.653  -2.229  -8.003  1.00 0.00 ? 66  GLU A CG   2  
ATOM 2874  C CD   . GLU A 1 67  ? 15.136  -2.557  -7.831  1.00 0.00 ? 66  GLU A CD   2  
ATOM 2875  O OE1  . GLU A 1 67  ? 15.448  -3.730  -7.490  1.00 0.00 ? 66  GLU A OE1  2  
ATOM 2876  O OE2  . GLU A 1 67  ? 15.976  -1.641  -8.041  1.00 0.00 ? 66  GLU A OE2  2  
ATOM 2877  H H    . GLU A 1 67  ? 11.744  -0.250  -7.710  1.00 0.00 ? 66  GLU A H    2  
ATOM 2878  H HA   . GLU A 1 67  ? 11.021  -2.911  -7.373  1.00 0.00 ? 66  GLU A HA   2  
ATOM 2879  H HB2  . GLU A 1 67  ? 13.390  -1.669  -5.937  1.00 0.00 ? 66  GLU A HB2  2  
ATOM 2880  H HB3  . GLU A 1 67  ? 13.112  -3.414  -6.280  1.00 0.00 ? 66  GLU A HB3  2  
ATOM 2881  H HG2  . GLU A 1 67  ? 13.212  -2.922  -8.750  1.00 0.00 ? 66  GLU A HG2  2  
ATOM 2882  H HG3  . GLU A 1 67  ? 13.545  -1.184  -8.367  1.00 0.00 ? 66  GLU A HG3  2  
ATOM 2883  N N    . VAL A 1 68  ? 9.589   -2.905  -5.302  1.00 0.00 ? 67  VAL A N    2  
ATOM 2884  C CA   . VAL A 1 68  ? 8.822   -3.191  -4.099  1.00 0.00 ? 67  VAL A CA   2  
ATOM 2885  C C    . VAL A 1 68  ? 8.958   -4.643  -3.834  1.00 0.00 ? 67  VAL A C    2  
ATOM 2886  O O    . VAL A 1 68  ? 9.509   -5.405  -4.613  1.00 0.00 ? 67  VAL A O    2  
ATOM 2887  C CB   . VAL A 1 68  ? 7.356   -2.753  -4.013  1.00 0.00 ? 67  VAL A CB   2  
ATOM 2888  C CG1  . VAL A 1 68  ? 7.273   -1.774  -2.830  1.00 0.00 ? 67  VAL A CG1  2  
ATOM 2889  C CG2  . VAL A 1 68  ? 6.825   -2.142  -5.320  1.00 0.00 ? 67  VAL A CG2  2  
ATOM 2890  H H    . VAL A 1 68  ? 9.252   -3.234  -6.184  1.00 0.00 ? 67  VAL A H    2  
ATOM 2891  H HA   . VAL A 1 68  ? 9.305   -2.744  -3.232  1.00 0.00 ? 67  VAL A HA   2  
ATOM 2892  H HB   . VAL A 1 68  ? 6.683   -3.595  -3.728  1.00 0.00 ? 67  VAL A HB   2  
ATOM 2893  H HG11 . VAL A 1 68  ? 7.970   -0.926  -2.988  1.00 0.00 ? 67  VAL A HG11 2  
ATOM 2894  H HG12 . VAL A 1 68  ? 7.546   -2.312  -1.890  1.00 0.00 ? 67  VAL A HG12 2  
ATOM 2895  H HG13 . VAL A 1 68  ? 6.229   -1.427  -2.678  1.00 0.00 ? 67  VAL A HG13 2  
ATOM 2896  H HG21 . VAL A 1 68  ? 7.428   -1.255  -5.610  1.00 0.00 ? 67  VAL A HG21 2  
ATOM 2897  H HG22 . VAL A 1 68  ? 5.770   -1.823  -5.174  1.00 0.00 ? 67  VAL A HG22 2  
ATOM 2898  H HG23 . VAL A 1 68  ? 6.847   -2.898  -6.134  1.00 0.00 ? 67  VAL A HG23 2  
ATOM 2899  N N    . THR A 1 69  ? 8.471   -5.060  -2.661  1.00 0.00 ? 68  THR A N    2  
ATOM 2900  C CA   . THR A 1 69  ? 8.644   -6.423  -2.160  1.00 0.00 ? 68  THR A CA   2  
ATOM 2901  C C    . THR A 1 69  ? 7.405   -7.240  -2.397  1.00 0.00 ? 68  THR A C    2  
ATOM 2902  O O    . THR A 1 69  ? 6.284   -6.768  -2.232  1.00 0.00 ? 68  THR A O    2  
ATOM 2903  C CB   . THR A 1 69  ? 9.222   -6.441  -0.750  1.00 0.00 ? 68  THR A CB   2  
ATOM 2904  O OG1  . THR A 1 69  ? 9.359   -7.735  -0.154  1.00 0.00 ? 68  THR A OG1  2  
ATOM 2905  C CG2  . THR A 1 69  ? 8.288   -5.589  0.080   1.00 0.00 ? 68  THR A CG2  2  
ATOM 2906  H H    . THR A 1 69  ? 7.931   -4.417  -2.077  1.00 0.00 ? 68  THR A H    2  
ATOM 2907  H HA   . THR A 1 69  ? 9.393   -6.938  -2.701  1.00 0.00 ? 68  THR A HA   2  
ATOM 2908  H HB   . THR A 1 69  ? 10.229  -5.961  -0.773  1.00 0.00 ? 68  THR A HB   2  
ATOM 2909  H HG1  . THR A 1 69  ? 9.577   -7.583  0.774   1.00 0.00 ? 68  THR A HG1  2  
ATOM 2910  H HG21 . THR A 1 69  ? 8.078   -4.612  -0.420  1.00 0.00 ? 68  THR A HG21 2  
ATOM 2911  H HG22 . THR A 1 69  ? 8.671   -5.428  1.108   1.00 0.00 ? 68  THR A HG22 2  
ATOM 2912  H HG23 . THR A 1 69  ? 7.317   -6.125  0.114   1.00 0.00 ? 68  THR A HG23 2  
ATOM 2913  N N    . ALA A 1 70  ? 7.614   -8.490  -2.818  1.00 0.00 ? 69  ALA A N    2  
ATOM 2914  C CA   . ALA A 1 70  ? 6.589   -9.442  -3.166  1.00 0.00 ? 69  ALA A CA   2  
ATOM 2915  C C    . ALA A 1 70  ? 6.384   -10.457 -2.060  1.00 0.00 ? 69  ALA A C    2  
ATOM 2916  O O    . ALA A 1 70  ? 7.363   -10.875 -1.440  1.00 0.00 ? 69  ALA A O    2  
ATOM 2917  C CB   . ALA A 1 70  ? 7.083   -10.100 -4.452  1.00 0.00 ? 69  ALA A CB   2  
ATOM 2918  H H    . ALA A 1 70  ? 8.578   -8.799  -2.934  1.00 0.00 ? 69  ALA A H    2  
ATOM 2919  H HA   . ALA A 1 70  ? 5.638   -8.953  -3.343  1.00 0.00 ? 69  ALA A HA   2  
ATOM 2920  H HB1  . ALA A 1 70  ? 6.409   -10.899 -4.826  1.00 0.00 ? 69  ALA A HB1  2  
ATOM 2921  H HB2  . ALA A 1 70  ? 8.108   -10.501 -4.287  1.00 0.00 ? 69  ALA A HB2  2  
ATOM 2922  H HB3  . ALA A 1 70  ? 7.171   -9.295  -5.216  1.00 0.00 ? 69  ALA A HB3  2  
ATOM 2923  N N    . LEU A 1 71  ? 5.120   -10.899 -1.756  1.00 0.00 ? 70  LEU A N    2  
ATOM 2924  C CA   . LEU A 1 71  ? 4.872   -11.935 -0.739  1.00 0.00 ? 70  LEU A CA   2  
ATOM 2925  C C    . LEU A 1 71  ? 5.383   -13.334 -1.090  1.00 0.00 ? 70  LEU A C    2  
ATOM 2926  O O    . LEU A 1 71  ? 4.878   -14.122 -1.891  1.00 0.00 ? 70  LEU A O    2  
ATOM 2927  C CB   . LEU A 1 71  ? 3.515   -11.997 -0.008  1.00 0.00 ? 70  LEU A CB   2  
ATOM 2928  C CG   . LEU A 1 71  ? 3.516   -11.223 1.338   1.00 0.00 ? 70  LEU A CG   2  
ATOM 2929  C CD1  . LEU A 1 71  ? 4.492   -11.746 2.428   1.00 0.00 ? 70  LEU A CD1  2  
ATOM 2930  C CD2  . LEU A 1 71  ? 3.741   -9.729  1.099   1.00 0.00 ? 70  LEU A CD2  2  
ATOM 2931  H H    . LEU A 1 71  ? 4.310   -10.547 -2.249  1.00 0.00 ? 70  LEU A H    2  
ATOM 2932  H HA   . LEU A 1 71  ? 5.489   -11.607 0.081   1.00 0.00 ? 70  LEU A HA   2  
ATOM 2933  H HB2  . LEU A 1 71  ? 2.716   -11.609 -0.671  1.00 0.00 ? 70  LEU A HB2  2  
ATOM 2934  H HB3  . LEU A 1 71  ? 3.258   -13.046 0.258   1.00 0.00 ? 70  LEU A HB3  2  
ATOM 2935  H HG   . LEU A 1 71  ? 2.495   -11.355 1.751   1.00 0.00 ? 70  LEU A HG   2  
ATOM 2936  H HD11 . LEU A 1 71  ? 4.275   -11.266 3.407   1.00 0.00 ? 70  LEU A HD11 2  
ATOM 2937  H HD12 . LEU A 1 71  ? 5.547   -11.498 2.183   1.00 0.00 ? 70  LEU A HD12 2  
ATOM 2938  H HD13 . LEU A 1 71  ? 4.433   -12.849 2.552   1.00 0.00 ? 70  LEU A HD13 2  
ATOM 2939  H HD21 . LEU A 1 71  ? 4.803   -9.546  0.806   1.00 0.00 ? 70  LEU A HD21 2  
ATOM 2940  H HD22 . LEU A 1 71  ? 3.530   -9.177  2.036   1.00 0.00 ? 70  LEU A HD22 2  
ATOM 2941  H HD23 . LEU A 1 71  ? 3.062   -9.347  0.307   1.00 0.00 ? 70  LEU A HD23 2  
ATOM 2942  N N    . SER A 1 72  ? 6.514   -13.529 -0.417  1.00 0.00 ? 71  SER A N    2  
ATOM 2943  C CA   . SER A 1 72  ? 7.503   -14.544 -0.294  1.00 0.00 ? 71  SER A CA   2  
ATOM 2944  C C    . SER A 1 72  ? 7.659   -14.458 1.212   1.00 0.00 ? 71  SER A C    2  
ATOM 2945  O O    . SER A 1 72  ? 7.081   -13.551 1.817   1.00 0.00 ? 71  SER A O    2  
ATOM 2946  C CB   . SER A 1 72  ? 8.737   -14.189 -1.161  1.00 0.00 ? 71  SER A CB   2  
ATOM 2947  O OG   . SER A 1 72  ? 9.827   -15.092 -0.987  1.00 0.00 ? 71  SER A OG   2  
ATOM 2948  H H    . SER A 1 72  ? 6.739   -12.815 0.255   1.00 0.00 ? 71  SER A H    2  
ATOM 2949  H HA   . SER A 1 72  ? 7.085   -15.506 -0.547  1.00 0.00 ? 71  SER A HA   2  
ATOM 2950  H HB2  . SER A 1 72  ? 8.423   -14.212 -2.229  1.00 0.00 ? 71  SER A HB2  2  
ATOM 2951  H HB3  . SER A 1 72  ? 9.051   -13.145 -0.948  1.00 0.00 ? 71  SER A HB3  2  
ATOM 2952  H HG   . SER A 1 72  ? 10.609  -14.606 -1.275  1.00 0.00 ? 71  SER A HG   2  
ATOM 2953  N N    . GLU A 1 73  ? 8.355   -15.391 1.888   1.00 0.00 ? 72  GLU A N    2  
ATOM 2954  C CA   . GLU A 1 73  ? 8.513   -15.511 3.343   1.00 0.00 ? 72  GLU A CA   2  
ATOM 2955  C C    . GLU A 1 73  ? 8.670   -14.217 4.210   1.00 0.00 ? 72  GLU A C    2  
ATOM 2956  O O    . GLU A 1 73  ? 9.278   -13.232 3.818   1.00 0.00 ? 72  GLU A O    2  
ATOM 2957  C CB   . GLU A 1 73  ? 9.771   -16.400 3.502   1.00 0.00 ? 72  GLU A CB   2  
ATOM 2958  C CG   . GLU A 1 73  ? 10.312  -16.485 4.933   1.00 0.00 ? 72  GLU A CG   2  
ATOM 2959  C CD   . GLU A 1 73  ? 11.397  -17.546 5.098   1.00 0.00 ? 72  GLU A CD   2  
ATOM 2960  O OE1  . GLU A 1 73  ? 11.777  -18.197 4.087   1.00 0.00 ? 72  GLU A OE1  2  
ATOM 2961  O OE2  . GLU A 1 73  ? 11.868  -17.718 6.255   1.00 0.00 ? 72  GLU A OE2  2  
ATOM 2962  H H    . GLU A 1 73  ? 8.811   -16.087 1.341   1.00 0.00 ? 72  GLU A H    2  
ATOM 2963  H HA   . GLU A 1 73  ? 7.647   -16.042 3.716   1.00 0.00 ? 72  GLU A HA   2  
ATOM 2964  H HB2  . GLU A 1 73  ? 9.535   -17.417 3.117   1.00 0.00 ? 72  GLU A HB2  2  
ATOM 2965  H HB3  . GLU A 1 73  ? 10.583  -15.957 2.871   1.00 0.00 ? 72  GLU A HB3  2  
ATOM 2966  H HG2  . GLU A 1 73  ? 10.738  -15.465 5.108   1.00 0.00 ? 72  GLU A HG2  2  
ATOM 2967  H HG3  . GLU A 1 73  ? 9.469   -16.674 5.632   1.00 0.00 ? 72  GLU A HG3  2  
ATOM 2968  N N    . ASP A 1 74  ? 8.094   -14.216 5.443   1.00 0.00 ? 73  ASP A N    2  
ATOM 2969  C CA   . ASP A 1 74  ? 7.804   -13.072 6.327   1.00 0.00 ? 73  ASP A CA   2  
ATOM 2970  C C    . ASP A 1 74  ? 8.803   -11.943 6.551   1.00 0.00 ? 73  ASP A C    2  
ATOM 2971  O O    . ASP A 1 74  ? 8.420   -10.791 6.376   1.00 0.00 ? 73  ASP A O    2  
ATOM 2972  C CB   . ASP A 1 74  ? 7.315   -13.555 7.725   1.00 0.00 ? 73  ASP A CB   2  
ATOM 2973  C CG   . ASP A 1 74  ? 6.141   -14.528 7.566   1.00 0.00 ? 73  ASP A CG   2  
ATOM 2974  O OD1  . ASP A 1 74  ? 5.078   -14.093 7.048   1.00 0.00 ? 73  ASP A OD1  2  
ATOM 2975  O OD2  . ASP A 1 74  ? 6.296   -15.715 7.959   1.00 0.00 ? 73  ASP A OD2  2  
ATOM 2976  H H    . ASP A 1 74  ? 7.651   -15.053 5.737   1.00 0.00 ? 73  ASP A H    2  
ATOM 2977  H HA   . ASP A 1 74  ? 6.982   -12.574 5.857   1.00 0.00 ? 73  ASP A HA   2  
ATOM 2978  H HB2  . ASP A 1 74  ? 8.142   -14.073 8.259   1.00 0.00 ? 73  ASP A HB2  2  
ATOM 2979  H HB3  . ASP A 1 74  ? 6.965   -12.705 8.353   1.00 0.00 ? 73  ASP A HB3  2  
ATOM 2980  N N    . GLU A 1 75  ? 10.085  -12.197 6.881   1.00 0.00 ? 74  GLU A N    2  
ATOM 2981  C CA   . GLU A 1 75  ? 11.122  -11.164 6.887   1.00 0.00 ? 74  GLU A CA   2  
ATOM 2982  C C    . GLU A 1 75  ? 12.136  -11.409 5.757   1.00 0.00 ? 74  GLU A C    2  
ATOM 2983  O O    . GLU A 1 75  ? 13.137  -10.713 5.626   1.00 0.00 ? 74  GLU A O    2  
ATOM 2984  C CB   . GLU A 1 75  ? 11.738  -11.064 8.312   1.00 0.00 ? 74  GLU A CB   2  
ATOM 2985  C CG   . GLU A 1 75  ? 12.768  -9.938  8.532   1.00 0.00 ? 74  GLU A CG   2  
ATOM 2986  C CD   . GLU A 1 75  ? 13.122  -9.847  10.016  1.00 0.00 ? 74  GLU A CD   2  
ATOM 2987  O OE1  . GLU A 1 75  ? 13.677  -10.842 10.554  1.00 0.00 ? 74  GLU A OE1  2  
ATOM 2988  O OE2  . GLU A 1 75  ? 12.844  -8.782  10.628  1.00 0.00 ? 74  GLU A OE2  2  
ATOM 2989  H H    . GLU A 1 75  ? 10.389  -13.126 7.063   1.00 0.00 ? 74  GLU A H    2  
ATOM 2990  H HA   . GLU A 1 75  ? 10.711  -10.183 6.669   1.00 0.00 ? 74  GLU A HA   2  
ATOM 2991  H HB2  . GLU A 1 75  ? 10.886  -10.874 9.011   1.00 0.00 ? 74  GLU A HB2  2  
ATOM 2992  H HB3  . GLU A 1 75  ? 12.193  -12.035 8.593   1.00 0.00 ? 74  GLU A HB3  2  
ATOM 2993  H HG2  . GLU A 1 75  ? 13.694  -10.155 7.956   1.00 0.00 ? 74  GLU A HG2  2  
ATOM 2994  H HG3  . GLU A 1 75  ? 12.342  -8.974  8.182   1.00 0.00 ? 74  GLU A HG3  2  
ATOM 2995  N N    . TYR A 1 76  ? 11.928  -12.484 4.943   1.00 0.00 ? 75  TYR A N    2  
ATOM 2996  C CA   . TYR A 1 76  ? 12.952  -13.033 4.047   1.00 0.00 ? 75  TYR A CA   2  
ATOM 2997  C C    . TYR A 1 76  ? 12.557  -13.006 2.574   1.00 0.00 ? 75  TYR A C    2  
ATOM 2998  O O    . TYR A 1 76  ? 13.261  -13.529 1.712   1.00 0.00 ? 75  TYR A O    2  
ATOM 2999  C CB   . TYR A 1 76  ? 13.410  -14.448 4.525   1.00 0.00 ? 75  TYR A CB   2  
ATOM 3000  C CG   . TYR A 1 76  ? 13.677  -14.473 6.022   1.00 0.00 ? 75  TYR A CG   2  
ATOM 3001  C CD1  . TYR A 1 76  ? 12.655  -14.607 6.963   1.00 0.00 ? 75  TYR A CD1  2  
ATOM 3002  C CD2  . TYR A 1 76  ? 14.967  -14.294 6.489   1.00 0.00 ? 75  TYR A CD2  2  
ATOM 3003  C CE1  . TYR A 1 76  ? 12.921  -14.556 8.314   1.00 0.00 ? 75  TYR A CE1  2  
ATOM 3004  C CE2  . TYR A 1 76  ? 15.233  -14.226 7.846   1.00 0.00 ? 75  TYR A CE2  2  
ATOM 3005  C CZ   . TYR A 1 76  ? 14.204  -14.350 8.755   1.00 0.00 ? 75  TYR A CZ   2  
ATOM 3006  O OH   . TYR A 1 76  ? 14.430  -14.231 10.140  1.00 0.00 ? 75  TYR A OH   2  
ATOM 3007  H H    . TYR A 1 76  ? 11.096  -13.028 5.038   1.00 0.00 ? 75  TYR A H    2  
ATOM 3008  H HA   . TYR A 1 76  ? 13.846  -12.419 4.088   1.00 0.00 ? 75  TYR A HA   2  
ATOM 3009  H HB2  . TYR A 1 76  ? 12.642  -15.208 4.305   1.00 0.00 ? 75  TYR A HB2  2  
ATOM 3010  H HB3  . TYR A 1 76  ? 14.345  -14.738 3.997   1.00 0.00 ? 75  TYR A HB3  2  
ATOM 3011  H HD1  . TYR A 1 76  ? 11.618  -14.664 6.657   1.00 0.00 ? 75  TYR A HD1  2  
ATOM 3012  H HD2  . TYR A 1 76  ? 15.774  -14.170 5.778   1.00 0.00 ? 75  TYR A HD2  2  
ATOM 3013  H HE1  . TYR A 1 76  ? 12.114  -14.633 9.032   1.00 0.00 ? 75  TYR A HE1  2  
ATOM 3014  H HE2  . TYR A 1 76  ? 16.248  -14.059 8.181   1.00 0.00 ? 75  TYR A HE2  2  
ATOM 3015  H HH   . TYR A 1 76  ? 15.369  -14.100 10.281  1.00 0.00 ? 75  TYR A HH   2  
ATOM 3016  N N    . PHE A 1 77  ? 11.435  -12.302 2.305   1.00 0.00 ? 76  PHE A N    2  
ATOM 3017  C CA   . PHE A 1 77  ? 10.788  -11.900 1.053   1.00 0.00 ? 76  PHE A CA   2  
ATOM 3018  C C    . PHE A 1 77  ? 11.660  -11.114 0.055   1.00 0.00 ? 76  PHE A C    2  
ATOM 3019  O O    . PHE A 1 77  ? 12.720  -10.588 0.387   1.00 0.00 ? 76  PHE A O    2  
ATOM 3020  C CB   . PHE A 1 77  ? 9.478   -11.109 1.346   1.00 0.00 ? 76  PHE A CB   2  
ATOM 3021  C CG   . PHE A 1 77  ? 9.538   -9.987  2.363   1.00 0.00 ? 76  PHE A CG   2  
ATOM 3022  C CD1  . PHE A 1 77  ? 10.674  -9.273  2.734   1.00 0.00 ? 76  PHE A CD1  2  
ATOM 3023  C CD2  . PHE A 1 77  ? 8.334   -9.641  2.943   1.00 0.00 ? 76  PHE A CD2  2  
ATOM 3024  C CE1  . PHE A 1 77  ? 10.585  -8.197  3.589   1.00 0.00 ? 76  PHE A CE1  2  
ATOM 3025  C CE2  . PHE A 1 77  ? 8.250   -8.599  3.836   1.00 0.00 ? 76  PHE A CE2  2  
ATOM 3026  C CZ   . PHE A 1 77  ? 9.367   -7.845  4.118   1.00 0.00 ? 76  PHE A CZ   2  
ATOM 3027  H H    . PHE A 1 77  ? 10.949  -12.082 3.152   1.00 0.00 ? 76  PHE A H    2  
ATOM 3028  H HA   . PHE A 1 77  ? 10.474  -12.803 0.560   1.00 0.00 ? 76  PHE A HA   2  
ATOM 3029  H HB2  . PHE A 1 77  ? 9.011   -10.701 0.423   1.00 0.00 ? 76  PHE A HB2  2  
ATOM 3030  H HB3  . PHE A 1 77  ? 8.764   -11.840 1.773   1.00 0.00 ? 76  PHE A HB3  2  
ATOM 3031  H HD1  . PHE A 1 77  ? 11.649  -9.524  2.347   1.00 0.00 ? 76  PHE A HD1  2  
ATOM 3032  H HD2  . PHE A 1 77  ? 7.440   -10.195 2.686   1.00 0.00 ? 76  PHE A HD2  2  
ATOM 3033  H HE1  . PHE A 1 77  ? 11.473  -7.633  3.848   1.00 0.00 ? 76  PHE A HE1  2  
ATOM 3034  H HE2  . PHE A 1 77  ? 7.289   -8.349  4.263   1.00 0.00 ? 76  PHE A HE2  2  
ATOM 3035  H HZ   . PHE A 1 77  ? 9.292   -6.988  4.764   1.00 0.00 ? 76  PHE A HZ   2  
ATOM 3036  N N    . SER A 1 78  ? 11.254  -11.025 -1.229  1.00 0.00 ? 77  SER A N    2  
ATOM 3037  C CA   . SER A 1 78  ? 12.131  -10.451 -2.260  1.00 0.00 ? 77  SER A CA   2  
ATOM 3038  C C    . SER A 1 78  ? 11.496  -9.335  -3.054  1.00 0.00 ? 77  SER A C    2  
ATOM 3039  O O    . SER A 1 78  ? 10.277  -9.275  -3.207  1.00 0.00 ? 77  SER A O    2  
ATOM 3040  C CB   . SER A 1 78  ? 12.648  -11.564 -3.224  1.00 0.00 ? 77  SER A CB   2  
ATOM 3041  O OG   . SER A 1 78  ? 11.583  -12.368 -3.736  1.00 0.00 ? 77  SER A OG   2  
ATOM 3042  H H    . SER A 1 78  ? 10.375  -11.398 -1.542  1.00 0.00 ? 77  SER A H    2  
ATOM 3043  H HA   . SER A 1 78  ? 13.012  -9.995  -1.823  1.00 0.00 ? 77  SER A HA   2  
ATOM 3044  H HB2  . SER A 1 78  ? 13.268  -11.158 -4.056  1.00 0.00 ? 77  SER A HB2  2  
ATOM 3045  H HB3  . SER A 1 78  ? 13.309  -12.237 -2.635  1.00 0.00 ? 77  SER A HB3  2  
ATOM 3046  H HG   . SER A 1 78  ? 11.239  -11.934 -4.523  1.00 0.00 ? 77  SER A HG   2  
ATOM 3047  N N    . ALA A 1 79  ? 12.352  -8.424  -3.614  1.00 0.00 ? 78  ALA A N    2  
ATOM 3048  C CA   . ALA A 1 79  ? 11.948  -7.306  -4.467  1.00 0.00 ? 78  ALA A CA   2  
ATOM 3049  C C    . ALA A 1 79  ? 11.754  -7.668  -5.935  1.00 0.00 ? 78  ALA A C    2  
ATOM 3050  O O    . ALA A 1 79  ? 12.490  -8.432  -6.557  1.00 0.00 ? 78  ALA A O    2  
ATOM 3051  C CB   . ALA A 1 79  ? 12.743  -5.971  -4.259  1.00 0.00 ? 78  ALA A CB   2  
ATOM 3052  H H    . ALA A 1 79  ? 13.333  -8.497  -3.464  1.00 0.00 ? 78  ALA A H    2  
ATOM 3053  H HA   . ALA A 1 79  ? 10.950  -7.078  -4.176  1.00 0.00 ? 78  ALA A HA   2  
ATOM 3054  H HB1  . ALA A 1 79  ? 13.789  -6.052  -4.615  1.00 0.00 ? 78  ALA A HB1  2  
ATOM 3055  H HB2  . ALA A 1 79  ? 12.755  -5.705  -3.183  1.00 0.00 ? 78  ALA A HB2  2  
ATOM 3056  H HB3  . ALA A 1 79  ? 12.269  -5.085  -4.761  1.00 0.00 ? 78  ALA A HB3  2  
ATOM 3057  N N    . GLY A 1 80  ? 10.677  -7.075  -6.481  1.00 0.00 ? 79  GLY A N    2  
ATOM 3058  C CA   . GLY A 1 80  ? 10.207  -7.125  -7.842  1.00 0.00 ? 79  GLY A CA   2  
ATOM 3059  C C    . GLY A 1 80  ? 9.805   -5.731  -8.055  1.00 0.00 ? 79  GLY A C    2  
ATOM 3060  O O    . GLY A 1 80  ? 10.155  -4.865  -7.279  1.00 0.00 ? 79  GLY A O    2  
ATOM 3061  H H    . GLY A 1 80  ? 10.151  -6.430  -5.899  1.00 0.00 ? 79  GLY A H    2  
ATOM 3062  H HA2  . GLY A 1 80  ? 11.033  -7.359  -8.536  1.00 0.00 ? 79  GLY A HA2  2  
ATOM 3063  H HA3  . GLY A 1 80  ? 9.265   -7.655  -7.895  1.00 0.00 ? 79  GLY A HA3  2  
ATOM 3064  N N    . VAL A 1 81  ? 9.088   -5.422  -9.120  1.00 0.00 ? 80  VAL A N    2  
ATOM 3065  C CA   . VAL A 1 81  ? 8.809   -4.052  -9.463  1.00 0.00 ? 80  VAL A CA   2  
ATOM 3066  C C    . VAL A 1 81  ? 7.358   -3.819  -9.506  1.00 0.00 ? 80  VAL A C    2  
ATOM 3067  O O    . VAL A 1 81  ? 6.631   -4.599  -10.095 1.00 0.00 ? 80  VAL A O    2  
ATOM 3068  C CB   . VAL A 1 81  ? 9.507   -3.821  -10.806 1.00 0.00 ? 80  VAL A CB   2  
ATOM 3069  C CG1  . VAL A 1 81  ? 8.985   -2.666  -11.683 1.00 0.00 ? 80  VAL A CG1  2  
ATOM 3070  C CG2  . VAL A 1 81  ? 10.965  -3.544  -10.433 1.00 0.00 ? 80  VAL A CG2  2  
ATOM 3071  H H    . VAL A 1 81  ? 8.824   -6.144  -9.768  1.00 0.00 ? 80  VAL A H    2  
ATOM 3072  H HA   . VAL A 1 81  ? 9.145   -3.323  -8.744  1.00 0.00 ? 80  VAL A HA   2  
ATOM 3073  H HB   . VAL A 1 81  ? 9.461   -4.776  -11.389 1.00 0.00 ? 80  VAL A HB   2  
ATOM 3074  H HG11 . VAL A 1 81  ? 7.971   -2.886  -12.079 1.00 0.00 ? 80  VAL A HG11 2  
ATOM 3075  H HG12 . VAL A 1 81  ? 9.657   -2.511  -12.553 1.00 0.00 ? 80  VAL A HG12 2  
ATOM 3076  H HG13 . VAL A 1 81  ? 8.950   -1.723  -11.100 1.00 0.00 ? 80  VAL A HG13 2  
ATOM 3077  H HG21 . VAL A 1 81  ? 11.572  -3.421  -11.349 1.00 0.00 ? 80  VAL A HG21 2  
ATOM 3078  H HG22 . VAL A 1 81  ? 11.358  -4.391  -9.822  1.00 0.00 ? 80  VAL A HG22 2  
ATOM 3079  H HG23 . VAL A 1 81  ? 10.998  -2.598  -9.846  1.00 0.00 ? 80  VAL A HG23 2  
ATOM 3080  N N    . VAL A 1 82  ? 6.877   -2.662  -8.970  1.00 0.00 ? 81  VAL A N    2  
ATOM 3081  C CA   . VAL A 1 82  ? 5.539   -2.172  -9.310  1.00 0.00 ? 81  VAL A CA   2  
ATOM 3082  C C    . VAL A 1 82  ? 5.621   -1.566  -10.711 1.00 0.00 ? 81  VAL A C    2  
ATOM 3083  O O    . VAL A 1 82  ? 6.563   -0.808  -10.957 1.00 0.00 ? 81  VAL A O    2  
ATOM 3084  C CB   . VAL A 1 82  ? 5.059   -1.078  -8.339  1.00 0.00 ? 81  VAL A CB   2  
ATOM 3085  C CG1  . VAL A 1 82  ? 5.936   0.194   -8.324  1.00 0.00 ? 81  VAL A CG1  2  
ATOM 3086  C CG2  . VAL A 1 82  ? 3.643   -0.586  -8.662  1.00 0.00 ? 81  VAL A CG2  2  
ATOM 3087  H H    . VAL A 1 82  ? 7.479   -2.033  -8.437  1.00 0.00 ? 81  VAL A H    2  
ATOM 3088  H HA   . VAL A 1 82  ? 4.868   -3.031  -9.375  1.00 0.00 ? 81  VAL A HA   2  
ATOM 3089  H HB   . VAL A 1 82  ? 5.042   -1.514  -7.315  1.00 0.00 ? 81  VAL A HB   2  
ATOM 3090  H HG11 . VAL A 1 82  ? 5.378   0.954   -7.743  1.00 0.00 ? 81  VAL A HG11 2  
ATOM 3091  H HG12 . VAL A 1 82  ? 6.099   0.646   -9.339  1.00 0.00 ? 81  VAL A HG12 2  
ATOM 3092  H HG13 . VAL A 1 82  ? 6.911   0.021   -7.852  1.00 0.00 ? 81  VAL A HG13 2  
ATOM 3093  H HG21 . VAL A 1 82  ? 2.956   -1.445  -8.801  1.00 0.00 ? 81  VAL A HG21 2  
ATOM 3094  H HG22 . VAL A 1 82  ? 3.690   0.051   -9.581  1.00 0.00 ? 81  VAL A HG22 2  
ATOM 3095  H HG23 . VAL A 1 82  ? 3.290   0.048   -7.808  1.00 0.00 ? 81  VAL A HG23 2  
ATOM 3096  N N    . LYS A 1 83  ? 4.701   -1.949  -11.637 1.00 0.00 ? 82  LYS A N    2  
ATOM 3097  C CA   . LYS A 1 83  ? 4.740   -1.444  -13.003 1.00 0.00 ? 82  LYS A CA   2  
ATOM 3098  C C    . LYS A 1 83  ? 3.433   -0.806  -13.436 1.00 0.00 ? 82  LYS A C    2  
ATOM 3099  O O    . LYS A 1 83  ? 3.412   0.217   -14.114 1.00 0.00 ? 82  LYS A O    2  
ATOM 3100  C CB   . LYS A 1 83  ? 5.163   -2.551  -13.991 1.00 0.00 ? 82  LYS A CB   2  
ATOM 3101  C CG   . LYS A 1 83  ? 5.880   -2.006  -15.237 1.00 0.00 ? 82  LYS A CG   2  
ATOM 3102  C CD   . LYS A 1 83  ? 6.451   -3.115  -16.126 1.00 0.00 ? 82  LYS A CD   2  
ATOM 3103  C CE   . LYS A 1 83  ? 7.321   -2.552  -17.259 1.00 0.00 ? 82  LYS A CE   2  
ATOM 3104  N NZ   . LYS A 1 83  ? 7.798   -3.626  -18.158 1.00 0.00 ? 82  LYS A NZ   2  
ATOM 3105  H H    . LYS A 1 83  ? 3.994   -2.634  -11.432 1.00 0.00 ? 82  LYS A H    2  
ATOM 3106  H HA   . LYS A 1 83  ? 5.473   -0.652  -13.079 1.00 0.00 ? 82  LYS A HA   2  
ATOM 3107  H HB2  . LYS A 1 83  ? 5.883   -3.219  -13.464 1.00 0.00 ? 82  LYS A HB2  2  
ATOM 3108  H HB3  . LYS A 1 83  ? 4.281   -3.164  -14.277 1.00 0.00 ? 82  LYS A HB3  2  
ATOM 3109  H HG2  . LYS A 1 83  ? 5.176   -1.386  -15.837 1.00 0.00 ? 82  LYS A HG2  2  
ATOM 3110  H HG3  . LYS A 1 83  ? 6.713   -1.342  -14.906 1.00 0.00 ? 82  LYS A HG3  2  
ATOM 3111  H HD2  . LYS A 1 83  ? 7.052   -3.820  -15.509 1.00 0.00 ? 82  LYS A HD2  2  
ATOM 3112  H HD3  . LYS A 1 83  ? 5.600   -3.675  -16.564 1.00 0.00 ? 82  LYS A HD3  2  
ATOM 3113  H HE2  . LYS A 1 83  ? 6.737   -1.835  -17.874 1.00 0.00 ? 82  LYS A HE2  2  
ATOM 3114  H HE3  . LYS A 1 83  ? 8.213   -2.037  -16.842 1.00 0.00 ? 82  LYS A HE3  2  
ATOM 3115  H HZ1  . LYS A 1 83  ? 8.358   -4.312  -17.611 1.00 0.00 ? 82  LYS A HZ1  2  
ATOM 3116  H HZ2  . LYS A 1 83  ? 8.388   -3.215  -18.908 1.00 0.00 ? 82  LYS A HZ2  2  
ATOM 3117  H HZ3  . LYS A 1 83  ? 6.981   -4.109  -18.584 1.00 0.00 ? 82  LYS A HZ3  2  
ATOM 3118  N N    . GLY A 1 84  ? 2.276   -1.406  -13.057 1.00 0.00 ? 83  GLY A N    2  
ATOM 3119  C CA   . GLY A 1 84  ? 0.957   -0.900  -13.441 1.00 0.00 ? 83  GLY A CA   2  
ATOM 3120  C C    . GLY A 1 84  ? -0.108  -1.470  -12.543 1.00 0.00 ? 83  GLY A C    2  
ATOM 3121  O O    . GLY A 1 84  ? -0.007  -2.626  -12.108 1.00 0.00 ? 83  GLY A O    2  
ATOM 3122  H H    . GLY A 1 84  ? 2.275   -2.256  -12.531 1.00 0.00 ? 83  GLY A H    2  
ATOM 3123  H HA2  . GLY A 1 84  ? 0.930   0.178   -13.350 1.00 0.00 ? 83  GLY A HA2  2  
ATOM 3124  H HA3  . GLY A 1 84  ? 0.750   -1.252  -14.443 1.00 0.00 ? 83  GLY A HA3  2  
ATOM 3125  N N    . HIS A 1 85  ? -1.184  -0.698  -12.236 1.00 0.00 ? 84  HIS A N    2  
ATOM 3126  C CA   . HIS A 1 85  ? -2.244  -1.174  -11.351 1.00 0.00 ? 84  HIS A CA   2  
ATOM 3127  C C    . HIS A 1 85  ? -3.653  -0.736  -11.664 1.00 0.00 ? 84  HIS A C    2  
ATOM 3128  O O    . HIS A 1 85  ? -3.913  0.315   -12.253 1.00 0.00 ? 84  HIS A O    2  
ATOM 3129  C CB   . HIS A 1 85  ? -1.913  -0.946  -9.854  1.00 0.00 ? 84  HIS A CB   2  
ATOM 3130  C CG   . HIS A 1 85  ? -1.034  0.228   -9.490  1.00 0.00 ? 84  HIS A CG   2  
ATOM 3131  N ND1  . HIS A 1 85  ? -1.394  1.559   -9.381  1.00 0.00 ? 84  HIS A ND1  2  
ATOM 3132  C CD2  . HIS A 1 85  ? 0.238   0.158   -9.023  1.00 0.00 ? 84  HIS A CD2  2  
ATOM 3133  C CE1  . HIS A 1 85  ? -0.324  2.208   -8.851  1.00 0.00 ? 84  HIS A CE1  2  
ATOM 3134  N NE2  . HIS A 1 85  ? 0.670   1.391   -8.594  1.00 0.00 ? 84  HIS A NE2  2  
ATOM 3135  H H    . HIS A 1 85  ? -1.299  0.235   -12.573 1.00 0.00 ? 84  HIS A H    2  
ATOM 3136  H HA   . HIS A 1 85  ? -2.359  -2.232  -11.511 1.00 0.00 ? 84  HIS A HA   2  
ATOM 3137  H HB2  . HIS A 1 85  ? -2.809  -0.950  -9.196  1.00 0.00 ? 84  HIS A HB2  2  
ATOM 3138  H HB3  . HIS A 1 85  ? -1.302  -1.828  -9.554  1.00 0.00 ? 84  HIS A HB3  2  
ATOM 3139  H HD1  . HIS A 1 85  ? -2.298  1.948   -9.558  1.00 0.00 ? 84  HIS A HD1  2  
ATOM 3140  H HD2  . HIS A 1 85  ? 0.879   -0.708  -8.932  1.00 0.00 ? 84  HIS A HD2  2  
ATOM 3141  H HE1  . HIS A 1 85  ? -0.209  3.285   -8.754  1.00 0.00 ? 84  HIS A HE1  2  
ATOM 3142  N N    . ARG A 1 86  ? -4.617  -1.611  -11.242 1.00 0.00 ? 85  ARG A N    2  
ATOM 3143  C CA   . ARG A 1 86  ? -6.018  -1.403  -11.477 1.00 0.00 ? 85  ARG A CA   2  
ATOM 3144  C C    . ARG A 1 86  ? -6.682  -1.737  -10.173 1.00 0.00 ? 85  ARG A C    2  
ATOM 3145  O O    . ARG A 1 86  ? -6.251  -2.638  -9.445  1.00 0.00 ? 85  ARG A O    2  
ATOM 3146  C CB   . ARG A 1 86  ? -6.520  -2.329  -12.632 1.00 0.00 ? 85  ARG A CB   2  
ATOM 3147  C CG   . ARG A 1 86  ? -7.015  -3.745  -12.242 1.00 0.00 ? 85  ARG A CG   2  
ATOM 3148  C CD   . ARG A 1 86  ? -8.547  -3.881  -12.091 1.00 0.00 ? 85  ARG A CD   2  
ATOM 3149  N NE   . ARG A 1 86  ? -9.202  -3.882  -13.451 1.00 0.00 ? 85  ARG A NE   2  
ATOM 3150  C CZ   . ARG A 1 86  ? -9.995  -2.876  -13.943 1.00 0.00 ? 85  ARG A CZ   2  
ATOM 3151  N NH1  . ARG A 1 86  ? -10.215 -1.733  -13.232 1.00 0.00 ? 85  ARG A NH1  2  
ATOM 3152  N NH2  . ARG A 1 86  ? -10.570 -3.024  -15.172 1.00 0.00 ? 85  ARG A NH2  2  
ATOM 3153  H H    . ARG A 1 86  ? -4.458  -2.486  -10.732 1.00 0.00 ? 85  ARG A H    2  
ATOM 3154  H HA   . ARG A 1 86  ? -6.239  -0.368  -11.713 1.00 0.00 ? 85  ARG A HA   2  
ATOM 3155  H HB2  . ARG A 1 86  ? -7.331  -1.805  -13.185 1.00 0.00 ? 85  ARG A HB2  2  
ATOM 3156  H HB3  . ARG A 1 86  ? -5.672  -2.457  -13.351 1.00 0.00 ? 85  ARG A HB3  2  
ATOM 3157  H HG2  . ARG A 1 86  ? -6.675  -4.458  -13.024 1.00 0.00 ? 85  ARG A HG2  2  
ATOM 3158  H HG3  . ARG A 1 86  ? -6.542  -4.053  -11.272 1.00 0.00 ? 85  ARG A HG3  2  
ATOM 3159  H HD2  . ARG A 1 86  ? -8.781  -4.858  -11.618 1.00 0.00 ? 85  ARG A HD2  2  
ATOM 3160  H HD3  . ARG A 1 86  ? -8.960  -3.081  -11.441 1.00 0.00 ? 85  ARG A HD3  2  
ATOM 3161  H HE   . ARG A 1 86  ? -9.073  -4.694  -14.020 1.00 0.00 ? 85  ARG A HE   2  
ATOM 3162  H HH11 . ARG A 1 86  ? -9.797  -1.619  -12.330 1.00 0.00 ? 85  ARG A HH11 2  
ATOM 3163  H HH12 . ARG A 1 86  ? -10.798 -1.014  -13.610 1.00 0.00 ? 85  ARG A HH12 2  
ATOM 3164  H HH21 . ARG A 1 86  ? -10.412 -3.859  -15.700 1.00 0.00 ? 85  ARG A HH21 2  
ATOM 3165  H HH22 . ARG A 1 86  ? -11.150 -2.300  -15.543 1.00 0.00 ? 85  ARG A HH22 2  
ATOM 3166  N N    . LYS A 1 87  ? -7.774  -1.048  -9.827  1.00 0.00 ? 86  LYS A N    2  
ATOM 3167  C CA   . LYS A 1 87  ? -8.598  -1.499  -8.740  1.00 0.00 ? 86  LYS A CA   2  
ATOM 3168  C C    . LYS A 1 87  ? -10.025 -1.305  -9.213  1.00 0.00 ? 86  LYS A C    2  
ATOM 3169  O O    . LYS A 1 87  ? -10.397 -0.229  -9.689  1.00 0.00 ? 86  LYS A O    2  
ATOM 3170  C CB   . LYS A 1 87  ? -8.114  -0.778  -7.479  1.00 0.00 ? 86  LYS A CB   2  
ATOM 3171  C CG   . LYS A 1 87  ? -8.960  -0.948  -6.217  1.00 0.00 ? 86  LYS A CG   2  
ATOM 3172  C CD   . LYS A 1 87  ? -8.296  -0.275  -5.013  1.00 0.00 ? 86  LYS A CD   2  
ATOM 3173  C CE   . LYS A 1 87  ? -9.068  -0.467  -3.709  1.00 0.00 ? 86  LYS A CE   2  
ATOM 3174  N NZ   . LYS A 1 87  ? -8.393  0.250   -2.606  1.00 0.00 ? 86  LYS A NZ   2  
ATOM 3175  H H    . LYS A 1 87  ? -8.151  -0.300  -10.372 1.00 0.00 ? 86  LYS A H    2  
ATOM 3176  H HA   . LYS A 1 87  ? -8.492  -2.592  -8.579  1.00 0.00 ? 86  LYS A HA   2  
ATOM 3177  H HB2  . LYS A 1 87  ? -7.094  -1.217  -7.321  1.00 0.00 ? 86  LYS A HB2  2  
ATOM 3178  H HB3  . LYS A 1 87  ? -7.976  0.299   -7.713  1.00 0.00 ? 86  LYS A HB3  2  
ATOM 3179  H HG2  . LYS A 1 87  ? -9.958  -0.477  -6.366  1.00 0.00 ? 86  LYS A HG2  2  
ATOM 3180  H HG3  . LYS A 1 87  ? -9.109  -2.030  -6.007  1.00 0.00 ? 86  LYS A HG3  2  
ATOM 3181  H HD2  . LYS A 1 87  ? -7.262  -0.674  -4.892  1.00 0.00 ? 86  LYS A HD2  2  
ATOM 3182  H HD3  . LYS A 1 87  ? -8.215  0.817   -5.221  1.00 0.00 ? 86  LYS A HD3  2  
ATOM 3183  H HE2  . LYS A 1 87  ? -10.099 -0.061  -3.795  1.00 0.00 ? 86  LYS A HE2  2  
ATOM 3184  H HE3  . LYS A 1 87  ? -9.116  -1.543  -3.438  1.00 0.00 ? 86  LYS A HE3  2  
ATOM 3185  H HZ1  . LYS A 1 87  ? -8.920  0.101   -1.721  1.00 0.00 ? 86  LYS A HZ1  2  
ATOM 3186  H HZ2  . LYS A 1 87  ? -8.358  1.267   -2.821  1.00 0.00 ? 86  LYS A HZ2  2  
ATOM 3187  H HZ3  . LYS A 1 87  ? -7.425  -0.114  -2.497  1.00 0.00 ? 86  LYS A HZ3  2  
ATOM 3188  N N    . GLU A 1 88  ? -10.845 -2.377  -9.107  1.00 0.00 ? 87  GLU A N    2  
ATOM 3189  C CA   . GLU A 1 88  ? -12.241 -2.447  -9.501  1.00 0.00 ? 87  GLU A CA   2  
ATOM 3190  C C    . GLU A 1 88  ? -13.014 -2.867  -8.261  1.00 0.00 ? 87  GLU A C    2  
ATOM 3191  O O    . GLU A 1 88  ? -12.426 -3.387  -7.314  1.00 0.00 ? 87  GLU A O    2  
ATOM 3192  C CB   . GLU A 1 88  ? -12.414 -3.435  -10.685 1.00 0.00 ? 87  GLU A CB   2  
ATOM 3193  C CG   . GLU A 1 88  ? -13.734 -3.273  -11.459 1.00 0.00 ? 87  GLU A CG   2  
ATOM 3194  C CD   . GLU A 1 88  ? -13.674 -4.075  -12.758 1.00 0.00 ? 87  GLU A CD   2  
ATOM 3195  O OE1  . GLU A 1 88  ? -13.521 -5.323  -12.681 1.00 0.00 ? 87  GLU A OE1  2  
ATOM 3196  O OE2  . GLU A 1 88  ? -13.778 -3.449  -13.847 1.00 0.00 ? 87  GLU A OE2  2  
ATOM 3197  H H    . GLU A 1 88  ? -10.496 -3.261  -8.738  1.00 0.00 ? 87  GLU A H    2  
ATOM 3198  H HA   . GLU A 1 88  ? -12.599 -1.468  -9.798  1.00 0.00 ? 87  GLU A HA   2  
ATOM 3199  H HB2  . GLU A 1 88  ? -11.574 -3.243  -11.390 1.00 0.00 ? 87  GLU A HB2  2  
ATOM 3200  H HB3  . GLU A 1 88  ? -12.296 -4.486  -10.350 1.00 0.00 ? 87  GLU A HB3  2  
ATOM 3201  H HG2  . GLU A 1 88  ? -14.589 -3.627  -10.846 1.00 0.00 ? 87  GLU A HG2  2  
ATOM 3202  H HG3  . GLU A 1 88  ? -13.890 -2.198  -11.697 1.00 0.00 ? 87  GLU A HG3  2  
ATOM 3203  N N    . SER A 1 89  ? -14.355 -2.656  -8.192  1.00 0.00 ? 88  SER A N    2  
ATOM 3204  C CA   . SER A 1 89  ? -15.245 -2.978  -7.065  1.00 0.00 ? 88  SER A CA   2  
ATOM 3205  C C    . SER A 1 89  ? -15.345 -4.465  -6.663  1.00 0.00 ? 88  SER A C    2  
ATOM 3206  O O    . SER A 1 89  ? -16.317 -5.145  -6.981  1.00 0.00 ? 88  SER A O    2  
ATOM 3207  C CB   . SER A 1 89  ? -16.670 -2.416  -7.350  1.00 0.00 ? 88  SER A CB   2  
ATOM 3208  O OG   . SER A 1 89  ? -17.199 -2.931  -8.572  1.00 0.00 ? 88  SER A OG   2  
ATOM 3209  H H    . SER A 1 89  ? -14.834 -2.250  -8.966  1.00 0.00 ? 88  SER A H    2  
ATOM 3210  H HA   . SER A 1 89  ? -14.867 -2.453  -6.197  1.00 0.00 ? 88  SER A HA   2  
ATOM 3211  H HB2  . SER A 1 89  ? -17.371 -2.630  -6.512  1.00 0.00 ? 88  SER A HB2  2  
ATOM 3212  H HB3  . SER A 1 89  ? -16.603 -1.310  -7.450  1.00 0.00 ? 88  SER A HB3  2  
ATOM 3213  H HG   . SER A 1 89  ? -17.169 -3.895  -8.461  1.00 0.00 ? 88  SER A HG   2  
ATOM 3214  N N    . GLY A 1 90  ? -14.291 -4.964  -5.966  1.00 0.00 ? 89  GLY A N    2  
ATOM 3215  C CA   . GLY A 1 90  ? -14.098 -6.338  -5.516  1.00 0.00 ? 89  GLY A CA   2  
ATOM 3216  C C    . GLY A 1 90  ? -13.010 -7.076  -6.261  1.00 0.00 ? 89  GLY A C    2  
ATOM 3217  O O    . GLY A 1 90  ? -12.804 -8.259  -6.013  1.00 0.00 ? 89  GLY A O    2  
ATOM 3218  H H    . GLY A 1 90  ? -13.531 -4.336  -5.787  1.00 0.00 ? 89  GLY A H    2  
ATOM 3219  H HA2  . GLY A 1 90  ? -13.786 -6.291  -4.483  1.00 0.00 ? 89  GLY A HA2  2  
ATOM 3220  H HA3  . GLY A 1 90  ? -15.008 -6.911  -5.647  1.00 0.00 ? 89  GLY A HA3  2  
ATOM 3221  N N    . GLU A 1 91  ? -12.286 -6.412  -7.213  1.00 0.00 ? 90  GLU A N    2  
ATOM 3222  C CA   . GLU A 1 91  ? -11.246 -6.991  -8.024  1.00 0.00 ? 90  GLU A CA   2  
ATOM 3223  C C    . GLU A 1 91  ? -10.052 -6.070  -7.880  1.00 0.00 ? 90  GLU A C    2  
ATOM 3224  O O    . GLU A 1 91  ? -10.065 -4.933  -8.350  1.00 0.00 ? 90  GLU A O    2  
ATOM 3225  C CB   . GLU A 1 91  ? -11.647 -7.081  -9.523  1.00 0.00 ? 90  GLU A CB   2  
ATOM 3226  C CG   . GLU A 1 91  ? -13.141 -7.304  -9.845  1.00 0.00 ? 90  GLU A CG   2  
ATOM 3227  C CD   . GLU A 1 91  ? -13.639 -8.669  -9.372  1.00 0.00 ? 90  GLU A CD   2  
ATOM 3228  O OE1  . GLU A 1 91  ? -12.986 -9.691  -9.712  1.00 0.00 ? 90  GLU A OE1  2  
ATOM 3229  O OE2  . GLU A 1 91  ? -14.691 -8.710  -8.679  1.00 0.00 ? 90  GLU A OE2  2  
ATOM 3230  H H    . GLU A 1 91  ? -12.387 -5.446  -7.462  1.00 0.00 ? 90  GLU A H    2  
ATOM 3231  H HA   . GLU A 1 91  ? -10.968 -7.977  -7.665  1.00 0.00 ? 90  GLU A HA   2  
ATOM 3232  H HB2  . GLU A 1 91  ? -11.372 -6.165  -10.098 1.00 0.00 ? 90  GLU A HB2  2  
ATOM 3233  H HB3  . GLU A 1 91  ? -11.061 -7.905  -9.946  1.00 0.00 ? 90  GLU A HB3  2  
ATOM 3234  H HG2  . GLU A 1 91  ? -13.735 -6.477  -9.400  1.00 0.00 ? 90  GLU A HG2  2  
ATOM 3235  H HG3  . GLU A 1 91  ? -13.263 -7.253  -10.947 1.00 0.00 ? 90  GLU A HG3  2  
ATOM 3236  N N    . LEU A 1 92  ? -8.967  -6.530  -7.224  1.00 0.00 ? 91  LEU A N    2  
ATOM 3237  C CA   . LEU A 1 92  ? -7.781  -5.731  -6.993  1.00 0.00 ? 91  LEU A CA   2  
ATOM 3238  C C    . LEU A 1 92  ? -6.652  -6.369  -7.731  1.00 0.00 ? 91  LEU A C    2  
ATOM 3239  O O    . LEU A 1 92  ? -6.331  -7.510  -7.391  1.00 0.00 ? 91  LEU A O    2  
ATOM 3240  C CB   . LEU A 1 92  ? -7.403  -5.799  -5.481  1.00 0.00 ? 91  LEU A CB   2  
ATOM 3241  C CG   . LEU A 1 92  ? -7.096  -4.404  -4.911  1.00 0.00 ? 91  LEU A CG   2  
ATOM 3242  C CD1  . LEU A 1 92  ? -7.224  -4.411  -3.383  1.00 0.00 ? 91  LEU A CD1  2  
ATOM 3243  C CD2  . LEU A 1 92  ? -5.750  -3.827  -5.381  1.00 0.00 ? 91  LEU A CD2  2  
ATOM 3244  H H    . LEU A 1 92  ? -8.917  -7.458  -6.867  1.00 0.00 ? 91  LEU A H    2  
ATOM 3245  H HA   . LEU A 1 92  ? -7.918  -4.703  -7.338  1.00 0.00 ? 91  LEU A HA   2  
ATOM 3246  H HB2  . LEU A 1 92  ? -8.312  -6.159  -4.946  1.00 0.00 ? 91  LEU A HB2  2  
ATOM 3247  H HB3  . LEU A 1 92  ? -6.592  -6.552  -5.223  1.00 0.00 ? 91  LEU A HB3  2  
ATOM 3248  H HG   . LEU A 1 92  ? -7.894  -3.718  -5.290  1.00 0.00 ? 91  LEU A HG   2  
ATOM 3249  H HD11 . LEU A 1 92  ? -6.547  -5.175  -2.950  1.00 0.00 ? 91  LEU A HD11 2  
ATOM 3250  H HD12 . LEU A 1 92  ? -8.264  -4.660  -3.088  1.00 0.00 ? 91  LEU A HD12 2  
ATOM 3251  H HD13 . LEU A 1 92  ? -6.955  -3.413  -2.975  1.00 0.00 ? 91  LEU A HD13 2  
ATOM 3252  H HD21 . LEU A 1 92  ? -5.556  -2.863  -4.861  1.00 0.00 ? 91  LEU A HD21 2  
ATOM 3253  H HD22 . LEU A 1 92  ? -5.778  -3.625  -6.473  1.00 0.00 ? 91  LEU A HD22 2  
ATOM 3254  H HD23 . LEU A 1 92  ? -4.914  -4.520  -5.170  1.00 0.00 ? 91  LEU A HD23 2  
ATOM 3255  N N    . TYR A 1 93  ? -5.969  -5.720  -8.715  1.00 0.00 ? 92  TYR A N    2  
ATOM 3256  C CA   . TYR A 1 93  ? -4.807  -6.449  -9.210  1.00 0.00 ? 92  TYR A CA   2  
ATOM 3257  C C    . TYR A 1 93  ? -3.688  -5.509  -9.567  1.00 0.00 ? 92  TYR A C    2  
ATOM 3258  O O    . TYR A 1 93  ? -3.870  -4.535  -10.298 1.00 0.00 ? 92  TYR A O    2  
ATOM 3259  C CB   . TYR A 1 93  ? -5.111  -7.623  -10.218 1.00 0.00 ? 92  TYR A CB   2  
ATOM 3260  C CG   . TYR A 1 93  ? -6.245  -7.413  -11.205 1.00 0.00 ? 92  TYR A CG   2  
ATOM 3261  C CD1  . TYR A 1 93  ? -7.571  -7.664  -10.872 1.00 0.00 ? 92  TYR A CD1  2  
ATOM 3262  C CD2  . TYR A 1 93  ? -5.965  -7.102  -12.519 1.00 0.00 ? 92  TYR A CD2  2  
ATOM 3263  C CE1  . TYR A 1 93  ? -8.575  -7.565  -11.818 1.00 0.00 ? 92  TYR A CE1  2  
ATOM 3264  C CE2  . TYR A 1 93  ? -6.952  -7.049  -13.480 1.00 0.00 ? 92  TYR A CE2  2  
ATOM 3265  C CZ   . TYR A 1 93  ? -8.265  -7.266  -13.125 1.00 0.00 ? 92  TYR A CZ   2  
ATOM 3266  O OH   . TYR A 1 93  ? -9.297  -7.187  -14.081 1.00 0.00 ? 92  TYR A OH   2  
ATOM 3267  H H    . TYR A 1 93  ? -6.122  -4.756  -9.054  1.00 0.00 ? 92  TYR A H    2  
ATOM 3268  H HA   . TYR A 1 93  ? -4.327  -6.935  -8.345  1.00 0.00 ? 92  TYR A HA   2  
ATOM 3269  H HB2  . TYR A 1 93  ? -4.205  -7.944  -10.766 1.00 0.00 ? 92  TYR A HB2  2  
ATOM 3270  H HB3  . TYR A 1 93  ? -5.417  -8.501  -9.607  1.00 0.00 ? 92  TYR A HB3  2  
ATOM 3271  H HD1  . TYR A 1 93  ? -7.827  -7.959  -9.865  1.00 0.00 ? 92  TYR A HD1  2  
ATOM 3272  H HD2  . TYR A 1 93  ? -4.948  -6.933  -12.811 1.00 0.00 ? 92  TYR A HD2  2  
ATOM 3273  H HE1  . TYR A 1 93  ? -9.609  -7.722  -11.544 1.00 0.00 ? 92  TYR A HE1  2  
ATOM 3274  H HE2  . TYR A 1 93  ? -6.671  -6.815  -14.499 1.00 0.00 ? 92  TYR A HE2  2  
ATOM 3275  H HH   . TYR A 1 93  ? -8.899  -6.933  -14.915 1.00 0.00 ? 92  TYR A HH   2  
ATOM 3276  N N    . TYR A 1 94  ? -2.489  -5.790  -8.998  1.00 0.00 ? 93  TYR A N    2  
ATOM 3277  C CA   . TYR A 1 94  ? -1.248  -5.070  -9.194  1.00 0.00 ? 93  TYR A CA   2  
ATOM 3278  C C    . TYR A 1 94  ? -0.391  -5.970  -10.072 1.00 0.00 ? 93  TYR A C    2  
ATOM 3279  O O    . TYR A 1 94  ? -0.216  -7.153  -9.781  1.00 0.00 ? 93  TYR A O    2  
ATOM 3280  C CB   . TYR A 1 94  ? -0.538  -4.661  -7.853  1.00 0.00 ? 93  TYR A CB   2  
ATOM 3281  C CG   . TYR A 1 94  ? -1.117  -3.397  -7.242  1.00 0.00 ? 93  TYR A CG   2  
ATOM 3282  C CD1  . TYR A 1 94  ? -2.485  -3.281  -7.036  1.00 0.00 ? 93  TYR A CD1  2  
ATOM 3283  C CD2  . TYR A 1 94  ? -0.319  -2.287  -6.944  1.00 0.00 ? 93  TYR A CD2  2  
ATOM 3284  C CE1  . TYR A 1 94  ? -3.070  -2.085  -6.694  1.00 0.00 ? 93  TYR A CE1  2  
ATOM 3285  C CE2  . TYR A 1 94  ? -0.925  -1.084  -6.623  1.00 0.00 ? 93  TYR A CE2  2  
ATOM 3286  C CZ   . TYR A 1 94  ? -2.293  -0.978  -6.518  1.00 0.00 ? 93  TYR A CZ   2  
ATOM 3287  O OH   . TYR A 1 94  ? -2.947  0.246   -6.311  1.00 0.00 ? 93  TYR A OH   2  
ATOM 3288  H H    . TYR A 1 94  ? -2.411  -6.566  -8.354  1.00 0.00 ? 93  TYR A H    2  
ATOM 3289  H HA   . TYR A 1 94  ? -1.414  -4.173  -9.750  1.00 0.00 ? 93  TYR A HA   2  
ATOM 3290  H HB2  . TYR A 1 94  ? -0.597  -5.475  -7.105  1.00 0.00 ? 93  TYR A HB2  2  
ATOM 3291  H HB3  . TYR A 1 94  ? 0.525   -4.438  -8.050  1.00 0.00 ? 93  TYR A HB3  2  
ATOM 3292  H HD1  . TYR A 1 94  ? -3.154  -4.110  -7.197  1.00 0.00 ? 93  TYR A HD1  2  
ATOM 3293  H HD2  . TYR A 1 94  ? 0.775   -2.281  -7.023  1.00 0.00 ? 93  TYR A HD2  2  
ATOM 3294  H HE1  . TYR A 1 94  ? -4.146  -2.001  -6.639  1.00 0.00 ? 93  TYR A HE1  2  
ATOM 3295  H HE2  . TYR A 1 94  ? -0.318  -0.195  -6.541  1.00 0.00 ? 93  TYR A HE2  2  
ATOM 3296  H HH   . TYR A 1 94  ? -2.275  0.961   -6.239  1.00 0.00 ? 93  TYR A HH   2  
ATOM 3297  N N    . SER A 1 95  ? 0.159   -5.412  -11.190 1.00 0.00 ? 94  SER A N    2  
ATOM 3298  C CA   . SER A 1 95  ? 1.044   -6.080  -12.138 1.00 0.00 ? 94  SER A CA   2  
ATOM 3299  C C    . SER A 1 95  ? 2.456   -5.826  -11.662 1.00 0.00 ? 94  SER A C    2  
ATOM 3300  O O    . SER A 1 95  ? 3.059   -4.764  -11.858 1.00 0.00 ? 94  SER A O    2  
ATOM 3301  C CB   . SER A 1 95  ? 0.816   -5.677  -13.626 1.00 0.00 ? 94  SER A CB   2  
ATOM 3302  O OG   . SER A 1 95  ? 0.998   -4.295  -13.924 1.00 0.00 ? 94  SER A OG   2  
ATOM 3303  H H    . SER A 1 95  ? -0.009  -4.447  -11.398 1.00 0.00 ? 94  SER A H    2  
ATOM 3304  H HA   . SER A 1 95  ? 0.868   -7.153  -12.079 1.00 0.00 ? 94  SER A HA   2  
ATOM 3305  H HB2  . SER A 1 95  ? 1.477   -6.261  -14.297 1.00 0.00 ? 94  SER A HB2  2  
ATOM 3306  H HB3  . SER A 1 95  ? -0.222  -5.945  -13.898 1.00 0.00 ? 94  SER A HB3  2  
ATOM 3307  H HG   . SER A 1 95  ? 0.710   -3.740  -13.170 1.00 0.00 ? 94  SER A HG   2  
ATOM 3308  N N    . ILE A 1 96  ? 2.948   -6.829  -10.907 1.00 0.00 ? 95  ILE A N    2  
ATOM 3309  C CA   . ILE A 1 96  ? 4.206   -6.796  -10.197 1.00 0.00 ? 95  ILE A CA   2  
ATOM 3310  C C    . ILE A 1 96  ? 5.164   -7.534  -11.071 1.00 0.00 ? 95  ILE A C    2  
ATOM 3311  O O    . ILE A 1 96  ? 4.938   -8.693  -11.410 1.00 0.00 ? 95  ILE A O    2  
ATOM 3312  C CB   . ILE A 1 96  ? 4.001   -7.384  -8.809  1.00 0.00 ? 95  ILE A CB   2  
ATOM 3313  C CG1  . ILE A 1 96  ? 2.868   -6.573  -8.124  1.00 0.00 ? 95  ILE A CG1  2  
ATOM 3314  C CG2  . ILE A 1 96  ? 5.285   -7.391  -7.940  1.00 0.00 ? 95  ILE A CG2  2  
ATOM 3315  C CD1  . ILE A 1 96  ? 3.111   -5.056  -8.028  1.00 0.00 ? 95  ILE A CD1  2  
ATOM 3316  H H    . ILE A 1 96  ? 2.398   -7.679  -10.781 1.00 0.00 ? 95  ILE A H    2  
ATOM 3317  H HA   . ILE A 1 96  ? 4.572   -5.787  -10.097 1.00 0.00 ? 95  ILE A HA   2  
ATOM 3318  H HB   . ILE A 1 96  ? 3.638   -8.437  -8.905  1.00 0.00 ? 95  ILE A HB   2  
ATOM 3319  H HG12 . ILE A 1 96  ? 1.904   -6.765  -8.632  1.00 0.00 ? 95  ILE A HG12 2  
ATOM 3320  H HG13 . ILE A 1 96  ? 2.732   -6.982  -7.106  1.00 0.00 ? 95  ILE A HG13 2  
ATOM 3321  H HG21 . ILE A 1 96  ? 5.049   -7.828  -6.944  1.00 0.00 ? 95  ILE A HG21 2  
ATOM 3322  H HG22 . ILE A 1 96  ? 5.644   -6.357  -7.751  1.00 0.00 ? 95  ILE A HG22 2  
ATOM 3323  H HG23 . ILE A 1 96  ? 6.112   -7.970  -8.397  1.00 0.00 ? 95  ILE A HG23 2  
ATOM 3324  H HD11 . ILE A 1 96  ? 2.990   -4.562  -9.015  1.00 0.00 ? 95  ILE A HD11 2  
ATOM 3325  H HD12 . ILE A 1 96  ? 4.132   -4.845  -7.648  1.00 0.00 ? 95  ILE A HD12 2  
ATOM 3326  H HD13 . ILE A 1 96  ? 2.408   -4.589  -7.309  1.00 0.00 ? 95  ILE A HD13 2  
ATOM 3327  N N    . GLU A 1 97  ? 6.257   -6.868  -11.522 1.00 0.00 ? 96  GLU A N    2  
ATOM 3328  C CA   . GLU A 1 97  ? 7.199   -7.503  -12.458 1.00 0.00 ? 96  GLU A CA   2  
ATOM 3329  C C    . GLU A 1 97  ? 8.239   -8.269  -11.667 1.00 0.00 ? 96  GLU A C    2  
ATOM 3330  O O    . GLU A 1 97  ? 8.949   -7.707  -10.839 1.00 0.00 ? 96  GLU A O    2  
ATOM 3331  C CB   . GLU A 1 97  ? 7.793   -6.521  -13.495 1.00 0.00 ? 96  GLU A CB   2  
ATOM 3332  C CG   . GLU A 1 97  ? 8.497   -7.241  -14.661 1.00 0.00 ? 96  GLU A CG   2  
ATOM 3333  C CD   . GLU A 1 97  ? 8.852   -6.243  -15.760 1.00 0.00 ? 96  GLU A CD   2  
ATOM 3334  O OE1  . GLU A 1 97  ? 9.605   -5.276  -15.467 1.00 0.00 ? 96  GLU A OE1  2  
ATOM 3335  O OE2  . GLU A 1 97  ? 8.376   -6.441  -16.910 1.00 0.00 ? 96  GLU A OE2  2  
ATOM 3336  H H    . GLU A 1 97  ? 6.402   -5.911  -11.187 1.00 0.00 ? 96  GLU A H    2  
ATOM 3337  H HA   . GLU A 1 97  ? 6.649   -8.250  -13.015 1.00 0.00 ? 96  GLU A HA   2  
ATOM 3338  H HB2  . GLU A 1 97  ? 6.944   -5.925  -13.907 1.00 0.00 ? 96  GLU A HB2  2  
ATOM 3339  H HB3  . GLU A 1 97  ? 8.497   -5.821  -13.003 1.00 0.00 ? 96  GLU A HB3  2  
ATOM 3340  H HG2  . GLU A 1 97  ? 9.424   -7.738  -14.305 1.00 0.00 ? 96  GLU A HG2  2  
ATOM 3341  H HG3  . GLU A 1 97  ? 7.818   -8.019  -15.074 1.00 0.00 ? 96  GLU A HG3  2  
ATOM 3342  N N    . LYS A 1 98  ? 8.227   -9.612  -11.808 1.00 0.00 ? 97  LYS A N    2  
ATOM 3343  C CA   . LYS A 1 98  ? 8.850   -10.455 -10.804 1.00 0.00 ? 97  LYS A CA   2  
ATOM 3344  C C    . LYS A 1 98  ? 9.521   -11.642 -11.421 1.00 0.00 ? 97  LYS A C    2  
ATOM 3345  O O    . LYS A 1 98  ? 8.893   -12.404 -12.154 1.00 0.00 ? 97  LYS A O    2  
ATOM 3346  C CB   . LYS A 1 98  ? 7.669   -10.987 -9.947  1.00 0.00 ? 97  LYS A CB   2  
ATOM 3347  C CG   . LYS A 1 98  ? 7.921   -11.457 -8.498  1.00 0.00 ? 97  LYS A CG   2  
ATOM 3348  C CD   . LYS A 1 98  ? 8.947   -12.562 -8.226  1.00 0.00 ? 97  LYS A CD   2  
ATOM 3349  C CE   . LYS A 1 98  ? 8.807   -13.095 -6.796  1.00 0.00 ? 97  LYS A CE   2  
ATOM 3350  N NZ   . LYS A 1 98  ? 9.899   -14.029 -6.445  1.00 0.00 ? 97  LYS A NZ   2  
ATOM 3351  H H    . LYS A 1 98  ? 7.659   -10.090 -12.533 1.00 0.00 ? 97  LYS A H    2  
ATOM 3352  H HA   . LYS A 1 98  ? 9.584   -9.917  -10.215 1.00 0.00 ? 97  LYS A HA   2  
ATOM 3353  H HB2  . LYS A 1 98  ? 6.926   -10.156 -9.852  1.00 0.00 ? 97  LYS A HB2  2  
ATOM 3354  H HB3  . LYS A 1 98  ? 7.151   -11.768 -10.545 1.00 0.00 ? 97  LYS A HB3  2  
ATOM 3355  H HG2  . LYS A 1 98  ? 8.226   -10.587 -7.885  1.00 0.00 ? 97  LYS A HG2  2  
ATOM 3356  H HG3  . LYS A 1 98  ? 6.933   -11.823 -8.132  1.00 0.00 ? 97  LYS A HG3  2  
ATOM 3357  H HD2  . LYS A 1 98  ? 8.784   -13.406 -8.933  1.00 0.00 ? 97  LYS A HD2  2  
ATOM 3358  H HD3  . LYS A 1 98  ? 9.971   -12.155 -8.384  1.00 0.00 ? 97  LYS A HD3  2  
ATOM 3359  H HE2  . LYS A 1 98  ? 8.831   -12.258 -6.068  1.00 0.00 ? 97  LYS A HE2  2  
ATOM 3360  H HE3  . LYS A 1 98  ? 7.844   -13.641 -6.711  1.00 0.00 ? 97  LYS A HE3  2  
ATOM 3361  H HZ1  . LYS A 1 98  ? 9.896   -14.831 -7.107  1.00 0.00 ? 97  LYS A HZ1  2  
ATOM 3362  H HZ2  . LYS A 1 98  ? 9.758   -14.379 -5.475  1.00 0.00 ? 97  LYS A HZ2  2  
ATOM 3363  H HZ3  . LYS A 1 98  ? 10.811  -13.534 -6.506  1.00 0.00 ? 97  LYS A HZ3  2  
ATOM 3364  N N    . GLU A 1 99  ? 10.832  -11.875 -11.128 1.00 0.00 ? 98  GLU A N    2  
ATOM 3365  C CA   . GLU A 1 99  ? 11.623  -13.034 -11.576 1.00 0.00 ? 98  GLU A CA   2  
ATOM 3366  C C    . GLU A 1 99  ? 11.852  -13.145 -13.100 1.00 0.00 ? 98  GLU A C    2  
ATOM 3367  O O    . GLU A 1 99  ? 12.472  -14.078 -13.604 1.00 0.00 ? 98  GLU A O    2  
ATOM 3368  C CB   . GLU A 1 99  ? 11.052  -14.348 -10.941 1.00 0.00 ? 98  GLU A CB   2  
ATOM 3369  C CG   . GLU A 1 99  ? 11.743  -14.718 -9.621  1.00 0.00 ? 98  GLU A CG   2  
ATOM 3370  C CD   . GLU A 1 99  ? 11.144  -16.010 -9.066  1.00 0.00 ? 98  GLU A CD   2  
ATOM 3371  O OE1  . GLU A 1 99  ? 9.903   -16.052 -8.853  1.00 0.00 ? 98  GLU A OE1  2  
ATOM 3372  O OE2  . GLU A 1 99  ? 11.924  -16.979 -8.852  1.00 0.00 ? 98  GLU A OE2  2  
ATOM 3373  H H    . GLU A 1 99  ? 11.315  -11.249 -10.522 1.00 0.00 ? 98  GLU A H    2  
ATOM 3374  H HA   . GLU A 1 99  ? 12.618  -12.898 -11.174 1.00 0.00 ? 98  GLU A HA   2  
ATOM 3375  H HB2  . GLU A 1 99  ? 9.949   -14.209 -10.731 1.00 0.00 ? 98  GLU A HB2  2  
ATOM 3376  H HB3  . GLU A 1 99  ? 11.255  -15.233 -11.595 1.00 0.00 ? 98  GLU A HB3  2  
ATOM 3377  H HG2  . GLU A 1 99  ? 12.815  -14.878 -9.859  1.00 0.00 ? 98  GLU A HG2  2  
ATOM 3378  H HG3  . GLU A 1 99  ? 11.639  -13.899 -8.883  1.00 0.00 ? 98  GLU A HG3  2  
ATOM 3379  N N    . GLY A 1 100 ? 11.367  -12.116 -13.833 1.00 0.00 ? 99  GLY A N    2  
ATOM 3380  C CA   . GLY A 1 100 ? 11.468  -11.931 -15.277 1.00 0.00 ? 99  GLY A CA   2  
ATOM 3381  C C    . GLY A 1 100 ? 10.105  -11.875 -15.908 1.00 0.00 ? 99  GLY A C    2  
ATOM 3382  O O    . GLY A 1 100 ? 9.955   -11.469 -17.054 1.00 0.00 ? 99  GLY A O    2  
ATOM 3383  H H    . GLY A 1 100 ? 10.836  -11.447 -13.304 1.00 0.00 ? 99  GLY A H    2  
ATOM 3384  H HA2  . GLY A 1 100 ? 11.945  -10.977 -15.451 1.00 0.00 ? 99  GLY A HA2  2  
ATOM 3385  H HA3  . GLY A 1 100 ? 12.000  -12.755 -15.737 1.00 0.00 ? 99  GLY A HA3  2  
ATOM 3386  N N    . GLN A 1 101 ? 9.058   -12.294 -15.157 1.00 0.00 ? 100 GLN A N    2  
ATOM 3387  C CA   . GLN A 1 101 ? 7.669   -12.371 -15.587 1.00 0.00 ? 100 GLN A CA   2  
ATOM 3388  C C    . GLN A 1 101 ? 6.740   -11.504 -14.773 1.00 0.00 ? 100 GLN A C    2  
ATOM 3389  O O    . GLN A 1 101 ? 7.123   -10.910 -13.779 1.00 0.00 ? 100 GLN A O    2  
ATOM 3390  C CB   . GLN A 1 101 ? 7.215   -13.856 -15.741 1.00 0.00 ? 100 GLN A CB   2  
ATOM 3391  C CG   . GLN A 1 101 ? 7.505   -14.832 -14.564 1.00 0.00 ? 100 GLN A CG   2  
ATOM 3392  C CD   . GLN A 1 101 ? 6.422   -14.823 -13.484 1.00 0.00 ? 100 GLN A CD   2  
ATOM 3393  O OE1  . GLN A 1 101 ? 5.382   -15.481 -13.607 1.00 0.00 ? 100 GLN A OE1  2  
ATOM 3394  N NE2  . GLN A 1 101 ? 6.659   -14.043 -12.393 1.00 0.00 ? 100 GLN A NE2  2  
ATOM 3395  H H    . GLN A 1 101 ? 9.218   -12.597 -14.216 1.00 0.00 ? 100 GLN A H    2  
ATOM 3396  H HA   . GLN A 1 101 ? 7.585   -11.872 -16.533 1.00 0.00 ? 100 GLN A HA   2  
ATOM 3397  H HB2  . GLN A 1 101 ? 6.146   -13.928 -16.034 1.00 0.00 ? 100 GLN A HB2  2  
ATOM 3398  H HB3  . GLN A 1 101 ? 7.807   -14.251 -16.601 1.00 0.00 ? 100 GLN A HB3  2  
ATOM 3399  H HG2  . GLN A 1 101 ? 7.500   -15.864 -14.979 1.00 0.00 ? 100 GLN A HG2  2  
ATOM 3400  H HG3  . GLN A 1 101 ? 8.506   -14.664 -14.121 1.00 0.00 ? 100 GLN A HG3  2  
ATOM 3401  H HE21 . GLN A 1 101 ? 7.538   -13.529 -12.282 1.00 0.00 ? 100 GLN A HE21 2  
ATOM 3402  H HE22 . GLN A 1 101 ? 5.867   -13.886 -11.797 1.00 0.00 ? 100 GLN A HE22 2  
ATOM 3403  N N    . ARG A 1 102 ? 5.465   -11.341 -15.189 1.00 0.00 ? 101 ARG A N    2  
ATOM 3404  C CA   . ARG A 1 102 ? 4.508   -10.477 -14.516 1.00 0.00 ? 101 ARG A CA   2  
ATOM 3405  C C    . ARG A 1 102 ? 3.609   -11.251 -13.584 1.00 0.00 ? 101 ARG A C    2  
ATOM 3406  O O    . ARG A 1 102 ? 2.995   -12.223 -14.004 1.00 0.00 ? 101 ARG A O    2  
ATOM 3407  C CB   . ARG A 1 102 ? 3.654   -9.714  -15.569 1.00 0.00 ? 101 ARG A CB   2  
ATOM 3408  C CG   . ARG A 1 102 ? 3.052   -8.391  -15.062 1.00 0.00 ? 101 ARG A CG   2  
ATOM 3409  C CD   . ARG A 1 102 ? 4.110   -7.292  -14.831 1.00 0.00 ? 101 ARG A CD   2  
ATOM 3410  N NE   . ARG A 1 102 ? 4.842   -6.984  -16.111 1.00 0.00 ? 101 ARG A NE   2  
ATOM 3411  C CZ   . ARG A 1 102 ? 4.347   -6.175  -17.099 1.00 0.00 ? 101 ARG A CZ   2  
ATOM 3412  N NH1  . ARG A 1 102 ? 3.164   -5.512  -16.944 1.00 0.00 ? 101 ARG A NH1  2  
ATOM 3413  N NH2  . ARG A 1 102 ? 5.060   -6.021  -18.254 1.00 0.00 ? 101 ARG A NH2  2  
ATOM 3414  H H    . ARG A 1 102 ? 5.113   -11.806 -15.993 1.00 0.00 ? 101 ARG A H    2  
ATOM 3415  H HA   . ARG A 1 102 ? 5.028   -9.770  -13.895 1.00 0.00 ? 101 ARG A HA   2  
ATOM 3416  H HB2  . ARG A 1 102 ? 4.314   -9.482  -16.434 1.00 0.00 ? 101 ARG A HB2  2  
ATOM 3417  H HB3  . ARG A 1 102 ? 2.841   -10.356 -15.973 1.00 0.00 ? 101 ARG A HB3  2  
ATOM 3418  H HG2  . ARG A 1 102 ? 2.307   -8.024  -15.805 1.00 0.00 ? 101 ARG A HG2  2  
ATOM 3419  H HG3  . ARG A 1 102 ? 2.510   -8.559  -14.104 1.00 0.00 ? 101 ARG A HG3  2  
ATOM 3420  H HD2  . ARG A 1 102 ? 3.658   -6.365  -14.422 1.00 0.00 ? 101 ARG A HD2  2  
ATOM 3421  H HD3  . ARG A 1 102 ? 4.862   -7.661  -14.104 1.00 0.00 ? 101 ARG A HD3  2  
ATOM 3422  H HE   . ARG A 1 102 ? 5.720   -7.439  -16.267 1.00 0.00 ? 101 ARG A HE   2  
ATOM 3423  H HH11 . ARG A 1 102 ? 2.641   -5.617  -16.098 1.00 0.00 ? 101 ARG A HH11 2  
ATOM 3424  H HH12 . ARG A 1 102 ? 2.822   -4.922  -17.675 1.00 0.00 ? 101 ARG A HH12 2  
ATOM 3425  H HH21 . ARG A 1 102 ? 5.929   -6.500  -18.371 1.00 0.00 ? 101 ARG A HH21 2  
ATOM 3426  H HH22 . ARG A 1 102 ? 4.713   -5.429  -18.980 1.00 0.00 ? 101 ARG A HH22 2  
ATOM 3427  N N    . LYS A 1 103 ? 3.501   -10.842 -12.300 1.00 0.00 ? 102 LYS A N    2  
ATOM 3428  C CA   . LYS A 1 103 ? 2.595   -11.490 -11.348 1.00 0.00 ? 102 LYS A CA   2  
ATOM 3429  C C    . LYS A 1 103 ? 1.442   -10.545 -11.173 1.00 0.00 ? 102 LYS A C    2  
ATOM 3430  O O    . LYS A 1 103 ? 1.636   -9.370  -10.885 1.00 0.00 ? 102 LYS A O    2  
ATOM 3431  C CB   . LYS A 1 103 ? 3.275   -11.891 -10.000 1.00 0.00 ? 102 LYS A CB   2  
ATOM 3432  C CG   . LYS A 1 103 ? 3.796   -13.342 -10.110 1.00 0.00 ? 102 LYS A CG   2  
ATOM 3433  C CD   . LYS A 1 103 ? 5.002   -13.701 -9.229  1.00 0.00 ? 102 LYS A CD   2  
ATOM 3434  C CE   . LYS A 1 103 ? 5.256   -15.215 -9.180  1.00 0.00 ? 102 LYS A CE   2  
ATOM 3435  N NZ   . LYS A 1 103 ? 6.446   -15.531 -8.357  1.00 0.00 ? 102 LYS A NZ   2  
ATOM 3436  H H    . LYS A 1 103 ? 4.018   -10.018 -11.972 1.00 0.00 ? 102 LYS A H    2  
ATOM 3437  H HA   . LYS A 1 103 ? 2.172   -12.403 -11.751 1.00 0.00 ? 102 LYS A HA   2  
ATOM 3438  H HB2  . LYS A 1 103 ? 4.112   -11.187 -9.796  1.00 0.00 ? 102 LYS A HB2  2  
ATOM 3439  H HB3  . LYS A 1 103 ? 2.587   -11.839 -9.110  1.00 0.00 ? 102 LYS A HB3  2  
ATOM 3440  H HG2  . LYS A 1 103 ? 2.951   -14.028 -9.865  1.00 0.00 ? 102 LYS A HG2  2  
ATOM 3441  H HG3  . LYS A 1 103 ? 4.078   -13.538 -11.169 1.00 0.00 ? 102 LYS A HG3  2  
ATOM 3442  H HD2  . LYS A 1 103 ? 5.921   -13.214 -9.626  1.00 0.00 ? 102 LYS A HD2  2  
ATOM 3443  H HD3  . LYS A 1 103 ? 4.823   -13.333 -8.195  1.00 0.00 ? 102 LYS A HD3  2  
ATOM 3444  H HE2  . LYS A 1 103 ? 4.386   -15.741 -8.734  1.00 0.00 ? 102 LYS A HE2  2  
ATOM 3445  H HE3  . LYS A 1 103 ? 5.440   -15.610 -10.201 1.00 0.00 ? 102 LYS A HE3  2  
ATOM 3446  H HZ1  . LYS A 1 103 ? 7.282   -15.067 -8.764  1.00 0.00 ? 102 LYS A HZ1  2  
ATOM 3447  H HZ2  . LYS A 1 103 ? 6.595   -16.561 -8.342  1.00 0.00 ? 102 LYS A HZ2  2  
ATOM 3448  H HZ3  . LYS A 1 103 ? 6.298   -15.190 -7.386  1.00 0.00 ? 102 LYS A HZ3  2  
ATOM 3449  N N    . TRP A 1 104 ? 0.178   -11.015 -11.350 1.00 0.00 ? 103 TRP A N    2  
ATOM 3450  C CA   . TRP A 1 104 ? -0.988  -10.184 -11.135 1.00 0.00 ? 103 TRP A CA   2  
ATOM 3451  C C    . TRP A 1 104 ? -1.460  -10.599 -9.746  1.00 0.00 ? 103 TRP A C    2  
ATOM 3452  O O    . TRP A 1 104 ? -1.978  -11.687 -9.487  1.00 0.00 ? 103 TRP A O    2  
ATOM 3453  C CB   . TRP A 1 104 ? -2.057  -10.394 -12.243 1.00 0.00 ? 103 TRP A CB   2  
ATOM 3454  C CG   . TRP A 1 104 ? -1.776  -9.682  -13.569 1.00 0.00 ? 103 TRP A CG   2  
ATOM 3455  C CD1  . TRP A 1 104 ? -1.422  -10.206 -14.782 1.00 0.00 ? 103 TRP A CD1  2  
ATOM 3456  C CD2  . TRP A 1 104 ? -2.042  -8.282  -13.801 1.00 0.00 ? 103 TRP A CD2  2  
ATOM 3457  N NE1  . TRP A 1 104 ? -1.504  -9.234  -15.762 1.00 0.00 ? 103 TRP A NE1  2  
ATOM 3458  C CE2  . TRP A 1 104 ? -1.911  -8.057  -15.170 1.00 0.00 ? 103 TRP A CE2  2  
ATOM 3459  C CE3  . TRP A 1 104 ? -2.405  -7.275  -12.952 1.00 0.00 ? 103 TRP A CE3  2  
ATOM 3460  C CZ2  . TRP A 1 104 ? -2.205  -6.835  -15.710 1.00 0.00 ? 103 TRP A CZ2  2  
ATOM 3461  C CZ3  . TRP A 1 104 ? -2.705  -6.039  -13.495 1.00 0.00 ? 103 TRP A CZ3  2  
ATOM 3462  C CH2  . TRP A 1 104 ? -2.628  -5.831  -14.859 1.00 0.00 ? 103 TRP A CH2  2  
ATOM 3463  H H    . TRP A 1 104 ? -0.005  -11.964 -11.588 1.00 0.00 ? 103 TRP A H    2  
ATOM 3464  H HA   . TRP A 1 104 ? -0.693  -9.128  -11.104 1.00 0.00 ? 103 TRP A HA   2  
ATOM 3465  H HB2  . TRP A 1 104 ? -2.177  -11.483 -12.431 1.00 0.00 ? 103 TRP A HB2  2  
ATOM 3466  H HB3  . TRP A 1 104 ? -3.039  -10.003 -11.897 1.00 0.00 ? 103 TRP A HB3  2  
ATOM 3467  H HD1  . TRP A 1 104 ? -1.155  -11.240 -14.946 1.00 0.00 ? 103 TRP A HD1  2  
ATOM 3468  H HE1  . TRP A 1 104 ? -1.430  -9.376  -16.727 1.00 0.00 ? 103 TRP A HE1  2  
ATOM 3469  H HE3  . TRP A 1 104 ? -2.474  -7.427  -11.886 1.00 0.00 ? 103 TRP A HE3  2  
ATOM 3470  H HZ2  . TRP A 1 104 ? -2.155  -6.641  -16.769 1.00 0.00 ? 103 TRP A HZ2  2  
ATOM 3471  H HZ3  . TRP A 1 104 ? -3.029  -5.232  -12.848 1.00 0.00 ? 103 TRP A HZ3  2  
ATOM 3472  H HH2  . TRP A 1 104 ? -2.879  -4.858  -15.265 1.00 0.00 ? 103 TRP A HH2  2  
ATOM 3473  N N    . TYR A 1 105 ? -1.166  -9.686  -8.815  1.00 0.00 ? 104 TYR A N    2  
ATOM 3474  C CA   . TYR A 1 105 ? -1.286  -9.855  -7.384  1.00 0.00 ? 104 TYR A CA   2  
ATOM 3475  C C    . TYR A 1 105 ? -2.259  -8.849  -6.828  1.00 0.00 ? 104 TYR A C    2  
ATOM 3476  O O    . TYR A 1 105 ? -1.987  -7.659  -6.923  1.00 0.00 ? 104 TYR A O    2  
ATOM 3477  C CB   . TYR A 1 105 ? 0.103   -9.483  -6.741  1.00 0.00 ? 104 TYR A CB   2  
ATOM 3478  C CG   . TYR A 1 105 ? 1.184   -10.544 -6.677  1.00 0.00 ? 104 TYR A CG   2  
ATOM 3479  C CD1  . TYR A 1 105 ? 0.956   -11.896 -6.459  1.00 0.00 ? 104 TYR A CD1  2  
ATOM 3480  C CD2  . TYR A 1 105 ? 2.492   -10.098 -6.600  1.00 0.00 ? 104 TYR A CD2  2  
ATOM 3481  C CE1  . TYR A 1 105 ? 1.998   -12.736 -6.086  1.00 0.00 ? 104 TYR A CE1  2  
ATOM 3482  C CE2  . TYR A 1 105 ? 3.534   -10.934 -6.266  1.00 0.00 ? 104 TYR A CE2  2  
ATOM 3483  C CZ   . TYR A 1 105 ? 3.286   -12.249 -5.955  1.00 0.00 ? 104 TYR A CZ   2  
ATOM 3484  O OH   . TYR A 1 105 ? 4.347   -13.045 -5.456  1.00 0.00 ? 104 TYR A OH   2  
ATOM 3485  H H    . TYR A 1 105 ? -0.711  -8.841  -9.141  1.00 0.00 ? 104 TYR A H    2  
ATOM 3486  H HA   . TYR A 1 105 ? -1.612  -10.838 -7.077  1.00 0.00 ? 104 TYR A HA   2  
ATOM 3487  H HB2  . TYR A 1 105 ? 0.513   -8.610  -7.303  1.00 0.00 ? 104 TYR A HB2  2  
ATOM 3488  H HB3  . TYR A 1 105 ? -0.005  -9.168  -5.677  1.00 0.00 ? 104 TYR A HB3  2  
ATOM 3489  H HD1  . TYR A 1 105 ? -0.048  -12.293 -6.469  1.00 0.00 ? 104 TYR A HD1  2  
ATOM 3490  H HD2  . TYR A 1 105 ? 2.698   -9.047  -6.718  1.00 0.00 ? 104 TYR A HD2  2  
ATOM 3491  H HE1  . TYR A 1 105 ? 1.781   -13.769 -5.857  1.00 0.00 ? 104 TYR A HE1  2  
ATOM 3492  H HE2  . TYR A 1 105 ? 4.531   -10.525 -6.179  1.00 0.00 ? 104 TYR A HE2  2  
ATOM 3493  H HH   . TYR A 1 105 ? 4.004   -13.621 -4.764  1.00 0.00 ? 104 TYR A HH   2  
ATOM 3494  N N    . LYS A 1 106 ? -3.360  -9.248  -6.104  1.00 0.00 ? 105 LYS A N    2  
ATOM 3495  C CA   . LYS A 1 106 ? -4.212  -8.401  -5.287  1.00 0.00 ? 105 LYS A CA   2  
ATOM 3496  C C    . LYS A 1 106 ? -3.409  -7.838  -4.117  1.00 0.00 ? 105 LYS A C    2  
ATOM 3497  O O    . LYS A 1 106 ? -2.515  -8.522  -3.618  1.00 0.00 ? 105 LYS A O    2  
ATOM 3498  C CB   . LYS A 1 106 ? -5.396  -9.228  -4.692  1.00 0.00 ? 105 LYS A CB   2  
ATOM 3499  C CG   . LYS A 1 106 ? -6.053  -10.241 -5.646  1.00 0.00 ? 105 LYS A CG   2  
ATOM 3500  C CD   . LYS A 1 106 ? -7.321  -10.846 -5.020  1.00 0.00 ? 105 LYS A CD   2  
ATOM 3501  C CE   . LYS A 1 106 ? -8.030  -11.836 -5.953  1.00 0.00 ? 105 LYS A CE   2  
ATOM 3502  N NZ   . LYS A 1 106 ? -9.256  -12.374 -5.321  1.00 0.00 ? 105 LYS A NZ   2  
ATOM 3503  H H    . LYS A 1 106 ? -3.686  -10.162 -5.962  1.00 0.00 ? 105 LYS A H    2  
ATOM 3504  H HA   . LYS A 1 106 ? -4.520  -7.578  -5.921  1.00 0.00 ? 105 LYS A HA   2  
ATOM 3505  H HB2  . LYS A 1 106 ? -5.079  -9.827  -3.803  1.00 0.00 ? 105 LYS A HB2  2  
ATOM 3506  H HB3  . LYS A 1 106 ? -6.190  -8.524  -4.355  1.00 0.00 ? 105 LYS A HB3  2  
ATOM 3507  H HG2  . LYS A 1 106 ? -6.330  -9.748  -6.602  1.00 0.00 ? 105 LYS A HG2  2  
ATOM 3508  H HG3  . LYS A 1 106 ? -5.349  -11.072 -5.876  1.00 0.00 ? 105 LYS A HG3  2  
ATOM 3509  H HD2  . LYS A 1 106 ? -7.043  -11.356 -4.071  1.00 0.00 ? 105 LYS A HD2  2  
ATOM 3510  H HD3  . LYS A 1 106 ? -8.020  -10.019 -4.767  1.00 0.00 ? 105 LYS A HD3  2  
ATOM 3511  H HE2  . LYS A 1 106 ? -8.331  -11.332 -6.896  1.00 0.00 ? 105 LYS A HE2  2  
ATOM 3512  H HE3  . LYS A 1 106 ? -7.367  -12.693 -6.190  1.00 0.00 ? 105 LYS A HE3  2  
ATOM 3513  H HZ1  . LYS A 1 106 ? -9.003  -12.869 -4.441  1.00 0.00 ? 105 LYS A HZ1  2  
ATOM 3514  H HZ2  . LYS A 1 106 ? -9.719  -13.040 -5.972  1.00 0.00 ? 105 LYS A HZ2  2  
ATOM 3515  H HZ3  . LYS A 1 106 ? -9.907  -11.592 -5.103  1.00 0.00 ? 105 LYS A HZ3  2  
ATOM 3516  N N    . ARG A 1 107 ? -3.670  -6.574  -3.697  1.00 0.00 ? 106 ARG A N    2  
ATOM 3517  C CA   . ARG A 1 107 ? -2.867  -5.684  -2.839  1.00 0.00 ? 106 ARG A CA   2  
ATOM 3518  C C    . ARG A 1 107 ? -1.979  -6.297  -1.766  1.00 0.00 ? 106 ARG A C    2  
ATOM 3519  O O    . ARG A 1 107 ? -0.786  -6.055  -1.738  1.00 0.00 ? 106 ARG A O    2  
ATOM 3520  C CB   . ARG A 1 107 ? -3.786  -4.600  -2.197  1.00 0.00 ? 106 ARG A CB   2  
ATOM 3521  C CG   . ARG A 1 107 ? -3.121  -3.305  -1.679  1.00 0.00 ? 106 ARG A CG   2  
ATOM 3522  C CD   . ARG A 1 107 ? -2.611  -2.302  -2.740  1.00 0.00 ? 106 ARG A CD   2  
ATOM 3523  N NE   . ARG A 1 107 ? -1.448  -2.805  -3.560  1.00 0.00 ? 106 ARG A NE   2  
ATOM 3524  C CZ   . ARG A 1 107 ? -0.178  -3.010  -3.084  1.00 0.00 ? 106 ARG A CZ   2  
ATOM 3525  N NH1  . ARG A 1 107 ? 0.096   -3.004  -1.748  1.00 0.00 ? 106 ARG A NH1  2  
ATOM 3526  N NH2  . ARG A 1 107 ? 0.844   -3.182  -3.971  1.00 0.00 ? 106 ARG A NH2  2  
ATOM 3527  H H    . ARG A 1 107 ? -4.395  -6.116  -4.192  1.00 0.00 ? 106 ARG A H    2  
ATOM 3528  H HA   . ARG A 1 107 ? -2.184  -5.206  -3.523  1.00 0.00 ? 106 ARG A HA   2  
ATOM 3529  H HB2  . ARG A 1 107 ? -4.516  -4.274  -2.965  1.00 0.00 ? 106 ARG A HB2  2  
ATOM 3530  H HB3  . ARG A 1 107 ? -4.381  -5.062  -1.365  1.00 0.00 ? 106 ARG A HB3  2  
ATOM 3531  H HG2  . ARG A 1 107 ? -3.894  -2.740  -1.106  1.00 0.00 ? 106 ARG A HG2  2  
ATOM 3532  H HG3  . ARG A 1 107 ? -2.308  -3.549  -0.971  1.00 0.00 ? 106 ARG A HG3  2  
ATOM 3533  H HD2  . ARG A 1 107 ? -3.433  -2.067  -3.448  1.00 0.00 ? 106 ARG A HD2  2  
ATOM 3534  H HD3  . ARG A 1 107 ? -2.305  -1.355  -2.241  1.00 0.00 ? 106 ARG A HD3  2  
ATOM 3535  H HE   . ARG A 1 107 ? -1.577  -2.837  -4.551  1.00 0.00 ? 106 ARG A HE   2  
ATOM 3536  H HH11 . ARG A 1 107 ? -0.642  -2.867  -1.088  1.00 0.00 ? 106 ARG A HH11 2  
ATOM 3537  H HH12 . ARG A 1 107 ? 1.034   -3.145  -1.429  1.00 0.00 ? 106 ARG A HH12 2  
ATOM 3538  H HH21 . ARG A 1 107 ? 0.660   -3.172  -4.954  1.00 0.00 ? 106 ARG A HH21 2  
ATOM 3539  H HH22 . ARG A 1 107 ? 1.776   -3.321  -3.637  1.00 0.00 ? 106 ARG A HH22 2  
ATOM 3540  N N    . MET A 1 108 ? -2.522  -7.238  -0.966  1.00 0.00 ? 107 MET A N    2  
ATOM 3541  C CA   . MET A 1 108 ? -1.860  -8.030  0.073   1.00 0.00 ? 107 MET A CA   2  
ATOM 3542  C C    . MET A 1 108 ? -0.700  -8.953  -0.352  1.00 0.00 ? 107 MET A C    2  
ATOM 3543  O O    . MET A 1 108 ? 0.048   -9.424  0.503   1.00 0.00 ? 107 MET A O    2  
ATOM 3544  C CB   . MET A 1 108 ? -2.920  -8.751  0.961   1.00 0.00 ? 107 MET A CB   2  
ATOM 3545  C CG   . MET A 1 108 ? -3.836  -9.749  0.223   1.00 0.00 ? 107 MET A CG   2  
ATOM 3546  S SD   . MET A 1 108 ? -5.320  -10.138 1.210   1.00 0.00 ? 107 MET A SD   2  
ATOM 3547  C CE   . MET A 1 108 ? -6.323  -10.907 -0.092  1.00 0.00 ? 107 MET A CE   2  
ATOM 3548  H H    . MET A 1 108 ? -3.473  -7.447  -1.151  1.00 0.00 ? 107 MET A H    2  
ATOM 3549  H HA   . MET A 1 108 ? -1.374  -7.321  0.729   1.00 0.00 ? 107 MET A HA   2  
ATOM 3550  H HB2  . MET A 1 108 ? -2.424  -9.285  1.804   1.00 0.00 ? 107 MET A HB2  2  
ATOM 3551  H HB3  . MET A 1 108 ? -3.566  -7.956  1.427   1.00 0.00 ? 107 MET A HB3  2  
ATOM 3552  H HG2  . MET A 1 108 ? -4.138  -9.319  -0.759  1.00 0.00 ? 107 MET A HG2  2  
ATOM 3553  H HG3  . MET A 1 108 ? -3.260  -10.679 0.013   1.00 0.00 ? 107 MET A HG3  2  
ATOM 3554  H HE1  . MET A 1 108 ? -5.868  -11.860 -0.438  1.00 0.00 ? 107 MET A HE1  2  
ATOM 3555  H HE2  . MET A 1 108 ? -6.420  -10.230 -0.967  1.00 0.00 ? 107 MET A HE2  2  
ATOM 3556  H HE3  . MET A 1 108 ? -7.346  -11.133 0.285   1.00 0.00 ? 107 MET A HE3  2  
ATOM 3557  N N    . ALA A 1 109 ? -0.477  -9.185  -1.683  1.00 0.00 ? 108 ALA A N    2  
ATOM 3558  C CA   . ALA A 1 109 ? 0.649   -9.965  -2.212  1.00 0.00 ? 108 ALA A CA   2  
ATOM 3559  C C    . ALA A 1 109 ? 1.889   -9.200  -2.632  1.00 0.00 ? 108 ALA A C    2  
ATOM 3560  O O    . ALA A 1 109 ? 2.916   -9.778  -2.980  1.00 0.00 ? 108 ALA A O    2  
ATOM 3561  C CB   . ALA A 1 109 ? 0.197   -10.931 -3.341  1.00 0.00 ? 108 ALA A CB   2  
ATOM 3562  H H    . ALA A 1 109 ? -1.131  -8.801  -2.358  1.00 0.00 ? 108 ALA A H    2  
ATOM 3563  H HA   . ALA A 1 109 ? 1.072   -10.477 -1.390  1.00 0.00 ? 108 ALA A HA   2  
ATOM 3564  H HB1  . ALA A 1 109 ? -0.467  -11.718 -2.926  1.00 0.00 ? 108 ALA A HB1  2  
ATOM 3565  H HB2  . ALA A 1 109 ? 1.056   -11.431 -3.853  1.00 0.00 ? 108 ALA A HB2  2  
ATOM 3566  H HB3  . ALA A 1 109 ? -0.374  -10.390 -4.123  1.00 0.00 ? 108 ALA A HB3  2  
ATOM 3567  N N    . VAL A 1 110 ? 1.797   -7.871  -2.594  1.00 0.00 ? 109 VAL A N    2  
ATOM 3568  C CA   . VAL A 1 110 ? 2.784   -6.851  -2.772  1.00 0.00 ? 109 VAL A CA   2  
ATOM 3569  C C    . VAL A 1 110 ? 2.731   -5.963  -1.568  1.00 0.00 ? 109 VAL A C    2  
ATOM 3570  O O    . VAL A 1 110 ? 1.688   -5.523  -1.099  1.00 0.00 ? 109 VAL A O    2  
ATOM 3571  C CB   . VAL A 1 110 ? 2.760   -6.109  -4.100  1.00 0.00 ? 109 VAL A CB   2  
ATOM 3572  C CG1  . VAL A 1 110 ? 3.952   -6.688  -4.868  1.00 0.00 ? 109 VAL A CG1  2  
ATOM 3573  C CG2  . VAL A 1 110 ? 1.384   -6.258  -4.798  1.00 0.00 ? 109 VAL A CG2  2  
ATOM 3574  H H    . VAL A 1 110 ? 1.014   -7.520  -2.127  1.00 0.00 ? 109 VAL A H    2  
ATOM 3575  H HA   . VAL A 1 110 ? 3.749   -7.330  -2.691  1.00 0.00 ? 109 VAL A HA   2  
ATOM 3576  H HB   . VAL A 1 110 ? 3.009   -5.028  -4.021  1.00 0.00 ? 109 VAL A HB   2  
ATOM 3577  H HG11 . VAL A 1 110 ? 4.133   -6.128  -5.802  1.00 0.00 ? 109 VAL A HG11 2  
ATOM 3578  H HG12 . VAL A 1 110 ? 3.820   -7.771  -5.069  1.00 0.00 ? 109 VAL A HG12 2  
ATOM 3579  H HG13 . VAL A 1 110 ? 4.882   -6.563  -4.275  1.00 0.00 ? 109 VAL A HG13 2  
ATOM 3580  H HG21 . VAL A 1 110 ? 0.569   -5.948  -4.108  1.00 0.00 ? 109 VAL A HG21 2  
ATOM 3581  H HG22 . VAL A 1 110 ? 1.207   -7.315  -5.085  1.00 0.00 ? 109 VAL A HG22 2  
ATOM 3582  H HG23 . VAL A 1 110 ? 1.338   -5.621  -5.704  1.00 0.00 ? 109 VAL A HG23 2  
ATOM 3583  N N    . ILE A 1 111 ? 3.894   -5.659  -1.022  1.00 0.00 ? 110 ILE A N    2  
ATOM 3584  C CA   . ILE A 1 111 ? 4.047   -4.759  0.123   1.00 0.00 ? 110 ILE A CA   2  
ATOM 3585  C C    . ILE A 1 111 ? 5.279   -3.862  -0.041  1.00 0.00 ? 110 ILE A C    2  
ATOM 3586  O O    . ILE A 1 111 ? 5.916   -3.850  -1.095  1.00 0.00 ? 110 ILE A O    2  
ATOM 3587  C CB   . ILE A 1 111 ? 3.986   -5.458  1.483   1.00 0.00 ? 110 ILE A CB   2  
ATOM 3588  C CG1  . ILE A 1 111 ? 5.049   -6.556  1.696   1.00 0.00 ? 110 ILE A CG1  2  
ATOM 3589  C CG2  . ILE A 1 111 ? 2.578   -6.038  1.779   1.00 0.00 ? 110 ILE A CG2  2  
ATOM 3590  C CD1  . ILE A 1 111 ? 6.255   -6.143  2.530   1.00 0.00 ? 110 ILE A CD1  2  
ATOM 3591  H H    . ILE A 1 111 ? 4.641   -6.121  -1.492  1.00 0.00 ? 110 ILE A H    2  
ATOM 3592  H HA   . ILE A 1 111 ? 3.228   -4.051  0.169   1.00 0.00 ? 110 ILE A HA   2  
ATOM 3593  H HB   . ILE A 1 111 ? 4.119   -4.644  2.213   1.00 0.00 ? 110 ILE A HB   2  
ATOM 3594  H HG12 . ILE A 1 111 ? 4.560   -7.390  2.248   1.00 0.00 ? 110 ILE A HG12 2  
ATOM 3595  H HG13 . ILE A 1 111 ? 5.374   -6.968  0.716   1.00 0.00 ? 110 ILE A HG13 2  
ATOM 3596  H HG21 . ILE A 1 111 ? 2.525   -6.396  2.829   1.00 0.00 ? 110 ILE A HG21 2  
ATOM 3597  H HG22 . ILE A 1 111 ? 2.364   -6.902  1.115   1.00 0.00 ? 110 ILE A HG22 2  
ATOM 3598  H HG23 . ILE A 1 111 ? 1.790   -5.268  1.630   1.00 0.00 ? 110 ILE A HG23 2  
ATOM 3599  H HD11 . ILE A 1 111 ? 6.683   -5.182  2.184   1.00 0.00 ? 110 ILE A HD11 2  
ATOM 3600  H HD12 . ILE A 1 111 ? 7.042   -6.920  2.428   1.00 0.00 ? 110 ILE A HD12 2  
ATOM 3601  H HD13 . ILE A 1 111 ? 5.972   -6.040  3.597   1.00 0.00 ? 110 ILE A HD13 2  
ATOM 3602  N N    . LEU A 1 112 ? 5.649   -3.076  1.021   1.00 0.00 ? 111 LEU A N    2  
ATOM 3603  C CA   . LEU A 1 112 ? 6.803   -2.176  1.002   1.00 0.00 ? 111 LEU A CA   2  
ATOM 3604  C C    . LEU A 1 112 ? 7.512   -1.970  2.341   1.00 0.00 ? 111 LEU A C    2  
ATOM 3605  O O    . LEU A 1 112 ? 6.890   -2.020  3.398   1.00 0.00 ? 111 LEU A O    2  
ATOM 3606  C CB   . LEU A 1 112 ? 6.403   -0.797  0.438   1.00 0.00 ? 111 LEU A CB   2  
ATOM 3607  C CG   . LEU A 1 112 ? 5.483   0.077   1.311   1.00 0.00 ? 111 LEU A CG   2  
ATOM 3608  C CD1  . LEU A 1 112 ? 5.210   1.345   0.536   1.00 0.00 ? 111 LEU A CD1  2  
ATOM 3609  C CD2  . LEU A 1 112 ? 4.155   -0.570  1.699   1.00 0.00 ? 111 LEU A CD2  2  
ATOM 3610  H H    . LEU A 1 112 ? 5.123   -3.066  1.879   1.00 0.00 ? 111 LEU A H    2  
ATOM 3611  H HA   . LEU A 1 112 ? 7.559   -2.591  0.349   1.00 0.00 ? 111 LEU A HA   2  
ATOM 3612  H HB2  . LEU A 1 112 ? 7.318   -0.210  0.201   1.00 0.00 ? 111 LEU A HB2  2  
ATOM 3613  H HB3  . LEU A 1 112 ? 5.867   -0.968  -0.520  1.00 0.00 ? 111 LEU A HB3  2  
ATOM 3614  H HG   . LEU A 1 112 ? 6.036   0.357   2.239   1.00 0.00 ? 111 LEU A HG   2  
ATOM 3615  H HD11 . LEU A 1 112 ? 4.443   1.120   -0.245  1.00 0.00 ? 111 LEU A HD11 2  
ATOM 3616  H HD12 . LEU A 1 112 ? 6.188   1.600   0.070   1.00 0.00 ? 111 LEU A HD12 2  
ATOM 3617  H HD13 . LEU A 1 112 ? 4.858   2.201   1.143   1.00 0.00 ? 111 LEU A HD13 2  
ATOM 3618  H HD21 . LEU A 1 112 ? 3.648   -1.009  0.820   1.00 0.00 ? 111 LEU A HD21 2  
ATOM 3619  H HD22 . LEU A 1 112 ? 3.491   0.160   2.201   1.00 0.00 ? 111 LEU A HD22 2  
ATOM 3620  H HD23 . LEU A 1 112 ? 4.358   -1.326  2.478   1.00 0.00 ? 111 LEU A HD23 2  
ATOM 3621  N N    . SER A 1 113 ? 8.842   -1.678  2.275   1.00 0.00 ? 112 SER A N    2  
ATOM 3622  C CA   . SER A 1 113 ? 9.829   -1.363  3.313   1.00 0.00 ? 112 SER A CA   2  
ATOM 3623  C C    . SER A 1 113 ? 9.798   0.131   3.695   1.00 0.00 ? 112 SER A C    2  
ATOM 3624  O O    . SER A 1 113 ? 9.356   0.935   2.869   1.00 0.00 ? 112 SER A O    2  
ATOM 3625  C CB   . SER A 1 113 ? 11.228  -1.711  2.691   1.00 0.00 ? 112 SER A CB   2  
ATOM 3626  O OG   . SER A 1 113 ? 11.340  -1.233  1.336   1.00 0.00 ? 112 SER A OG   2  
ATOM 3627  H H    . SER A 1 113 ? 9.296   -1.633  1.381   1.00 0.00 ? 112 SER A H    2  
ATOM 3628  H HA   . SER A 1 113 ? 9.666   -1.964  4.194   1.00 0.00 ? 112 SER A HA   2  
ATOM 3629  H HB2  . SER A 1 113 ? 12.069  -1.334  3.315   1.00 0.00 ? 112 SER A HB2  2  
ATOM 3630  H HB3  . SER A 1 113 ? 11.311  -2.820  2.668   1.00 0.00 ? 112 SER A HB3  2  
ATOM 3631  H HG   . SER A 1 113 ? 12.082  -1.667  0.886   1.00 0.00 ? 112 SER A HG   2  
ATOM 3632  N N    . LEU A 1 114 ? 10.303  0.631   4.898   1.00 0.00 ? 113 LEU A N    2  
ATOM 3633  C CA   . LEU A 1 114 ? 10.311  2.107   5.145   1.00 0.00 ? 113 LEU A CA   2  
ATOM 3634  C C    . LEU A 1 114 ? 11.132  2.953   4.167   1.00 0.00 ? 113 LEU A C    2  
ATOM 3635  O O    . LEU A 1 114 ? 10.779  4.096   3.973   1.00 0.00 ? 113 LEU A O    2  
ATOM 3636  C CB   . LEU A 1 114 ? 10.495  2.858   6.531   1.00 0.00 ? 113 LEU A CB   2  
ATOM 3637  C CG   . LEU A 1 114 ? 10.326  2.203   7.928   1.00 0.00 ? 113 LEU A CG   2  
ATOM 3638  C CD1  . LEU A 1 114 ? 9.027   1.431   8.165   1.00 0.00 ? 113 LEU A CD1  2  
ATOM 3639  C CD2  . LEU A 1 114 ? 11.550  1.388   8.356   1.00 0.00 ? 113 LEU A CD2  2  
ATOM 3640  H H    . LEU A 1 114 ? 10.649  0.012   5.615   1.00 0.00 ? 113 LEU A H    2  
ATOM 3641  H HA   . LEU A 1 114 ? 9.291   2.389   4.937   1.00 0.00 ? 113 LEU A HA   2  
ATOM 3642  H HB2  . LEU A 1 114 ? 11.518  3.304   6.580   1.00 0.00 ? 113 LEU A HB2  2  
ATOM 3643  H HB3  . LEU A 1 114 ? 9.780   3.741   6.461   1.00 0.00 ? 113 LEU A HB3  2  
ATOM 3644  H HG   . LEU A 1 114 ? 10.297  3.053   8.661   1.00 0.00 ? 113 LEU A HG   2  
ATOM 3645  H HD11 . LEU A 1 114 ? 8.199   2.157   8.306   1.00 0.00 ? 113 LEU A HD11 2  
ATOM 3646  H HD12 . LEU A 1 114 ? 9.089   0.820   9.088   1.00 0.00 ? 113 LEU A HD12 2  
ATOM 3647  H HD13 . LEU A 1 114 ? 8.805   0.763   7.307   1.00 0.00 ? 113 LEU A HD13 2  
ATOM 3648  H HD21 . LEU A 1 114 ? 11.752  0.593   7.611   1.00 0.00 ? 113 LEU A HD21 2  
ATOM 3649  H HD22 . LEU A 1 114 ? 11.340  0.895   9.349   1.00 0.00 ? 113 LEU A HD22 2  
ATOM 3650  H HD23 . LEU A 1 114 ? 12.451  2.033   8.434   1.00 0.00 ? 113 LEU A HD23 2  
ATOM 3651  N N    . GLU A 1 115 ? 12.212  2.476   3.502   1.00 0.00 ? 114 GLU A N    2  
ATOM 3652  C CA   . GLU A 1 115 ? 12.911  3.303   2.499   1.00 0.00 ? 114 GLU A CA   2  
ATOM 3653  C C    . GLU A 1 115 ? 12.358  3.255   1.084   1.00 0.00 ? 114 GLU A C    2  
ATOM 3654  O O    . GLU A 1 115 ? 12.654  4.129   0.278   1.00 0.00 ? 114 GLU A O    2  
ATOM 3655  C CB   . GLU A 1 115 ? 14.446  3.412   2.628   1.00 0.00 ? 114 GLU A CB   2  
ATOM 3656  C CG   . GLU A 1 115 ? 14.781  4.794   3.242   1.00 0.00 ? 114 GLU A CG   2  
ATOM 3657  C CD   . GLU A 1 115 ? 16.291  4.980   3.339   1.00 0.00 ? 114 GLU A CD   2  
ATOM 3658  O OE1  . GLU A 1 115 ? 16.956  5.009   2.269   1.00 0.00 ? 114 GLU A OE1  2  
ATOM 3659  O OE2  . GLU A 1 115 ? 16.802  5.099   4.485   1.00 0.00 ? 114 GLU A OE2  2  
ATOM 3660  H H    . GLU A 1 115 ? 12.518  1.550   3.693   1.00 0.00 ? 114 GLU A H    2  
ATOM 3661  H HA   . GLU A 1 115 ? 12.658  4.338   2.705   1.00 0.00 ? 114 GLU A HA   2  
ATOM 3662  H HB2  . GLU A 1 115 ? 14.826  2.604   3.289   1.00 0.00 ? 114 GLU A HB2  2  
ATOM 3663  H HB3  . GLU A 1 115 ? 14.960  3.317   1.644   1.00 0.00 ? 114 GLU A HB3  2  
ATOM 3664  H HG2  . GLU A 1 115 ? 14.331  5.615   2.615   1.00 0.00 ? 114 GLU A HG2  2  
ATOM 3665  H HG3  . GLU A 1 115 ? 14.319  4.828   4.259   1.00 0.00 ? 114 GLU A HG3  2  
ATOM 3666  N N    . GLN A 1 116 ? 11.427  2.305   0.779   1.00 0.00 ? 115 GLN A N    2  
ATOM 3667  C CA   . GLN A 1 116 ? 10.580  2.357   -0.423  1.00 0.00 ? 115 GLN A CA   2  
ATOM 3668  C C    . GLN A 1 116 ? 9.321   3.176   -0.124  1.00 0.00 ? 115 GLN A C    2  
ATOM 3669  O O    . GLN A 1 116 ? 8.805   3.866   -0.988  1.00 0.00 ? 115 GLN A O    2  
ATOM 3670  C CB   . GLN A 1 116 ? 10.203  0.998   -1.075  1.00 0.00 ? 115 GLN A CB   2  
ATOM 3671  C CG   . GLN A 1 116 ? 10.651  0.951   -2.556  1.00 0.00 ? 115 GLN A CG   2  
ATOM 3672  C CD   . GLN A 1 116 ? 12.117  0.519   -2.715  1.00 0.00 ? 115 GLN A CD   2  
ATOM 3673  O OE1  . GLN A 1 116 ? 12.818  0.197   -1.756  1.00 0.00 ? 115 GLN A OE1  2  
ATOM 3674  N NE2  . GLN A 1 116 ? 12.546  0.419   -3.993  1.00 0.00 ? 115 GLN A NE2  2  
ATOM 3675  H H    . GLN A 1 116 ? 11.213  1.580   1.433   1.00 0.00 ? 115 GLN A H    2  
ATOM 3676  H HA   . GLN A 1 116 ? 11.108  2.902   -1.196  1.00 0.00 ? 115 GLN A HA   2  
ATOM 3677  H HB2  . GLN A 1 116 ? 10.680  0.176   -0.495  1.00 0.00 ? 115 GLN A HB2  2  
ATOM 3678  H HB3  . GLN A 1 116 ? 9.093   0.827   -1.091  1.00 0.00 ? 115 GLN A HB3  2  
ATOM 3679  H HG2  . GLN A 1 116 ? 10.034  0.196   -3.094  1.00 0.00 ? 115 GLN A HG2  2  
ATOM 3680  H HG3  . GLN A 1 116 ? 10.495  1.938   -3.041  1.00 0.00 ? 115 GLN A HG3  2  
ATOM 3681  H HE21 . GLN A 1 116 ? 11.893  0.724   -4.692  1.00 0.00 ? 115 GLN A HE21 2  
ATOM 3682  H HE22 . GLN A 1 116 ? 13.062  -0.440  -4.145  1.00 0.00 ? 115 GLN A HE22 2  
ATOM 3683  N N    . GLY A 1 117 ? 8.832   3.157   1.137   1.00 0.00 ? 116 GLY A N    2  
ATOM 3684  C CA   . GLY A 1 117 ? 7.757   3.968   1.671   1.00 0.00 ? 116 GLY A CA   2  
ATOM 3685  C C    . GLY A 1 117 ? 8.030   5.407   2.088   1.00 0.00 ? 116 GLY A C    2  
ATOM 3686  O O    . GLY A 1 117 ? 7.274   6.302   1.743   1.00 0.00 ? 116 GLY A O    2  
ATOM 3687  H H    . GLY A 1 117 ? 9.219   2.528   1.813   1.00 0.00 ? 116 GLY A H    2  
ATOM 3688  H HA2  . GLY A 1 117 ? 6.910   3.951   0.994   1.00 0.00 ? 116 GLY A HA2  2  
ATOM 3689  H HA3  . GLY A 1 117 ? 7.543   3.456   2.579   1.00 0.00 ? 116 GLY A HA3  2  
ATOM 3690  N N    . ASN A 1 118 ? 9.122   5.716   2.843   1.00 0.00 ? 117 ASN A N    2  
ATOM 3691  C CA   . ASN A 1 118 ? 9.504   7.062   3.329   1.00 0.00 ? 117 ASN A CA   2  
ATOM 3692  C C    . ASN A 1 118 ? 10.116  7.918   2.251   1.00 0.00 ? 117 ASN A C    2  
ATOM 3693  O O    . ASN A 1 118 ? 10.088  9.143   2.301   1.00 0.00 ? 117 ASN A O    2  
ATOM 3694  C CB   . ASN A 1 118 ? 10.430  7.165   4.570   1.00 0.00 ? 117 ASN A CB   2  
ATOM 3695  C CG   . ASN A 1 118 ? 9.795   6.455   5.762   1.00 0.00 ? 117 ASN A CG   2  
ATOM 3696  O OD1  . ASN A 1 118 ? 8.590   6.189   5.781   1.00 0.00 ? 117 ASN A OD1  2  
ATOM 3697  N ND2  . ASN A 1 118 ? 10.621  6.199   6.803   1.00 0.00 ? 117 ASN A ND2  2  
ATOM 3698  H H    . ASN A 1 118 ? 9.741   4.971   3.153   1.00 0.00 ? 117 ASN A H    2  
ATOM 3699  H HA   . ASN A 1 118 ? 8.604   7.563   3.617   1.00 0.00 ? 117 ASN A HA   2  
ATOM 3700  H HB2  . ASN A 1 118 ? 11.438  6.783   4.338   1.00 0.00 ? 117 ASN A HB2  2  
ATOM 3701  H HB3  . ASN A 1 118 ? 10.533  8.234   4.879   1.00 0.00 ? 117 ASN A HB3  2  
ATOM 3702  H HD21 . ASN A 1 118 ? 11.603  6.345   6.689   1.00 0.00 ? 117 ASN A HD21 2  
ATOM 3703  H HD22 . ASN A 1 118 ? 10.203  5.833   7.633   1.00 0.00 ? 117 ASN A HD22 2  
ATOM 3704  N N    . ARG A 1 119 ? 10.602  7.273   1.155   1.00 0.00 ? 118 ARG A N    2  
ATOM 3705  C CA   . ARG A 1 119 ? 11.067  7.940   -0.051  1.00 0.00 ? 118 ARG A CA   2  
ATOM 3706  C C    . ARG A 1 119 ? 9.886   8.610   -0.792  1.00 0.00 ? 118 ARG A C    2  
ATOM 3707  O O    . ARG A 1 119 ? 10.045  9.577   -1.522  1.00 0.00 ? 118 ARG A O    2  
ATOM 3708  C CB   . ARG A 1 119 ? 11.753  6.966   -1.038  1.00 0.00 ? 118 ARG A CB   2  
ATOM 3709  C CG   . ARG A 1 119 ? 10.795  5.959   -1.706  1.00 0.00 ? 118 ARG A CG   2  
ATOM 3710  C CD   . ARG A 1 119 ? 10.581  6.133   -3.221  1.00 0.00 ? 118 ARG A CD   2  
ATOM 3711  N NE   . ARG A 1 119 ? 11.853  5.761   -3.932  1.00 0.00 ? 118 ARG A NE   2  
ATOM 3712  C CZ   . ARG A 1 119 ? 11.919  5.529   -5.281  1.00 0.00 ? 118 ARG A CZ   2  
ATOM 3713  N NH1  . ARG A 1 119 ? 10.816  5.669   -6.070  1.00 0.00 ? 118 ARG A NH1  2  
ATOM 3714  N NH2  . ARG A 1 119 ? 13.105  5.148   -5.839  1.00 0.00 ? 118 ARG A NH2  2  
ATOM 3715  H H    . ARG A 1 119 ? 10.603  6.276   1.132   1.00 0.00 ? 118 ARG A H    2  
ATOM 3716  H HA   . ARG A 1 119 ? 11.827  8.643   0.275   1.00 0.00 ? 118 ARG A HA   2  
ATOM 3717  H HB2  . ARG A 1 119 ? 12.289  7.542   -1.826  1.00 0.00 ? 118 ARG A HB2  2  
ATOM 3718  H HB3  . ARG A 1 119 ? 12.536  6.403   -0.481  1.00 0.00 ? 118 ARG A HB3  2  
ATOM 3719  H HG2  . ARG A 1 119 ? 11.193  4.937   -1.545  1.00 0.00 ? 118 ARG A HG2  2  
ATOM 3720  H HG3  . ARG A 1 119 ? 9.787   6.005   -1.204  1.00 0.00 ? 118 ARG A HG3  2  
ATOM 3721  H HD2  . ARG A 1 119 ? 9.763   5.451   -3.548  1.00 0.00 ? 118 ARG A HD2  2  
ATOM 3722  H HD3  . ARG A 1 119 ? 10.315  7.182   -3.470  1.00 0.00 ? 118 ARG A HD3  2  
ATOM 3723  H HE   . ARG A 1 119 ? 12.684  5.650   -3.387  1.00 0.00 ? 118 ARG A HE   2  
ATOM 3724  H HH11 . ARG A 1 119 ? 9.943   5.943   -5.666  1.00 0.00 ? 118 ARG A HH11 2  
ATOM 3725  H HH12 . ARG A 1 119 ? 10.878  5.491   -7.052  1.00 0.00 ? 118 ARG A HH12 2  
ATOM 3726  H HH21 . ARG A 1 119 ? 13.917  5.042   -5.264  1.00 0.00 ? 118 ARG A HH21 2  
ATOM 3727  H HH22 . ARG A 1 119 ? 13.162  4.975   -6.822  1.00 0.00 ? 118 ARG A HH22 2  
ATOM 3728  N N    . LEU A 1 120 ? 8.659   8.029   -0.569  1.00 0.00 ? 119 LEU A N    2  
ATOM 3729  C CA   . LEU A 1 120 ? 7.335   8.367   -1.064  1.00 0.00 ? 119 LEU A CA   2  
ATOM 3730  C C    . LEU A 1 120 ? 6.662   9.351   -0.177  1.00 0.00 ? 119 LEU A C    2  
ATOM 3731  O O    . LEU A 1 120 ? 5.918   10.208  -0.653  1.00 0.00 ? 119 LEU A O    2  
ATOM 3732  C CB   . LEU A 1 120 ? 6.391   7.123   -1.104  1.00 0.00 ? 119 LEU A CB   2  
ATOM 3733  C CG   . LEU A 1 120 ? 5.194   7.297   -2.041  1.00 0.00 ? 119 LEU A CG   2  
ATOM 3734  C CD1  . LEU A 1 120 ? 4.806   6.000   -2.698  1.00 0.00 ? 119 LEU A CD1  2  
ATOM 3735  C CD2  . LEU A 1 120 ? 3.924   7.705   -1.335  1.00 0.00 ? 119 LEU A CD2  2  
ATOM 3736  H H    . LEU A 1 120 ? 8.663   7.227   0.034   1.00 0.00 ? 119 LEU A H    2  
ATOM 3737  H HA   . LEU A 1 120 ? 7.358   8.842   -2.036  1.00 0.00 ? 119 LEU A HA   2  
ATOM 3738  H HB2  . LEU A 1 120 ? 6.949   6.233   -1.428  1.00 0.00 ? 119 LEU A HB2  2  
ATOM 3739  H HB3  . LEU A 1 120 ? 6.008   6.817   -0.106  1.00 0.00 ? 119 LEU A HB3  2  
ATOM 3740  H HG   . LEU A 1 120 ? 5.495   8.027   -2.826  1.00 0.00 ? 119 LEU A HG   2  
ATOM 3741  H HD11 . LEU A 1 120 ? 4.256   5.354   -1.969  1.00 0.00 ? 119 LEU A HD11 2  
ATOM 3742  H HD12 . LEU A 1 120 ? 5.738   5.517   -2.997  1.00 0.00 ? 119 LEU A HD12 2  
ATOM 3743  H HD13 . LEU A 1 120 ? 4.156   6.168   -3.585  1.00 0.00 ? 119 LEU A HD13 2  
ATOM 3744  H HD21 . LEU A 1 120 ? 4.016   8.718   -0.916  1.00 0.00 ? 119 LEU A HD21 2  
ATOM 3745  H HD22 . LEU A 1 120 ? 3.672   6.977   -0.538  1.00 0.00 ? 119 LEU A HD22 2  
ATOM 3746  H HD23 . LEU A 1 120 ? 3.122   7.661   -2.100  1.00 0.00 ? 119 LEU A HD23 2  
ATOM 3747  N N    . ARG A 1 121 ? 6.848   9.215   1.164   1.00 0.00 ? 120 ARG A N    2  
ATOM 3748  C CA   . ARG A 1 121 ? 6.099   9.898   2.208   1.00 0.00 ? 120 ARG A CA   2  
ATOM 3749  C C    . ARG A 1 121 ? 5.887   11.409  2.160   1.00 0.00 ? 120 ARG A C    2  
ATOM 3750  O O    . ARG A 1 121 ? 4.884   11.949  2.610   1.00 0.00 ? 120 ARG A O    2  
ATOM 3751  C CB   . ARG A 1 121 ? 6.625   9.518   3.667   1.00 0.00 ? 120 ARG A CB   2  
ATOM 3752  C CG   . ARG A 1 121 ? 7.754   10.380  4.292   1.00 0.00 ? 120 ARG A CG   2  
ATOM 3753  C CD   . ARG A 1 121 ? 8.080   9.984   5.745   1.00 0.00 ? 120 ARG A CD   2  
ATOM 3754  N NE   . ARG A 1 121 ? 6.940   10.423  6.634   1.00 0.00 ? 120 ARG A NE   2  
ATOM 3755  C CZ   . ARG A 1 121 ? 6.327   9.636   7.573   1.00 0.00 ? 120 ARG A CZ   2  
ATOM 3756  N NH1  . ARG A 1 121 ? 6.701   8.339   7.765   1.00 0.00 ? 120 ARG A NH1  2  
ATOM 3757  N NH2  . ARG A 1 121 ? 5.318   10.165  8.325   1.00 0.00 ? 120 ARG A NH2  2  
ATOM 3758  H H    . ARG A 1 121 ? 7.438   8.480   1.495   1.00 0.00 ? 120 ARG A H    2  
ATOM 3759  H HA   . ARG A 1 121 ? 5.120   9.509   1.890   1.00 0.00 ? 120 ARG A HA   2  
ATOM 3760  H HB2  . ARG A 1 121 ? 5.797   9.695   4.376   1.00 0.00 ? 120 ARG A HB2  2  
ATOM 3761  H HB3  . ARG A 1 121 ? 6.902   8.425   3.786   1.00 0.00 ? 120 ARG A HB3  2  
ATOM 3762  H HG2  . ARG A 1 121 ? 8.677   10.297  3.688   1.00 0.00 ? 120 ARG A HG2  2  
ATOM 3763  H HG3  . ARG A 1 121 ? 7.478   11.459  4.310   1.00 0.00 ? 120 ARG A HG3  2  
ATOM 3764  H HD2  . ARG A 1 121 ? 8.256   8.889   5.805   1.00 0.00 ? 120 ARG A HD2  2  
ATOM 3765  H HD3  . ARG A 1 121 ? 8.990   10.520  6.086   1.00 0.00 ? 120 ARG A HD3  2  
ATOM 3766  H HE   . ARG A 1 121 ? 6.619   11.365  6.534   1.00 0.00 ? 120 ARG A HE   2  
ATOM 3767  H HH11 . ARG A 1 121 ? 7.438   7.944   7.215   1.00 0.00 ? 120 ARG A HH11 2  
ATOM 3768  H HH12 . ARG A 1 121 ? 6.237   7.782   8.454   1.00 0.00 ? 120 ARG A HH12 2  
ATOM 3769  H HH21 . ARG A 1 121 ? 5.038   11.115  8.186   1.00 0.00 ? 120 ARG A HH21 2  
ATOM 3770  H HH22 . ARG A 1 121 ? 4.859   9.603   9.011   1.00 0.00 ? 120 ARG A HH22 2  
ATOM 3771  N N    . GLU A 1 122 ? 6.892   12.078  1.566   1.00 0.00 ? 121 GLU A N    2  
ATOM 3772  C CA   . GLU A 1 122 ? 7.073   13.480  1.313   1.00 0.00 ? 121 GLU A CA   2  
ATOM 3773  C C    . GLU A 1 122 ? 6.593   13.898  -0.088  1.00 0.00 ? 121 GLU A C    2  
ATOM 3774  O O    . GLU A 1 122 ? 6.307   15.071  -0.314  1.00 0.00 ? 121 GLU A O    2  
ATOM 3775  C CB   . GLU A 1 122 ? 8.592   13.769  1.540   1.00 0.00 ? 121 GLU A CB   2  
ATOM 3776  C CG   . GLU A 1 122 ? 9.546   12.614  1.123   1.00 0.00 ? 121 GLU A CG   2  
ATOM 3777  C CD   . GLU A 1 122 ? 10.998  13.085  1.225   1.00 0.00 ? 121 GLU A CD   2  
ATOM 3778  O OE1  . GLU A 1 122 ? 11.368  14.033  0.482   1.00 0.00 ? 121 GLU A OE1  2  
ATOM 3779  O OE2  . GLU A 1 122 ? 11.757  12.499  2.043   1.00 0.00 ? 121 GLU A OE2  2  
ATOM 3780  H H    . GLU A 1 122 ? 7.663   11.538  1.247   1.00 0.00 ? 121 GLU A H    2  
ATOM 3781  H HA   . GLU A 1 122 ? 6.497   14.065  2.022   1.00 0.00 ? 121 GLU A HA   2  
ATOM 3782  H HB2  . GLU A 1 122 ? 8.886   14.718  1.040   1.00 0.00 ? 121 GLU A HB2  2  
ATOM 3783  H HB3  . GLU A 1 122 ? 8.743   13.921  2.634   1.00 0.00 ? 121 GLU A HB3  2  
ATOM 3784  H HG2  . GLU A 1 122 ? 9.432   11.709  1.778   1.00 0.00 ? 121 GLU A HG2  2  
ATOM 3785  H HG3  . GLU A 1 122 ? 9.340   12.318  0.073   1.00 0.00 ? 121 GLU A HG3  2  
ATOM 3786  N N    . GLN A 1 123 ? 6.510   12.944  -1.065  1.00 0.00 ? 122 GLN A N    2  
ATOM 3787  C CA   . GLN A 1 123 ? 6.109   13.165  -2.451  1.00 0.00 ? 122 GLN A CA   2  
ATOM 3788  C C    . GLN A 1 123 ? 4.703   12.685  -2.799  1.00 0.00 ? 122 GLN A C    2  
ATOM 3789  O O    . GLN A 1 123 ? 3.997   13.418  -3.492  1.00 0.00 ? 122 GLN A O    2  
ATOM 3790  C CB   . GLN A 1 123 ? 7.150   12.663  -3.530  1.00 0.00 ? 122 GLN A CB   2  
ATOM 3791  C CG   . GLN A 1 123 ? 7.806   11.264  -3.352  1.00 0.00 ? 122 GLN A CG   2  
ATOM 3792  C CD   . GLN A 1 123 ? 8.889   11.021  -4.434  1.00 0.00 ? 122 GLN A CD   2  
ATOM 3793  O OE1  . GLN A 1 123 ? 8.772   11.456  -5.584  1.00 0.00 ? 122 GLN A OE1  2  
ATOM 3794  N NE2  . GLN A 1 123 ? 9.980   10.297  -4.085  1.00 0.00 ? 122 GLN A NE2  2  
ATOM 3795  H H    . GLN A 1 123 ? 6.704   11.985  -0.864  1.00 0.00 ? 122 GLN A H    2  
ATOM 3796  H HA   . GLN A 1 123 ? 6.045   14.233  -2.628  1.00 0.00 ? 122 GLN A HA   2  
ATOM 3797  H HB2  . GLN A 1 123 ? 6.691   12.705  -4.548  1.00 0.00 ? 122 GLN A HB2  2  
ATOM 3798  H HB3  . GLN A 1 123 ? 7.975   13.409  -3.548  1.00 0.00 ? 122 GLN A HB3  2  
ATOM 3799  H HG2  . GLN A 1 123 ? 8.300   11.238  -2.358  1.00 0.00 ? 122 GLN A HG2  2  
ATOM 3800  H HG3  . GLN A 1 123 ? 7.044   10.443  -3.400  1.00 0.00 ? 122 GLN A HG3  2  
ATOM 3801  H HE21 . GLN A 1 123 ? 10.063  9.983   -3.122  1.00 0.00 ? 122 GLN A HE21 2  
ATOM 3802  H HE22 . GLN A 1 123 ? 10.687  10.151  -4.776  1.00 0.00 ? 122 GLN A HE22 2  
ATOM 3803  N N    . TYR A 1 124 ? 4.254   11.444  -2.410  1.00 0.00 ? 123 TYR A N    2  
ATOM 3804  C CA   . TYR A 1 124 ? 2.966   10.965  -2.967  1.00 0.00 ? 123 TYR A CA   2  
ATOM 3805  C C    . TYR A 1 124 ? 1.953   10.414  -1.990  1.00 0.00 ? 123 TYR A C    2  
ATOM 3806  O O    . TYR A 1 124 ? 1.000   9.800   -2.463  1.00 0.00 ? 123 TYR A O    2  
ATOM 3807  C CB   . TYR A 1 124 ? 3.110   9.856   -4.087  1.00 0.00 ? 123 TYR A CB   2  
ATOM 3808  C CG   . TYR A 1 124 ? 4.133   10.193  -5.123  1.00 0.00 ? 123 TYR A CG   2  
ATOM 3809  C CD1  . TYR A 1 124 ? 4.091   11.373  -5.840  1.00 0.00 ? 123 TYR A CD1  2  
ATOM 3810  C CD2  . TYR A 1 124 ? 5.182   9.324   -5.335  1.00 0.00 ? 123 TYR A CD2  2  
ATOM 3811  C CE1  . TYR A 1 124 ? 5.118   11.706  -6.697  1.00 0.00 ? 123 TYR A CE1  2  
ATOM 3812  C CE2  . TYR A 1 124 ? 6.199   9.646   -6.198  1.00 0.00 ? 123 TYR A CE2  2  
ATOM 3813  C CZ   . TYR A 1 124 ? 6.164   10.835  -6.894  1.00 0.00 ? 123 TYR A CZ   2  
ATOM 3814  O OH   . TYR A 1 124 ? 7.268   11.240  -7.669  1.00 0.00 ? 123 TYR A OH   2  
ATOM 3815  H H    . TYR A 1 124 ? 4.802   10.812  -1.804  1.00 0.00 ? 123 TYR A H    2  
ATOM 3816  H HA   . TYR A 1 124 ? 2.413   11.770  -3.440  1.00 0.00 ? 123 TYR A HA   2  
ATOM 3817  H HB2  . TYR A 1 124 ? 3.422   8.890   -3.646  1.00 0.00 ? 123 TYR A HB2  2  
ATOM 3818  H HB3  . TYR A 1 124 ? 2.153   9.668   -4.632  1.00 0.00 ? 123 TYR A HB3  2  
ATOM 3819  H HD1  . TYR A 1 124 ? 3.293   12.083  -5.666  1.00 0.00 ? 123 TYR A HD1  2  
ATOM 3820  H HD2  . TYR A 1 124 ? 5.231   8.391   -4.795  1.00 0.00 ? 123 TYR A HD2  2  
ATOM 3821  H HE1  . TYR A 1 124 ? 5.136   12.682  -7.155  1.00 0.00 ? 123 TYR A HE1  2  
ATOM 3822  H HE2  . TYR A 1 124 ? 7.035   8.969   -6.256  1.00 0.00 ? 123 TYR A HE2  2  
ATOM 3823  H HH   . TYR A 1 124 ? 7.991   11.361  -7.013  1.00 0.00 ? 123 TYR A HH   2  
ATOM 3824  N N    . GLY A 1 125 ? 2.064   10.498  -0.629  1.00 0.00 ? 124 GLY A N    2  
ATOM 3825  C CA   . GLY A 1 125 ? 1.059   9.751   0.072   1.00 0.00 ? 124 GLY A CA   2  
ATOM 3826  C C    . GLY A 1 125 ? 1.495   9.684   1.451   1.00 0.00 ? 124 GLY A C    2  
ATOM 3827  O O    . GLY A 1 125 ? 0.902   10.321  2.309   1.00 0.00 ? 124 GLY A O    2  
ATOM 3828  H H    . GLY A 1 125 ? 2.738   10.915  0.013   1.00 0.00 ? 124 GLY A H    2  
ATOM 3829  H HA2  . GLY A 1 125 ? 0.121   10.289  0.052   1.00 0.00 ? 124 GLY A HA2  2  
ATOM 3830  H HA3  . GLY A 1 125 ? 1.001   8.699   -0.255  1.00 0.00 ? 124 GLY A HA3  2  
ATOM 3831  N N    . LEU A 1 126 ? 2.553   8.867   1.676   1.00 0.00 ? 125 LEU A N    2  
ATOM 3832  C CA   . LEU A 1 126 ? 3.059   8.286   2.920   1.00 0.00 ? 125 LEU A CA   2  
ATOM 3833  C C    . LEU A 1 126 ? 3.308   9.110   4.185   1.00 0.00 ? 125 LEU A C    2  
ATOM 3834  O O    . LEU A 1 126 ? 3.795   8.597   5.189   1.00 0.00 ? 125 LEU A O    2  
ATOM 3835  C CB   . LEU A 1 126 ? 4.104   7.177   2.602   1.00 0.00 ? 125 LEU A CB   2  
ATOM 3836  C CG   . LEU A 1 126 ? 3.865   5.749   3.134   1.00 0.00 ? 125 LEU A CG   2  
ATOM 3837  C CD1  . LEU A 1 126 ? 2.933   5.590   4.366   1.00 0.00 ? 125 LEU A CD1  2  
ATOM 3838  C CD2  . LEU A 1 126 ? 3.515   4.975   1.868   1.00 0.00 ? 125 LEU A CD2  2  
ATOM 3839  H H    . LEU A 1 126 ? 2.949   8.455   0.864   1.00 0.00 ? 125 LEU A H    2  
ATOM 3840  H HA   . LEU A 1 126 ? 2.237   7.704   3.227   1.00 0.00 ? 125 LEU A HA   2  
ATOM 3841  H HB2  . LEU A 1 126 ? 4.083   7.092   1.486   1.00 0.00 ? 125 LEU A HB2  2  
ATOM 3842  H HB3  . LEU A 1 126 ? 5.135   7.447   2.807   1.00 0.00 ? 125 LEU A HB3  2  
ATOM 3843  H HG   . LEU A 1 126 ? 4.806   5.271   3.477   1.00 0.00 ? 125 LEU A HG   2  
ATOM 3844  H HD11 . LEU A 1 126 ? 2.791   4.517   4.599   1.00 0.00 ? 125 LEU A HD11 2  
ATOM 3845  H HD12 . LEU A 1 126 ? 1.930   6.039   4.272   1.00 0.00 ? 125 LEU A HD12 2  
ATOM 3846  H HD13 . LEU A 1 126 ? 3.373   6.089   5.254   1.00 0.00 ? 125 LEU A HD13 2  
ATOM 3847  H HD21 . LEU A 1 126 ? 2.555   5.424   1.511   1.00 0.00 ? 125 LEU A HD21 2  
ATOM 3848  H HD22 . LEU A 1 126 ? 3.408   3.892   2.063   1.00 0.00 ? 125 LEU A HD22 2  
ATOM 3849  H HD23 . LEU A 1 126 ? 4.288   5.060   1.059   1.00 0.00 ? 125 LEU A HD23 2  
ATOM 3850  N N    . GLY A 1 127 ? 2.796   10.362  4.225   1.00 0.00 ? 126 GLY A N    2  
ATOM 3851  C CA   . GLY A 1 127 ? 2.562   10.972  5.540   1.00 0.00 ? 126 GLY A CA   2  
ATOM 3852  C C    . GLY A 1 127 ? 2.033   12.382  5.580   1.00 0.00 ? 126 GLY A C    2  
ATOM 3853  O O    . GLY A 1 127 ? 2.881   13.267  5.577   1.00 0.00 ? 126 GLY A O    2  
ATOM 3854  H H    . GLY A 1 127 ? 2.392   10.715  3.347   1.00 0.00 ? 126 GLY A H    2  
ATOM 3855  H HA2  . GLY A 1 127 ? 1.854   10.352  6.073   1.00 0.00 ? 126 GLY A HA2  2  
ATOM 3856  H HA3  . GLY A 1 127 ? 3.519   11.027  6.046   1.00 0.00 ? 126 GLY A HA3  2  
ATOM 3857  N N    . PRO A 1 128 ? 0.730   12.770  5.686   1.00 0.00 ? 127 PRO A N    2  
ATOM 3858  C CA   . PRO A 1 128 ? 0.331   14.188  5.744   1.00 0.00 ? 127 PRO A CA   2  
ATOM 3859  C C    . PRO A 1 128 ? 0.491   14.809  7.153   1.00 0.00 ? 127 PRO A C    2  
ATOM 3860  O O    . PRO A 1 128 ? 0.409   16.026  7.284   1.00 0.00 ? 127 PRO A O    2  
ATOM 3861  C CB   . PRO A 1 128 ? -1.134  14.139  5.274   1.00 0.00 ? 127 PRO A CB   2  
ATOM 3862  C CG   . PRO A 1 128 ? -1.669  12.821  5.838   1.00 0.00 ? 127 PRO A CG   2  
ATOM 3863  C CD   . PRO A 1 128 ? -0.442  11.882  5.738   1.00 0.00 ? 127 PRO A CD   2  
ATOM 3864  H HA   . PRO A 1 128 ? 0.924   14.789  5.066   1.00 0.00 ? 127 PRO A HA   2  
ATOM 3865  H HB2  . PRO A 1 128 ? -1.736  15.020  5.576   1.00 0.00 ? 127 PRO A HB2  2  
ATOM 3866  H HB3  . PRO A 1 128 ? -1.141  14.076  4.159   1.00 0.00 ? 127 PRO A HB3  2  
ATOM 3867  H HG2  . PRO A 1 128 ? -1.991  12.994  6.891   1.00 0.00 ? 127 PRO A HG2  2  
ATOM 3868  H HG3  . PRO A 1 128 ? -2.560  12.475  5.277   1.00 0.00 ? 127 PRO A HG3  2  
ATOM 3869  H HD2  . PRO A 1 128 ? -0.390  11.203  6.615   1.00 0.00 ? 127 PRO A HD2  2  
ATOM 3870  H HD3  . PRO A 1 128 ? -0.503  11.288  4.798   1.00 0.00 ? 127 PRO A HD3  2  
ATOM 3871  N N    . TYR A 1 129 ? 0.740   13.986  8.207   1.00 0.00 ? 128 TYR A N    2  
ATOM 3872  C CA   . TYR A 1 129 ? 0.994   14.361  9.581   1.00 0.00 ? 128 TYR A CA   2  
ATOM 3873  C C    . TYR A 1 129 ? 2.443   13.951  9.836   1.00 0.00 ? 128 TYR A C    2  
ATOM 3874  O O    . TYR A 1 129 ? 2.774   12.775  9.706   1.00 0.00 ? 128 TYR A O    2  
ATOM 3875  C CB   . TYR A 1 129 ? -0.011  13.609  10.506  1.00 0.00 ? 128 TYR A CB   2  
ATOM 3876  C CG   . TYR A 1 129 ? -0.098  14.186  11.896  1.00 0.00 ? 128 TYR A CG   2  
ATOM 3877  C CD1  . TYR A 1 129 ? -0.919  15.272  12.143  1.00 0.00 ? 128 TYR A CD1  2  
ATOM 3878  C CD2  . TYR A 1 129 ? 0.607   13.627  12.951  1.00 0.00 ? 128 TYR A CD2  2  
ATOM 3879  C CE1  . TYR A 1 129 ? -1.031  15.791  13.418  1.00 0.00 ? 128 TYR A CE1  2  
ATOM 3880  C CE2  . TYR A 1 129 ? 0.489   14.141  14.228  1.00 0.00 ? 128 TYR A CE2  2  
ATOM 3881  C CZ   . TYR A 1 129 ? -0.327  15.229  14.460  1.00 0.00 ? 128 TYR A CZ   2  
ATOM 3882  O OH   . TYR A 1 129 ? -0.451  15.784  15.750  1.00 0.00 ? 128 TYR A OH   2  
ATOM 3883  H H    . TYR A 1 129 ? 0.813   13.009  8.018   1.00 0.00 ? 128 TYR A H    2  
ATOM 3884  H HA   . TYR A 1 129 ? 0.899   15.432  9.710   1.00 0.00 ? 128 TYR A HA   2  
ATOM 3885  H HB2  . TYR A 1 129 ? -1.026  13.693  10.058  1.00 0.00 ? 128 TYR A HB2  2  
ATOM 3886  H HB3  . TYR A 1 129 ? 0.223   12.528  10.579  1.00 0.00 ? 128 TYR A HB3  2  
ATOM 3887  H HD1  . TYR A 1 129 ? -1.482  15.720  11.335  1.00 0.00 ? 128 TYR A HD1  2  
ATOM 3888  H HD2  . TYR A 1 129 ? 1.254   12.777  12.778  1.00 0.00 ? 128 TYR A HD2  2  
ATOM 3889  H HE1  . TYR A 1 129 ? -1.677  16.640  13.604  1.00 0.00 ? 128 TYR A HE1  2  
ATOM 3890  H HE2  . TYR A 1 129 ? 1.051   13.695  15.038  1.00 0.00 ? 128 TYR A HE2  2  
ATOM 3891  H HH   . TYR A 1 129 ? -0.108  15.161  16.394  1.00 0.00 ? 128 TYR A HH   2  
ATOM 3892  N N    . GLU A 1 130 ? 3.336   14.915  10.169  1.00 0.00 ? 129 GLU A N    2  
ATOM 3893  C CA   . GLU A 1 130 ? 4.751   14.689  10.418  1.00 0.00 ? 129 GLU A CA   2  
ATOM 3894  C C    . GLU A 1 130 ? 5.124   15.495  11.648  1.00 0.00 ? 129 GLU A C    2  
ATOM 3895  O O    . GLU A 1 130 ? 4.519   16.530  11.931  1.00 0.00 ? 129 GLU A O    2  
ATOM 3896  C CB   . GLU A 1 130 ? 5.644   15.098  9.207   1.00 0.00 ? 129 GLU A CB   2  
ATOM 3897  C CG   . GLU A 1 130 ? 5.436   14.199  7.969   1.00 0.00 ? 129 GLU A CG   2  
ATOM 3898  C CD   . GLU A 1 130 ? 6.384   14.607  6.841   1.00 0.00 ? 129 GLU A CD   2  
ATOM 3899  O OE1  . GLU A 1 130 ? 6.274   15.769  6.367   1.00 0.00 ? 129 GLU A OE1  2  
ATOM 3900  O OE2  . GLU A 1 130 ? 7.224   13.760  6.434   1.00 0.00 ? 129 GLU A OE2  2  
ATOM 3901  H H    . GLU A 1 130 ? 3.058   15.869  10.260  1.00 0.00 ? 129 GLU A H    2  
ATOM 3902  H HA   . GLU A 1 130 ? 4.941   13.649  10.662  1.00 0.00 ? 129 GLU A HA   2  
ATOM 3903  H HB2  . GLU A 1 130 ? 5.423   16.152  8.923   1.00 0.00 ? 129 GLU A HB2  2  
ATOM 3904  H HB3  . GLU A 1 130 ? 6.721   15.030  9.485   1.00 0.00 ? 129 GLU A HB3  2  
ATOM 3905  H HG2  . GLU A 1 130 ? 5.621   13.141  8.249   1.00 0.00 ? 129 GLU A HG2  2  
ATOM 3906  H HG3  . GLU A 1 130 ? 4.391   14.289  7.606   1.00 0.00 ? 129 GLU A HG3  2  
ATOM 3907  N N    . ASN A 1 8   ? -14.204 12.457  -6.018  1.00 0.00 ? 7   ASN A N    3  
ATOM 3908  C CA   . ASN A 1 8   ? -14.913 11.213  -5.915  1.00 0.00 ? 7   ASN A CA   3  
ATOM 3909  C C    . ASN A 1 8   ? -13.912 10.169  -5.473  1.00 0.00 ? 7   ASN A C    3  
ATOM 3910  O O    . ASN A 1 8   ? -13.741 9.871   -4.291  1.00 0.00 ? 7   ASN A O    3  
ATOM 3911  C CB   . ASN A 1 8   ? -15.629 10.857  -7.268  1.00 0.00 ? 7   ASN A CB   3  
ATOM 3912  C CG   . ASN A 1 8   ? -16.510 9.599   -7.193  1.00 0.00 ? 7   ASN A CG   3  
ATOM 3913  O OD1  . ASN A 1 8   ? -17.655 9.671   -6.749  1.00 0.00 ? 7   ASN A OD1  3  
ATOM 3914  N ND2  . ASN A 1 8   ? -15.981 8.424   -7.620  1.00 0.00 ? 7   ASN A ND2  3  
ATOM 3915  H H    . ASN A 1 8   ? -14.618 13.275  -5.618  1.00 0.00 ? 7   ASN A H    3  
ATOM 3916  H HA   . ASN A 1 8   ? -15.643 11.317  -5.124  1.00 0.00 ? 7   ASN A HA   3  
ATOM 3917  H HB2  . ASN A 1 8   ? -16.314 11.699  -7.509  1.00 0.00 ? 7   ASN A HB2  3  
ATOM 3918  H HB3  . ASN A 1 8   ? -14.915 10.779  -8.109  1.00 0.00 ? 7   ASN A HB3  3  
ATOM 3919  H HD21 . ASN A 1 8   ? -15.036 8.383   -7.998  1.00 0.00 ? 7   ASN A HD21 3  
ATOM 3920  H HD22 . ASN A 1 8   ? -16.588 7.626   -7.549  1.00 0.00 ? 7   ASN A HD22 3  
ATOM 3921  N N    . SER A 1 9   ? -13.227 9.555   -6.472  1.00 0.00 ? 8   SER A N    3  
ATOM 3922  C CA   . SER A 1 9   ? -12.314 8.421   -6.470  1.00 0.00 ? 8   SER A CA   3  
ATOM 3923  C C    . SER A 1 9   ? -10.970 8.601   -5.786  1.00 0.00 ? 8   SER A C    3  
ATOM 3924  O O    . SER A 1 9   ? -9.946  8.130   -6.269  1.00 0.00 ? 8   SER A O    3  
ATOM 3925  C CB   . SER A 1 9   ? -12.078 7.959   -7.942  1.00 0.00 ? 8   SER A CB   3  
ATOM 3926  O OG   . SER A 1 9   ? -13.311 7.961   -8.673  1.00 0.00 ? 8   SER A OG   3  
ATOM 3927  H H    . SER A 1 9   ? -13.409 9.846   -7.403  1.00 0.00 ? 8   SER A H    3  
ATOM 3928  H HA   . SER A 1 9   ? -12.818 7.618   -5.950  1.00 0.00 ? 8   SER A HA   3  
ATOM 3929  H HB2  . SER A 1 9   ? -11.380 8.654   -8.461  1.00 0.00 ? 8   SER A HB2  3  
ATOM 3930  H HB3  . SER A 1 9   ? -11.639 6.935   -7.965  1.00 0.00 ? 8   SER A HB3  3  
ATOM 3931  H HG   . SER A 1 9   ? -13.128 7.577   -9.542  1.00 0.00 ? 8   SER A HG   3  
ATOM 3932  N N    . PHE A 1 10  ? -10.972 9.268   -4.610  1.00 0.00 ? 9   PHE A N    3  
ATOM 3933  C CA   . PHE A 1 10  ? -9.843  9.508   -3.734  1.00 0.00 ? 9   PHE A CA   3  
ATOM 3934  C C    . PHE A 1 10  ? -10.129 8.735   -2.516  1.00 0.00 ? 9   PHE A C    3  
ATOM 3935  O O    . PHE A 1 10  ? -9.424  7.792   -2.229  1.00 0.00 ? 9   PHE A O    3  
ATOM 3936  C CB   . PHE A 1 10  ? -9.636  11.019  -3.429  1.00 0.00 ? 9   PHE A CB   3  
ATOM 3937  C CG   . PHE A 1 10  ? -8.327  11.432  -2.815  1.00 0.00 ? 9   PHE A CG   3  
ATOM 3938  C CD1  . PHE A 1 10  ? -7.140  10.728  -2.931  1.00 0.00 ? 9   PHE A CD1  3  
ATOM 3939  C CD2  . PHE A 1 10  ? -8.334  12.609  -2.093  1.00 0.00 ? 9   PHE A CD2  3  
ATOM 3940  C CE1  . PHE A 1 10  ? -5.989  11.210  -2.339  1.00 0.00 ? 9   PHE A CE1  3  
ATOM 3941  C CE2  . PHE A 1 10  ? -7.194  13.082  -1.490  1.00 0.00 ? 9   PHE A CE2  3  
ATOM 3942  C CZ   . PHE A 1 10  ? -6.011  12.391  -1.625  1.00 0.00 ? 9   PHE A CZ   3  
ATOM 3943  H H    . PHE A 1 10  ? -11.869 9.611   -4.309  1.00 0.00 ? 9   PHE A H    3  
ATOM 3944  H HA   . PHE A 1 10  ? -8.974  8.985   -4.083  1.00 0.00 ? 9   PHE A HA   3  
ATOM 3945  H HB2  . PHE A 1 10  ? -9.740  11.596  -4.375  1.00 0.00 ? 9   PHE A HB2  3  
ATOM 3946  H HB3  . PHE A 1 10  ? -10.408 11.353  -2.708  1.00 0.00 ? 9   PHE A HB3  3  
ATOM 3947  H HD1  . PHE A 1 10  ? -7.090  9.796   -3.478  1.00 0.00 ? 9   PHE A HD1  3  
ATOM 3948  H HD2  . PHE A 1 10  ? -9.253  13.173  -2.000  1.00 0.00 ? 9   PHE A HD2  3  
ATOM 3949  H HE1  . PHE A 1 10  ? -5.068  10.650  -2.427  1.00 0.00 ? 9   PHE A HE1  3  
ATOM 3950  H HE2  . PHE A 1 10  ? -7.249  13.994  -0.914  1.00 0.00 ? 9   PHE A HE2  3  
ATOM 3951  H HZ   . PHE A 1 10  ? -5.107  12.774  -1.172  1.00 0.00 ? 9   PHE A HZ   3  
ATOM 3952  N N    . VAL A 1 11  ? -11.219 9.026   -1.779  1.00 0.00 ? 10  VAL A N    3  
ATOM 3953  C CA   . VAL A 1 11  ? -11.683 8.295   -0.585  1.00 0.00 ? 10  VAL A CA   3  
ATOM 3954  C C    . VAL A 1 11  ? -12.059 6.803   -0.691  1.00 0.00 ? 10  VAL A C    3  
ATOM 3955  O O    . VAL A 1 11  ? -12.495 6.187   0.266   1.00 0.00 ? 10  VAL A O    3  
ATOM 3956  C CB   . VAL A 1 11  ? -12.609 9.144   0.250   1.00 0.00 ? 10  VAL A CB   3  
ATOM 3957  C CG1  . VAL A 1 11  ? -11.714 10.303  0.697   1.00 0.00 ? 10  VAL A CG1  3  
ATOM 3958  C CG2  . VAL A 1 11  ? -13.766 9.707   -0.582  1.00 0.00 ? 10  VAL A CG2  3  
ATOM 3959  H H    . VAL A 1 11  ? -11.773 9.840   -2.010  1.00 0.00 ? 10  VAL A H    3  
ATOM 3960  H HA   . VAL A 1 11  ? -10.802 8.226   0.039   1.00 0.00 ? 10  VAL A HA   3  
ATOM 3961  H HB   . VAL A 1 11  ? -12.994 8.598   1.143   1.00 0.00 ? 10  VAL A HB   3  
ATOM 3962  H HG11 . VAL A 1 11  ? -11.300 10.802  -0.202  1.00 0.00 ? 10  VAL A HG11 3  
ATOM 3963  H HG12 . VAL A 1 11  ? -10.866 9.904   1.282   1.00 0.00 ? 10  VAL A HG12 3  
ATOM 3964  H HG13 . VAL A 1 11  ? -12.281 11.037  1.303   1.00 0.00 ? 10  VAL A HG13 3  
ATOM 3965  H HG21 . VAL A 1 11  ? -14.425 10.296  0.095   1.00 0.00 ? 10  VAL A HG21 3  
ATOM 3966  H HG22 . VAL A 1 11  ? -14.343 8.893   -1.066  1.00 0.00 ? 10  VAL A HG22 3  
ATOM 3967  H HG23 . VAL A 1 11  ? -13.374 10.387  -1.373  1.00 0.00 ? 10  VAL A HG23 3  
ATOM 3968  N N    . GLY A 1 12  ? -11.784 6.239   -1.888  1.00 0.00 ? 11  GLY A N    3  
ATOM 3969  C CA   . GLY A 1 12  ? -11.771 4.856   -2.351  1.00 0.00 ? 11  GLY A CA   3  
ATOM 3970  C C    . GLY A 1 12  ? -10.351 4.409   -2.690  1.00 0.00 ? 11  GLY A C    3  
ATOM 3971  O O    . GLY A 1 12  ? -10.159 3.461   -3.449  1.00 0.00 ? 11  GLY A O    3  
ATOM 3972  H H    . GLY A 1 12  ? -11.389 6.907   -2.507  1.00 0.00 ? 11  GLY A H    3  
ATOM 3973  H HA2  . GLY A 1 12  ? -12.117 4.204   -1.536  1.00 0.00 ? 11  GLY A HA2  3  
ATOM 3974  H HA3  . GLY A 1 12  ? -12.335 4.831   -3.289  1.00 0.00 ? 11  GLY A HA3  3  
ATOM 3975  N N    . LEU A 1 13  ? -9.337  5.110   -2.090  1.00 0.00 ? 12  LEU A N    3  
ATOM 3976  C CA   . LEU A 1 13  ? -7.871  5.010   -2.046  1.00 0.00 ? 12  LEU A CA   3  
ATOM 3977  C C    . LEU A 1 13  ? -7.266  3.647   -1.814  1.00 0.00 ? 12  LEU A C    3  
ATOM 3978  O O    . LEU A 1 13  ? -7.905  2.692   -1.369  1.00 0.00 ? 12  LEU A O    3  
ATOM 3979  C CB   . LEU A 1 13  ? -7.339  5.899   -0.875  1.00 0.00 ? 12  LEU A CB   3  
ATOM 3980  C CG   . LEU A 1 13  ? -6.304  7.045   -1.080  1.00 0.00 ? 12  LEU A CG   3  
ATOM 3981  C CD1  . LEU A 1 13  ? -5.822  7.404   -2.489  1.00 0.00 ? 12  LEU A CD1  3  
ATOM 3982  C CD2  . LEU A 1 13  ? -6.973  8.224   -0.348  1.00 0.00 ? 12  LEU A CD2  3  
ATOM 3983  H H    . LEU A 1 13  ? -9.617  5.963   -1.641  1.00 0.00 ? 12  LEU A H    3  
ATOM 3984  H HA   . LEU A 1 13  ? -7.510  5.371   -2.999  1.00 0.00 ? 12  LEU A HA   3  
ATOM 3985  H HB2  . LEU A 1 13  ? -8.270  6.428   -0.557  1.00 0.00 ? 12  LEU A HB2  3  
ATOM 3986  H HB3  . LEU A 1 13  ? -7.024  5.338   0.037   1.00 0.00 ? 12  LEU A HB3  3  
ATOM 3987  H HG   . LEU A 1 13  ? -5.327  6.814   -0.562  1.00 0.00 ? 12  LEU A HG   3  
ATOM 3988  H HD11 . LEU A 1 13  ? -6.674  7.700   -3.131  1.00 0.00 ? 12  LEU A HD11 3  
ATOM 3989  H HD12 . LEU A 1 13  ? -5.278  6.554   -2.951  1.00 0.00 ? 12  LEU A HD12 3  
ATOM 3990  H HD13 . LEU A 1 13  ? -5.091  8.249   -2.394  1.00 0.00 ? 12  LEU A HD13 3  
ATOM 3991  H HD21 . LEU A 1 13  ? -7.848  8.633   -0.894  1.00 0.00 ? 12  LEU A HD21 3  
ATOM 3992  H HD22 . LEU A 1 13  ? -6.299  9.080   -0.188  1.00 0.00 ? 12  LEU A HD22 3  
ATOM 3993  H HD23 . LEU A 1 13  ? -7.338  7.797   0.621   1.00 0.00 ? 12  LEU A HD23 3  
ATOM 3994  N N    . ARG A 1 14  ? -5.947  3.612   -2.083  1.00 0.00 ? 13  ARG A N    3  
ATOM 3995  C CA   . ARG A 1 14  ? -5.071  2.455   -2.082  1.00 0.00 ? 13  ARG A CA   3  
ATOM 3996  C C    . ARG A 1 14  ? -4.138  2.728   -0.929  1.00 0.00 ? 13  ARG A C    3  
ATOM 3997  O O    . ARG A 1 14  ? -3.442  3.734   -0.937  1.00 0.00 ? 13  ARG A O    3  
ATOM 3998  C CB   . ARG A 1 14  ? -4.352  2.378   -3.462  1.00 0.00 ? 13  ARG A CB   3  
ATOM 3999  C CG   . ARG A 1 14  ? -5.326  2.164   -4.648  1.00 0.00 ? 13  ARG A CG   3  
ATOM 4000  C CD   . ARG A 1 14  ? -4.936  2.912   -5.938  1.00 0.00 ? 13  ARG A CD   3  
ATOM 4001  N NE   . ARG A 1 14  ? -6.043  2.796   -6.959  1.00 0.00 ? 13  ARG A NE   3  
ATOM 4002  C CZ   . ARG A 1 14  ? -6.268  1.706   -7.761  1.00 0.00 ? 13  ARG A CZ   3  
ATOM 4003  N NH1  . ARG A 1 14  ? -5.496  0.585   -7.684  1.00 0.00 ? 13  ARG A NH1  3  
ATOM 4004  N NH2  . ARG A 1 14  ? -7.295  1.746   -8.661  1.00 0.00 ? 13  ARG A NH2  3  
ATOM 4005  H H    . ARG A 1 14  ? -5.476  4.480   -2.289  1.00 0.00 ? 13  ARG A H    3  
ATOM 4006  H HA   . ARG A 1 14  ? -5.607  1.539   -1.905  1.00 0.00 ? 13  ARG A HA   3  
ATOM 4007  H HB2  . ARG A 1 14  ? -3.814  3.335   -3.648  1.00 0.00 ? 13  ARG A HB2  3  
ATOM 4008  H HB3  . ARG A 1 14  ? -3.597  1.564   -3.466  1.00 0.00 ? 13  ARG A HB3  3  
ATOM 4009  H HG2  . ARG A 1 14  ? -5.391  1.075   -4.860  1.00 0.00 ? 13  ARG A HG2  3  
ATOM 4010  H HG3  . ARG A 1 14  ? -6.343  2.509   -4.364  1.00 0.00 ? 13  ARG A HG3  3  
ATOM 4011  H HD2  . ARG A 1 14  ? -4.821  3.993   -5.710  1.00 0.00 ? 13  ARG A HD2  3  
ATOM 4012  H HD3  . ARG A 1 14  ? -3.982  2.545   -6.368  1.00 0.00 ? 13  ARG A HD3  3  
ATOM 4013  H HE   . ARG A 1 14  ? -6.649  3.585   -7.065  1.00 0.00 ? 13  ARG A HE   3  
ATOM 4014  H HH11 . ARG A 1 14  ? -4.742  0.543   -7.029  1.00 0.00 ? 13  ARG A HH11 3  
ATOM 4015  H HH12 . ARG A 1 14  ? -5.686  -0.194  -8.282  1.00 0.00 ? 13  ARG A HH12 3  
ATOM 4016  H HH21 . ARG A 1 14  ? -7.869  2.561   -8.729  1.00 0.00 ? 13  ARG A HH21 3  
ATOM 4017  H HH22 . ARG A 1 14  ? -7.472  0.958   -9.252  1.00 0.00 ? 13  ARG A HH22 3  
ATOM 4018  N N    . VAL A 1 15  ? -4.144  1.927   0.162   1.00 0.00 ? 14  VAL A N    3  
ATOM 4019  C CA   . VAL A 1 15  ? -3.408  2.256   1.385   1.00 0.00 ? 14  VAL A CA   3  
ATOM 4020  C C    . VAL A 1 15  ? -2.388  1.237   1.802   1.00 0.00 ? 14  VAL A C    3  
ATOM 4021  O O    . VAL A 1 15  ? -2.357  0.094   1.365   1.00 0.00 ? 14  VAL A O    3  
ATOM 4022  C CB   . VAL A 1 15  ? -4.231  2.876   2.541   1.00 0.00 ? 14  VAL A CB   3  
ATOM 4023  C CG1  . VAL A 1 15  ? -5.067  3.996   1.935   1.00 0.00 ? 14  VAL A CG1  3  
ATOM 4024  C CG2  . VAL A 1 15  ? -5.134  2.097   3.493   1.00 0.00 ? 14  VAL A CG2  3  
ATOM 4025  H H    . VAL A 1 15  ? -4.688  1.086   0.223   1.00 0.00 ? 14  VAL A H    3  
ATOM 4026  H HA   . VAL A 1 15  ? -2.743  3.076   1.154   1.00 0.00 ? 14  VAL A HA   3  
ATOM 4027  H HB   . VAL A 1 15  ? -3.506  3.299   3.263   1.00 0.00 ? 14  VAL A HB   3  
ATOM 4028  H HG11 . VAL A 1 15  ? -4.480  4.560   1.191   1.00 0.00 ? 14  VAL A HG11 3  
ATOM 4029  H HG12 . VAL A 1 15  ? -5.346  4.693   2.749   1.00 0.00 ? 14  VAL A HG12 3  
ATOM 4030  H HG13 . VAL A 1 15  ? -5.971  3.596   1.427   1.00 0.00 ? 14  VAL A HG13 3  
ATOM 4031  H HG21 . VAL A 1 15  ? -4.607  1.251   3.962   1.00 0.00 ? 14  VAL A HG21 3  
ATOM 4032  H HG22 . VAL A 1 15  ? -6.058  1.790   2.989   1.00 0.00 ? 14  VAL A HG22 3  
ATOM 4033  H HG23 . VAL A 1 15  ? -5.468  2.786   4.304   1.00 0.00 ? 14  VAL A HG23 3  
ATOM 4034  N N    . VAL A 1 16  ? -1.450  1.673   2.667   1.00 0.00 ? 15  VAL A N    3  
ATOM 4035  C CA   . VAL A 1 16  ? -0.329  0.933   3.228   1.00 0.00 ? 15  VAL A CA   3  
ATOM 4036  C C    . VAL A 1 16  ? -0.550  0.855   4.693   1.00 0.00 ? 15  VAL A C    3  
ATOM 4037  O O    . VAL A 1 16  ? -1.142  1.773   5.245   1.00 0.00 ? 15  VAL A O    3  
ATOM 4038  C CB   . VAL A 1 16  ? 1.010   1.552   2.907   1.00 0.00 ? 15  VAL A CB   3  
ATOM 4039  C CG1  . VAL A 1 16  ? 1.293   1.017   1.490   1.00 0.00 ? 15  VAL A CG1  3  
ATOM 4040  C CG2  . VAL A 1 16  ? 0.952   3.089   3.053   1.00 0.00 ? 15  VAL A CG2  3  
ATOM 4041  H H    . VAL A 1 16  ? -1.486  2.616   2.987   1.00 0.00 ? 15  VAL A H    3  
ATOM 4042  H HA   . VAL A 1 16  ? -0.322  -0.082  2.869   1.00 0.00 ? 15  VAL A HA   3  
ATOM 4043  H HB   . VAL A 1 16  ? 1.829   1.201   3.584   1.00 0.00 ? 15  VAL A HB   3  
ATOM 4044  H HG11 . VAL A 1 16  ? 1.251   -0.104  1.513   1.00 0.00 ? 15  VAL A HG11 3  
ATOM 4045  H HG12 . VAL A 1 16  ? 2.292   1.338   1.152   1.00 0.00 ? 15  VAL A HG12 3  
ATOM 4046  H HG13 . VAL A 1 16  ? 0.520   1.378   0.781   1.00 0.00 ? 15  VAL A HG13 3  
ATOM 4047  H HG21 . VAL A 1 16  ? 0.645   3.387   4.080   1.00 0.00 ? 15  VAL A HG21 3  
ATOM 4048  H HG22 . VAL A 1 16  ? 0.253   3.547   2.326   1.00 0.00 ? 15  VAL A HG22 3  
ATOM 4049  H HG23 . VAL A 1 16  ? 1.952   3.517   2.878   1.00 0.00 ? 15  VAL A HG23 3  
ATOM 4050  N N    . ALA A 1 17  ? -0.120  -0.267  5.326   1.00 0.00 ? 16  ALA A N    3  
ATOM 4051  C CA   . ALA A 1 17  ? -0.453  -0.578  6.698   1.00 0.00 ? 16  ALA A CA   3  
ATOM 4052  C C    . ALA A 1 17  ? 0.761   -0.887  7.563   1.00 0.00 ? 16  ALA A C    3  
ATOM 4053  O O    . ALA A 1 17  ? 1.388   -1.935  7.519   1.00 0.00 ? 16  ALA A O    3  
ATOM 4054  C CB   . ALA A 1 17  ? -1.482  -1.743  6.629   1.00 0.00 ? 16  ALA A CB   3  
ATOM 4055  H H    . ALA A 1 17  ? 0.389   -0.978  4.822   1.00 0.00 ? 16  ALA A H    3  
ATOM 4056  H HA   . ALA A 1 17  ? -0.922  0.263   7.185   1.00 0.00 ? 16  ALA A HA   3  
ATOM 4057  H HB1  . ALA A 1 17  ? -1.210  -2.524  5.881   1.00 0.00 ? 16  ALA A HB1  3  
ATOM 4058  H HB2  . ALA A 1 17  ? -2.449  -1.358  6.243   1.00 0.00 ? 16  ALA A HB2  3  
ATOM 4059  H HB3  . ALA A 1 17  ? -1.651  -2.229  7.608   1.00 0.00 ? 16  ALA A HB3  3  
ATOM 4060  N N    . LYS A 1 18  ? 1.080   0.077   8.434   1.00 0.00 ? 17  LYS A N    3  
ATOM 4061  C CA   . LYS A 1 18  ? 2.173   0.102   9.369   1.00 0.00 ? 17  LYS A CA   3  
ATOM 4062  C C    . LYS A 1 18  ? 1.607   0.656   10.677  1.00 0.00 ? 17  LYS A C    3  
ATOM 4063  O O    . LYS A 1 18  ? 1.282   1.830   10.693  1.00 0.00 ? 17  LYS A O    3  
ATOM 4064  C CB   . LYS A 1 18  ? 3.317   1.052   8.841   1.00 0.00 ? 17  LYS A CB   3  
ATOM 4065  C CG   . LYS A 1 18  ? 3.059   1.951   7.596   1.00 0.00 ? 17  LYS A CG   3  
ATOM 4066  C CD   . LYS A 1 18  ? 3.535   3.405   7.793   1.00 0.00 ? 17  LYS A CD   3  
ATOM 4067  C CE   . LYS A 1 18  ? 5.035   3.626   7.595   1.00 0.00 ? 17  LYS A CE   3  
ATOM 4068  N NZ   . LYS A 1 18  ? 5.421   5.022   7.907   1.00 0.00 ? 17  LYS A NZ   3  
ATOM 4069  H H    . LYS A 1 18  ? 0.558   0.927   8.422   1.00 0.00 ? 17  LYS A H    3  
ATOM 4070  H HA   . LYS A 1 18  ? 2.570   -0.888  9.544   1.00 0.00 ? 17  LYS A HA   3  
ATOM 4071  H HB2  . LYS A 1 18  ? 3.631   1.744   9.652   1.00 0.00 ? 17  LYS A HB2  3  
ATOM 4072  H HB3  . LYS A 1 18  ? 4.177   0.400   8.604   1.00 0.00 ? 17  LYS A HB3  3  
ATOM 4073  H HG2  . LYS A 1 18  ? 3.447   1.534   6.630   1.00 0.00 ? 17  LYS A HG2  3  
ATOM 4074  H HG3  . LYS A 1 18  ? 1.978   2.036   7.422   1.00 0.00 ? 17  LYS A HG3  3  
ATOM 4075  H HD2  . LYS A 1 18  ? 2.987   4.053   7.073   1.00 0.00 ? 17  LYS A HD2  3  
ATOM 4076  H HD3  . LYS A 1 18  ? 3.250   3.737   8.817   1.00 0.00 ? 17  LYS A HD3  3  
ATOM 4077  H HE2  . LYS A 1 18  ? 5.631   2.956   8.251   1.00 0.00 ? 17  LYS A HE2  3  
ATOM 4078  H HE3  . LYS A 1 18  ? 5.291   3.445   6.531   1.00 0.00 ? 17  LYS A HE3  3  
ATOM 4079  H HZ1  . LYS A 1 18  ? 5.199   5.229   8.902   1.00 0.00 ? 17  LYS A HZ1  3  
ATOM 4080  H HZ2  . LYS A 1 18  ? 4.892   5.672   7.291   1.00 0.00 ? 17  LYS A HZ2  3  
ATOM 4081  H HZ3  . LYS A 1 18  ? 6.441   5.145   7.745   1.00 0.00 ? 17  LYS A HZ3  3  
ATOM 4082  N N    . TRP A 1 19  ? 1.462   -0.067  11.820  1.00 0.00 ? 18  TRP A N    3  
ATOM 4083  C CA   . TRP A 1 19  ? 0.936   0.554   13.062  1.00 0.00 ? 18  TRP A CA   3  
ATOM 4084  C C    . TRP A 1 19  ? 1.999   1.264   13.924  1.00 0.00 ? 18  TRP A C    3  
ATOM 4085  O O    . TRP A 1 19  ? 1.744   2.236   14.630  1.00 0.00 ? 18  TRP A O    3  
ATOM 4086  C CB   . TRP A 1 19  ? 0.078   -0.434  13.889  1.00 0.00 ? 18  TRP A CB   3  
ATOM 4087  C CG   . TRP A 1 19  ? -1.266  -0.727  13.259  1.00 0.00 ? 18  TRP A CG   3  
ATOM 4088  C CD1  . TRP A 1 19  ? -1.727  -1.764  12.494  1.00 0.00 ? 18  TRP A CD1  3  
ATOM 4089  C CD2  . TRP A 1 19  ? -2.391  0.099   13.560  1.00 0.00 ? 18  TRP A CD2  3  
ATOM 4090  N NE1  . TRP A 1 19  ? -3.094  -1.651  12.332  1.00 0.00 ? 18  TRP A NE1  3  
ATOM 4091  C CE2  . TRP A 1 19  ? -3.516  -0.533  13.029  1.00 0.00 ? 18  TRP A CE2  3  
ATOM 4092  C CE3  . TRP A 1 19  ? -2.473  1.268   14.264  1.00 0.00 ? 18  TRP A CE3  3  
ATOM 4093  C CZ2  . TRP A 1 19  ? -4.763  -0.031  13.249  1.00 0.00 ? 18  TRP A CZ2  3  
ATOM 4094  C CZ3  . TRP A 1 19  ? -3.735  1.715   14.553  1.00 0.00 ? 18  TRP A CZ3  3  
ATOM 4095  C CH2  . TRP A 1 19  ? -4.862  1.069   14.078  1.00 0.00 ? 18  TRP A CH2  3  
ATOM 4096  H H    . TRP A 1 19  ? 1.683   -1.038  11.841  1.00 0.00 ? 18  TRP A H    3  
ATOM 4097  H HA   . TRP A 1 19  ? 0.248   1.354   12.803  1.00 0.00 ? 18  TRP A HA   3  
ATOM 4098  H HB2  . TRP A 1 19  ? 0.595   -1.391  14.047  1.00 0.00 ? 18  TRP A HB2  3  
ATOM 4099  H HB3  . TRP A 1 19  ? -0.140  -0.006  14.897  1.00 0.00 ? 18  TRP A HB3  3  
ATOM 4100  H HD1  . TRP A 1 19  ? -1.111  -2.556  12.096  1.00 0.00 ? 18  TRP A HD1  3  
ATOM 4101  H HE1  . TRP A 1 19  ? -3.681  -2.271  11.853  1.00 0.00 ? 18  TRP A HE1  3  
ATOM 4102  H HE3  . TRP A 1 19  ? -1.610  1.842   14.598  1.00 0.00 ? 18  TRP A HE3  3  
ATOM 4103  H HZ2  . TRP A 1 19  ? -5.653  -0.502  12.862  1.00 0.00 ? 18  TRP A HZ2  3  
ATOM 4104  H HZ3  . TRP A 1 19  ? -3.816  2.583   15.182  1.00 0.00 ? 18  TRP A HZ3  3  
ATOM 4105  H HH2  . TRP A 1 19  ? -5.836  1.465   14.322  1.00 0.00 ? 18  TRP A HH2  3  
ATOM 4106  N N    . SER A 1 20  ? 3.246   0.778   13.868  1.00 0.00 ? 19  SER A N    3  
ATOM 4107  C CA   . SER A 1 20  ? 4.426   1.386   14.458  1.00 0.00 ? 19  SER A CA   3  
ATOM 4108  C C    . SER A 1 20  ? 5.360   1.399   13.279  1.00 0.00 ? 19  SER A C    3  
ATOM 4109  O O    . SER A 1 20  ? 5.229   0.513   12.433  1.00 0.00 ? 19  SER A O    3  
ATOM 4110  C CB   . SER A 1 20  ? 5.057   0.549   15.611  1.00 0.00 ? 19  SER A CB   3  
ATOM 4111  O OG   . SER A 1 20  ? 4.162   0.437   16.713  1.00 0.00 ? 19  SER A OG   3  
ATOM 4112  H H    . SER A 1 20  ? 3.430   -0.006  13.280  1.00 0.00 ? 19  SER A H    3  
ATOM 4113  H HA   . SER A 1 20  ? 4.246   2.411   14.760  1.00 0.00 ? 19  SER A HA   3  
ATOM 4114  H HB2  . SER A 1 20  ? 5.303   -0.483  15.270  1.00 0.00 ? 19  SER A HB2  3  
ATOM 4115  H HB3  . SER A 1 20  ? 5.992   1.028   15.980  1.00 0.00 ? 19  SER A HB3  3  
ATOM 4116  H HG   . SER A 1 20  ? 3.490   1.117   16.596  1.00 0.00 ? 19  SER A HG   3  
ATOM 4117  N N    . SER A 1 21  ? 6.349   2.339   13.147  1.00 0.00 ? 20  SER A N    3  
ATOM 4118  C CA   . SER A 1 21  ? 7.327   2.252   12.043  1.00 0.00 ? 20  SER A CA   3  
ATOM 4119  C C    . SER A 1 21  ? 8.321   1.101   12.308  1.00 0.00 ? 20  SER A C    3  
ATOM 4120  O O    . SER A 1 21  ? 9.140   1.160   13.222  1.00 0.00 ? 20  SER A O    3  
ATOM 4121  C CB   . SER A 1 21  ? 8.078   3.611   11.863  1.00 0.00 ? 20  SER A CB   3  
ATOM 4122  O OG   . SER A 1 21  ? 8.631   4.110   13.086  1.00 0.00 ? 20  SER A OG   3  
ATOM 4123  H H    . SER A 1 21  ? 6.500   3.085   13.794  1.00 0.00 ? 20  SER A H    3  
ATOM 4124  H HA   . SER A 1 21  ? 6.813   2.040   11.112  1.00 0.00 ? 20  SER A HA   3  
ATOM 4125  H HB2  . SER A 1 21  ? 8.871   3.541   11.088  1.00 0.00 ? 20  SER A HB2  3  
ATOM 4126  H HB3  . SER A 1 21  ? 7.339   4.365   11.509  1.00 0.00 ? 20  SER A HB3  3  
ATOM 4127  H HG   . SER A 1 21  ? 9.185   3.410   13.463  1.00 0.00 ? 20  SER A HG   3  
ATOM 4128  N N    . ASN A 1 22  ? 8.157   0.014   11.505  1.00 0.00 ? 21  ASN A N    3  
ATOM 4129  C CA   . ASN A 1 22  ? 8.722   -1.321  11.698  1.00 0.00 ? 21  ASN A CA   3  
ATOM 4130  C C    . ASN A 1 22  ? 9.923   -1.670  10.850  1.00 0.00 ? 21  ASN A C    3  
ATOM 4131  O O    . ASN A 1 22  ? 10.735  -2.522  11.195  1.00 0.00 ? 21  ASN A O    3  
ATOM 4132  C CB   . ASN A 1 22  ? 7.576   -2.331  11.344  1.00 0.00 ? 21  ASN A CB   3  
ATOM 4133  C CG   . ASN A 1 22  ? 7.401   -3.488  12.333  1.00 0.00 ? 21  ASN A CG   3  
ATOM 4134  O OD1  . ASN A 1 22  ? 6.349   -3.539  12.974  1.00 0.00 ? 21  ASN A OD1  3  
ATOM 4135  N ND2  . ASN A 1 22  ? 8.398   -4.395  12.484  1.00 0.00 ? 21  ASN A ND2  3  
ATOM 4136  H H    . ASN A 1 22  ? 7.423   0.050   10.829  1.00 0.00 ? 21  ASN A H    3  
ATOM 4137  H HA   . ASN A 1 22  ? 9.036   -1.405  12.725  1.00 0.00 ? 21  ASN A HA   3  
ATOM 4138  H HB2  . ASN A 1 22  ? 6.624   -1.757  11.431  1.00 0.00 ? 21  ASN A HB2  3  
ATOM 4139  H HB3  . ASN A 1 22  ? 7.601   -2.707  10.302  1.00 0.00 ? 21  ASN A HB3  3  
ATOM 4140  H HD21 . ASN A 1 22  ? 9.240   -4.309  11.943  1.00 0.00 ? 21  ASN A HD21 3  
ATOM 4141  H HD22 . ASN A 1 22  ? 8.260   -5.126  13.158  1.00 0.00 ? 21  ASN A HD22 3  
ATOM 4142  N N    . GLY A 1 23  ? 9.960   -1.042  9.667   1.00 0.00 ? 22  GLY A N    3  
ATOM 4143  C CA   . GLY A 1 23  ? 10.864  -1.250  8.559   1.00 0.00 ? 22  GLY A CA   3  
ATOM 4144  C C    . GLY A 1 23  ? 10.198  -1.882  7.373   1.00 0.00 ? 22  GLY A C    3  
ATOM 4145  O O    . GLY A 1 23  ? 10.702  -1.689  6.282   1.00 0.00 ? 22  GLY A O    3  
ATOM 4146  H H    . GLY A 1 23  ? 9.236   -0.382  9.484   1.00 0.00 ? 22  GLY A H    3  
ATOM 4147  H HA2  . GLY A 1 23  ? 11.241  -0.295  8.251   1.00 0.00 ? 22  GLY A HA2  3  
ATOM 4148  H HA3  . GLY A 1 23  ? 11.664  -1.919  8.846   1.00 0.00 ? 22  GLY A HA3  3  
ATOM 4149  N N    . TYR A 1 24  ? 9.024   -2.552  7.495   1.00 0.00 ? 23  TYR A N    3  
ATOM 4150  C CA   . TYR A 1 24  ? 8.120   -2.926  6.406   1.00 0.00 ? 23  TYR A CA   3  
ATOM 4151  C C    . TYR A 1 24  ? 6.654   -2.693  6.707   1.00 0.00 ? 23  TYR A C    3  
ATOM 4152  O O    . TYR A 1 24  ? 6.233   -2.784  7.859   1.00 0.00 ? 23  TYR A O    3  
ATOM 4153  C CB   . TYR A 1 24  ? 8.427   -4.180  5.535   1.00 0.00 ? 23  TYR A CB   3  
ATOM 4154  C CG   . TYR A 1 24  ? 9.421   -5.168  6.093   1.00 0.00 ? 23  TYR A CG   3  
ATOM 4155  C CD1  . TYR A 1 24  ? 9.233   -5.787  7.317   1.00 0.00 ? 23  TYR A CD1  3  
ATOM 4156  C CD2  . TYR A 1 24  ? 10.503  -5.550  5.319   1.00 0.00 ? 23  TYR A CD2  3  
ATOM 4157  C CE1  . TYR A 1 24  ? 10.111  -6.767  7.746   1.00 0.00 ? 23  TYR A CE1  3  
ATOM 4158  C CE2  . TYR A 1 24  ? 11.362  -6.549  5.727   1.00 0.00 ? 23  TYR A CE2  3  
ATOM 4159  C CZ   . TYR A 1 24  ? 11.161  -7.164  6.942   1.00 0.00 ? 23  TYR A CZ   3  
ATOM 4160  O OH   . TYR A 1 24  ? 12.001  -8.224  7.350   1.00 0.00 ? 23  TYR A OH   3  
ATOM 4161  H H    . TYR A 1 24  ? 8.631   -2.693  8.397   1.00 0.00 ? 23  TYR A H    3  
ATOM 4162  H HA   . TYR A 1 24  ? 8.238   -2.130  5.685   1.00 0.00 ? 23  TYR A HA   3  
ATOM 4163  H HB2  . TYR A 1 24  ? 7.518   -4.752  5.240   1.00 0.00 ? 23  TYR A HB2  3  
ATOM 4164  H HB3  . TYR A 1 24  ? 8.853   -3.735  4.602   1.00 0.00 ? 23  TYR A HB3  3  
ATOM 4165  H HD1  . TYR A 1 24  ? 8.390   -5.514  7.938   1.00 0.00 ? 23  TYR A HD1  3  
ATOM 4166  H HD2  . TYR A 1 24  ? 10.659  -5.089  4.353   1.00 0.00 ? 23  TYR A HD2  3  
ATOM 4167  H HE1  . TYR A 1 24  ? 9.954   -7.253  8.701   1.00 0.00 ? 23  TYR A HE1  3  
ATOM 4168  H HE2  . TYR A 1 24  ? 12.177  -6.849  5.079   1.00 0.00 ? 23  TYR A HE2  3  
ATOM 4169  H HH   . TYR A 1 24  ? 12.440  -8.582  6.575   1.00 0.00 ? 23  TYR A HH   3  
ATOM 4170  N N    . PHE A 1 25  ? 5.835   -2.384  5.657   1.00 0.00 ? 24  PHE A N    3  
ATOM 4171  C CA   . PHE A 1 25  ? 4.400   -2.125  5.697   1.00 0.00 ? 24  PHE A CA   3  
ATOM 4172  C C    . PHE A 1 25  ? 3.673   -3.164  4.863   1.00 0.00 ? 24  PHE A C    3  
ATOM 4173  O O    . PHE A 1 25  ? 4.158   -3.678  3.849   1.00 0.00 ? 24  PHE A O    3  
ATOM 4174  C CB   . PHE A 1 25  ? 3.886   -0.685  5.278   1.00 0.00 ? 24  PHE A CB   3  
ATOM 4175  C CG   . PHE A 1 25  ? 4.933   0.402   5.118   1.00 0.00 ? 24  PHE A CG   3  
ATOM 4176  C CD1  . PHE A 1 25  ? 5.894   0.530   6.106   1.00 0.00 ? 24  PHE A CD1  3  
ATOM 4177  C CD2  . PHE A 1 25  ? 4.922   1.354   4.086   1.00 0.00 ? 24  PHE A CD2  3  
ATOM 4178  C CE1  . PHE A 1 25  ? 6.955   1.378   5.971   1.00 0.00 ? 24  PHE A CE1  3  
ATOM 4179  C CE2  . PHE A 1 25  ? 5.928   2.287   4.026   1.00 0.00 ? 24  PHE A CE2  3  
ATOM 4180  C CZ   . PHE A 1 25  ? 6.971   2.259   4.922   1.00 0.00 ? 24  PHE A CZ   3  
ATOM 4181  H H    . PHE A 1 25  ? 6.215   -2.324  4.719   1.00 0.00 ? 24  PHE A H    3  
ATOM 4182  H HA   . PHE A 1 25  ? 4.033   -2.259  6.709   1.00 0.00 ? 24  PHE A HA   3  
ATOM 4183  H HB2  . PHE A 1 25  ? 3.267   -0.686  4.361   1.00 0.00 ? 24  PHE A HB2  3  
ATOM 4184  H HB3  . PHE A 1 25  ? 3.198   -0.355  6.081   1.00 0.00 ? 24  PHE A HB3  3  
ATOM 4185  H HD1  . PHE A 1 25  ? 5.847   -0.083  6.994   1.00 0.00 ? 24  PHE A HD1  3  
ATOM 4186  H HD2  . PHE A 1 25  ? 4.222   1.385   3.231   1.00 0.00 ? 24  PHE A HD2  3  
ATOM 4187  H HE1  . PHE A 1 25  ? 7.746   1.378   6.707   1.00 0.00 ? 24  PHE A HE1  3  
ATOM 4188  H HE2  . PHE A 1 25  ? 5.872   3.028   3.246   1.00 0.00 ? 24  PHE A HE2  3  
ATOM 4189  H HZ   . PHE A 1 25  ? 7.794   2.932   4.850   1.00 0.00 ? 24  PHE A HZ   3  
ATOM 4190  N N    . TYR A 1 26  ? 2.425   -3.384  5.315   1.00 0.00 ? 25  TYR A N    3  
ATOM 4191  C CA   . TYR A 1 26  ? 1.308   -4.207  4.915   1.00 0.00 ? 25  TYR A CA   3  
ATOM 4192  C C    . TYR A 1 26  ? 0.424   -3.351  4.020   1.00 0.00 ? 25  TYR A C    3  
ATOM 4193  O O    . TYR A 1 26  ? 0.817   -2.279  3.567   1.00 0.00 ? 25  TYR A O    3  
ATOM 4194  C CB   . TYR A 1 26  ? 0.599   -4.863  6.147   1.00 0.00 ? 25  TYR A CB   3  
ATOM 4195  C CG   . TYR A 1 26  ? 1.671   -5.403  7.072   1.00 0.00 ? 25  TYR A CG   3  
ATOM 4196  C CD1  . TYR A 1 26  ? 2.623   -6.291  6.596   1.00 0.00 ? 25  TYR A CD1  3  
ATOM 4197  C CD2  . TYR A 1 26  ? 1.833   -4.882  8.347   1.00 0.00 ? 25  TYR A CD2  3  
ATOM 4198  C CE1  . TYR A 1 26  ? 3.773   -6.542  7.314   1.00 0.00 ? 25  TYR A CE1  3  
ATOM 4199  C CE2  . TYR A 1 26  ? 2.971   -5.153  9.080   1.00 0.00 ? 25  TYR A CE2  3  
ATOM 4200  C CZ   . TYR A 1 26  ? 3.955   -5.946  8.542   1.00 0.00 ? 25  TYR A CZ   3  
ATOM 4201  O OH   . TYR A 1 26  ? 5.170   -6.097  9.228   1.00 0.00 ? 25  TYR A OH   3  
ATOM 4202  H H    . TYR A 1 26  ? 2.147   -2.861  6.126   1.00 0.00 ? 25  TYR A H    3  
ATOM 4203  H HA   . TYR A 1 26  ? 1.670   -5.001  4.278   1.00 0.00 ? 25  TYR A HA   3  
ATOM 4204  H HB2  . TYR A 1 26  ? 0.001   -4.118  6.713   1.00 0.00 ? 25  TYR A HB2  3  
ATOM 4205  H HB3  . TYR A 1 26  ? -0.053  -5.708  5.837   1.00 0.00 ? 25  TYR A HB3  3  
ATOM 4206  H HD1  . TYR A 1 26  ? 2.529   -6.702  5.600   1.00 0.00 ? 25  TYR A HD1  3  
ATOM 4207  H HD2  . TYR A 1 26  ? 1.109   -4.181  8.739   1.00 0.00 ? 25  TYR A HD2  3  
ATOM 4208  H HE1  . TYR A 1 26  ? 4.541   -7.174  6.889   1.00 0.00 ? 25  TYR A HE1  3  
ATOM 4209  H HE2  . TYR A 1 26  ? 3.126   -4.685  10.044  1.00 0.00 ? 25  TYR A HE2  3  
ATOM 4210  H HH   . TYR A 1 26  ? 5.838   -6.311  8.573   1.00 0.00 ? 25  TYR A HH   3  
ATOM 4211  N N    . SER A 1 27  ? -0.749  -3.858  3.619   1.00 0.00 ? 26  SER A N    3  
ATOM 4212  C CA   . SER A 1 27  ? -1.625  -3.266  2.622   1.00 0.00 ? 26  SER A CA   3  
ATOM 4213  C C    . SER A 1 27  ? -3.152  -3.196  3.003   1.00 0.00 ? 26  SER A C    3  
ATOM 4214  O O    . SER A 1 27  ? -3.711  -4.060  3.681   1.00 0.00 ? 26  SER A O    3  
ATOM 4215  C CB   . SER A 1 27  ? -1.269  -4.123  1.413   1.00 0.00 ? 26  SER A CB   3  
ATOM 4216  O OG   . SER A 1 27  ? -1.243  -3.404  0.184   1.00 0.00 ? 26  SER A OG   3  
ATOM 4217  H H    . SER A 1 27  ? -1.026  -4.738  3.950   1.00 0.00 ? 26  SER A H    3  
ATOM 4218  H HA   . SER A 1 27  ? -1.327  -2.258  2.393   1.00 0.00 ? 26  SER A HA   3  
ATOM 4219  H HB2  . SER A 1 27  ? -0.222  -4.529  1.521   1.00 0.00 ? 26  SER A HB2  3  
ATOM 4220  H HB3  . SER A 1 27  ? -1.960  -4.981  1.465   1.00 0.00 ? 26  SER A HB3  3  
ATOM 4221  H HG   . SER A 1 27  ? -0.816  -4.015  -0.453  1.00 0.00 ? 26  SER A HG   3  
ATOM 4222  N N    . GLY A 1 28  ? -3.778  -2.028  2.670   1.00 0.00 ? 27  GLY A N    3  
ATOM 4223  C CA   . GLY A 1 28  ? -5.044  -1.403  3.079   1.00 0.00 ? 27  GLY A CA   3  
ATOM 4224  C C    . GLY A 1 28  ? -5.839  -0.710  1.969   1.00 0.00 ? 27  GLY A C    3  
ATOM 4225  O O    . GLY A 1 28  ? -5.331  -0.529  0.869   1.00 0.00 ? 27  GLY A O    3  
ATOM 4226  H H    . GLY A 1 28  ? -3.250  -1.377  2.105   1.00 0.00 ? 27  GLY A H    3  
ATOM 4227  H HA2  . GLY A 1 28  ? -5.679  -2.199  3.428   1.00 0.00 ? 27  GLY A HA2  3  
ATOM 4228  H HA3  . GLY A 1 28  ? -4.825  -0.691  3.854   1.00 0.00 ? 27  GLY A HA3  3  
ATOM 4229  N N    . LYS A 1 29  ? -7.127  -0.306  2.195   1.00 0.00 ? 28  LYS A N    3  
ATOM 4230  C CA   . LYS A 1 29  ? -7.880  0.588   1.278   1.00 0.00 ? 28  LYS A CA   3  
ATOM 4231  C C    . LYS A 1 29  ? -8.666  1.673   2.054   1.00 0.00 ? 28  LYS A C    3  
ATOM 4232  O O    . LYS A 1 29  ? -9.180  1.351   3.117   1.00 0.00 ? 28  LYS A O    3  
ATOM 4233  C CB   . LYS A 1 29  ? -8.823  -0.243  0.381   1.00 0.00 ? 28  LYS A CB   3  
ATOM 4234  C CG   . LYS A 1 29  ? -9.888  -1.071  1.119   1.00 0.00 ? 28  LYS A CG   3  
ATOM 4235  C CD   . LYS A 1 29  ? -10.654 -2.004  0.176   1.00 0.00 ? 28  LYS A CD   3  
ATOM 4236  C CE   . LYS A 1 29  ? -11.639 -2.907  0.928   1.00 0.00 ? 28  LYS A CE   3  
ATOM 4237  N NZ   . LYS A 1 29  ? -12.277 -3.884  0.017   1.00 0.00 ? 28  LYS A NZ   3  
ATOM 4238  H H    . LYS A 1 29  ? -7.595  -0.431  3.091   1.00 0.00 ? 28  LYS A H    3  
ATOM 4239  H HA   . LYS A 1 29  ? -7.196  1.134   0.653   1.00 0.00 ? 28  LYS A HA   3  
ATOM 4240  H HB2  . LYS A 1 29  ? -9.308  0.401   -0.386  1.00 0.00 ? 28  LYS A HB2  3  
ATOM 4241  H HB3  . LYS A 1 29  ? -8.172  -0.965  -0.157  1.00 0.00 ? 28  LYS A HB3  3  
ATOM 4242  H HG2  . LYS A 1 29  ? -9.390  -1.687  1.900   1.00 0.00 ? 28  LYS A HG2  3  
ATOM 4243  H HG3  . LYS A 1 29  ? -10.603 -0.392  1.636   1.00 0.00 ? 28  LYS A HG3  3  
ATOM 4244  H HD2  . LYS A 1 29  ? -11.206 -1.393  -0.574  1.00 0.00 ? 28  LYS A HD2  3  
ATOM 4245  H HD3  . LYS A 1 29  ? -9.923  -2.645  -0.368  1.00 0.00 ? 28  LYS A HD3  3  
ATOM 4246  H HE2  . LYS A 1 29  ? -11.112 -3.478  1.723   1.00 0.00 ? 28  LYS A HE2  3  
ATOM 4247  H HE3  . LYS A 1 29  ? -12.443 -2.298  1.390   1.00 0.00 ? 28  LYS A HE3  3  
ATOM 4248  H HZ1  . LYS A 1 29  ? -12.803 -3.377  -0.722  1.00 0.00 ? 28  LYS A HZ1  3  
ATOM 4249  H HZ2  . LYS A 1 29  ? -12.932 -4.484  0.559   1.00 0.00 ? 28  LYS A HZ2  3  
ATOM 4250  H HZ3  . LYS A 1 29  ? -11.546 -4.479  -0.421  1.00 0.00 ? 28  LYS A HZ3  3  
ATOM 4251  N N    . ILE A 1 30  ? -8.852  3.000   1.653   1.00 0.00 ? 29  ILE A N    3  
ATOM 4252  C CA   . ILE A 1 30  ? -9.730  3.900   2.479   1.00 0.00 ? 29  ILE A CA   3  
ATOM 4253  C C    . ILE A 1 30  ? -11.211 3.880   2.098   1.00 0.00 ? 29  ILE A C    3  
ATOM 4254  O O    . ILE A 1 30  ? -11.570 3.481   0.995   1.00 0.00 ? 29  ILE A O    3  
ATOM 4255  C CB   . ILE A 1 30  ? -9.237  5.282   2.946   1.00 0.00 ? 29  ILE A CB   3  
ATOM 4256  C CG1  . ILE A 1 30  ? -9.690  6.504   2.119   1.00 0.00 ? 29  ILE A CG1  3  
ATOM 4257  C CG2  . ILE A 1 30  ? -7.718  5.221   3.114   1.00 0.00 ? 29  ILE A CG2  3  
ATOM 4258  C CD1  . ILE A 1 30  ? -9.128  7.814   2.674   1.00 0.00 ? 29  ILE A CD1  3  
ATOM 4259  H H    . ILE A 1 30  ? -8.490  3.441   0.807   1.00 0.00 ? 29  ILE A H    3  
ATOM 4260  H HA   . ILE A 1 30  ? -9.759  3.478   3.468   1.00 0.00 ? 29  ILE A HA   3  
ATOM 4261  H HB   . ILE A 1 30  ? -9.655  5.460   3.970   1.00 0.00 ? 29  ILE A HB   3  
ATOM 4262  H HG12 . ILE A 1 30  ? -9.401  6.367   1.063   1.00 0.00 ? 29  ILE A HG12 3  
ATOM 4263  H HG13 . ILE A 1 30  ? -10.799 6.592   2.152   1.00 0.00 ? 29  ILE A HG13 3  
ATOM 4264  H HG21 . ILE A 1 30  ? -7.257  5.281   2.110   1.00 0.00 ? 29  ILE A HG21 3  
ATOM 4265  H HG22 . ILE A 1 30  ? -7.400  4.277   3.610   1.00 0.00 ? 29  ILE A HG22 3  
ATOM 4266  H HG23 . ILE A 1 30  ? -7.323  6.067   3.708   1.00 0.00 ? 29  ILE A HG23 3  
ATOM 4267  H HD11 . ILE A 1 30  ? -9.443  7.953   3.730   1.00 0.00 ? 29  ILE A HD11 3  
ATOM 4268  H HD12 . ILE A 1 30  ? -9.494  8.679   2.088   1.00 0.00 ? 29  ILE A HD12 3  
ATOM 4269  H HD13 . ILE A 1 30  ? -8.019  7.828   2.636   1.00 0.00 ? 29  ILE A HD13 3  
ATOM 4270  N N    . THR A 1 31  ? -12.093 4.265   3.067   1.00 0.00 ? 30  THR A N    3  
ATOM 4271  C CA   . THR A 1 31  ? -13.553 4.390   2.922   1.00 0.00 ? 30  THR A CA   3  
ATOM 4272  C C    . THR A 1 31  ? -13.992 5.855   2.994   1.00 0.00 ? 30  THR A C    3  
ATOM 4273  O O    . THR A 1 31  ? -14.866 6.288   2.240   1.00 0.00 ? 30  THR A O    3  
ATOM 4274  C CB   . THR A 1 31  ? -14.310 3.555   3.951   1.00 0.00 ? 30  THR A CB   3  
ATOM 4275  O OG1  . THR A 1 31  ? -13.832 2.222   3.885   1.00 0.00 ? 30  THR A OG1  3  
ATOM 4276  C CG2  . THR A 1 31  ? -15.826 3.499   3.676   1.00 0.00 ? 30  THR A CG2  3  
ATOM 4277  H H    . THR A 1 31  ? -11.726 4.566   3.956   1.00 0.00 ? 30  THR A H    3  
ATOM 4278  H HA   . THR A 1 31  ? -13.848 4.045   1.938   1.00 0.00 ? 30  THR A HA   3  
ATOM 4279  H HB   . THR A 1 31  ? -14.130 3.924   4.988   1.00 0.00 ? 30  THR A HB   3  
ATOM 4280  H HG1  . THR A 1 31  ? -12.926 2.296   3.563   1.00 0.00 ? 30  THR A HG1  3  
ATOM 4281  H HG21 . THR A 1 31  ? -16.001 3.156   2.634   1.00 0.00 ? 30  THR A HG21 3  
ATOM 4282  H HG22 . THR A 1 31  ? -16.315 4.484   3.815   1.00 0.00 ? 30  THR A HG22 3  
ATOM 4283  H HG23 . THR A 1 31  ? -16.306 2.773   4.366   1.00 0.00 ? 30  THR A HG23 3  
ATOM 4284  N N    . ARG A 1 32  ? -13.391 6.671   3.916   1.00 0.00 ? 31  ARG A N    3  
ATOM 4285  C CA   . ARG A 1 32  ? -13.710 8.084   4.057   1.00 0.00 ? 31  ARG A CA   3  
ATOM 4286  C C    . ARG A 1 32  ? -12.449 8.749   4.582   1.00 0.00 ? 31  ARG A C    3  
ATOM 4287  O O    . ARG A 1 32  ? -11.548 8.087   5.097   1.00 0.00 ? 31  ARG A O    3  
ATOM 4288  C CB   . ARG A 1 32  ? -14.862 8.385   5.074   1.00 0.00 ? 31  ARG A CB   3  
ATOM 4289  C CG   . ARG A 1 32  ? -16.247 7.797   4.742   1.00 0.00 ? 31  ARG A CG   3  
ATOM 4290  C CD   . ARG A 1 32  ? -17.286 8.204   5.794   1.00 0.00 ? 31  ARG A CD   3  
ATOM 4291  N NE   . ARG A 1 32  ? -18.617 7.617   5.410   1.00 0.00 ? 31  ARG A NE   3  
ATOM 4292  C CZ   . ARG A 1 32  ? -19.772 7.875   6.100   1.00 0.00 ? 31  ARG A CZ   3  
ATOM 4293  N NH1  . ARG A 1 32  ? -19.763 8.683   7.199   1.00 0.00 ? 31  ARG A NH1  3  
ATOM 4294  N NH2  . ARG A 1 32  ? -20.945 7.318   5.679   1.00 0.00 ? 31  ARG A NH2  3  
ATOM 4295  H H    . ARG A 1 32  ? -12.662 6.382   4.568   1.00 0.00 ? 31  ARG A H    3  
ATOM 4296  H HA   . ARG A 1 32  ? -13.947 8.522   3.095   1.00 0.00 ? 31  ARG A HA   3  
ATOM 4297  H HB2  . ARG A 1 32  ? -14.592 8.003   6.084   1.00 0.00 ? 31  ARG A HB2  3  
ATOM 4298  H HB3  . ARG A 1 32  ? -15.016 9.487   5.161   1.00 0.00 ? 31  ARG A HB3  3  
ATOM 4299  H HG2  . ARG A 1 32  ? -16.571 8.151   3.738   1.00 0.00 ? 31  ARG A HG2  3  
ATOM 4300  H HG3  . ARG A 1 32  ? -16.178 6.686   4.719   1.00 0.00 ? 31  ARG A HG3  3  
ATOM 4301  H HD2  . ARG A 1 32  ? -16.990 7.818   6.795   1.00 0.00 ? 31  ARG A HD2  3  
ATOM 4302  H HD3  . ARG A 1 32  ? -17.368 9.314   5.832   1.00 0.00 ? 31  ARG A HD3  3  
ATOM 4303  H HE   . ARG A 1 32  ? -18.662 7.021   4.608   1.00 0.00 ? 31  ARG A HE   3  
ATOM 4304  H HH11 . ARG A 1 32  ? -18.906 9.096   7.509   1.00 0.00 ? 31  ARG A HH11 3  
ATOM 4305  H HH12 . ARG A 1 32  ? -20.614 8.863   7.694   1.00 0.00 ? 31  ARG A HH12 3  
ATOM 4306  H HH21 . ARG A 1 32  ? -20.957 6.726   4.874   1.00 0.00 ? 31  ARG A HH21 3  
ATOM 4307  H HH22 . ARG A 1 32  ? -21.793 7.508   6.175   1.00 0.00 ? 31  ARG A HH22 3  
ATOM 4308  N N    . ASP A 1 33  ? -12.374 10.103  4.539   1.00 0.00 ? 32  ASP A N    3  
ATOM 4309  C CA   . ASP A 1 33  ? -11.304 10.893  5.160   1.00 0.00 ? 32  ASP A CA   3  
ATOM 4310  C C    . ASP A 1 33  ? -11.747 11.338  6.570   1.00 0.00 ? 32  ASP A C    3  
ATOM 4311  O O    . ASP A 1 33  ? -12.869 11.812  6.741   1.00 0.00 ? 32  ASP A O    3  
ATOM 4312  C CB   . ASP A 1 33  ? -10.975 12.134  4.266   1.00 0.00 ? 32  ASP A CB   3  
ATOM 4313  C CG   . ASP A 1 33  ? -9.744  12.931  4.731   1.00 0.00 ? 32  ASP A CG   3  
ATOM 4314  O OD1  . ASP A 1 33  ? -8.630  12.346  4.741   1.00 0.00 ? 32  ASP A OD1  3  
ATOM 4315  O OD2  . ASP A 1 33  ? -9.910  14.129  5.083   1.00 0.00 ? 32  ASP A OD2  3  
ATOM 4316  H H    . ASP A 1 33  ? -13.103 10.643  4.120   1.00 0.00 ? 32  ASP A H    3  
ATOM 4317  H HA   . ASP A 1 33  ? -10.403 10.299  5.256   1.00 0.00 ? 32  ASP A HA   3  
ATOM 4318  H HB2  . ASP A 1 33  ? -10.763 11.768  3.237   1.00 0.00 ? 32  ASP A HB2  3  
ATOM 4319  H HB3  . ASP A 1 33  ? -11.856 12.808  4.206   1.00 0.00 ? 32  ASP A HB3  3  
ATOM 4320  N N    . VAL A 1 34  ? -10.874 11.208  7.610   1.00 0.00 ? 33  VAL A N    3  
ATOM 4321  C CA   . VAL A 1 34  ? -11.144 11.681  8.973   1.00 0.00 ? 33  VAL A CA   3  
ATOM 4322  C C    . VAL A 1 34  ? -10.188 12.847  9.178   1.00 0.00 ? 33  VAL A C    3  
ATOM 4323  O O    . VAL A 1 34  ? -8.993  12.700  9.007   1.00 0.00 ? 33  VAL A O    3  
ATOM 4324  C CB   . VAL A 1 34  ? -11.124 10.642  10.146  1.00 0.00 ? 33  VAL A CB   3  
ATOM 4325  C CG1  . VAL A 1 34  ? -12.595 10.252  10.414  1.00 0.00 ? 33  VAL A CG1  3  
ATOM 4326  C CG2  . VAL A 1 34  ? -10.258 9.366   9.949   1.00 0.00 ? 33  VAL A CG2  3  
ATOM 4327  H H    . VAL A 1 34  ? -9.951  10.854  7.454   1.00 0.00 ? 33  VAL A H    3  
ATOM 4328  H HA   . VAL A 1 34  ? -12.126 12.136  9.015   1.00 0.00 ? 33  VAL A HA   3  
ATOM 4329  H HB   . VAL A 1 34  ? -10.761 11.134  11.080  1.00 0.00 ? 33  VAL A HB   3  
ATOM 4330  H HG11 . VAL A 1 34  ? -12.996 9.654   9.566   1.00 0.00 ? 33  VAL A HG11 3  
ATOM 4331  H HG12 . VAL A 1 34  ? -13.236 11.148  10.550  1.00 0.00 ? 33  VAL A HG12 3  
ATOM 4332  H HG13 . VAL A 1 34  ? -12.662 9.641   11.338  1.00 0.00 ? 33  VAL A HG13 3  
ATOM 4333  H HG21 . VAL A 1 34  ? -9.939  8.847   10.878  1.00 0.00 ? 33  VAL A HG21 3  
ATOM 4334  H HG22 . VAL A 1 34  ? -9.303  9.571   9.443   1.00 0.00 ? 33  VAL A HG22 3  
ATOM 4335  H HG23 . VAL A 1 34  ? -10.776 8.588   9.358   1.00 0.00 ? 33  VAL A HG23 3  
ATOM 4336  N N    . GLY A 1 35  ? -10.697 14.054  9.532   1.00 0.00 ? 34  GLY A N    3  
ATOM 4337  C CA   . GLY A 1 35  ? -9.999  15.330  9.812   1.00 0.00 ? 34  GLY A CA   3  
ATOM 4338  C C    . GLY A 1 35  ? -8.761  15.768  9.023   1.00 0.00 ? 34  GLY A C    3  
ATOM 4339  O O    . GLY A 1 35  ? -8.737  15.780  7.797   1.00 0.00 ? 34  GLY A O    3  
ATOM 4340  H H    . GLY A 1 35  ? -11.682 14.102  9.644   1.00 0.00 ? 34  GLY A H    3  
ATOM 4341  H HA2  . GLY A 1 35  ? -10.732 16.107  9.644   1.00 0.00 ? 34  GLY A HA2  3  
ATOM 4342  H HA3  . GLY A 1 35  ? -9.700  15.276  10.850  1.00 0.00 ? 34  GLY A HA3  3  
ATOM 4343  N N    . ALA A 1 36  ? -7.697  16.173  9.759   1.00 0.00 ? 35  ALA A N    3  
ATOM 4344  C CA   . ALA A 1 36  ? -6.364  16.503  9.271   1.00 0.00 ? 35  ALA A CA   3  
ATOM 4345  C C    . ALA A 1 36  ? -5.418  15.390  9.634   1.00 0.00 ? 35  ALA A C    3  
ATOM 4346  O O    . ALA A 1 36  ? -5.223  15.064  10.803  1.00 0.00 ? 35  ALA A O    3  
ATOM 4347  C CB   . ALA A 1 36  ? -5.868  17.851  9.840   1.00 0.00 ? 35  ALA A CB   3  
ATOM 4348  H H    . ALA A 1 36  ? -7.758  16.166  10.751  1.00 0.00 ? 35  ALA A H    3  
ATOM 4349  H HA   . ALA A 1 36  ? -6.304  16.499  8.183   1.00 0.00 ? 35  ALA A HA   3  
ATOM 4350  H HB1  . ALA A 1 36  ? -6.551  18.667  9.523   1.00 0.00 ? 35  ALA A HB1  3  
ATOM 4351  H HB2  . ALA A 1 36  ? -4.849  18.093  9.469   1.00 0.00 ? 35  ALA A HB2  3  
ATOM 4352  H HB3  . ALA A 1 36  ? -5.846  17.831  10.952  1.00 0.00 ? 35  ALA A HB3  3  
ATOM 4353  N N    . GLY A 1 37  ? -4.811  14.772  8.599   1.00 0.00 ? 36  GLY A N    3  
ATOM 4354  C CA   . GLY A 1 37  ? -3.833  13.717  8.710   1.00 0.00 ? 36  GLY A CA   3  
ATOM 4355  C C    . GLY A 1 37  ? -4.400  12.334  8.797   1.00 0.00 ? 36  GLY A C    3  
ATOM 4356  O O    . GLY A 1 37  ? -3.662  11.387  8.558   1.00 0.00 ? 36  GLY A O    3  
ATOM 4357  H H    . GLY A 1 37  ? -5.018  15.065  7.670   1.00 0.00 ? 36  GLY A H    3  
ATOM 4358  H HA2  . GLY A 1 37  ? -3.259  13.758  7.800   1.00 0.00 ? 36  GLY A HA2  3  
ATOM 4359  H HA3  . GLY A 1 37  ? -3.215  13.867  9.589   1.00 0.00 ? 36  GLY A HA3  3  
ATOM 4360  N N    . LYS A 1 38  ? -5.699  12.166  9.164   1.00 0.00 ? 37  LYS A N    3  
ATOM 4361  C CA   . LYS A 1 38  ? -6.340  10.871  9.372   1.00 0.00 ? 37  LYS A CA   3  
ATOM 4362  C C    . LYS A 1 38  ? -7.143  10.354  8.185   1.00 0.00 ? 37  LYS A C    3  
ATOM 4363  O O    . LYS A 1 38  ? -7.570  11.069  7.280   1.00 0.00 ? 37  LYS A O    3  
ATOM 4364  C CB   . LYS A 1 38  ? -7.031  10.711  10.781  1.00 0.00 ? 37  LYS A CB   3  
ATOM 4365  C CG   . LYS A 1 38  ? -7.446  11.934  11.613  1.00 0.00 ? 37  LYS A CG   3  
ATOM 4366  C CD   . LYS A 1 38  ? -8.048  11.485  12.959  1.00 0.00 ? 37  LYS A CD   3  
ATOM 4367  C CE   . LYS A 1 38  ? -8.651  12.648  13.760  1.00 0.00 ? 37  LYS A CE   3  
ATOM 4368  N NZ   . LYS A 1 38  ? -9.851  13.202  13.089  1.00 0.00 ? 37  LYS A NZ   3  
ATOM 4369  H H    . LYS A 1 38  ? -6.302  12.945  9.340   1.00 0.00 ? 37  LYS A H    3  
ATOM 4370  H HA   . LYS A 1 38  ? -5.597  10.101  9.413   1.00 0.00 ? 37  LYS A HA   3  
ATOM 4371  H HB2  . LYS A 1 38  ? -7.918  10.053  10.719  1.00 0.00 ? 37  LYS A HB2  3  
ATOM 4372  H HB3  . LYS A 1 38  ? -6.328  10.145  11.443  1.00 0.00 ? 37  LYS A HB3  3  
ATOM 4373  H HG2  . LYS A 1 38  ? -6.583  12.607  11.795  1.00 0.00 ? 37  LYS A HG2  3  
ATOM 4374  H HG3  . LYS A 1 38  ? -8.214  12.525  11.088  1.00 0.00 ? 37  LYS A HG3  3  
ATOM 4375  H HD2  . LYS A 1 38  ? -8.822  10.697  12.788  1.00 0.00 ? 37  LYS A HD2  3  
ATOM 4376  H HD3  . LYS A 1 38  ? -7.245  11.013  13.569  1.00 0.00 ? 37  LYS A HD3  3  
ATOM 4377  H HE2  . LYS A 1 38  ? -8.962  12.302  14.769  1.00 0.00 ? 37  LYS A HE2  3  
ATOM 4378  H HE3  . LYS A 1 38  ? -7.911  13.472  13.861  1.00 0.00 ? 37  LYS A HE3  3  
ATOM 4379  H HZ1  . LYS A 1 38  ? -10.574 12.458  13.003  1.00 0.00 ? 37  LYS A HZ1  3  
ATOM 4380  H HZ2  . LYS A 1 38  ? -9.591  13.543  12.142  1.00 0.00 ? 37  LYS A HZ2  3  
ATOM 4381  H HZ3  . LYS A 1 38  ? -10.230 13.991  13.650  1.00 0.00 ? 37  LYS A HZ3  3  
ATOM 4382  N N    . TYR A 1 39  ? -7.375  9.011   8.186   1.00 0.00 ? 38  TYR A N    3  
ATOM 4383  C CA   . TYR A 1 39  ? -8.148  8.261   7.200   1.00 0.00 ? 38  TYR A CA   3  
ATOM 4384  C C    . TYR A 1 39  ? -9.015  7.232   7.937   1.00 0.00 ? 38  TYR A C    3  
ATOM 4385  O O    . TYR A 1 39  ? -8.612  6.730   8.991   1.00 0.00 ? 38  TYR A O    3  
ATOM 4386  C CB   . TYR A 1 39  ? -7.240  7.568   6.150   1.00 0.00 ? 38  TYR A CB   3  
ATOM 4387  C CG   . TYR A 1 39  ? -6.311  8.588   5.535   1.00 0.00 ? 38  TYR A CG   3  
ATOM 4388  C CD1  . TYR A 1 39  ? -6.797  9.537   4.651   1.00 0.00 ? 38  TYR A CD1  3  
ATOM 4389  C CD2  . TYR A 1 39  ? -4.996  8.693   5.961   1.00 0.00 ? 38  TYR A CD2  3  
ATOM 4390  C CE1  . TYR A 1 39  ? -6.000  10.584  4.237   1.00 0.00 ? 38  TYR A CE1  3  
ATOM 4391  C CE2  . TYR A 1 39  ? -4.156  9.672   5.453   1.00 0.00 ? 38  TYR A CE2  3  
ATOM 4392  C CZ   . TYR A 1 39  ? -4.686  10.655  4.638   1.00 0.00 ? 38  TYR A CZ   3  
ATOM 4393  O OH   . TYR A 1 39  ? -3.880  11.710  4.150   1.00 0.00 ? 38  TYR A OH   3  
ATOM 4394  H H    . TYR A 1 39  ? -7.026  8.452   8.945   1.00 0.00 ? 38  TYR A H    3  
ATOM 4395  H HA   . TYR A 1 39  ? -8.823  8.933   6.686   1.00 0.00 ? 38  TYR A HA   3  
ATOM 4396  H HB2  . TYR A 1 39  ? -6.623  6.768   6.616   1.00 0.00 ? 38  TYR A HB2  3  
ATOM 4397  H HB3  . TYR A 1 39  ? -7.859  7.126   5.344   1.00 0.00 ? 38  TYR A HB3  3  
ATOM 4398  H HD1  . TYR A 1 39  ? -7.839  9.528   4.369   1.00 0.00 ? 38  TYR A HD1  3  
ATOM 4399  H HD2  . TYR A 1 39  ? -4.667  8.049   6.771   1.00 0.00 ? 38  TYR A HD2  3  
ATOM 4400  H HE1  . TYR A 1 39  ? -6.401  11.342  3.576   1.00 0.00 ? 38  TYR A HE1  3  
ATOM 4401  H HE2  . TYR A 1 39  ? -3.105  9.693   5.728   1.00 0.00 ? 38  TYR A HE2  3  
ATOM 4402  H HH   . TYR A 1 39  ? -3.056  11.320  3.839   1.00 0.00 ? 38  TYR A HH   3  
ATOM 4403  N N    . LYS A 1 40  ? -10.248 6.934   7.398   1.00 0.00 ? 39  LYS A N    3  
ATOM 4404  C CA   . LYS A 1 40  ? -11.283 6.004   7.879   1.00 0.00 ? 39  LYS A CA   3  
ATOM 4405  C C    . LYS A 1 40  ? -11.221 4.970   6.811   1.00 0.00 ? 39  LYS A C    3  
ATOM 4406  O O    . LYS A 1 40  ? -11.519 5.157   5.623   1.00 0.00 ? 39  LYS A O    3  
ATOM 4407  C CB   . LYS A 1 40  ? -12.665 6.704   7.970   1.00 0.00 ? 39  LYS A CB   3  
ATOM 4408  C CG   . LYS A 1 40  ? -13.913 5.815   7.848   1.00 0.00 ? 39  LYS A CG   3  
ATOM 4409  C CD   . LYS A 1 40  ? -14.065 4.725   8.915   1.00 0.00 ? 39  LYS A CD   3  
ATOM 4410  C CE   . LYS A 1 40  ? -15.200 3.771   8.534   1.00 0.00 ? 39  LYS A CE   3  
ATOM 4411  N NZ   . LYS A 1 40  ? -16.524 4.425   8.619   1.00 0.00 ? 39  LYS A NZ   3  
ATOM 4412  H H    . LYS A 1 40  ? -10.568 7.327   6.514   1.00 0.00 ? 39  LYS A H    3  
ATOM 4413  H HA   . LYS A 1 40  ? -11.024 5.454   8.799   1.00 0.00 ? 39  LYS A HA   3  
ATOM 4414  H HB2  . LYS A 1 40  ? -12.702 7.264   8.929   1.00 0.00 ? 39  LYS A HB2  3  
ATOM 4415  H HB3  . LYS A 1 40  ? -12.721 7.463   7.158   1.00 0.00 ? 39  LYS A HB3  3  
ATOM 4416  H HG2  . LYS A 1 40  ? -14.817 6.466   7.881   1.00 0.00 ? 39  LYS A HG2  3  
ATOM 4417  H HG3  . LYS A 1 40  ? -13.900 5.320   6.846   1.00 0.00 ? 39  LYS A HG3  3  
ATOM 4418  H HD2  . LYS A 1 40  ? -13.133 4.119   8.983   1.00 0.00 ? 39  LYS A HD2  3  
ATOM 4419  H HD3  . LYS A 1 40  ? -14.248 5.176   9.914   1.00 0.00 ? 39  LYS A HD3  3  
ATOM 4420  H HE2  . LYS A 1 40  ? -15.041 3.453   7.477   1.00 0.00 ? 39  LYS A HE2  3  
ATOM 4421  H HE3  . LYS A 1 40  ? -15.209 2.878   9.193   1.00 0.00 ? 39  LYS A HE3  3  
ATOM 4422  H HZ1  . LYS A 1 40  ? -16.539 5.258   7.995   1.00 0.00 ? 39  LYS A HZ1  3  
ATOM 4423  H HZ2  . LYS A 1 40  ? -16.701 4.724   9.599   1.00 0.00 ? 39  LYS A HZ2  3  
ATOM 4424  H HZ3  . LYS A 1 40  ? -17.261 3.755   8.321   1.00 0.00 ? 39  LYS A HZ3  3  
ATOM 4425  N N    . LEU A 1 41  ? -10.605 3.870   7.244   1.00 0.00 ? 40  LEU A N    3  
ATOM 4426  C CA   . LEU A 1 41  ? -10.103 2.894   6.327   1.00 0.00 ? 40  LEU A CA   3  
ATOM 4427  C C    . LEU A 1 41  ? -10.379 1.482   6.659   1.00 0.00 ? 40  LEU A C    3  
ATOM 4428  O O    . LEU A 1 41  ? -10.668 1.108   7.790   1.00 0.00 ? 40  LEU A O    3  
ATOM 4429  C CB   . LEU A 1 41  ? -8.611  3.198   6.135   1.00 0.00 ? 40  LEU A CB   3  
ATOM 4430  C CG   . LEU A 1 41  ? -7.701  2.865   7.339   1.00 0.00 ? 40  LEU A CG   3  
ATOM 4431  C CD1  . LEU A 1 41  ? -8.281  2.913   8.762   1.00 0.00 ? 40  LEU A CD1  3  
ATOM 4432  C CD2  . LEU A 1 41  ? -6.984  1.545   7.037   1.00 0.00 ? 40  LEU A CD2  3  
ATOM 4433  H H    . LEU A 1 41  ? -10.400 3.709   8.236   1.00 0.00 ? 40  LEU A H    3  
ATOM 4434  H HA   . LEU A 1 41  ? -10.644 2.993   5.399   1.00 0.00 ? 40  LEU A HA   3  
ATOM 4435  H HB2  . LEU A 1 41  ? -8.222  2.667   5.237   1.00 0.00 ? 40  LEU A HB2  3  
ATOM 4436  H HB3  . LEU A 1 41  ? -8.517  4.291   5.926   1.00 0.00 ? 40  LEU A HB3  3  
ATOM 4437  H HG   . LEU A 1 41  ? -7.002  3.704   7.418   1.00 0.00 ? 40  LEU A HG   3  
ATOM 4438  H HD11 . LEU A 1 41  ? -7.495  2.706   9.512   1.00 0.00 ? 40  LEU A HD11 3  
ATOM 4439  H HD12 . LEU A 1 41  ? -9.073  2.135   8.864   1.00 0.00 ? 40  LEU A HD12 3  
ATOM 4440  H HD13 . LEU A 1 41  ? -8.694  3.934   8.990   1.00 0.00 ? 40  LEU A HD13 3  
ATOM 4441  H HD21 . LEU A 1 41  ? -6.330  1.278   7.888   1.00 0.00 ? 40  LEU A HD21 3  
ATOM 4442  H HD22 . LEU A 1 41  ? -6.408  1.601   6.086   1.00 0.00 ? 40  LEU A HD22 3  
ATOM 4443  H HD23 . LEU A 1 41  ? -7.706  0.712   6.900   1.00 0.00 ? 40  LEU A HD23 3  
ATOM 4444  N N    . LEU A 1 42  ? -10.280 0.591   5.671   1.00 0.00 ? 41  LEU A N    3  
ATOM 4445  C CA   . LEU A 1 42  ? -10.455 -0.803  5.942   1.00 0.00 ? 41  LEU A CA   3  
ATOM 4446  C C    . LEU A 1 42  ? -9.304  -1.520  5.343   1.00 0.00 ? 41  LEU A C    3  
ATOM 4447  O O    . LEU A 1 42  ? -8.832  -1.117  4.300   1.00 0.00 ? 41  LEU A O    3  
ATOM 4448  C CB   . LEU A 1 42  ? -11.893 -0.986  5.444   1.00 0.00 ? 41  LEU A CB   3  
ATOM 4449  C CG   . LEU A 1 42  ? -12.623 -2.331  5.624   1.00 0.00 ? 41  LEU A CG   3  
ATOM 4450  C CD1  . LEU A 1 42  ? -14.156 -2.178  5.650   1.00 0.00 ? 41  LEU A CD1  3  
ATOM 4451  C CD2  . LEU A 1 42  ? -12.336 -3.208  4.413   1.00 0.00 ? 41  LEU A CD2  3  
ATOM 4452  H H    . LEU A 1 42  ? -9.992  0.814   4.725   1.00 0.00 ? 41  LEU A H    3  
ATOM 4453  H HA   . LEU A 1 42  ? -10.366 -1.030  6.999   1.00 0.00 ? 41  LEU A HA   3  
ATOM 4454  H HB2  . LEU A 1 42  ? -12.340 -0.199  6.114   1.00 0.00 ? 41  LEU A HB2  3  
ATOM 4455  H HB3  . LEU A 1 42  ? -12.005 -0.637  4.397   1.00 0.00 ? 41  LEU A HB3  3  
ATOM 4456  H HG   . LEU A 1 42  ? -12.310 -2.777  6.612   1.00 0.00 ? 41  LEU A HG   3  
ATOM 4457  H HD11 . LEU A 1 42  ? -14.526 -1.743  4.696   1.00 0.00 ? 41  LEU A HD11 3  
ATOM 4458  H HD12 . LEU A 1 42  ? -14.481 -1.521  6.476   1.00 0.00 ? 41  LEU A HD12 3  
ATOM 4459  H HD13 . LEU A 1 42  ? -14.635 -3.171  5.792   1.00 0.00 ? 41  LEU A HD13 3  
ATOM 4460  H HD21 . LEU A 1 42  ? -11.257 -3.324  4.233   1.00 0.00 ? 41  LEU A HD21 3  
ATOM 4461  H HD22 . LEU A 1 42  ? -12.770 -2.728  3.510   1.00 0.00 ? 41  LEU A HD22 3  
ATOM 4462  H HD23 . LEU A 1 42  ? -12.815 -4.200  4.506   1.00 0.00 ? 41  LEU A HD23 3  
ATOM 4463  N N    . PHE A 1 43  ? -8.775  -2.643  5.897   1.00 0.00 ? 42  PHE A N    3  
ATOM 4464  C CA   . PHE A 1 43  ? -7.724  -3.447  5.235   1.00 0.00 ? 42  PHE A CA   3  
ATOM 4465  C C    . PHE A 1 43  ? -8.416  -4.287  4.156   1.00 0.00 ? 42  PHE A C    3  
ATOM 4466  O O    . PHE A 1 43  ? -9.519  -4.751  4.411   1.00 0.00 ? 42  PHE A O    3  
ATOM 4467  C CB   . PHE A 1 43  ? -6.979  -4.443  6.192   1.00 0.00 ? 42  PHE A CB   3  
ATOM 4468  C CG   . PHE A 1 43  ? -5.951  -3.803  7.106   1.00 0.00 ? 42  PHE A CG   3  
ATOM 4469  C CD1  . PHE A 1 43  ? -6.203  -2.668  7.865   1.00 0.00 ? 42  PHE A CD1  3  
ATOM 4470  C CD2  . PHE A 1 43  ? -4.711  -4.412  7.255   1.00 0.00 ? 42  PHE A CD2  3  
ATOM 4471  C CE1  . PHE A 1 43  ? -5.244  -2.142  8.707   1.00 0.00 ? 42  PHE A CE1  3  
ATOM 4472  C CE2  . PHE A 1 43  ? -3.764  -3.910  8.124   1.00 0.00 ? 42  PHE A CE2  3  
ATOM 4473  C CZ   . PHE A 1 43  ? -4.023  -2.765  8.843   1.00 0.00 ? 42  PHE A CZ   3  
ATOM 4474  H H    . PHE A 1 43  ? -9.140  -2.978  6.774   1.00 0.00 ? 42  PHE A H    3  
ATOM 4475  H HA   . PHE A 1 43  ? -7.020  -2.786  4.751   1.00 0.00 ? 42  PHE A HA   3  
ATOM 4476  H HB2  . PHE A 1 43  ? -7.727  -4.961  6.830   1.00 0.00 ? 42  PHE A HB2  3  
ATOM 4477  H HB3  . PHE A 1 43  ? -6.429  -5.216  5.594   1.00 0.00 ? 42  PHE A HB3  3  
ATOM 4478  H HD1  . PHE A 1 43  ? -7.169  -2.188  7.831   1.00 0.00 ? 42  PHE A HD1  3  
ATOM 4479  H HD2  . PHE A 1 43  ? -4.472  -5.306  6.696   1.00 0.00 ? 42  PHE A HD2  3  
ATOM 4480  H HE1  . PHE A 1 43  ? -5.456  -1.250  9.282   1.00 0.00 ? 42  PHE A HE1  3  
ATOM 4481  H HE2  . PHE A 1 43  ? -2.813  -4.414  8.240   1.00 0.00 ? 42  PHE A HE2  3  
ATOM 4482  H HZ   . PHE A 1 43  ? -3.272  -2.360  9.507   1.00 0.00 ? 42  PHE A HZ   3  
ATOM 4483  N N    . ASP A 1 44  ? -7.839  -4.527  2.941   1.00 0.00 ? 43  ASP A N    3  
ATOM 4484  C CA   . ASP A 1 44  ? -8.462  -5.234  1.792   1.00 0.00 ? 43  ASP A CA   3  
ATOM 4485  C C    . ASP A 1 44  ? -9.133  -6.607  2.032   1.00 0.00 ? 43  ASP A C    3  
ATOM 4486  O O    . ASP A 1 44  ? -9.962  -7.076  1.257   1.00 0.00 ? 43  ASP A O    3  
ATOM 4487  C CB   . ASP A 1 44  ? -7.522  -5.266  0.543   1.00 0.00 ? 43  ASP A CB   3  
ATOM 4488  C CG   . ASP A 1 44  ? -6.260  -6.124  0.723   1.00 0.00 ? 43  ASP A CG   3  
ATOM 4489  O OD1  . ASP A 1 44  ? -5.425  -5.796  1.607   1.00 0.00 ? 43  ASP A OD1  3  
ATOM 4490  O OD2  . ASP A 1 44  ? -6.117  -7.113  -0.046  1.00 0.00 ? 43  ASP A OD2  3  
ATOM 4491  H H    . ASP A 1 44  ? -6.933  -4.161  2.740   1.00 0.00 ? 43  ASP A H    3  
ATOM 4492  H HA   . ASP A 1 44  ? -9.275  -4.591  1.486   1.00 0.00 ? 43  ASP A HA   3  
ATOM 4493  H HB2  . ASP A 1 44  ? -8.085  -5.619  -0.348  1.00 0.00 ? 43  ASP A HB2  3  
ATOM 4494  H HB3  . ASP A 1 44  ? -7.198  -4.223  0.329   1.00 0.00 ? 43  ASP A HB3  3  
ATOM 4495  N N    . ASP A 1 45  ? -8.772  -7.220  3.182   1.00 0.00 ? 44  ASP A N    3  
ATOM 4496  C CA   . ASP A 1 45  ? -9.246  -8.455  3.774   1.00 0.00 ? 44  ASP A CA   3  
ATOM 4497  C C    . ASP A 1 45  ? -10.340 -8.256  4.860   1.00 0.00 ? 44  ASP A C    3  
ATOM 4498  O O    . ASP A 1 45  ? -10.945 -9.227  5.302   1.00 0.00 ? 44  ASP A O    3  
ATOM 4499  C CB   . ASP A 1 45  ? -7.999  -9.287  4.214   1.00 0.00 ? 44  ASP A CB   3  
ATOM 4500  C CG   . ASP A 1 45  ? -7.126  -8.585  5.269   1.00 0.00 ? 44  ASP A CG   3  
ATOM 4501  O OD1  . ASP A 1 45  ? -7.526  -8.565  6.463   1.00 0.00 ? 44  ASP A OD1  3  
ATOM 4502  O OD2  . ASP A 1 45  ? -6.044  -8.065  4.885   1.00 0.00 ? 44  ASP A OD2  3  
ATOM 4503  H H    . ASP A 1 45  ? -8.092  -6.741  3.725   1.00 0.00 ? 44  ASP A H    3  
ATOM 4504  H HA   . ASP A 1 45  ? -9.730  -9.041  3.002   1.00 0.00 ? 44  ASP A HA   3  
ATOM 4505  H HB2  . ASP A 1 45  ? -8.268  -10.307 4.552   1.00 0.00 ? 44  ASP A HB2  3  
ATOM 4506  H HB3  . ASP A 1 45  ? -7.370  -9.401  3.295   1.00 0.00 ? 44  ASP A HB3  3  
ATOM 4507  N N    . GLY A 1 46  ? -10.679 -6.990  5.268   1.00 0.00 ? 45  GLY A N    3  
ATOM 4508  C CA   . GLY A 1 46  ? -11.876 -6.653  6.056   1.00 0.00 ? 45  GLY A CA   3  
ATOM 4509  C C    . GLY A 1 46  ? -11.735 -6.123  7.459   1.00 0.00 ? 45  GLY A C    3  
ATOM 4510  O O    . GLY A 1 46  ? -12.735 -6.032  8.163   1.00 0.00 ? 45  GLY A O    3  
ATOM 4511  H H    . GLY A 1 46  ? -10.203 -6.173  4.892   1.00 0.00 ? 45  GLY A H    3  
ATOM 4512  H HA2  . GLY A 1 46  ? -12.317 -5.819  5.508   1.00 0.00 ? 45  GLY A HA2  3  
ATOM 4513  H HA3  . GLY A 1 46  ? -12.532 -7.516  6.168   1.00 0.00 ? 45  GLY A HA3  3  
ATOM 4514  N N    . TYR A 1 47  ? -10.531 -5.723  7.933   1.00 0.00 ? 46  TYR A N    3  
ATOM 4515  C CA   . TYR A 1 47  ? -10.333 -5.125  9.259   1.00 0.00 ? 46  TYR A CA   3  
ATOM 4516  C C    . TYR A 1 47  ? -10.413 -3.596  9.145   1.00 0.00 ? 46  TYR A C    3  
ATOM 4517  O O    . TYR A 1 47  ? -9.480  -2.965  8.656   1.00 0.00 ? 46  TYR A O    3  
ATOM 4518  C CB   . TYR A 1 47  ? -8.972  -5.594  9.895   1.00 0.00 ? 46  TYR A CB   3  
ATOM 4519  C CG   . TYR A 1 47  ? -8.674  -4.946  11.235  1.00 0.00 ? 46  TYR A CG   3  
ATOM 4520  C CD1  . TYR A 1 47  ? -9.416  -5.257  12.361  1.00 0.00 ? 46  TYR A CD1  3  
ATOM 4521  C CD2  . TYR A 1 47  ? -7.760  -3.907  11.302  1.00 0.00 ? 46  TYR A CD2  3  
ATOM 4522  C CE1  . TYR A 1 47  ? -9.256  -4.535  13.530  1.00 0.00 ? 46  TYR A CE1  3  
ATOM 4523  C CE2  . TYR A 1 47  ? -7.621  -3.168  12.457  1.00 0.00 ? 46  TYR A CE2  3  
ATOM 4524  C CZ   . TYR A 1 47  ? -8.363  -3.481  13.573  1.00 0.00 ? 46  TYR A CZ   3  
ATOM 4525  O OH   . TYR A 1 47  ? -8.221  -2.692  14.731  1.00 0.00 ? 46  TYR A OH   3  
ATOM 4526  H H    . TYR A 1 47  ? -9.725  -5.801  7.358   1.00 0.00 ? 46  TYR A H    3  
ATOM 4527  H HA   . TYR A 1 47  ? -11.121 -5.434  9.936   1.00 0.00 ? 46  TYR A HA   3  
ATOM 4528  H HB2  . TYR A 1 47  ? -9.001  -6.694  10.046  1.00 0.00 ? 46  TYR A HB2  3  
ATOM 4529  H HB3  . TYR A 1 47  ? -8.134  -5.361  9.201   1.00 0.00 ? 46  TYR A HB3  3  
ATOM 4530  H HD1  . TYR A 1 47  ? -10.157 -6.042  12.309  1.00 0.00 ? 46  TYR A HD1  3  
ATOM 4531  H HD2  . TYR A 1 47  ? -7.205  -3.623  10.415  1.00 0.00 ? 46  TYR A HD2  3  
ATOM 4532  H HE1  . TYR A 1 47  ? -9.861  -4.780  14.393  1.00 0.00 ? 46  TYR A HE1  3  
ATOM 4533  H HE2  . TYR A 1 47  ? -6.951  -2.320  12.472  1.00 0.00 ? 46  TYR A HE2  3  
ATOM 4534  H HH   . TYR A 1 47  ? -8.633  -3.165  15.458  1.00 0.00 ? 46  TYR A HH   3  
ATOM 4535  N N    . GLU A 1 48  ? -11.510 -2.952  9.631   1.00 0.00 ? 47  GLU A N    3  
ATOM 4536  C CA   . GLU A 1 48  ? -11.682 -1.494  9.611   1.00 0.00 ? 47  GLU A CA   3  
ATOM 4537  C C    . GLU A 1 48  ? -11.431 -0.801  10.918  1.00 0.00 ? 47  GLU A C    3  
ATOM 4538  O O    . GLU A 1 48  ? -11.515 -1.377  12.003  1.00 0.00 ? 47  GLU A O    3  
ATOM 4539  C CB   . GLU A 1 48  ? -12.994 -1.057  8.916   1.00 0.00 ? 47  GLU A CB   3  
ATOM 4540  C CG   . GLU A 1 48  ? -13.446 0.425   8.983   1.00 0.00 ? 47  GLU A CG   3  
ATOM 4541  C CD   . GLU A 1 48  ? -14.568 0.609   7.967   1.00 0.00 ? 47  GLU A CD   3  
ATOM 4542  O OE1  . GLU A 1 48  ? -15.715 0.183   8.268   1.00 0.00 ? 47  GLU A OE1  3  
ATOM 4543  O OE2  . GLU A 1 48  ? -14.293 1.165   6.870   1.00 0.00 ? 47  GLU A OE2  3  
ATOM 4544  H H    . GLU A 1 48  ? -12.259 -3.462  10.049  1.00 0.00 ? 47  GLU A H    3  
ATOM 4545  H HA   . GLU A 1 48  ? -10.895 -1.065  9.021   1.00 0.00 ? 47  GLU A HA   3  
ATOM 4546  H HB2  . GLU A 1 48  ? -12.774 -1.216  7.854   1.00 0.00 ? 47  GLU A HB2  3  
ATOM 4547  H HB3  . GLU A 1 48  ? -13.794 -1.788  9.112   1.00 0.00 ? 47  GLU A HB3  3  
ATOM 4548  H HG2  . GLU A 1 48  ? -13.828 0.668   9.997   1.00 0.00 ? 47  GLU A HG2  3  
ATOM 4549  H HG3  . GLU A 1 48  ? -12.590 1.133   8.751   1.00 0.00 ? 47  GLU A HG3  3  
ATOM 4550  N N    . CYS A 1 49  ? -11.043 0.498   10.785  1.00 0.00 ? 48  CYS A N    3  
ATOM 4551  C CA   . CYS A 1 49  ? -10.610 1.304   11.890  1.00 0.00 ? 48  CYS A CA   3  
ATOM 4552  C C    . CYS A 1 49  ? -10.635 2.722   11.382  1.00 0.00 ? 48  CYS A C    3  
ATOM 4553  O O    . CYS A 1 49  ? -10.873 2.956   10.197  1.00 0.00 ? 48  CYS A O    3  
ATOM 4554  C CB   . CYS A 1 49  ? -9.158  0.879   12.324  1.00 0.00 ? 48  CYS A CB   3  
ATOM 4555  S SG   . CYS A 1 49  ? -8.009  0.306   11.016  1.00 0.00 ? 48  CYS A SG   3  
ATOM 4556  H H    . CYS A 1 49  ? -10.993 0.992   9.875   1.00 0.00 ? 48  CYS A H    3  
ATOM 4557  H HA   . CYS A 1 49  ? -11.308 1.241   12.716  1.00 0.00 ? 48  CYS A HA   3  
ATOM 4558  H HB2  . CYS A 1 49  ? -8.659  1.708   12.849  1.00 0.00 ? 48  CYS A HB2  3  
ATOM 4559  H HB3  . CYS A 1 49  ? -9.283  0.037   13.039  1.00 0.00 ? 48  CYS A HB3  3  
ATOM 4560  H HG   . CYS A 1 49  ? -8.685  -0.804  10.754  1.00 0.00 ? 48  CYS A HG   3  
ATOM 4561  N N    . ASP A 1 50  ? -10.315 3.712   12.247  1.00 0.00 ? 49  ASP A N    3  
ATOM 4562  C CA   . ASP A 1 50  ? -10.014 5.075   11.834  1.00 0.00 ? 49  ASP A CA   3  
ATOM 4563  C C    . ASP A 1 50  ? -8.661  5.265   12.479  1.00 0.00 ? 49  ASP A C    3  
ATOM 4564  O O    . ASP A 1 50  ? -8.456  4.811   13.609  1.00 0.00 ? 49  ASP A O    3  
ATOM 4565  C CB   . ASP A 1 50  ? -10.851 6.234   12.460  1.00 0.00 ? 49  ASP A CB   3  
ATOM 4566  C CG   . ASP A 1 50  ? -12.308 6.172   12.010  1.00 0.00 ? 49  ASP A CG   3  
ATOM 4567  O OD1  . ASP A 1 50  ? -12.993 5.165   12.336  1.00 0.00 ? 49  ASP A OD1  3  
ATOM 4568  O OD2  . ASP A 1 50  ? -12.767 7.143   11.357  1.00 0.00 ? 49  ASP A OD2  3  
ATOM 4569  H H    . ASP A 1 50  ? -10.105 3.527   13.207  1.00 0.00 ? 49  ASP A H    3  
ATOM 4570  H HA   . ASP A 1 50  ? -9.939  5.127   10.729  1.00 0.00 ? 49  ASP A HA   3  
ATOM 4571  H HB2  . ASP A 1 50  ? -10.839 6.232   13.575  1.00 0.00 ? 49  ASP A HB2  3  
ATOM 4572  H HB3  . ASP A 1 50  ? -10.369 7.195   12.154  1.00 0.00 ? 49  ASP A HB3  3  
ATOM 4573  N N    . VAL A 1 51  ? -7.713  5.921   11.787  1.00 0.00 ? 50  VAL A N    3  
ATOM 4574  C CA   . VAL A 1 51  ? -6.364  6.121   12.298  1.00 0.00 ? 50  VAL A CA   3  
ATOM 4575  C C    . VAL A 1 51  ? -5.786  7.413   11.821  1.00 0.00 ? 50  VAL A C    3  
ATOM 4576  O O    . VAL A 1 51  ? -6.243  7.925   10.801  1.00 0.00 ? 50  VAL A O    3  
ATOM 4577  C CB   . VAL A 1 51  ? -5.396  5.061   11.749  1.00 0.00 ? 50  VAL A CB   3  
ATOM 4578  C CG1  . VAL A 1 51  ? -5.720  3.716   12.392  1.00 0.00 ? 50  VAL A CG1  3  
ATOM 4579  C CG2  . VAL A 1 51  ? -5.483  5.014   10.198  1.00 0.00 ? 50  VAL A CG2  3  
ATOM 4580  H H    . VAL A 1 51  ? -7.887  6.293   10.868  1.00 0.00 ? 50  VAL A H    3  
ATOM 4581  H HA   . VAL A 1 51  ? -6.421  6.188   13.373  1.00 0.00 ? 50  VAL A HA   3  
ATOM 4582  H HB   . VAL A 1 51  ? -4.331  5.253   12.040  1.00 0.00 ? 50  VAL A HB   3  
ATOM 4583  H HG11 . VAL A 1 51  ? -5.762  3.849   13.494  1.00 0.00 ? 50  VAL A HG11 3  
ATOM 4584  H HG12 . VAL A 1 51  ? -4.938  2.974   12.129  1.00 0.00 ? 50  VAL A HG12 3  
ATOM 4585  H HG13 . VAL A 1 51  ? -6.703  3.347   12.039  1.00 0.00 ? 50  VAL A HG13 3  
ATOM 4586  H HG21 . VAL A 1 51  ? -5.315  3.981   9.843   1.00 0.00 ? 50  VAL A HG21 3  
ATOM 4587  H HG22 . VAL A 1 51  ? -4.704  5.675   9.763   1.00 0.00 ? 50  VAL A HG22 3  
ATOM 4588  H HG23 . VAL A 1 51  ? -6.465  5.385   9.805   1.00 0.00 ? 50  VAL A HG23 3  
ATOM 4589  N N    . LEU A 1 52  ? -4.675  7.906   12.461  1.00 0.00 ? 51  LEU A N    3  
ATOM 4590  C CA   . LEU A 1 52  ? -3.868  9.033   11.994  1.00 0.00 ? 51  LEU A CA   3  
ATOM 4591  C C    . LEU A 1 52  ? -2.861  8.488   11.021  1.00 0.00 ? 51  LEU A C    3  
ATOM 4592  O O    . LEU A 1 52  ? -2.381  7.368   11.159  1.00 0.00 ? 51  LEU A O    3  
ATOM 4593  C CB   . LEU A 1 52  ? -3.250  9.796   13.193  1.00 0.00 ? 51  LEU A CB   3  
ATOM 4594  C CG   . LEU A 1 52  ? -2.925  11.303  13.027  1.00 0.00 ? 51  LEU A CG   3  
ATOM 4595  C CD1  . LEU A 1 52  ? -1.832  11.666  12.005  1.00 0.00 ? 51  LEU A CD1  3  
ATOM 4596  C CD2  . LEU A 1 52  ? -4.187  12.124  12.747  1.00 0.00 ? 51  LEU A CD2  3  
ATOM 4597  H H    . LEU A 1 52  ? -4.291  7.481   13.278  1.00 0.00 ? 51  LEU A H    3  
ATOM 4598  H HA   . LEU A 1 52  ? -4.484  9.633   11.342  1.00 0.00 ? 51  LEU A HA   3  
ATOM 4599  H HB2  . LEU A 1 52  ? -4.020  9.758   14.002  1.00 0.00 ? 51  LEU A HB2  3  
ATOM 4600  H HB3  . LEU A 1 52  ? -2.353  9.264   13.583  1.00 0.00 ? 51  LEU A HB3  3  
ATOM 4601  H HG   . LEU A 1 52  ? -2.551  11.605  14.033  1.00 0.00 ? 51  LEU A HG   3  
ATOM 4602  H HD11 . LEU A 1 52  ? -0.919  11.060  12.163  1.00 0.00 ? 51  LEU A HD11 3  
ATOM 4603  H HD12 . LEU A 1 52  ? -1.557  12.739  12.111  1.00 0.00 ? 51  LEU A HD12 3  
ATOM 4604  H HD13 . LEU A 1 52  ? -2.198  11.512  10.972  1.00 0.00 ? 51  LEU A HD13 3  
ATOM 4605  H HD21 . LEU A 1 52  ? -4.597  11.856  11.753  1.00 0.00 ? 51  LEU A HD21 3  
ATOM 4606  H HD22 . LEU A 1 52  ? -3.956  13.211  12.741  1.00 0.00 ? 51  LEU A HD22 3  
ATOM 4607  H HD23 . LEU A 1 52  ? -4.964  11.930  13.519  1.00 0.00 ? 51  LEU A HD23 3  
ATOM 4608  N N    . GLY A 1 53  ? -2.774  9.195   9.869   1.00 0.00 ? 52  GLY A N    3  
ATOM 4609  C CA   . GLY A 1 53  ? -2.616  8.599   8.554   1.00 0.00 ? 52  GLY A CA   3  
ATOM 4610  C C    . GLY A 1 53  ? -1.357  7.908   8.298   1.00 0.00 ? 52  GLY A C    3  
ATOM 4611  O O    . GLY A 1 53  ? -1.376  6.813   7.777   1.00 0.00 ? 52  GLY A O    3  
ATOM 4612  H H    . GLY A 1 53  ? -3.131  10.128  9.803   1.00 0.00 ? 52  GLY A H    3  
ATOM 4613  H HA2  . GLY A 1 53  ? -3.468  7.923   8.431   1.00 0.00 ? 52  GLY A HA2  3  
ATOM 4614  H HA3  . GLY A 1 53  ? -2.619  9.363   7.801   1.00 0.00 ? 52  GLY A HA3  3  
ATOM 4615  N N    . LYS A 1 54  ? -0.216  8.478   8.756   1.00 0.00 ? 53  LYS A N    3  
ATOM 4616  C CA   . LYS A 1 54  ? 1.183   8.079   8.575   1.00 0.00 ? 53  LYS A CA   3  
ATOM 4617  C C    . LYS A 1 54  ? 1.591   6.666   9.089   1.00 0.00 ? 53  LYS A C    3  
ATOM 4618  O O    . LYS A 1 54  ? 2.764   6.384   9.310   1.00 0.00 ? 53  LYS A O    3  
ATOM 4619  C CB   . LYS A 1 54  ? 2.010   9.120   9.419   1.00 0.00 ? 53  LYS A CB   3  
ATOM 4620  C CG   . LYS A 1 54  ? 1.543   9.465   10.878  1.00 0.00 ? 53  LYS A CG   3  
ATOM 4621  C CD   . LYS A 1 54  ? 1.327   8.263   11.835  1.00 0.00 ? 53  LYS A CD   3  
ATOM 4622  C CE   . LYS A 1 54  ? 1.308   8.486   13.355  1.00 0.00 ? 53  LYS A CE   3  
ATOM 4623  N NZ   . LYS A 1 54  ? 0.347   9.528   13.764  1.00 0.00 ? 53  LYS A NZ   3  
ATOM 4624  H H    . LYS A 1 54  ? -0.291  9.351   9.231   1.00 0.00 ? 53  LYS A H    3  
ATOM 4625  H HA   . LYS A 1 54  ? 1.442   8.197   7.510   1.00 0.00 ? 53  LYS A HA   3  
ATOM 4626  H HB2  . LYS A 1 54  ? 3.085   8.833   9.446   1.00 0.00 ? 53  LYS A HB2  3  
ATOM 4627  H HB3  . LYS A 1 54  ? 1.984   10.076  8.851   1.00 0.00 ? 53  LYS A HB3  3  
ATOM 4628  H HG2  . LYS A 1 54  ? 2.331   10.117  11.320  1.00 0.00 ? 53  LYS A HG2  3  
ATOM 4629  H HG3  . LYS A 1 54  ? 0.612   10.068  10.838  1.00 0.00 ? 53  LYS A HG3  3  
ATOM 4630  H HD2  . LYS A 1 54  ? 0.375   7.758   11.549  1.00 0.00 ? 53  LYS A HD2  3  
ATOM 4631  H HD3  . LYS A 1 54  ? 2.164   7.547   11.663  1.00 0.00 ? 53  LYS A HD3  3  
ATOM 4632  H HE2  . LYS A 1 54  ? 1.001   7.529   13.852  1.00 0.00 ? 53  LYS A HE2  3  
ATOM 4633  H HE3  . LYS A 1 54  ? 2.311   8.785   13.721  1.00 0.00 ? 53  LYS A HE3  3  
ATOM 4634  H HZ1  . LYS A 1 54  ? -0.610  9.258   13.457  1.00 0.00 ? 53  LYS A HZ1  3  
ATOM 4635  H HZ2  . LYS A 1 54  ? 0.608   10.433  13.324  1.00 0.00 ? 53  LYS A HZ2  3  
ATOM 4636  H HZ3  . LYS A 1 54  ? 0.362   9.628   14.799  1.00 0.00 ? 53  LYS A HZ3  3  
ATOM 4637  N N    . ASP A 1 55  ? 0.562   5.820   9.298   1.00 0.00 ? 54  ASP A N    3  
ATOM 4638  C CA   . ASP A 1 55  ? 0.399   4.475   9.757   1.00 0.00 ? 54  ASP A CA   3  
ATOM 4639  C C    . ASP A 1 55  ? -0.419  3.806   8.668   1.00 0.00 ? 54  ASP A C    3  
ATOM 4640  O O    . ASP A 1 55  ? 0.115   3.107   7.819   1.00 0.00 ? 54  ASP A O    3  
ATOM 4641  C CB   . ASP A 1 55  ? -0.385  4.383   11.108  1.00 0.00 ? 54  ASP A CB   3  
ATOM 4642  C CG   . ASP A 1 55  ? 0.479   4.788   12.307  1.00 0.00 ? 54  ASP A CG   3  
ATOM 4643  O OD1  . ASP A 1 55  ? 1.730   4.845   12.172  1.00 0.00 ? 54  ASP A OD1  3  
ATOM 4644  O OD2  . ASP A 1 55  ? -0.117  5.024   13.392  1.00 0.00 ? 54  ASP A OD2  3  
ATOM 4645  H H    . ASP A 1 55  ? -0.317  6.227   9.044   1.00 0.00 ? 54  ASP A H    3  
ATOM 4646  H HA   . ASP A 1 55  ? 1.360   3.989   9.796   1.00 0.00 ? 54  ASP A HA   3  
ATOM 4647  H HB2  . ASP A 1 55  ? -1.283  5.040   11.070  1.00 0.00 ? 54  ASP A HB2  3  
ATOM 4648  H HB3  . ASP A 1 55  ? -0.731  3.342   11.302  1.00 0.00 ? 54  ASP A HB3  3  
ATOM 4649  N N    . ILE A 1 56  ? -1.773  3.992   8.610   1.00 0.00 ? 55  ILE A N    3  
ATOM 4650  C CA   . ILE A 1 56  ? -2.572  3.360   7.556   1.00 0.00 ? 55  ILE A CA   3  
ATOM 4651  C C    . ILE A 1 56  ? -3.122  4.480   6.649   1.00 0.00 ? 55  ILE A C    3  
ATOM 4652  O O    . ILE A 1 56  ? -4.087  5.179   6.977   1.00 0.00 ? 55  ILE A O    3  
ATOM 4653  C CB   . ILE A 1 56  ? -3.603  2.380   8.132   1.00 0.00 ? 55  ILE A CB   3  
ATOM 4654  C CG1  . ILE A 1 56  ? -3.234  1.796   9.539   1.00 0.00 ? 55  ILE A CG1  3  
ATOM 4655  C CG2  . ILE A 1 56  ? -3.790  1.246   7.104   1.00 0.00 ? 55  ILE A CG2  3  
ATOM 4656  C CD1  . ILE A 1 56  ? -2.025  0.844   9.632   1.00 0.00 ? 55  ILE A CD1  3  
ATOM 4657  H H    . ILE A 1 56  ? -2.266  4.575   9.245   1.00 0.00 ? 55  ILE A H    3  
ATOM 4658  H HA   . ILE A 1 56  ? -1.959  2.749   6.944   1.00 0.00 ? 55  ILE A HA   3  
ATOM 4659  H HB   . ILE A 1 56  ? -4.581  2.900   8.268   1.00 0.00 ? 55  ILE A HB   3  
ATOM 4660  H HG12 . ILE A 1 56  ? -3.092  2.631   10.257  1.00 0.00 ? 55  ILE A HG12 3  
ATOM 4661  H HG13 . ILE A 1 56  ? -4.127  1.234   9.902   1.00 0.00 ? 55  ILE A HG13 3  
ATOM 4662  H HG21 . ILE A 1 56  ? -4.232  1.641   6.169   1.00 0.00 ? 55  ILE A HG21 3  
ATOM 4663  H HG22 . ILE A 1 56  ? -4.445  0.452   7.516   1.00 0.00 ? 55  ILE A HG22 3  
ATOM 4664  H HG23 . ILE A 1 56  ? -2.828  0.778   6.844   1.00 0.00 ? 55  ILE A HG23 3  
ATOM 4665  H HD11 . ILE A 1 56  ? -1.837  0.576   10.693  1.00 0.00 ? 55  ILE A HD11 3  
ATOM 4666  H HD12 . ILE A 1 56  ? -1.072  1.285   9.265   1.00 0.00 ? 55  ILE A HD12 3  
ATOM 4667  H HD13 . ILE A 1 56  ? -2.207  -0.092  9.068   1.00 0.00 ? 55  ILE A HD13 3  
ATOM 4668  N N    . LEU A 1 57  ? -2.409  4.676   5.494   1.00 0.00 ? 56  LEU A N    3  
ATOM 4669  C CA   . LEU A 1 57  ? -2.505  5.868   4.624   1.00 0.00 ? 56  LEU A CA   3  
ATOM 4670  C C    . LEU A 1 57  ? -2.593  5.764   3.139   1.00 0.00 ? 56  LEU A C    3  
ATOM 4671  O O    . LEU A 1 57  ? -2.059  4.819   2.565   1.00 0.00 ? 56  LEU A O    3  
ATOM 4672  C CB   . LEU A 1 57  ? -1.326  6.792   4.966   1.00 0.00 ? 56  LEU A CB   3  
ATOM 4673  C CG   . LEU A 1 57  ? -0.422  7.529   3.963   1.00 0.00 ? 56  LEU A CG   3  
ATOM 4674  C CD1  . LEU A 1 57  ? 0.436   8.389   4.888   1.00 0.00 ? 56  LEU A CD1  3  
ATOM 4675  C CD2  . LEU A 1 57  ? 0.433   6.647   3.019   1.00 0.00 ? 56  LEU A CD2  3  
ATOM 4676  H H    . LEU A 1 57  ? -1.646  4.050   5.311   1.00 0.00 ? 56  LEU A H    3  
ATOM 4677  H HA   . LEU A 1 57  ? -3.413  6.398   4.892   1.00 0.00 ? 56  LEU A HA   3  
ATOM 4678  H HB2  . LEU A 1 57  ? -1.789  7.593   5.590   1.00 0.00 ? 56  LEU A HB2  3  
ATOM 4679  H HB3  . LEU A 1 57  ? -0.636  6.214   5.628   1.00 0.00 ? 56  LEU A HB3  3  
ATOM 4680  H HG   . LEU A 1 57  ? -1.033  8.220   3.344   1.00 0.00 ? 56  LEU A HG   3  
ATOM 4681  H HD11 . LEU A 1 57  ? 1.093   9.024   4.295   1.00 0.00 ? 56  LEU A HD11 3  
ATOM 4682  H HD12 . LEU A 1 57  ? 1.098   7.742   5.494   1.00 0.00 ? 56  LEU A HD12 3  
ATOM 4683  H HD13 . LEU A 1 57  ? -0.172  9.036   5.547   1.00 0.00 ? 56  LEU A HD13 3  
ATOM 4684  H HD21 . LEU A 1 57  ? 1.298   7.171   2.584   1.00 0.00 ? 56  LEU A HD21 3  
ATOM 4685  H HD22 . LEU A 1 57  ? -0.130  6.305   2.134   1.00 0.00 ? 56  LEU A HD22 3  
ATOM 4686  H HD23 . LEU A 1 57  ? 0.799   5.736   3.520   1.00 0.00 ? 56  LEU A HD23 3  
ATOM 4687  N N    . LEU A 1 58  ? -3.143  6.830   2.470   1.00 0.00 ? 57  LEU A N    3  
ATOM 4688  C CA   . LEU A 1 58  ? -3.265  7.132   1.050   1.00 0.00 ? 57  LEU A CA   3  
ATOM 4689  C C    . LEU A 1 58  ? -2.002  7.076   0.209   1.00 0.00 ? 57  LEU A C    3  
ATOM 4690  O O    . LEU A 1 58  ? -1.075  7.873   0.219   1.00 0.00 ? 57  LEU A O    3  
ATOM 4691  C CB   . LEU A 1 58  ? -3.965  8.506   0.881   1.00 0.00 ? 57  LEU A CB   3  
ATOM 4692  C CG   . LEU A 1 58  ? -3.467  9.801   1.576   1.00 0.00 ? 57  LEU A CG   3  
ATOM 4693  C CD1  . LEU A 1 58  ? -2.024  10.247  1.353   1.00 0.00 ? 57  LEU A CD1  3  
ATOM 4694  C CD2  . LEU A 1 58  ? -4.350  10.971  1.105   1.00 0.00 ? 57  LEU A CD2  3  
ATOM 4695  H H    . LEU A 1 58  ? -3.487  7.597   2.979   1.00 0.00 ? 57  LEU A H    3  
ATOM 4696  H HA   . LEU A 1 58  ? -3.907  6.369   0.599   1.00 0.00 ? 57  LEU A HA   3  
ATOM 4697  H HB2  . LEU A 1 58  ? -4.098  8.703   -0.204  1.00 0.00 ? 57  LEU A HB2  3  
ATOM 4698  H HB3  . LEU A 1 58  ? -4.989  8.358   1.305   1.00 0.00 ? 57  LEU A HB3  3  
ATOM 4699  H HG   . LEU A 1 58  ? -3.604  9.643   2.663   1.00 0.00 ? 57  LEU A HG   3  
ATOM 4700  H HD11 . LEU A 1 58  ? -1.842  10.199  0.250   1.00 0.00 ? 57  LEU A HD11 3  
ATOM 4701  H HD12 . LEU A 1 58  ? -1.299  9.570   1.867   1.00 0.00 ? 57  LEU A HD12 3  
ATOM 4702  H HD13 . LEU A 1 58  ? -1.841  11.277  1.715   1.00 0.00 ? 57  LEU A HD13 3  
ATOM 4703  H HD21 . LEU A 1 58  ? -4.093  11.907  1.641   1.00 0.00 ? 57  LEU A HD21 3  
ATOM 4704  H HD22 . LEU A 1 58  ? -5.421  10.748  1.275   1.00 0.00 ? 57  LEU A HD22 3  
ATOM 4705  H HD23 . LEU A 1 58  ? -4.180  11.141  0.023   1.00 0.00 ? 57  LEU A HD23 3  
ATOM 4706  N N    . CYS A 1 59  ? -1.916  5.986   -0.519  1.00 0.00 ? 58  CYS A N    3  
ATOM 4707  C CA   . CYS A 1 59  ? -0.855  5.574   -1.342  1.00 0.00 ? 58  CYS A CA   3  
ATOM 4708  C C    . CYS A 1 59  ? -1.413  5.321   -2.759  1.00 0.00 ? 58  CYS A C    3  
ATOM 4709  O O    . CYS A 1 59  ? -2.605  5.351   -3.050  1.00 0.00 ? 58  CYS A O    3  
ATOM 4710  C CB   . CYS A 1 59  ? -0.236  4.397   -0.523  1.00 0.00 ? 58  CYS A CB   3  
ATOM 4711  S SG   . CYS A 1 59  ? 1.566   4.569   -0.286  1.00 0.00 ? 58  CYS A SG   3  
ATOM 4712  H H    . CYS A 1 59  ? -2.620  5.287   -0.567  1.00 0.00 ? 58  CYS A H    3  
ATOM 4713  H HA   . CYS A 1 59  ? -0.115  6.367   -1.437  1.00 0.00 ? 58  CYS A HA   3  
ATOM 4714  H HB2  . CYS A 1 59  ? -0.682  4.430   0.500   1.00 0.00 ? 58  CYS A HB2  3  
ATOM 4715  H HB3  . CYS A 1 59  ? -0.534  3.406   -0.932  1.00 0.00 ? 58  CYS A HB3  3  
ATOM 4716  H HG   . CYS A 1 59  ? 1.672   3.645   0.662   1.00 0.00 ? 58  CYS A HG   3  
ATOM 4717  N N    . ASP A 1 60  ? -0.487  5.024   -3.663  1.00 0.00 ? 59  ASP A N    3  
ATOM 4718  C CA   . ASP A 1 60  ? -0.618  4.463   -5.023  1.00 0.00 ? 59  ASP A CA   3  
ATOM 4719  C C    . ASP A 1 60  ? -0.627  2.909   -4.968  1.00 0.00 ? 59  ASP A C    3  
ATOM 4720  O O    . ASP A 1 60  ? -1.373  2.324   -5.752  1.00 0.00 ? 59  ASP A O    3  
ATOM 4721  C CB   . ASP A 1 60  ? 0.447   4.969   -6.080  1.00 0.00 ? 59  ASP A CB   3  
ATOM 4722  C CG   . ASP A 1 60  ? -0.235  5.772   -7.197  1.00 0.00 ? 59  ASP A CG   3  
ATOM 4723  O OD1  . ASP A 1 60  ? -1.179  5.234   -7.834  1.00 0.00 ? 59  ASP A OD1  3  
ATOM 4724  O OD2  . ASP A 1 60  ? 0.179   6.941   -7.419  1.00 0.00 ? 59  ASP A OD2  3  
ATOM 4725  H H    . ASP A 1 60  ? 0.399   5.051   -3.221  1.00 0.00 ? 59  ASP A H    3  
ATOM 4726  H HA   . ASP A 1 60  ? -1.606  4.729   -5.380  1.00 0.00 ? 59  ASP A HA   3  
ATOM 4727  H HB2  . ASP A 1 60  ? 1.168   5.658   -5.594  1.00 0.00 ? 59  ASP A HB2  3  
ATOM 4728  H HB3  . ASP A 1 60  ? 1.064   4.149   -6.539  1.00 0.00 ? 59  ASP A HB3  3  
ATOM 4729  N N    . PRO A 1 61  ? 0.150   2.150   -4.117  1.00 0.00 ? 60  PRO A N    3  
ATOM 4730  C CA   . PRO A 1 61  ? 1.113   2.584   -3.119  1.00 0.00 ? 60  PRO A CA   3  
ATOM 4731  C C    . PRO A 1 61  ? 2.307   3.292   -3.666  1.00 0.00 ? 60  PRO A C    3  
ATOM 4732  O O    . PRO A 1 61  ? 2.403   4.488   -3.424  1.00 0.00 ? 60  PRO A O    3  
ATOM 4733  C CB   . PRO A 1 61  ? 1.410   1.373   -2.190  1.00 0.00 ? 60  PRO A CB   3  
ATOM 4734  C CG   . PRO A 1 61  ? 0.413   0.293   -2.607  1.00 0.00 ? 60  PRO A CG   3  
ATOM 4735  C CD   . PRO A 1 61  ? -0.025  0.709   -4.011  1.00 0.00 ? 60  PRO A CD   3  
ATOM 4736  H HA   . PRO A 1 61  ? 0.690   3.334   -2.495  1.00 0.00 ? 60  PRO A HA   3  
ATOM 4737  H HB2  . PRO A 1 61  ? 2.465   1.011   -2.162  1.00 0.00 ? 60  PRO A HB2  3  
ATOM 4738  H HB3  . PRO A 1 61  ? 1.177   1.675   -1.148  1.00 0.00 ? 60  PRO A HB3  3  
ATOM 4739  H HG2  . PRO A 1 61  ? 0.840   -0.731  -2.587  1.00 0.00 ? 60  PRO A HG2  3  
ATOM 4740  H HG3  . PRO A 1 61  ? -0.472  0.328   -1.932  1.00 0.00 ? 60  PRO A HG3  3  
ATOM 4741  H HD2  . PRO A 1 61  ? 0.662   0.229   -4.740  1.00 0.00 ? 60  PRO A HD2  3  
ATOM 4742  H HD3  . PRO A 1 61  ? -1.079  0.383   -4.170  1.00 0.00 ? 60  PRO A HD3  3  
ATOM 4743  N N    . ILE A 1 62  ? 3.235   2.578   -4.301  1.00 0.00 ? 61  ILE A N    3  
ATOM 4744  C CA   . ILE A 1 62  ? 4.561   3.071   -4.555  1.00 0.00 ? 61  ILE A CA   3  
ATOM 4745  C C    . ILE A 1 62  ? 4.783   3.483   -6.011  1.00 0.00 ? 61  ILE A C    3  
ATOM 4746  O O    . ILE A 1 62  ? 4.014   3.055   -6.875  1.00 0.00 ? 61  ILE A O    3  
ATOM 4747  C CB   . ILE A 1 62  ? 5.432   1.979   -3.954  1.00 0.00 ? 61  ILE A CB   3  
ATOM 4748  C CG1  . ILE A 1 62  ? 5.171   2.004   -2.434  1.00 0.00 ? 61  ILE A CG1  3  
ATOM 4749  C CG2  . ILE A 1 62  ? 6.957   2.136   -4.067  1.00 0.00 ? 61  ILE A CG2  3  
ATOM 4750  C CD1  . ILE A 1 62  ? 5.937   3.060   -1.636  1.00 0.00 ? 61  ILE A CD1  3  
ATOM 4751  H H    . ILE A 1 62  ? 3.088   1.607   -4.467  1.00 0.00 ? 61  ILE A H    3  
ATOM 4752  H HA   . ILE A 1 62  ? 4.729   3.924   -3.931  1.00 0.00 ? 61  ILE A HA   3  
ATOM 4753  H HB   . ILE A 1 62  ? 5.065   0.990   -4.365  1.00 0.00 ? 61  ILE A HB   3  
ATOM 4754  H HG12 . ILE A 1 62  ? 4.124   2.211   -2.155  1.00 0.00 ? 61  ILE A HG12 3  
ATOM 4755  H HG13 . ILE A 1 62  ? 5.434   0.997   -2.053  1.00 0.00 ? 61  ILE A HG13 3  
ATOM 4756  H HG21 . ILE A 1 62  ? 7.404   1.429   -3.332  1.00 0.00 ? 61  ILE A HG21 3  
ATOM 4757  H HG22 . ILE A 1 62  ? 7.299   3.132   -3.713  1.00 0.00 ? 61  ILE A HG22 3  
ATOM 4758  H HG23 . ILE A 1 62  ? 7.344   1.948   -5.083  1.00 0.00 ? 61  ILE A HG23 3  
ATOM 4759  H HD11 . ILE A 1 62  ? 5.318   3.460   -0.805  1.00 0.00 ? 61  ILE A HD11 3  
ATOM 4760  H HD12 . ILE A 1 62  ? 6.294   3.909   -2.230  1.00 0.00 ? 61  ILE A HD12 3  
ATOM 4761  H HD13 . ILE A 1 62  ? 6.823   2.569   -1.194  1.00 0.00 ? 61  ILE A HD13 3  
ATOM 4762  N N    . PRO A 1 63  ? 5.800   4.337   -6.325  1.00 0.00 ? 62  PRO A N    3  
ATOM 4763  C CA   . PRO A 1 63  ? 6.067   5.006   -7.593  1.00 0.00 ? 62  PRO A CA   3  
ATOM 4764  C C    . PRO A 1 63  ? 6.133   4.078   -8.816  1.00 0.00 ? 62  PRO A C    3  
ATOM 4765  O O    . PRO A 1 63  ? 7.078   3.336   -8.999  1.00 0.00 ? 62  PRO A O    3  
ATOM 4766  C CB   . PRO A 1 63  ? 7.492   5.559   -7.236  1.00 0.00 ? 62  PRO A CB   3  
ATOM 4767  C CG   . PRO A 1 63  ? 7.471   5.971   -5.768  1.00 0.00 ? 62  PRO A CG   3  
ATOM 4768  C CD   . PRO A 1 63  ? 6.273   5.226   -5.273  1.00 0.00 ? 62  PRO A CD   3  
ATOM 4769  H HA   . PRO A 1 63  ? 5.321   5.769   -7.769  1.00 0.00 ? 62  PRO A HA   3  
ATOM 4770  H HB2  . PRO A 1 63  ? 8.248   4.731   -7.194  1.00 0.00 ? 62  PRO A HB2  3  
ATOM 4771  H HB3  . PRO A 1 63  ? 7.829   6.363   -7.915  1.00 0.00 ? 62  PRO A HB3  3  
ATOM 4772  H HG2  . PRO A 1 63  ? 8.321   5.661   -5.133  1.00 0.00 ? 62  PRO A HG2  3  
ATOM 4773  H HG3  . PRO A 1 63  ? 7.368   7.040   -5.587  1.00 0.00 ? 62  PRO A HG3  3  
ATOM 4774  H HD2  . PRO A 1 63  ? 6.570   4.724   -4.338  1.00 0.00 ? 62  PRO A HD2  3  
ATOM 4775  H HD3  . PRO A 1 63  ? 5.473   5.977   -5.065  1.00 0.00 ? 62  PRO A HD3  3  
ATOM 4776  N N    . LEU A 1 64  ? 5.110   4.076   -9.690  1.00 0.00 ? 63  LEU A N    3  
ATOM 4777  C CA   . LEU A 1 64  ? 4.755   3.176   -10.788 1.00 0.00 ? 63  LEU A CA   3  
ATOM 4778  C C    . LEU A 1 64  ? 5.688   2.481   -11.781 1.00 0.00 ? 63  LEU A C    3  
ATOM 4779  O O    . LEU A 1 64  ? 5.218   1.920   -12.758 1.00 0.00 ? 63  LEU A O    3  
ATOM 4780  C CB   . LEU A 1 64  ? 3.533   3.840   -11.466 1.00 0.00 ? 63  LEU A CB   3  
ATOM 4781  C CG   . LEU A 1 64  ? 2.237   3.511   -10.702 1.00 0.00 ? 63  LEU A CG   3  
ATOM 4782  C CD1  . LEU A 1 64  ? 1.337   4.734   -10.464 1.00 0.00 ? 63  LEU A CD1  3  
ATOM 4783  C CD2  . LEU A 1 64  ? 1.538   2.388   -11.476 1.00 0.00 ? 63  LEU A CD2  3  
ATOM 4784  H H    . LEU A 1 64  ? 4.327   4.663   -9.493  1.00 0.00 ? 63  LEU A H    3  
ATOM 4785  H HA   . LEU A 1 64  ? 4.447   2.264   -10.285 1.00 0.00 ? 63  LEU A HA   3  
ATOM 4786  H HB2  . LEU A 1 64  ? 3.693   4.942   -11.475 1.00 0.00 ? 63  LEU A HB2  3  
ATOM 4787  H HB3  . LEU A 1 64  ? 3.394   3.526   -12.526 1.00 0.00 ? 63  LEU A HB3  3  
ATOM 4788  H HG   . LEU A 1 64  ? 2.496   3.107   -9.691  1.00 0.00 ? 63  LEU A HG   3  
ATOM 4789  H HD11 . LEU A 1 64  ? 1.089   5.237   -11.422 1.00 0.00 ? 63  LEU A HD11 3  
ATOM 4790  H HD12 . LEU A 1 64  ? 1.834   5.462   -9.783  1.00 0.00 ? 63  LEU A HD12 3  
ATOM 4791  H HD13 . LEU A 1 64  ? 0.396   4.421   -9.965  1.00 0.00 ? 63  LEU A HD13 3  
ATOM 4792  H HD21 . LEU A 1 64  ? 1.338   2.698   -12.522 1.00 0.00 ? 63  LEU A HD21 3  
ATOM 4793  H HD22 . LEU A 1 64  ? 0.584   2.086   -11.006 1.00 0.00 ? 63  LEU A HD22 3  
ATOM 4794  H HD23 . LEU A 1 64  ? 2.214   1.503   -11.511 1.00 0.00 ? 63  LEU A HD23 3  
ATOM 4795  N N    . ASP A 1 65  ? 7.006   2.448   -11.542 1.00 0.00 ? 64  ASP A N    3  
ATOM 4796  C CA   . ASP A 1 65  ? 7.991   1.644   -12.275 1.00 0.00 ? 64  ASP A CA   3  
ATOM 4797  C C    . ASP A 1 65  ? 9.199   1.514   -11.367 1.00 0.00 ? 64  ASP A C    3  
ATOM 4798  O O    . ASP A 1 65  ? 10.346  1.726   -11.748 1.00 0.00 ? 64  ASP A O    3  
ATOM 4799  C CB   . ASP A 1 65  ? 8.233   2.306   -13.637 1.00 0.00 ? 64  ASP A CB   3  
ATOM 4800  C CG   . ASP A 1 65  ? 9.119   1.515   -14.603 1.00 0.00 ? 64  ASP A CG   3  
ATOM 4801  O OD1  . ASP A 1 65  ? 8.792   0.330   -14.877 1.00 0.00 ? 64  ASP A OD1  3  
ATOM 4802  O OD2  . ASP A 1 65  ? 10.135  2.090   -15.077 1.00 0.00 ? 64  ASP A OD2  3  
ATOM 4803  H H    . ASP A 1 65  ? 7.282   2.913   -10.702 1.00 0.00 ? 64  ASP A H    3  
ATOM 4804  H HA   . ASP A 1 65  ? 7.613   0.652   -12.458 1.00 0.00 ? 64  ASP A HA   3  
ATOM 4805  H HB2  . ASP A 1 65  ? 7.191   2.329   -14.023 1.00 0.00 ? 64  ASP A HB2  3  
ATOM 4806  H HB3  . ASP A 1 65  ? 8.588   3.344   -13.499 1.00 0.00 ? 64  ASP A HB3  3  
ATOM 4807  N N    . THR A 1 66  ? 8.898   1.312   -10.064 1.00 0.00 ? 65  THR A N    3  
ATOM 4808  C CA   . THR A 1 66  ? 9.810   1.335   -8.956  1.00 0.00 ? 65  THR A CA   3  
ATOM 4809  C C    . THR A 1 66  ? 9.863   0.054   -8.285  1.00 0.00 ? 65  THR A C    3  
ATOM 4810  O O    . THR A 1 66  ? 8.918   -0.701  -8.215  1.00 0.00 ? 65  THR A O    3  
ATOM 4811  C CB   . THR A 1 66  ? 9.540   2.475   -7.980  1.00 0.00 ? 65  THR A CB   3  
ATOM 4812  O OG1  . THR A 1 66  ? 9.578   3.661   -8.749  1.00 0.00 ? 65  THR A OG1  3  
ATOM 4813  C CG2  . THR A 1 66  ? 10.545  2.753   -6.854  1.00 0.00 ? 65  THR A CG2  3  
ATOM 4814  H H    . THR A 1 66  ? 7.994   0.994   -9.797  1.00 0.00 ? 65  THR A H    3  
ATOM 4815  H HA   . THR A 1 66  ? 10.799  1.441   -9.347  1.00 0.00 ? 65  THR A HA   3  
ATOM 4816  H HB   . THR A 1 66  ? 8.505   2.321   -7.547  1.00 0.00 ? 65  THR A HB   3  
ATOM 4817  H HG1  . THR A 1 66  ? 8.641   3.747   -9.014  1.00 0.00 ? 65  THR A HG1  3  
ATOM 4818  H HG21 . THR A 1 66  ? 11.576  2.835   -7.258  1.00 0.00 ? 65  THR A HG21 3  
ATOM 4819  H HG22 . THR A 1 66  ? 10.506  1.961   -6.082  1.00 0.00 ? 65  THR A HG22 3  
ATOM 4820  H HG23 . THR A 1 66  ? 10.298  3.708   -6.342  1.00 0.00 ? 65  THR A HG23 3  
ATOM 4821  N N    . GLU A 1 67  ? 10.966  -0.102  -7.593  1.00 0.00 ? 66  GLU A N    3  
ATOM 4822  C CA   . GLU A 1 67  ? 11.354  -1.090  -6.617  1.00 0.00 ? 66  GLU A CA   3  
ATOM 4823  C C    . GLU A 1 67  ? 10.414  -1.033  -5.405  1.00 0.00 ? 66  GLU A C    3  
ATOM 4824  O O    . GLU A 1 67  ? 10.214  -0.002  -4.760  1.00 0.00 ? 66  GLU A O    3  
ATOM 4825  C CB   . GLU A 1 67  ? 12.838  -0.936  -6.201  1.00 0.00 ? 66  GLU A CB   3  
ATOM 4826  C CG   . GLU A 1 67  ? 13.397  -2.143  -5.420  1.00 0.00 ? 66  GLU A CG   3  
ATOM 4827  C CD   . GLU A 1 67  ? 14.856  -1.888  -5.049  1.00 0.00 ? 66  GLU A CD   3  
ATOM 4828  O OE1  . GLU A 1 67  ? 15.693  -1.761  -5.984  1.00 0.00 ? 66  GLU A OE1  3  
ATOM 4829  O OE2  . GLU A 1 67  ? 15.154  -1.819  -3.827  1.00 0.00 ? 66  GLU A OE2  3  
ATOM 4830  H H    . GLU A 1 67  ? 11.497  0.692   -7.746  1.00 0.00 ? 66  GLU A H    3  
ATOM 4831  H HA   . GLU A 1 67  ? 11.261  -2.055  -7.089  1.00 0.00 ? 66  GLU A HA   3  
ATOM 4832  H HB2  . GLU A 1 67  ? 13.438  -0.827  -7.134  1.00 0.00 ? 66  GLU A HB2  3  
ATOM 4833  H HB3  . GLU A 1 67  ? 12.978  -0.003  -5.613  1.00 0.00 ? 66  GLU A HB3  3  
ATOM 4834  H HG2  . GLU A 1 67  ? 12.808  -2.311  -4.493  1.00 0.00 ? 66  GLU A HG2  3  
ATOM 4835  H HG3  . GLU A 1 67  ? 13.329  -3.059  -6.046  1.00 0.00 ? 66  GLU A HG3  3  
ATOM 4836  N N    . VAL A 1 68  ? 9.795   -2.197  -5.206  1.00 0.00 ? 67  VAL A N    3  
ATOM 4837  C CA   . VAL A 1 68  ? 8.781   -2.645  -4.260  1.00 0.00 ? 67  VAL A CA   3  
ATOM 4838  C C    . VAL A 1 68  ? 8.908   -4.122  -4.201  1.00 0.00 ? 67  VAL A C    3  
ATOM 4839  O O    . VAL A 1 68  ? 9.764   -4.758  -4.801  1.00 0.00 ? 67  VAL A O    3  
ATOM 4840  C CB   . VAL A 1 68  ? 7.303   -2.244  -4.320  1.00 0.00 ? 67  VAL A CB   3  
ATOM 4841  C CG1  . VAL A 1 68  ? 6.926   -1.551  -3.000  1.00 0.00 ? 67  VAL A CG1  3  
ATOM 4842  C CG2  . VAL A 1 68  ? 7.002   -1.358  -5.531  1.00 0.00 ? 67  VAL A CG2  3  
ATOM 4843  H H    . VAL A 1 68  ? 10.083  -2.876  -5.891  1.00 0.00 ? 67  VAL A H    3  
ATOM 4844  H HA   . VAL A 1 68  ? 9.116   -2.360  -3.274  1.00 0.00 ? 67  VAL A HA   3  
ATOM 4845  H HB   . VAL A 1 68  ? 6.629   -3.136  -4.295  1.00 0.00 ? 67  VAL A HB   3  
ATOM 4846  H HG11 . VAL A 1 68  ? 7.175   -2.205  -2.131  1.00 0.00 ? 67  VAL A HG11 3  
ATOM 4847  H HG12 . VAL A 1 68  ? 5.832   -1.371  -2.949  1.00 0.00 ? 67  VAL A HG12 3  
ATOM 4848  H HG13 . VAL A 1 68  ? 7.461   -0.589  -2.908  1.00 0.00 ? 67  VAL A HG13 3  
ATOM 4849  H HG21 . VAL A 1 68  ? 5.955   -0.998  -5.475  1.00 0.00 ? 67  VAL A HG21 3  
ATOM 4850  H HG22 . VAL A 1 68  ? 7.162   -1.922  -6.475  1.00 0.00 ? 67  VAL A HG22 3  
ATOM 4851  H HG23 . VAL A 1 68  ? 7.658   -0.463  -5.548  1.00 0.00 ? 67  VAL A HG23 3  
ATOM 4852  N N    . THR A 1 69  ? 8.128   -4.713  -3.294  1.00 0.00 ? 68  THR A N    3  
ATOM 4853  C CA   . THR A 1 69  ? 8.267   -6.101  -2.974  1.00 0.00 ? 68  THR A CA   3  
ATOM 4854  C C    . THR A 1 69  ? 6.954   -6.829  -2.917  1.00 0.00 ? 68  THR A C    3  
ATOM 4855  O O    . THR A 1 69  ? 5.864   -6.285  -2.762  1.00 0.00 ? 68  THR A O    3  
ATOM 4856  C CB   . THR A 1 69  ? 9.168   -6.170  -1.736  1.00 0.00 ? 68  THR A CB   3  
ATOM 4857  O OG1  . THR A 1 69  ? 9.367   -7.459  -1.175  1.00 0.00 ? 68  THR A OG1  3  
ATOM 4858  C CG2  . THR A 1 69  ? 8.572   -5.260  -0.656  1.00 0.00 ? 68  THR A CG2  3  
ATOM 4859  H H    . THR A 1 69  ? 7.428   -4.201  -2.756  1.00 0.00 ? 68  THR A H    3  
ATOM 4860  H HA   . THR A 1 69  ? 8.714   -6.616  -3.804  1.00 0.00 ? 68  THR A HA   3  
ATOM 4861  H HB   . THR A 1 69  ? 10.171  -5.764  -2.013  1.00 0.00 ? 68  THR A HB   3  
ATOM 4862  H HG1  . THR A 1 69  ? 9.635   -8.088  -1.872  1.00 0.00 ? 68  THR A HG1  3  
ATOM 4863  H HG21 . THR A 1 69  ? 9.286   -5.126  0.181   1.00 0.00 ? 68  THR A HG21 3  
ATOM 4864  H HG22 . THR A 1 69  ? 7.668   -5.756  -0.266  1.00 0.00 ? 68  THR A HG22 3  
ATOM 4865  H HG23 . THR A 1 69  ? 8.251   -4.268  -1.076  1.00 0.00 ? 68  THR A HG23 3  
ATOM 4866  N N    . ALA A 1 70  ? 7.113   -8.149  -3.089  1.00 0.00 ? 69  ALA A N    3  
ATOM 4867  C CA   . ALA A 1 70  ? 6.109   -9.165  -3.132  1.00 0.00 ? 69  ALA A CA   3  
ATOM 4868  C C    . ALA A 1 70  ? 6.045   -9.882  -1.798  1.00 0.00 ? 69  ALA A C    3  
ATOM 4869  O O    . ALA A 1 70  ? 7.074   -10.201 -1.207  1.00 0.00 ? 69  ALA A O    3  
ATOM 4870  C CB   . ALA A 1 70  ? 6.587   -10.111 -4.239  1.00 0.00 ? 69  ALA A CB   3  
ATOM 4871  H H    . ALA A 1 70  ? 8.049   -8.487  -3.209  1.00 0.00 ? 69  ALA A H    3  
ATOM 4872  H HA   . ALA A 1 70  ? 5.137   -8.752  -3.369  1.00 0.00 ? 69  ALA A HA   3  
ATOM 4873  H HB1  . ALA A 1 70  ? 6.723   -9.518  -5.169  1.00 0.00 ? 69  ALA A HB1  3  
ATOM 4874  H HB2  . ALA A 1 70  ? 5.870   -10.935 -4.433  1.00 0.00 ? 69  ALA A HB2  3  
ATOM 4875  H HB3  . ALA A 1 70  ? 7.587   -10.527 -3.974  1.00 0.00 ? 69  ALA A HB3  3  
ATOM 4876  N N    . LEU A 1 71  ? 4.826   -10.170 -1.291  1.00 0.00 ? 70  LEU A N    3  
ATOM 4877  C CA   . LEU A 1 71  ? 4.637   -10.870 -0.025  1.00 0.00 ? 70  LEU A CA   3  
ATOM 4878  C C    . LEU A 1 71  ? 4.649   -12.384 -0.194  1.00 0.00 ? 70  LEU A C    3  
ATOM 4879  O O    . LEU A 1 71  ? 3.809   -13.001 -0.850  1.00 0.00 ? 70  LEU A O    3  
ATOM 4880  C CB   . LEU A 1 71  ? 3.339   -10.451 0.685   1.00 0.00 ? 70  LEU A CB   3  
ATOM 4881  C CG   . LEU A 1 71  ? 3.190   -10.691 2.223   1.00 0.00 ? 70  LEU A CG   3  
ATOM 4882  C CD1  . LEU A 1 71  ? 3.239   -12.134 2.732   1.00 0.00 ? 70  LEU A CD1  3  
ATOM 4883  C CD2  . LEU A 1 71  ? 4.186   -9.890  3.065   1.00 0.00 ? 70  LEU A CD2  3  
ATOM 4884  H H    . LEU A 1 71  ? 4.000   -9.898  -1.802  1.00 0.00 ? 70  LEU A H    3  
ATOM 4885  H HA   . LEU A 1 71  ? 5.440   -10.595 0.649   1.00 0.00 ? 70  LEU A HA   3  
ATOM 4886  H HB2  . LEU A 1 71  ? 3.209   -9.355  0.526   1.00 0.00 ? 70  LEU A HB2  3  
ATOM 4887  H HB3  . LEU A 1 71  ? 2.522   -10.959 0.143   1.00 0.00 ? 70  LEU A HB3  3  
ATOM 4888  H HG   . LEU A 1 71  ? 2.176   -10.310 2.467   1.00 0.00 ? 70  LEU A HG   3  
ATOM 4889  H HD11 . LEU A 1 71  ? 4.299   -12.453 2.780   1.00 0.00 ? 70  LEU A HD11 3  
ATOM 4890  H HD12 . LEU A 1 71  ? 2.657   -12.819 2.083   1.00 0.00 ? 70  LEU A HD12 3  
ATOM 4891  H HD13 . LEU A 1 71  ? 2.845   -12.180 3.768   1.00 0.00 ? 70  LEU A HD13 3  
ATOM 4892  H HD21 . LEU A 1 71  ? 3.977   -10.024 4.148   1.00 0.00 ? 70  LEU A HD21 3  
ATOM 4893  H HD22 . LEU A 1 71  ? 4.102   -8.817  2.814   1.00 0.00 ? 70  LEU A HD22 3  
ATOM 4894  H HD23 . LEU A 1 71  ? 5.219   -10.235 2.861   1.00 0.00 ? 70  LEU A HD23 3  
ATOM 4895  N N    . SER A 1 72  ? 5.661   -12.952 0.464   1.00 0.00 ? 71  SER A N    3  
ATOM 4896  C CA   . SER A 1 72  ? 5.999   -14.320 0.756   1.00 0.00 ? 71  SER A CA   3  
ATOM 4897  C C    . SER A 1 72  ? 6.477   -14.209 2.189   1.00 0.00 ? 71  SER A C    3  
ATOM 4898  O O    . SER A 1 72  ? 6.693   -13.102 2.667   1.00 0.00 ? 71  SER A O    3  
ATOM 4899  C CB   . SER A 1 72  ? 7.034   -14.950 -0.205  1.00 0.00 ? 71  SER A CB   3  
ATOM 4900  O OG   . SER A 1 72  ? 6.386   -15.310 -1.421  1.00 0.00 ? 71  SER A OG   3  
ATOM 4901  H H    . SER A 1 72  ? 6.204   -12.317 1.012   1.00 0.00 ? 71  SER A H    3  
ATOM 4902  H HA   . SER A 1 72  ? 5.097   -14.922 0.768   1.00 0.00 ? 71  SER A HA   3  
ATOM 4903  H HB2  . SER A 1 72  ? 7.848   -14.227 -0.426  1.00 0.00 ? 71  SER A HB2  3  
ATOM 4904  H HB3  . SER A 1 72  ? 7.481   -15.877 0.219   1.00 0.00 ? 71  SER A HB3  3  
ATOM 4905  H HG   . SER A 1 72  ? 5.890   -14.535 -1.714  1.00 0.00 ? 71  SER A HG   3  
ATOM 4906  N N    . GLU A 1 73  ? 6.647   -15.329 2.908   1.00 0.00 ? 72  GLU A N    3  
ATOM 4907  C CA   . GLU A 1 73  ? 7.200   -15.520 4.256   1.00 0.00 ? 72  GLU A CA   3  
ATOM 4908  C C    . GLU A 1 73  ? 8.442   -14.712 4.745   1.00 0.00 ? 72  GLU A C    3  
ATOM 4909  O O    . GLU A 1 73  ? 9.185   -14.103 3.981   1.00 0.00 ? 72  GLU A O    3  
ATOM 4910  C CB   . GLU A 1 73  ? 7.607   -17.014 4.385   1.00 0.00 ? 72  GLU A CB   3  
ATOM 4911  C CG   . GLU A 1 73  ? 7.446   -17.864 3.109   1.00 0.00 ? 72  GLU A CG   3  
ATOM 4912  C CD   . GLU A 1 73  ? 6.005   -18.290 2.833   1.00 0.00 ? 72  GLU A CD   3  
ATOM 4913  O OE1  . GLU A 1 73  ? 5.388   -18.912 3.738   1.00 0.00 ? 72  GLU A OE1  3  
ATOM 4914  O OE2  . GLU A 1 73  ? 5.506   -18.008 1.711   1.00 0.00 ? 72  GLU A OE2  3  
ATOM 4915  H H    . GLU A 1 73  ? 6.404   -16.185 2.462   1.00 0.00 ? 72  GLU A H    3  
ATOM 4916  H HA   . GLU A 1 73  ? 6.391   -15.310 4.943   1.00 0.00 ? 72  GLU A HA   3  
ATOM 4917  H HB2  . GLU A 1 73  ? 8.711   -17.120 4.536   1.00 0.00 ? 72  GLU A HB2  3  
ATOM 4918  H HB3  . GLU A 1 73  ? 7.100   -17.488 5.248   1.00 0.00 ? 72  GLU A HB3  3  
ATOM 4919  H HG2  . GLU A 1 73  ? 7.899   -17.276 2.268   1.00 0.00 ? 72  GLU A HG2  3  
ATOM 4920  H HG3  . GLU A 1 73  ? 8.060   -18.770 3.288   1.00 0.00 ? 72  GLU A HG3  3  
ATOM 4921  N N    . ASP A 1 74  ? 8.718   -14.801 6.072   1.00 0.00 ? 73  ASP A N    3  
ATOM 4922  C CA   . ASP A 1 74  ? 9.749   -14.106 6.864   1.00 0.00 ? 73  ASP A CA   3  
ATOM 4923  C C    . ASP A 1 74  ? 11.204  -14.051 6.383   1.00 0.00 ? 73  ASP A C    3  
ATOM 4924  O O    . ASP A 1 74  ? 11.840  -13.003 6.409   1.00 0.00 ? 73  ASP A O    3  
ATOM 4925  C CB   . ASP A 1 74  ? 9.675   -14.570 8.354   1.00 0.00 ? 73  ASP A CB   3  
ATOM 4926  C CG   . ASP A 1 74  ? 10.240  -13.546 9.352   1.00 0.00 ? 73  ASP A CG   3  
ATOM 4927  O OD1  . ASP A 1 74  ? 9.714   -12.401 9.386   1.00 0.00 ? 73  ASP A OD1  3  
ATOM 4928  O OD2  . ASP A 1 74  ? 11.201  -13.900 10.085  1.00 0.00 ? 73  ASP A OD2  3  
ATOM 4929  H H    . ASP A 1 74  ? 8.107   -15.387 6.598   1.00 0.00 ? 73  ASP A H    3  
ATOM 4930  H HA   . ASP A 1 74  ? 9.438   -13.084 6.816   1.00 0.00 ? 73  ASP A HA   3  
ATOM 4931  H HB2  . ASP A 1 74  ? 8.601   -14.716 8.612   1.00 0.00 ? 73  ASP A HB2  3  
ATOM 4932  H HB3  . ASP A 1 74  ? 10.177  -15.552 8.481   1.00 0.00 ? 73  ASP A HB3  3  
ATOM 4933  N N    . GLU A 1 75  ? 11.759  -15.192 5.940   1.00 0.00 ? 74  GLU A N    3  
ATOM 4934  C CA   . GLU A 1 75  ? 13.111  -15.344 5.417   1.00 0.00 ? 74  GLU A CA   3  
ATOM 4935  C C    . GLU A 1 75  ? 13.079  -15.612 3.910   1.00 0.00 ? 74  GLU A C    3  
ATOM 4936  O O    . GLU A 1 75  ? 14.062  -16.009 3.294   1.00 0.00 ? 74  GLU A O    3  
ATOM 4937  C CB   . GLU A 1 75  ? 13.773  -16.500 6.227   1.00 0.00 ? 74  GLU A CB   3  
ATOM 4938  C CG   . GLU A 1 75  ? 15.252  -16.798 5.923   1.00 0.00 ? 74  GLU A CG   3  
ATOM 4939  C CD   . GLU A 1 75  ? 15.808  -17.771 6.962   1.00 0.00 ? 74  GLU A CD   3  
ATOM 4940  O OE1  . GLU A 1 75  ? 15.311  -18.927 7.016   1.00 0.00 ? 74  GLU A OE1  3  
ATOM 4941  O OE2  . GLU A 1 75  ? 16.735  -17.369 7.715   1.00 0.00 ? 74  GLU A OE2  3  
ATOM 4942  H H    . GLU A 1 75  ? 11.215  -16.020 5.967   1.00 0.00 ? 74  GLU A H    3  
ATOM 4943  H HA   . GLU A 1 75  ? 13.693  -14.441 5.554   1.00 0.00 ? 74  GLU A HA   3  
ATOM 4944  H HB2  . GLU A 1 75  ? 13.698  -16.213 7.302   1.00 0.00 ? 74  GLU A HB2  3  
ATOM 4945  H HB3  . GLU A 1 75  ? 13.184  -17.434 6.092   1.00 0.00 ? 74  GLU A HB3  3  
ATOM 4946  H HG2  . GLU A 1 75  ? 15.337  -17.261 4.915   1.00 0.00 ? 74  GLU A HG2  3  
ATOM 4947  H HG3  . GLU A 1 75  ? 15.829  -15.850 5.936   1.00 0.00 ? 74  GLU A HG3  3  
ATOM 4948  N N    . TYR A 1 76  ? 11.885  -15.471 3.281   1.00 0.00 ? 75  TYR A N    3  
ATOM 4949  C CA   . TYR A 1 76  ? 11.633  -15.911 1.916   1.00 0.00 ? 75  TYR A CA   3  
ATOM 4950  C C    . TYR A 1 76  ? 11.197  -14.778 1.003   1.00 0.00 ? 75  TYR A C    3  
ATOM 4951  O O    . TYR A 1 76  ? 11.558  -14.774 -0.174  1.00 0.00 ? 75  TYR A O    3  
ATOM 4952  C CB   . TYR A 1 76  ? 10.582  -17.032 1.958   1.00 0.00 ? 75  TYR A CB   3  
ATOM 4953  C CG   . TYR A 1 76  ? 11.086  -18.279 2.648   1.00 0.00 ? 75  TYR A CG   3  
ATOM 4954  C CD1  . TYR A 1 76  ? 11.069  -18.421 4.033   1.00 0.00 ? 75  TYR A CD1  3  
ATOM 4955  C CD2  . TYR A 1 76  ? 11.545  -19.332 1.880   1.00 0.00 ? 75  TYR A CD2  3  
ATOM 4956  C CE1  . TYR A 1 76  ? 11.508  -19.597 4.619   1.00 0.00 ? 75  TYR A CE1  3  
ATOM 4957  C CE2  . TYR A 1 76  ? 11.978  -20.506 2.465   1.00 0.00 ? 75  TYR A CE2  3  
ATOM 4958  C CZ   . TYR A 1 76  ? 11.958  -20.640 3.836   1.00 0.00 ? 75  TYR A CZ   3  
ATOM 4959  O OH   . TYR A 1 76  ? 12.393  -21.842 4.436   1.00 0.00 ? 75  TYR A OH   3  
ATOM 4960  H H    . TYR A 1 76  ? 11.081  -15.140 3.774   1.00 0.00 ? 75  TYR A H    3  
ATOM 4961  H HA   . TYR A 1 76  ? 12.533  -16.305 1.457   1.00 0.00 ? 75  TYR A HA   3  
ATOM 4962  H HB2  . TYR A 1 76  ? 9.736   -16.651 2.555   1.00 0.00 ? 75  TYR A HB2  3  
ATOM 4963  H HB3  . TYR A 1 76  ? 10.232  -17.321 0.944   1.00 0.00 ? 75  TYR A HB3  3  
ATOM 4964  H HD1  . TYR A 1 76  ? 10.727  -17.597 4.659   1.00 0.00 ? 75  TYR A HD1  3  
ATOM 4965  H HD2  . TYR A 1 76  ? 11.556  -19.238 0.801   1.00 0.00 ? 75  TYR A HD2  3  
ATOM 4966  H HE1  . TYR A 1 76  ? 11.497  -19.706 5.697   1.00 0.00 ? 75  TYR A HE1  3  
ATOM 4967  H HE2  . TYR A 1 76  ? 12.328  -21.313 1.837   1.00 0.00 ? 75  TYR A HE2  3  
ATOM 4968  H HH   . TYR A 1 76  ? 12.652  -22.447 3.736   1.00 0.00 ? 75  TYR A HH   3  
ATOM 4969  N N    . PHE A 1 77  ? 10.446  -13.755 1.518   1.00 0.00 ? 76  PHE A N    3  
ATOM 4970  C CA   . PHE A 1 77  ? 10.074  -12.537 0.713   1.00 0.00 ? 76  PHE A CA   3  
ATOM 4971  C C    . PHE A 1 77  ? 11.210  -11.731 0.014   1.00 0.00 ? 76  PHE A C    3  
ATOM 4972  O O    . PHE A 1 77  ? 12.328  -11.577 0.508   1.00 0.00 ? 76  PHE A O    3  
ATOM 4973  C CB   . PHE A 1 77  ? 9.167   -11.472 1.438   1.00 0.00 ? 76  PHE A CB   3  
ATOM 4974  C CG   . PHE A 1 77  ? 9.475   -11.109 2.883   1.00 0.00 ? 76  PHE A CG   3  
ATOM 4975  C CD1  . PHE A 1 77  ? 10.744  -11.031 3.438   1.00 0.00 ? 76  PHE A CD1  3  
ATOM 4976  C CD2  . PHE A 1 77  ? 8.404   -10.769 3.691   1.00 0.00 ? 76  PHE A CD2  3  
ATOM 4977  C CE1  . PHE A 1 77  ? 10.919  -10.638 4.754   1.00 0.00 ? 76  PHE A CE1  3  
ATOM 4978  C CE2  . PHE A 1 77  ? 8.565   -10.412 5.010   1.00 0.00 ? 76  PHE A CE2  3  
ATOM 4979  C CZ   . PHE A 1 77  ? 9.832   -10.338 5.552   1.00 0.00 ? 76  PHE A CZ   3  
ATOM 4980  H H    . PHE A 1 77  ? 10.025  -13.934 2.440   1.00 0.00 ? 76  PHE A H    3  
ATOM 4981  H HA   . PHE A 1 77  ? 9.474   -12.912 -0.104  1.00 0.00 ? 76  PHE A HA   3  
ATOM 4982  H HB2  . PHE A 1 77  ? 9.070   -10.509 0.878   1.00 0.00 ? 76  PHE A HB2  3  
ATOM 4983  H HB3  . PHE A 1 77  ? 8.154   -11.903 1.432   1.00 0.00 ? 76  PHE A HB3  3  
ATOM 4984  H HD1  . PHE A 1 77  ? 11.620  -11.266 2.853   1.00 0.00 ? 76  PHE A HD1  3  
ATOM 4985  H HD2  . PHE A 1 77  ? 7.408   -10.803 3.274   1.00 0.00 ? 76  PHE A HD2  3  
ATOM 4986  H HE1  . PHE A 1 77  ? 11.918  -10.599 5.171   1.00 0.00 ? 76  PHE A HE1  3  
ATOM 4987  H HE2  . PHE A 1 77  ? 7.691   -10.179 5.604   1.00 0.00 ? 76  PHE A HE2  3  
ATOM 4988  H HZ   . PHE A 1 77  ? 9.968   -10.044 6.585   1.00 0.00 ? 76  PHE A HZ   3  
ATOM 4989  N N    . SER A 1 78  ? 10.896  -11.265 -1.228  1.00 0.00 ? 77  SER A N    3  
ATOM 4990  C CA   . SER A 1 78  ? 11.882  -10.668 -2.143  1.00 0.00 ? 77  SER A CA   3  
ATOM 4991  C C    . SER A 1 78  ? 11.299  -9.485  -2.890  1.00 0.00 ? 77  SER A C    3  
ATOM 4992  O O    . SER A 1 78  ? 10.081  -9.294  -2.938  1.00 0.00 ? 77  SER A O    3  
ATOM 4993  C CB   . SER A 1 78  ? 12.547  -11.726 -3.097  1.00 0.00 ? 77  SER A CB   3  
ATOM 4994  O OG   . SER A 1 78  ? 13.569  -11.200 -3.962  1.00 0.00 ? 77  SER A OG   3  
ATOM 4995  H H    . SER A 1 78  ? 9.940   -11.355 -1.559  1.00 0.00 ? 77  SER A H    3  
ATOM 4996  H HA   . SER A 1 78  ? 12.685  -10.237 -1.555  1.00 0.00 ? 77  SER A HA   3  
ATOM 4997  H HB2  . SER A 1 78  ? 13.020  -12.499 -2.451  1.00 0.00 ? 77  SER A HB2  3  
ATOM 4998  H HB3  . SER A 1 78  ? 11.772  -12.248 -3.698  1.00 0.00 ? 77  SER A HB3  3  
ATOM 4999  H HG   . SER A 1 78  ? 13.114  -10.732 -4.675  1.00 0.00 ? 77  SER A HG   3  
ATOM 5000  N N    . ALA A 1 79  ? 12.180  -8.618  -3.466  1.00 0.00 ? 78  ALA A N    3  
ATOM 5001  C CA   . ALA A 1 79  ? 11.803  -7.432  -4.235  1.00 0.00 ? 78  ALA A CA   3  
ATOM 5002  C C    . ALA A 1 79  ? 11.637  -7.637  -5.749  1.00 0.00 ? 78  ALA A C    3  
ATOM 5003  O O    . ALA A 1 79  ? 12.123  -8.597  -6.346  1.00 0.00 ? 78  ALA A O    3  
ATOM 5004  C CB   . ALA A 1 79  ? 12.664  -6.185  -3.912  1.00 0.00 ? 78  ALA A CB   3  
ATOM 5005  H H    . ALA A 1 79  ? 13.158  -8.809  -3.386  1.00 0.00 ? 78  ALA A H    3  
ATOM 5006  H HA   . ALA A 1 79  ? 10.826  -7.153  -3.901  1.00 0.00 ? 78  ALA A HA   3  
ATOM 5007  H HB1  . ALA A 1 79  ? 13.717  -6.320  -4.236  1.00 0.00 ? 78  ALA A HB1  3  
ATOM 5008  H HB2  . ALA A 1 79  ? 12.640  -5.996  -2.819  1.00 0.00 ? 78  ALA A HB2  3  
ATOM 5009  H HB3  . ALA A 1 79  ? 12.251  -5.262  -4.384  1.00 0.00 ? 78  ALA A HB3  3  
ATOM 5010  N N    . GLY A 1 80  ? 10.865  -6.694  -6.341  1.00 0.00 ? 79  GLY A N    3  
ATOM 5011  C CA   . GLY A 1 80  ? 10.388  -6.582  -7.704  1.00 0.00 ? 79  GLY A CA   3  
ATOM 5012  C C    . GLY A 1 80  ? 9.998   -5.162  -7.957  1.00 0.00 ? 79  GLY A C    3  
ATOM 5013  O O    . GLY A 1 80  ? 10.397  -4.213  -7.288  1.00 0.00 ? 79  GLY A O    3  
ATOM 5014  H H    . GLY A 1 80  ? 10.509  -5.946  -5.756  1.00 0.00 ? 79  GLY A H    3  
ATOM 5015  H HA2  . GLY A 1 80  ? 11.228  -6.811  -8.385  1.00 0.00 ? 79  GLY A HA2  3  
ATOM 5016  H HA3  . GLY A 1 80  ? 9.448   -7.112  -7.827  1.00 0.00 ? 79  GLY A HA3  3  
ATOM 5017  N N    . VAL A 1 81  ? 9.257   -4.951  -9.041  1.00 0.00 ? 80  VAL A N    3  
ATOM 5018  C CA   . VAL A 1 81  ? 8.833   -3.649  -9.478  1.00 0.00 ? 80  VAL A CA   3  
ATOM 5019  C C    . VAL A 1 81  ? 7.340   -3.528  -9.468  1.00 0.00 ? 80  VAL A C    3  
ATOM 5020  O O    . VAL A 1 81  ? 6.626   -4.470  -9.763  1.00 0.00 ? 80  VAL A O    3  
ATOM 5021  C CB   . VAL A 1 81  ? 9.460   -3.487  -10.859 1.00 0.00 ? 80  VAL A CB   3  
ATOM 5022  C CG1  . VAL A 1 81  ? 8.812   -2.450  -11.800 1.00 0.00 ? 80  VAL A CG1  3  
ATOM 5023  C CG2  . VAL A 1 81  ? 10.887  -3.036  -10.559 1.00 0.00 ? 80  VAL A CG2  3  
ATOM 5024  H H    . VAL A 1 81  ? 8.988   -5.726  -9.626  1.00 0.00 ? 80  VAL A H    3  
ATOM 5025  H HA   . VAL A 1 81  ? 9.153   -2.869  -8.804  1.00 0.00 ? 80  VAL A HA   3  
ATOM 5026  H HB   . VAL A 1 81  ? 9.496   -4.509  -11.332 1.00 0.00 ? 80  VAL A HB   3  
ATOM 5027  H HG11 . VAL A 1 81  ? 9.420   -2.332  -12.722 1.00 0.00 ? 80  VAL A HG11 3  
ATOM 5028  H HG12 . VAL A 1 81  ? 8.745   -1.454  -11.307 1.00 0.00 ? 80  VAL A HG12 3  
ATOM 5029  H HG13 . VAL A 1 81  ? 7.794   -2.762  -12.104 1.00 0.00 ? 80  VAL A HG13 3  
ATOM 5030  H HG21 . VAL A 1 81  ? 11.360  -3.767  -9.861  1.00 0.00 ? 80  VAL A HG21 3  
ATOM 5031  H HG22 . VAL A 1 81  ? 10.827  -2.027  -10.086 1.00 0.00 ? 80  VAL A HG22 3  
ATOM 5032  H HG23 . VAL A 1 81  ? 11.472  -2.959  -11.494 1.00 0.00 ? 80  VAL A HG23 3  
ATOM 5033  N N    . VAL A 1 82  ? 6.822   -2.312  -9.179  1.00 0.00 ? 81  VAL A N    3  
ATOM 5034  C CA   . VAL A 1 82  ? 5.441   -1.901  -9.369  1.00 0.00 ? 81  VAL A CA   3  
ATOM 5035  C C    . VAL A 1 82  ? 5.434   -1.319  -10.768 1.00 0.00 ? 81  VAL A C    3  
ATOM 5036  O O    . VAL A 1 82  ? 6.351   -0.543  -11.061 1.00 0.00 ? 81  VAL A O    3  
ATOM 5037  C CB   . VAL A 1 82  ? 5.020   -0.818  -8.349  1.00 0.00 ? 81  VAL A CB   3  
ATOM 5038  C CG1  . VAL A 1 82  ? 5.841   0.485   -8.407  1.00 0.00 ? 81  VAL A CG1  3  
ATOM 5039  C CG2  . VAL A 1 82  ? 3.590   -0.297  -8.485  1.00 0.00 ? 81  VAL A CG2  3  
ATOM 5040  H H    . VAL A 1 82  ? 7.460   -1.569  -8.913  1.00 0.00 ? 81  VAL A H    3  
ATOM 5041  H HA   . VAL A 1 82  ? 4.809   -2.789  -9.366  1.00 0.00 ? 81  VAL A HA   3  
ATOM 5042  H HB   . VAL A 1 82  ? 5.101   -1.273  -7.339  1.00 0.00 ? 81  VAL A HB   3  
ATOM 5043  H HG11 . VAL A 1 82  ? 5.878   0.916   -9.444  1.00 0.00 ? 81  VAL A HG11 3  
ATOM 5044  H HG12 . VAL A 1 82  ? 6.864   0.355   -8.035  1.00 0.00 ? 81  VAL A HG12 3  
ATOM 5045  H HG13 . VAL A 1 82  ? 5.303   1.239   -7.785  1.00 0.00 ? 81  VAL A HG13 3  
ATOM 5046  H HG21 . VAL A 1 82  ? 2.856   -1.119  -8.532  1.00 0.00 ? 81  VAL A HG21 3  
ATOM 5047  H HG22 . VAL A 1 82  ? 3.558   0.358   -9.389  1.00 0.00 ? 81  VAL A HG22 3  
ATOM 5048  H HG23 . VAL A 1 82  ? 3.398   0.342   -7.579  1.00 0.00 ? 81  VAL A HG23 3  
ATOM 5049  N N    . LYS A 1 83  ? 4.455   -1.724  -11.623 1.00 0.00 ? 82  LYS A N    3  
ATOM 5050  C CA   . LYS A 1 83  ? 4.344   -1.259  -13.002 1.00 0.00 ? 82  LYS A CA   3  
ATOM 5051  C C    . LYS A 1 83  ? 3.028   -0.554  -13.251 1.00 0.00 ? 82  LYS A C    3  
ATOM 5052  O O    . LYS A 1 83  ? 2.953   0.477   -13.911 1.00 0.00 ? 82  LYS A O    3  
ATOM 5053  C CB   . LYS A 1 83  ? 4.347   -2.452  -14.011 1.00 0.00 ? 82  LYS A CB   3  
ATOM 5054  C CG   . LYS A 1 83  ? 5.659   -3.246  -14.114 1.00 0.00 ? 82  LYS A CG   3  
ATOM 5055  C CD   . LYS A 1 83  ? 6.804   -2.457  -14.780 1.00 0.00 ? 82  LYS A CD   3  
ATOM 5056  C CE   . LYS A 1 83  ? 6.620   -2.165  -16.277 1.00 0.00 ? 82  LYS A CE   3  
ATOM 5057  N NZ   . LYS A 1 83  ? 6.511   -3.416  -17.060 1.00 0.00 ? 82  LYS A NZ   3  
ATOM 5058  H H    . LYS A 1 83  ? 3.786   -2.416  -11.334 1.00 0.00 ? 82  LYS A H    3  
ATOM 5059  H HA   . LYS A 1 83  ? 5.117   -0.521  -13.193 1.00 0.00 ? 82  LYS A HA   3  
ATOM 5060  H HB2  . LYS A 1 83  ? 3.544   -3.159  -13.694 1.00 0.00 ? 82  LYS A HB2  3  
ATOM 5061  H HB3  . LYS A 1 83  ? 4.100   -2.115  -15.046 1.00 0.00 ? 82  LYS A HB3  3  
ATOM 5062  H HG2  . LYS A 1 83  ? 5.971   -3.563  -13.095 1.00 0.00 ? 82  LYS A HG2  3  
ATOM 5063  H HG3  . LYS A 1 83  ? 5.475   -4.178  -14.693 1.00 0.00 ? 82  LYS A HG3  3  
ATOM 5064  H HD2  . LYS A 1 83  ? 6.939   -1.489  -14.247 1.00 0.00 ? 82  LYS A HD2  3  
ATOM 5065  H HD3  . LYS A 1 83  ? 7.743   -3.040  -14.652 1.00 0.00 ? 82  LYS A HD3  3  
ATOM 5066  H HE2  . LYS A 1 83  ? 5.705   -1.567  -16.460 1.00 0.00 ? 82  LYS A HE2  3  
ATOM 5067  H HE3  . LYS A 1 83  ? 7.498   -1.606  -16.664 1.00 0.00 ? 82  LYS A HE3  3  
ATOM 5068  H HZ1  . LYS A 1 83  ? 6.388   -3.187  -18.067 1.00 0.00 ? 82  LYS A HZ1  3  
ATOM 5069  H HZ2  . LYS A 1 83  ? 5.691   -3.962  -16.726 1.00 0.00 ? 82  LYS A HZ2  3  
ATOM 5070  H HZ3  . LYS A 1 83  ? 7.376   -3.981  -16.936 1.00 0.00 ? 82  LYS A HZ3  3  
ATOM 5071  N N    . GLY A 1 84  ? 1.915   -1.167  -12.797 1.00 0.00 ? 83  GLY A N    3  
ATOM 5072  C CA   . GLY A 1 84  ? 0.580   -0.698  -13.149 1.00 0.00 ? 83  GLY A CA   3  
ATOM 5073  C C    . GLY A 1 84  ? -0.437  -1.391  -12.300 1.00 0.00 ? 83  GLY A C    3  
ATOM 5074  O O    . GLY A 1 84  ? -0.261  -2.554  -11.915 1.00 0.00 ? 83  GLY A O    3  
ATOM 5075  H H    . GLY A 1 84  ? 1.955   -2.026  -12.290 1.00 0.00 ? 83  GLY A H    3  
ATOM 5076  H HA2  . GLY A 1 84  ? 0.502   0.366   -12.966 1.00 0.00 ? 83  GLY A HA2  3  
ATOM 5077  H HA3  . GLY A 1 84  ? 0.384   -0.977  -14.176 1.00 0.00 ? 83  GLY A HA3  3  
ATOM 5078  N N    . HIS A 1 85  ? -1.550  -0.689  -11.975 1.00 0.00 ? 84  HIS A N    3  
ATOM 5079  C CA   . HIS A 1 85  ? -2.594  -1.211  -11.109 1.00 0.00 ? 84  HIS A CA   3  
ATOM 5080  C C    . HIS A 1 85  ? -4.020  -0.888  -11.490 1.00 0.00 ? 84  HIS A C    3  
ATOM 5081  O O    . HIS A 1 85  ? -4.332  0.142   -12.094 1.00 0.00 ? 84  HIS A O    3  
ATOM 5082  C CB   . HIS A 1 85  ? -2.321  -0.894  -9.614  1.00 0.00 ? 84  HIS A CB   3  
ATOM 5083  C CG   . HIS A 1 85  ? -1.387  0.257   -9.313  1.00 0.00 ? 84  HIS A CG   3  
ATOM 5084  N ND1  . HIS A 1 85  ? -1.725  1.576   -9.078  1.00 0.00 ? 84  HIS A ND1  3  
ATOM 5085  C CD2  . HIS A 1 85  ? -0.063  0.168   -9.024  1.00 0.00 ? 84  HIS A CD2  3  
ATOM 5086  C CE1  . HIS A 1 85  ? -0.597  2.202   -8.650  1.00 0.00 ? 84  HIS A CE1  3  
ATOM 5087  N NE2  . HIS A 1 85  ? 0.423   1.379   -8.575  1.00 0.00 ? 84  HIS A NE2  3  
ATOM 5088  H H    . HIS A 1 85  ? -1.689  0.247   -12.286 1.00 0.00 ? 84  HIS A H    3  
ATOM 5089  H HA   . HIS A 1 85  ? -2.613  -2.280  -11.238 1.00 0.00 ? 84  HIS A HA   3  
ATOM 5090  H HB2  . HIS A 1 85  ? -3.237  -0.809  -8.990  1.00 0.00 ? 84  HIS A HB2  3  
ATOM 5091  H HB3  . HIS A 1 85  ? -1.760  -1.775  -9.228  1.00 0.00 ? 84  HIS A HB3  3  
ATOM 5092  H HD1  . HIS A 1 85  ? -2.640  1.978   -9.125  1.00 0.00 ? 84  HIS A HD1  3  
ATOM 5093  H HD2  . HIS A 1 85  ? 0.583   -0.699  -9.066  1.00 0.00 ? 84  HIS A HD2  3  
ATOM 5094  H HE1  . HIS A 1 85  ? -0.478  3.268   -8.450  1.00 0.00 ? 84  HIS A HE1  3  
ATOM 5095  N N    . ARG A 1 86  ? -4.923  -1.847  -11.115 1.00 0.00 ? 85  ARG A N    3  
ATOM 5096  C CA   . ARG A 1 86  ? -6.333  -1.791  -11.433 1.00 0.00 ? 85  ARG A CA   3  
ATOM 5097  C C    . ARG A 1 86  ? -7.116  -2.029  -10.179 1.00 0.00 ? 85  ARG A C    3  
ATOM 5098  O O    . ARG A 1 86  ? -6.638  -2.674  -9.242  1.00 0.00 ? 85  ARG A O    3  
ATOM 5099  C CB   . ARG A 1 86  ? -6.729  -2.948  -12.428 1.00 0.00 ? 85  ARG A CB   3  
ATOM 5100  C CG   . ARG A 1 86  ? -7.298  -4.255  -11.790 1.00 0.00 ? 85  ARG A CG   3  
ATOM 5101  C CD   . ARG A 1 86  ? -7.695  -5.366  -12.763 1.00 0.00 ? 85  ARG A CD   3  
ATOM 5102  N NE   . ARG A 1 86  ? -6.507  -5.877  -13.529 1.00 0.00 ? 85  ARG A NE   3  
ATOM 5103  C CZ   . ARG A 1 86  ? -6.648  -6.651  -14.652 1.00 0.00 ? 85  ARG A CZ   3  
ATOM 5104  N NH1  . ARG A 1 86  ? -7.887  -6.977  -15.125 1.00 0.00 ? 85  ARG A NH1  3  
ATOM 5105  N NH2  . ARG A 1 86  ? -5.543  -7.119  -15.300 1.00 0.00 ? 85  ARG A NH2  3  
ATOM 5106  H H    . ARG A 1 86  ? -4.665  -2.690  -10.588 1.00 0.00 ? 85  ARG A H    3  
ATOM 5107  H HA   . ARG A 1 86  ? -6.614  -0.826  -11.838 1.00 0.00 ? 85  ARG A HA   3  
ATOM 5108  H HB2  . ARG A 1 86  ? -7.501  -2.558  -13.131 1.00 0.00 ? 85  ARG A HB2  3  
ATOM 5109  H HB3  . ARG A 1 86  ? -5.831  -3.207  -13.036 1.00 0.00 ? 85  ARG A HB3  3  
ATOM 5110  H HG2  . ARG A 1 86  ? -6.656  -4.550  -10.917 1.00 0.00 ? 85  ARG A HG2  3  
ATOM 5111  H HG3  . ARG A 1 86  ? -8.301  -4.026  -11.352 1.00 0.00 ? 85  ARG A HG3  3  
ATOM 5112  H HD2  . ARG A 1 86  ? -8.152  -6.188  -12.161 1.00 0.00 ? 85  ARG A HD2  3  
ATOM 5113  H HD3  . ARG A 1 86  ? -8.455  -4.961  -13.471 1.00 0.00 ? 85  ARG A HD3  3  
ATOM 5114  H HE   . ARG A 1 86  ? -5.588  -5.658  -13.202 1.00 0.00 ? 85  ARG A HE   3  
ATOM 5115  H HH11 . ARG A 1 86  ? -8.705  -6.645  -14.655 1.00 0.00 ? 85  ARG A HH11 3  
ATOM 5116  H HH12 . ARG A 1 86  ? -7.977  -7.545  -15.944 1.00 0.00 ? 85  ARG A HH12 3  
ATOM 5117  H HH21 . ARG A 1 86  ? -4.631  -6.893  -14.960 1.00 0.00 ? 85  ARG A HH21 3  
ATOM 5118  H HH22 . ARG A 1 86  ? -5.646  -7.691  -16.114 1.00 0.00 ? 85  ARG A HH22 3  
ATOM 5119  N N    . LYS A 1 87  ? -8.407  -1.653  -10.198 1.00 0.00 ? 86  LYS A N    3  
ATOM 5120  C CA   . LYS A 1 87  ? -9.361  -2.208  -9.275  1.00 0.00 ? 86  LYS A CA   3  
ATOM 5121  C C    . LYS A 1 87  ? -10.613 -2.478  -10.082 1.00 0.00 ? 86  LYS A C    3  
ATOM 5122  O O    . LYS A 1 87  ? -11.010 -1.676  -10.929 1.00 0.00 ? 86  LYS A O    3  
ATOM 5123  C CB   . LYS A 1 87  ? -9.491  -1.259  -8.082  1.00 0.00 ? 86  LYS A CB   3  
ATOM 5124  C CG   . LYS A 1 87  ? -10.727 -1.388  -7.179  1.00 0.00 ? 86  LYS A CG   3  
ATOM 5125  C CD   . LYS A 1 87  ? -10.624 -0.455  -5.959  1.00 0.00 ? 86  LYS A CD   3  
ATOM 5126  C CE   . LYS A 1 87  ? -11.699 -0.713  -4.893  1.00 0.00 ? 86  LYS A CE   3  
ATOM 5127  N NZ   . LYS A 1 87  ? -13.060 -0.481  -5.430  1.00 0.00 ? 86  LYS A NZ   3  
ATOM 5128  H H    . LYS A 1 87  ? -8.823  -1.155  -10.962 1.00 0.00 ? 86  LYS A H    3  
ATOM 5129  H HA   . LYS A 1 87  ? -9.033  -3.199  -8.914  1.00 0.00 ? 86  LYS A HA   3  
ATOM 5130  H HB2  . LYS A 1 87  ? -8.558  -1.482  -7.509  1.00 0.00 ? 86  LYS A HB2  3  
ATOM 5131  H HB3  . LYS A 1 87  ? -9.403  -0.219  -8.460  1.00 0.00 ? 86  LYS A HB3  3  
ATOM 5132  H HG2  . LYS A 1 87  ? -11.644 -1.121  -7.750  1.00 0.00 ? 86  LYS A HG2  3  
ATOM 5133  H HG3  . LYS A 1 87  ? -10.839 -2.440  -6.835  1.00 0.00 ? 86  LYS A HG3  3  
ATOM 5134  H HD2  . LYS A 1 87  ? -9.629  -0.603  -5.484  1.00 0.00 ? 86  LYS A HD2  3  
ATOM 5135  H HD3  . LYS A 1 87  ? -10.674 0.605   -6.291  1.00 0.00 ? 86  LYS A HD3  3  
ATOM 5136  H HE2  . LYS A 1 87  ? -11.649 -1.765  -4.539  1.00 0.00 ? 86  LYS A HE2  3  
ATOM 5137  H HE3  . LYS A 1 87  ? -11.556 -0.029  -4.030  1.00 0.00 ? 86  LYS A HE3  3  
ATOM 5138  H HZ1  . LYS A 1 87  ? -13.762 -0.659  -4.685  1.00 0.00 ? 86  LYS A HZ1  3  
ATOM 5139  H HZ2  . LYS A 1 87  ? -13.231 -1.126  -6.229  1.00 0.00 ? 86  LYS A HZ2  3  
ATOM 5140  H HZ3  . LYS A 1 87  ? -13.141 0.502   -5.756  1.00 0.00 ? 86  LYS A HZ3  3  
ATOM 5141  N N    . GLU A 1 88  ? -11.276 -3.625  -9.810  1.00 0.00 ? 87  GLU A N    3  
ATOM 5142  C CA   . GLU A 1 88  ? -12.538 -4.064  -10.384 1.00 0.00 ? 87  GLU A CA   3  
ATOM 5143  C C    . GLU A 1 88  ? -13.537 -4.133  -9.226  1.00 0.00 ? 87  GLU A C    3  
ATOM 5144  O O    . GLU A 1 88  ? -13.123 -4.213  -8.068  1.00 0.00 ? 87  GLU A O    3  
ATOM 5145  C CB   . GLU A 1 88  ? -12.355 -5.462  -11.032 1.00 0.00 ? 87  GLU A CB   3  
ATOM 5146  C CG   . GLU A 1 88  ? -13.469 -5.894  -12.002 1.00 0.00 ? 87  GLU A CG   3  
ATOM 5147  C CD   . GLU A 1 88  ? -13.135 -7.274  -12.570 1.00 0.00 ? 87  GLU A CD   3  
ATOM 5148  O OE1  . GLU A 1 88  ? -12.090 -7.393  -13.264 1.00 0.00 ? 87  GLU A OE1  3  
ATOM 5149  O OE2  . GLU A 1 88  ? -13.919 -8.227  -12.315 1.00 0.00 ? 87  GLU A OE2  3  
ATOM 5150  H H    . GLU A 1 88  ? -10.924 -4.280  -9.117  1.00 0.00 ? 87  GLU A H    3  
ATOM 5151  H HA   . GLU A 1 88  ? -12.900 -3.352  -11.118 1.00 0.00 ? 87  GLU A HA   3  
ATOM 5152  H HB2  . GLU A 1 88  ? -11.389 -5.465  -11.585 1.00 0.00 ? 87  GLU A HB2  3  
ATOM 5153  H HB3  . GLU A 1 88  ? -12.244 -6.219  -10.230 1.00 0.00 ? 87  GLU A HB3  3  
ATOM 5154  H HG2  . GLU A 1 88  ? -14.443 -5.940  -11.473 1.00 0.00 ? 87  GLU A HG2  3  
ATOM 5155  H HG3  . GLU A 1 88  ? -13.551 -5.163  -12.833 1.00 0.00 ? 87  GLU A HG3  3  
ATOM 5156  N N    . SER A 1 89  ? -14.878 -4.138  -9.480  1.00 0.00 ? 88  SER A N    3  
ATOM 5157  C CA   . SER A 1 89  ? -15.973 -4.248  -8.492  1.00 0.00 ? 88  SER A CA   3  
ATOM 5158  C C    . SER A 1 89  ? -16.019 -5.569  -7.683  1.00 0.00 ? 88  SER A C    3  
ATOM 5159  O O    . SER A 1 89  ? -16.969 -6.343  -7.781  1.00 0.00 ? 88  SER A O    3  
ATOM 5160  C CB   . SER A 1 89  ? -17.355 -4.011  -9.195  1.00 0.00 ? 88  SER A CB   3  
ATOM 5161  O OG   . SER A 1 89  ? -18.470 -3.951  -8.297  1.00 0.00 ? 88  SER A OG   3  
ATOM 5162  H H    . SER A 1 89  ? -15.175 -4.086  -10.428 1.00 0.00 ? 88  SER A H    3  
ATOM 5163  H HA   . SER A 1 89  ? -15.847 -3.449  -7.774  1.00 0.00 ? 88  SER A HA   3  
ATOM 5164  H HB2  . SER A 1 89  ? -17.309 -3.040  -9.735  1.00 0.00 ? 88  SER A HB2  3  
ATOM 5165  H HB3  . SER A 1 89  ? -17.536 -4.806  -9.952  1.00 0.00 ? 88  SER A HB3  3  
ATOM 5166  H HG   . SER A 1 89  ? -18.475 -4.816  -7.858  1.00 0.00 ? 88  SER A HG   3  
ATOM 5167  N N    . GLY A 1 90  ? -14.977 -5.808  -6.850  1.00 0.00 ? 89  GLY A N    3  
ATOM 5168  C CA   . GLY A 1 90  ? -14.769 -6.967  -5.995  1.00 0.00 ? 89  GLY A CA   3  
ATOM 5169  C C    . GLY A 1 90  ? -13.549 -7.768  -6.375  1.00 0.00 ? 89  GLY A C    3  
ATOM 5170  O O    . GLY A 1 90  ? -13.400 -8.895  -5.921  1.00 0.00 ? 89  GLY A O    3  
ATOM 5171  H H    . GLY A 1 90  ? -14.246 -5.118  -6.855  1.00 0.00 ? 89  GLY A H    3  
ATOM 5172  H HA2  . GLY A 1 90  ? -14.602 -6.598  -4.994  1.00 0.00 ? 89  GLY A HA2  3  
ATOM 5173  H HA3  . GLY A 1 90  ? -15.614 -7.641  -6.053  1.00 0.00 ? 89  GLY A HA3  3  
ATOM 5174  N N    . GLU A 1 91  ? -12.628 -7.228  -7.229  1.00 0.00 ? 90  GLU A N    3  
ATOM 5175  C CA   . GLU A 1 91  ? -11.400 -7.881  -7.621  1.00 0.00 ? 90  GLU A CA   3  
ATOM 5176  C C    . GLU A 1 91  ? -10.337 -6.788  -7.658  1.00 0.00 ? 90  GLU A C    3  
ATOM 5177  O O    . GLU A 1 91  ? -10.609 -5.645  -8.016  1.00 0.00 ? 90  GLU A O    3  
ATOM 5178  C CB   . GLU A 1 91  ? -11.599 -8.687  -8.924  1.00 0.00 ? 90  GLU A CB   3  
ATOM 5179  C CG   . GLU A 1 91  ? -10.318 -9.385  -9.367  1.00 0.00 ? 90  GLU A CG   3  
ATOM 5180  C CD   . GLU A 1 91  ? -10.620 -10.406 -10.460 1.00 0.00 ? 90  GLU A CD   3  
ATOM 5181  O OE1  . GLU A 1 91  ? -11.208 -10.008 -11.502 1.00 0.00 ? 90  GLU A OE1  3  
ATOM 5182  O OE2  . GLU A 1 91  ? -10.265 -11.600 -10.269 1.00 0.00 ? 90  GLU A OE2  3  
ATOM 5183  H H    . GLU A 1 91  ? -12.668 -6.303  -7.622  1.00 0.00 ? 90  GLU A H    3  
ATOM 5184  H HA   . GLU A 1 91  ? -11.087 -8.576  -6.847  1.00 0.00 ? 90  GLU A HA   3  
ATOM 5185  H HB2  . GLU A 1 91  ? -12.387 -9.450  -8.729  1.00 0.00 ? 90  GLU A HB2  3  
ATOM 5186  H HB3  . GLU A 1 91  ? -11.956 -8.035  -9.748  1.00 0.00 ? 90  GLU A HB3  3  
ATOM 5187  H HG2  . GLU A 1 91  ? -9.651  -8.577  -9.734  1.00 0.00 ? 90  GLU A HG2  3  
ATOM 5188  H HG3  . GLU A 1 91  ? -9.845  -9.878  -8.493  1.00 0.00 ? 90  GLU A HG3  3  
ATOM 5189  N N    . LEU A 1 92  ? -9.083  -7.082  -7.248  1.00 0.00 ? 91  LEU A N    3  
ATOM 5190  C CA   . LEU A 1 92  ? -8.035  -6.094  -7.095  1.00 0.00 ? 91  LEU A CA   3  
ATOM 5191  C C    . LEU A 1 92  ? -6.797  -6.627  -7.734  1.00 0.00 ? 91  LEU A C    3  
ATOM 5192  O O    . LEU A 1 92  ? -6.439  -7.764  -7.426  1.00 0.00 ? 91  LEU A O    3  
ATOM 5193  C CB   . LEU A 1 92  ? -7.743  -5.910  -5.575  1.00 0.00 ? 91  LEU A CB   3  
ATOM 5194  C CG   . LEU A 1 92  ? -7.487  -4.456  -5.137  1.00 0.00 ? 91  LEU A CG   3  
ATOM 5195  C CD1  . LEU A 1 92  ? -6.300  -3.780  -5.844  1.00 0.00 ? 91  LEU A CD1  3  
ATOM 5196  C CD2  . LEU A 1 92  ? -8.760  -3.622  -5.302  1.00 0.00 ? 91  LEU A CD2  3  
ATOM 5197  H H    . LEU A 1 92  ? -8.793  -8.004  -7.021  1.00 0.00 ? 91  LEU A H    3  
ATOM 5198  H HA   . LEU A 1 92  ? -8.286  -5.158  -7.574  1.00 0.00 ? 91  LEU A HA   3  
ATOM 5199  H HB2  . LEU A 1 92  ? -8.660  -6.235  -5.031  1.00 0.00 ? 91  LEU A HB2  3  
ATOM 5200  H HB3  . LEU A 1 92  ? -6.926  -6.581  -5.200  1.00 0.00 ? 91  LEU A HB3  3  
ATOM 5201  H HG   . LEU A 1 92  ? -7.262  -4.484  -4.044  1.00 0.00 ? 91  LEU A HG   3  
ATOM 5202  H HD11 . LEU A 1 92  ? -5.395  -4.421  -5.798  1.00 0.00 ? 91  LEU A HD11 3  
ATOM 5203  H HD12 . LEU A 1 92  ? -6.075  -2.810  -5.351  1.00 0.00 ? 91  LEU A HD12 3  
ATOM 5204  H HD13 . LEU A 1 92  ? -6.545  -3.571  -6.905  1.00 0.00 ? 91  LEU A HD13 3  
ATOM 5205  H HD21 . LEU A 1 92  ? -8.583  -2.567  -5.014  1.00 0.00 ? 91  LEU A HD21 3  
ATOM 5206  H HD22 . LEU A 1 92  ? -9.591  -4.026  -4.684  1.00 0.00 ? 91  LEU A HD22 3  
ATOM 5207  H HD23 . LEU A 1 92  ? -9.086  -3.628  -6.361  1.00 0.00 ? 91  LEU A HD23 3  
ATOM 5208  N N    . TYR A 1 93  ? -6.059  -5.865  -8.595  1.00 0.00 ? 92  TYR A N    3  
ATOM 5209  C CA   . TYR A 1 93  ? -4.782  -6.448  -8.997  1.00 0.00 ? 92  TYR A CA   3  
ATOM 5210  C C    . TYR A 1 93  ? -3.713  -5.395  -9.163  1.00 0.00 ? 92  TYR A C    3  
ATOM 5211  O O    . TYR A 1 93  ? -3.935  -4.354  -9.777  1.00 0.00 ? 92  TYR A O    3  
ATOM 5212  C CB   . TYR A 1 93  ? -4.704  -7.260  -10.362 1.00 0.00 ? 92  TYR A CB   3  
ATOM 5213  C CG   . TYR A 1 93  ? -5.742  -8.195  -10.947 1.00 0.00 ? 92  TYR A CG   3  
ATOM 5214  C CD1  . TYR A 1 93  ? -7.118  -8.095  -10.869 1.00 0.00 ? 92  TYR A CD1  3  
ATOM 5215  C CD2  . TYR A 1 93  ? -5.244  -9.017  -11.944 1.00 0.00 ? 92  TYR A CD2  3  
ATOM 5216  C CE1  . TYR A 1 93  ? -7.923  -8.794  -11.751 1.00 0.00 ? 92  TYR A CE1  3  
ATOM 5217  C CE2  . TYR A 1 93  ? -6.032  -9.730  -12.812 1.00 0.00 ? 92  TYR A CE2  3  
ATOM 5218  C CZ   . TYR A 1 93  ? -7.401  -9.641  -12.700 1.00 0.00 ? 92  TYR A CZ   3  
ATOM 5219  O OH   . TYR A 1 93  ? -8.271  -10.301 -13.592 1.00 0.00 ? 92  TYR A OH   3  
ATOM 5220  H H    . TYR A 1 93  ? -6.274  -4.907  -8.887  1.00 0.00 ? 92  TYR A H    3  
ATOM 5221  H HA   . TYR A 1 93  ? -4.377  -7.006  -8.132  1.00 0.00 ? 92  TYR A HA   3  
ATOM 5222  H HB2  . TYR A 1 93  ? -4.584  -6.556  -11.218 1.00 0.00 ? 92  TYR A HB2  3  
ATOM 5223  H HB3  . TYR A 1 93  ? -3.781  -7.881  -10.269 1.00 0.00 ? 92  TYR A HB3  3  
ATOM 5224  H HD1  . TYR A 1 93  ? -7.593  -7.374  -10.228 1.00 0.00 ? 92  TYR A HD1  3  
ATOM 5225  H HD2  . TYR A 1 93  ? -4.188  -9.020  -12.136 1.00 0.00 ? 92  TYR A HD2  3  
ATOM 5226  H HE1  . TYR A 1 93  ? -8.987  -8.618  -11.750 1.00 0.00 ? 92  TYR A HE1  3  
ATOM 5227  H HE2  . TYR A 1 93  ? -5.523  -10.267 -13.603 1.00 0.00 ? 92  TYR A HE2  3  
ATOM 5228  H HH   . TYR A 1 93  ? -7.731  -10.785 -14.218 1.00 0.00 ? 92  TYR A HH   3  
ATOM 5229  N N    . TYR A 1 94  ? -2.494  -5.712  -8.684  1.00 0.00 ? 93  TYR A N    3  
ATOM 5230  C CA   . TYR A 1 94  ? -1.270  -4.968  -8.862  1.00 0.00 ? 93  TYR A CA   3  
ATOM 5231  C C    . TYR A 1 94  ? -0.396  -5.873  -9.719  1.00 0.00 ? 93  TYR A C    3  
ATOM 5232  O O    . TYR A 1 94  ? -0.158  -7.030  -9.362  1.00 0.00 ? 93  TYR A O    3  
ATOM 5233  C CB   . TYR A 1 94  ? -0.563  -4.617  -7.507  1.00 0.00 ? 93  TYR A CB   3  
ATOM 5234  C CG   . TYR A 1 94  ? -1.101  -3.333  -6.945  1.00 0.00 ? 93  TYR A CG   3  
ATOM 5235  C CD1  . TYR A 1 94  ? -2.470  -3.224  -6.717  1.00 0.00 ? 93  TYR A CD1  3  
ATOM 5236  C CD2  . TYR A 1 94  ? -0.285  -2.213  -6.735  1.00 0.00 ? 93  TYR A CD2  3  
ATOM 5237  C CE1  . TYR A 1 94  ? -3.049  -2.034  -6.364  1.00 0.00 ? 93  TYR A CE1  3  
ATOM 5238  C CE2  . TYR A 1 94  ? -0.912  -1.010  -6.487  1.00 0.00 ? 93  TYR A CE2  3  
ATOM 5239  C CZ   . TYR A 1 94  ? -2.267  -0.922  -6.286  1.00 0.00 ? 93  TYR A CZ   3  
ATOM 5240  O OH   . TYR A 1 94  ? -2.894  0.306   -6.076  1.00 0.00 ? 93  TYR A OH   3  
ATOM 5241  H H    . TYR A 1 94  ? -2.375  -6.557  -8.148  1.00 0.00 ? 93  TYR A H    3  
ATOM 5242  H HA   . TYR A 1 94  ? -1.457  -4.065  -9.418  1.00 0.00 ? 93  TYR A HA   3  
ATOM 5243  H HB2  . TYR A 1 94  ? -0.723  -5.420  -6.758  1.00 0.00 ? 93  TYR A HB2  3  
ATOM 5244  H HB3  . TYR A 1 94  ? 0.522   -4.467  -7.647  1.00 0.00 ? 93  TYR A HB3  3  
ATOM 5245  H HD1  . TYR A 1 94  ? -3.157  -4.045  -6.871  1.00 0.00 ? 93  TYR A HD1  3  
ATOM 5246  H HD2  . TYR A 1 94  ? 0.813   -2.178  -6.834  1.00 0.00 ? 93  TYR A HD2  3  
ATOM 5247  H HE1  . TYR A 1 94  ? -4.121  -1.969  -6.239  1.00 0.00 ? 93  TYR A HE1  3  
ATOM 5248  H HE2  . TYR A 1 94  ? -0.324  -0.106  -6.516  1.00 0.00 ? 93  TYR A HE2  3  
ATOM 5249  H HH   . TYR A 1 94  ? -2.212  1.015   -6.094  1.00 0.00 ? 93  TYR A HH   3  
ATOM 5250  N N    . SER A 1 95  ? 0.104   -5.348  -10.879 1.00 0.00 ? 94  SER A N    3  
ATOM 5251  C CA   . SER A 1 95  ? 1.025   -6.018  -11.790 1.00 0.00 ? 94  SER A CA   3  
ATOM 5252  C C    . SER A 1 95  ? 2.447   -5.737  -11.322 1.00 0.00 ? 94  SER A C    3  
ATOM 5253  O O    . SER A 1 95  ? 3.007   -4.647  -11.503 1.00 0.00 ? 94  SER A O    3  
ATOM 5254  C CB   . SER A 1 95  ? 0.794   -5.701  -13.296 1.00 0.00 ? 94  SER A CB   3  
ATOM 5255  O OG   . SER A 1 95  ? 0.894   -4.317  -13.651 1.00 0.00 ? 94  SER A OG   3  
ATOM 5256  H H    . SER A 1 95  ? -0.127  -4.409  -11.140 1.00 0.00 ? 94  SER A H    3  
ATOM 5257  H HA   . SER A 1 95  ? 0.850   -7.081  -11.690 1.00 0.00 ? 94  SER A HA   3  
ATOM 5258  H HB2  . SER A 1 95  ? 1.502   -6.279  -13.929 1.00 0.00 ? 94  SER A HB2  3  
ATOM 5259  H HB3  . SER A 1 95  ? -0.230  -6.070  -13.541 1.00 0.00 ? 94  SER A HB3  3  
ATOM 5260  H HG   . SER A 1 95  ? 0.611   -3.747  -12.907 1.00 0.00 ? 94  SER A HG   3  
ATOM 5261  N N    . ILE A 1 96  ? 2.984   -6.746  -10.593 1.00 0.00 ? 95  ILE A N    3  
ATOM 5262  C CA   . ILE A 1 96  ? 4.256   -6.707  -9.883  1.00 0.00 ? 95  ILE A CA   3  
ATOM 5263  C C    . ILE A 1 96  ? 5.260   -7.437  -10.727 1.00 0.00 ? 95  ILE A C    3  
ATOM 5264  O O    . ILE A 1 96  ? 5.110   -8.624  -11.015 1.00 0.00 ? 95  ILE A O    3  
ATOM 5265  C CB   . ILE A 1 96  ? 4.134   -7.256  -8.459  1.00 0.00 ? 95  ILE A CB   3  
ATOM 5266  C CG1  . ILE A 1 96  ? 3.041   -6.472  -7.688  1.00 0.00 ? 95  ILE A CG1  3  
ATOM 5267  C CG2  . ILE A 1 96  ? 5.482   -7.185  -7.700  1.00 0.00 ? 95  ILE A CG2  3  
ATOM 5268  C CD1  . ILE A 1 96  ? 3.159   -4.942  -7.762  1.00 0.00 ? 95  ILE A CD1  3  
ATOM 5269  H H    . ILE A 1 96  ? 2.451   -7.612  -10.506 1.00 0.00 ? 95  ILE A H    3  
ATOM 5270  H HA   . ILE A 1 96  ? 4.604   -5.689  -9.796  1.00 0.00 ? 95  ILE A HA   3  
ATOM 5271  H HB   . ILE A 1 96  ? 3.799   -8.321  -8.499  1.00 0.00 ? 95  ILE A HB   3  
ATOM 5272  H HG12 . ILE A 1 96  ? 2.040   -6.768  -8.072  1.00 0.00 ? 95  ILE A HG12 3  
ATOM 5273  H HG13 . ILE A 1 96  ? 3.079   -6.778  -6.619  1.00 0.00 ? 95  ILE A HG13 3  
ATOM 5274  H HG21 . ILE A 1 96  ? 5.336   -7.493  -6.640  1.00 0.00 ? 95  ILE A HG21 3  
ATOM 5275  H HG22 . ILE A 1 96  ? 5.884   -6.149  -7.699  1.00 0.00 ? 95  ILE A HG22 3  
ATOM 5276  H HG23 . ILE A 1 96  ? 6.250   -7.851  -8.142  1.00 0.00 ? 95  ILE A HG23 3  
ATOM 5277  H HD11 . ILE A 1 96  ? 4.179   -4.614  -7.472  1.00 0.00 ? 95  ILE A HD11 3  
ATOM 5278  H HD12 . ILE A 1 96  ? 2.443   -4.467  -7.065  1.00 0.00 ? 95  ILE A HD12 3  
ATOM 5279  H HD13 . ILE A 1 96  ? 2.943   -4.553  -8.776  1.00 0.00 ? 95  ILE A HD13 3  
ATOM 5280  N N    . GLU A 1 97  ? 6.327   -6.730  -11.184 1.00 0.00 ? 96  GLU A N    3  
ATOM 5281  C CA   . GLU A 1 97  ? 7.333   -7.282  -12.098 1.00 0.00 ? 96  GLU A CA   3  
ATOM 5282  C C    . GLU A 1 97  ? 8.412   -7.971  -11.301 1.00 0.00 ? 96  GLU A C    3  
ATOM 5283  O O    . GLU A 1 97  ? 9.155   -7.382  -10.522 1.00 0.00 ? 96  GLU A O    3  
ATOM 5284  C CB   . GLU A 1 97  ? 7.806   -6.276  -13.170 1.00 0.00 ? 96  GLU A CB   3  
ATOM 5285  C CG   . GLU A 1 97  ? 8.775   -6.855  -14.219 1.00 0.00 ? 96  GLU A CG   3  
ATOM 5286  C CD   . GLU A 1 97  ? 9.128   -5.772  -15.236 1.00 0.00 ? 96  GLU A CD   3  
ATOM 5287  O OE1  . GLU A 1 97  ? 9.760   -4.760  -14.827 1.00 0.00 ? 96  GLU A OE1  3  
ATOM 5288  O OE2  . GLU A 1 97  ? 8.776   -5.940  -16.433 1.00 0.00 ? 96  GLU A OE2  3  
ATOM 5289  H H    . GLU A 1 97  ? 6.433   -5.766  -10.863 1.00 0.00 ? 96  GLU A H    3  
ATOM 5290  H HA   . GLU A 1 97  ? 6.870   -8.071  -12.653 1.00 0.00 ? 96  GLU A HA   3  
ATOM 5291  H HB2  . GLU A 1 97  ? 6.879   -5.954  -13.706 1.00 0.00 ? 96  GLU A HB2  3  
ATOM 5292  H HB3  . GLU A 1 97  ? 8.257   -5.391  -12.682 1.00 0.00 ? 96  GLU A HB3  3  
ATOM 5293  H HG2  . GLU A 1 97  ? 9.711   -7.210  -13.738 1.00 0.00 ? 96  GLU A HG2  3  
ATOM 5294  H HG3  . GLU A 1 97  ? 8.293   -7.715  -14.731 1.00 0.00 ? 96  GLU A HG3  3  
ATOM 5295  N N    . LYS A 1 98  ? 8.349   -9.313  -11.394 1.00 0.00 ? 97  LYS A N    3  
ATOM 5296  C CA   . LYS A 1 98  ? 8.974   -10.192 -10.434 1.00 0.00 ? 97  LYS A CA   3  
ATOM 5297  C C    . LYS A 1 98  ? 9.528   -11.432 -11.092 1.00 0.00 ? 97  LYS A C    3  
ATOM 5298  O O    . LYS A 1 98  ? 8.854   -12.080 -11.895 1.00 0.00 ? 97  LYS A O    3  
ATOM 5299  C CB   . LYS A 1 98  ? 7.777   -10.655 -9.569  1.00 0.00 ? 97  LYS A CB   3  
ATOM 5300  C CG   . LYS A 1 98  ? 7.914   -11.790 -8.531  1.00 0.00 ? 97  LYS A CG   3  
ATOM 5301  C CD   . LYS A 1 98  ? 8.615   -11.422 -7.222  1.00 0.00 ? 97  LYS A CD   3  
ATOM 5302  C CE   . LYS A 1 98  ? 10.140  -11.497 -7.323  1.00 0.00 ? 97  LYS A CE   3  
ATOM 5303  N NZ   . LYS A 1 98  ? 10.755  -11.327 -5.994  1.00 0.00 ? 97  LYS A NZ   3  
ATOM 5304  H H    . LYS A 1 98  ? 7.713   -9.752  -12.080 1.00 0.00 ? 97  LYS A H    3  
ATOM 5305  H HA   . LYS A 1 98  ? 9.749   -9.656  -9.886  1.00 0.00 ? 97  LYS A HA   3  
ATOM 5306  H HB2  . LYS A 1 98  ? 7.307   -9.771  -9.083  1.00 0.00 ? 97  LYS A HB2  3  
ATOM 5307  H HB3  . LYS A 1 98  ? 7.066   -11.026 -10.347 1.00 0.00 ? 97  LYS A HB3  3  
ATOM 5308  H HG2  . LYS A 1 98  ? 6.869   -12.083 -8.284  1.00 0.00 ? 97  LYS A HG2  3  
ATOM 5309  H HG3  . LYS A 1 98  ? 8.377   -12.702 -8.960  1.00 0.00 ? 97  LYS A HG3  3  
ATOM 5310  H HD2  . LYS A 1 98  ? 8.292   -10.407 -6.901  1.00 0.00 ? 97  LYS A HD2  3  
ATOM 5311  H HD3  . LYS A 1 98  ? 8.275   -12.150 -6.446  1.00 0.00 ? 97  LYS A HD3  3  
ATOM 5312  H HE2  . LYS A 1 98  ? 10.450  -12.488 -7.718  1.00 0.00 ? 97  LYS A HE2  3  
ATOM 5313  H HE3  . LYS A 1 98  ? 10.532  -10.699 -7.987  1.00 0.00 ? 97  LYS A HE3  3  
ATOM 5314  H HZ1  . LYS A 1 98  ? 10.498  -10.395 -5.609  1.00 0.00 ? 97  LYS A HZ1  3  
ATOM 5315  H HZ2  . LYS A 1 98  ? 11.790  -11.392 -6.078  1.00 0.00 ? 97  LYS A HZ2  3  
ATOM 5316  H HZ3  . LYS A 1 98  ? 10.412  -12.072 -5.354  1.00 0.00 ? 97  LYS A HZ3  3  
ATOM 5317  N N    . GLU A 1 99  ? 10.790  -11.832 -10.777 1.00 0.00 ? 98  GLU A N    3  
ATOM 5318  C CA   . GLU A 1 99  ? 11.471  -13.050 -11.253 1.00 0.00 ? 98  GLU A CA   3  
ATOM 5319  C C    . GLU A 1 99  ? 11.789  -13.052 -12.769 1.00 0.00 ? 98  GLU A C    3  
ATOM 5320  O O    . GLU A 1 99  ? 12.360  -13.976 -13.342 1.00 0.00 ? 98  GLU A O    3  
ATOM 5321  C CB   . GLU A 1 99  ? 10.685  -14.309 -10.731 1.00 0.00 ? 98  GLU A CB   3  
ATOM 5322  C CG   . GLU A 1 99  ? 11.316  -15.695 -10.949 1.00 0.00 ? 98  GLU A CG   3  
ATOM 5323  C CD   . GLU A 1 99  ? 12.740  -15.754 -10.394 1.00 0.00 ? 98  GLU A CD   3  
ATOM 5324  O OE1  . GLU A 1 99  ? 12.905  -15.538 -9.163  1.00 0.00 ? 98  GLU A OE1  3  
ATOM 5325  O OE2  . GLU A 1 99  ? 13.679  -16.019 -11.191 1.00 0.00 ? 98  GLU A OE2  3  
ATOM 5326  H H    . GLU A 1 99  ? 11.314  -11.291 -10.124 1.00 0.00 ? 98  GLU A H    3  
ATOM 5327  H HA   . GLU A 1 99  ? 12.437  -13.055 -10.766 1.00 0.00 ? 98  GLU A HA   3  
ATOM 5328  H HB2  . GLU A 1 99  ? 10.621  -14.213 -9.616  1.00 0.00 ? 98  GLU A HB2  3  
ATOM 5329  H HB3  . GLU A 1 99  ? 9.632   -14.323 -11.140 1.00 0.00 ? 98  GLU A HB3  3  
ATOM 5330  H HG2  . GLU A 1 99  ? 10.687  -16.421 -10.391 1.00 0.00 ? 98  GLU A HG2  3  
ATOM 5331  H HG3  . GLU A 1 99  ? 11.307  -15.965 -12.024 1.00 0.00 ? 98  GLU A HG3  3  
ATOM 5332  N N    . GLY A 1 100 ? 11.459  -11.904 -13.412 1.00 0.00 ? 99  GLY A N    3  
ATOM 5333  C CA   . GLY A 1 100 ? 11.673  -11.577 -14.817 1.00 0.00 ? 99  GLY A CA   3  
ATOM 5334  C C    . GLY A 1 100 ? 10.368  -11.412 -15.552 1.00 0.00 ? 99  GLY A C    3  
ATOM 5335  O O    . GLY A 1 100 ? 10.351  -11.059 -16.725 1.00 0.00 ? 99  GLY A O    3  
ATOM 5336  H H    . GLY A 1 100 ? 10.968  -11.243 -12.831 1.00 0.00 ? 99  GLY A H    3  
ATOM 5337  H HA2  . GLY A 1 100 ? 12.187  -10.628 -14.857 1.00 0.00 ? 99  GLY A HA2  3  
ATOM 5338  H HA3  . GLY A 1 100 ? 12.219  -12.367 -15.318 1.00 0.00 ? 99  GLY A HA3  3  
ATOM 5339  N N    . GLN A 1 101 ? 9.225   -11.676 -14.869 1.00 0.00 ? 100 GLN A N    3  
ATOM 5340  C CA   . GLN A 1 101 ? 7.887   -11.636 -15.440 1.00 0.00 ? 100 GLN A CA   3  
ATOM 5341  C C    . GLN A 1 101 ? 6.887   -10.947 -14.542 1.00 0.00 ? 100 GLN A C    3  
ATOM 5342  O O    . GLN A 1 101 ? 7.175   -10.571 -13.416 1.00 0.00 ? 100 GLN A O    3  
ATOM 5343  C CB   . GLN A 1 101 ? 7.437   -13.034 -15.966 1.00 0.00 ? 100 GLN A CB   3  
ATOM 5344  C CG   . GLN A 1 101 ? 7.628   -14.255 -15.026 1.00 0.00 ? 100 GLN A CG   3  
ATOM 5345  C CD   . GLN A 1 101 ? 6.504   -14.430 -14.005 1.00 0.00 ? 100 GLN A CD   3  
ATOM 5346  O OE1  . GLN A 1 101 ? 5.455   -15.023 -14.284 1.00 0.00 ? 100 GLN A OE1  3  
ATOM 5347  N NE2  . GLN A 1 101 ? 6.719   -13.909 -12.767 1.00 0.00 ? 100 GLN A NE2  3  
ATOM 5348  H H    . GLN A 1 101 ? 9.270   -11.956 -13.908 1.00 0.00 ? 100 GLN A H    3  
ATOM 5349  H HA   . GLN A 1 101 ? 7.904   -10.940 -16.260 1.00 0.00 ? 100 GLN A HA   3  
ATOM 5350  H HB2  . GLN A 1 101 ? 6.394   -13.013 -16.346 1.00 0.00 ? 100 GLN A HB2  3  
ATOM 5351  H HB3  . GLN A 1 101 ? 8.092   -13.238 -16.848 1.00 0.00 ? 100 GLN A HB3  3  
ATOM 5352  H HG2  . GLN A 1 101 ? 7.601   -15.170 -15.658 1.00 0.00 ? 100 GLN A HG2  3  
ATOM 5353  H HG3  . GLN A 1 101 ? 8.615   -14.237 -14.524 1.00 0.00 ? 100 GLN A HG3  3  
ATOM 5354  H HE21 . GLN A 1 101 ? 7.529   -13.322 -12.568 1.00 0.00 ? 100 GLN A HE21 3  
ATOM 5355  H HE22 . GLN A 1 101 ? 5.947   -14.033 -12.136 1.00 0.00 ? 100 GLN A HE22 3  
ATOM 5356  N N    . ARG A 1 102 ? 5.655   -10.677 -15.026 1.00 0.00 ? 101 ARG A N    3  
ATOM 5357  C CA   . ARG A 1 102 ? 4.650   -9.916  -14.297 1.00 0.00 ? 101 ARG A CA   3  
ATOM 5358  C C    . ARG A 1 102 ? 3.723   -10.803 -13.488 1.00 0.00 ? 101 ARG A C    3  
ATOM 5359  O O    . ARG A 1 102 ? 3.067   -11.682 -14.034 1.00 0.00 ? 101 ARG A O    3  
ATOM 5360  C CB   . ARG A 1 102 ? 3.835   -8.987  -15.253 1.00 0.00 ? 101 ARG A CB   3  
ATOM 5361  C CG   . ARG A 1 102 ? 4.613   -7.834  -15.939 1.00 0.00 ? 101 ARG A CG   3  
ATOM 5362  C CD   . ARG A 1 102 ? 5.601   -8.262  -17.039 1.00 0.00 ? 101 ARG A CD   3  
ATOM 5363  N NE   . ARG A 1 102 ? 6.103   -7.049  -17.782 1.00 0.00 ? 101 ARG A NE   3  
ATOM 5364  C CZ   . ARG A 1 102 ? 5.579   -6.602  -18.966 1.00 0.00 ? 101 ARG A CZ   3  
ATOM 5365  N NH1  . ARG A 1 102 ? 4.494   -7.206  -19.532 1.00 0.00 ? 101 ARG A NH1  3  
ATOM 5366  N NH2  . ARG A 1 102 ? 6.156   -5.535  -19.592 1.00 0.00 ? 101 ARG A NH2  3  
ATOM 5367  H H    . ARG A 1 102 ? 5.374   -10.958 -15.939 1.00 0.00 ? 101 ARG A H    3  
ATOM 5368  H HA   . ARG A 1 102 ? 5.123   -9.307  -13.556 1.00 0.00 ? 101 ARG A HA   3  
ATOM 5369  H HB2  . ARG A 1 102 ? 3.361   -9.595  -16.049 1.00 0.00 ? 101 ARG A HB2  3  
ATOM 5370  H HB3  . ARG A 1 102 ? 3.018   -8.494  -14.677 1.00 0.00 ? 101 ARG A HB3  3  
ATOM 5371  H HG2  . ARG A 1 102 ? 3.848   -7.173  -16.408 1.00 0.00 ? 101 ARG A HG2  3  
ATOM 5372  H HG3  . ARG A 1 102 ? 5.147   -7.240  -15.168 1.00 0.00 ? 101 ARG A HG3  3  
ATOM 5373  H HD2  . ARG A 1 102 ? 6.492   -8.743  -16.585 1.00 0.00 ? 101 ARG A HD2  3  
ATOM 5374  H HD3  . ARG A 1 102 ? 5.127   -8.989  -17.735 1.00 0.00 ? 101 ARG A HD3  3  
ATOM 5375  H HE   . ARG A 1 102 ? 6.894   -6.568  -17.404 1.00 0.00 ? 101 ARG A HE   3  
ATOM 5376  H HH11 . ARG A 1 102 ? 4.068   -7.990  -19.082 1.00 0.00 ? 101 ARG A HH11 3  
ATOM 5377  H HH12 . ARG A 1 102 ? 4.125   -6.861  -20.396 1.00 0.00 ? 101 ARG A HH12 3  
ATOM 5378  H HH21 . ARG A 1 102 ? 6.950   -5.086  -19.184 1.00 0.00 ? 101 ARG A HH21 3  
ATOM 5379  H HH22 . ARG A 1 102 ? 5.785   -5.203  -20.459 1.00 0.00 ? 101 ARG A HH22 3  
ATOM 5380  N N    . LYS A 1 103 ? 3.651   -10.570 -12.149 1.00 0.00 ? 102 LYS A N    3  
ATOM 5381  C CA   . LYS A 1 103 ? 2.728   -11.255 -11.244 1.00 0.00 ? 102 LYS A CA   3  
ATOM 5382  C C    . LYS A 1 103 ? 1.543   -10.368 -11.103 1.00 0.00 ? 102 LYS A C    3  
ATOM 5383  O O    . LYS A 1 103 ? 1.613   -9.156  -11.273 1.00 0.00 ? 102 LYS A O    3  
ATOM 5384  C CB   . LYS A 1 103 ? 3.256   -11.563 -9.817  1.00 0.00 ? 102 LYS A CB   3  
ATOM 5385  C CG   . LYS A 1 103 ? 4.509   -12.446 -9.820  1.00 0.00 ? 102 LYS A CG   3  
ATOM 5386  C CD   . LYS A 1 103 ? 4.416   -13.979 -9.998  1.00 0.00 ? 102 LYS A CD   3  
ATOM 5387  C CE   . LYS A 1 103 ? 3.648   -14.480 -11.228 1.00 0.00 ? 102 LYS A CE   3  
ATOM 5388  N NZ   . LYS A 1 103 ? 3.790   -15.947 -11.380 1.00 0.00 ? 102 LYS A NZ   3  
ATOM 5389  H H    . LYS A 1 103 ? 4.205   -9.814  -11.739 1.00 0.00 ? 102 LYS A H    3  
ATOM 5390  H HA   . LYS A 1 103 ? 2.375   -12.173 -11.692 1.00 0.00 ? 102 LYS A HA   3  
ATOM 5391  H HB2  . LYS A 1 103 ? 3.552   -10.607 -9.310  1.00 0.00 ? 102 LYS A HB2  3  
ATOM 5392  H HB3  . LYS A 1 103 ? 2.491   -12.002 -9.121  1.00 0.00 ? 102 LYS A HB3  3  
ATOM 5393  H HG2  . LYS A 1 103 ? 5.246   -12.038 -10.543 1.00 0.00 ? 102 LYS A HG2  3  
ATOM 5394  H HG3  . LYS A 1 103 ? 4.872   -12.283 -8.793  1.00 0.00 ? 102 LYS A HG3  3  
ATOM 5395  H HD2  . LYS A 1 103 ? 5.474   -14.358 -10.054 1.00 0.00 ? 102 LYS A HD2  3  
ATOM 5396  H HD3  . LYS A 1 103 ? 3.946   -14.418 -9.091  1.00 0.00 ? 102 LYS A HD3  3  
ATOM 5397  H HE2  . LYS A 1 103 ? 2.564   -14.261 -11.129 1.00 0.00 ? 102 LYS A HE2  3  
ATOM 5398  H HE3  . LYS A 1 103 ? 4.034   -14.007 -12.153 1.00 0.00 ? 102 LYS A HE3  3  
ATOM 5399  H HZ1  . LYS A 1 103 ? 4.794   -16.188 -11.500 1.00 0.00 ? 102 LYS A HZ1  3  
ATOM 5400  H HZ2  . LYS A 1 103 ? 3.254   -16.263 -12.214 1.00 0.00 ? 102 LYS A HZ2  3  
ATOM 5401  H HZ3  . LYS A 1 103 ? 3.418   -16.420 -10.531 1.00 0.00 ? 102 LYS A HZ3  3  
ATOM 5402  N N    . TRP A 1 104 ? 0.405   -10.964 -10.778 1.00 0.00 ? 103 TRP A N    3  
ATOM 5403  C CA   . TRP A 1 104 ? -0.805  -10.198 -10.665 1.00 0.00 ? 103 TRP A CA   3  
ATOM 5404  C C    . TRP A 1 104 ? -1.307  -10.547 -9.290  1.00 0.00 ? 103 TRP A C    3  
ATOM 5405  O O    . TRP A 1 104 ? -1.822  -11.631 -9.017  1.00 0.00 ? 103 TRP A O    3  
ATOM 5406  C CB   . TRP A 1 104 ? -1.767  -10.579 -11.825 1.00 0.00 ? 103 TRP A CB   3  
ATOM 5407  C CG   . TRP A 1 104 ? -1.507  -9.880  -13.173 1.00 0.00 ? 103 TRP A CG   3  
ATOM 5408  C CD1  . TRP A 1 104 ? -1.087  -10.428 -14.356 1.00 0.00 ? 103 TRP A CD1  3  
ATOM 5409  C CD2  . TRP A 1 104 ? -1.851  -8.508  -13.478 1.00 0.00 ? 103 TRP A CD2  3  
ATOM 5410  N NE1  . TRP A 1 104 ? -1.234  -9.515  -15.387 1.00 0.00 ? 103 TRP A NE1  3  
ATOM 5411  C CE2  . TRP A 1 104 ? -1.729  -8.342  -14.855 1.00 0.00 ? 103 TRP A CE2  3  
ATOM 5412  C CE3  . TRP A 1 104 ? -2.269  -7.475  -12.685 1.00 0.00 ? 103 TRP A CE3  3  
ATOM 5413  C CZ2  . TRP A 1 104 ? -2.073  -7.163  -15.453 1.00 0.00 ? 103 TRP A CZ2  3  
ATOM 5414  C CZ3  . TRP A 1 104 ? -2.681  -6.303  -13.291 1.00 0.00 ? 103 TRP A CZ3  3  
ATOM 5415  C CH2  . TRP A 1 104 ? -2.574  -6.148  -14.660 1.00 0.00 ? 103 TRP A CH2  3  
ATOM 5416  H H    . TRP A 1 104 ? 0.439   -11.947 -10.604 1.00 0.00 ? 103 TRP A H    3  
ATOM 5417  H HA   . TRP A 1 104 ? -0.610  -9.119  -10.668 1.00 0.00 ? 103 TRP A HA   3  
ATOM 5418  H HB2  . TRP A 1 104 ? -1.719  -11.678 -11.980 1.00 0.00 ? 103 TRP A HB2  3  
ATOM 5419  H HB3  . TRP A 1 104 ? -2.811  -10.350 -11.536 1.00 0.00 ? 103 TRP A HB3  3  
ATOM 5420  H HD1  . TRP A 1 104 ? -0.682  -11.425 -14.453 1.00 0.00 ? 103 TRP A HD1  3  
ATOM 5421  H HE1  . TRP A 1 104 ? -1.047  -9.676  -16.337 1.00 0.00 ? 103 TRP A HE1  3  
ATOM 5422  H HE3  . TRP A 1 104 ? -2.280  -7.565  -11.613 1.00 0.00 ? 103 TRP A HE3  3  
ATOM 5423  H HZ2  . TRP A 1 104 ? -2.006  -7.025  -16.521 1.00 0.00 ? 103 TRP A HZ2  3  
ATOM 5424  H HZ3  . TRP A 1 104 ? -3.056  -5.484  -12.689 1.00 0.00 ? 103 TRP A HZ3  3  
ATOM 5425  H HH2  . TRP A 1 104 ? -2.866  -5.211  -15.116 1.00 0.00 ? 103 TRP A HH2  3  
ATOM 5426  N N    . TYR A 1 105 ? -1.118  -9.581  -8.376  1.00 0.00 ? 104 TYR A N    3  
ATOM 5427  C CA   . TYR A 1 105 ? -1.448  -9.768  -6.979  1.00 0.00 ? 104 TYR A CA   3  
ATOM 5428  C C    . TYR A 1 105 ? -2.358  -8.680  -6.517  1.00 0.00 ? 104 TYR A C    3  
ATOM 5429  O O    . TYR A 1 105 ? -1.995  -7.514  -6.595  1.00 0.00 ? 104 TYR A O    3  
ATOM 5430  C CB   . TYR A 1 105 ? -0.248  -9.664  -5.976  1.00 0.00 ? 104 TYR A CB   3  
ATOM 5431  C CG   . TYR A 1 105 ? 1.003   -10.448 -6.282  1.00 0.00 ? 104 TYR A CG   3  
ATOM 5432  C CD1  . TYR A 1 105 ? 1.014   -11.830 -6.389  1.00 0.00 ? 104 TYR A CD1  3  
ATOM 5433  C CD2  . TYR A 1 105 ? 2.217   -9.789  -6.216  1.00 0.00 ? 104 TYR A CD2  3  
ATOM 5434  C CE1  . TYR A 1 105 ? 2.213   -12.527 -6.420  1.00 0.00 ? 104 TYR A CE1  3  
ATOM 5435  C CE2  . TYR A 1 105 ? 3.411   -10.472 -6.247  1.00 0.00 ? 104 TYR A CE2  3  
ATOM 5436  C CZ   . TYR A 1 105 ? 3.410   -11.842 -6.336  1.00 0.00 ? 104 TYR A CZ   3  
ATOM 5437  O OH   . TYR A 1 105 ? 4.646   -12.517 -6.348  1.00 0.00 ? 104 TYR A OH   3  
ATOM 5438  H H    . TYR A 1 105 ? -0.675  -8.713  -8.663  1.00 0.00 ? 104 TYR A H    3  
ATOM 5439  H HA   . TYR A 1 105 ? -1.933  -10.709 -6.789  1.00 0.00 ? 104 TYR A HA   3  
ATOM 5440  H HB2  . TYR A 1 105 ? 0.050   -8.611  -5.758  1.00 0.00 ? 104 TYR A HB2  3  
ATOM 5441  H HB3  . TYR A 1 105 ? -0.608  -10.078 -5.010  1.00 0.00 ? 104 TYR A HB3  3  
ATOM 5442  H HD1  . TYR A 1 105 ? 0.082   -12.382 -6.393  1.00 0.00 ? 104 TYR A HD1  3  
ATOM 5443  H HD2  . TYR A 1 105 ? 2.239   -8.721  -6.061  1.00 0.00 ? 104 TYR A HD2  3  
ATOM 5444  H HE1  . TYR A 1 105 ? 2.203   -13.607 -6.488  1.00 0.00 ? 104 TYR A HE1  3  
ATOM 5445  H HE2  . TYR A 1 105 ? 4.345   -9.935  -6.162  1.00 0.00 ? 104 TYR A HE2  3  
ATOM 5446  H HH   . TYR A 1 105 ? 4.463   -13.452 -6.452  1.00 0.00 ? 104 TYR A HH   3  
ATOM 5447  N N    . LYS A 1 106 ? -3.496  -9.010  -5.847  1.00 0.00 ? 105 LYS A N    3  
ATOM 5448  C CA   . LYS A 1 106 ? -4.323  -8.111  -5.077  1.00 0.00 ? 105 LYS A CA   3  
ATOM 5449  C C    . LYS A 1 106 ? -3.543  -7.567  -3.876  1.00 0.00 ? 105 LYS A C    3  
ATOM 5450  O O    . LYS A 1 106 ? -2.649  -8.253  -3.377  1.00 0.00 ? 105 LYS A O    3  
ATOM 5451  C CB   . LYS A 1 106 ? -5.570  -8.883  -4.553  1.00 0.00 ? 105 LYS A CB   3  
ATOM 5452  C CG   . LYS A 1 106 ? -5.329  -10.247 -3.862  1.00 0.00 ? 105 LYS A CG   3  
ATOM 5453  C CD   . LYS A 1 106 ? -5.249  -11.515 -4.746  1.00 0.00 ? 105 LYS A CD   3  
ATOM 5454  C CE   . LYS A 1 106 ? -6.551  -11.915 -5.469  1.00 0.00 ? 105 LYS A CE   3  
ATOM 5455  N NZ   . LYS A 1 106 ? -6.780  -11.142 -6.715  1.00 0.00 ? 105 LYS A NZ   3  
ATOM 5456  H H    . LYS A 1 106 ? -3.828  -9.929  -5.718  1.00 0.00 ? 105 LYS A H    3  
ATOM 5457  H HA   . LYS A 1 106 ? -4.587  -7.278  -5.720  1.00 0.00 ? 105 LYS A HA   3  
ATOM 5458  H HB2  . LYS A 1 106 ? -6.111  -8.228  -3.839  1.00 0.00 ? 105 LYS A HB2  3  
ATOM 5459  H HB3  . LYS A 1 106 ? -6.269  -9.038  -5.398  1.00 0.00 ? 105 LYS A HB3  3  
ATOM 5460  H HG2  . LYS A 1 106 ? -4.413  -10.189 -3.234  1.00 0.00 ? 105 LYS A HG2  3  
ATOM 5461  H HG3  . LYS A 1 106 ? -6.179  -10.412 -3.159  1.00 0.00 ? 105 LYS A HG3  3  
ATOM 5462  H HD2  . LYS A 1 106 ? -4.420  -11.473 -5.480  1.00 0.00 ? 105 LYS A HD2  3  
ATOM 5463  H HD3  . LYS A 1 106 ? -5.016  -12.362 -4.055  1.00 0.00 ? 105 LYS A HD3  3  
ATOM 5464  H HE2  . LYS A 1 106 ? -6.492  -12.985 -5.765  1.00 0.00 ? 105 LYS A HE2  3  
ATOM 5465  H HE3  . LYS A 1 106 ? -7.429  -11.772 -4.806  1.00 0.00 ? 105 LYS A HE3  3  
ATOM 5466  H HZ1  . LYS A 1 106 ? -5.980  -11.286 -7.363  1.00 0.00 ? 105 LYS A HZ1  3  
ATOM 5467  H HZ2  . LYS A 1 106 ? -6.862  -10.131 -6.483  1.00 0.00 ? 105 LYS A HZ2  3  
ATOM 5468  H HZ3  . LYS A 1 106 ? -7.658  -11.467 -7.167  1.00 0.00 ? 105 LYS A HZ3  3  
ATOM 5469  N N    . ARG A 1 107 ? -3.835  -6.315  -3.430  1.00 0.00 ? 106 ARG A N    3  
ATOM 5470  C CA   . ARG A 1 107 ? -3.083  -5.452  -2.482  1.00 0.00 ? 106 ARG A CA   3  
ATOM 5471  C C    . ARG A 1 107 ? -2.267  -6.107  -1.370  1.00 0.00 ? 106 ARG A C    3  
ATOM 5472  O O    . ARG A 1 107 ? -1.119  -5.742  -1.144  1.00 0.00 ? 106 ARG A O    3  
ATOM 5473  C CB   . ARG A 1 107 ? -3.971  -4.392  -1.765  1.00 0.00 ? 106 ARG A CB   3  
ATOM 5474  C CG   . ARG A 1 107 ? -4.627  -3.348  -2.676  1.00 0.00 ? 106 ARG A CG   3  
ATOM 5475  C CD   . ARG A 1 107 ? -5.106  -2.141  -1.853  1.00 0.00 ? 106 ARG A CD   3  
ATOM 5476  N NE   . ARG A 1 107 ? -5.786  -1.129  -2.736  1.00 0.00 ? 106 ARG A NE   3  
ATOM 5477  C CZ   . ARG A 1 107 ? -7.139  -1.099  -2.946  1.00 0.00 ? 106 ARG A CZ   3  
ATOM 5478  N NH1  . ARG A 1 107 ? -7.948  -2.081  -2.454  1.00 0.00 ? 106 ARG A NH1  3  
ATOM 5479  N NH2  . ARG A 1 107 ? -7.689  -0.073  -3.659  1.00 0.00 ? 106 ARG A NH2  3  
ATOM 5480  H H    . ARG A 1 107 ? -4.537  -5.878  -3.982  1.00 0.00 ? 106 ARG A H    3  
ATOM 5481  H HA   . ARG A 1 107 ? -2.367  -4.908  -3.080  1.00 0.00 ? 106 ARG A HA   3  
ATOM 5482  H HB2  . ARG A 1 107 ? -4.759  -4.893  -1.155  1.00 0.00 ? 106 ARG A HB2  3  
ATOM 5483  H HB3  . ARG A 1 107 ? -3.349  -3.775  -1.072  1.00 0.00 ? 106 ARG A HB3  3  
ATOM 5484  H HG2  . ARG A 1 107 ? -3.895  -2.987  -3.432  1.00 0.00 ? 106 ARG A HG2  3  
ATOM 5485  H HG3  . ARG A 1 107 ? -5.488  -3.808  -3.197  1.00 0.00 ? 106 ARG A HG3  3  
ATOM 5486  H HD2  . ARG A 1 107 ? -5.783  -2.469  -1.032  1.00 0.00 ? 106 ARG A HD2  3  
ATOM 5487  H HD3  . ARG A 1 107 ? -4.229  -1.634  -1.397  1.00 0.00 ? 106 ARG A HD3  3  
ATOM 5488  H HE   . ARG A 1 107 ? -5.231  -0.393  -3.122  1.00 0.00 ? 106 ARG A HE   3  
ATOM 5489  H HH11 . ARG A 1 107 ? -7.553  -2.836  -1.930  1.00 0.00 ? 106 ARG A HH11 3  
ATOM 5490  H HH12 . ARG A 1 107 ? -8.934  -2.046  -2.618  1.00 0.00 ? 106 ARG A HH12 3  
ATOM 5491  H HH21 . ARG A 1 107 ? -7.104  0.651   -4.025  1.00 0.00 ? 106 ARG A HH21 3  
ATOM 5492  H HH22 . ARG A 1 107 ? -8.677  -0.048  -3.819  1.00 0.00 ? 106 ARG A HH22 3  
ATOM 5493  N N    . MET A 1 108 ? -2.812  -7.161  -0.721  1.00 0.00 ? 107 MET A N    3  
ATOM 5494  C CA   . MET A 1 108 ? -2.194  -7.990  0.308   1.00 0.00 ? 107 MET A CA   3  
ATOM 5495  C C    . MET A 1 108 ? -0.931  -8.779  -0.098  1.00 0.00 ? 107 MET A C    3  
ATOM 5496  O O    . MET A 1 108 ? -0.148  -9.141  0.776   1.00 0.00 ? 107 MET A O    3  
ATOM 5497  C CB   . MET A 1 108 ? -3.257  -8.896  0.986   1.00 0.00 ? 107 MET A CB   3  
ATOM 5498  C CG   . MET A 1 108 ? -3.976  -9.868  0.023   1.00 0.00 ? 107 MET A CG   3  
ATOM 5499  S SD   . MET A 1 108 ? -5.591  -10.461 0.619   1.00 0.00 ? 107 MET A SD   3  
ATOM 5500  C CE   . MET A 1 108 ? -5.001  -11.261 2.137   1.00 0.00 ? 107 MET A CE   3  
ATOM 5501  H H    . MET A 1 108 ? -3.721  -7.429  -1.030  1.00 0.00 ? 107 MET A H    3  
ATOM 5502  H HA   . MET A 1 108 ? -1.855  -7.319  1.087   1.00 0.00 ? 107 MET A HA   3  
ATOM 5503  H HB2  . MET A 1 108 ? -2.789  -9.482  1.811   1.00 0.00 ? 107 MET A HB2  3  
ATOM 5504  H HB3  . MET A 1 108 ? -4.019  -8.224  1.460   1.00 0.00 ? 107 MET A HB3  3  
ATOM 5505  H HG2  . MET A 1 108 ? -4.135  -9.356  -0.953  1.00 0.00 ? 107 MET A HG2  3  
ATOM 5506  H HG3  . MET A 1 108 ? -3.307  -10.734 -0.170  1.00 0.00 ? 107 MET A HG3  3  
ATOM 5507  H HE1  . MET A 1 108 ? -4.629  -10.515 2.871   1.00 0.00 ? 107 MET A HE1  3  
ATOM 5508  H HE2  . MET A 1 108 ? -4.185  -11.984 1.921   1.00 0.00 ? 107 MET A HE2  3  
ATOM 5509  H HE3  . MET A 1 108 ? -5.827  -11.822 2.626   1.00 0.00 ? 107 MET A HE3  3  
ATOM 5510  N N    . ALA A 1 109 ? -0.648  -9.009  -1.421  1.00 0.00 ? 108 ALA A N    3  
ATOM 5511  C CA   . ALA A 1 109 ? 0.596   -9.655  -1.883  1.00 0.00 ? 108 ALA A CA   3  
ATOM 5512  C C    . ALA A 1 109 ? 1.639   -8.718  -2.452  1.00 0.00 ? 108 ALA A C    3  
ATOM 5513  O O    . ALA A 1 109 ? 2.668   -9.146  -2.969  1.00 0.00 ? 108 ALA A O    3  
ATOM 5514  C CB   . ALA A 1 109 ? 0.396   -10.903 -2.797  1.00 0.00 ? 108 ALA A CB   3  
ATOM 5515  H H    . ALA A 1 109 ? -1.301  -8.690  -2.122  1.00 0.00 ? 108 ALA A H    3  
ATOM 5516  H HA   . ALA A 1 109 ? 1.129   -9.964  -1.013  1.00 0.00 ? 108 ALA A HA   3  
ATOM 5517  H HB1  . ALA A 1 109 ? -0.650  -10.948 -3.160  1.00 0.00 ? 108 ALA A HB1  3  
ATOM 5518  H HB2  . ALA A 1 109 ? 0.596   -11.817 -2.201  1.00 0.00 ? 108 ALA A HB2  3  
ATOM 5519  H HB3  . ALA A 1 109 ? 1.072   -10.949 -3.695  1.00 0.00 ? 108 ALA A HB3  3  
ATOM 5520  N N    . VAL A 1 110 ? 1.423   -7.409  -2.306  1.00 0.00 ? 109 VAL A N    3  
ATOM 5521  C CA   . VAL A 1 110 ? 2.302   -6.335  -2.666  1.00 0.00 ? 109 VAL A CA   3  
ATOM 5522  C C    . VAL A 1 110 ? 2.486   -5.556  -1.388  1.00 0.00 ? 109 VAL A C    3  
ATOM 5523  O O    . VAL A 1 110 ? 1.575   -4.988  -0.788  1.00 0.00 ? 109 VAL A O    3  
ATOM 5524  C CB   . VAL A 1 110 ? 1.907   -5.545  -3.914  1.00 0.00 ? 109 VAL A CB   3  
ATOM 5525  C CG1  . VAL A 1 110 ? 0.585   -4.759  -3.789  1.00 0.00 ? 109 VAL A CG1  3  
ATOM 5526  C CG2  . VAL A 1 110 ? 3.094   -4.667  -4.353  1.00 0.00 ? 109 VAL A CG2  3  
ATOM 5527  H H    . VAL A 1 110 ? 0.668   -7.140  -1.739  1.00 0.00 ? 109 VAL A H    3  
ATOM 5528  H HA   . VAL A 1 110 ? 3.279   -6.750  -2.903  1.00 0.00 ? 109 VAL A HA   3  
ATOM 5529  H HB   . VAL A 1 110 ? 1.762   -6.294  -4.730  1.00 0.00 ? 109 VAL A HB   3  
ATOM 5530  H HG11 . VAL A 1 110 ? -0.250  -5.465  -3.599  1.00 0.00 ? 109 VAL A HG11 3  
ATOM 5531  H HG12 . VAL A 1 110 ? 0.372   -4.216  -4.735  1.00 0.00 ? 109 VAL A HG12 3  
ATOM 5532  H HG13 . VAL A 1 110 ? 0.622   -4.012  -2.970  1.00 0.00 ? 109 VAL A HG13 3  
ATOM 5533  H HG21 . VAL A 1 110 ? 3.905   -5.316  -4.755  1.00 0.00 ? 109 VAL A HG21 3  
ATOM 5534  H HG22 . VAL A 1 110 ? 3.498   -4.063  -3.517  1.00 0.00 ? 109 VAL A HG22 3  
ATOM 5535  H HG23 . VAL A 1 110 ? 2.767   -3.960  -5.140  1.00 0.00 ? 109 VAL A HG23 3  
ATOM 5536  N N    . ILE A 1 111 ? 3.732   -5.562  -0.923  1.00 0.00 ? 110 ILE A N    3  
ATOM 5537  C CA   . ILE A 1 111 ? 4.182   -4.869  0.272   1.00 0.00 ? 110 ILE A CA   3  
ATOM 5538  C C    . ILE A 1 111 ? 5.347   -3.950  -0.056  1.00 0.00 ? 110 ILE A C    3  
ATOM 5539  O O    . ILE A 1 111 ? 5.850   -3.892  -1.180  1.00 0.00 ? 110 ILE A O    3  
ATOM 5540  C CB   . ILE A 1 111 ? 4.547   -5.804  1.427   1.00 0.00 ? 110 ILE A CB   3  
ATOM 5541  C CG1  . ILE A 1 111 ? 5.454   -6.983  0.994   1.00 0.00 ? 110 ILE A CG1  3  
ATOM 5542  C CG2  . ILE A 1 111 ? 3.248   -6.292  2.114   1.00 0.00 ? 110 ILE A CG2  3  
ATOM 5543  C CD1  . ILE A 1 111 ? 6.482   -7.422  2.048   1.00 0.00 ? 110 ILE A CD1  3  
ATOM 5544  H H    . ILE A 1 111 ? 4.378   -6.064  -1.499  1.00 0.00 ? 110 ILE A H    3  
ATOM 5545  H HA   . ILE A 1 111 ? 3.410   -4.203  0.640   1.00 0.00 ? 110 ILE A HA   3  
ATOM 5546  H HB   . ILE A 1 111 ? 5.076   -5.196  2.190   1.00 0.00 ? 110 ILE A HB   3  
ATOM 5547  H HG12 . ILE A 1 111 ? 4.806   -7.846  0.736   1.00 0.00 ? 110 ILE A HG12 3  
ATOM 5548  H HG13 . ILE A 1 111 ? 5.993   -6.730  0.063   1.00 0.00 ? 110 ILE A HG13 3  
ATOM 5549  H HG21 . ILE A 1 111 ? 2.585   -5.431  2.344   1.00 0.00 ? 110 ILE A HG21 3  
ATOM 5550  H HG22 . ILE A 1 111 ? 3.498   -6.805  3.065   1.00 0.00 ? 110 ILE A HG22 3  
ATOM 5551  H HG23 . ILE A 1 111 ? 2.703   -7.003  1.458   1.00 0.00 ? 110 ILE A HG23 3  
ATOM 5552  H HD11 . ILE A 1 111 ? 5.973   -7.780  2.968   1.00 0.00 ? 110 ILE A HD11 3  
ATOM 5553  H HD12 . ILE A 1 111 ? 7.157   -6.580  2.315   1.00 0.00 ? 110 ILE A HD12 3  
ATOM 5554  H HD13 . ILE A 1 111 ? 7.096   -8.261  1.648   1.00 0.00 ? 110 ILE A HD13 3  
ATOM 5555  N N    . LEU A 1 112 ? 5.810   -3.195  0.984   1.00 0.00 ? 111 LEU A N    3  
ATOM 5556  C CA   . LEU A 1 112 ? 6.902   -2.230  0.940   1.00 0.00 ? 111 LEU A CA   3  
ATOM 5557  C C    . LEU A 1 112 ? 7.674   -2.109  2.255   1.00 0.00 ? 111 LEU A C    3  
ATOM 5558  O O    . LEU A 1 112 ? 7.125   -2.357  3.321   1.00 0.00 ? 111 LEU A O    3  
ATOM 5559  C CB   . LEU A 1 112 ? 6.404   -0.817  0.544   1.00 0.00 ? 111 LEU A CB   3  
ATOM 5560  C CG   . LEU A 1 112 ? 4.908   -0.451  0.724   1.00 0.00 ? 111 LEU A CG   3  
ATOM 5561  C CD1  . LEU A 1 112 ? 4.264   -0.849  2.038   1.00 0.00 ? 111 LEU A CD1  3  
ATOM 5562  C CD2  . LEU A 1 112 ? 4.872   1.061   0.569   1.00 0.00 ? 111 LEU A CD2  3  
ATOM 5563  H H    . LEU A 1 112 ? 5.379   -3.247  1.893   1.00 0.00 ? 111 LEU A H    3  
ATOM 5564  H HA   . LEU A 1 112 ? 7.634   -2.554  0.214   1.00 0.00 ? 111 LEU A HA   3  
ATOM 5565  H HB2  . LEU A 1 112 ? 6.991   -0.007  1.036   1.00 0.00 ? 111 LEU A HB2  3  
ATOM 5566  H HB3  . LEU A 1 112 ? 6.605   -0.708  -0.541  1.00 0.00 ? 111 LEU A HB3  3  
ATOM 5567  H HG   . LEU A 1 112 ? 4.318   -0.907  -0.108  1.00 0.00 ? 111 LEU A HG   3  
ATOM 5568  H HD11 . LEU A 1 112 ? 3.885   -1.886  2.043   1.00 0.00 ? 111 LEU A HD11 3  
ATOM 5569  H HD12 . LEU A 1 112 ? 3.434   -0.176  2.334   1.00 0.00 ? 111 LEU A HD12 3  
ATOM 5570  H HD13 . LEU A 1 112 ? 5.021   -0.726  2.841   1.00 0.00 ? 111 LEU A HD13 3  
ATOM 5571  H HD21 . LEU A 1 112 ? 5.008   1.652   1.488   1.00 0.00 ? 111 LEU A HD21 3  
ATOM 5572  H HD22 . LEU A 1 112 ? 3.970   1.409   0.029   1.00 0.00 ? 111 LEU A HD22 3  
ATOM 5573  H HD23 . LEU A 1 112 ? 5.781   1.277   -0.018  1.00 0.00 ? 111 LEU A HD23 3  
ATOM 5574  N N    . SER A 1 113 ? 8.965   -1.661  2.198   1.00 0.00 ? 112 SER A N    3  
ATOM 5575  C CA   . SER A 1 113 ? 9.877   -1.373  3.317   1.00 0.00 ? 112 SER A CA   3  
ATOM 5576  C C    . SER A 1 113 ? 9.935   0.135   3.588   1.00 0.00 ? 112 SER A C    3  
ATOM 5577  O O    . SER A 1 113 ? 9.343   0.893   2.816   1.00 0.00 ? 112 SER A O    3  
ATOM 5578  C CB   . SER A 1 113 ? 11.292  -2.007  3.115   1.00 0.00 ? 112 SER A CB   3  
ATOM 5579  O OG   . SER A 1 113 ? 12.057  -1.420  2.055   1.00 0.00 ? 112 SER A OG   3  
ATOM 5580  H H    . SER A 1 113 ? 9.358   -1.464  1.304   1.00 0.00 ? 112 SER A H    3  
ATOM 5581  H HA   . SER A 1 113 ? 9.481   -1.821  4.205   1.00 0.00 ? 112 SER A HA   3  
ATOM 5582  H HB2  . SER A 1 113 ? 11.880  -1.916  4.055   1.00 0.00 ? 112 SER A HB2  3  
ATOM 5583  H HB3  . SER A 1 113 ? 11.158  -3.094  2.924   1.00 0.00 ? 112 SER A HB3  3  
ATOM 5584  H HG   . SER A 1 113 ? 11.865  -1.868  1.213   1.00 0.00 ? 112 SER A HG   3  
ATOM 5585  N N    . LEU A 1 114 ? 10.648  0.683   4.647   1.00 0.00 ? 113 LEU A N    3  
ATOM 5586  C CA   . LEU A 1 114 ? 10.705  2.155   4.832   1.00 0.00 ? 113 LEU A CA   3  
ATOM 5587  C C    . LEU A 1 114 ? 11.358  2.920   3.720   1.00 0.00 ? 113 LEU A C    3  
ATOM 5588  O O    . LEU A 1 114 ? 10.727  3.800   3.209   1.00 0.00 ? 113 LEU A O    3  
ATOM 5589  C CB   . LEU A 1 114 ? 11.198  2.872   6.112   1.00 0.00 ? 113 LEU A CB   3  
ATOM 5590  C CG   . LEU A 1 114 ? 10.680  2.320   7.449   1.00 0.00 ? 113 LEU A CG   3  
ATOM 5591  C CD1  . LEU A 1 114 ? 11.858  2.245   8.430   1.00 0.00 ? 113 LEU A CD1  3  
ATOM 5592  C CD2  . LEU A 1 114 ? 9.523   3.100   8.091   1.00 0.00 ? 113 LEU A CD2  3  
ATOM 5593  H H    . LEU A 1 114 ? 11.125  0.095   5.305   1.00 0.00 ? 113 LEU A H    3  
ATOM 5594  H HA   . LEU A 1 114 ? 9.679   2.477   4.803   1.00 0.00 ? 113 LEU A HA   3  
ATOM 5595  H HB2  . LEU A 1 114 ? 12.309  2.884   6.163   1.00 0.00 ? 113 LEU A HB2  3  
ATOM 5596  H HB3  . LEU A 1 114 ? 10.881  3.951   5.966   1.00 0.00 ? 113 LEU A HB3  3  
ATOM 5597  H HG   . LEU A 1 114 ? 10.308  1.287   7.269   1.00 0.00 ? 113 LEU A HG   3  
ATOM 5598  H HD11 . LEU A 1 114 ? 12.671  1.616   8.008   1.00 0.00 ? 113 LEU A HD11 3  
ATOM 5599  H HD12 . LEU A 1 114 ? 11.520  1.805   9.394   1.00 0.00 ? 113 LEU A HD12 3  
ATOM 5600  H HD13 . LEU A 1 114 ? 12.269  3.264   8.597   1.00 0.00 ? 113 LEU A HD13 3  
ATOM 5601  H HD21 . LEU A 1 114 ? 8.686   3.242   7.377   1.00 0.00 ? 113 LEU A HD21 3  
ATOM 5602  H HD22 . LEU A 1 114 ? 9.869   4.095   8.441   1.00 0.00 ? 113 LEU A HD22 3  
ATOM 5603  H HD23 . LEU A 1 114 ? 9.147   2.530   8.977   1.00 0.00 ? 113 LEU A HD23 3  
ATOM 5604  N N    . GLU A 1 115 ? 12.576  2.658   3.249   1.00 0.00 ? 114 GLU A N    3  
ATOM 5605  C CA   . GLU A 1 115 ? 13.158  3.388   2.087   1.00 0.00 ? 114 GLU A CA   3  
ATOM 5606  C C    . GLU A 1 115 ? 12.471  3.293   0.705   1.00 0.00 ? 114 GLU A C    3  
ATOM 5607  O O    . GLU A 1 115 ? 12.745  4.077   -0.193  1.00 0.00 ? 114 GLU A O    3  
ATOM 5608  C CB   . GLU A 1 115 ? 14.690  3.573   2.095   1.00 0.00 ? 114 GLU A CB   3  
ATOM 5609  C CG   . GLU A 1 115 ? 15.017  4.923   2.776   1.00 0.00 ? 114 GLU A CG   3  
ATOM 5610  C CD   . GLU A 1 115 ? 16.524  5.146   2.809   1.00 0.00 ? 114 GLU A CD   3  
ATOM 5611  O OE1  . GLU A 1 115 ? 17.227  4.335   3.471   1.00 0.00 ? 114 GLU A OE1  3  
ATOM 5612  O OE2  . GLU A 1 115 ? 16.994  6.128   2.176   1.00 0.00 ? 114 GLU A OE2  3  
ATOM 5613  H H    . GLU A 1 115 ? 13.064  1.978   3.773   1.00 0.00 ? 114 GLU A H    3  
ATOM 5614  H HA   . GLU A 1 115 ? 12.884  4.419   2.282   1.00 0.00 ? 114 GLU A HA   3  
ATOM 5615  H HB2  . GLU A 1 115 ? 15.159  2.731   2.648   1.00 0.00 ? 114 GLU A HB2  3  
ATOM 5616  H HB3  . GLU A 1 115 ? 15.114  3.585   1.065   1.00 0.00 ? 114 GLU A HB3  3  
ATOM 5617  H HG2  . GLU A 1 115 ? 14.511  5.755   2.209   1.00 0.00 ? 114 GLU A HG2  3  
ATOM 5618  H HG3  . GLU A 1 115 ? 14.611  4.903   3.818   1.00 0.00 ? 114 GLU A HG3  3  
ATOM 5619  N N    . GLN A 1 116 ? 11.478  2.367   0.612   1.00 0.00 ? 115 GLN A N    3  
ATOM 5620  C CA   . GLN A 1 116 ? 10.432  2.157   -0.386  1.00 0.00 ? 115 GLN A CA   3  
ATOM 5621  C C    . GLN A 1 116 ? 9.282   3.156   -0.179  1.00 0.00 ? 115 GLN A C    3  
ATOM 5622  O O    . GLN A 1 116 ? 8.812   3.799   -1.109  1.00 0.00 ? 115 GLN A O    3  
ATOM 5623  C CB   . GLN A 1 116 ? 9.834   0.728   -0.213  1.00 0.00 ? 115 GLN A CB   3  
ATOM 5624  C CG   . GLN A 1 116 ? 9.836   -0.110  -1.489  1.00 0.00 ? 115 GLN A CG   3  
ATOM 5625  C CD   . GLN A 1 116 ? 11.189  -0.789  -1.654  1.00 0.00 ? 115 GLN A CD   3  
ATOM 5626  O OE1  . GLN A 1 116 ? 11.494  -1.730  -0.907  1.00 0.00 ? 115 GLN A OE1  3  
ATOM 5627  N NE2  . GLN A 1 116 ? 11.984  -0.309  -2.640  1.00 0.00 ? 115 GLN A NE2  3  
ATOM 5628  H H    . GLN A 1 116 ? 11.371  1.801   1.424   1.00 0.00 ? 115 GLN A H    3  
ATOM 5629  H HA   . GLN A 1 116 ? 10.842  2.308   -1.372  1.00 0.00 ? 115 GLN A HA   3  
ATOM 5630  H HB2  . GLN A 1 116 ? 10.453  0.206   0.561   1.00 0.00 ? 115 GLN A HB2  3  
ATOM 5631  H HB3  . GLN A 1 116 ? 8.774   0.729   0.160   1.00 0.00 ? 115 GLN A HB3  3  
ATOM 5632  H HG2  . GLN A 1 116 ? 9.095   -0.931  -1.387  1.00 0.00 ? 115 GLN A HG2  3  
ATOM 5633  H HG3  . GLN A 1 116 ? 9.569   0.496   -2.379  1.00 0.00 ? 115 GLN A HG3  3  
ATOM 5634  H HE21 . GLN A 1 116 ? 11.578  0.376   -3.287  1.00 0.00 ? 115 GLN A HE21 3  
ATOM 5635  H HE22 . GLN A 1 116 ? 12.794  -0.857  -2.856  1.00 0.00 ? 115 GLN A HE22 3  
ATOM 5636  N N    . GLY A 1 117 ? 8.838   3.259   1.098   1.00 0.00 ? 116 GLY A N    3  
ATOM 5637  C CA   . GLY A 1 117 ? 7.820   4.107   1.716   1.00 0.00 ? 116 GLY A CA   3  
ATOM 5638  C C    . GLY A 1 117 ? 8.186   5.558   2.045   1.00 0.00 ? 116 GLY A C    3  
ATOM 5639  O O    . GLY A 1 117 ? 7.410   6.471   1.826   1.00 0.00 ? 116 GLY A O    3  
ATOM 5640  H H    . GLY A 1 117 ? 9.285   2.644   1.746   1.00 0.00 ? 116 GLY A H    3  
ATOM 5641  H HA2  . GLY A 1 117 ? 6.898   4.045   1.146   1.00 0.00 ? 116 GLY A HA2  3  
ATOM 5642  H HA3  . GLY A 1 117 ? 7.687   3.653   2.681   1.00 0.00 ? 116 GLY A HA3  3  
ATOM 5643  N N    . ASN A 1 118 ? 9.395   5.827   2.601   1.00 0.00 ? 117 ASN A N    3  
ATOM 5644  C CA   . ASN A 1 118 ? 9.994   7.096   3.044   1.00 0.00 ? 117 ASN A CA   3  
ATOM 5645  C C    . ASN A 1 118 ? 10.492  7.934   1.891   1.00 0.00 ? 117 ASN A C    3  
ATOM 5646  O O    . ASN A 1 118 ? 10.503  9.161   1.951   1.00 0.00 ? 117 ASN A O    3  
ATOM 5647  C CB   . ASN A 1 118 ? 11.130  6.936   4.107   1.00 0.00 ? 117 ASN A CB   3  
ATOM 5648  C CG   . ASN A 1 118 ? 10.527  6.656   5.485   1.00 0.00 ? 117 ASN A CG   3  
ATOM 5649  O OD1  . ASN A 1 118 ? 9.317   6.482   5.638   1.00 0.00 ? 117 ASN A OD1  3  
ATOM 5650  N ND2  . ASN A 1 118 ? 11.395  6.657   6.527   1.00 0.00 ? 117 ASN A ND2  3  
ATOM 5651  H H    . ASN A 1 118 ? 9.978   5.016   2.788   1.00 0.00 ? 117 ASN A H    3  
ATOM 5652  H HA   . ASN A 1 118 ? 9.218   7.687   3.490   1.00 0.00 ? 117 ASN A HA   3  
ATOM 5653  H HB2  . ASN A 1 118 ? 11.818  6.114   3.825   1.00 0.00 ? 117 ASN A HB2  3  
ATOM 5654  H HB3  . ASN A 1 118 ? 11.717  7.878   4.212   1.00 0.00 ? 117 ASN A HB3  3  
ATOM 5655  H HD21 . ASN A 1 118 ? 12.365  6.846   6.368   1.00 0.00 ? 117 ASN A HD21 3  
ATOM 5656  H HD22 . ASN A 1 118 ? 10.995  6.585   7.441   1.00 0.00 ? 117 ASN A HD22 3  
ATOM 5657  N N    . ARG A 1 119 ? 10.834  7.281   0.743   1.00 0.00 ? 118 ARG A N    3  
ATOM 5658  C CA   . ARG A 1 119 ? 11.209  7.938   -0.508  1.00 0.00 ? 118 ARG A CA   3  
ATOM 5659  C C    . ARG A 1 119 ? 9.995   8.616   -1.182  1.00 0.00 ? 118 ARG A C    3  
ATOM 5660  O O    . ARG A 1 119 ? 10.101  9.511   -2.011  1.00 0.00 ? 118 ARG A O    3  
ATOM 5661  C CB   . ARG A 1 119 ? 11.773  6.950   -1.558  1.00 0.00 ? 118 ARG A CB   3  
ATOM 5662  C CG   . ARG A 1 119 ? 10.772  5.893   -2.085  1.00 0.00 ? 118 ARG A CG   3  
ATOM 5663  C CD   . ARG A 1 119 ? 10.858  5.663   -3.604  1.00 0.00 ? 118 ARG A CD   3  
ATOM 5664  N NE   . ARG A 1 119 ? 12.254  5.218   -3.971  1.00 0.00 ? 118 ARG A NE   3  
ATOM 5665  C CZ   . ARG A 1 119 ? 12.670  3.912   -3.979  1.00 0.00 ? 118 ARG A CZ   3  
ATOM 5666  N NH1  . ARG A 1 119 ? 11.807  2.894   -3.699  1.00 0.00 ? 118 ARG A NH1  3  
ATOM 5667  N NH2  . ARG A 1 119 ? 13.972  3.624   -4.274  1.00 0.00 ? 118 ARG A NH2  3  
ATOM 5668  H H    . ARG A 1 119 ? 10.797  6.286   0.703   1.00 0.00 ? 118 ARG A H    3  
ATOM 5669  H HA   . ARG A 1 119 ? 12.001  8.637   -0.255  1.00 0.00 ? 118 ARG A HA   3  
ATOM 5670  H HB2  . ARG A 1 119 ? 12.158  7.533   -2.428  1.00 0.00 ? 118 ARG A HB2  3  
ATOM 5671  H HB3  . ARG A 1 119 ? 12.657  6.422   -1.134  1.00 0.00 ? 118 ARG A HB3  3  
ATOM 5672  H HG2  . ARG A 1 119 ? 10.975  4.936   -1.573  1.00 0.00 ? 118 ARG A HG2  3  
ATOM 5673  H HG3  . ARG A 1 119 ? 9.710   6.125   -1.809  1.00 0.00 ? 118 ARG A HG3  3  
ATOM 5674  H HD2  . ARG A 1 119 ? 10.109  4.910   -3.933  1.00 0.00 ? 118 ARG A HD2  3  
ATOM 5675  H HD3  . ARG A 1 119 ? 10.657  6.617   -4.141  1.00 0.00 ? 118 ARG A HD3  3  
ATOM 5676  H HE   . ARG A 1 119 ? 12.926  5.926   -4.188  1.00 0.00 ? 118 ARG A HE   3  
ATOM 5677  H HH11 . ARG A 1 119 ? 10.852  3.095   -3.481  1.00 0.00 ? 118 ARG A HH11 3  
ATOM 5678  H HH12 . ARG A 1 119 ? 12.128  1.948   -3.713  1.00 0.00 ? 118 ARG A HH12 3  
ATOM 5679  H HH21 . ARG A 1 119 ? 14.613  4.363   -4.477  1.00 0.00 ? 118 ARG A HH21 3  
ATOM 5680  H HH22 . ARG A 1 119 ? 14.284  2.674   -4.280  1.00 0.00 ? 118 ARG A HH22 3  
ATOM 5681  N N    . LEU A 1 120 ? 8.799   8.090   -0.784  1.00 0.00 ? 119 LEU A N    3  
ATOM 5682  C CA   . LEU A 1 120 ? 7.444   8.419   -1.186  1.00 0.00 ? 119 LEU A CA   3  
ATOM 5683  C C    . LEU A 1 120 ? 6.854   9.423   -0.272  1.00 0.00 ? 119 LEU A C    3  
ATOM 5684  O O    . LEU A 1 120 ? 6.091   10.283  -0.710  1.00 0.00 ? 119 LEU A O    3  
ATOM 5685  C CB   . LEU A 1 120 ? 6.501   7.180   -1.118  1.00 0.00 ? 119 LEU A CB   3  
ATOM 5686  C CG   . LEU A 1 120 ? 5.197   7.343   -1.898  1.00 0.00 ? 119 LEU A CG   3  
ATOM 5687  C CD1  . LEU A 1 120 ? 4.729   6.045   -2.489  1.00 0.00 ? 119 LEU A CD1  3  
ATOM 5688  C CD2  . LEU A 1 120 ? 4.025   7.782   -1.056  1.00 0.00 ? 119 LEU A CD2  3  
ATOM 5689  H H    . LEU A 1 120 ? 8.865   7.338   -0.124  1.00 0.00 ? 119 LEU A H    3  
ATOM 5690  H HA   . LEU A 1 120 ? 7.380   8.871   -2.168  1.00 0.00 ? 119 LEU A HA   3  
ATOM 5691  H HB2  . LEU A 1 120 ? 7.017   6.294   -1.518  1.00 0.00 ? 119 LEU A HB2  3  
ATOM 5692  H HB3  . LEU A 1 120 ? 6.243   6.875   -0.084  1.00 0.00 ? 119 LEU A HB3  3  
ATOM 5693  H HG   . LEU A 1 120 ? 5.382   8.048   -2.735  1.00 0.00 ? 119 LEU A HG   3  
ATOM 5694  H HD11 . LEU A 1 120 ? 5.610   5.530   -2.882  1.00 0.00 ? 119 LEU A HD11 3  
ATOM 5695  H HD12 . LEU A 1 120 ? 4.008   6.230   -3.317  1.00 0.00 ? 119 LEU A HD12 3  
ATOM 5696  H HD13 . LEU A 1 120 ? 4.244   5.402   -1.722  1.00 0.00 ? 119 LEU A HD13 3  
ATOM 5697  H HD21 . LEU A 1 120 ? 3.137   7.728   -1.719  1.00 0.00 ? 119 LEU A HD21 3  
ATOM 5698  H HD22 . LEU A 1 120 ? 4.179   8.812   -0.702  1.00 0.00 ? 119 LEU A HD22 3  
ATOM 5699  H HD23 . LEU A 1 120 ? 3.879   7.098   -0.195  1.00 0.00 ? 119 LEU A HD23 3  
ATOM 5700  N N    . ARG A 1 121 ? 7.137   9.290   1.051   1.00 0.00 ? 120 ARG A N    3  
ATOM 5701  C CA   . ARG A 1 121 ? 6.469   9.961   2.148   1.00 0.00 ? 120 ARG A CA   3  
ATOM 5702  C C    . ARG A 1 121 ? 6.204   11.474  2.072   1.00 0.00 ? 120 ARG A C    3  
ATOM 5703  O O    . ARG A 1 121 ? 5.176   11.973  2.510   1.00 0.00 ? 120 ARG A O    3  
ATOM 5704  C CB   . ARG A 1 121 ? 7.116   9.574   3.553   1.00 0.00 ? 120 ARG A CB   3  
ATOM 5705  C CG   . ARG A 1 121 ? 8.289   10.465  4.031   1.00 0.00 ? 120 ARG A CG   3  
ATOM 5706  C CD   . ARG A 1 121 ? 8.830   10.038  5.402   1.00 0.00 ? 120 ARG A CD   3  
ATOM 5707  N NE   . ARG A 1 121 ? 10.065  10.841  5.701   1.00 0.00 ? 120 ARG A NE   3  
ATOM 5708  C CZ   . ARG A 1 121 ? 10.789  10.695  6.853   1.00 0.00 ? 120 ARG A CZ   3  
ATOM 5709  N NH1  . ARG A 1 121 ? 10.398  9.815   7.820   1.00 0.00 ? 120 ARG A NH1  3  
ATOM 5710  N NH2  . ARG A 1 121 ? 11.917  11.442  7.038   1.00 0.00 ? 120 ARG A NH2  3  
ATOM 5711  H H    . ARG A 1 121 ? 7.750   8.561   1.340   1.00 0.00 ? 120 ARG A H    3  
ATOM 5712  H HA   . ARG A 1 121 ? 5.483   9.532   1.926   1.00 0.00 ? 120 ARG A HA   3  
ATOM 5713  H HB2  . ARG A 1 121 ? 6.349   9.716   4.340   1.00 0.00 ? 120 ARG A HB2  3  
ATOM 5714  H HB3  . ARG A 1 121 ? 7.436   8.482   3.637   1.00 0.00 ? 120 ARG A HB3  3  
ATOM 5715  H HG2  . ARG A 1 121 ? 9.100   10.449  3.278   1.00 0.00 ? 120 ARG A HG2  3  
ATOM 5716  H HG3  . ARG A 1 121 ? 7.951   11.522  4.140   1.00 0.00 ? 120 ARG A HG3  3  
ATOM 5717  H HD2  . ARG A 1 121 ? 8.067   10.221  6.190   1.00 0.00 ? 120 ARG A HD2  3  
ATOM 5718  H HD3  . ARG A 1 121 ? 9.098   8.963   5.382   1.00 0.00 ? 120 ARG A HD3  3  
ATOM 5719  H HE   . ARG A 1 121 ? 10.384  11.496  5.015   1.00 0.00 ? 120 ARG A HE   3  
ATOM 5720  H HH11 . ARG A 1 121 ? 9.573   9.264   7.689   1.00 0.00 ? 120 ARG A HH11 3  
ATOM 5721  H HH12 . ARG A 1 121 ? 10.933  9.722   8.660   1.00 0.00 ? 120 ARG A HH12 3  
ATOM 5722  H HH21 . ARG A 1 121 ? 12.210  12.086  6.330   1.00 0.00 ? 120 ARG A HH21 3  
ATOM 5723  H HH22 . ARG A 1 121 ? 12.452  11.343  7.877   1.00 0.00 ? 120 ARG A HH22 3  
ATOM 5724  N N    . GLU A 1 122 ? 7.158   12.197  1.441   1.00 0.00 ? 121 GLU A N    3  
ATOM 5725  C CA   . GLU A 1 122 ? 7.187   13.614  1.146   1.00 0.00 ? 121 GLU A CA   3  
ATOM 5726  C C    . GLU A 1 122 ? 6.661   13.980  -0.254  1.00 0.00 ? 121 GLU A C    3  
ATOM 5727  O O    . GLU A 1 122 ? 6.367   15.147  -0.503  1.00 0.00 ? 121 GLU A O    3  
ATOM 5728  C CB   . GLU A 1 122 ? 8.648   14.122  1.326   1.00 0.00 ? 121 GLU A CB   3  
ATOM 5729  C CG   . GLU A 1 122 ? 9.713   13.293  0.574   1.00 0.00 ? 121 GLU A CG   3  
ATOM 5730  C CD   . GLU A 1 122 ? 11.100  13.881  0.835   1.00 0.00 ? 121 GLU A CD   3  
ATOM 5731  O OE1  . GLU A 1 122 ? 11.336  15.047  0.420   1.00 0.00 ? 121 GLU A OE1  3  
ATOM 5732  O OE2  . GLU A 1 122 ? 11.941  13.169  1.447   1.00 0.00 ? 121 GLU A OE2  3  
ATOM 5733  H H    . GLU A 1 122 ? 7.959   11.703  1.116   1.00 0.00 ? 121 GLU A H    3  
ATOM 5734  H HA   . GLU A 1 122 ? 6.559   14.144  1.853   1.00 0.00 ? 121 GLU A HA   3  
ATOM 5735  H HB2  . GLU A 1 122 ? 8.719   15.197  1.043   1.00 0.00 ? 121 GLU A HB2  3  
ATOM 5736  H HB3  . GLU A 1 122 ? 8.889   14.063  2.413   1.00 0.00 ? 121 GLU A HB3  3  
ATOM 5737  H HG2  . GLU A 1 122 ? 9.699   12.237  0.929   1.00 0.00 ? 121 GLU A HG2  3  
ATOM 5738  H HG3  . GLU A 1 122 ? 9.516   13.303  -0.519  1.00 0.00 ? 121 GLU A HG3  3  
ATOM 5739  N N    . GLN A 1 123 ? 6.542   13.005  -1.204  1.00 0.00 ? 122 GLN A N    3  
ATOM 5740  C CA   . GLN A 1 123 ? 6.075   13.213  -2.566  1.00 0.00 ? 122 GLN A CA   3  
ATOM 5741  C C    . GLN A 1 123 ? 4.651   12.713  -2.784  1.00 0.00 ? 122 GLN A C    3  
ATOM 5742  O O    . GLN A 1 123 ? 3.886   13.417  -3.442  1.00 0.00 ? 122 GLN A O    3  
ATOM 5743  C CB   . GLN A 1 123 ? 7.056   12.665  -3.665  1.00 0.00 ? 122 GLN A CB   3  
ATOM 5744  C CG   . GLN A 1 123 ? 7.537   11.204  -3.479  1.00 0.00 ? 122 GLN A CG   3  
ATOM 5745  C CD   . GLN A 1 123 ? 8.229   10.558  -4.695  1.00 0.00 ? 122 GLN A CD   3  
ATOM 5746  O OE1  . GLN A 1 123 ? 7.899   9.419   -5.028  1.00 0.00 ? 122 GLN A OE1  3  
ATOM 5747  N NE2  . GLN A 1 123 ? 9.178   11.259  -5.354  1.00 0.00 ? 122 GLN A NE2  3  
ATOM 5748  H H    . GLN A 1 123 ? 6.736   12.046  -0.993  1.00 0.00 ? 122 GLN A H    3  
ATOM 5749  H HA   . GLN A 1 123 ? 6.004   14.276  -2.767  1.00 0.00 ? 122 GLN A HA   3  
ATOM 5750  H HB2  . GLN A 1 123 ? 6.584   12.771  -4.670  1.00 0.00 ? 122 GLN A HB2  3  
ATOM 5751  H HB3  . GLN A 1 123 ? 7.955   13.323  -3.655  1.00 0.00 ? 122 GLN A HB3  3  
ATOM 5752  H HG2  . GLN A 1 123 ? 8.233   11.150  -2.618  1.00 0.00 ? 122 GLN A HG2  3  
ATOM 5753  H HG3  . GLN A 1 123 ? 6.658   10.547  -3.273  1.00 0.00 ? 122 GLN A HG3  3  
ATOM 5754  H HE21 . GLN A 1 123 ? 9.474   12.131  -4.969  1.00 0.00 ? 122 GLN A HE21 3  
ATOM 5755  H HE22 . GLN A 1 123 ? 9.569   10.839  -6.172  1.00 0.00 ? 122 GLN A HE22 3  
ATOM 5756  N N    . TYR A 1 124 ? 4.241   11.490  -2.305  1.00 0.00 ? 123 TYR A N    3  
ATOM 5757  C CA   . TYR A 1 124 ? 2.884   11.016  -2.668  1.00 0.00 ? 123 TYR A CA   3  
ATOM 5758  C C    . TYR A 1 124 ? 1.984   10.483  -1.573  1.00 0.00 ? 123 TYR A C    3  
ATOM 5759  O O    . TYR A 1 124 ? 0.954   9.908   -1.923  1.00 0.00 ? 123 TYR A O    3  
ATOM 5760  C CB   . TYR A 1 124 ? 2.873   9.888   -3.758  1.00 0.00 ? 123 TYR A CB   3  
ATOM 5761  C CG   . TYR A 1 124 ? 3.691   10.207  -4.956  1.00 0.00 ? 123 TYR A CG   3  
ATOM 5762  C CD1  . TYR A 1 124 ? 3.467   11.322  -5.740  1.00 0.00 ? 123 TYR A CD1  3  
ATOM 5763  C CD2  . TYR A 1 124 ? 4.671   9.319   -5.318  1.00 0.00 ? 123 TYR A CD2  3  
ATOM 5764  C CE1  . TYR A 1 124 ? 4.244   11.554  -6.859  1.00 0.00 ? 123 TYR A CE1  3  
ATOM 5765  C CE2  . TYR A 1 124 ? 5.399   9.513   -6.459  1.00 0.00 ? 123 TYR A CE2  3  
ATOM 5766  C CZ   . TYR A 1 124 ? 5.215   10.642  -7.224  1.00 0.00 ? 123 TYR A CZ   3  
ATOM 5767  O OH   . TYR A 1 124 ? 6.026   10.860  -8.355  1.00 0.00 ? 123 TYR A OH   3  
ATOM 5768  H H    . TYR A 1 124 ? 4.852   10.873  -1.740  1.00 0.00 ? 123 TYR A H    3  
ATOM 5769  H HA   . TYR A 1 124 ? 2.286   11.818  -3.086  1.00 0.00 ? 123 TYR A HA   3  
ATOM 5770  H HB2  . TYR A 1 124 ? 3.258   8.935   -3.344  1.00 0.00 ? 123 TYR A HB2  3  
ATOM 5771  H HB3  . TYR A 1 124 ? 1.850   9.688   -4.151  1.00 0.00 ? 123 TYR A HB3  3  
ATOM 5772  H HD1  . TYR A 1 124 ? 2.703   12.034  -5.456  1.00 0.00 ? 123 TYR A HD1  3  
ATOM 5773  H HD2  . TYR A 1 124 ? 4.877   8.449   -4.713  1.00 0.00 ? 123 TYR A HD2  3  
ATOM 5774  H HE1  . TYR A 1 124 ? 4.075   12.451  -7.432  1.00 0.00 ? 123 TYR A HE1  3  
ATOM 5775  H HE2  . TYR A 1 124 ? 6.148   8.771   -6.668  1.00 0.00 ? 123 TYR A HE2  3  
ATOM 5776  H HH   . TYR A 1 124 ? 5.770   11.697  -8.752  1.00 0.00 ? 123 TYR A HH   3  
ATOM 5777  N N    . GLY A 1 125 ? 2.277   10.519  -0.241  1.00 0.00 ? 124 GLY A N    3  
ATOM 5778  C CA   . GLY A 1 125 ? 1.390   9.720   0.558   1.00 0.00 ? 124 GLY A CA   3  
ATOM 5779  C C    . GLY A 1 125 ? 1.925   9.737   1.920   1.00 0.00 ? 124 GLY A C    3  
ATOM 5780  O O    . GLY A 1 125 ? 1.359   10.469  2.717   1.00 0.00 ? 124 GLY A O    3  
ATOM 5781  H H    . GLY A 1 125 ? 3.028   10.926  0.309   1.00 0.00 ? 124 GLY A H    3  
ATOM 5782  H HA2  . GLY A 1 125 ? 0.452   10.248  0.610   1.00 0.00 ? 124 GLY A HA2  3  
ATOM 5783  H HA3  . GLY A 1 125 ? 1.244   8.671   0.225   1.00 0.00 ? 124 GLY A HA3  3  
ATOM 5784  N N    . LEU A 1 126 ? 3.006   8.939   2.226   1.00 0.00 ? 125 LEU A N    3  
ATOM 5785  C CA   . LEU A 1 126 ? 3.522   8.491   3.547   1.00 0.00 ? 125 LEU A CA   3  
ATOM 5786  C C    . LEU A 1 126 ? 3.755   9.490   4.710   1.00 0.00 ? 125 LEU A C    3  
ATOM 5787  O O    . LEU A 1 126 ? 4.232   9.120   5.782   1.00 0.00 ? 125 LEU A O    3  
ATOM 5788  C CB   . LEU A 1 126 ? 4.612   7.342   3.459   1.00 0.00 ? 125 LEU A CB   3  
ATOM 5789  C CG   . LEU A 1 126 ? 4.115   5.880   3.528   1.00 0.00 ? 125 LEU A CG   3  
ATOM 5790  C CD1  . LEU A 1 126 ? 3.157   5.596   4.723   1.00 0.00 ? 125 LEU A CD1  3  
ATOM 5791  C CD2  . LEU A 1 126 ? 3.722   5.424   2.101   1.00 0.00 ? 125 LEU A CD2  3  
ATOM 5792  H H    . LEU A 1 126 ? 3.408   8.436   1.472   1.00 0.00 ? 125 LEU A H    3  
ATOM 5793  H HA   . LEU A 1 126 ? 2.706   7.939   3.936   1.00 0.00 ? 125 LEU A HA   3  
ATOM 5794  H HB2  . LEU A 1 126 ? 5.139   7.363   2.477   1.00 0.00 ? 125 LEU A HB2  3  
ATOM 5795  H HB3  . LEU A 1 126 ? 5.367   7.439   4.272   1.00 0.00 ? 125 LEU A HB3  3  
ATOM 5796  H HG   . LEU A 1 126 ? 5.011   5.247   3.758   1.00 0.00 ? 125 LEU A HG   3  
ATOM 5797  H HD11 . LEU A 1 126 ? 2.242   6.225   4.770   1.00 0.00 ? 125 LEU A HD11 3  
ATOM 5798  H HD12 . LEU A 1 126 ? 3.684   5.801   5.678   1.00 0.00 ? 125 LEU A HD12 3  
ATOM 5799  H HD13 . LEU A 1 126 ? 2.845   4.535   4.730   1.00 0.00 ? 125 LEU A HD13 3  
ATOM 5800  H HD21 . LEU A 1 126 ? 3.534   4.336   2.058   1.00 0.00 ? 125 LEU A HD21 3  
ATOM 5801  H HD22 . LEU A 1 126 ? 4.559   5.582   1.374   1.00 0.00 ? 125 LEU A HD22 3  
ATOM 5802  H HD23 . LEU A 1 126 ? 2.834   5.986   1.737   1.00 0.00 ? 125 LEU A HD23 3  
ATOM 5803  N N    . GLY A 1 127 ? 3.296   10.760  4.559   1.00 0.00 ? 126 GLY A N    3  
ATOM 5804  C CA   . GLY A 1 127 ? 3.237   11.710  5.687   1.00 0.00 ? 126 GLY A CA   3  
ATOM 5805  C C    . GLY A 1 127 ? 2.404   12.981  5.551   1.00 0.00 ? 126 GLY A C    3  
ATOM 5806  O O    . GLY A 1 127 ? 2.989   13.992  5.177   1.00 0.00 ? 126 GLY A O    3  
ATOM 5807  H H    . GLY A 1 127 ? 2.895   10.976  3.637   1.00 0.00 ? 126 GLY A H    3  
ATOM 5808  H HA2  . GLY A 1 127 ? 2.853   11.204  6.565   1.00 0.00 ? 126 GLY A HA2  3  
ATOM 5809  H HA3  . GLY A 1 127 ? 4.252   12.055  5.836   1.00 0.00 ? 126 GLY A HA3  3  
ATOM 5810  N N    . PRO A 1 128 ? 1.083   13.098  5.852   1.00 0.00 ? 127 PRO A N    3  
ATOM 5811  C CA   . PRO A 1 128 ? 0.347   14.366  5.787   1.00 0.00 ? 127 PRO A CA   3  
ATOM 5812  C C    . PRO A 1 128 ? 0.281   15.053  7.175   1.00 0.00 ? 127 PRO A C    3  
ATOM 5813  O O    . PRO A 1 128 ? -0.734  15.684  7.471   1.00 0.00 ? 127 PRO A O    3  
ATOM 5814  C CB   . PRO A 1 128 ? -1.053  13.852  5.390   1.00 0.00 ? 127 PRO A CB   3  
ATOM 5815  C CG   . PRO A 1 128 ? -1.223  12.600  6.262   1.00 0.00 ? 127 PRO A CG   3  
ATOM 5816  C CD   . PRO A 1 128 ? 0.200   11.997  6.259   1.00 0.00 ? 127 PRO A CD   3  
ATOM 5817  H HA   . PRO A 1 128 ? 0.755   15.062  5.066   1.00 0.00 ? 127 PRO A HA   3  
ATOM 5818  H HB2  . PRO A 1 128 ? -1.867  14.591  5.540   1.00 0.00 ? 127 PRO A HB2  3  
ATOM 5819  H HB3  . PRO A 1 128 ? -1.038  13.549  4.318   1.00 0.00 ? 127 PRO A HB3  3  
ATOM 5820  H HG2  . PRO A 1 128 ? -1.544  12.942  7.275   1.00 0.00 ? 127 PRO A HG2  3  
ATOM 5821  H HG3  . PRO A 1 128 ? -2.017  11.932  5.884   1.00 0.00 ? 127 PRO A HG3  3  
ATOM 5822  H HD2  . PRO A 1 128 ? 0.481   11.622  7.267   1.00 0.00 ? 127 PRO A HD2  3  
ATOM 5823  H HD3  . PRO A 1 128 ? 0.255   11.177  5.511   1.00 0.00 ? 127 PRO A HD3  3  
ATOM 5824  N N    . TYR A 1 129 ? 1.310   14.936  8.055   1.00 0.00 ? 128 TYR A N    3  
ATOM 5825  C CA   . TYR A 1 129 ? 1.299   15.433  9.427   1.00 0.00 ? 128 TYR A CA   3  
ATOM 5826  C C    . TYR A 1 129 ? 2.336   16.525  9.658   1.00 0.00 ? 128 TYR A C    3  
ATOM 5827  O O    . TYR A 1 129 ? 3.502   16.397  9.294   1.00 0.00 ? 128 TYR A O    3  
ATOM 5828  C CB   . TYR A 1 129 ? 1.377   14.271  10.484  1.00 0.00 ? 128 TYR A CB   3  
ATOM 5829  C CG   . TYR A 1 129 ? 2.679   13.487  10.568  1.00 0.00 ? 128 TYR A CG   3  
ATOM 5830  C CD1  . TYR A 1 129 ? 3.057   12.619  9.561   1.00 0.00 ? 128 TYR A CD1  3  
ATOM 5831  C CD2  . TYR A 1 129 ? 3.488   13.572  11.695  1.00 0.00 ? 128 TYR A CD2  3  
ATOM 5832  C CE1  . TYR A 1 129 ? 4.197   11.848  9.676   1.00 0.00 ? 128 TYR A CE1  3  
ATOM 5833  C CE2  . TYR A 1 129 ? 4.626   12.792  11.819  1.00 0.00 ? 128 TYR A CE2  3  
ATOM 5834  C CZ   . TYR A 1 129 ? 4.974   11.916  10.811  1.00 0.00 ? 128 TYR A CZ   3  
ATOM 5835  O OH   . TYR A 1 129 ? 6.103   11.071  10.919  1.00 0.00 ? 128 TYR A OH   3  
ATOM 5836  H H    . TYR A 1 129 ? 2.135   14.444  7.779   1.00 0.00 ? 128 TYR A H    3  
ATOM 5837  H HA   . TYR A 1 129 ? 0.346   15.911  9.624   1.00 0.00 ? 128 TYR A HA   3  
ATOM 5838  H HB2  . TYR A 1 129 ? 1.152   14.671  11.497  1.00 0.00 ? 128 TYR A HB2  3  
ATOM 5839  H HB3  . TYR A 1 129 ? 0.581   13.535  10.240  1.00 0.00 ? 128 TYR A HB3  3  
ATOM 5840  H HD1  . TYR A 1 129 ? 2.440   12.513  8.683   1.00 0.00 ? 128 TYR A HD1  3  
ATOM 5841  H HD2  . TYR A 1 129 ? 3.213   14.243  12.499  1.00 0.00 ? 128 TYR A HD2  3  
ATOM 5842  H HE1  . TYR A 1 129 ? 4.464   11.166  8.879   1.00 0.00 ? 128 TYR A HE1  3  
ATOM 5843  H HE2  . TYR A 1 129 ? 5.227   12.858  12.716  1.00 0.00 ? 128 TYR A HE2  3  
ATOM 5844  H HH   . TYR A 1 129 ? 6.550   11.253  11.747  1.00 0.00 ? 128 TYR A HH   3  
ATOM 5845  N N    . GLU A 1 130 ? 1.913   17.635  10.304  1.00 0.00 ? 129 GLU A N    3  
ATOM 5846  C CA   . GLU A 1 130 ? 2.758   18.762  10.647  1.00 0.00 ? 129 GLU A CA   3  
ATOM 5847  C C    . GLU A 1 130 ? 2.151   19.389  11.886  1.00 0.00 ? 129 GLU A C    3  
ATOM 5848  O O    . GLU A 1 130 ? 0.977   19.149  12.176  1.00 0.00 ? 129 GLU A O    3  
ATOM 5849  C CB   . GLU A 1 130 ? 2.863   19.790  9.484   1.00 0.00 ? 129 GLU A CB   3  
ATOM 5850  C CG   . GLU A 1 130 ? 3.830   20.960  9.748   1.00 0.00 ? 129 GLU A CG   3  
ATOM 5851  C CD   . GLU A 1 130 ? 3.968   21.808  8.484   1.00 0.00 ? 129 GLU A CD   3  
ATOM 5852  O OE1  . GLU A 1 130 ? 2.941   22.391  8.045   1.00 0.00 ? 129 GLU A OE1  3  
ATOM 5853  O OE2  . GLU A 1 130 ? 5.103   21.885  7.941   1.00 0.00 ? 129 GLU A OE2  3  
ATOM 5854  H H    . GLU A 1 130 ? 0.965   17.731  10.605  1.00 0.00 ? 129 GLU A H    3  
ATOM 5855  H HA   . GLU A 1 130 ? 3.751   18.414  10.915  1.00 0.00 ? 129 GLU A HA   3  
ATOM 5856  H HB2  . GLU A 1 130 ? 3.239   19.235  8.593   1.00 0.00 ? 129 GLU A HB2  3  
ATOM 5857  H HB3  . GLU A 1 130 ? 1.854   20.178  9.222   1.00 0.00 ? 129 GLU A HB3  3  
ATOM 5858  H HG2  . GLU A 1 130 ? 3.456   21.603  10.573  1.00 0.00 ? 129 GLU A HG2  3  
ATOM 5859  H HG3  . GLU A 1 130 ? 4.824   20.557  10.039  1.00 0.00 ? 129 GLU A HG3  3  
ATOM 5860  N N    . ASN A 1 8   ? -10.775 13.425  0.244   1.00 0.00 ? 7   ASN A N    4  
ATOM 5861  C CA   . ASN A 1 8   ? -11.775 14.418  -0.076  1.00 0.00 ? 7   ASN A CA   4  
ATOM 5862  C C    . ASN A 1 8   ? -12.372 13.993  -1.401  1.00 0.00 ? 7   ASN A C    4  
ATOM 5863  O O    . ASN A 1 8   ? -13.565 14.131  -1.655  1.00 0.00 ? 7   ASN A O    4  
ATOM 5864  C CB   . ASN A 1 8   ? -11.211 15.873  -0.093  1.00 0.00 ? 7   ASN A CB   4  
ATOM 5865  C CG   . ASN A 1 8   ? -10.843 16.316  1.327   1.00 0.00 ? 7   ASN A CG   4  
ATOM 5866  O OD1  . ASN A 1 8   ? -11.716 16.550  2.165   1.00 0.00 ? 7   ASN A OD1  4  
ATOM 5867  N ND2  . ASN A 1 8   ? -9.527  16.423  1.642   1.00 0.00 ? 7   ASN A ND2  4  
ATOM 5868  H H    . ASN A 1 8   ? -10.507 13.324  1.205   1.00 0.00 ? 7   ASN A H    4  
ATOM 5869  H HA   . ASN A 1 8   ? -12.565 14.336  0.658   1.00 0.00 ? 7   ASN A HA   4  
ATOM 5870  H HB2  . ASN A 1 8   ? -10.329 15.947  -0.760  1.00 0.00 ? 7   ASN A HB2  4  
ATOM 5871  H HB3  . ASN A 1 8   ? -11.989 16.582  -0.453  1.00 0.00 ? 7   ASN A HB3  4  
ATOM 5872  H HD21 . ASN A 1 8   ? -8.839  16.208  0.940   1.00 0.00 ? 7   ASN A HD21 4  
ATOM 5873  H HD22 . ASN A 1 8   ? -9.324  16.696  2.591   1.00 0.00 ? 7   ASN A HD22 4  
ATOM 5874  N N    . SER A 1 9   ? -11.521 13.430  -2.292  1.00 0.00 ? 8   SER A N    4  
ATOM 5875  C CA   . SER A 1 9   ? -11.886 12.859  -3.594  1.00 0.00 ? 8   SER A CA   4  
ATOM 5876  C C    . SER A 1 9   ? -11.170 11.526  -3.787  1.00 0.00 ? 8   SER A C    4  
ATOM 5877  O O    . SER A 1 9   ? -11.188 10.937  -4.863  1.00 0.00 ? 8   SER A O    4  
ATOM 5878  C CB   . SER A 1 9   ? -11.574 13.799  -4.794  1.00 0.00 ? 8   SER A CB   4  
ATOM 5879  O OG   . SER A 1 9   ? -12.459 14.918  -4.801  1.00 0.00 ? 8   SER A OG   4  
ATOM 5880  H H    . SER A 1 9   ? -10.563 13.407  -2.022  1.00 0.00 ? 8   SER A H    4  
ATOM 5881  H HA   . SER A 1 9   ? -12.944 12.624  -3.617  1.00 0.00 ? 8   SER A HA   4  
ATOM 5882  H HB2  . SER A 1 9   ? -10.526 14.167  -4.724  1.00 0.00 ? 8   SER A HB2  4  
ATOM 5883  H HB3  . SER A 1 9   ? -11.704 13.281  -5.771  1.00 0.00 ? 8   SER A HB3  4  
ATOM 5884  H HG   . SER A 1 9   ? -12.781 15.023  -3.896  1.00 0.00 ? 8   SER A HG   4  
ATOM 5885  N N    . PHE A 1 10  ? -10.513 11.025  -2.711  1.00 0.00 ? 9   PHE A N    4  
ATOM 5886  C CA   . PHE A 1 10  ? -9.751  9.784   -2.678  1.00 0.00 ? 9   PHE A CA   4  
ATOM 5887  C C    . PHE A 1 10  ? -10.292 8.844   -1.626  1.00 0.00 ? 9   PHE A C    4  
ATOM 5888  O O    . PHE A 1 10  ? -9.593  8.023   -1.044  1.00 0.00 ? 9   PHE A O    4  
ATOM 5889  C CB   . PHE A 1 10  ? -8.208  9.981   -2.585  1.00 0.00 ? 9   PHE A CB   4  
ATOM 5890  C CG   . PHE A 1 10  ? -7.714  10.965  -1.569  1.00 0.00 ? 9   PHE A CG   4  
ATOM 5891  C CD1  . PHE A 1 10  ? -7.746  12.339  -1.737  1.00 0.00 ? 9   PHE A CD1  4  
ATOM 5892  C CD2  . PHE A 1 10  ? -7.026  10.455  -0.501  1.00 0.00 ? 9   PHE A CD2  4  
ATOM 5893  C CE1  . PHE A 1 10  ? -7.110  13.170  -0.831  1.00 0.00 ? 9   PHE A CE1  4  
ATOM 5894  C CE2  . PHE A 1 10  ? -6.336  11.264  0.352   1.00 0.00 ? 9   PHE A CE2  4  
ATOM 5895  C CZ   . PHE A 1 10  ? -6.384  12.634  0.215   1.00 0.00 ? 9   PHE A CZ   4  
ATOM 5896  H H    . PHE A 1 10  ? -10.531 11.534  -1.855  1.00 0.00 ? 9   PHE A H    4  
ATOM 5897  H HA   . PHE A 1 10  ? -9.905  9.209   -3.585  1.00 0.00 ? 9   PHE A HA   4  
ATOM 5898  H HB2  . PHE A 1 10  ? -7.712  9.013   -2.373  1.00 0.00 ? 9   PHE A HB2  4  
ATOM 5899  H HB3  . PHE A 1 10  ? -7.799  10.290  -3.556  1.00 0.00 ? 9   PHE A HB3  4  
ATOM 5900  H HD1  . PHE A 1 10  ? -8.231  12.767  -2.602  1.00 0.00 ? 9   PHE A HD1  4  
ATOM 5901  H HD2  . PHE A 1 10  ? -6.928  9.387   -0.384  1.00 0.00 ? 9   PHE A HD2  4  
ATOM 5902  H HE1  . PHE A 1 10  ? -7.142  14.241  -0.975  1.00 0.00 ? 9   PHE A HE1  4  
ATOM 5903  H HE2  . PHE A 1 10  ? -5.723  10.758  1.075   1.00 0.00 ? 9   PHE A HE2  4  
ATOM 5904  H HZ   . PHE A 1 10  ? -5.841  13.270  0.904   1.00 0.00 ? 9   PHE A HZ   4  
ATOM 5905  N N    . VAL A 1 11  ? -11.619 8.884   -1.390  1.00 0.00 ? 10  VAL A N    4  
ATOM 5906  C CA   . VAL A 1 11  ? -12.357 8.006   -0.479  1.00 0.00 ? 10  VAL A CA   4  
ATOM 5907  C C    . VAL A 1 11  ? -12.575 6.548   -0.916  1.00 0.00 ? 10  VAL A C    4  
ATOM 5908  O O    . VAL A 1 11  ? -13.227 5.776   -0.227  1.00 0.00 ? 10  VAL A O    4  
ATOM 5909  C CB   . VAL A 1 11  ? -13.544 8.709   0.148   1.00 0.00 ? 10  VAL A CB   4  
ATOM 5910  C CG1  . VAL A 1 11  ? -13.050 10.136  0.421   1.00 0.00 ? 10  VAL A CG1  4  
ATOM 5911  C CG2  . VAL A 1 11  ? -14.816 8.747   -0.705  1.00 0.00 ? 10  VAL A CG2  4  
ATOM 5912  H H    . VAL A 1 11  ? -12.172 9.623   -1.802  1.00 0.00 ? 10  VAL A H    4  
ATOM 5913  H HA   . VAL A 1 11  ? -11.713 7.890   0.385   1.00 0.00 ? 10  VAL A HA   4  
ATOM 5914  H HB   . VAL A 1 11  ? -13.786 8.208   1.109   1.00 0.00 ? 10  VAL A HB   4  
ATOM 5915  H HG11 . VAL A 1 11  ? -12.936 10.671  -0.545  1.00 0.00 ? 10  VAL A HG11 4  
ATOM 5916  H HG12 . VAL A 1 11  ? -12.053 10.088  0.912   1.00 0.00 ? 10  VAL A HG12 4  
ATOM 5917  H HG13 . VAL A 1 11  ? -13.765 10.719  1.029   1.00 0.00 ? 10  VAL A HG13 4  
ATOM 5918  H HG21 . VAL A 1 11  ? -15.200 7.722   -0.895  1.00 0.00 ? 10  VAL A HG21 4  
ATOM 5919  H HG22 . VAL A 1 11  ? -14.635 9.263   -1.669  1.00 0.00 ? 10  VAL A HG22 4  
ATOM 5920  H HG23 . VAL A 1 11  ? -15.587 9.307   -0.126  1.00 0.00 ? 10  VAL A HG23 4  
ATOM 5921  N N    . GLY A 1 12  ? -11.945 6.145   -2.050  1.00 0.00 ? 11  GLY A N    4  
ATOM 5922  C CA   . GLY A 1 12  ? -11.832 4.798   -2.599  1.00 0.00 ? 11  GLY A CA   4  
ATOM 5923  C C    . GLY A 1 12  ? -10.415 4.513   -3.072  1.00 0.00 ? 11  GLY A C    4  
ATOM 5924  O O    . GLY A 1 12  ? -10.207 3.686   -3.953  1.00 0.00 ? 11  GLY A O    4  
ATOM 5925  H H    . GLY A 1 12  ? -11.422 6.846   -2.513  1.00 0.00 ? 11  GLY A H    4  
ATOM 5926  H HA2  . GLY A 1 12  ? -12.042 4.065   -1.807  1.00 0.00 ? 11  GLY A HA2  4  
ATOM 5927  H HA3  . GLY A 1 12  ? -12.465 4.765   -3.494  1.00 0.00 ? 11  GLY A HA3  4  
ATOM 5928  N N    . LEU A 1 13  ? -9.391  5.191   -2.475  1.00 0.00 ? 12  LEU A N    4  
ATOM 5929  C CA   . LEU A 1 13  ? -7.934  5.060   -2.684  1.00 0.00 ? 12  LEU A CA   4  
ATOM 5930  C C    . LEU A 1 13  ? -7.280  3.817   -2.124  1.00 0.00 ? 12  LEU A C    4  
ATOM 5931  O O    . LEU A 1 13  ? -7.867  2.980   -1.432  1.00 0.00 ? 12  LEU A O    4  
ATOM 5932  C CB   . LEU A 1 13  ? -7.068  6.364   -2.672  1.00 0.00 ? 12  LEU A CB   4  
ATOM 5933  C CG   . LEU A 1 13  ? -5.846  6.656   -1.783  1.00 0.00 ? 12  LEU A CG   4  
ATOM 5934  C CD1  . LEU A 1 13  ? -5.187  7.927   -2.377  1.00 0.00 ? 12  LEU A CD1  4  
ATOM 5935  C CD2  . LEU A 1 13  ? -6.512  6.790   -0.391  1.00 0.00 ? 12  LEU A CD2  4  
ATOM 5936  H H    . LEU A 1 13  ? -9.628  5.836   -1.751  1.00 0.00 ? 12  LEU A H    4  
ATOM 5937  H HA   . LEU A 1 13  ? -7.875  4.842   -3.745  1.00 0.00 ? 12  LEU A HA   4  
ATOM 5938  H HB2  . LEU A 1 13  ? -6.863  6.662   -3.722  1.00 0.00 ? 12  LEU A HB2  4  
ATOM 5939  H HB3  . LEU A 1 13  ? -7.705  7.133   -2.205  1.00 0.00 ? 12  LEU A HB3  4  
ATOM 5940  H HG   . LEU A 1 13  ? -4.985  5.936   -1.760  1.00 0.00 ? 12  LEU A HG   4  
ATOM 5941  H HD11 . LEU A 1 13  ? -4.100  7.948   -2.147  1.00 0.00 ? 12  LEU A HD11 4  
ATOM 5942  H HD12 . LEU A 1 13  ? -5.621  8.850   -1.929  1.00 0.00 ? 12  LEU A HD12 4  
ATOM 5943  H HD13 . LEU A 1 13  ? -5.287  7.964   -3.481  1.00 0.00 ? 12  LEU A HD13 4  
ATOM 5944  H HD21 . LEU A 1 13  ? -5.899  7.173   0.418   1.00 0.00 ? 12  LEU A HD21 4  
ATOM 5945  H HD22 . LEU A 1 13  ? -6.887  5.803   -0.064  1.00 0.00 ? 12  LEU A HD22 4  
ATOM 5946  H HD23 . LEU A 1 13  ? -7.367  7.502   -0.449  1.00 0.00 ? 12  LEU A HD23 4  
ATOM 5947  N N    . ARG A 1 14  ? -6.009  3.626   -2.517  1.00 0.00 ? 13  ARG A N    4  
ATOM 5948  C CA   . ARG A 1 14  ? -5.217  2.442   -2.237  1.00 0.00 ? 13  ARG A CA   4  
ATOM 5949  C C    . ARG A 1 14  ? -4.425  2.807   -1.010  1.00 0.00 ? 13  ARG A C    4  
ATOM 5950  O O    . ARG A 1 14  ? -3.827  3.871   -0.980  1.00 0.00 ? 13  ARG A O    4  
ATOM 5951  C CB   . ARG A 1 14  ? -4.365  2.074   -3.485  1.00 0.00 ? 13  ARG A CB   4  
ATOM 5952  C CG   . ARG A 1 14  ? -5.016  0.946   -4.322  1.00 0.00 ? 13  ARG A CG   4  
ATOM 5953  C CD   . ARG A 1 14  ? -6.306  1.308   -5.080  1.00 0.00 ? 13  ARG A CD   4  
ATOM 5954  N NE   . ARG A 1 14  ? -5.987  2.263   -6.203  1.00 0.00 ? 13  ARG A NE   4  
ATOM 5955  C CZ   . ARG A 1 14  ? -5.705  1.870   -7.486  1.00 0.00 ? 13  ARG A CZ   4  
ATOM 5956  N NH1  . ARG A 1 14  ? -5.723  0.554   -7.845  1.00 0.00 ? 13  ARG A NH1  4  
ATOM 5957  N NH2  . ARG A 1 14  ? -5.397  2.815   -8.422  1.00 0.00 ? 13  ARG A NH2  4  
ATOM 5958  H H    . ARG A 1 14  ? -5.515  4.416   -2.901  1.00 0.00 ? 13  ARG A H    4  
ATOM 5959  H HA   . ARG A 1 14  ? -5.842  1.594   -1.981  1.00 0.00 ? 13  ARG A HA   4  
ATOM 5960  H HB2  . ARG A 1 14  ? -4.184  2.976   -4.108  1.00 0.00 ? 13  ARG A HB2  4  
ATOM 5961  H HB3  . ARG A 1 14  ? -3.362  1.704   -3.182  1.00 0.00 ? 13  ARG A HB3  4  
ATOM 5962  H HG2  . ARG A 1 14  ? -4.273  0.555   -5.047  1.00 0.00 ? 13  ARG A HG2  4  
ATOM 5963  H HG3  . ARG A 1 14  ? -5.251  0.112   -3.621  1.00 0.00 ? 13  ARG A HG3  4  
ATOM 5964  H HD2  . ARG A 1 14  ? -6.786  0.385   -5.478  1.00 0.00 ? 13  ARG A HD2  4  
ATOM 5965  H HD3  . ARG A 1 14  ? -7.035  1.804   -4.409  1.00 0.00 ? 13  ARG A HD3  4  
ATOM 5966  H HE   . ARG A 1 14  ? -5.960  3.239   -5.990  1.00 0.00 ? 13  ARG A HE   4  
ATOM 5967  H HH11 . ARG A 1 14  ? -5.946  -0.145  -7.165  1.00 0.00 ? 13  ARG A HH11 4  
ATOM 5968  H HH12 . ARG A 1 14  ? -5.513  0.289   -8.785  1.00 0.00 ? 13  ARG A HH12 4  
ATOM 5969  H HH21 . ARG A 1 14  ? -5.378  3.783   -8.169  1.00 0.00 ? 13  ARG A HH21 4  
ATOM 5970  H HH22 . ARG A 1 14  ? -5.187  2.540   -9.360  1.00 0.00 ? 13  ARG A HH22 4  
ATOM 5971  N N    . VAL A 1 15  ? -4.461  2.005   0.080   1.00 0.00 ? 14  VAL A N    4  
ATOM 5972  C CA   . VAL A 1 15  ? -3.828  2.400   1.334   1.00 0.00 ? 14  VAL A CA   4  
ATOM 5973  C C    . VAL A 1 15  ? -2.823  1.373   1.806   1.00 0.00 ? 14  VAL A C    4  
ATOM 5974  O O    . VAL A 1 15  ? -2.947  0.179   1.570   1.00 0.00 ? 14  VAL A O    4  
ATOM 5975  C CB   . VAL A 1 15  ? -4.770  2.987   2.429   1.00 0.00 ? 14  VAL A CB   4  
ATOM 5976  C CG1  . VAL A 1 15  ? -5.650  4.105   1.834   1.00 0.00 ? 14  VAL A CG1  4  
ATOM 5977  C CG2  . VAL A 1 15  ? -5.697  2.032   3.177   1.00 0.00 ? 14  VAL A CG2  4  
ATOM 5978  H H    . VAL A 1 15  ? -4.923  1.115   0.081   1.00 0.00 ? 14  VAL A H    4  
ATOM 5979  H HA   . VAL A 1 15  ? -3.177  3.224   1.114   1.00 0.00 ? 14  VAL A HA   4  
ATOM 5980  H HB   . VAL A 1 15  ? -4.126  3.435   3.216   1.00 0.00 ? 14  VAL A HB   4  
ATOM 5981  H HG11 . VAL A 1 15  ? -5.046  4.780   1.201   1.00 0.00 ? 14  VAL A HG11 4  
ATOM 5982  H HG12 . VAL A 1 15  ? -6.120  4.698   2.647   1.00 0.00 ? 14  VAL A HG12 4  
ATOM 5983  H HG13 . VAL A 1 15  ? -6.455  3.670   1.203   1.00 0.00 ? 14  VAL A HG13 4  
ATOM 5984  H HG21 . VAL A 1 15  ? -5.138  1.253   3.723   1.00 0.00 ? 14  VAL A HG21 4  
ATOM 5985  H HG22 . VAL A 1 15  ? -6.408  1.584   2.466   1.00 0.00 ? 14  VAL A HG22 4  
ATOM 5986  H HG23 . VAL A 1 15  ? -6.303  2.602   3.918   1.00 0.00 ? 14  VAL A HG23 4  
ATOM 5987  N N    . VAL A 1 16  ? -1.735  1.816   2.492   1.00 0.00 ? 15  VAL A N    4  
ATOM 5988  C CA   . VAL A 1 16  ? -0.660  0.996   3.092   1.00 0.00 ? 15  VAL A CA   4  
ATOM 5989  C C    . VAL A 1 16  ? -0.848  1.036   4.574   1.00 0.00 ? 15  VAL A C    4  
ATOM 5990  O O    . VAL A 1 16  ? -1.384  2.017   5.073   1.00 0.00 ? 15  VAL A O    4  
ATOM 5991  C CB   . VAL A 1 16  ? 0.776   1.358   2.770   1.00 0.00 ? 15  VAL A CB   4  
ATOM 5992  C CG1  . VAL A 1 16  ? 1.106   0.701   1.410   1.00 0.00 ? 15  VAL A CG1  4  
ATOM 5993  C CG2  . VAL A 1 16  ? 0.952   2.879   2.874   1.00 0.00 ? 15  VAL A CG2  4  
ATOM 5994  H H    . VAL A 1 16  ? -1.648  2.799   2.663   1.00 0.00 ? 15  VAL A H    4  
ATOM 5995  H HA   . VAL A 1 16  ? -0.775  -0.023  2.784   1.00 0.00 ? 15  VAL A HA   4  
ATOM 5996  H HB   . VAL A 1 16  ? 1.504   0.911   3.497   1.00 0.00 ? 15  VAL A HB   4  
ATOM 5997  H HG11 . VAL A 1 16  ? 2.158   0.903   1.131   1.00 0.00 ? 15  VAL A HG11 4  
ATOM 5998  H HG12 . VAL A 1 16  ? 0.428   1.071   0.612   1.00 0.00 ? 15  VAL A HG12 4  
ATOM 5999  H HG13 . VAL A 1 16  ? 0.980   -0.409  1.514   1.00 0.00 ? 15  VAL A HG13 4  
ATOM 6000  H HG21 . VAL A 1 16  ? 1.966   3.151   2.534   1.00 0.00 ? 15  VAL A HG21 4  
ATOM 6001  H HG22 . VAL A 1 16  ? 0.833   3.234   3.920   1.00 0.00 ? 15  VAL A HG22 4  
ATOM 6002  H HG23 . VAL A 1 16  ? 0.213   3.417   2.250   1.00 0.00 ? 15  VAL A HG23 4  
ATOM 6003  N N    . ALA A 1 17  ? -0.449  -0.060  5.269   1.00 0.00 ? 16  ALA A N    4  
ATOM 6004  C CA   . ALA A 1 17  ? -0.784  -0.351  6.640   1.00 0.00 ? 16  ALA A CA   4  
ATOM 6005  C C    . ALA A 1 17  ? 0.414   -0.672  7.518   1.00 0.00 ? 16  ALA A C    4  
ATOM 6006  O O    . ALA A 1 17  ? 1.038   -1.719  7.430   1.00 0.00 ? 16  ALA A O    4  
ATOM 6007  C CB   . ALA A 1 17  ? -1.826  -1.505  6.573   1.00 0.00 ? 16  ALA A CB   4  
ATOM 6008  H H    . ALA A 1 17  ? 0.044   -0.819  4.823   1.00 0.00 ? 16  ALA A H    4  
ATOM 6009  H HA   . ALA A 1 17  ? -1.235  0.509   7.107   1.00 0.00 ? 16  ALA A HA   4  
ATOM 6010  H HB1  . ALA A 1 17  ? -1.585  -2.232  5.761   1.00 0.00 ? 16  ALA A HB1  4  
ATOM 6011  H HB2  . ALA A 1 17  ? -2.818  -1.094  6.288   1.00 0.00 ? 16  ALA A HB2  4  
ATOM 6012  H HB3  . ALA A 1 17  ? -1.937  -2.058  7.526   1.00 0.00 ? 16  ALA A HB3  4  
ATOM 6013  N N    . LYS A 1 18  ? 0.741   0.270   8.411   1.00 0.00 ? 17  LYS A N    4  
ATOM 6014  C CA   . LYS A 1 18  ? 1.817   0.259   9.374   1.00 0.00 ? 17  LYS A CA   4  
ATOM 6015  C C    . LYS A 1 18  ? 1.204   0.809   10.664  1.00 0.00 ? 17  LYS A C    4  
ATOM 6016  O O    . LYS A 1 18  ? 0.830   1.968   10.655  1.00 0.00 ? 17  LYS A O    4  
ATOM 6017  C CB   . LYS A 1 18  ? 2.994   1.196   8.902   1.00 0.00 ? 17  LYS A CB   4  
ATOM 6018  C CG   . LYS A 1 18  ? 2.772   2.074   7.636   1.00 0.00 ? 17  LYS A CG   4  
ATOM 6019  C CD   . LYS A 1 18  ? 3.328   3.510   7.731   1.00 0.00 ? 17  LYS A CD   4  
ATOM 6020  C CE   . LYS A 1 18  ? 4.784   3.686   7.294   1.00 0.00 ? 17  LYS A CE   4  
ATOM 6021  N NZ   . LYS A 1 18  ? 5.233   5.087   7.461   1.00 0.00 ? 17  LYS A NZ   4  
ATOM 6022  H H    . LYS A 1 18  ? 0.223   1.123   8.412   1.00 0.00 ? 17  LYS A H    4  
ATOM 6023  H HA   . LYS A 1 18  ? 2.179   -0.744  9.547   1.00 0.00 ? 17  LYS A HA   4  
ATOM 6024  H HB2  . LYS A 1 18  ? 3.279   1.901   9.715   1.00 0.00 ? 17  LYS A HB2  4  
ATOM 6025  H HB3  . LYS A 1 18  ? 3.866   0.542   8.712   1.00 0.00 ? 17  LYS A HB3  4  
ATOM 6026  H HG2  . LYS A 1 18  ? 3.100   1.591   6.686   1.00 0.00 ? 17  LYS A HG2  4  
ATOM 6027  H HG3  . LYS A 1 18  ? 1.695   2.229   7.493   1.00 0.00 ? 17  LYS A HG3  4  
ATOM 6028  H HD2  . LYS A 1 18  ? 2.696   4.149   7.067   1.00 0.00 ? 17  LYS A HD2  4  
ATOM 6029  H HD3  . LYS A 1 18  ? 3.186   3.885   8.768   1.00 0.00 ? 17  LYS A HD3  4  
ATOM 6030  H HE2  . LYS A 1 18  ? 5.457   3.042   7.900   1.00 0.00 ? 17  LYS A HE2  4  
ATOM 6031  H HE3  . LYS A 1 18  ? 4.883   3.431   6.212   1.00 0.00 ? 17  LYS A HE3  4  
ATOM 6032  H HZ1  . LYS A 1 18  ? 4.635   5.712   6.885   1.00 0.00 ? 17  LYS A HZ1  4  
ATOM 6033  H HZ2  . LYS A 1 18  ? 6.223   5.172   7.153   1.00 0.00 ? 17  LYS A HZ2  4  
ATOM 6034  H HZ3  . LYS A 1 18  ? 5.156   5.359   8.462   1.00 0.00 ? 17  LYS A HZ3  4  
ATOM 6035  N N    . TRP A 1 19  ? 1.057   0.090   11.813  1.00 0.00 ? 18  TRP A N    4  
ATOM 6036  C CA   . TRP A 1 19  ? 0.464   0.697   13.033  1.00 0.00 ? 18  TRP A CA   4  
ATOM 6037  C C    . TRP A 1 19  ? 1.457   1.510   13.889  1.00 0.00 ? 18  TRP A C    4  
ATOM 6038  O O    . TRP A 1 19  ? 1.119   2.487   14.548  1.00 0.00 ? 18  TRP A O    4  
ATOM 6039  C CB   . TRP A 1 19  ? -0.298  -0.348  13.903  1.00 0.00 ? 18  TRP A CB   4  
ATOM 6040  C CG   . TRP A 1 19  ? -1.733  -0.581  13.486  1.00 0.00 ? 18  TRP A CG   4  
ATOM 6041  C CD1  . TRP A 1 19  ? -2.393  -1.642  12.928  1.00 0.00 ? 18  TRP A CD1  4  
ATOM 6042  C CD2  . TRP A 1 19  ? -2.726  0.370   13.866  1.00 0.00 ? 18  TRP A CD2  4  
ATOM 6043  N NE1  . TRP A 1 19  ? -3.756  -1.402  12.943  1.00 0.00 ? 18  TRP A NE1  4  
ATOM 6044  C CE2  . TRP A 1 19  ? -3.968  -0.175  13.547  1.00 0.00 ? 18  TRP A CE2  4  
ATOM 6045  C CE3  . TRP A 1 19  ? -2.599  1.580   14.479  1.00 0.00 ? 18  TRP A CE3  4  
ATOM 6046  C CZ2  . TRP A 1 19  ? -5.115  0.489   13.871  1.00 0.00 ? 18  TRP A CZ2  4  
ATOM 6047  C CZ3  . TRP A 1 19  ? -3.753  2.202   14.866  1.00 0.00 ? 18  TRP A CZ3  4  
ATOM 6048  C CH2  . TRP A 1 19  ? -4.993  1.668   14.575  1.00 0.00 ? 18  TRP A CH2  4  
ATOM 6049  H H    . TRP A 1 19  ? 1.311   -0.873  11.842  1.00 0.00 ? 18  TRP A H    4  
ATOM 6050  H HA   . TRP A 1 19  ? -0.281  1.433   12.742  1.00 0.00 ? 18  TRP A HA   4  
ATOM 6051  H HB2  . TRP A 1 19  ? 0.220   -1.311  13.918  1.00 0.00 ? 18  TRP A HB2  4  
ATOM 6052  H HB3  . TRP A 1 19  ? -0.378  -0.001  14.962  1.00 0.00 ? 18  TRP A HB3  4  
ATOM 6053  H HD1  . TRP A 1 19  ? -1.919  -2.543  12.568  1.00 0.00 ? 18  TRP A HD1  4  
ATOM 6054  H HE1  . TRP A 1 19  ? -4.472  -2.016  12.682  1.00 0.00 ? 18  TRP A HE1  4  
ATOM 6055  H HE3  . TRP A 1 19  ? -1.644  2.048   14.693  1.00 0.00 ? 18  TRP A HE3  4  
ATOM 6056  H HZ2  . TRP A 1 19  ? -6.097  0.106   13.652  1.00 0.00 ? 18  TRP A HZ2  4  
ATOM 6057  H HZ3  . TRP A 1 19  ? -3.643  3.109   15.428  1.00 0.00 ? 18  TRP A HZ3  4  
ATOM 6058  H HH2  . TRP A 1 19  ? -5.886  2.188   14.886  1.00 0.00 ? 18  TRP A HH2  4  
ATOM 6059  N N    . SER A 1 20  ? 2.720   1.085   13.867  1.00 0.00 ? 19  SER A N    4  
ATOM 6060  C CA   . SER A 1 20  ? 3.886   1.712   14.449  1.00 0.00 ? 19  SER A CA   4  
ATOM 6061  C C    . SER A 1 20  ? 4.838   1.718   13.277  1.00 0.00 ? 19  SER A C    4  
ATOM 6062  O O    . SER A 1 20  ? 4.736   0.807   12.452  1.00 0.00 ? 19  SER A O    4  
ATOM 6063  C CB   . SER A 1 20  ? 4.433   0.858   15.635  1.00 0.00 ? 19  SER A CB   4  
ATOM 6064  O OG   . SER A 1 20  ? 5.687   1.324   16.137  1.00 0.00 ? 19  SER A OG   4  
ATOM 6065  H H    . SER A 1 20  ? 2.920   0.300   13.290  1.00 0.00 ? 19  SER A H    4  
ATOM 6066  H HA   . SER A 1 20  ? 3.692   2.736   14.744  1.00 0.00 ? 19  SER A HA   4  
ATOM 6067  H HB2  . SER A 1 20  ? 3.677   0.892   16.452  1.00 0.00 ? 19  SER A HB2  4  
ATOM 6068  H HB3  . SER A 1 20  ? 4.545   -0.204  15.321  1.00 0.00 ? 19  SER A HB3  4  
ATOM 6069  H HG   . SER A 1 20  ? 5.727   1.098   17.073  1.00 0.00 ? 19  SER A HG   4  
ATOM 6070  N N    . SER A 1 21  ? 5.827   2.668   13.146  1.00 0.00 ? 20  SER A N    4  
ATOM 6071  C CA   . SER A 1 21  ? 6.852   2.515   12.095  1.00 0.00 ? 20  SER A CA   4  
ATOM 6072  C C    . SER A 1 21  ? 7.833   1.387   12.495  1.00 0.00 ? 20  SER A C    4  
ATOM 6073  O O    . SER A 1 21  ? 8.629   1.507   13.423  1.00 0.00 ? 20  SER A O    4  
ATOM 6074  C CB   . SER A 1 21  ? 7.625   3.851   11.859  1.00 0.00 ? 20  SER A CB   4  
ATOM 6075  O OG   . SER A 1 21  ? 8.143   4.410   13.070  1.00 0.00 ? 20  SER A OG   4  
ATOM 6076  H H    . SER A 1 21  ? 5.969   3.422   13.788  1.00 0.00 ? 20  SER A H    4  
ATOM 6077  H HA   . SER A 1 21  ? 6.383   2.242   11.156  1.00 0.00 ? 20  SER A HA   4  
ATOM 6078  H HB2  . SER A 1 21  ? 8.447   3.712   11.121  1.00 0.00 ? 20  SER A HB2  4  
ATOM 6079  H HB3  . SER A 1 21  ? 6.917   4.594   11.425  1.00 0.00 ? 20  SER A HB3  4  
ATOM 6080  H HG   . SER A 1 21  ? 8.673   3.715   13.490  1.00 0.00 ? 20  SER A HG   4  
ATOM 6081  N N    . ASN A 1 22  ? 7.672   0.258   11.760  1.00 0.00 ? 21  ASN A N    4  
ATOM 6082  C CA   . ASN A 1 22  ? 8.181   -1.085  12.011  1.00 0.00 ? 21  ASN A CA   4  
ATOM 6083  C C    . ASN A 1 22  ? 9.382   -1.455  11.174  1.00 0.00 ? 21  ASN A C    4  
ATOM 6084  O O    . ASN A 1 22  ? 10.156  -2.345  11.515  1.00 0.00 ? 21  ASN A O    4  
ATOM 6085  C CB   . ASN A 1 22  ? 6.953   -2.012  11.680  1.00 0.00 ? 21  ASN A CB   4  
ATOM 6086  C CG   . ASN A 1 22  ? 7.062   -3.537  11.877  1.00 0.00 ? 21  ASN A CG   4  
ATOM 6087  O OD1  . ASN A 1 22  ? 6.838   -4.272  10.908  1.00 0.00 ? 21  ASN A OD1  4  
ATOM 6088  N ND2  . ASN A 1 22  ? 7.359   -4.020  13.111  1.00 0.00 ? 21  ASN A ND2  4  
ATOM 6089  H H    . ASN A 1 22  ? 6.950   0.277   11.073  1.00 0.00 ? 21  ASN A H    4  
ATOM 6090  H HA   . ASN A 1 22  ? 8.478   -1.163  13.044  1.00 0.00 ? 21  ASN A HA   4  
ATOM 6091  H HB2  . ASN A 1 22  ? 6.086   -1.655  12.273  1.00 0.00 ? 21  ASN A HB2  4  
ATOM 6092  H HB3  . ASN A 1 22  ? 6.689   -1.852  10.607  1.00 0.00 ? 21  ASN A HB3  4  
ATOM 6093  H HD21 . ASN A 1 22  ? 7.516   -3.407  13.886  1.00 0.00 ? 21  ASN A HD21 4  
ATOM 6094  H HD22 . ASN A 1 22  ? 7.427   -5.016  13.207  1.00 0.00 ? 21  ASN A HD22 4  
ATOM 6095  N N    . GLY A 1 23  ? 9.488   -0.775  10.022  1.00 0.00 ? 22  GLY A N    4  
ATOM 6096  C CA   . GLY A 1 23  ? 10.470  -0.964  8.974   1.00 0.00 ? 22  GLY A CA   4  
ATOM 6097  C C    . GLY A 1 23  ? 9.880   -1.558  7.732   1.00 0.00 ? 22  GLY A C    4  
ATOM 6098  O O    . GLY A 1 23  ? 10.496  -1.410  6.688   1.00 0.00 ? 22  GLY A O    4  
ATOM 6099  H H    . GLY A 1 23  ? 8.792   -0.082  9.849   1.00 0.00 ? 22  GLY A H    4  
ATOM 6100  H HA2  . GLY A 1 23  ? 10.881  -0.002  8.726   1.00 0.00 ? 22  GLY A HA2  4  
ATOM 6101  H HA3  . GLY A 1 23  ? 11.239  -1.656  9.295   1.00 0.00 ? 22  GLY A HA3  4  
ATOM 6102  N N    . TYR A 1 24  ? 8.673   -2.192  7.805   1.00 0.00 ? 23  TYR A N    4  
ATOM 6103  C CA   . TYR A 1 24  ? 7.848   -2.682  6.695   1.00 0.00 ? 23  TYR A CA   4  
ATOM 6104  C C    . TYR A 1 24  ? 6.361   -2.340  6.873   1.00 0.00 ? 23  TYR A C    4  
ATOM 6105  O O    . TYR A 1 24  ? 5.879   -2.277  8.004   1.00 0.00 ? 23  TYR A O    4  
ATOM 6106  C CB   . TYR A 1 24  ? 7.960   -4.194  6.345   1.00 0.00 ? 23  TYR A CB   4  
ATOM 6107  C CG   . TYR A 1 24  ? 9.372   -4.723  6.356   1.00 0.00 ? 23  TYR A CG   4  
ATOM 6108  C CD1  . TYR A 1 24  ? 9.912   -5.237  7.522   1.00 0.00 ? 23  TYR A CD1  4  
ATOM 6109  C CD2  . TYR A 1 24  ? 10.137  -4.759  5.202   1.00 0.00 ? 23  TYR A CD2  4  
ATOM 6110  C CE1  . TYR A 1 24  ? 11.196  -5.748  7.544   1.00 0.00 ? 23  TYR A CE1  4  
ATOM 6111  C CE2  . TYR A 1 24  ? 11.424  -5.266  5.221   1.00 0.00 ? 23  TYR A CE2  4  
ATOM 6112  C CZ   . TYR A 1 24  ? 11.958  -5.749  6.395   1.00 0.00 ? 23  TYR A CZ   4  
ATOM 6113  O OH   . TYR A 1 24  ? 13.280  -6.241  6.413   1.00 0.00 ? 23  TYR A OH   4  
ATOM 6114  H H    . TYR A 1 24  ? 8.224   -2.282  8.689   1.00 0.00 ? 23  TYR A H    4  
ATOM 6115  H HA   . TYR A 1 24  ? 8.142   -2.129  5.818   1.00 0.00 ? 23  TYR A HA   4  
ATOM 6116  H HB2  . TYR A 1 24  ? 7.365   -4.834  7.033   1.00 0.00 ? 23  TYR A HB2  4  
ATOM 6117  H HB3  . TYR A 1 24  ? 7.565   -4.280  5.304   1.00 0.00 ? 23  TYR A HB3  4  
ATOM 6118  H HD1  . TYR A 1 24  ? 9.322   -5.237  8.430   1.00 0.00 ? 23  TYR A HD1  4  
ATOM 6119  H HD2  . TYR A 1 24  ? 9.712   -4.394  4.277   1.00 0.00 ? 23  TYR A HD2  4  
ATOM 6120  H HE1  . TYR A 1 24  ? 11.598  -6.131  8.473   1.00 0.00 ? 23  TYR A HE1  4  
ATOM 6121  H HE2  . TYR A 1 24  ? 12.020  -5.287  4.317   1.00 0.00 ? 23  TYR A HE2  4  
ATOM 6122  H HH   . TYR A 1 24  ? 13.410  -6.710  7.243   1.00 0.00 ? 23  TYR A HH   4  
ATOM 6123  N N    . PHE A 1 25  ? 5.566   -2.153  5.766   1.00 0.00 ? 24  PHE A N    4  
ATOM 6124  C CA   . PHE A 1 25  ? 4.110   -1.917  5.778   1.00 0.00 ? 24  PHE A CA   4  
ATOM 6125  C C    . PHE A 1 25  ? 3.479   -3.072  5.029   1.00 0.00 ? 24  PHE A C    4  
ATOM 6126  O O    . PHE A 1 25  ? 4.050   -3.595  4.067   1.00 0.00 ? 24  PHE A O    4  
ATOM 6127  C CB   . PHE A 1 25  ? 3.500   -0.553  5.228   1.00 0.00 ? 24  PHE A CB   4  
ATOM 6128  C CG   . PHE A 1 25  ? 4.468   0.600   5.128   1.00 0.00 ? 24  PHE A CG   4  
ATOM 6129  C CD1  . PHE A 1 25  ? 5.430   0.714   6.113   1.00 0.00 ? 24  PHE A CD1  4  
ATOM 6130  C CD2  . PHE A 1 25  ? 4.447   1.548   4.093   1.00 0.00 ? 24  PHE A CD2  4  
ATOM 6131  C CE1  . PHE A 1 25  ? 6.610   1.326   5.830   1.00 0.00 ? 24  PHE A CE1  4  
ATOM 6132  C CE2  . PHE A 1 25  ? 5.607   2.247   3.850   1.00 0.00 ? 24  PHE A CE2  4  
ATOM 6133  C CZ   . PHE A 1 25  ? 6.690   2.033   4.661   1.00 0.00 ? 24  PHE A CZ   4  
ATOM 6134  H H    . PHE A 1 25  ? 5.966   -2.229  4.844   1.00 0.00 ? 24  PHE A H    4  
ATOM 6135  H HA   . PHE A 1 25  ? 3.721   -1.975  6.787   1.00 0.00 ? 24  PHE A HA   4  
ATOM 6136  H HB2  . PHE A 1 25  ? 3.038   -0.672  4.228   1.00 0.00 ? 24  PHE A HB2  4  
ATOM 6137  H HB3  . PHE A 1 25  ? 2.684   -0.238  5.904   1.00 0.00 ? 24  PHE A HB3  4  
ATOM 6138  H HD1  . PHE A 1 25  ? 5.342   0.164   7.037   1.00 0.00 ? 24  PHE A HD1  4  
ATOM 6139  H HD2  . PHE A 1 25  ? 3.716   1.558   3.273   1.00 0.00 ? 24  PHE A HD2  4  
ATOM 6140  H HE1  . PHE A 1 25  ? 7.451   1.221   6.501   1.00 0.00 ? 24  PHE A HE1  4  
ATOM 6141  H HE2  . PHE A 1 25  ? 5.701   2.846   2.956   1.00 0.00 ? 24  PHE A HE2  4  
ATOM 6142  H HZ   . PHE A 1 25  ? 7.631   2.387   4.367   1.00 0.00 ? 24  PHE A HZ   4  
ATOM 6143  N N    . TYR A 1 26  ? 2.250   -3.385  5.500   1.00 0.00 ? 25  TYR A N    4  
ATOM 6144  C CA   . TYR A 1 26  ? 1.210   -4.337  5.146   1.00 0.00 ? 25  TYR A CA   4  
ATOM 6145  C C    . TYR A 1 26  ? 0.211   -3.542  4.314   1.00 0.00 ? 25  TYR A C    4  
ATOM 6146  O O    . TYR A 1 26  ? 0.479   -2.395  3.969   1.00 0.00 ? 25  TYR A O    4  
ATOM 6147  C CB   . TYR A 1 26  ? 0.629   -4.956  6.463   1.00 0.00 ? 25  TYR A CB   4  
ATOM 6148  C CG   . TYR A 1 26  ? 1.787   -5.337  7.379   1.00 0.00 ? 25  TYR A CG   4  
ATOM 6149  C CD1  . TYR A 1 26  ? 2.704   -6.302  6.992   1.00 0.00 ? 25  TYR A CD1  4  
ATOM 6150  C CD2  . TYR A 1 26  ? 2.047   -4.628  8.546   1.00 0.00 ? 25  TYR A CD2  4  
ATOM 6151  C CE1  . TYR A 1 26  ? 3.867   -6.501  7.708   1.00 0.00 ? 25  TYR A CE1  4  
ATOM 6152  C CE2  . TYR A 1 26  ? 3.222   -4.817  9.256   1.00 0.00 ? 25  TYR A CE2  4  
ATOM 6153  C CZ   . TYR A 1 26  ? 4.145   -5.746  8.827   1.00 0.00 ? 25  TYR A CZ   4  
ATOM 6154  O OH   . TYR A 1 26  ? 5.363   -5.976  9.510   1.00 0.00 ? 25  TYR A OH   4  
ATOM 6155  H H    . TYR A 1 26  ? 1.926   -2.824  6.268   1.00 0.00 ? 25  TYR A H    4  
ATOM 6156  H HA   . TYR A 1 26  ? 1.586   -5.110  4.493   1.00 0.00 ? 25  TYR A HA   4  
ATOM 6157  H HB2  . TYR A 1 26  ? 0.000   -4.216  7.007   1.00 0.00 ? 25  TYR A HB2  4  
ATOM 6158  H HB3  . TYR A 1 26  ? 0.028   -5.867  6.258   1.00 0.00 ? 25  TYR A HB3  4  
ATOM 6159  H HD1  . TYR A 1 26  ? 2.549   -6.863  6.081   1.00 0.00 ? 25  TYR A HD1  4  
ATOM 6160  H HD2  . TYR A 1 26  ? 1.354   -3.864  8.875   1.00 0.00 ? 25  TYR A HD2  4  
ATOM 6161  H HE1  . TYR A 1 26  ? 4.591   -7.228  7.368   1.00 0.00 ? 25  TYR A HE1  4  
ATOM 6162  H HE2  . TYR A 1 26  ? 3.422   -4.234  10.142  1.00 0.00 ? 25  TYR A HE2  4  
ATOM 6163  H HH   . TYR A 1 26  ? 5.709   -5.160  9.928   1.00 0.00 ? 25  TYR A HH   4  
ATOM 6164  N N    . SER A 1 27  ? -0.948  -4.074  3.867   1.00 0.00 ? 26  SER A N    4  
ATOM 6165  C CA   . SER A 1 27  ? -1.844  -3.283  3.013   1.00 0.00 ? 26  SER A CA   4  
ATOM 6166  C C    . SER A 1 27  ? -3.365  -3.296  3.241   1.00 0.00 ? 26  SER A C    4  
ATOM 6167  O O    . SER A 1 27  ? -3.909  -4.105  3.985   1.00 0.00 ? 26  SER A O    4  
ATOM 6168  C CB   . SER A 1 27  ? -1.463  -3.543  1.558   1.00 0.00 ? 26  SER A CB   4  
ATOM 6169  O OG   . SER A 1 27  ? -1.893  -2.488  0.709   1.00 0.00 ? 26  SER A OG   4  
ATOM 6170  H H    . SER A 1 27  ? -1.166  -5.009  4.075   1.00 0.00 ? 26  SER A H    4  
ATOM 6171  H HA   . SER A 1 27  ? -1.657  -2.241  3.195   1.00 0.00 ? 26  SER A HA   4  
ATOM 6172  H HB2  . SER A 1 27  ? -0.357  -3.660  1.452   1.00 0.00 ? 26  SER A HB2  4  
ATOM 6173  H HB3  . SER A 1 27  ? -1.937  -4.505  1.306   1.00 0.00 ? 26  SER A HB3  4  
ATOM 6174  H HG   . SER A 1 27  ? -1.383  -1.689  0.910   1.00 0.00 ? 26  SER A HG   4  
ATOM 6175  N N    . GLY A 1 28  ? -3.989  -2.227  2.665   1.00 0.00 ? 27  GLY A N    4  
ATOM 6176  C CA   . GLY A 1 28  ? -5.264  -1.548  2.845   1.00 0.00 ? 27  GLY A CA   4  
ATOM 6177  C C    . GLY A 1 28  ? -6.062  -1.055  1.653   1.00 0.00 ? 27  GLY A C    4  
ATOM 6178  O O    . GLY A 1 28  ? -5.597  -0.938  0.519   1.00 0.00 ? 27  GLY A O    4  
ATOM 6179  H H    . GLY A 1 28  ? -3.420  -1.676  2.039   1.00 0.00 ? 27  GLY A H    4  
ATOM 6180  H HA2  . GLY A 1 28  ? -5.922  -2.266  3.270   1.00 0.00 ? 27  GLY A HA2  4  
ATOM 6181  H HA3  . GLY A 1 28  ? -5.091  -0.716  3.504   1.00 0.00 ? 27  GLY A HA3  4  
ATOM 6182  N N    . LYS A 1 29  ? -7.345  -0.705  1.934   1.00 0.00 ? 28  LYS A N    4  
ATOM 6183  C CA   . LYS A 1 29  ? -8.235  0.038   1.014   1.00 0.00 ? 28  LYS A CA   4  
ATOM 6184  C C    . LYS A 1 29  ? -9.086  1.040   1.810   1.00 0.00 ? 28  LYS A C    4  
ATOM 6185  O O    . LYS A 1 29  ? -9.377  0.794   2.975   1.00 0.00 ? 28  LYS A O    4  
ATOM 6186  C CB   . LYS A 1 29  ? -9.088  -0.826  0.048   1.00 0.00 ? 28  LYS A CB   4  
ATOM 6187  C CG   . LYS A 1 29  ? -10.223 -1.687  0.633   1.00 0.00 ? 28  LYS A CG   4  
ATOM 6188  C CD   . LYS A 1 29  ? -9.726  -2.952  1.350   1.00 0.00 ? 28  LYS A CD   4  
ATOM 6189  C CE   . LYS A 1 29  ? -10.703 -4.134  1.253   1.00 0.00 ? 28  LYS A CE   4  
ATOM 6190  N NZ   . LYS A 1 29  ? -12.053 -3.769  1.742   1.00 0.00 ? 28  LYS A NZ   4  
ATOM 6191  H H    . LYS A 1 29  ? -7.674  -0.811  2.901   1.00 0.00 ? 28  LYS A H    4  
ATOM 6192  H HA   . LYS A 1 29  ? -7.613  0.655   0.378   1.00 0.00 ? 28  LYS A HA   4  
ATOM 6193  H HB2  . LYS A 1 29  ? -9.541  -0.147  -0.713  1.00 0.00 ? 28  LYS A HB2  4  
ATOM 6194  H HB3  . LYS A 1 29  ? -8.395  -1.501  -0.502  1.00 0.00 ? 28  LYS A HB3  4  
ATOM 6195  H HG2  . LYS A 1 29  ? -10.887 -1.095  1.299   1.00 0.00 ? 28  LYS A HG2  4  
ATOM 6196  H HG3  . LYS A 1 29  ? -10.847 -2.023  -0.231  1.00 0.00 ? 28  LYS A HG3  4  
ATOM 6197  H HD2  . LYS A 1 29  ? -8.766  -3.264  0.877   1.00 0.00 ? 28  LYS A HD2  4  
ATOM 6198  H HD3  . LYS A 1 29  ? -9.512  -2.697  2.409   1.00 0.00 ? 28  LYS A HD3  4  
ATOM 6199  H HE2  . LYS A 1 29  ? -10.811 -4.456  0.195   1.00 0.00 ? 28  LYS A HE2  4  
ATOM 6200  H HE3  . LYS A 1 29  ? -10.340 -4.991  1.860   1.00 0.00 ? 28  LYS A HE3  4  
ATOM 6201  H HZ1  . LYS A 1 29  ? -12.424 -2.977  1.179   1.00 0.00 ? 28  LYS A HZ1  4  
ATOM 6202  H HZ2  . LYS A 1 29  ? -11.994 -3.487  2.742   1.00 0.00 ? 28  LYS A HZ2  4  
ATOM 6203  H HZ3  . LYS A 1 29  ? -12.689 -4.588  1.651   1.00 0.00 ? 28  LYS A HZ3  4  
ATOM 6204  N N    . ILE A 1 30  ? -9.502  2.225   1.268   1.00 0.00 ? 29  ILE A N    4  
ATOM 6205  C CA   . ILE A 1 30  ? -10.257 3.237   2.049   1.00 0.00 ? 29  ILE A CA   4  
ATOM 6206  C C    . ILE A 1 30  ? -11.751 3.348   1.677   1.00 0.00 ? 29  ILE A C    4  
ATOM 6207  O O    . ILE A 1 30  ? -12.179 3.008   0.576   1.00 0.00 ? 29  ILE A O    4  
ATOM 6208  C CB   . ILE A 1 30  ? -9.506  4.574   2.047   1.00 0.00 ? 29  ILE A CB   4  
ATOM 6209  C CG1  . ILE A 1 30  ? -9.993  5.621   3.073   1.00 0.00 ? 29  ILE A CG1  4  
ATOM 6210  C CG2  . ILE A 1 30  ? -9.512  5.153   0.641   1.00 0.00 ? 29  ILE A CG2  4  
ATOM 6211  C CD1  . ILE A 1 30  ? -9.257  6.950   2.975   1.00 0.00 ? 29  ILE A CD1  4  
ATOM 6212  H H    . ILE A 1 30  ? -9.297  2.499   0.322   1.00 0.00 ? 29  ILE A H    4  
ATOM 6213  H HA   . ILE A 1 30  ? -10.269 2.963   3.095   1.00 0.00 ? 29  ILE A HA   4  
ATOM 6214  H HB   . ILE A 1 30  ? -8.446  4.345   2.311   1.00 0.00 ? 29  ILE A HB   4  
ATOM 6215  H HG12 . ILE A 1 30  ? -11.072 5.840   2.929   1.00 0.00 ? 29  ILE A HG12 4  
ATOM 6216  H HG13 . ILE A 1 30  ? -9.862  5.209   4.096   1.00 0.00 ? 29  ILE A HG13 4  
ATOM 6217  H HG21 . ILE A 1 30  ? -8.835  6.019   0.547   1.00 0.00 ? 29  ILE A HG21 4  
ATOM 6218  H HG22 . ILE A 1 30  ? -10.529 5.493   0.383   1.00 0.00 ? 29  ILE A HG22 4  
ATOM 6219  H HG23 . ILE A 1 30  ? -9.208  4.386   -0.088  1.00 0.00 ? 29  ILE A HG23 4  
ATOM 6220  H HD11 . ILE A 1 30  ? -9.624  7.636   3.768   1.00 0.00 ? 29  ILE A HD11 4  
ATOM 6221  H HD12 . ILE A 1 30  ? -9.453  7.447   2.001   1.00 0.00 ? 29  ILE A HD12 4  
ATOM 6222  H HD13 . ILE A 1 30  ? -8.162  6.806   3.088   1.00 0.00 ? 29  ILE A HD13 4  
ATOM 6223  N N    . THR A 1 31  ? -12.590 3.828   2.637   1.00 0.00 ? 30  THR A N    4  
ATOM 6224  C CA   . THR A 1 31  ? -14.039 3.992   2.489   1.00 0.00 ? 30  THR A CA   4  
ATOM 6225  C C    . THR A 1 31  ? -14.452 5.443   2.662   1.00 0.00 ? 30  THR A C    4  
ATOM 6226  O O    . THR A 1 31  ? -15.316 5.926   1.929   1.00 0.00 ? 30  THR A O    4  
ATOM 6227  C CB   . THR A 1 31  ? -14.843 3.089   3.430   1.00 0.00 ? 30  THR A CB   4  
ATOM 6228  O OG1  . THR A 1 31  ? -14.411 1.746   3.288   1.00 0.00 ? 30  THR A OG1  4  
ATOM 6229  C CG2  . THR A 1 31  ? -16.354 3.085   3.125   1.00 0.00 ? 30  THR A CG2  4  
ATOM 6230  H H    . THR A 1 31  ? -12.208 4.077   3.532   1.00 0.00 ? 30  THR A H    4  
ATOM 6231  H HA   . THR A 1 31  ? -14.332 3.739   1.477   1.00 0.00 ? 30  THR A HA   4  
ATOM 6232  H HB   . THR A 1 31  ? -14.681 3.375   4.493   1.00 0.00 ? 30  THR A HB   4  
ATOM 6233  H HG1  . THR A 1 31  ? -14.533 1.524   2.359   1.00 0.00 ? 30  THR A HG1  4  
ATOM 6234  H HG21 . THR A 1 31  ? -16.536 2.854   2.053   1.00 0.00 ? 30  THR A HG21 4  
ATOM 6235  H HG22 . THR A 1 31  ? -16.821 4.064   3.357   1.00 0.00 ? 30  THR A HG22 4  
ATOM 6236  H HG23 . THR A 1 31  ? -16.862 2.314   3.746   1.00 0.00 ? 30  THR A HG23 4  
ATOM 6237  N N    . ARG A 1 32  ? -13.859 6.201   3.637   1.00 0.00 ? 31  ARG A N    4  
ATOM 6238  C CA   . ARG A 1 32  ? -14.242 7.594   3.838   1.00 0.00 ? 31  ARG A CA   4  
ATOM 6239  C C    . ARG A 1 32  ? -12.991 8.343   4.253   1.00 0.00 ? 31  ARG A C    4  
ATOM 6240  O O    . ARG A 1 32  ? -12.038 7.754   4.768   1.00 0.00 ? 31  ARG A O    4  
ATOM 6241  C CB   . ARG A 1 32  ? -15.326 7.819   4.940   1.00 0.00 ? 31  ARG A CB   4  
ATOM 6242  C CG   . ARG A 1 32  ? -16.688 7.140   4.698   1.00 0.00 ? 31  ARG A CG   4  
ATOM 6243  C CD   . ARG A 1 32  ? -17.642 7.361   5.883   1.00 0.00 ? 31  ARG A CD   4  
ATOM 6244  N NE   . ARG A 1 32  ? -18.930 6.616   5.642   1.00 0.00 ? 31  ARG A NE   4  
ATOM 6245  C CZ   . ARG A 1 32  ? -19.116 5.291   5.941   1.00 0.00 ? 31  ARG A CZ   4  
ATOM 6246  N NH1  . ARG A 1 32  ? -18.120 4.547   6.505   1.00 0.00 ? 31  ARG A NH1  4  
ATOM 6247  N NH2  . ARG A 1 32  ? -20.319 4.706   5.667   1.00 0.00 ? 31  ARG A NH2  4  
ATOM 6248  H H    . ARG A 1 32  ? -13.128 5.892   4.282   1.00 0.00 ? 31  ARG A H    4  
ATOM 6249  H HA   . ARG A 1 32  ? -14.631 8.033   2.933   1.00 0.00 ? 31  ARG A HA   4  
ATOM 6250  H HB2  . ARG A 1 32  ? -14.956 7.459   5.923   1.00 0.00 ? 31  ARG A HB2  4  
ATOM 6251  H HB3  . ARG A 1 32  ? -15.542 8.909   5.045   1.00 0.00 ? 31  ARG A HB3  4  
ATOM 6252  H HG2  . ARG A 1 32  ? -17.150 7.537   3.765   1.00 0.00 ? 31  ARG A HG2  4  
ATOM 6253  H HG3  . ARG A 1 32  ? -16.529 6.047   4.569   1.00 0.00 ? 31  ARG A HG3  4  
ATOM 6254  H HD2  . ARG A 1 32  ? -17.173 7.031   6.837   1.00 0.00 ? 31  ARG A HD2  4  
ATOM 6255  H HD3  . ARG A 1 32  ? -17.888 8.441   5.972   1.00 0.00 ? 31  ARG A HD3  4  
ATOM 6256  H HE   . ARG A 1 32  ? -19.690 7.118   5.230   1.00 0.00 ? 31  ARG A HE   4  
ATOM 6257  H HH11 . ARG A 1 32  ? -17.236 4.968   6.708   1.00 0.00 ? 31  ARG A HH11 4  
ATOM 6258  H HH12 . ARG A 1 32  ? -18.277 3.582   6.716   1.00 0.00 ? 31  ARG A HH12 4  
ATOM 6259  H HH21 . ARG A 1 32  ? -21.053 5.245   5.253   1.00 0.00 ? 31  ARG A HH21 4  
ATOM 6260  H HH22 . ARG A 1 32  ? -20.466 3.741   5.881   1.00 0.00 ? 31  ARG A HH22 4  
ATOM 6261  N N    . ASP A 1 33  ? -12.977 9.694   4.123   1.00 0.00 ? 32  ASP A N    4  
ATOM 6262  C CA   . ASP A 1 33  ? -11.922 10.525  4.729   1.00 0.00 ? 32  ASP A CA   4  
ATOM 6263  C C    . ASP A 1 33  ? -12.308 10.943  6.168   1.00 0.00 ? 32  ASP A C    4  
ATOM 6264  O O    . ASP A 1 33  ? -13.472 11.203  6.471   1.00 0.00 ? 32  ASP A O    4  
ATOM 6265  C CB   . ASP A 1 33  ? -11.508 11.753  3.849   1.00 0.00 ? 32  ASP A CB   4  
ATOM 6266  C CG   . ASP A 1 33  ? -12.622 12.785  3.594   1.00 0.00 ? 32  ASP A CG   4  
ATOM 6267  O OD1  . ASP A 1 33  ? -13.643 12.427  2.952   1.00 0.00 ? 32  ASP A OD1  4  
ATOM 6268  O OD2  . ASP A 1 33  ? -12.449 13.953  4.036   1.00 0.00 ? 32  ASP A OD2  4  
ATOM 6269  H H    . ASP A 1 33  ? -13.726 10.182  3.667   1.00 0.00 ? 32  ASP A H    4  
ATOM 6270  H HA   . ASP A 1 33  ? -11.007 9.943   4.829   1.00 0.00 ? 32  ASP A HA   4  
ATOM 6271  H HB2  . ASP A 1 33  ? -10.641 12.267  4.321   1.00 0.00 ? 32  ASP A HB2  4  
ATOM 6272  H HB3  . ASP A 1 33  ? -11.169 11.369  2.862   1.00 0.00 ? 32  ASP A HB3  4  
ATOM 6273  N N    . VAL A 1 34  ? -11.319 11.002  7.095   1.00 0.00 ? 33  VAL A N    4  
ATOM 6274  C CA   . VAL A 1 34  ? -11.481 11.434  8.484   1.00 0.00 ? 33  VAL A CA   4  
ATOM 6275  C C    . VAL A 1 34  ? -10.574 12.659  8.538   1.00 0.00 ? 33  VAL A C    4  
ATOM 6276  O O    . VAL A 1 34  ? -9.454  12.592  8.064   1.00 0.00 ? 33  VAL A O    4  
ATOM 6277  C CB   . VAL A 1 34  ? -11.267 10.350  9.604   1.00 0.00 ? 33  VAL A CB   4  
ATOM 6278  C CG1  . VAL A 1 34  ? -12.679 9.869   10.007  1.00 0.00 ? 33  VAL A CG1  4  
ATOM 6279  C CG2  . VAL A 1 34  ? -10.412 9.105   9.226   1.00 0.00 ? 33  VAL A CG2  4  
ATOM 6280  H H    . VAL A 1 34  ? -10.371 10.808  6.827   1.00 0.00 ? 33  VAL A H    4  
ATOM 6281  H HA   . VAL A 1 34  ? -12.479 11.829  8.634   1.00 0.00 ? 33  VAL A HA   4  
ATOM 6282  H HB   . VAL A 1 34  ? -10.821 10.816  10.512  1.00 0.00 ? 33  VAL A HB   4  
ATOM 6283  H HG11 . VAL A 1 34  ? -13.176 9.367   9.147   1.00 0.00 ? 33  VAL A HG11 4  
ATOM 6284  H HG12 . VAL A 1 34  ? -13.315 10.716  10.341  1.00 0.00 ? 33  VAL A HG12 4  
ATOM 6285  H HG13 . VAL A 1 34  ? -12.614 9.135   10.837  1.00 0.00 ? 33  VAL A HG13 4  
ATOM 6286  H HG21 . VAL A 1 34  ? -9.455  8.905   9.778   1.00 0.00 ? 33  VAL A HG21 4  
ATOM 6287  H HG22 . VAL A 1 34  ? -10.080 9.197   8.183   1.00 0.00 ? 33  VAL A HG22 4  
ATOM 6288  H HG23 . VAL A 1 34  ? -10.965 8.144   9.293   1.00 0.00 ? 33  VAL A HG23 4  
ATOM 6289  N N    . GLY A 1 35  ? -11.054 13.832  9.036   1.00 0.00 ? 34  GLY A N    4  
ATOM 6290  C CA   . GLY A 1 35  ? -10.439 15.186  9.102   1.00 0.00 ? 34  GLY A CA   4  
ATOM 6291  C C    . GLY A 1 35  ? -9.199  15.603  8.297   1.00 0.00 ? 34  GLY A C    4  
ATOM 6292  O O    . GLY A 1 35  ? -9.199  15.612  7.071   1.00 0.00 ? 34  GLY A O    4  
ATOM 6293  H H    . GLY A 1 35  ? -11.982 13.799  9.386   1.00 0.00 ? 34  GLY A H    4  
ATOM 6294  H HA2  . GLY A 1 35  ? -11.215 15.859  8.759   1.00 0.00 ? 34  GLY A HA2  4  
ATOM 6295  H HA3  . GLY A 1 35  ? -10.200 15.353  10.141  1.00 0.00 ? 34  GLY A HA3  4  
ATOM 6296  N N    . ALA A 1 36  ? -8.103  16.012  8.990   1.00 0.00 ? 35  ALA A N    4  
ATOM 6297  C CA   . ALA A 1 36  ? -6.817  16.392  8.408   1.00 0.00 ? 35  ALA A CA   4  
ATOM 6298  C C    . ALA A 1 36  ? -5.797  15.308  8.633   1.00 0.00 ? 35  ALA A C    4  
ATOM 6299  O O    . ALA A 1 36  ? -5.359  15.032  9.748   1.00 0.00 ? 35  ALA A O    4  
ATOM 6300  C CB   . ALA A 1 36  ? -6.342  17.750  8.974   1.00 0.00 ? 35  ALA A CB   4  
ATOM 6301  H H    . ALA A 1 36  ? -8.103  16.024  9.986   1.00 0.00 ? 35  ALA A H    4  
ATOM 6302  H HA   . ALA A 1 36  ? -6.845  16.436  7.322   1.00 0.00 ? 35  ALA A HA   4  
ATOM 6303  H HB1  . ALA A 1 36  ? -5.389  18.070  8.502   1.00 0.00 ? 35  ALA A HB1  4  
ATOM 6304  H HB2  . ALA A 1 36  ? -6.192  17.701  10.075  1.00 0.00 ? 35  ALA A HB2  4  
ATOM 6305  H HB3  . ALA A 1 36  ? -7.103  18.532  8.766   1.00 0.00 ? 35  ALA A HB3  4  
ATOM 6306  N N    . GLY A 1 37  ? -5.386  14.662  7.517   1.00 0.00 ? 36  GLY A N    4  
ATOM 6307  C CA   . GLY A 1 37  ? -4.412  13.596  7.453   1.00 0.00 ? 36  GLY A CA   4  
ATOM 6308  C C    . GLY A 1 37  ? -4.919  12.239  7.802   1.00 0.00 ? 36  GLY A C    4  
ATOM 6309  O O    . GLY A 1 37  ? -4.125  11.306  7.830   1.00 0.00 ? 36  GLY A O    4  
ATOM 6310  H H    . GLY A 1 37  ? -5.769  14.925  6.637   1.00 0.00 ? 36  GLY A H    4  
ATOM 6311  H HA2  . GLY A 1 37  ? -4.074  13.545  6.431   1.00 0.00 ? 36  GLY A HA2  4  
ATOM 6312  H HA3  . GLY A 1 37  ? -3.613  13.796  8.152   1.00 0.00 ? 36  GLY A HA3  4  
ATOM 6313  N N    . LYS A 1 38  ? -6.233  12.085  8.113   1.00 0.00 ? 37  LYS A N    4  
ATOM 6314  C CA   . LYS A 1 38  ? -6.827  10.832  8.553   1.00 0.00 ? 37  LYS A CA   4  
ATOM 6315  C C    . LYS A 1 38  ? -7.634  10.125  7.462   1.00 0.00 ? 37  LYS A C    4  
ATOM 6316  O O    . LYS A 1 38  ? -8.141  10.695  6.496   1.00 0.00 ? 37  LYS A O    4  
ATOM 6317  C CB   . LYS A 1 38  ? -7.472  10.906  9.982   1.00 0.00 ? 37  LYS A CB   4  
ATOM 6318  C CG   . LYS A 1 38  ? -7.655  12.266  10.676  1.00 0.00 ? 37  LYS A CG   4  
ATOM 6319  C CD   . LYS A 1 38  ? -8.267  12.038  12.070  1.00 0.00 ? 37  LYS A CD   4  
ATOM 6320  C CE   . LYS A 1 38  ? -8.350  13.295  12.944  1.00 0.00 ? 37  LYS A CE   4  
ATOM 6321  N NZ   . LYS A 1 38  ? -9.254  14.308  12.358  1.00 0.00 ? 37  LYS A NZ   4  
ATOM 6322  H H    . LYS A 1 38  ? -6.879  12.847  8.086   1.00 0.00 ? 37  LYS A H    4  
ATOM 6323  H HA   . LYS A 1 38  ? -6.051  10.102  8.700   1.00 0.00 ? 37  LYS A HA   4  
ATOM 6324  H HB2  . LYS A 1 38  ? -8.489  10.494  9.984   1.00 0.00 ? 37  LYS A HB2  4  
ATOM 6325  H HB3  . LYS A 1 38  ? -6.892  10.241  10.675  1.00 0.00 ? 37  LYS A HB3  4  
ATOM 6326  H HG2  . LYS A 1 38  ? -6.695  12.807  10.765  1.00 0.00 ? 37  LYS A HG2  4  
ATOM 6327  H HG3  . LYS A 1 38  ? -8.332  12.922  10.094  1.00 0.00 ? 37  LYS A HG3  4  
ATOM 6328  H HD2  . LYS A 1 38  ? -9.274  11.576  11.960  1.00 0.00 ? 37  LYS A HD2  4  
ATOM 6329  H HD3  . LYS A 1 38  ? -7.633  11.297  12.609  1.00 0.00 ? 37  LYS A HD3  4  
ATOM 6330  H HE2  . LYS A 1 38  ? -8.750  13.028  13.945  1.00 0.00 ? 37  LYS A HE2  4  
ATOM 6331  H HE3  . LYS A 1 38  ? -7.347  13.759  13.058  1.00 0.00 ? 37  LYS A HE3  4  
ATOM 6332  H HZ1  . LYS A 1 38  ? -10.210 13.907  12.267  1.00 0.00 ? 37  LYS A HZ1  4  
ATOM 6333  H HZ2  . LYS A 1 38  ? -8.904  14.583  11.419  1.00 0.00 ? 37  LYS A HZ2  4  
ATOM 6334  H HZ3  . LYS A 1 38  ? -9.286  15.144  12.976  1.00 0.00 ? 37  LYS A HZ3  4  
ATOM 6335  N N    . TYR A 1 39  ? -7.726  8.776   7.596   1.00 0.00 ? 38  TYR A N    4  
ATOM 6336  C CA   . TYR A 1 39  ? -8.322  7.833   6.650   1.00 0.00 ? 38  TYR A CA   4  
ATOM 6337  C C    . TYR A 1 39  ? -9.230  6.817   7.399   1.00 0.00 ? 38  TYR A C    4  
ATOM 6338  O O    . TYR A 1 39  ? -8.845  6.321   8.463   1.00 0.00 ? 38  TYR A O    4  
ATOM 6339  C CB   . TYR A 1 39  ? -7.144  7.158   5.886   1.00 0.00 ? 38  TYR A CB   4  
ATOM 6340  C CG   . TYR A 1 39  ? -6.347  8.221   5.126   1.00 0.00 ? 38  TYR A CG   4  
ATOM 6341  C CD1  . TYR A 1 39  ? -6.964  9.074   4.230   1.00 0.00 ? 38  TYR A CD1  4  
ATOM 6342  C CD2  . TYR A 1 39  ? -5.017  8.478   5.416   1.00 0.00 ? 38  TYR A CD2  4  
ATOM 6343  C CE1  . TYR A 1 39  ? -6.297  10.139  3.674   1.00 0.00 ? 38  TYR A CE1  4  
ATOM 6344  C CE2  . TYR A 1 39  ? -4.290  9.461   4.754   1.00 0.00 ? 38  TYR A CE2  4  
ATOM 6345  C CZ   . TYR A 1 39  ? -4.960  10.333  3.907   1.00 0.00 ? 38  TYR A CZ   4  
ATOM 6346  O OH   . TYR A 1 39  ? -4.345  11.448  3.283   1.00 0.00 ? 38  TYR A OH   4  
ATOM 6347  H H    . TYR A 1 39  ? -7.317  8.342   8.407   1.00 0.00 ? 38  TYR A H    4  
ATOM 6348  H HA   . TYR A 1 39  ? -8.941  8.361   5.935   1.00 0.00 ? 38  TYR A HA   4  
ATOM 6349  H HB2  . TYR A 1 39  ? -6.461  6.658   6.609   1.00 0.00 ? 38  TYR A HB2  4  
ATOM 6350  H HB3  . TYR A 1 39  ? -7.504  6.404   5.156   1.00 0.00 ? 38  TYR A HB3  4  
ATOM 6351  H HD1  . TYR A 1 39  ? -8.020  9.003   4.046   1.00 0.00 ? 38  TYR A HD1  4  
ATOM 6352  H HD2  . TYR A 1 39  ? -4.569  7.913   6.219   1.00 0.00 ? 38  TYR A HD2  4  
ATOM 6353  H HE1  . TYR A 1 39  ? -6.841  10.820  3.036   1.00 0.00 ? 38  TYR A HE1  4  
ATOM 6354  H HE2  . TYR A 1 39  ? -3.217  9.544   4.940   1.00 0.00 ? 38  TYR A HE2  4  
ATOM 6355  H HH   . TYR A 1 39  ? -3.429  11.217  3.095   1.00 0.00 ? 38  TYR A HH   4  
ATOM 6356  N N    . LYS A 1 40  ? -10.498 6.538   6.901   1.00 0.00 ? 39  LYS A N    4  
ATOM 6357  C CA   . LYS A 1 40  ? -11.517 5.619   7.469   1.00 0.00 ? 39  LYS A CA   4  
ATOM 6358  C C    . LYS A 1 40  ? -11.509 4.531   6.463   1.00 0.00 ? 39  LYS A C    4  
ATOM 6359  O O    . LYS A 1 40  ? -11.917 4.637   5.298   1.00 0.00 ? 39  LYS A O    4  
ATOM 6360  C CB   . LYS A 1 40  ? -12.925 6.262   7.648   1.00 0.00 ? 39  LYS A CB   4  
ATOM 6361  C CG   . LYS A 1 40  ? -14.157 5.344   7.455   1.00 0.00 ? 39  LYS A CG   4  
ATOM 6362  C CD   . LYS A 1 40  ? -14.280 4.103   8.359   1.00 0.00 ? 39  LYS A CD   4  
ATOM 6363  C CE   . LYS A 1 40  ? -14.827 2.907   7.561   1.00 0.00 ? 39  LYS A CE   4  
ATOM 6364  N NZ   . LYS A 1 40  ? -13.768 2.184   6.825   1.00 0.00 ? 39  LYS A NZ   4  
ATOM 6365  H H    . LYS A 1 40  ? -10.862 6.906   6.020   1.00 0.00 ? 39  LYS A H    4  
ATOM 6366  H HA   . LYS A 1 40  ? -11.205 5.107   8.389   1.00 0.00 ? 39  LYS A HA   4  
ATOM 6367  H HB2  . LYS A 1 40  ? -12.965 6.724   8.658   1.00 0.00 ? 39  LYS A HB2  4  
ATOM 6368  H HB3  . LYS A 1 40  ? -13.013 7.095   6.917   1.00 0.00 ? 39  LYS A HB3  4  
ATOM 6369  H HG2  . LYS A 1 40  ? -15.083 5.949   7.582   1.00 0.00 ? 39  LYS A HG2  4  
ATOM 6370  H HG3  . LYS A 1 40  ? -14.156 4.986   6.397   1.00 0.00 ? 39  LYS A HG3  4  
ATOM 6371  H HD2  . LYS A 1 40  ? -13.314 3.831   8.838   1.00 0.00 ? 39  LYS A HD2  4  
ATOM 6372  H HD3  . LYS A 1 40  ? -14.999 4.346   9.174   1.00 0.00 ? 39  LYS A HD3  4  
ATOM 6373  H HE2  . LYS A 1 40  ? -15.320 2.182   8.238   1.00 0.00 ? 39  LYS A HE2  4  
ATOM 6374  H HE3  . LYS A 1 40  ? -15.528 3.256   6.779   1.00 0.00 ? 39  LYS A HE3  4  
ATOM 6375  H HZ1  . LYS A 1 40  ? -14.191 1.395   6.295   1.00 0.00 ? 39  LYS A HZ1  4  
ATOM 6376  H HZ2  . LYS A 1 40  ? -13.068 1.813   7.499   1.00 0.00 ? 39  LYS A HZ2  4  
ATOM 6377  H HZ3  . LYS A 1 40  ? -13.299 2.835   6.163   1.00 0.00 ? 39  LYS A HZ3  4  
ATOM 6378  N N    . LEU A 1 41  ? -10.830 3.479   6.922   1.00 0.00 ? 40  LEU A N    4  
ATOM 6379  C CA   . LEU A 1 41  ? -10.330 2.458   6.061   1.00 0.00 ? 40  LEU A CA   4  
ATOM 6380  C C    . LEU A 1 41  ? -10.515 1.061   6.500   1.00 0.00 ? 40  LEU A C    4  
ATOM 6381  O O    . LEU A 1 41  ? -10.804 0.781   7.655   1.00 0.00 ? 40  LEU A O    4  
ATOM 6382  C CB   . LEU A 1 41  ? -8.854  2.797   5.832   1.00 0.00 ? 40  LEU A CB   4  
ATOM 6383  C CG   . LEU A 1 41  ? -7.923  2.592   7.055   1.00 0.00 ? 40  LEU A CG   4  
ATOM 6384  C CD1  . LEU A 1 41  ? -8.457  2.662   8.493   1.00 0.00 ? 40  LEU A CD1  4  
ATOM 6385  C CD2  . LEU A 1 41  ? -7.137  1.301   6.843   1.00 0.00 ? 40  LEU A CD2  4  
ATOM 6386  H H    . LEU A 1 41  ? -10.557 3.393   7.911   1.00 0.00 ? 40  LEU A H    4  
ATOM 6387  H HA   . LEU A 1 41  ? -10.930 2.482   5.156   1.00 0.00 ? 40  LEU A HA   4  
ATOM 6388  H HB2  . LEU A 1 41  ? -8.450  2.214   4.971   1.00 0.00 ? 40  LEU A HB2  4  
ATOM 6389  H HB3  . LEU A 1 41  ? -8.792  3.871   5.542   1.00 0.00 ? 40  LEU A HB3  4  
ATOM 6390  H HG   . LEU A 1 41  ? -7.301  3.490   7.101   1.00 0.00 ? 40  LEU A HG   4  
ATOM 6391  H HD11 . LEU A 1 41  ? -8.931  3.655   8.695   1.00 0.00 ? 40  LEU A HD11 4  
ATOM 6392  H HD12 . LEU A 1 41  ? -7.619  2.573   9.211   1.00 0.00 ? 40  LEU A HD12 4  
ATOM 6393  H HD13 . LEU A 1 41  ? -9.162  1.816   8.676   1.00 0.00 ? 40  LEU A HD13 4  
ATOM 6394  H HD21 . LEU A 1 41  ? -6.622  1.276   5.853   1.00 0.00 ? 40  LEU A HD21 4  
ATOM 6395  H HD22 . LEU A 1 41  ? -7.815  0.426   6.834   1.00 0.00 ? 40  LEU A HD22 4  
ATOM 6396  H HD23 . LEU A 1 41  ? -6.436  1.152   7.683   1.00 0.00 ? 40  LEU A HD23 4  
ATOM 6397  N N    . LEU A 1 42  ? -10.295 0.086   5.613   1.00 0.00 ? 41  LEU A N    4  
ATOM 6398  C CA   . LEU A 1 42  ? -10.193 -1.283  6.035   1.00 0.00 ? 41  LEU A CA   4  
ATOM 6399  C C    . LEU A 1 42  ? -8.936  -1.865  5.467   1.00 0.00 ? 41  LEU A C    4  
ATOM 6400  O O    . LEU A 1 42  ? -8.479  -1.429  4.427   1.00 0.00 ? 41  LEU A O    4  
ATOM 6401  C CB   . LEU A 1 42  ? -11.566 -1.815  5.651   1.00 0.00 ? 41  LEU A CB   4  
ATOM 6402  C CG   . LEU A 1 42  ? -11.954 -3.262  5.988   1.00 0.00 ? 41  LEU A CG   4  
ATOM 6403  C CD1  . LEU A 1 42  ? -13.465 -3.477  5.818   1.00 0.00 ? 41  LEU A CD1  4  
ATOM 6404  C CD2  . LEU A 1 42  ? -11.249 -4.233  5.060   1.00 0.00 ? 41  LEU A CD2  4  
ATOM 6405  H H    . LEU A 1 42  ? -10.037 0.251   4.652   1.00 0.00 ? 41  LEU A H    4  
ATOM 6406  H HA   . LEU A 1 42  ? -10.006 -1.347  7.100   1.00 0.00 ? 41  LEU A HA   4  
ATOM 6407  H HB2  . LEU A 1 42  ? -12.162 -1.086  6.266   1.00 0.00 ? 41  LEU A HB2  4  
ATOM 6408  H HB3  . LEU A 1 42  ? -11.786 -1.609  4.581   1.00 0.00 ? 41  LEU A HB3  4  
ATOM 6409  H HG   . LEU A 1 42  ? -11.670 -3.476  7.057   1.00 0.00 ? 41  LEU A HG   4  
ATOM 6410  H HD11 . LEU A 1 42  ? -14.034 -2.771  6.453   1.00 0.00 ? 41  LEU A HD11 4  
ATOM 6411  H HD12 . LEU A 1 42  ? -13.743 -4.510  6.116   1.00 0.00 ? 41  LEU A HD12 4  
ATOM 6412  H HD13 . LEU A 1 42  ? -13.771 -3.321  4.761   1.00 0.00 ? 41  LEU A HD13 4  
ATOM 6413  H HD21 . LEU A 1 42  ? -10.340 -4.619  5.558   1.00 0.00 ? 41  LEU A HD21 4  
ATOM 6414  H HD22 . LEU A 1 42  ? -10.939 -3.731  4.120   1.00 0.00 ? 41  LEU A HD22 4  
ATOM 6415  H HD23 . LEU A 1 42  ? -11.907 -5.086  4.793   1.00 0.00 ? 41  LEU A HD23 4  
ATOM 6416  N N    . PHE A 1 43  ? -8.267  -2.882  6.065   1.00 0.00 ? 42  PHE A N    4  
ATOM 6417  C CA   . PHE A 1 43  ? -7.064  -3.468  5.425   1.00 0.00 ? 42  PHE A CA   4  
ATOM 6418  C C    . PHE A 1 43  ? -7.422  -4.366  4.223   1.00 0.00 ? 42  PHE A C    4  
ATOM 6419  O O    . PHE A 1 43  ? -8.558  -4.784  4.057   1.00 0.00 ? 42  PHE A O    4  
ATOM 6420  C CB   . PHE A 1 43  ? -6.156  -4.329  6.375   1.00 0.00 ? 42  PHE A CB   4  
ATOM 6421  C CG   . PHE A 1 43  ? -5.391  -3.541  7.423   1.00 0.00 ? 42  PHE A CG   4  
ATOM 6422  C CD1  . PHE A 1 43  ? -5.720  -2.264  7.866   1.00 0.00 ? 42  PHE A CD1  4  
ATOM 6423  C CD2  . PHE A 1 43  ? -4.305  -4.165  8.016   1.00 0.00 ? 42  PHE A CD2  4  
ATOM 6424  C CE1  . PHE A 1 43  ? -4.999  -1.655  8.873   1.00 0.00 ? 42  PHE A CE1  4  
ATOM 6425  C CE2  . PHE A 1 43  ? -3.591  -3.565  9.035   1.00 0.00 ? 42  PHE A CE2  4  
ATOM 6426  C CZ   . PHE A 1 43  ? -3.941  -2.306  9.467   1.00 0.00 ? 42  PHE A CZ   4  
ATOM 6427  H H    . PHE A 1 43  ? -8.591  -3.218  6.956   1.00 0.00 ? 42  PHE A H    4  
ATOM 6428  H HA   . PHE A 1 43  ? -6.491  -2.637  5.026   1.00 0.00 ? 42  PHE A HA   4  
ATOM 6429  H HB2  . PHE A 1 43  ? -6.777  -5.072  6.919   1.00 0.00 ? 42  PHE A HB2  4  
ATOM 6430  H HB3  . PHE A 1 43  ? -5.384  -4.893  5.772   1.00 0.00 ? 42  PHE A HB3  4  
ATOM 6431  H HD1  . PHE A 1 43  ? -6.559  -1.718  7.467   1.00 0.00 ? 42  PHE A HD1  4  
ATOM 6432  H HD2  . PHE A 1 43  ? -4.018  -5.156  7.689   1.00 0.00 ? 42  PHE A HD2  4  
ATOM 6433  H HE1  . PHE A 1 43  ? -5.285  -0.670  9.222   1.00 0.00 ? 42  PHE A HE1  4  
ATOM 6434  H HE2  . PHE A 1 43  ? -2.753  -4.080  9.488   1.00 0.00 ? 42  PHE A HE2  4  
ATOM 6435  H HZ   . PHE A 1 43  ? -3.390  -1.824  10.263  1.00 0.00 ? 42  PHE A HZ   4  
ATOM 6436  N N    . ASP A 1 44  ? -6.462  -4.777  3.355   1.00 0.00 ? 43  ASP A N    4  
ATOM 6437  C CA   . ASP A 1 44  ? -6.680  -5.635  2.167   1.00 0.00 ? 43  ASP A CA   4  
ATOM 6438  C C    . ASP A 1 44  ? -6.979  -7.101  2.514   1.00 0.00 ? 43  ASP A C    4  
ATOM 6439  O O    . ASP A 1 44  ? -7.105  -7.973  1.663   1.00 0.00 ? 43  ASP A O    4  
ATOM 6440  C CB   . ASP A 1 44  ? -5.520  -5.501  1.133   1.00 0.00 ? 43  ASP A CB   4  
ATOM 6441  C CG   . ASP A 1 44  ? -5.924  -5.939  -0.283  1.00 0.00 ? 43  ASP A CG   4  
ATOM 6442  O OD1  . ASP A 1 44  ? -6.848  -5.304  -0.857  1.00 0.00 ? 43  ASP A OD1  4  
ATOM 6443  O OD2  . ASP A 1 44  ? -5.311  -6.909  -0.800  1.00 0.00 ? 43  ASP A OD2  4  
ATOM 6444  H H    . ASP A 1 44  ? -5.504  -4.484  3.512   1.00 0.00 ? 43  ASP A H    4  
ATOM 6445  H HA   . ASP A 1 44  ? -7.574  -5.266  1.676   1.00 0.00 ? 43  ASP A HA   4  
ATOM 6446  H HB2  . ASP A 1 44  ? -5.238  -4.427  1.071   1.00 0.00 ? 43  ASP A HB2  4  
ATOM 6447  H HB3  . ASP A 1 44  ? -4.622  -6.059  1.471   1.00 0.00 ? 43  ASP A HB3  4  
ATOM 6448  N N    . ASP A 1 45  ? -7.057  -7.341  3.840   1.00 0.00 ? 44  ASP A N    4  
ATOM 6449  C CA   . ASP A 1 45  ? -7.329  -8.546  4.573   1.00 0.00 ? 44  ASP A CA   4  
ATOM 6450  C C    . ASP A 1 45  ? -8.499  -8.438  5.591   1.00 0.00 ? 44  ASP A C    4  
ATOM 6451  O O    . ASP A 1 45  ? -8.808  -9.435  6.238   1.00 0.00 ? 44  ASP A O    4  
ATOM 6452  C CB   . ASP A 1 45  ? -5.964  -9.050  5.138   1.00 0.00 ? 44  ASP A CB   4  
ATOM 6453  C CG   . ASP A 1 45  ? -5.310  -8.089  6.147   1.00 0.00 ? 44  ASP A CG   4  
ATOM 6454  O OD1  . ASP A 1 45  ? -5.796  -8.009  7.307   1.00 0.00 ? 44  ASP A OD1  4  
ATOM 6455  O OD2  . ASP A 1 45  ? -4.306  -7.429  5.765   1.00 0.00 ? 44  ASP A OD2  4  
ATOM 6456  H H    . ASP A 1 45  ? -6.916  -6.531  4.400   1.00 0.00 ? 44  ASP A H    4  
ATOM 6457  H HA   . ASP A 1 45  ? -7.655  -9.306  3.872   1.00 0.00 ? 44  ASP A HA   4  
ATOM 6458  H HB2  . ASP A 1 45  ? -6.054  -10.064 5.575   1.00 0.00 ? 44  ASP A HB2  4  
ATOM 6459  H HB3  . ASP A 1 45  ? -5.279  -9.097  4.245   1.00 0.00 ? 44  ASP A HB3  4  
ATOM 6460  N N    . GLY A 1 46  ? -9.219  -7.274  5.762   1.00 0.00 ? 45  GLY A N    4  
ATOM 6461  C CA   . GLY A 1 46  ? -10.453 -7.205  6.581   1.00 0.00 ? 45  GLY A CA   4  
ATOM 6462  C C    . GLY A 1 46  ? -10.424 -6.534  7.933   1.00 0.00 ? 45  GLY A C    4  
ATOM 6463  O O    . GLY A 1 46  ? -11.417 -6.580  8.653   1.00 0.00 ? 45  GLY A O    4  
ATOM 6464  H H    . GLY A 1 46  ? -9.028  -6.438  5.237   1.00 0.00 ? 45  GLY A H    4  
ATOM 6465  H HA2  . GLY A 1 46  ? -11.151 -6.612  5.988   1.00 0.00 ? 45  GLY A HA2  4  
ATOM 6466  H HA3  . GLY A 1 46  ? -10.830 -8.197  6.821   1.00 0.00 ? 45  GLY A HA3  4  
ATOM 6467  N N    . TYR A 1 47  ? -9.315  -5.874  8.341   1.00 0.00 ? 46  TYR A N    4  
ATOM 6468  C CA   . TYR A 1 47  ? -9.206  -5.159  9.617   1.00 0.00 ? 46  TYR A CA   4  
ATOM 6469  C C    . TYR A 1 47  ? -9.558  -3.676  9.424   1.00 0.00 ? 46  TYR A C    4  
ATOM 6470  O O    . TYR A 1 47  ? -8.756  -2.897  8.921   1.00 0.00 ? 46  TYR A O    4  
ATOM 6471  C CB   . TYR A 1 47  ? -7.780  -5.339  10.251  1.00 0.00 ? 46  TYR A CB   4  
ATOM 6472  C CG   . TYR A 1 47  ? -7.657  -4.653  11.597  1.00 0.00 ? 46  TYR A CG   4  
ATOM 6473  C CD1  . TYR A 1 47  ? -8.299  -5.152  12.717  1.00 0.00 ? 46  TYR A CD1  4  
ATOM 6474  C CD2  . TYR A 1 47  ? -7.065  -3.406  11.672  1.00 0.00 ? 46  TYR A CD2  4  
ATOM 6475  C CE1  . TYR A 1 47  ? -8.379  -4.406  13.878  1.00 0.00 ? 46  TYR A CE1  4  
ATOM 6476  C CE2  . TYR A 1 47  ? -7.172  -2.651  12.817  1.00 0.00 ? 46  TYR A CE2  4  
ATOM 6477  C CZ   . TYR A 1 47  ? -7.830  -3.140  13.920  1.00 0.00 ? 46  TYR A CZ   4  
ATOM 6478  O OH   . TYR A 1 47  ? -7.978  -2.310  15.048  1.00 0.00 ? 46  TYR A OH   4  
ATOM 6479  H H    . TYR A 1 47  ? -8.516  -5.858  7.754   1.00 0.00 ? 46  TYR A H    4  
ATOM 6480  H HA   . TYR A 1 47  ? -9.920  -5.560  10.329  1.00 0.00 ? 46  TYR A HA   4  
ATOM 6481  H HB2  . TYR A 1 47  ? -7.579  -6.421  10.402  1.00 0.00 ? 46  TYR A HB2  4  
ATOM 6482  H HB3  . TYR A 1 47  ? -7.000  -4.935  9.570   1.00 0.00 ? 46  TYR A HB3  4  
ATOM 6483  H HD1  . TYR A 1 47  ? -8.794  -6.110  12.654  1.00 0.00 ? 46  TYR A HD1  4  
ATOM 6484  H HD2  . TYR A 1 47  ? -6.606  -2.973  10.793  1.00 0.00 ? 46  TYR A HD2  4  
ATOM 6485  H HE1  . TYR A 1 47  ? -8.917  -4.798  14.730  1.00 0.00 ? 46  TYR A HE1  4  
ATOM 6486  H HE2  . TYR A 1 47  ? -6.788  -1.645  12.816  1.00 0.00 ? 46  TYR A HE2  4  
ATOM 6487  H HH   . TYR A 1 47  ? -8.409  -2.825  15.731  1.00 0.00 ? 46  TYR A HH   4  
ATOM 6488  N N    . GLU A 1 48  ? -10.769 -3.231  9.842   1.00 0.00 ? 47  GLU A N    4  
ATOM 6489  C CA   . GLU A 1 48  ? -11.217 -1.836  9.746   1.00 0.00 ? 47  GLU A CA   4  
ATOM 6490  C C    . GLU A 1 48  ? -11.029 -1.009  10.990  1.00 0.00 ? 47  GLU A C    4  
ATOM 6491  O O    . GLU A 1 48  ? -11.047 -1.500  12.120  1.00 0.00 ? 47  GLU A O    4  
ATOM 6492  C CB   . GLU A 1 48  ? -12.642 -1.703  9.157   1.00 0.00 ? 47  GLU A CB   4  
ATOM 6493  C CG   . GLU A 1 48  ? -13.318 -0.310  9.220   1.00 0.00 ? 47  GLU A CG   4  
ATOM 6494  C CD   . GLU A 1 48  ? -14.671 -0.399  8.523   1.00 0.00 ? 47  GLU A CD   4  
ATOM 6495  O OE1  . GLU A 1 48  ? -14.698 -0.616  7.283   1.00 0.00 ? 47  GLU A OE1  4  
ATOM 6496  O OE2  . GLU A 1 48  ? -15.707 -0.252  9.227   1.00 0.00 ? 47  GLU A OE2  4  
ATOM 6497  H H    . GLU A 1 48  ? -11.419 -3.861  10.256  1.00 0.00 ? 47  GLU A H    4  
ATOM 6498  H HA   . GLU A 1 48  ? -10.570 -1.321  9.071   1.00 0.00 ? 47  GLU A HA   4  
ATOM 6499  H HB2  . GLU A 1 48  ? -12.545 -1.926  8.087   1.00 0.00 ? 47  GLU A HB2  4  
ATOM 6500  H HB3  . GLU A 1 48  ? -13.270 -2.532  9.520   1.00 0.00 ? 47  GLU A HB3  4  
ATOM 6501  H HG2  . GLU A 1 48  ? -13.504 -0.030  10.280  1.00 0.00 ? 47  GLU A HG2  4  
ATOM 6502  H HG3  . GLU A 1 48  ? -12.633 0.479   8.770   1.00 0.00 ? 47  GLU A HG3  4  
ATOM 6503  N N    . CYS A 1 49  ? -10.805 0.318   10.755  1.00 0.00 ? 48  CYS A N    4  
ATOM 6504  C CA   . CYS A 1 49  ? -10.492 1.256   11.791  1.00 0.00 ? 48  CYS A CA   4  
ATOM 6505  C C    . CYS A 1 49  ? -10.703 2.615   11.170  1.00 0.00 ? 48  CYS A C    4  
ATOM 6506  O O    . CYS A 1 49  ? -10.972 2.721   9.973   1.00 0.00 ? 48  CYS A O    4  
ATOM 6507  C CB   . CYS A 1 49  ? -9.007  1.054   12.264  1.00 0.00 ? 48  CYS A CB   4  
ATOM 6508  S SG   . CYS A 1 49  ? -7.774  0.519   11.018  1.00 0.00 ? 48  CYS A SG   4  
ATOM 6509  H H    . CYS A 1 49  ? -10.813 0.766   9.817   1.00 0.00 ? 48  CYS A H    4  
ATOM 6510  H HA   . CYS A 1 49  ? -11.187 1.168   12.617  1.00 0.00 ? 48  CYS A HA   4  
ATOM 6511  H HB2  . CYS A 1 49  ? -8.629  1.982   12.715  1.00 0.00 ? 48  CYS A HB2  4  
ATOM 6512  H HB3  . CYS A 1 49  ? -9.039  0.263   13.043  1.00 0.00 ? 48  CYS A HB3  4  
ATOM 6513  H HG   . CYS A 1 49  ? -8.371  -0.640  10.771  1.00 0.00 ? 48  CYS A HG   4  
ATOM 6514  N N    . ASP A 1 50  ? -10.515 3.709   11.948  1.00 0.00 ? 49  ASP A N    4  
ATOM 6515  C CA   . ASP A 1 50  ? -10.347 5.053   11.407  1.00 0.00 ? 49  ASP A CA   4  
ATOM 6516  C C    . ASP A 1 50  ? -9.033  5.389   12.077  1.00 0.00 ? 49  ASP A C    4  
ATOM 6517  O O    . ASP A 1 50  ? -8.853  5.063   13.255  1.00 0.00 ? 49  ASP A O    4  
ATOM 6518  C CB   . ASP A 1 50  ? -11.321 6.200   11.847  1.00 0.00 ? 49  ASP A CB   4  
ATOM 6519  C CG   . ASP A 1 50  ? -12.786 5.759   11.851  1.00 0.00 ? 49  ASP A CG   4  
ATOM 6520  O OD1  . ASP A 1 50  ? -13.151 4.899   12.697  1.00 0.00 ? 49  ASP A OD1  4  
ATOM 6521  O OD2  . ASP A 1 50  ? -13.569 6.297   11.025  1.00 0.00 ? 49  ASP A OD2  4  
ATOM 6522  H H    . ASP A 1 50  ? -10.286 3.642   12.920  1.00 0.00 ? 49  ASP A H    4  
ATOM 6523  H HA   . ASP A 1 50  ? -10.218 4.991   10.312  1.00 0.00 ? 49  ASP A HA   4  
ATOM 6524  H HB2  . ASP A 1 50  ? -11.065 6.621   12.852  1.00 0.00 ? 49  ASP A HB2  4  
ATOM 6525  H HB3  . ASP A 1 50  ? -11.194 7.048   11.133  1.00 0.00 ? 49  ASP A HB3  4  
ATOM 6526  N N    . VAL A 1 51  ? -8.081  6.004   11.363  1.00 0.00 ? 50  VAL A N    4  
ATOM 6527  C CA   . VAL A 1 51  ? -6.771  6.294   11.910  1.00 0.00 ? 50  VAL A CA   4  
ATOM 6528  C C    . VAL A 1 51  ? -6.246  7.547   11.309  1.00 0.00 ? 50  VAL A C    4  
ATOM 6529  O O    . VAL A 1 51  ? -6.719  7.966   10.252  1.00 0.00 ? 50  VAL A O    4  
ATOM 6530  C CB   . VAL A 1 51  ? -5.732  5.227   11.546  1.00 0.00 ? 50  VAL A CB   4  
ATOM 6531  C CG1  . VAL A 1 51  ? -6.022  3.968   12.359  1.00 0.00 ? 50  VAL A CG1  4  
ATOM 6532  C CG2  . VAL A 1 51  ? -5.747  4.959   10.021  1.00 0.00 ? 50  VAL A CG2  4  
ATOM 6533  H H    . VAL A 1 51  ? -8.215  6.267   10.399  1.00 0.00 ? 50  VAL A H    4  
ATOM 6534  H HA   . VAL A 1 51  ? -6.860  6.464   12.977  1.00 0.00 ? 50  VAL A HA   4  
ATOM 6535  H HB   . VAL A 1 51  ? -4.690  5.514   11.843  1.00 0.00 ? 50  VAL A HB   4  
ATOM 6536  H HG11 . VAL A 1 51  ? -6.145  4.258   13.424  1.00 0.00 ? 50  VAL A HG11 4  
ATOM 6537  H HG12 . VAL A 1 51  ? -5.184  3.248   12.261  1.00 0.00 ? 50  VAL A HG12 4  
ATOM 6538  H HG13 . VAL A 1 51  ? -6.960  3.497   12.006  1.00 0.00 ? 50  VAL A HG13 4  
ATOM 6539  H HG21 . VAL A 1 51  ? -6.758  5.055   9.566   1.00 0.00 ? 50  VAL A HG21 4  
ATOM 6540  H HG22 . VAL A 1 51  ? -5.373  3.940   9.834   1.00 0.00 ? 50  VAL A HG22 4  
ATOM 6541  H HG23 . VAL A 1 51  ? -5.086  5.685   9.499   1.00 0.00 ? 50  VAL A HG23 4  
ATOM 6542  N N    . LEU A 1 52  ? -5.156  8.111   11.918  1.00 0.00 ? 51  LEU A N    4  
ATOM 6543  C CA   . LEU A 1 52  ? -4.354  9.191   11.363  1.00 0.00 ? 51  LEU A CA   4  
ATOM 6544  C C    . LEU A 1 52  ? -3.343  8.574   10.437  1.00 0.00 ? 51  LEU A C    4  
ATOM 6545  O O    . LEU A 1 52  ? -2.858  7.466   10.651  1.00 0.00 ? 51  LEU A O    4  
ATOM 6546  C CB   . LEU A 1 52  ? -3.708  10.019  12.508  1.00 0.00 ? 51  LEU A CB   4  
ATOM 6547  C CG   . LEU A 1 52  ? -3.271  11.474  12.213  1.00 0.00 ? 51  LEU A CG   4  
ATOM 6548  C CD1  . LEU A 1 52  ? -2.091  11.641  11.245  1.00 0.00 ? 51  LEU A CD1  4  
ATOM 6549  C CD2  . LEU A 1 52  ? -4.443  12.332  11.748  1.00 0.00 ? 51  LEU A CD2  4  
ATOM 6550  H H    . LEU A 1 52  ? -4.782  7.754   12.772  1.00 0.00 ? 51  LEU A H    4  
ATOM 6551  H HA   . LEU A 1 52  ? -4.976  9.745   10.674  1.00 0.00 ? 51  LEU A HA   4  
ATOM 6552  H HB2  . LEU A 1 52  ? -4.489  10.102  13.301  1.00 0.00 ? 51  LEU A HB2  4  
ATOM 6553  H HB3  . LEU A 1 52  ? -2.854  9.469   12.963  1.00 0.00 ? 51  LEU A HB3  4  
ATOM 6554  H HG   . LEU A 1 52  ? -2.942  11.868  13.205  1.00 0.00 ? 51  LEU A HG   4  
ATOM 6555  H HD11 . LEU A 1 52  ? -2.401  11.452  10.197  1.00 0.00 ? 51  LEU A HD11 4  
ATOM 6556  H HD12 . LEU A 1 52  ? -1.273  10.949  11.519  1.00 0.00 ? 51  LEU A HD12 4  
ATOM 6557  H HD13 . LEU A 1 52  ? -1.705  12.680  11.297  1.00 0.00 ? 51  LEU A HD13 4  
ATOM 6558  H HD21 . LEU A 1 52  ? -4.816  11.970  10.766  1.00 0.00 ? 51  LEU A HD21 4  
ATOM 6559  H HD22 . LEU A 1 52  ? -4.140  13.396  11.633  1.00 0.00 ? 51  LEU A HD22 4  
ATOM 6560  H HD23 . LEU A 1 52  ? -5.283  12.274  12.471  1.00 0.00 ? 51  LEU A HD23 4  
ATOM 6561  N N    . GLY A 1 53  ? -3.166  9.211   9.257   1.00 0.00 ? 52  GLY A N    4  
ATOM 6562  C CA   . GLY A 1 53  ? -2.731  8.543   8.049   1.00 0.00 ? 52  GLY A CA   4  
ATOM 6563  C C    . GLY A 1 53  ? -1.316  8.090   7.990   1.00 0.00 ? 52  GLY A C    4  
ATOM 6564  O O    . GLY A 1 53  ? -1.032  7.132   7.299   1.00 0.00 ? 52  GLY A O    4  
ATOM 6565  H H    . GLY A 1 53  ? -3.551  10.122  9.093   1.00 0.00 ? 52  GLY A H    4  
ATOM 6566  H HA2  . GLY A 1 53  ? -3.462  7.733   7.927   1.00 0.00 ? 52  GLY A HA2  4  
ATOM 6567  H HA3  . GLY A 1 53  ? -2.776  9.196   7.198   1.00 0.00 ? 52  GLY A HA3  4  
ATOM 6568  N N    . LYS A 1 54  ? -0.349  8.690   8.745   1.00 0.00 ? 53  LYS A N    4  
ATOM 6569  C CA   . LYS A 1 54  ? 1.096   8.327   8.714   1.00 0.00 ? 53  LYS A CA   4  
ATOM 6570  C C    . LYS A 1 54  ? 1.436   6.860   9.119   1.00 0.00 ? 53  LYS A C    4  
ATOM 6571  O O    . LYS A 1 54  ? 2.578   6.429   9.012   1.00 0.00 ? 53  LYS A O    4  
ATOM 6572  C CB   . LYS A 1 54  ? 1.969   9.307   9.575   1.00 0.00 ? 53  LYS A CB   4  
ATOM 6573  C CG   . LYS A 1 54  ? 2.140   9.038   11.099  1.00 0.00 ? 53  LYS A CG   4  
ATOM 6574  C CD   . LYS A 1 54  ? 0.854   9.112   11.941  1.00 0.00 ? 53  LYS A CD   4  
ATOM 6575  C CE   . LYS A 1 54  ? 1.010   8.542   13.360  1.00 0.00 ? 53  LYS A CE   4  
ATOM 6576  N NZ   . LYS A 1 54  ? -0.242  8.717   14.134  1.00 0.00 ? 53  LYS A NZ   4  
ATOM 6577  H H    . LYS A 1 54  ? -0.607  9.462   9.324   1.00 0.00 ? 53  LYS A H    4  
ATOM 6578  H HA   . LYS A 1 54  ? 1.431   8.471   7.674   1.00 0.00 ? 53  LYS A HA   4  
ATOM 6579  H HB2  . LYS A 1 54  ? 2.995   9.290   9.136   1.00 0.00 ? 53  LYS A HB2  4  
ATOM 6580  H HB3  . LYS A 1 54  ? 1.585   10.340  9.433   1.00 0.00 ? 53  LYS A HB3  4  
ATOM 6581  H HG2  . LYS A 1 54  ? 2.623   8.048   11.262  1.00 0.00 ? 53  LYS A HG2  4  
ATOM 6582  H HG3  . LYS A 1 54  ? 2.851   9.795   11.503  1.00 0.00 ? 53  LYS A HG3  4  
ATOM 6583  H HD2  . LYS A 1 54  ? 0.552   10.179  12.006  1.00 0.00 ? 53  LYS A HD2  4  
ATOM 6584  H HD3  . LYS A 1 54  ? 0.046   8.531   11.442  1.00 0.00 ? 53  LYS A HD3  4  
ATOM 6585  H HE2  . LYS A 1 54  ? 1.225   7.452   13.326  1.00 0.00 ? 53  LYS A HE2  4  
ATOM 6586  H HE3  . LYS A 1 54  ? 1.822   9.063   13.907  1.00 0.00 ? 53  LYS A HE3  4  
ATOM 6587  H HZ1  . LYS A 1 54  ? -0.466  9.731   14.205  1.00 0.00 ? 53  LYS A HZ1  4  
ATOM 6588  H HZ2  . LYS A 1 54  ? -0.117  8.323   15.089  1.00 0.00 ? 53  LYS A HZ2  4  
ATOM 6589  H HZ3  . LYS A 1 54  ? -1.019  8.223   13.652  1.00 0.00 ? 53  LYS A HZ3  4  
ATOM 6590  N N    . ASP A 1 55  ? 0.363   6.125   9.517   1.00 0.00 ? 54  ASP A N    4  
ATOM 6591  C CA   . ASP A 1 55  ? 0.126   4.734   9.802   1.00 0.00 ? 54  ASP A CA   4  
ATOM 6592  C C    . ASP A 1 55  ? -0.646  4.121   8.619   1.00 0.00 ? 54  ASP A C    4  
ATOM 6593  O O    . ASP A 1 55  ? -0.093  3.422   7.783   1.00 0.00 ? 54  ASP A O    4  
ATOM 6594  C CB   . ASP A 1 55  ? -0.729  4.564   11.100  1.00 0.00 ? 54  ASP A CB   4  
ATOM 6595  C CG   . ASP A 1 55  ? 0.062   4.949   12.356  1.00 0.00 ? 54  ASP A CG   4  
ATOM 6596  O OD1  . ASP A 1 55  ? 1.318   5.006   12.296  1.00 0.00 ? 54  ASP A OD1  4  
ATOM 6597  O OD2  . ASP A 1 55  ? -0.598  5.171   13.408  1.00 0.00 ? 54  ASP A OD2  4  
ATOM 6598  H H    . ASP A 1 55  ? -0.483  6.648   9.547   1.00 0.00 ? 54  ASP A H    4  
ATOM 6599  H HA   . ASP A 1 55  ? 1.071   4.216   9.869   1.00 0.00 ? 54  ASP A HA   4  
ATOM 6600  H HB2  . ASP A 1 55  ? -1.637  5.205   11.042  1.00 0.00 ? 54  ASP A HB2  4  
ATOM 6601  H HB3  . ASP A 1 55  ? -1.063  3.511   11.232  1.00 0.00 ? 54  ASP A HB3  4  
ATOM 6602  N N    . ILE A 1 56  ? -1.990  4.326   8.477   1.00 0.00 ? 55  ILE A N    4  
ATOM 6603  C CA   . ILE A 1 56  ? -2.763  3.701   7.381   1.00 0.00 ? 55  ILE A CA   4  
ATOM 6604  C C    . ILE A 1 56  ? -3.315  4.768   6.403   1.00 0.00 ? 55  ILE A C    4  
ATOM 6605  O O    . ILE A 1 56  ? -4.284  5.472   6.697   1.00 0.00 ? 55  ILE A O    4  
ATOM 6606  C CB   . ILE A 1 56  ? -3.814  2.693   7.885   1.00 0.00 ? 55  ILE A CB   4  
ATOM 6607  C CG1  . ILE A 1 56  ? -3.527  2.102   9.307   1.00 0.00 ? 55  ILE A CG1  4  
ATOM 6608  C CG2  . ILE A 1 56  ? -3.959  1.577   6.827   1.00 0.00 ? 55  ILE A CG2  4  
ATOM 6609  C CD1  . ILE A 1 56  ? -2.347  1.136   9.469   1.00 0.00 ? 55  ILE A CD1  4  
ATOM 6610  H H    . ILE A 1 56  ? -2.498  4.894   9.113   1.00 0.00 ? 55  ILE A H    4  
ATOM 6611  H HA   . ILE A 1 56  ? -2.111  3.095   6.794   1.00 0.00 ? 55  ILE A HA   4  
ATOM 6612  H HB   . ILE A 1 56  ? -4.805  3.197   7.981   1.00 0.00 ? 55  ILE A HB   4  
ATOM 6613  H HG12 . ILE A 1 56  ? -3.402  2.932   10.034  1.00 0.00 ? 55  ILE A HG12 4  
ATOM 6614  H HG13 . ILE A 1 56  ? -4.452  1.566   9.619   1.00 0.00 ? 55  ILE A HG13 4  
ATOM 6615  H HG21 . ILE A 1 56  ? -4.549  0.727   7.222   1.00 0.00 ? 55  ILE A HG21 4  
ATOM 6616  H HG22 . ILE A 1 56  ? -2.983  1.168   6.541   1.00 0.00 ? 55  ILE A HG22 4  
ATOM 6617  H HG23 . ILE A 1 56  ? -4.439  1.966   5.906   1.00 0.00 ? 55  ILE A HG23 4  
ATOM 6618  H HD11 . ILE A 1 56  ? -1.377  1.578   9.159   1.00 0.00 ? 55  ILE A HD11 4  
ATOM 6619  H HD12 . ILE A 1 56  ? -2.511  0.205   8.889   1.00 0.00 ? 55  ILE A HD12 4  
ATOM 6620  H HD13 . ILE A 1 56  ? -2.230  0.855   10.539  1.00 0.00 ? 55  ILE A HD13 4  
ATOM 6621  N N    . LEU A 1 57  ? -2.616  4.926   5.231   1.00 0.00 ? 56  LEU A N    4  
ATOM 6622  C CA   . LEU A 1 57  ? -2.768  6.014   4.232   1.00 0.00 ? 56  LEU A CA   4  
ATOM 6623  C C    . LEU A 1 57  ? -2.822  5.748   2.764   1.00 0.00 ? 56  LEU A C    4  
ATOM 6624  O O    . LEU A 1 57  ? -2.247  4.761   2.326   1.00 0.00 ? 56  LEU A O    4  
ATOM 6625  C CB   . LEU A 1 57  ? -1.770  7.182   4.352   1.00 0.00 ? 56  LEU A CB   4  
ATOM 6626  C CG   . LEU A 1 57  ? -0.275  6.824   4.185   1.00 0.00 ? 56  LEU A CG   4  
ATOM 6627  C CD1  . LEU A 1 57  ? 0.218   6.588   2.727   1.00 0.00 ? 56  LEU A CD1  4  
ATOM 6628  C CD2  . LEU A 1 57  ? 0.512   7.960   4.827   1.00 0.00 ? 56  LEU A CD2  4  
ATOM 6629  H H    . LEU A 1 57  ? -1.845  4.299   5.078   1.00 0.00 ? 56  LEU A H    4  
ATOM 6630  H HA   . LEU A 1 57  ? -3.746  6.436   4.416   1.00 0.00 ? 56  LEU A HA   4  
ATOM 6631  H HB2  . LEU A 1 57  ? -2.019  8.035   3.683   1.00 0.00 ? 56  LEU A HB2  4  
ATOM 6632  H HB3  . LEU A 1 57  ? -1.948  7.592   5.363   1.00 0.00 ? 56  LEU A HB3  4  
ATOM 6633  H HG   . LEU A 1 57  ? -0.085  5.901   4.783   1.00 0.00 ? 56  LEU A HG   4  
ATOM 6634  H HD11 . LEU A 1 57  ? -0.161  7.382   2.061   1.00 0.00 ? 56  LEU A HD11 4  
ATOM 6635  H HD12 . LEU A 1 57  ? -0.096  5.616   2.314   1.00 0.00 ? 56  LEU A HD12 4  
ATOM 6636  H HD13 . LEU A 1 57  ? 1.311   6.582   2.591   1.00 0.00 ? 56  LEU A HD13 4  
ATOM 6637  H HD21 . LEU A 1 57  ? 1.459   7.581   5.261   1.00 0.00 ? 56  LEU A HD21 4  
ATOM 6638  H HD22 . LEU A 1 57  ? -0.046  8.479   5.619   1.00 0.00 ? 56  LEU A HD22 4  
ATOM 6639  H HD23 . LEU A 1 57  ? 0.746   8.720   4.070   1.00 0.00 ? 56  LEU A HD23 4  
ATOM 6640  N N    . LEU A 1 58  ? -3.348  6.766   1.995   1.00 0.00 ? 57  LEU A N    4  
ATOM 6641  C CA   . LEU A 1 58  ? -3.413  7.040   0.580   1.00 0.00 ? 57  LEU A CA   4  
ATOM 6642  C C    . LEU A 1 58  ? -2.107  6.903   -0.175  1.00 0.00 ? 57  LEU A C    4  
ATOM 6643  O O    . LEU A 1 58  ? -1.123  7.620   -0.108  1.00 0.00 ? 57  LEU A O    4  
ATOM 6644  C CB   . LEU A 1 58  ? -3.899  8.573   0.590   1.00 0.00 ? 57  LEU A CB   4  
ATOM 6645  C CG   . LEU A 1 58  ? -3.003  9.857   0.658   1.00 0.00 ? 57  LEU A CG   4  
ATOM 6646  C CD1  . LEU A 1 58  ? -1.975  9.921   1.790   1.00 0.00 ? 57  LEU A CD1  4  
ATOM 6647  C CD2  . LEU A 1 58  ? -2.461  10.337  -0.708  1.00 0.00 ? 57  LEU A CD2  4  
ATOM 6648  H H    . LEU A 1 58  ? -3.871  7.517   2.354   1.00 0.00 ? 57  LEU A H    4  
ATOM 6649  H HA   . LEU A 1 58  ? -4.092  6.328   0.094   1.00 0.00 ? 57  LEU A HA   4  
ATOM 6650  H HB2  . LEU A 1 58  ? -4.488  8.734   -0.312  1.00 0.00 ? 57  LEU A HB2  4  
ATOM 6651  H HB3  . LEU A 1 58  ? -4.653  8.699   1.408   1.00 0.00 ? 57  LEU A HB3  4  
ATOM 6652  H HG   . LEU A 1 58  ? -3.726  10.669  0.913   1.00 0.00 ? 57  LEU A HG   4  
ATOM 6653  H HD11 . LEU A 1 58  ? -1.227  9.114   1.671   1.00 0.00 ? 57  LEU A HD11 4  
ATOM 6654  H HD12 . LEU A 1 58  ? -2.455  9.776   2.771   1.00 0.00 ? 57  LEU A HD12 4  
ATOM 6655  H HD13 . LEU A 1 58  ? -1.431  10.889  1.780   1.00 0.00 ? 57  LEU A HD13 4  
ATOM 6656  H HD21 . LEU A 1 58  ? -1.621  9.713   -1.066  1.00 0.00 ? 57  LEU A HD21 4  
ATOM 6657  H HD22 . LEU A 1 58  ? -2.090  11.381  -0.618  1.00 0.00 ? 57  LEU A HD22 4  
ATOM 6658  H HD23 . LEU A 1 58  ? -3.265  10.315  -1.473  1.00 0.00 ? 57  LEU A HD23 4  
ATOM 6659  N N    . CYS A 1 59  ? -2.048  5.778   -0.865  1.00 0.00 ? 58  CYS A N    4  
ATOM 6660  C CA   . CYS A 1 59  ? -0.959  5.234   -1.555  1.00 0.00 ? 58  CYS A CA   4  
ATOM 6661  C C    . CYS A 1 59  ? -1.293  4.970   -3.001  1.00 0.00 ? 58  CYS A C    4  
ATOM 6662  O O    . CYS A 1 59  ? -2.406  5.109   -3.508  1.00 0.00 ? 58  CYS A O    4  
ATOM 6663  C CB   . CYS A 1 59  ? -0.538  4.001   -0.722  1.00 0.00 ? 58  CYS A CB   4  
ATOM 6664  S SG   . CYS A 1 59  ? 1.164   4.187   -0.141  1.00 0.00 ? 58  CYS A SG   4  
ATOM 6665  H H    . CYS A 1 59  ? -2.797  5.113   -0.942  1.00 0.00 ? 58  CYS A H    4  
ATOM 6666  H HA   . CYS A 1 59  ? -0.150  5.958   -1.590  1.00 0.00 ? 58  CYS A HA   4  
ATOM 6667  H HB2  . CYS A 1 59  ? -1.186  3.959   0.183   1.00 0.00 ? 58  CYS A HB2  4  
ATOM 6668  H HB3  . CYS A 1 59  ? -0.709  3.038   -1.253  1.00 0.00 ? 58  CYS A HB3  4  
ATOM 6669  H HG   . CYS A 1 59  ? 0.962   5.309   0.542   1.00 0.00 ? 58  CYS A HG   4  
ATOM 6670  N N    . ASP A 1 60  ? -0.217  4.565   -3.657  1.00 0.00 ? 59  ASP A N    4  
ATOM 6671  C CA   . ASP A 1 60  ? -0.065  4.108   -5.032  1.00 0.00 ? 59  ASP A CA   4  
ATOM 6672  C C    . ASP A 1 60  ? 0.216   2.598   -5.134  1.00 0.00 ? 59  ASP A C    4  
ATOM 6673  O O    . ASP A 1 60  ? -0.295  2.036   -6.104  1.00 0.00 ? 59  ASP A O    4  
ATOM 6674  C CB   . ASP A 1 60  ? 0.993   4.918   -5.850  1.00 0.00 ? 59  ASP A CB   4  
ATOM 6675  C CG   . ASP A 1 60  ? 0.577   6.392   -5.904  1.00 0.00 ? 59  ASP A CG   4  
ATOM 6676  O OD1  . ASP A 1 60  ? -0.499  6.682   -6.492  1.00 0.00 ? 59  ASP A OD1  4  
ATOM 6677  O OD2  . ASP A 1 60  ? 1.331   7.240   -5.359  1.00 0.00 ? 59  ASP A OD2  4  
ATOM 6678  H H    . ASP A 1 60  ? 0.560   4.539   -3.040  1.00 0.00 ? 59  ASP A H    4  
ATOM 6679  H HA   . ASP A 1 60  ? -1.012  4.241   -5.544  1.00 0.00 ? 59  ASP A HA   4  
ATOM 6680  H HB2  . ASP A 1 60  ? 2.009   4.858   -5.401  1.00 0.00 ? 59  ASP A HB2  4  
ATOM 6681  H HB3  . ASP A 1 60  ? 1.058   4.543   -6.893  1.00 0.00 ? 59  ASP A HB3  4  
ATOM 6682  N N    . PRO A 1 61  ? 0.947   1.812   -4.268  1.00 0.00 ? 60  PRO A N    4  
ATOM 6683  C CA   . PRO A 1 61  ? 1.563   2.137   -2.982  1.00 0.00 ? 60  PRO A CA   4  
ATOM 6684  C C    . PRO A 1 61  ? 2.761   3.015   -3.115  1.00 0.00 ? 60  PRO A C    4  
ATOM 6685  O O    . PRO A 1 61  ? 2.732   4.191   -2.761  1.00 0.00 ? 60  PRO A O    4  
ATOM 6686  C CB   . PRO A 1 61  ? 2.000   0.775   -2.358  1.00 0.00 ? 60  PRO A CB   4  
ATOM 6687  C CG   . PRO A 1 61  ? 1.985   -0.246  -3.501  1.00 0.00 ? 60  PRO A CG   4  
ATOM 6688  C CD   . PRO A 1 61  ? 1.086   0.389   -4.563  1.00 0.00 ? 60  PRO A CD   4  
ATOM 6689  H HA   . PRO A 1 61  ? 0.880   2.671   -2.360  1.00 0.00 ? 60  PRO A HA   4  
ATOM 6690  H HB2  . PRO A 1 61  ? 2.978   0.764   -1.833  1.00 0.00 ? 60  PRO A HB2  4  
ATOM 6691  H HB3  . PRO A 1 61  ? 1.287   0.468   -1.575  1.00 0.00 ? 60  PRO A HB3  4  
ATOM 6692  H HG2  . PRO A 1 61  ? 3.006   -0.391  -3.914  1.00 0.00 ? 60  PRO A HG2  4  
ATOM 6693  H HG3  . PRO A 1 61  ? 1.589   -1.230  -3.173  1.00 0.00 ? 60  PRO A HG3  4  
ATOM 6694  H HD2  . PRO A 1 61  ? 1.556   0.242   -5.564  1.00 0.00 ? 60  PRO A HD2  4  
ATOM 6695  H HD3  . PRO A 1 61  ? 0.081   -0.091  -4.519  1.00 0.00 ? 60  PRO A HD3  4  
ATOM 6696  N N    . ILE A 1 62  ? 3.831   2.384   -3.584  1.00 0.00 ? 61  ILE A N    4  
ATOM 6697  C CA   . ILE A 1 62  ? 5.156   2.891   -3.665  1.00 0.00 ? 61  ILE A CA   4  
ATOM 6698  C C    . ILE A 1 62  ? 5.418   2.972   -5.158  1.00 0.00 ? 61  ILE A C    4  
ATOM 6699  O O    . ILE A 1 62  ? 4.688   2.337   -5.911  1.00 0.00 ? 61  ILE A O    4  
ATOM 6700  C CB   . ILE A 1 62  ? 5.984   2.068   -2.682  1.00 0.00 ? 61  ILE A CB   4  
ATOM 6701  C CG1  . ILE A 1 62  ? 6.584   2.898   -1.536  1.00 0.00 ? 61  ILE A CG1  4  
ATOM 6702  C CG2  . ILE A 1 62  ? 7.222   1.459   -3.295  1.00 0.00 ? 61  ILE A CG2  4  
ATOM 6703  C CD1  . ILE A 1 62  ? 5.714   3.931   -0.862  1.00 0.00 ? 61  ILE A CD1  4  
ATOM 6704  H H    . ILE A 1 62  ? 3.701   1.436   -3.885  1.00 0.00 ? 61  ILE A H    4  
ATOM 6705  H HA   . ILE A 1 62  ? 5.150   3.916   -3.327  1.00 0.00 ? 61  ILE A HA   4  
ATOM 6706  H HB   . ILE A 1 62  ? 5.318   1.293   -2.229  1.00 0.00 ? 61  ILE A HB   4  
ATOM 6707  H HG12 . ILE A 1 62  ? 7.054   2.238   -0.776  1.00 0.00 ? 61  ILE A HG12 4  
ATOM 6708  H HG13 . ILE A 1 62  ? 7.422   3.468   -1.986  1.00 0.00 ? 61  ILE A HG13 4  
ATOM 6709  H HG21 . ILE A 1 62  ? 7.697   0.800   -2.543  1.00 0.00 ? 61  ILE A HG21 4  
ATOM 6710  H HG22 . ILE A 1 62  ? 7.912   2.322   -3.482  1.00 0.00 ? 61  ILE A HG22 4  
ATOM 6711  H HG23 . ILE A 1 62  ? 7.024   0.917   -4.235  1.00 0.00 ? 61  ILE A HG23 4  
ATOM 6712  H HD11 . ILE A 1 62  ? 5.753   3.845   0.246   1.00 0.00 ? 61  ILE A HD11 4  
ATOM 6713  H HD12 . ILE A 1 62  ? 4.651   3.836   -1.143  1.00 0.00 ? 61  ILE A HD12 4  
ATOM 6714  H HD13 . ILE A 1 62  ? 6.142   4.899   -1.248  1.00 0.00 ? 61  ILE A HD13 4  
ATOM 6715  N N    . PRO A 1 63  ? 6.382   3.754   -5.631  1.00 0.00 ? 62  PRO A N    4  
ATOM 6716  C CA   . PRO A 1 63  ? 6.408   4.380   -6.968  1.00 0.00 ? 62  PRO A CA   4  
ATOM 6717  C C    . PRO A 1 63  ? 6.478   3.443   -8.199  1.00 0.00 ? 62  PRO A C    4  
ATOM 6718  O O    . PRO A 1 63  ? 7.304   2.550   -8.180  1.00 0.00 ? 62  PRO A O    4  
ATOM 6719  C CB   . PRO A 1 63  ? 7.647   5.320   -6.787  1.00 0.00 ? 62  PRO A CB   4  
ATOM 6720  C CG   . PRO A 1 63  ? 7.588   5.692   -5.303  1.00 0.00 ? 62  PRO A CG   4  
ATOM 6721  C CD   . PRO A 1 63  ? 7.355   4.354   -4.734  1.00 0.00 ? 62  PRO A CD   4  
ATOM 6722  H HA   . PRO A 1 63  ? 5.505   4.963   -7.079  1.00 0.00 ? 62  PRO A HA   4  
ATOM 6723  H HB2  . PRO A 1 63  ? 8.593   4.756   -6.971  1.00 0.00 ? 62  PRO A HB2  4  
ATOM 6724  H HB3  . PRO A 1 63  ? 7.597   6.209   -7.444  1.00 0.00 ? 62  PRO A HB3  4  
ATOM 6725  H HG2  . PRO A 1 63  ? 8.419   6.052   -4.665  1.00 0.00 ? 62  PRO A HG2  4  
ATOM 6726  H HG3  . PRO A 1 63  ? 6.671   6.245   -5.053  1.00 0.00 ? 62  PRO A HG3  4  
ATOM 6727  H HD2  . PRO A 1 63  ? 8.306   3.770   -4.782  1.00 0.00 ? 62  PRO A HD2  4  
ATOM 6728  H HD3  . PRO A 1 63  ? 7.058   4.509   -3.673  1.00 0.00 ? 62  PRO A HD3  4  
ATOM 6729  N N    . LEU A 1 64  ? 5.691   3.614   -9.306  1.00 0.00 ? 63  LEU A N    4  
ATOM 6730  C CA   . LEU A 1 64  ? 5.551   2.909   -10.622 1.00 0.00 ? 63  LEU A CA   4  
ATOM 6731  C C    . LEU A 1 64  ? 6.721   2.344   -11.452 1.00 0.00 ? 63  LEU A C    4  
ATOM 6732  O O    . LEU A 1 64  ? 6.678   2.104   -12.661 1.00 0.00 ? 63  LEU A O    4  
ATOM 6733  C CB   . LEU A 1 64  ? 4.560   3.730   -11.456 1.00 0.00 ? 63  LEU A CB   4  
ATOM 6734  C CG   . LEU A 1 64  ? 3.184   3.737   -10.767 1.00 0.00 ? 63  LEU A CG   4  
ATOM 6735  C CD1  . LEU A 1 64  ? 2.730   5.117   -10.250 1.00 0.00 ? 63  LEU A CD1  4  
ATOM 6736  C CD2  . LEU A 1 64  ? 2.227   3.070   -11.751 1.00 0.00 ? 63  LEU A CD2  4  
ATOM 6737  H H    . LEU A 1 64  ? 4.981   4.323   -9.253  1.00 0.00 ? 63  LEU A H    4  
ATOM 6738  H HA   . LEU A 1 64  ? 5.114   1.951   -10.387 1.00 0.00 ? 63  LEU A HA   4  
ATOM 6739  H HB2  . LEU A 1 64  ? 4.934   4.770   -11.576 1.00 0.00 ? 63  LEU A HB2  4  
ATOM 6740  H HB3  . LEU A 1 64  ? 4.438   3.299   -12.478 1.00 0.00 ? 63  LEU A HB3  4  
ATOM 6741  H HG   . LEU A 1 64  ? 3.208   3.060   -9.876  1.00 0.00 ? 63  LEU A HG   4  
ATOM 6742  H HD11 . LEU A 1 64  ? 1.743   5.016   -9.746  1.00 0.00 ? 63  LEU A HD11 4  
ATOM 6743  H HD12 . LEU A 1 64  ? 2.637   5.839   -11.087 1.00 0.00 ? 63  LEU A HD12 4  
ATOM 6744  H HD13 . LEU A 1 64  ? 3.439   5.526   -9.497  1.00 0.00 ? 63  LEU A HD13 4  
ATOM 6745  H HD21 . LEU A 1 64  ? 2.235   3.602   -12.722 1.00 0.00 ? 63  LEU A HD21 4  
ATOM 6746  H HD22 . LEU A 1 64  ? 1.197   3.033   -11.362 1.00 0.00 ? 63  LEU A HD22 4  
ATOM 6747  H HD23 . LEU A 1 64  ? 2.604   2.033   -11.914 1.00 0.00 ? 63  LEU A HD23 4  
ATOM 6748  N N    . ASP A 1 65  ? 7.824   2.256   -10.746 1.00 0.00 ? 64  ASP A N    4  
ATOM 6749  C CA   . ASP A 1 65  ? 9.182   1.921   -11.072 1.00 0.00 ? 64  ASP A CA   4  
ATOM 6750  C C    . ASP A 1 65  ? 9.784   1.104   -9.939  1.00 0.00 ? 64  ASP A C    4  
ATOM 6751  O O    . ASP A 1 65  ? 10.992  1.158   -9.720  1.00 0.00 ? 64  ASP A O    4  
ATOM 6752  C CB   . ASP A 1 65  ? 9.856   3.316   -10.932 1.00 0.00 ? 64  ASP A CB   4  
ATOM 6753  C CG   . ASP A 1 65  ? 9.644   4.155   -12.193 1.00 0.00 ? 64  ASP A CG   4  
ATOM 6754  O OD1  . ASP A 1 65  ? 10.167  3.751   -13.265 1.00 0.00 ? 64  ASP A OD1  4  
ATOM 6755  O OD2  . ASP A 1 65  ? 8.957   5.208   -12.099 1.00 0.00 ? 64  ASP A OD2  4  
ATOM 6756  H H    . ASP A 1 65  ? 7.612   2.456   -9.778  1.00 0.00 ? 64  ASP A H    4  
ATOM 6757  H HA   . ASP A 1 65  ? 9.302   1.424   -12.025 1.00 0.00 ? 64  ASP A HA   4  
ATOM 6758  H HB2  . ASP A 1 65  ? 9.308   3.787   -10.067 1.00 0.00 ? 64  ASP A HB2  4  
ATOM 6759  H HB3  . ASP A 1 65  ? 10.936  3.298   -10.692 1.00 0.00 ? 64  ASP A HB3  4  
ATOM 6760  N N    . THR A 1 66  ? 8.957   0.457   -9.074  1.00 0.00 ? 65  THR A N    4  
ATOM 6761  C CA   . THR A 1 66  ? 9.450   0.065   -7.762  1.00 0.00 ? 65  THR A CA   4  
ATOM 6762  C C    . THR A 1 66  ? 9.520   -1.349  -7.512  1.00 0.00 ? 65  THR A C    4  
ATOM 6763  O O    . THR A 1 66  ? 8.530   -1.992  -7.219  1.00 0.00 ? 65  THR A O    4  
ATOM 6764  C CB   . THR A 1 66  ? 8.867   0.729   -6.507  1.00 0.00 ? 65  THR A CB   4  
ATOM 6765  O OG1  . THR A 1 66  ? 9.128   2.116   -6.527  1.00 0.00 ? 65  THR A OG1  4  
ATOM 6766  C CG2  . THR A 1 66  ? 9.574   0.264   -5.224  1.00 0.00 ? 65  THR A CG2  4  
ATOM 6767  H H    . THR A 1 66  ? 7.991   0.279   -9.224  1.00 0.00 ? 65  THR A H    4  
ATOM 6768  H HA   . THR A 1 66  ? 10.468  0.355   -7.652  1.00 0.00 ? 65  THR A HA   4  
ATOM 6769  H HB   . THR A 1 66  ? 7.767   0.568   -6.423  1.00 0.00 ? 65  THR A HB   4  
ATOM 6770  H HG1  . THR A 1 66  ? 8.514   2.461   -7.212  1.00 0.00 ? 65  THR A HG1  4  
ATOM 6771  H HG21 . THR A 1 66  ? 9.436   0.993   -4.407  1.00 0.00 ? 65  THR A HG21 4  
ATOM 6772  H HG22 . THR A 1 66  ? 10.669  0.182   -5.390  1.00 0.00 ? 65  THR A HG22 4  
ATOM 6773  H HG23 . THR A 1 66  ? 9.166   -0.708  -4.880  1.00 0.00 ? 65  THR A HG23 4  
ATOM 6774  N N    . GLU A 1 67  ? 10.762  -1.823  -7.395  1.00 0.00 ? 66  GLU A N    4  
ATOM 6775  C CA   . GLU A 1 67  ? 11.093  -3.103  -6.761  1.00 0.00 ? 66  GLU A CA   4  
ATOM 6776  C C    . GLU A 1 67  ? 10.790  -3.089  -5.245  1.00 0.00 ? 66  GLU A C    4  
ATOM 6777  O O    . GLU A 1 67  ? 11.556  -2.661  -4.393  1.00 0.00 ? 66  GLU A O    4  
ATOM 6778  C CB   . GLU A 1 67  ? 12.522  -3.605  -7.125  1.00 0.00 ? 66  GLU A CB   4  
ATOM 6779  C CG   . GLU A 1 67  ? 13.714  -2.834  -6.526  1.00 0.00 ? 66  GLU A CG   4  
ATOM 6780  C CD   . GLU A 1 67  ? 15.015  -3.352  -7.138  1.00 0.00 ? 66  GLU A CD   4  
ATOM 6781  O OE1  . GLU A 1 67  ? 15.328  -4.555  -6.933  1.00 0.00 ? 66  GLU A OE1  4  
ATOM 6782  O OE2  . GLU A 1 67  ? 15.713  -2.551  -7.815  1.00 0.00 ? 66  GLU A OE2  4  
ATOM 6783  H H    . GLU A 1 67  ? 11.431  -1.156  -7.682  1.00 0.00 ? 66  GLU A H    4  
ATOM 6784  H HA   . GLU A 1 67  ? 10.443  -3.851  -7.153  1.00 0.00 ? 66  GLU A HA   4  
ATOM 6785  H HB2  . GLU A 1 67  ? 12.616  -4.679  -6.856  1.00 0.00 ? 66  GLU A HB2  4  
ATOM 6786  H HB3  . GLU A 1 67  ? 12.599  -3.550  -8.234  1.00 0.00 ? 66  GLU A HB3  4  
ATOM 6787  H HG2  . GLU A 1 67  ? 13.599  -1.755  -6.735  1.00 0.00 ? 66  GLU A HG2  4  
ATOM 6788  H HG3  . GLU A 1 67  ? 13.758  -2.976  -5.425  1.00 0.00 ? 66  GLU A HG3  4  
ATOM 6789  N N    . VAL A 1 68  ? 9.572   -3.604  -4.950  1.00 0.00 ? 67  VAL A N    4  
ATOM 6790  C CA   . VAL A 1 68  ? 8.846   -3.804  -3.697  1.00 0.00 ? 67  VAL A CA   4  
ATOM 6791  C C    . VAL A 1 68  ? 9.068   -5.221  -3.360  1.00 0.00 ? 67  VAL A C    4  
ATOM 6792  O O    . VAL A 1 68  ? 9.588   -5.968  -4.166  1.00 0.00 ? 67  VAL A O    4  
ATOM 6793  C CB   . VAL A 1 68  ? 7.333   -3.546  -3.723  1.00 0.00 ? 67  VAL A CB   4  
ATOM 6794  C CG1  . VAL A 1 68  ? 7.034   -2.339  -2.817  1.00 0.00 ? 67  VAL A CG1  4  
ATOM 6795  C CG2  . VAL A 1 68  ? 6.777   -3.440  -5.134  1.00 0.00 ? 67  VAL A CG2  4  
ATOM 6796  H H    . VAL A 1 68  ? 9.060   -3.921  -5.757  1.00 0.00 ? 67  VAL A H    4  
ATOM 6797  H HA   . VAL A 1 68  ? 9.284   -3.265  -2.876  1.00 0.00 ? 67  VAL A HA   4  
ATOM 6798  H HB   . VAL A 1 68  ? 6.746   -4.379  -3.287  1.00 0.00 ? 67  VAL A HB   4  
ATOM 6799  H HG11 . VAL A 1 68  ? 7.506   -1.405  -3.181  1.00 0.00 ? 67  VAL A HG11 4  
ATOM 6800  H HG12 . VAL A 1 68  ? 7.448   -2.594  -1.813  1.00 0.00 ? 67  VAL A HG12 4  
ATOM 6801  H HG13 . VAL A 1 68  ? 5.942   -2.200  -2.657  1.00 0.00 ? 67  VAL A HG13 4  
ATOM 6802  H HG21 . VAL A 1 68  ? 5.668   -3.443  -5.071  1.00 0.00 ? 67  VAL A HG21 4  
ATOM 6803  H HG22 . VAL A 1 68  ? 7.083   -4.293  -5.774  1.00 0.00 ? 67  VAL A HG22 4  
ATOM 6804  H HG23 . VAL A 1 68  ? 7.099   -2.478  -5.569  1.00 0.00 ? 67  VAL A HG23 4  
ATOM 6805  N N    . THR A 1 69  ? 8.679   -5.661  -2.162  1.00 0.00 ? 68  THR A N    4  
ATOM 6806  C CA   . THR A 1 69  ? 8.951   -7.041  -1.747  1.00 0.00 ? 68  THR A CA   4  
ATOM 6807  C C    . THR A 1 69  ? 7.721   -7.860  -2.069  1.00 0.00 ? 68  THR A C    4  
ATOM 6808  O O    . THR A 1 69  ? 6.594   -7.442  -1.842  1.00 0.00 ? 68  THR A O    4  
ATOM 6809  C CB   . THR A 1 69  ? 9.478   -7.087  -0.320  1.00 0.00 ? 68  THR A CB   4  
ATOM 6810  O OG1  . THR A 1 69  ? 9.474   -8.366  0.315   1.00 0.00 ? 68  THR A OG1  4  
ATOM 6811  C CG2  . THR A 1 69  ? 8.582   -6.135  0.443   1.00 0.00 ? 68  THR A CG2  4  
ATOM 6812  H H    . THR A 1 69  ? 8.120   -5.075  -1.534  1.00 0.00 ? 68  THR A H    4  
ATOM 6813  H HA   . THR A 1 69  ? 9.752   -7.471  -2.314  1.00 0.00 ? 68  THR A HA   4  
ATOM 6814  H HB   . THR A 1 69  ? 10.525  -6.698  -0.313  1.00 0.00 ? 68  THR A HB   4  
ATOM 6815  H HG1  . THR A 1 69  ? 9.852   -8.229  1.193   1.00 0.00 ? 68  THR A HG1  4  
ATOM 6816  H HG21 . THR A 1 69  ? 8.713   -5.083  0.104   1.00 0.00 ? 68  THR A HG21 4  
ATOM 6817  H HG22 . THR A 1 69  ? 8.723   -6.204  1.533   1.00 0.00 ? 68  THR A HG22 4  
ATOM 6818  H HG23 . THR A 1 69  ? 7.540   -6.406  0.151   1.00 0.00 ? 68  THR A HG23 4  
ATOM 6819  N N    . ALA A 1 70  ? 7.890   -9.040  -2.677  1.00 0.00 ? 69  ALA A N    4  
ATOM 6820  C CA   . ALA A 1 70  ? 6.811   -9.884  -3.117  1.00 0.00 ? 69  ALA A CA   4  
ATOM 6821  C C    . ALA A 1 70  ? 6.606   -10.982 -2.103  1.00 0.00 ? 69  ALA A C    4  
ATOM 6822  O O    . ALA A 1 70  ? 7.574   -11.487 -1.533  1.00 0.00 ? 69  ALA A O    4  
ATOM 6823  C CB   . ALA A 1 70  ? 7.232   -10.406 -4.493  1.00 0.00 ? 69  ALA A CB   4  
ATOM 6824  H H    . ALA A 1 70  ? 8.810   -9.408  -2.880  1.00 0.00 ? 69  ALA A H    4  
ATOM 6825  H HA   . ALA A 1 70  ? 5.883   -9.324  -3.192  1.00 0.00 ? 69  ALA A HA   4  
ATOM 6826  H HB1  . ALA A 1 70  ? 6.475   -11.051 -4.978  1.00 0.00 ? 69  ALA A HB1  4  
ATOM 6827  H HB2  . ALA A 1 70  ? 8.202   -10.945 -4.443  1.00 0.00 ? 69  ALA A HB2  4  
ATOM 6828  H HB3  . ALA A 1 70  ? 7.399   -9.516  -5.139  1.00 0.00 ? 69  ALA A HB3  4  
ATOM 6829  N N    . LEU A 1 71  ? 5.337   -11.371 -1.803  1.00 0.00 ? 70  LEU A N    4  
ATOM 6830  C CA   . LEU A 1 71  ? 5.030   -12.367 -0.765  1.00 0.00 ? 70  LEU A CA   4  
ATOM 6831  C C    . LEU A 1 71  ? 5.518   -13.802 -1.018  1.00 0.00 ? 70  LEU A C    4  
ATOM 6832  O O    . LEU A 1 71  ? 4.995   -14.636 -1.757  1.00 0.00 ? 70  LEU A O    4  
ATOM 6833  C CB   . LEU A 1 71  ? 3.576   -12.368 -0.302  1.00 0.00 ? 70  LEU A CB   4  
ATOM 6834  C CG   . LEU A 1 71  ? 3.347   -12.555 1.228   1.00 0.00 ? 70  LEU A CG   4  
ATOM 6835  C CD1  . LEU A 1 71  ? 3.967   -13.794 1.899   1.00 0.00 ? 70  LEU A CD1  4  
ATOM 6836  C CD2  . LEU A 1 71  ? 3.767   -11.302 2.011   1.00 0.00 ? 70  LEU A CD2  4  
ATOM 6837  H H    . LEU A 1 71  ? 4.561   -10.892 -2.254  1.00 0.00 ? 70  LEU A H    4  
ATOM 6838  H HA   . LEU A 1 71  ? 5.552   -12.013 0.115   1.00 0.00 ? 70  LEU A HA   4  
ATOM 6839  H HB2  . LEU A 1 71  ? 3.147   -11.379 -0.565  1.00 0.00 ? 70  LEU A HB2  4  
ATOM 6840  H HB3  . LEU A 1 71  ? 3.046   -13.134 -0.892  1.00 0.00 ? 70  LEU A HB3  4  
ATOM 6841  H HG   . LEU A 1 71  ? 2.254   -12.666 1.343   1.00 0.00 ? 70  LEU A HG   4  
ATOM 6842  H HD11 . LEU A 1 71  ? 3.793   -14.715 1.305   1.00 0.00 ? 70  LEU A HD11 4  
ATOM 6843  H HD12 . LEU A 1 71  ? 3.540   -13.940 2.914   1.00 0.00 ? 70  LEU A HD12 4  
ATOM 6844  H HD13 . LEU A 1 71  ? 5.057   -13.650 2.033   1.00 0.00 ? 70  LEU A HD13 4  
ATOM 6845  H HD21 . LEU A 1 71  ? 3.532   -11.426 3.089   1.00 0.00 ? 70  LEU A HD21 4  
ATOM 6846  H HD22 . LEU A 1 71  ? 3.231   -10.407 1.631   1.00 0.00 ? 70  LEU A HD22 4  
ATOM 6847  H HD23 . LEU A 1 71  ? 4.861   -11.136 1.921   1.00 0.00 ? 70  LEU A HD23 4  
ATOM 6848  N N    . SER A 1 72  ? 6.637   -13.983 -0.332  1.00 0.00 ? 71  SER A N    4  
ATOM 6849  C CA   . SER A 1 72  ? 7.592   -15.029 -0.158  1.00 0.00 ? 71  SER A CA   4  
ATOM 6850  C C    . SER A 1 72  ? 7.781   -14.915 1.330   1.00 0.00 ? 71  SER A C    4  
ATOM 6851  O O    . SER A 1 72  ? 7.295   -13.957 1.929   1.00 0.00 ? 71  SER A O    4  
ATOM 6852  C CB   . SER A 1 72  ? 8.897   -14.782 -0.948  1.00 0.00 ? 71  SER A CB   4  
ATOM 6853  O OG   . SER A 1 72  ? 8.670   -14.967 -2.338  1.00 0.00 ? 71  SER A OG   4  
ATOM 6854  H H    . SER A 1 72  ? 6.851   -13.219 0.277   1.00 0.00 ? 71  SER A H    4  
ATOM 6855  H HA   . SER A 1 72  ? 7.153   -15.990 -0.393  1.00 0.00 ? 71  SER A HA   4  
ATOM 6856  H HB2  . SER A 1 72  ? 9.232   -13.733 -0.802  1.00 0.00 ? 71  SER A HB2  4  
ATOM 6857  H HB3  . SER A 1 72  ? 9.710   -15.473 -0.635  1.00 0.00 ? 71  SER A HB3  4  
ATOM 6858  H HG   . SER A 1 72  ? 8.106   -14.233 -2.619  1.00 0.00 ? 71  SER A HG   4  
ATOM 6859  N N    . GLU A 1 73  ? 8.450   -15.875 1.988   1.00 0.00 ? 72  GLU A N    4  
ATOM 6860  C CA   . GLU A 1 73  ? 8.685   -16.016 3.421   1.00 0.00 ? 72  GLU A CA   4  
ATOM 6861  C C    . GLU A 1 73  ? 8.962   -14.787 4.312   1.00 0.00 ? 72  GLU A C    4  
ATOM 6862  O O    . GLU A 1 73  ? 9.389   -13.716 3.896   1.00 0.00 ? 72  GLU A O    4  
ATOM 6863  C CB   . GLU A 1 73  ? 9.887   -16.974 3.618   1.00 0.00 ? 72  GLU A CB   4  
ATOM 6864  C CG   . GLU A 1 73  ? 10.713  -17.263 2.354   1.00 0.00 ? 72  GLU A CG   4  
ATOM 6865  C CD   . GLU A 1 73  ? 10.118  -18.354 1.462   1.00 0.00 ? 72  GLU A CD   4  
ATOM 6866  O OE1  . GLU A 1 73  ? 9.859   -19.471 1.984   1.00 0.00 ? 72  GLU A OE1  4  
ATOM 6867  O OE2  . GLU A 1 73  ? 9.924   -18.087 0.246   1.00 0.00 ? 72  GLU A OE2  4  
ATOM 6868  H H    . GLU A 1 73  ? 8.822   -16.629 1.457   1.00 0.00 ? 72  GLU A H    4  
ATOM 6869  H HA   . GLU A 1 73  ? 7.795   -16.488 3.819   1.00 0.00 ? 72  GLU A HA   4  
ATOM 6870  H HB2  . GLU A 1 73  ? 10.676  -16.529 4.276   1.00 0.00 ? 72  GLU A HB2  4  
ATOM 6871  H HB3  . GLU A 1 73  ? 9.550   -17.920 4.088   1.00 0.00 ? 72  GLU A HB3  4  
ATOM 6872  H HG2  . GLU A 1 73  ? 10.889  -16.307 1.808   1.00 0.00 ? 72  GLU A HG2  4  
ATOM 6873  H HG3  . GLU A 1 73  ? 11.672  -17.628 2.763   1.00 0.00 ? 72  GLU A HG3  4  
ATOM 6874  N N    . ASP A 1 74  ? 8.669   -14.998 5.615   1.00 0.00 ? 73  ASP A N    4  
ATOM 6875  C CA   . ASP A 1 74  ? 8.497   -14.017 6.701   1.00 0.00 ? 73  ASP A CA   4  
ATOM 6876  C C    . ASP A 1 74  ? 9.525   -12.920 6.921   1.00 0.00 ? 73  ASP A C    4  
ATOM 6877  O O    . ASP A 1 74  ? 9.167   -11.750 6.937   1.00 0.00 ? 73  ASP A O    4  
ATOM 6878  C CB   . ASP A 1 74  ? 8.257   -14.729 8.066   1.00 0.00 ? 73  ASP A CB   4  
ATOM 6879  C CG   . ASP A 1 74  ? 7.083   -15.707 7.950   1.00 0.00 ? 73  ASP A CG   4  
ATOM 6880  O OD1  . ASP A 1 74  ? 5.943   -15.236 7.695   1.00 0.00 ? 73  ASP A OD1  4  
ATOM 6881  O OD2  . ASP A 1 74  ? 7.314   -16.934 8.117   1.00 0.00 ? 73  ASP A OD2  4  
ATOM 6882  H H    . ASP A 1 74  ? 8.435   -15.940 5.830   1.00 0.00 ? 73  ASP A H    4  
ATOM 6883  H HA   . ASP A 1 74  ? 7.594   -13.484 6.455   1.00 0.00 ? 73  ASP A HA   4  
ATOM 6884  H HB2  . ASP A 1 74  ? 9.167   -15.294 8.368   1.00 0.00 ? 73  ASP A HB2  4  
ATOM 6885  H HB3  . ASP A 1 74  ? 8.011   -13.999 8.870   1.00 0.00 ? 73  ASP A HB3  4  
ATOM 6886  N N    . GLU A 1 75  ? 10.823  -13.267 7.014   1.00 0.00 ? 74  GLU A N    4  
ATOM 6887  C CA   . GLU A 1 75  ? 11.936  -12.328 7.057   1.00 0.00 ? 74  GLU A CA   4  
ATOM 6888  C C    . GLU A 1 75  ? 12.738  -12.428 5.764   1.00 0.00 ? 74  GLU A C    4  
ATOM 6889  O O    . GLU A 1 75  ? 13.679  -11.682 5.517   1.00 0.00 ? 74  GLU A O    4  
ATOM 6890  C CB   . GLU A 1 75  ? 12.787  -12.634 8.324   1.00 0.00 ? 74  GLU A CB   4  
ATOM 6891  C CG   . GLU A 1 75  ? 13.924  -11.640 8.638   1.00 0.00 ? 74  GLU A CG   4  
ATOM 6892  C CD   . GLU A 1 75  ? 14.618  -11.984 9.960   1.00 0.00 ? 74  GLU A CD   4  
ATOM 6893  O OE1  . GLU A 1 75  ? 14.249  -13.003 10.600  1.00 0.00 ? 74  GLU A OE1  4  
ATOM 6894  O OE2  . GLU A 1 75  ? 15.542  -11.216 10.343  1.00 0.00 ? 74  GLU A OE2  4  
ATOM 6895  H H    . GLU A 1 75  ? 11.074  -14.228 7.026   1.00 0.00 ? 74  GLU A H    4  
ATOM 6896  H HA   . GLU A 1 75  ? 11.592  -11.303 7.111   1.00 0.00 ? 74  GLU A HA   4  
ATOM 6897  H HB2  . GLU A 1 75  ? 12.082  -12.618 9.188   1.00 0.00 ? 74  GLU A HB2  4  
ATOM 6898  H HB3  . GLU A 1 75  ? 13.204  -13.661 8.255   1.00 0.00 ? 74  GLU A HB3  4  
ATOM 6899  H HG2  . GLU A 1 75  ? 14.685  -11.665 7.829   1.00 0.00 ? 74  GLU A HG2  4  
ATOM 6900  H HG3  . GLU A 1 75  ? 13.506  -10.613 8.703   1.00 0.00 ? 74  GLU A HG3  4  
ATOM 6901  N N    . TYR A 1 76  ? 12.408  -13.449 4.931   1.00 0.00 ? 75  TYR A N    4  
ATOM 6902  C CA   . TYR A 1 76  ? 13.245  -13.928 3.837   1.00 0.00 ? 75  TYR A CA   4  
ATOM 6903  C C    . TYR A 1 76  ? 12.741  -13.640 2.427   1.00 0.00 ? 75  TYR A C    4  
ATOM 6904  O O    . TYR A 1 76  ? 13.382  -14.061 1.467   1.00 0.00 ? 75  TYR A O    4  
ATOM 6905  C CB   . TYR A 1 76  ? 13.578  -15.444 4.028   1.00 0.00 ? 75  TYR A CB   4  
ATOM 6906  C CG   . TYR A 1 76  ? 13.870  -15.769 5.477   1.00 0.00 ? 75  TYR A CG   4  
ATOM 6907  C CD1  . TYR A 1 76  ? 15.145  -15.600 5.988   1.00 0.00 ? 75  TYR A CD1  4  
ATOM 6908  C CD2  . TYR A 1 76  ? 12.857  -16.176 6.337   1.00 0.00 ? 75  TYR A CD2  4  
ATOM 6909  C CE1  . TYR A 1 76  ? 15.404  -15.817 7.329   1.00 0.00 ? 75  TYR A CE1  4  
ATOM 6910  C CE2  . TYR A 1 76  ? 13.115  -16.397 7.675   1.00 0.00 ? 75  TYR A CE2  4  
ATOM 6911  C CZ   . TYR A 1 76  ? 14.384  -16.208 8.172   1.00 0.00 ? 75  TYR A CZ   4  
ATOM 6912  O OH   . TYR A 1 76  ? 14.609  -16.395 9.550   1.00 0.00 ? 75  TYR A OH   4  
ATOM 6913  H H    . TYR A 1 76  ? 11.627  -14.018 5.157   1.00 0.00 ? 75  TYR A H    4  
ATOM 6914  H HA   . TYR A 1 76  ? 14.203  -13.420 3.888   1.00 0.00 ? 75  TYR A HA   4  
ATOM 6915  H HB2  . TYR A 1 76  ? 12.732  -16.077 3.715   1.00 0.00 ? 75  TYR A HB2  4  
ATOM 6916  H HB3  . TYR A 1 76  ? 14.467  -15.721 3.419   1.00 0.00 ? 75  TYR A HB3  4  
ATOM 6917  H HD1  . TYR A 1 76  ? 15.939  -15.266 5.333   1.00 0.00 ? 75  TYR A HD1  4  
ATOM 6918  H HD2  . TYR A 1 76  ? 11.842  -16.278 5.979   1.00 0.00 ? 75  TYR A HD2  4  
ATOM 6919  H HE1  . TYR A 1 76  ? 16.404  -15.661 7.710   1.00 0.00 ? 75  TYR A HE1  4  
ATOM 6920  H HE2  . TYR A 1 76  ? 12.319  -16.700 8.343   1.00 0.00 ? 75  TYR A HE2  4  
ATOM 6921  H HH   . TYR A 1 76  ? 15.548  -16.285 9.719   1.00 0.00 ? 75  TYR A HH   4  
ATOM 6922  N N    . PHE A 1 77  ? 11.615  -12.883 2.288   1.00 0.00 ? 76  PHE A N    4  
ATOM 6923  C CA   . PHE A 1 77  ? 10.980  -12.370 1.055   1.00 0.00 ? 76  PHE A CA   4  
ATOM 6924  C C    . PHE A 1 77  ? 11.831  -11.526 0.086   1.00 0.00 ? 76  PHE A C    4  
ATOM 6925  O O    . PHE A 1 77  ? 12.888  -11.007 0.435   1.00 0.00 ? 76  PHE A O    4  
ATOM 6926  C CB   . PHE A 1 77  ? 9.631   -11.621 1.325   1.00 0.00 ? 76  PHE A CB   4  
ATOM 6927  C CG   . PHE A 1 77  ? 9.501   -10.781 2.578   1.00 0.00 ? 76  PHE A CG   4  
ATOM 6928  C CD1  . PHE A 1 77  ? 10.528  -10.062 3.171   1.00 0.00 ? 76  PHE A CD1  4  
ATOM 6929  C CD2  . PHE A 1 77  ? 8.242   -10.717 3.153   1.00 0.00 ? 76  PHE A CD2  4  
ATOM 6930  C CE1  . PHE A 1 77  ? 10.296  -9.326  4.318   1.00 0.00 ? 76  PHE A CE1  4  
ATOM 6931  C CE2  . PHE A 1 77  ? 8.004   -9.984  4.294   1.00 0.00 ? 76  PHE A CE2  4  
ATOM 6932  C CZ   . PHE A 1 77  ? 9.034   -9.279  4.881   1.00 0.00 ? 76  PHE A CZ   4  
ATOM 6933  H H    . PHE A 1 77  ? 11.127  -12.730 3.151   1.00 0.00 ? 76  PHE A H    4  
ATOM 6934  H HA   . PHE A 1 77  ? 10.739  -13.255 0.490   1.00 0.00 ? 76  PHE A HA   4  
ATOM 6935  H HB2  . PHE A 1 77  ? 9.266   -11.012 0.470   1.00 0.00 ? 76  PHE A HB2  4  
ATOM 6936  H HB3  . PHE A 1 77  ? 8.894   -12.425 1.461   1.00 0.00 ? 76  PHE A HB3  4  
ATOM 6937  H HD1  . PHE A 1 77  ? 11.521  -10.073 2.743   1.00 0.00 ? 76  PHE A HD1  4  
ATOM 6938  H HD2  . PHE A 1 77  ? 7.430   -11.270 2.700   1.00 0.00 ? 76  PHE A HD2  4  
ATOM 6939  H HE1  . PHE A 1 77  ? 11.112  -8.792  4.786   1.00 0.00 ? 76  PHE A HE1  4  
ATOM 6940  H HE2  . PHE A 1 77  ? 7.012   -9.985  4.731   1.00 0.00 ? 76  PHE A HE2  4  
ATOM 6941  H HZ   . PHE A 1 77  ? 8.854   -8.710  5.784   1.00 0.00 ? 76  PHE A HZ   4  
ATOM 6942  N N    . SER A 1 78  ? 11.427  -11.424 -1.213  1.00 0.00 ? 77  SER A N    4  
ATOM 6943  C CA   . SER A 1 78  ? 12.310  -10.780 -2.220  1.00 0.00 ? 77  SER A CA   4  
ATOM 6944  C C    . SER A 1 78  ? 11.564  -9.918  -3.205  1.00 0.00 ? 77  SER A C    4  
ATOM 6945  O O    . SER A 1 78  ? 10.351  -10.020 -3.344  1.00 0.00 ? 77  SER A O    4  
ATOM 6946  C CB   . SER A 1 78  ? 13.267  -11.771 -2.950  1.00 0.00 ? 77  SER A CB   4  
ATOM 6947  O OG   . SER A 1 78  ? 14.349  -12.122 -2.089  1.00 0.00 ? 77  SER A OG   4  
ATOM 6948  H H    . SER A 1 78  ? 10.537  -11.814 -1.510  1.00 0.00 ? 77  SER A H    4  
ATOM 6949  H HA   . SER A 1 78  ? 12.946  -10.050 -1.731  1.00 0.00 ? 77  SER A HA   4  
ATOM 6950  H HB2  . SER A 1 78  ? 12.718  -12.690 -3.255  1.00 0.00 ? 77  SER A HB2  4  
ATOM 6951  H HB3  . SER A 1 78  ? 13.728  -11.333 -3.865  1.00 0.00 ? 77  SER A HB3  4  
ATOM 6952  H HG   . SER A 1 78  ? 14.031  -12.007 -1.180  1.00 0.00 ? 77  SER A HG   4  
ATOM 6953  N N    . ALA A 1 79  ? 12.270  -8.975  -3.895  1.00 0.00 ? 78  ALA A N    4  
ATOM 6954  C CA   . ALA A 1 79  ? 11.669  -7.970  -4.764  1.00 0.00 ? 78  ALA A CA   4  
ATOM 6955  C C    . ALA A 1 79  ? 11.208  -8.302  -6.191  1.00 0.00 ? 78  ALA A C    4  
ATOM 6956  O O    . ALA A 1 79  ? 11.740  -9.169  -6.884  1.00 0.00 ? 78  ALA A O    4  
ATOM 6957  C CB   . ALA A 1 79  ? 12.454  -6.632  -4.663  1.00 0.00 ? 78  ALA A CB   4  
ATOM 6958  H H    . ALA A 1 79  ? 13.255  -8.874  -3.775  1.00 0.00 ? 78  ALA A H    4  
ATOM 6959  H HA   . ALA A 1 79  ? 10.730  -7.764  -4.310  1.00 0.00 ? 78  ALA A HA   4  
ATOM 6960  H HB1  . ALA A 1 79  ? 13.465  -6.702  -5.109  1.00 0.00 ? 78  ALA A HB1  4  
ATOM 6961  H HB2  . ALA A 1 79  ? 12.553  -6.341  -3.593  1.00 0.00 ? 78  ALA A HB2  4  
ATOM 6962  H HB3  . ALA A 1 79  ? 11.904  -5.784  -5.128  1.00 0.00 ? 78  ALA A HB3  4  
ATOM 6963  N N    . GLY A 1 80  ? 10.160  -7.537  -6.620  1.00 0.00 ? 79  GLY A N    4  
ATOM 6964  C CA   . GLY A 1 80  ? 9.503   -7.518  -7.920  1.00 0.00 ? 79  GLY A CA   4  
ATOM 6965  C C    . GLY A 1 80  ? 8.908   -6.147  -7.995  1.00 0.00 ? 79  GLY A C    4  
ATOM 6966  O O    . GLY A 1 80  ? 8.827   -5.455  -6.988  1.00 0.00 ? 79  GLY A O    4  
ATOM 6967  H H    . GLY A 1 80  ? 9.794   -6.844  -5.978  1.00 0.00 ? 79  GLY A H    4  
ATOM 6968  H HA2  . GLY A 1 80  ? 10.280  -7.574  -8.704  1.00 0.00 ? 79  GLY A HA2  4  
ATOM 6969  H HA3  . GLY A 1 80  ? 8.672   -8.220  -7.941  1.00 0.00 ? 79  GLY A HA3  4  
ATOM 6970  N N    . VAL A 1 81  ? 8.564   -5.673  -9.199  1.00 0.00 ? 80  VAL A N    4  
ATOM 6971  C CA   . VAL A 1 81  ? 8.336   -4.278  -9.489  1.00 0.00 ? 80  VAL A CA   4  
ATOM 6972  C C    . VAL A 1 81  ? 6.921   -3.857  -9.636  1.00 0.00 ? 80  VAL A C    4  
ATOM 6973  O O    . VAL A 1 81  ? 6.263   -4.365  -10.535 1.00 0.00 ? 80  VAL A O    4  
ATOM 6974  C CB   . VAL A 1 81  ? 9.101   -3.987  -10.790 1.00 0.00 ? 80  VAL A CB   4  
ATOM 6975  C CG1  . VAL A 1 81  ? 8.955   -2.550  -11.340 1.00 0.00 ? 80  VAL A CG1  4  
ATOM 6976  C CG2  . VAL A 1 81  ? 10.585  -4.167  -10.458 1.00 0.00 ? 80  VAL A CG2  4  
ATOM 6977  H H    . VAL A 1 81  ? 8.633   -6.253  -10.014 1.00 0.00 ? 80  VAL A H    4  
ATOM 6978  H HA   . VAL A 1 81  ? 8.748   -3.652  -8.740  1.00 0.00 ? 80  VAL A HA   4  
ATOM 6979  H HB   . VAL A 1 81  ? 8.823   -4.745  -11.562 1.00 0.00 ? 80  VAL A HB   4  
ATOM 6980  H HG11 . VAL A 1 81  ? 9.306   -1.814  -10.588 1.00 0.00 ? 80  VAL A HG11 4  
ATOM 6981  H HG12 . VAL A 1 81  ? 7.915   -2.303  -11.611 1.00 0.00 ? 80  VAL A HG12 4  
ATOM 6982  H HG13 . VAL A 1 81  ? 9.579   -2.429  -12.252 1.00 0.00 ? 80  VAL A HG13 4  
ATOM 6983  H HG21 . VAL A 1 81  ? 10.802  -5.188  -10.068 1.00 0.00 ? 80  VAL A HG21 4  
ATOM 6984  H HG22 . VAL A 1 81  ? 10.833  -3.395  -9.697  1.00 0.00 ? 80  VAL A HG22 4  
ATOM 6985  H HG23 . VAL A 1 81  ? 11.193  -3.958  -11.361 1.00 0.00 ? 80  VAL A HG23 4  
ATOM 6986  N N    . VAL A 1 82  ? 6.405   -2.835  -8.862  1.00 0.00 ? 81  VAL A N    4  
ATOM 6987  C CA   . VAL A 1 82  ? 5.121   -2.213  -9.299  1.00 0.00 ? 81  VAL A CA   4  
ATOM 6988  C C    . VAL A 1 82  ? 5.298   -1.421  -10.626 1.00 0.00 ? 81  VAL A C    4  
ATOM 6989  O O    . VAL A 1 82  ? 6.214   -0.586  -10.691 1.00 0.00 ? 81  VAL A O    4  
ATOM 6990  C CB   . VAL A 1 82  ? 4.397   -1.269  -8.284  1.00 0.00 ? 81  VAL A CB   4  
ATOM 6991  C CG1  . VAL A 1 82  ? 4.645   -1.645  -6.824  1.00 0.00 ? 81  VAL A CG1  4  
ATOM 6992  C CG2  . VAL A 1 82  ? 4.729   0.241   -8.395  1.00 0.00 ? 81  VAL A CG2  4  
ATOM 6993  H H    . VAL A 1 82  ? 6.935   -2.448  -8.056  1.00 0.00 ? 81  VAL A H    4  
ATOM 6994  H HA   . VAL A 1 82  ? 4.463   -3.053  -9.538  1.00 0.00 ? 81  VAL A HA   4  
ATOM 6995  H HB   . VAL A 1 82  ? 3.300   -1.376  -8.469  1.00 0.00 ? 81  VAL A HB   4  
ATOM 6996  H HG11 . VAL A 1 82  ? 5.672   -1.300  -6.564  1.00 0.00 ? 81  VAL A HG11 4  
ATOM 6997  H HG12 . VAL A 1 82  ? 4.521   -2.734  -6.665  1.00 0.00 ? 81  VAL A HG12 4  
ATOM 6998  H HG13 . VAL A 1 82  ? 3.940   -1.097  -6.149  1.00 0.00 ? 81  VAL A HG13 4  
ATOM 6999  H HG21 . VAL A 1 82  ? 5.825   0.464   -8.470  1.00 0.00 ? 81  VAL A HG21 4  
ATOM 7000  H HG22 . VAL A 1 82  ? 4.336   0.771   -7.512  1.00 0.00 ? 81  VAL A HG22 4  
ATOM 7001  H HG23 . VAL A 1 82  ? 4.220   0.694   -9.264  1.00 0.00 ? 81  VAL A HG23 4  
ATOM 7002  N N    . LYS A 1 83  ? 4.459   -1.743  -11.667 1.00 0.00 ? 82  LYS A N    4  
ATOM 7003  C CA   . LYS A 1 83  ? 4.478   -1.088  -12.980 1.00 0.00 ? 82  LYS A CA   4  
ATOM 7004  C C    . LYS A 1 83  ? 3.109   -0.545  -13.366 1.00 0.00 ? 82  LYS A C    4  
ATOM 7005  O O    . LYS A 1 83  ? 3.010   0.601   -13.795 1.00 0.00 ? 82  LYS A O    4  
ATOM 7006  C CB   . LYS A 1 83  ? 5.010   -1.977  -14.136 1.00 0.00 ? 82  LYS A CB   4  
ATOM 7007  C CG   . LYS A 1 83  ? 6.512   -2.266  -14.032 1.00 0.00 ? 82  LYS A CG   4  
ATOM 7008  C CD   . LYS A 1 83  ? 7.072   -2.949  -15.286 1.00 0.00 ? 82  LYS A CD   4  
ATOM 7009  C CE   . LYS A 1 83  ? 8.591   -3.150  -15.222 1.00 0.00 ? 82  LYS A CE   4  
ATOM 7010  N NZ   . LYS A 1 83  ? 9.087   -3.829  -16.441 1.00 0.00 ? 82  LYS A NZ   4  
ATOM 7011  H H    . LYS A 1 83  ? 3.783   -2.482  -11.565 1.00 0.00 ? 82  LYS A H    4  
ATOM 7012  H HA   . LYS A 1 83  ? 5.125   -0.218  -12.951 1.00 0.00 ? 82  LYS A HA   4  
ATOM 7013  H HB2  . LYS A 1 83  ? 4.455   -2.940  -14.169 1.00 0.00 ? 82  LYS A HB2  4  
ATOM 7014  H HB3  . LYS A 1 83  ? 4.860   -1.454  -15.112 1.00 0.00 ? 82  LYS A HB3  4  
ATOM 7015  H HG2  . LYS A 1 83  ? 7.055   -1.305  -13.870 1.00 0.00 ? 82  LYS A HG2  4  
ATOM 7016  H HG3  . LYS A 1 83  ? 6.693   -2.919  -13.149 1.00 0.00 ? 82  LYS A HG3  4  
ATOM 7017  H HD2  . LYS A 1 83  ? 6.571   -3.936  -15.406 1.00 0.00 ? 82  LYS A HD2  4  
ATOM 7018  H HD3  . LYS A 1 83  ? 6.829   -2.326  -16.177 1.00 0.00 ? 82  LYS A HD3  4  
ATOM 7019  H HE2  . LYS A 1 83  ? 9.109   -2.171  -15.146 1.00 0.00 ? 82  LYS A HE2  4  
ATOM 7020  H HE3  . LYS A 1 83  ? 8.865   -3.778  -14.350 1.00 0.00 ? 82  LYS A HE3  4  
ATOM 7021  H HZ1  . LYS A 1 83  ? 8.635   -4.761  -16.525 1.00 0.00 ? 82  LYS A HZ1  4  
ATOM 7022  H HZ2  . LYS A 1 83  ? 10.118  -3.948  -16.377 1.00 0.00 ? 82  LYS A HZ2  4  
ATOM 7023  H HZ3  . LYS A 1 83  ? 8.856   -3.254  -17.276 1.00 0.00 ? 82  LYS A HZ3  4  
ATOM 7024  N N    . GLY A 1 84  ? 1.994   -1.318  -13.234 1.00 0.00 ? 83  GLY A N    4  
ATOM 7025  C CA   . GLY A 1 84  ? 0.659   -0.803  -13.583 1.00 0.00 ? 83  GLY A CA   4  
ATOM 7026  C C    . GLY A 1 84  ? -0.402  -1.333  -12.655 1.00 0.00 ? 83  GLY A C    4  
ATOM 7027  O O    . GLY A 1 84  ? -0.353  -2.498  -12.242 1.00 0.00 ? 83  GLY A O    4  
ATOM 7028  H H    . GLY A 1 84  ? 2.028   -2.272  -12.917 1.00 0.00 ? 83  GLY A H    4  
ATOM 7029  H HA2  . GLY A 1 84  ? 0.619   0.278   -13.515 1.00 0.00 ? 83  GLY A HA2  4  
ATOM 7030  H HA3  . GLY A 1 84  ? 0.429   -1.167  -14.573 1.00 0.00 ? 83  GLY A HA3  4  
ATOM 7031  N N    . HIS A 1 85  ? -1.428  -0.516  -12.300 1.00 0.00 ? 84  HIS A N    4  
ATOM 7032  C CA   . HIS A 1 85  ? -2.474  -0.929  -11.368 1.00 0.00 ? 84  HIS A CA   4  
ATOM 7033  C C    . HIS A 1 85  ? -3.896  -0.546  -11.708 1.00 0.00 ? 84  HIS A C    4  
ATOM 7034  O O    . HIS A 1 85  ? -4.167  0.471   -12.351 1.00 0.00 ? 84  HIS A O    4  
ATOM 7035  C CB   . HIS A 1 85  ? -2.126  -0.532  -9.915  1.00 0.00 ? 84  HIS A CB   4  
ATOM 7036  C CG   . HIS A 1 85  ? -1.173  0.627   -9.742  1.00 0.00 ? 84  HIS A CG   4  
ATOM 7037  N ND1  . HIS A 1 85  ? -1.459  1.977   -9.891  1.00 0.00 ? 84  HIS A ND1  4  
ATOM 7038  C CD2  . HIS A 1 85  ? 0.111   0.573   -9.296  1.00 0.00 ? 84  HIS A CD2  4  
ATOM 7039  C CE1  . HIS A 1 85  ? -0.338  2.651   -9.522  1.00 0.00 ? 84  HIS A CE1  4  
ATOM 7040  N NE2  . HIS A 1 85  ? 0.622   1.837   -9.150  1.00 0.00 ? 84  HIS A NE2  4  
ATOM 7041  H H    . HIS A 1 85  ? -1.502  0.428   -12.618 1.00 0.00 ? 84  HIS A H    4  
ATOM 7042  H HA   . HIS A 1 85  ? -2.557  -2.000  -11.416 1.00 0.00 ? 84  HIS A HA   4  
ATOM 7043  H HB2  . HIS A 1 85  ? -3.014  -0.376  -9.264  1.00 0.00 ? 84  HIS A HB2  4  
ATOM 7044  H HB3  . HIS A 1 85  ? -1.576  -1.405  -9.495  1.00 0.00 ? 84  HIS A HB3  4  
ATOM 7045  H HD1  . HIS A 1 85  ? -2.368  2.377   -10.030 1.00 0.00 ? 84  HIS A HD1  4  
ATOM 7046  H HD2  . HIS A 1 85  ? 0.745   -0.252  -8.988  1.00 0.00 ? 84  HIS A HD2  4  
ATOM 7047  H HE1  . HIS A 1 85  ? -0.141  3.726   -9.549  1.00 0.00 ? 84  HIS A HE1  4  
ATOM 7048  N N    . ARG A 1 86  ? -4.846  -1.430  -11.262 1.00 0.00 ? 85  ARG A N    4  
ATOM 7049  C CA   . ARG A 1 86  ? -6.250  -1.305  -11.589 1.00 0.00 ? 85  ARG A CA   4  
ATOM 7050  C C    . ARG A 1 86  ? -7.096  -1.683  -10.399 1.00 0.00 ? 85  ARG A C    4  
ATOM 7051  O O    . ARG A 1 86  ? -6.664  -2.428  -9.510  1.00 0.00 ? 85  ARG A O    4  
ATOM 7052  C CB   . ARG A 1 86  ? -6.588  -2.303  -12.750 1.00 0.00 ? 85  ARG A CB   4  
ATOM 7053  C CG   . ARG A 1 86  ? -6.756  -3.798  -12.350 1.00 0.00 ? 85  ARG A CG   4  
ATOM 7054  C CD   . ARG A 1 86  ? -8.221  -4.287  -12.377 1.00 0.00 ? 85  ARG A CD   4  
ATOM 7055  N NE   . ARG A 1 86  ? -8.608  -4.585  -13.805 1.00 0.00 ? 85  ARG A NE   4  
ATOM 7056  C CZ   . ARG A 1 86  ? -9.762  -4.167  -14.414 1.00 0.00 ? 85  ARG A CZ   4  
ATOM 7057  N NH1  . ARG A 1 86  ? -10.658 -3.367  -13.769 1.00 0.00 ? 85  ARG A NH1  4  
ATOM 7058  N NH2  . ARG A 1 86  ? -10.015 -4.558  -15.698 1.00 0.00 ? 85  ARG A NH2  4  
ATOM 7059  H H    . ARG A 1 86  ? -4.642  -2.271  -10.717 1.00 0.00 ? 85  ARG A H    4  
ATOM 7060  H HA   . ARG A 1 86  ? -6.502  -0.290  -11.874 1.00 0.00 ? 85  ARG A HA   4  
ATOM 7061  H HB2  . ARG A 1 86  ? -7.522  -1.970  -13.256 1.00 0.00 ? 85  ARG A HB2  4  
ATOM 7062  H HB3  . ARG A 1 86  ? -5.770  -2.238  -13.506 1.00 0.00 ? 85  ARG A HB3  4  
ATOM 7063  H HG2  . ARG A 1 86  ? -6.129  -4.434  -13.010 1.00 0.00 ? 85  ARG A HG2  4  
ATOM 7064  H HG3  . ARG A 1 86  ? -6.400  -3.969  -11.303 1.00 0.00 ? 85  ARG A HG3  4  
ATOM 7065  H HD2  . ARG A 1 86  ? -8.331  -5.212  -11.759 1.00 0.00 ? 85  ARG A HD2  4  
ATOM 7066  H HD3  . ARG A 1 86  ? -8.877  -3.509  -11.943 1.00 0.00 ? 85  ARG A HD3  4  
ATOM 7067  H HE   . ARG A 1 86  ? -7.989  -5.167  -14.333 1.00 0.00 ? 85  ARG A HE   4  
ATOM 7068  H HH11 . ARG A 1 86  ? -10.482 -3.076  -12.829 1.00 0.00 ? 85  ARG A HH11 4  
ATOM 7069  H HH12 . ARG A 1 86  ? -11.493 -3.075  -14.236 1.00 0.00 ? 85  ARG A HH12 4  
ATOM 7070  H HH21 . ARG A 1 86  ? -9.363  -5.145  -16.179 1.00 0.00 ? 85  ARG A HH21 4  
ATOM 7071  H HH22 . ARG A 1 86  ? -10.852 -4.260  -16.156 1.00 0.00 ? 85  ARG A HH22 4  
ATOM 7072  N N    . LYS A 1 87  ? -8.381  -1.273  -10.401 1.00 0.00 ? 86  LYS A N    4  
ATOM 7073  C CA   . LYS A 1 87  ? -9.354  -1.896  -9.535  1.00 0.00 ? 86  LYS A CA   4  
ATOM 7074  C C    . LYS A 1 87  ? -10.636 -2.104  -10.308 1.00 0.00 ? 86  LYS A C    4  
ATOM 7075  O O    . LYS A 1 87  ? -10.978 -1.329  -11.201 1.00 0.00 ? 86  LYS A O    4  
ATOM 7076  C CB   . LYS A 1 87  ? -9.448  -1.226  -8.162  1.00 0.00 ? 86  LYS A CB   4  
ATOM 7077  C CG   . LYS A 1 87  ? -9.840  0.251   -8.227  1.00 0.00 ? 86  LYS A CG   4  
ATOM 7078  C CD   . LYS A 1 87  ? -10.048 0.894   -6.854  1.00 0.00 ? 86  LYS A CD   4  
ATOM 7079  C CE   . LYS A 1 87  ? -10.581 2.328   -6.977  1.00 0.00 ? 86  LYS A CE   4  
ATOM 7080  N NZ   . LYS A 1 87  ? -9.533  3.250   -7.474  1.00 0.00 ? 86  LYS A NZ   4  
ATOM 7081  H H    . LYS A 1 87  ? -8.777  -0.690  -11.109 1.00 0.00 ? 86  LYS A H    4  
ATOM 7082  H HA   . LYS A 1 87  ? -9.057  -2.920  -9.330  1.00 0.00 ? 86  LYS A HA   4  
ATOM 7083  H HB2  . LYS A 1 87  ? -10.142 -1.798  -7.511  1.00 0.00 ? 86  LYS A HB2  4  
ATOM 7084  H HB3  . LYS A 1 87  ? -8.418  -1.332  -7.740  1.00 0.00 ? 86  LYS A HB3  4  
ATOM 7085  H HG2  . LYS A 1 87  ? -9.058  0.812   -8.786  1.00 0.00 ? 86  LYS A HG2  4  
ATOM 7086  H HG3  . LYS A 1 87  ? -10.795 0.338   -8.795  1.00 0.00 ? 86  LYS A HG3  4  
ATOM 7087  H HD2  . LYS A 1 87  ? -10.795 0.292   -6.288  1.00 0.00 ? 86  LYS A HD2  4  
ATOM 7088  H HD3  . LYS A 1 87  ? -9.097  0.891   -6.277  1.00 0.00 ? 86  LYS A HD3  4  
ATOM 7089  H HE2  . LYS A 1 87  ? -11.434 2.366   -7.687  1.00 0.00 ? 86  LYS A HE2  4  
ATOM 7090  H HE3  . LYS A 1 87  ? -10.921 2.699   -5.992  1.00 0.00 ? 86  LYS A HE3  4  
ATOM 7091  H HZ1  . LYS A 1 87  ? -9.921  4.212   -7.544  1.00 0.00 ? 86  LYS A HZ1  4  
ATOM 7092  H HZ2  . LYS A 1 87  ? -9.213  2.935   -8.412  1.00 0.00 ? 86  LYS A HZ2  4  
ATOM 7093  H HZ3  . LYS A 1 87  ? -8.728  3.247   -6.815  1.00 0.00 ? 86  LYS A HZ3  4  
ATOM 7094  N N    . GLU A 1 88  ? -11.368 -3.186  -9.953  1.00 0.00 ? 87  GLU A N    4  
ATOM 7095  C CA   . GLU A 1 88  ? -12.642 -3.636  -10.499 1.00 0.00 ? 87  GLU A CA   4  
ATOM 7096  C C    . GLU A 1 88  ? -13.640 -3.585  -9.340  1.00 0.00 ? 87  GLU A C    4  
ATOM 7097  O O    . GLU A 1 88  ? -13.220 -3.551  -8.185  1.00 0.00 ? 87  GLU A O    4  
ATOM 7098  C CB   . GLU A 1 88  ? -12.477 -5.070  -11.090 1.00 0.00 ? 87  GLU A CB   4  
ATOM 7099  C CG   . GLU A 1 88  ? -13.382 -5.426  -12.290 1.00 0.00 ? 87  GLU A CG   4  
ATOM 7100  C CD   . GLU A 1 88  ? -14.806 -5.772  -11.858 1.00 0.00 ? 87  GLU A CD   4  
ATOM 7101  O OE1  . GLU A 1 88  ? -14.965 -6.722  -11.043 1.00 0.00 ? 87  GLU A OE1  4  
ATOM 7102  O OE2  . GLU A 1 88  ? -15.755 -5.097  -12.340 1.00 0.00 ? 87  GLU A OE2  4  
ATOM 7103  H H    . GLU A 1 88  ? -11.026 -3.774  -9.198  1.00 0.00 ? 87  GLU A H    4  
ATOM 7104  H HA   . GLU A 1 88  ? -12.976 -2.955  -11.274 1.00 0.00 ? 87  GLU A HA   4  
ATOM 7105  H HB2  . GLU A 1 88  ? -11.430 -5.138  -11.471 1.00 0.00 ? 87  GLU A HB2  4  
ATOM 7106  H HB3  . GLU A 1 88  ? -12.554 -5.851  -10.307 1.00 0.00 ? 87  GLU A HB3  4  
ATOM 7107  H HG2  . GLU A 1 88  ? -13.392 -4.582  -13.013 1.00 0.00 ? 87  GLU A HG2  4  
ATOM 7108  H HG3  . GLU A 1 88  ? -12.952 -6.314  -12.803 1.00 0.00 ? 87  GLU A HG3  4  
ATOM 7109  N N    . SER A 1 89  ? -14.983 -3.577  -9.578  1.00 0.00 ? 88  SER A N    4  
ATOM 7110  C CA   . SER A 1 89  ? -16.075 -3.544  -8.579  1.00 0.00 ? 88  SER A CA   4  
ATOM 7111  C C    . SER A 1 89  ? -16.124 -4.707  -7.554  1.00 0.00 ? 88  SER A C    4  
ATOM 7112  O O    . SER A 1 89  ? -17.076 -5.484  -7.521  1.00 0.00 ? 88  SER A O    4  
ATOM 7113  C CB   . SER A 1 89  ? -17.461 -3.432  -9.308  1.00 0.00 ? 88  SER A CB   4  
ATOM 7114  O OG   . SER A 1 89  ? -18.575 -3.219  -8.432  1.00 0.00 ? 88  SER A OG   4  
ATOM 7115  H H    . SER A 1 89  ? -15.284 -3.609  -10.526 1.00 0.00 ? 88  SER A H    4  
ATOM 7116  H HA   . SER A 1 89  ? -15.951 -2.635  -8.005  1.00 0.00 ? 88  SER A HA   4  
ATOM 7117  H HB2  . SER A 1 89  ? -17.418 -2.568  -10.009 1.00 0.00 ? 88  SER A HB2  4  
ATOM 7118  H HB3  . SER A 1 89  ? -17.643 -4.346  -9.916  1.00 0.00 ? 88  SER A HB3  4  
ATOM 7119  H HG   . SER A 1 89  ? -18.580 -3.997  -7.852  1.00 0.00 ? 88  SER A HG   4  
ATOM 7120  N N    . GLY A 1 90  ? -15.086 -4.801  -6.687  1.00 0.00 ? 89  GLY A N    4  
ATOM 7121  C CA   . GLY A 1 90  ? -14.890 -5.801  -5.648  1.00 0.00 ? 89  GLY A CA   4  
ATOM 7122  C C    . GLY A 1 90  ? -13.673 -6.656  -5.885  1.00 0.00 ? 89  GLY A C    4  
ATOM 7123  O O    . GLY A 1 90  ? -13.521 -7.691  -5.250  1.00 0.00 ? 89  GLY A O    4  
ATOM 7124  H H    . GLY A 1 90  ? -14.349 -4.126  -6.811  1.00 0.00 ? 89  GLY A H    4  
ATOM 7125  H HA2  . GLY A 1 90  ? -14.731 -5.273  -4.720  1.00 0.00 ? 89  GLY A HA2  4  
ATOM 7126  H HA3  . GLY A 1 90  ? -15.737 -6.475  -5.600  1.00 0.00 ? 89  GLY A HA3  4  
ATOM 7127  N N    . GLU A 1 91  ? -12.756 -6.259  -6.814  1.00 0.00 ? 90  GLU A N    4  
ATOM 7128  C CA   . GLU A 1 91  ? -11.536 -6.967  -7.117  1.00 0.00 ? 90  GLU A CA   4  
ATOM 7129  C C    . GLU A 1 91  ? -10.462 -5.906  -7.311  1.00 0.00 ? 90  GLU A C    4  
ATOM 7130  O O    . GLU A 1 91  ? -10.734 -4.792  -7.752  1.00 0.00 ? 90  GLU A O    4  
ATOM 7131  C CB   . GLU A 1 91  ? -11.738 -7.913  -8.321  1.00 0.00 ? 90  GLU A CB   4  
ATOM 7132  C CG   . GLU A 1 91  ? -10.500 -8.764  -8.609  1.00 0.00 ? 90  GLU A CG   4  
ATOM 7133  C CD   . GLU A 1 91  ? -10.790 -9.915  -9.570  1.00 0.00 ? 90  GLU A CD   4  
ATOM 7134  O OE1  . GLU A 1 91  ? -11.923 -9.985  -10.117 1.00 0.00 ? 90  GLU A OE1  4  
ATOM 7135  O OE2  . GLU A 1 91  ? -9.865  -10.748 -9.771  1.00 0.00 ? 90  GLU A OE2  4  
ATOM 7136  H H    . GLU A 1 91  ? -12.803 -5.413  -7.354  1.00 0.00 ? 90  GLU A H    4  
ATOM 7137  H HA   . GLU A 1 91  ? -11.229 -7.563  -6.264  1.00 0.00 ? 90  GLU A HA   4  
ATOM 7138  H HB2  . GLU A 1 91  ? -12.590 -8.586  -8.073  1.00 0.00 ? 90  GLU A HB2  4  
ATOM 7139  H HB3  . GLU A 1 91  ? -12.003 -7.343  -9.234  1.00 0.00 ? 90  GLU A HB3  4  
ATOM 7140  H HG2  . GLU A 1 91  ? -9.740  -8.079  -9.039  1.00 0.00 ? 90  GLU A HG2  4  
ATOM 7141  H HG3  . GLU A 1 91  ? -10.128 -9.165  -7.643  1.00 0.00 ? 90  GLU A HG3  4  
ATOM 7142  N N    . LEU A 1 92  ? -9.195  -6.208  -6.958  1.00 0.00 ? 91  LEU A N    4  
ATOM 7143  C CA   . LEU A 1 92  ? -8.093  -5.273  -6.958  1.00 0.00 ? 91  LEU A CA   4  
ATOM 7144  C C    . LEU A 1 92  ? -6.941  -5.955  -7.632  1.00 0.00 ? 91  LEU A C    4  
ATOM 7145  O O    . LEU A 1 92  ? -6.625  -7.066  -7.214  1.00 0.00 ? 91  LEU A O    4  
ATOM 7146  C CB   . LEU A 1 92  ? -7.689  -5.016  -5.470  1.00 0.00 ? 91  LEU A CB   4  
ATOM 7147  C CG   . LEU A 1 92  ? -7.361  -3.534  -5.181  1.00 0.00 ? 91  LEU A CG   4  
ATOM 7148  C CD1  . LEU A 1 92  ? -7.546  -3.195  -3.690  1.00 0.00 ? 91  LEU A CD1  4  
ATOM 7149  C CD2  . LEU A 1 92  ? -5.976  -3.127  -5.700  1.00 0.00 ? 91  LEU A CD2  4  
ATOM 7150  H H    . LEU A 1 92  ? -8.926  -7.112  -6.654  1.00 0.00 ? 91  LEU A H    4  
ATOM 7151  H HA   . LEU A 1 92  ? -8.344  -4.359  -7.477  1.00 0.00 ? 91  LEU A HA   4  
ATOM 7152  H HB2  . LEU A 1 92  ? -8.588  -5.248  -4.852  1.00 0.00 ? 91  LEU A HB2  4  
ATOM 7153  H HB3  . LEU A 1 92  ? -6.882  -5.724  -5.104  1.00 0.00 ? 91  LEU A HB3  4  
ATOM 7154  H HG   . LEU A 1 92  ? -8.110  -2.909  -5.727  1.00 0.00 ? 91  LEU A HG   4  
ATOM 7155  H HD11 . LEU A 1 92  ? -6.882  -3.821  -3.064  1.00 0.00 ? 91  LEU A HD11 4  
ATOM 7156  H HD12 . LEU A 1 92  ? -8.601  -3.383  -3.389  1.00 0.00 ? 91  LEU A HD12 4  
ATOM 7157  H HD13 . LEU A 1 92  ? -7.311  -2.127  -3.489  1.00 0.00 ? 91  LEU A HD13 4  
ATOM 7158  H HD21 . LEU A 1 92  ? -5.936  -3.184  -6.809  1.00 0.00 ? 91  LEU A HD21 4  
ATOM 7159  H HD22 . LEU A 1 92  ? -5.191  -3.787  -5.277  1.00 0.00 ? 91  LEU A HD22 4  
ATOM 7160  H HD23 . LEU A 1 92  ? -5.757  -2.079  -5.402  1.00 0.00 ? 91  LEU A HD23 4  
ATOM 7161  N N    . TYR A 1 93  ? -6.222  -5.392  -8.643  1.00 0.00 ? 92  TYR A N    4  
ATOM 7162  C CA   . TYR A 1 93  ? -4.999  -6.107  -8.997  1.00 0.00 ? 92  TYR A CA   4  
ATOM 7163  C C    . TYR A 1 93  ? -3.902  -5.178  -9.423  1.00 0.00 ? 92  TYR A C    4  
ATOM 7164  O O    . TYR A 1 93  ? -4.077  -4.213  -10.168 1.00 0.00 ? 92  TYR A O    4  
ATOM 7165  C CB   . TYR A 1 93  ? -5.124  -7.439  -9.827  1.00 0.00 ? 92  TYR A CB   4  
ATOM 7166  C CG   . TYR A 1 93  ? -6.192  -7.485  -10.894 1.00 0.00 ? 92  TYR A CG   4  
ATOM 7167  C CD1  . TYR A 1 93  ? -5.935  -7.047  -12.174 1.00 0.00 ? 92  TYR A CD1  4  
ATOM 7168  C CD2  . TYR A 1 93  ? -7.423  -8.073  -10.650 1.00 0.00 ? 92  TYR A CD2  4  
ATOM 7169  C CE1  . TYR A 1 93  ? -6.838  -7.236  -13.201 1.00 0.00 ? 92  TYR A CE1  4  
ATOM 7170  C CE2  . TYR A 1 93  ? -8.369  -8.188  -11.653 1.00 0.00 ? 92  TYR A CE2  4  
ATOM 7171  C CZ   . TYR A 1 93  ? -8.068  -7.793  -12.936 1.00 0.00 ? 92  TYR A CZ   4  
ATOM 7172  O OH   . TYR A 1 93  ? -9.022  -7.912  -13.966 1.00 0.00 ? 92  TYR A OH   4  
ATOM 7173  H H    . TYR A 1 93  ? -6.342  -4.465  -9.057  1.00 0.00 ? 92  TYR A H    4  
ATOM 7174  H HA   . TYR A 1 93  ? -4.545  -6.423  -8.036  1.00 0.00 ? 92  TYR A HA   4  
ATOM 7175  H HB2  . TYR A 1 93  ? -4.154  -7.743  -10.275 1.00 0.00 ? 92  TYR A HB2  4  
ATOM 7176  H HB3  . TYR A 1 93  ? -5.380  -8.248  -9.105  1.00 0.00 ? 92  TYR A HB3  4  
ATOM 7177  H HD1  . TYR A 1 93  ? -5.006  -6.552  -12.376 1.00 0.00 ? 92  TYR A HD1  4  
ATOM 7178  H HD2  . TYR A 1 93  ? -7.639  -8.448  -9.658  1.00 0.00 ? 92  TYR A HD2  4  
ATOM 7179  H HE1  . TYR A 1 93  ? -6.608  -6.899  -14.204 1.00 0.00 ? 92  TYR A HE1  4  
ATOM 7180  H HE2  . TYR A 1 93  ? -9.345  -8.590  -11.430 1.00 0.00 ? 92  TYR A HE2  4  
ATOM 7181  H HH   . TYR A 1 93  ? -9.742  -8.459  -13.644 1.00 0.00 ? 92  TYR A HH   4  
ATOM 7182  N N    . TYR A 1 94  ? -2.712  -5.489  -8.897  1.00 0.00 ? 93  TYR A N    4  
ATOM 7183  C CA   . TYR A 1 94  ? -1.450  -4.850  -9.097  1.00 0.00 ? 93  TYR A CA   4  
ATOM 7184  C C    . TYR A 1 94  ? -0.636  -5.789  -9.949  1.00 0.00 ? 93  TYR A C    4  
ATOM 7185  O O    . TYR A 1 94  ? -0.503  -6.965  -9.614  1.00 0.00 ? 93  TYR A O    4  
ATOM 7186  C CB   . TYR A 1 94  ? -0.760  -4.615  -7.725  1.00 0.00 ? 93  TYR A CB   4  
ATOM 7187  C CG   . TYR A 1 94  ? -1.198  -3.284  -7.208  1.00 0.00 ? 93  TYR A CG   4  
ATOM 7188  C CD1  . TYR A 1 94  ? -2.532  -2.986  -6.973  1.00 0.00 ? 93  TYR A CD1  4  
ATOM 7189  C CD2  . TYR A 1 94  ? -0.262  -2.278  -7.119  1.00 0.00 ? 93  TYR A CD2  4  
ATOM 7190  C CE1  . TYR A 1 94  ? -2.936  -1.687  -6.756  1.00 0.00 ? 93  TYR A CE1  4  
ATOM 7191  C CE2  . TYR A 1 94  ? -0.671  -0.992  -6.886  1.00 0.00 ? 93  TYR A CE2  4  
ATOM 7192  C CZ   . TYR A 1 94  ? -1.998  -0.694  -6.723  1.00 0.00 ? 93  TYR A CZ   4  
ATOM 7193  O OH   . TYR A 1 94  ? -2.402  0.644   -6.652  1.00 0.00 ? 93  TYR A OH   4  
ATOM 7194  H H    . TYR A 1 94  ? -2.672  -6.251  -8.237  1.00 0.00 ? 93  TYR A H    4  
ATOM 7195  H HA   . TYR A 1 94  ? -1.568  -3.925  -9.635  1.00 0.00 ? 93  TYR A HA   4  
ATOM 7196  H HB2  . TYR A 1 94  ? -1.033  -5.391  -6.985  1.00 0.00 ? 93  TYR A HB2  4  
ATOM 7197  H HB3  . TYR A 1 94  ? 0.342   -4.584  -7.817  1.00 0.00 ? 93  TYR A HB3  4  
ATOM 7198  H HD1  . TYR A 1 94  ? -3.292  -3.748  -7.021  1.00 0.00 ? 93  TYR A HD1  4  
ATOM 7199  H HD2  . TYR A 1 94  ? 0.786   -2.473  -7.314  1.00 0.00 ? 93  TYR A HD2  4  
ATOM 7200  H HE1  . TYR A 1 94  ? -3.984  -1.445  -6.665  1.00 0.00 ? 93  TYR A HE1  4  
ATOM 7201  H HE2  . TYR A 1 94  ? 0.058   -0.201  -6.938  1.00 0.00 ? 93  TYR A HE2  4  
ATOM 7202  H HH   . TYR A 1 94  ? -1.588  1.189   -6.588  1.00 0.00 ? 93  TYR A HH   4  
ATOM 7203  N N    . SER A 1 95  ? -0.057  -5.259  -11.067 1.00 0.00 ? 94  SER A N    4  
ATOM 7204  C CA   . SER A 1 95  ? 0.838   -5.948  -11.984 1.00 0.00 ? 94  SER A CA   4  
ATOM 7205  C C    . SER A 1 95  ? 2.249   -5.720  -11.483 1.00 0.00 ? 94  SER A C    4  
ATOM 7206  O O    . SER A 1 95  ? 2.866   -4.646  -11.591 1.00 0.00 ? 94  SER A O    4  
ATOM 7207  C CB   . SER A 1 95  ? 0.705   -5.553  -13.488 1.00 0.00 ? 94  SER A CB   4  
ATOM 7208  O OG   . SER A 1 95  ? 0.972   -4.177  -13.765 1.00 0.00 ? 94  SER A OG   4  
ATOM 7209  H H    . SER A 1 95  ? -0.209  -4.293  -11.282 1.00 0.00 ? 94  SER A H    4  
ATOM 7210  H HA   . SER A 1 95  ? 0.622   -7.014  -11.904 1.00 0.00 ? 94  SER A HA   4  
ATOM 7211  H HB2  . SER A 1 95  ? 1.386   -6.171  -14.112 1.00 0.00 ? 94  SER A HB2  4  
ATOM 7212  H HB3  . SER A 1 95  ? -0.323  -5.781  -13.825 1.00 0.00 ? 94  SER A HB3  4  
ATOM 7213  H HG   . SER A 1 95  ? 0.439   -3.608  -13.168 1.00 0.00 ? 94  SER A HG   4  
ATOM 7214  N N    . ILE A 1 96  ? 2.733   -6.790  -10.831 1.00 0.00 ? 95  ILE A N    4  
ATOM 7215  C CA   . ILE A 1 96  ? 4.010   -6.819  -10.169 1.00 0.00 ? 95  ILE A CA   4  
ATOM 7216  C C    . ILE A 1 96  ? 4.924   -7.540  -11.109 1.00 0.00 ? 95  ILE A C    4  
ATOM 7217  O O    . ILE A 1 96  ? 4.698   -8.707  -11.427 1.00 0.00 ? 95  ILE A O    4  
ATOM 7218  C CB   . ILE A 1 96  ? 3.849   -7.459  -8.804  1.00 0.00 ? 95  ILE A CB   4  
ATOM 7219  C CG1  . ILE A 1 96  ? 2.746   -6.686  -8.024  1.00 0.00 ? 95  ILE A CG1  4  
ATOM 7220  C CG2  . ILE A 1 96  ? 5.196   -7.488  -8.045  1.00 0.00 ? 95  ILE A CG2  4  
ATOM 7221  C CD1  . ILE A 1 96  ? 2.995   -5.167  -7.907  1.00 0.00 ? 95  ILE A CD1  4  
ATOM 7222  H H    . ILE A 1 96  ? 2.167   -7.638  -10.746 1.00 0.00 ? 95  ILE A H    4  
ATOM 7223  H HA   . ILE A 1 96  ? 4.412   -5.828  -10.032 1.00 0.00 ? 95  ILE A HA   4  
ATOM 7224  H HB   . ILE A 1 96  ? 3.484   -8.508  -8.922  1.00 0.00 ? 95  ILE A HB   4  
ATOM 7225  H HG12 . ILE A 1 96  ? 1.754   -6.856  -8.493  1.00 0.00 ? 95  ILE A HG12 4  
ATOM 7226  H HG13 . ILE A 1 96  ? 2.669   -7.140  -7.013  1.00 0.00 ? 95  ILE A HG13 4  
ATOM 7227  H HG21 . ILE A 1 96  ? 5.063   -7.978  -7.058  1.00 0.00 ? 95  ILE A HG21 4  
ATOM 7228  H HG22 . ILE A 1 96  ? 5.577   -6.458  -7.877  1.00 0.00 ? 95  ILE A HG22 4  
ATOM 7229  H HG23 . ILE A 1 96  ? 5.968   -8.064  -8.592  1.00 0.00 ? 95  ILE A HG23 4  
ATOM 7230  H HD11 . ILE A 1 96  ? 2.309   -4.690  -7.180  1.00 0.00 ? 95  ILE A HD11 4  
ATOM 7231  H HD12 . ILE A 1 96  ? 2.855   -4.653  -8.880  1.00 0.00 ? 95  ILE A HD12 4  
ATOM 7232  H HD13 . ILE A 1 96  ? 4.028   -4.971  -7.553  1.00 0.00 ? 95  ILE A HD13 4  
ATOM 7233  N N    . GLU A 1 97  ? 5.980   -6.851  -11.623 1.00 0.00 ? 96  GLU A N    4  
ATOM 7234  C CA   . GLU A 1 97  ? 6.889   -7.473  -12.597 1.00 0.00 ? 96  GLU A CA   4  
ATOM 7235  C C    . GLU A 1 97  ? 8.002   -8.206  -11.894 1.00 0.00 ? 96  GLU A C    4  
ATOM 7236  O O    . GLU A 1 97  ? 8.861   -7.632  -11.232 1.00 0.00 ? 96  GLU A O    4  
ATOM 7237  C CB   . GLU A 1 97  ? 7.326   -6.566  -13.763 1.00 0.00 ? 96  GLU A CB   4  
ATOM 7238  C CG   . GLU A 1 97  ? 8.085   -7.319  -14.880 1.00 0.00 ? 96  GLU A CG   4  
ATOM 7239  C CD   . GLU A 1 97  ? 9.598   -7.347  -14.646 1.00 0.00 ? 96  GLU A CD   4  
ATOM 7240  O OE1  . GLU A 1 97  ? 10.203  -6.249  -14.528 1.00 0.00 ? 96  GLU A OE1  4  
ATOM 7241  O OE2  . GLU A 1 97  ? 10.166  -8.469  -14.582 1.00 0.00 ? 96  GLU A OE2  4  
ATOM 7242  H H    . GLU A 1 97  ? 6.130   -5.883  -11.318 1.00 0.00 ? 96  GLU A H    4  
ATOM 7243  H HA   . GLU A 1 97  ? 6.349   -8.255  -13.089 1.00 0.00 ? 96  GLU A HA   4  
ATOM 7244  H HB2  . GLU A 1 97  ? 6.383   -6.184  -14.224 1.00 0.00 ? 96  GLU A HB2  4  
ATOM 7245  H HB3  . GLU A 1 97  ? 7.877   -5.685  -13.396 1.00 0.00 ? 96  GLU A HB3  4  
ATOM 7246  H HG2  . GLU A 1 97  ? 7.693   -8.354  -14.966 1.00 0.00 ? 96  GLU A HG2  4  
ATOM 7247  H HG3  . GLU A 1 97  ? 7.883   -6.822  -15.843 1.00 0.00 ? 96  GLU A HG3  4  
ATOM 7248  N N    . LYS A 1 98  ? 7.897   -9.541  -11.953 1.00 0.00 ? 97  LYS A N    4  
ATOM 7249  C CA   . LYS A 1 98  ? 8.642   -10.425 -11.083 1.00 0.00 ? 97  LYS A CA   4  
ATOM 7250  C C    . LYS A 1 98  ? 9.069   -11.688 -11.789 1.00 0.00 ? 97  LYS A C    4  
ATOM 7251  O O    . LYS A 1 98  ? 8.283   -12.334 -12.484 1.00 0.00 ? 97  LYS A O    4  
ATOM 7252  C CB   . LYS A 1 98  ? 7.686   -10.836 -9.942  1.00 0.00 ? 97  LYS A CB   4  
ATOM 7253  C CG   . LYS A 1 98  ? 8.339   -11.601 -8.786  1.00 0.00 ? 97  LYS A CG   4  
ATOM 7254  C CD   . LYS A 1 98  ? 7.464   -11.754 -7.542  1.00 0.00 ? 97  LYS A CD   4  
ATOM 7255  C CE   . LYS A 1 98  ? 6.520   -12.958 -7.633  1.00 0.00 ? 97  LYS A CE   4  
ATOM 7256  N NZ   . LYS A 1 98  ? 5.841   -13.208 -6.342  1.00 0.00 ? 97  LYS A NZ   4  
ATOM 7257  H H    . LYS A 1 98  ? 7.202   -9.942  -12.594 1.00 0.00 ? 97  LYS A H    4  
ATOM 7258  H HA   . LYS A 1 98  ? 9.519   -9.915  -10.691 1.00 0.00 ? 97  LYS A HA   4  
ATOM 7259  H HB2  . LYS A 1 98  ? 7.221   -9.913  -9.523  1.00 0.00 ? 97  LYS A HB2  4  
ATOM 7260  H HB3  . LYS A 1 98  ? 6.892   -11.441 -10.435 1.00 0.00 ? 97  LYS A HB3  4  
ATOM 7261  H HG2  . LYS A 1 98  ? 8.585   -12.635 -9.080  1.00 0.00 ? 97  LYS A HG2  4  
ATOM 7262  H HG3  . LYS A 1 98  ? 9.290   -11.091 -8.516  1.00 0.00 ? 97  LYS A HG3  4  
ATOM 7263  H HD2  . LYS A 1 98  ? 8.144   -11.910 -6.672  1.00 0.00 ? 97  LYS A HD2  4  
ATOM 7264  H HD3  . LYS A 1 98  ? 6.887   -10.821 -7.368  1.00 0.00 ? 97  LYS A HD3  4  
ATOM 7265  H HE2  . LYS A 1 98  ? 5.743   -12.778 -8.401  1.00 0.00 ? 97  LYS A HE2  4  
ATOM 7266  H HE3  . LYS A 1 98  ? 7.086   -13.878 -7.892  1.00 0.00 ? 97  LYS A HE3  4  
ATOM 7267  H HZ1  . LYS A 1 98  ? 6.552   -13.403 -5.609  1.00 0.00 ? 97  LYS A HZ1  4  
ATOM 7268  H HZ2  . LYS A 1 98  ? 5.207   -14.027 -6.437  1.00 0.00 ? 97  LYS A HZ2  4  
ATOM 7269  H HZ3  . LYS A 1 98  ? 5.287   -12.370 -6.074  1.00 0.00 ? 97  LYS A HZ3  4  
ATOM 7270  N N    . GLU A 1 99  ? 10.365  -12.085 -11.643 1.00 0.00 ? 98  GLU A N    4  
ATOM 7271  C CA   . GLU A 1 99  ? 11.003  -13.289 -12.201 1.00 0.00 ? 98  GLU A CA   4  
ATOM 7272  C C    . GLU A 1 99  ? 11.135  -13.263 -13.739 1.00 0.00 ? 98  GLU A C    4  
ATOM 7273  O O    . GLU A 1 99  ? 11.671  -14.156 -14.388 1.00 0.00 ? 98  GLU A O    4  
ATOM 7274  C CB   . GLU A 1 99  ? 10.294  -14.561 -11.625 1.00 0.00 ? 98  GLU A CB   4  
ATOM 7275  C CG   . GLU A 1 99  ? 10.899  -15.939 -11.948 1.00 0.00 ? 98  GLU A CG   4  
ATOM 7276  C CD   . GLU A 1 99  ? 12.373  -16.007 -11.546 1.00 0.00 ? 98  GLU A CD   4  
ATOM 7277  O OE1  . GLU A 1 99  ? 12.667  -15.824 -10.334 1.00 0.00 ? 98  GLU A OE1  4  
ATOM 7278  O OE2  . GLU A 1 99  ? 13.223  -16.248 -12.444 1.00 0.00 ? 98  GLU A OE2  4  
ATOM 7279  H H    . GLU A 1 99  ? 10.968  -11.527 -11.080 1.00 0.00 ? 98  GLU A H    4  
ATOM 7280  H HA   . GLU A 1 99  ? 12.019  -13.288 -11.830 1.00 0.00 ? 98  GLU A HA   4  
ATOM 7281  H HB2  . GLU A 1 99  ? 10.340  -14.497 -10.508 1.00 0.00 ? 98  GLU A HB2  4  
ATOM 7282  H HB3  . GLU A 1 99  ? 9.214   -14.553 -11.935 1.00 0.00 ? 98  GLU A HB3  4  
ATOM 7283  H HG2  . GLU A 1 99  ? 10.332  -16.682 -11.347 1.00 0.00 ? 98  GLU A HG2  4  
ATOM 7284  H HG3  . GLU A 1 99  ? 10.777  -16.180 -13.022 1.00 0.00 ? 98  GLU A HG3  4  
ATOM 7285  N N    . GLY A 1 100 ? 10.709  -12.115 -14.317 1.00 0.00 ? 99  GLY A N    4  
ATOM 7286  C CA   . GLY A 1 100 ? 10.807  -11.751 -15.727 1.00 0.00 ? 99  GLY A CA   4  
ATOM 7287  C C    . GLY A 1 100 ? 9.456   -11.527 -16.348 1.00 0.00 ? 99  GLY A C    4  
ATOM 7288  O O    . GLY A 1 100 ? 9.358   -11.129 -17.504 1.00 0.00 ? 99  GLY A O    4  
ATOM 7289  H H    . GLY A 1 100 ? 10.259  -11.490 -13.664 1.00 0.00 ? 99  GLY A H    4  
ATOM 7290  H HA2  . GLY A 1 100 ? 11.347  -10.816 -15.785 1.00 0.00 ? 99  GLY A HA2  4  
ATOM 7291  H HA3  . GLY A 1 100 ? 11.284  -12.539 -16.298 1.00 0.00 ? 99  GLY A HA3  4  
ATOM 7292  N N    . GLN A 1 101 ? 8.363   -11.789 -15.588 1.00 0.00 ? 100 GLN A N    4  
ATOM 7293  C CA   . GLN A 1 101 ? 6.991   -11.672 -16.059 1.00 0.00 ? 100 GLN A CA   4  
ATOM 7294  C C    . GLN A 1 101 ? 6.100   -11.014 -15.036 1.00 0.00 ? 100 GLN A C    4  
ATOM 7295  O O    . GLN A 1 101 ? 6.505   -10.749 -13.911 1.00 0.00 ? 100 GLN A O    4  
ATOM 7296  C CB   . GLN A 1 101 ? 6.457   -13.026 -16.617 1.00 0.00 ? 100 GLN A CB   4  
ATOM 7297  C CG   . GLN A 1 101 ? 6.734   -14.304 -15.779 1.00 0.00 ? 100 GLN A CG   4  
ATOM 7298  C CD   . GLN A 1 101 ? 5.760   -14.503 -14.618 1.00 0.00 ? 100 GLN A CD   4  
ATOM 7299  O OE1  . GLN A 1 101 ? 4.674   -15.073 -14.771 1.00 0.00 ? 100 GLN A OE1  4  
ATOM 7300  N NE2  . GLN A 1 101 ? 6.148   -14.036 -13.403 1.00 0.00 ? 100 GLN A NE2  4  
ATOM 7301  H H    . GLN A 1 101 ? 8.468   -12.110 -14.646 1.00 0.00 ? 100 GLN A H    4  
ATOM 7302  H HA   . GLN A 1 101 ? 6.967   -10.924 -16.832 1.00 0.00 ? 100 GLN A HA   4  
ATOM 7303  H HB2  . GLN A 1 101 ? 5.378   -12.969 -16.878 1.00 0.00 ? 100 GLN A HB2  4  
ATOM 7304  H HB3  . GLN A 1 101 ? 7.007   -13.183 -17.576 1.00 0.00 ? 100 GLN A HB3  4  
ATOM 7305  H HG2  . GLN A 1 101 ? 6.590   -15.183 -16.446 1.00 0.00 ? 100 GLN A HG2  4  
ATOM 7306  H HG3  . GLN A 1 101 ? 7.780   -14.339 -15.415 1.00 0.00 ? 100 GLN A HG3  4  
ATOM 7307  H HE21 . GLN A 1 101 ? 7.017   -13.517 -13.257 1.00 0.00 ? 100 GLN A HE21 4  
ATOM 7308  H HE22 . GLN A 1 101 ? 5.469   -14.189 -12.679 1.00 0.00 ? 100 GLN A HE22 4  
ATOM 7309  N N    . ARG A 1 102 ? 4.844   -10.658 -15.396 1.00 0.00 ? 101 ARG A N    4  
ATOM 7310  C CA   . ARG A 1 102 ? 3.928   -9.931  -14.526 1.00 0.00 ? 101 ARG A CA   4  
ATOM 7311  C C    . ARG A 1 102 ? 3.001   -10.823 -13.739 1.00 0.00 ? 101 ARG A C    4  
ATOM 7312  O O    . ARG A 1 102 ? 2.259   -11.627 -14.295 1.00 0.00 ? 101 ARG A O    4  
ATOM 7313  C CB   . ARG A 1 102 ? 3.185   -8.736  -15.211 1.00 0.00 ? 101 ARG A CB   4  
ATOM 7314  C CG   . ARG A 1 102 ? 3.793   -8.223  -16.539 1.00 0.00 ? 101 ARG A CG   4  
ATOM 7315  C CD   . ARG A 1 102 ? 3.398   -9.040  -17.786 1.00 0.00 ? 101 ARG A CD   4  
ATOM 7316  N NE   . ARG A 1 102 ? 1.905   -8.953  -17.969 1.00 0.00 ? 101 ARG A NE   4  
ATOM 7317  C CZ   . ARG A 1 102 ? 1.206   -9.726  -18.857 1.00 0.00 ? 101 ARG A CZ   4  
ATOM 7318  N NH1  . ARG A 1 102 ? 1.846   -10.626 -19.658 1.00 0.00 ? 101 ARG A NH1  4  
ATOM 7319  N NH2  . ARG A 1 102 ? -0.151  -9.595  -18.936 1.00 0.00 ? 101 ARG A NH2  4  
ATOM 7320  H H    . ARG A 1 102 ? 4.486   -10.857 -16.302 1.00 0.00 ? 101 ARG A H    4  
ATOM 7321  H HA   . ARG A 1 102 ? 4.499   -9.480  -13.747 1.00 0.00 ? 101 ARG A HA   4  
ATOM 7322  H HB2  . ARG A 1 102 ? 2.113   -8.968  -15.398 1.00 0.00 ? 101 ARG A HB2  4  
ATOM 7323  H HB3  . ARG A 1 102 ? 3.234   -7.880  -14.491 1.00 0.00 ? 101 ARG A HB3  4  
ATOM 7324  H HG2  . ARG A 1 102 ? 3.445   -7.176  -16.699 1.00 0.00 ? 101 ARG A HG2  4  
ATOM 7325  H HG3  . ARG A 1 102 ? 4.901   -8.187  -16.452 1.00 0.00 ? 101 ARG A HG3  4  
ATOM 7326  H HD2  . ARG A 1 102 ? 3.891   -8.618  -18.688 1.00 0.00 ? 101 ARG A HD2  4  
ATOM 7327  H HD3  . ARG A 1 102 ? 3.697   -10.105 -17.661 1.00 0.00 ? 101 ARG A HD3  4  
ATOM 7328  H HE   . ARG A 1 102 ? 1.397   -8.306  -17.399 1.00 0.00 ? 101 ARG A HE   4  
ATOM 7329  H HH11 . ARG A 1 102 ? 2.838   -10.726 -19.602 1.00 0.00 ? 101 ARG A HH11 4  
ATOM 7330  H HH12 . ARG A 1 102 ? 1.321   -11.184 -20.301 1.00 0.00 ? 101 ARG A HH12 4  
ATOM 7331  H HH21 . ARG A 1 102 ? -0.625  -8.938  -18.348 1.00 0.00 ? 101 ARG A HH21 4  
ATOM 7332  H HH22 . ARG A 1 102 ? -0.671  -10.155 -19.581 1.00 0.00 ? 101 ARG A HH22 4  
ATOM 7333  N N    . LYS A 1 103 ? 3.052   -10.670 -12.392 1.00 0.00 ? 102 LYS A N    4  
ATOM 7334  C CA   . LYS A 1 103 ? 2.198   -11.357 -11.428 1.00 0.00 ? 102 LYS A CA   4  
ATOM 7335  C C    . LYS A 1 103 ? 1.050   -10.417 -11.158 1.00 0.00 ? 102 LYS A C    4  
ATOM 7336  O O    . LYS A 1 103 ? 1.282   -9.267  -10.802 1.00 0.00 ? 102 LYS A O    4  
ATOM 7337  C CB   . LYS A 1 103 ? 2.936   -11.665 -10.089 1.00 0.00 ? 102 LYS A CB   4  
ATOM 7338  C CG   . LYS A 1 103 ? 3.293   -13.149 -9.914  1.00 0.00 ? 102 LYS A CG   4  
ATOM 7339  C CD   . LYS A 1 103 ? 4.313   -13.723 -10.897 1.00 0.00 ? 102 LYS A CD   4  
ATOM 7340  C CE   . LYS A 1 103 ? 4.647   -15.196 -10.602 1.00 0.00 ? 102 LYS A CE   4  
ATOM 7341  N NZ   . LYS A 1 103 ? 3.466   -16.069 -10.799 1.00 0.00 ? 102 LYS A NZ   4  
ATOM 7342  H H    . LYS A 1 103 ? 3.692   -9.964  -12.014 1.00 0.00 ? 102 LYS A H    4  
ATOM 7343  H HA   . LYS A 1 103 ? 1.796   -12.275 -11.840 1.00 0.00 ? 102 LYS A HA   4  
ATOM 7344  H HB2  . LYS A 1 103 ? 3.851   -11.037 -10.018 1.00 0.00 ? 102 LYS A HB2  4  
ATOM 7345  H HB3  . LYS A 1 103 ? 2.316   -11.422 -9.181  1.00 0.00 ? 102 LYS A HB3  4  
ATOM 7346  H HG2  . LYS A 1 103 ? 3.727   -13.268 -8.896  1.00 0.00 ? 102 LYS A HG2  4  
ATOM 7347  H HG3  . LYS A 1 103 ? 2.355   -13.746 -9.955  1.00 0.00 ? 102 LYS A HG3  4  
ATOM 7348  H HD2  . LYS A 1 103 ? 3.915   -13.626 -11.931 1.00 0.00 ? 102 LYS A HD2  4  
ATOM 7349  H HD3  . LYS A 1 103 ? 5.263   -13.139 -10.831 1.00 0.00 ? 102 LYS A HD3  4  
ATOM 7350  H HE2  . LYS A 1 103 ? 5.447   -15.561 -11.278 1.00 0.00 ? 102 LYS A HE2  4  
ATOM 7351  H HE3  . LYS A 1 103 ? 4.982   -15.313 -9.549  1.00 0.00 ? 102 LYS A HE3  4  
ATOM 7352  H HZ1  . LYS A 1 103 ? 3.144   -15.996 -11.785 1.00 0.00 ? 102 LYS A HZ1  4  
ATOM 7353  H HZ2  . LYS A 1 103 ? 2.703   -15.767 -10.161 1.00 0.00 ? 102 LYS A HZ2  4  
ATOM 7354  H HZ3  . LYS A 1 103 ? 3.724   -17.055 -10.590 1.00 0.00 ? 102 LYS A HZ3  4  
ATOM 7355  N N    . TRP A 1 104 ? -0.224  -10.847 -11.309 1.00 0.00 ? 103 TRP A N    4  
ATOM 7356  C CA   . TRP A 1 104 ? -1.359  -9.978  -11.045 1.00 0.00 ? 103 TRP A CA   4  
ATOM 7357  C C    . TRP A 1 104 ? -1.907  -10.349 -9.661  1.00 0.00 ? 103 TRP A C    4  
ATOM 7358  O O    . TRP A 1 104 ? -2.489  -11.413 -9.439  1.00 0.00 ? 103 TRP A O    4  
ATOM 7359  C CB   . TRP A 1 104 ? -2.438  -10.112 -12.156 1.00 0.00 ? 103 TRP A CB   4  
ATOM 7360  C CG   . TRP A 1 104 ? -2.110  -9.461  -13.502 1.00 0.00 ? 103 TRP A CG   4  
ATOM 7361  C CD1  . TRP A 1 104 ? -1.786  -10.045 -14.696 1.00 0.00 ? 103 TRP A CD1  4  
ATOM 7362  C CD2  . TRP A 1 104 ? -2.308  -8.061  -13.785 1.00 0.00 ? 103 TRP A CD2  4  
ATOM 7363  N NE1  . TRP A 1 104 ? -1.823  -9.104  -15.709 1.00 0.00 ? 103 TRP A NE1  4  
ATOM 7364  C CE2  . TRP A 1 104 ? -2.174  -7.892  -15.162 1.00 0.00 ? 103 TRP A CE2  4  
ATOM 7365  C CE3  . TRP A 1 104 ? -2.622  -7.008  -12.974 1.00 0.00 ? 103 TRP A CE3  4  
ATOM 7366  C CZ2  . TRP A 1 104 ? -2.397  -6.678  -15.747 1.00 0.00 ? 103 TRP A CZ2  4  
ATOM 7367  C CZ3  . TRP A 1 104 ? -2.870  -5.782  -13.564 1.00 0.00 ? 103 TRP A CZ3  4  
ATOM 7368  C CH2  . TRP A 1 104 ? -2.771  -5.625  -14.934 1.00 0.00 ? 103 TRP A CH2  4  
ATOM 7369  H H    . TRP A 1 104 ? -0.432  -11.775 -11.598 1.00 0.00 ? 103 TRP A H    4  
ATOM 7370  H HA   . TRP A 1 104 ? -1.016  -8.935  -11.003 1.00 0.00 ? 103 TRP A HA   4  
ATOM 7371  H HB2  . TRP A 1 104 ? -2.657  -11.189 -12.324 1.00 0.00 ? 103 TRP A HB2  4  
ATOM 7372  H HB3  . TRP A 1 104 ? -3.384  -9.629  -11.823 1.00 0.00 ? 103 TRP A HB3  4  
ATOM 7373  H HD1  . TRP A 1 104 ? -1.570  -11.096 -14.823 1.00 0.00 ? 103 TRP A HD1  4  
ATOM 7374  H HE1  . TRP A 1 104 ? -1.693  -9.276  -16.665 1.00 0.00 ? 103 TRP A HE1  4  
ATOM 7375  H HE3  . TRP A 1 104 ? -2.710  -7.123  -11.904 1.00 0.00 ? 103 TRP A HE3  4  
ATOM 7376  H HZ2  . TRP A 1 104 ? -2.336  -6.542  -16.817 1.00 0.00 ? 103 TRP A HZ2  4  
ATOM 7377  H HZ3  . TRP A 1 104 ? -3.157  -4.940  -12.946 1.00 0.00 ? 103 TRP A HZ3  4  
ATOM 7378  H HH2  . TRP A 1 104 ? -2.976  -4.658  -15.376 1.00 0.00 ? 103 TRP A HH2  4  
ATOM 7379  N N    . TYR A 1 105 ? -1.656  -9.448  -8.692  1.00 0.00 ? 104 TYR A N    4  
ATOM 7380  C CA   . TYR A 1 105 ? -1.988  -9.633  -7.284  1.00 0.00 ? 104 TYR A CA   4  
ATOM 7381  C C    . TYR A 1 105 ? -2.737  -8.482  -6.709  1.00 0.00 ? 104 TYR A C    4  
ATOM 7382  O O    . TYR A 1 105 ? -2.277  -7.359  -6.835  1.00 0.00 ? 104 TYR A O    4  
ATOM 7383  C CB   . TYR A 1 105 ? -0.701  -9.659  -6.408  1.00 0.00 ? 104 TYR A CB   4  
ATOM 7384  C CG   . TYR A 1 105 ? 0.235   -10.791 -6.703  1.00 0.00 ? 104 TYR A CG   4  
ATOM 7385  C CD1  . TYR A 1 105 ? -0.225  -12.078 -6.930  1.00 0.00 ? 104 TYR A CD1  4  
ATOM 7386  C CD2  . TYR A 1 105 ? 1.594   -10.575 -6.566  1.00 0.00 ? 104 TYR A CD2  4  
ATOM 7387  C CE1  . TYR A 1 105 ? 0.653   -13.139 -6.988  1.00 0.00 ? 104 TYR A CE1  4  
ATOM 7388  C CE2  . TYR A 1 105 ? 2.470   -11.637 -6.592  1.00 0.00 ? 104 TYR A CE2  4  
ATOM 7389  C CZ   . TYR A 1 105 ? 1.993   -12.920 -6.770  1.00 0.00 ? 104 TYR A CZ   4  
ATOM 7390  O OH   . TYR A 1 105 ? 2.876   -14.015 -6.743  1.00 0.00 ? 104 TYR A OH   4  
ATOM 7391  H H    . TYR A 1 105 ? -1.151  -8.611  -8.969  1.00 0.00 ? 104 TYR A H    4  
ATOM 7392  H HA   . TYR A 1 105 ? -2.536  -10.522 -7.024  1.00 0.00 ? 104 TYR A HA   4  
ATOM 7393  H HB2  . TYR A 1 105 ? -0.134  -8.702  -6.464  1.00 0.00 ? 104 TYR A HB2  4  
ATOM 7394  H HB3  . TYR A 1 105 ? -0.985  -9.809  -5.341  1.00 0.00 ? 104 TYR A HB3  4  
ATOM 7395  H HD1  . TYR A 1 105 ? -1.283  -12.279 -7.021  1.00 0.00 ? 104 TYR A HD1  4  
ATOM 7396  H HD2  . TYR A 1 105 ? 1.965   -9.578  -6.361  1.00 0.00 ? 104 TYR A HD2  4  
ATOM 7397  H HE1  . TYR A 1 105 ? 0.270   -14.138 -7.147  1.00 0.00 ? 104 TYR A HE1  4  
ATOM 7398  H HE2  . TYR A 1 105 ? 3.526   -11.449 -6.479  1.00 0.00 ? 104 TYR A HE2  4  
ATOM 7399  H HH   . TYR A 1 105 ? 2.491   -14.722 -7.266  1.00 0.00 ? 104 TYR A HH   4  
ATOM 7400  N N    . LYS A 1 106 ? -3.793  -8.704  -5.856  1.00 0.00 ? 105 LYS A N    4  
ATOM 7401  C CA   . LYS A 1 106 ? -4.285  -7.730  -4.896  1.00 0.00 ? 105 LYS A CA   4  
ATOM 7402  C C    . LYS A 1 106 ? -3.166  -7.374  -3.895  1.00 0.00 ? 105 LYS A C    4  
ATOM 7403  O O    . LYS A 1 106 ? -2.329  -8.218  -3.555  1.00 0.00 ? 105 LYS A O    4  
ATOM 7404  C CB   . LYS A 1 106 ? -5.418  -8.349  -4.007  1.00 0.00 ? 105 LYS A CB   4  
ATOM 7405  C CG   . LYS A 1 106 ? -6.682  -8.810  -4.741  1.00 0.00 ? 105 LYS A CG   4  
ATOM 7406  C CD   . LYS A 1 106 ? -7.679  -9.532  -3.816  1.00 0.00 ? 105 LYS A CD   4  
ATOM 7407  C CE   . LYS A 1 106 ? -9.032  -9.816  -4.487  1.00 0.00 ? 105 LYS A CE   4  
ATOM 7408  N NZ   . LYS A 1 106 ? -8.882  -10.728 -5.644  1.00 0.00 ? 105 LYS A NZ   4  
ATOM 7409  H H    . LYS A 1 106 ? -4.264  -9.554  -5.698  1.00 0.00 ? 105 LYS A H    4  
ATOM 7410  H HA   . LYS A 1 106 ? -4.568  -6.846  -5.467  1.00 0.00 ? 105 LYS A HA   4  
ATOM 7411  H HB2  . LYS A 1 106 ? -5.024  -9.249  -3.479  1.00 0.00 ? 105 LYS A HB2  4  
ATOM 7412  H HB3  . LYS A 1 106 ? -5.756  -7.619  -3.235  1.00 0.00 ? 105 LYS A HB3  4  
ATOM 7413  H HG2  . LYS A 1 106 ? -7.200  -7.913  -5.138  1.00 0.00 ? 105 LYS A HG2  4  
ATOM 7414  H HG3  . LYS A 1 106 ? -6.431  -9.463  -5.603  1.00 0.00 ? 105 LYS A HG3  4  
ATOM 7415  H HD2  . LYS A 1 106 ? -7.232  -10.484 -3.457  1.00 0.00 ? 105 LYS A HD2  4  
ATOM 7416  H HD3  . LYS A 1 106 ? -7.865  -8.883  -2.929  1.00 0.00 ? 105 LYS A HD3  4  
ATOM 7417  H HE2  . LYS A 1 106 ? -9.725  -10.299 -3.766  1.00 0.00 ? 105 LYS A HE2  4  
ATOM 7418  H HE3  . LYS A 1 106 ? -9.487  -8.872  -4.857  1.00 0.00 ? 105 LYS A HE3  4  
ATOM 7419  H HZ1  . LYS A 1 106 ? -9.813  -10.896 -6.077  1.00 0.00 ? 105 LYS A HZ1  4  
ATOM 7420  H HZ2  . LYS A 1 106 ? -8.480  -11.632 -5.324  1.00 0.00 ? 105 LYS A HZ2  4  
ATOM 7421  H HZ3  . LYS A 1 106 ? -8.247  -10.295 -6.345  1.00 0.00 ? 105 LYS A HZ3  4  
ATOM 7422  N N    . ARG A 1 107 ? -3.155  -6.107  -3.457  1.00 0.00 ? 106 ARG A N    4  
ATOM 7423  C CA   . ARG A 1 107 ? -2.163  -5.367  -2.669  1.00 0.00 ? 106 ARG A CA   4  
ATOM 7424  C C    . ARG A 1 107 ? -1.280  -6.087  -1.658  1.00 0.00 ? 106 ARG A C    4  
ATOM 7425  O O    . ARG A 1 107 ? -0.082  -5.866  -1.581  1.00 0.00 ? 106 ARG A O    4  
ATOM 7426  C CB   . ARG A 1 107 ? -2.956  -4.377  -1.776  1.00 0.00 ? 106 ARG A CB   4  
ATOM 7427  C CG   . ARG A 1 107 ? -3.926  -3.460  -2.532  1.00 0.00 ? 106 ARG A CG   4  
ATOM 7428  C CD   . ARG A 1 107 ? -3.244  -2.536  -3.561  1.00 0.00 ? 106 ARG A CD   4  
ATOM 7429  N NE   . ARG A 1 107 ? -2.103  -1.731  -2.990  1.00 0.00 ? 106 ARG A NE   4  
ATOM 7430  C CZ   . ARG A 1 107 ? -2.266  -0.734  -2.066  1.00 0.00 ? 106 ARG A CZ   4  
ATOM 7431  N NH1  . ARG A 1 107 ? -3.481  -0.499  -1.501  1.00 0.00 ? 106 ARG A NH1  4  
ATOM 7432  N NH2  . ARG A 1 107 ? -1.206  0.032   -1.688  1.00 0.00 ? 106 ARG A NH2  4  
ATOM 7433  H H    . ARG A 1 107 ? -3.854  -5.551  -3.906  1.00 0.00 ? 106 ARG A H    4  
ATOM 7434  H HA   . ARG A 1 107 ? -1.515  -4.836  -3.351  1.00 0.00 ? 106 ARG A HA   4  
ATOM 7435  H HB2  . ARG A 1 107 ? -3.549  -4.916  -0.985  1.00 0.00 ? 106 ARG A HB2  4  
ATOM 7436  H HB3  . ARG A 1 107 ? -2.243  -3.700  -1.258  1.00 0.00 ? 106 ARG A HB3  4  
ATOM 7437  H HG2  . ARG A 1 107 ? -4.711  -4.057  -3.039  1.00 0.00 ? 106 ARG A HG2  4  
ATOM 7438  H HG3  . ARG A 1 107 ? -4.455  -2.838  -1.776  1.00 0.00 ? 106 ARG A HG3  4  
ATOM 7439  H HD2  . ARG A 1 107 ? -2.816  -3.163  -4.368  1.00 0.00 ? 106 ARG A HD2  4  
ATOM 7440  H HD3  . ARG A 1 107 ? -3.986  -1.842  -4.010  1.00 0.00 ? 106 ARG A HD3  4  
ATOM 7441  H HE   . ARG A 1 107 ? -1.189  -1.880  -3.368  1.00 0.00 ? 106 ARG A HE   4  
ATOM 7442  H HH11 . ARG A 1 107 ? -4.270  -1.058  -1.761  1.00 0.00 ? 106 ARG A HH11 4  
ATOM 7443  H HH12 . ARG A 1 107 ? -3.585  0.228   -0.823  1.00 0.00 ? 106 ARG A HH12 4  
ATOM 7444  H HH21 . ARG A 1 107 ? -0.305  -0.126  -2.091  1.00 0.00 ? 106 ARG A HH21 4  
ATOM 7445  H HH22 . ARG A 1 107 ? -1.331  0.756   -1.008  1.00 0.00 ? 106 ARG A HH22 4  
ATOM 7446  N N    . MET A 1 108 ? -1.871  -7.031  -0.902  1.00 0.00 ? 107 MET A N    4  
ATOM 7447  C CA   . MET A 1 108 ? -1.305  -7.860  0.149   1.00 0.00 ? 107 MET A CA   4  
ATOM 7448  C C    . MET A 1 108 ? -0.180  -8.811  -0.296  1.00 0.00 ? 107 MET A C    4  
ATOM 7449  O O    . MET A 1 108 ? 0.662   -9.183  0.521   1.00 0.00 ? 107 MET A O    4  
ATOM 7450  C CB   . MET A 1 108 ? -2.457  -8.584  0.903   1.00 0.00 ? 107 MET A CB   4  
ATOM 7451  C CG   . MET A 1 108 ? -3.254  -9.532  -0.025  1.00 0.00 ? 107 MET A CG   4  
ATOM 7452  S SD   . MET A 1 108 ? -4.782  -10.169 0.711   1.00 0.00 ? 107 MET A SD   4  
ATOM 7453  C CE   . MET A 1 108 ? -5.241  -11.134 -0.757  1.00 0.00 ? 107 MET A CE   4  
ATOM 7454  H H    . MET A 1 108 ? -2.828  -7.198  -1.104  1.00 0.00 ? 107 MET A H    4  
ATOM 7455  H HA   . MET A 1 108 ? -0.845  -7.194  0.867   1.00 0.00 ? 107 MET A HA   4  
ATOM 7456  H HB2  . MET A 1 108 ? -2.038  -9.182  1.745   1.00 0.00 ? 107 MET A HB2  4  
ATOM 7457  H HB3  . MET A 1 108 ? -3.134  -7.814  1.377   1.00 0.00 ? 107 MET A HB3  4  
ATOM 7458  H HG2  . MET A 1 108 ? -3.498  -9.005  -0.979  1.00 0.00 ? 107 MET A HG2  4  
ATOM 7459  H HG3  . MET A 1 108 ? -2.598  -10.388 -0.304  1.00 0.00 ? 107 MET A HG3  4  
ATOM 7460  H HE1  . MET A 1 108 ? -5.242  -10.499 -1.667  1.00 0.00 ? 107 MET A HE1  4  
ATOM 7461  H HE2  . MET A 1 108 ? -6.257  -11.569 -0.644  1.00 0.00 ? 107 MET A HE2  4  
ATOM 7462  H HE3  . MET A 1 108 ? -4.533  -11.975 -0.913  1.00 0.00 ? 107 MET A HE3  4  
ATOM 7463  N N    . ALA A 1 109 ? -0.075  -9.186  -1.619  1.00 0.00 ? 108 ALA A N    4  
ATOM 7464  C CA   . ALA A 1 109 ? 1.047   -10.008 -2.090  1.00 0.00 ? 108 ALA A CA   4  
ATOM 7465  C C    . ALA A 1 109 ? 2.298   -9.256  -2.511  1.00 0.00 ? 108 ALA A C    4  
ATOM 7466  O O    . ALA A 1 109 ? 3.293   -9.853  -2.904  1.00 0.00 ? 108 ALA A O    4  
ATOM 7467  C CB   . ALA A 1 109 ? 0.625   -11.001 -3.201  1.00 0.00 ? 108 ALA A CB   4  
ATOM 7468  H H    . ALA A 1 109 ? -0.751  -8.903  -2.323  1.00 0.00 ? 108 ALA A H    4  
ATOM 7469  H HA   . ALA A 1 109 ? 1.417   -10.541 -1.252  1.00 0.00 ? 108 ALA A HA   4  
ATOM 7470  H HB1  . ALA A 1 109 ? 1.444   -11.710 -3.458  1.00 0.00 ? 108 ALA A HB1  4  
ATOM 7471  H HB2  . ALA A 1 109 ? 0.401   -10.456 -4.135  1.00 0.00 ? 108 ALA A HB2  4  
ATOM 7472  H HB3  . ALA A 1 109 ? -0.268  -11.588 -2.899  1.00 0.00 ? 108 ALA A HB3  4  
ATOM 7473  N N    . VAL A 1 110 ? 2.229   -7.922  -2.458  1.00 0.00 ? 109 VAL A N    4  
ATOM 7474  C CA   . VAL A 1 110 ? 3.264   -6.918  -2.678  1.00 0.00 ? 109 VAL A CA   4  
ATOM 7475  C C    . VAL A 1 110 ? 3.391   -5.946  -1.529  1.00 0.00 ? 109 VAL A C    4  
ATOM 7476  O O    . VAL A 1 110 ? 2.688   -4.938  -1.476  1.00 0.00 ? 109 VAL A O    4  
ATOM 7477  C CB   . VAL A 1 110 ? 3.196   -6.185  -4.009  1.00 0.00 ? 109 VAL A CB   4  
ATOM 7478  C CG1  . VAL A 1 110 ? 4.267   -6.850  -4.885  1.00 0.00 ? 109 VAL A CG1  4  
ATOM 7479  C CG2  . VAL A 1 110 ? 1.751   -6.209  -4.556  1.00 0.00 ? 109 VAL A CG2  4  
ATOM 7480  H H    . VAL A 1 110 ? 1.404   -7.620  -2.007  1.00 0.00 ? 109 VAL A H    4  
ATOM 7481  H HA   . VAL A 1 110 ? 4.203   -7.460  -2.658  1.00 0.00 ? 109 VAL A HA   4  
ATOM 7482  H HB   . VAL A 1 110 ? 3.506   -5.114  -3.960  1.00 0.00 ? 109 VAL A HB   4  
ATOM 7483  H HG11 . VAL A 1 110 ? 4.016   -7.916  -5.069  1.00 0.00 ? 109 VAL A HG11 4  
ATOM 7484  H HG12 . VAL A 1 110 ? 5.266   -6.804  -4.401  1.00 0.00 ? 109 VAL A HG12 4  
ATOM 7485  H HG13 . VAL A 1 110 ? 4.339   -6.307  -5.843  1.00 0.00 ? 109 VAL A HG13 4  
ATOM 7486  H HG21 . VAL A 1 110 ? 1.053   -5.783  -3.807  1.00 0.00 ? 109 VAL A HG21 4  
ATOM 7487  H HG22 . VAL A 1 110 ? 1.426   -7.241  -4.802  1.00 0.00 ? 109 VAL A HG22 4  
ATOM 7488  H HG23 . VAL A 1 110 ? 1.676   -5.585  -5.464  1.00 0.00 ? 109 VAL A HG23 4  
ATOM 7489  N N    . ILE A 1 111 ? 4.314   -6.164  -0.587  1.00 0.00 ? 110 ILE A N    4  
ATOM 7490  C CA   . ILE A 1 111 ? 4.517   -5.252  0.552   1.00 0.00 ? 110 ILE A CA   4  
ATOM 7491  C C    . ILE A 1 111 ? 5.721   -4.330  0.370   1.00 0.00 ? 110 ILE A C    4  
ATOM 7492  O O    . ILE A 1 111 ? 6.377   -4.370  -0.664  1.00 0.00 ? 110 ILE A O    4  
ATOM 7493  C CB   . ILE A 1 111 ? 4.517   -5.937  1.913   1.00 0.00 ? 110 ILE A CB   4  
ATOM 7494  C CG1  . ILE A 1 111 ? 5.634   -6.971  2.222   1.00 0.00 ? 110 ILE A CG1  4  
ATOM 7495  C CG2  . ILE A 1 111 ? 3.095   -6.483  2.204   1.00 0.00 ? 110 ILE A CG2  4  
ATOM 7496  C CD1  . ILE A 1 111 ? 5.659   -8.254  1.388   1.00 0.00 ? 110 ILE A CD1  4  
ATOM 7497  H H    . ILE A 1 111 ? 4.907   -6.961  -0.697  1.00 0.00 ? 110 ILE A H    4  
ATOM 7498  H HA   . ILE A 1 111 ? 3.680   -4.567  0.639   1.00 0.00 ? 110 ILE A HA   4  
ATOM 7499  H HB   . ILE A 1 111 ? 4.694   -5.115  2.635   1.00 0.00 ? 110 ILE A HB   4  
ATOM 7500  H HG12 . ILE A 1 111 ? 6.623   -6.473  2.185   1.00 0.00 ? 110 ILE A HG12 4  
ATOM 7501  H HG13 . ILE A 1 111 ? 5.482   -7.281  3.273   1.00 0.00 ? 110 ILE A HG13 4  
ATOM 7502  H HG21 . ILE A 1 111 ? 2.837   -7.282  1.477   1.00 0.00 ? 110 ILE A HG21 4  
ATOM 7503  H HG22 . ILE A 1 111 ? 2.333   -5.677  2.131   1.00 0.00 ? 110 ILE A HG22 4  
ATOM 7504  H HG23 . ILE A 1 111 ? 3.054   -6.916  3.227   1.00 0.00 ? 110 ILE A HG23 4  
ATOM 7505  H HD11 . ILE A 1 111 ? 4.662   -8.738  1.382   1.00 0.00 ? 110 ILE A HD11 4  
ATOM 7506  H HD12 . ILE A 1 111 ? 6.402   -8.971  1.802   1.00 0.00 ? 110 ILE A HD12 4  
ATOM 7507  H HD13 . ILE A 1 111 ? 5.953   -8.041  0.345   1.00 0.00 ? 110 ILE A HD13 4  
ATOM 7508  N N    . LEU A 1 112 ? 6.074   -3.477  1.379   1.00 0.00 ? 111 LEU A N    4  
ATOM 7509  C CA   . LEU A 1 112 ? 7.212   -2.541  1.245   1.00 0.00 ? 111 LEU A CA   4  
ATOM 7510  C C    . LEU A 1 112 ? 7.952   -2.271  2.555   1.00 0.00 ? 111 LEU A C    4  
ATOM 7511  O O    . LEU A 1 112 ? 7.412   -2.525  3.628   1.00 0.00 ? 111 LEU A O    4  
ATOM 7512  C CB   . LEU A 1 112 ? 6.766   -1.180  0.625   1.00 0.00 ? 111 LEU A CB   4  
ATOM 7513  C CG   . LEU A 1 112 ? 5.314   -0.759  0.926   1.00 0.00 ? 111 LEU A CG   4  
ATOM 7514  C CD1  . LEU A 1 112 ? 4.989   -0.760  2.387   1.00 0.00 ? 111 LEU A CD1  4  
ATOM 7515  C CD2  . LEU A 1 112 ? 5.116   0.661   0.437   1.00 0.00 ? 111 LEU A CD2  4  
ATOM 7516  H H    . LEU A 1 112 ? 5.545   -3.428  2.237   1.00 0.00 ? 111 LEU A H    4  
ATOM 7517  H HA   . LEU A 1 112 ? 7.973   -2.965  0.600   1.00 0.00 ? 111 LEU A HA   4  
ATOM 7518  H HB2  . LEU A 1 112 ? 7.447   -0.346  0.899   1.00 0.00 ? 111 LEU A HB2  4  
ATOM 7519  H HB3  . LEU A 1 112 ? 6.842   -1.250  -0.477  1.00 0.00 ? 111 LEU A HB3  4  
ATOM 7520  H HG   . LEU A 1 112 ? 4.609   -1.434  0.380   1.00 0.00 ? 111 LEU A HG   4  
ATOM 7521  H HD11 . LEU A 1 112 ? 3.999   -0.287  2.557   1.00 0.00 ? 111 LEU A HD11 4  
ATOM 7522  H HD12 . LEU A 1 112 ? 5.755   -0.162  2.935   1.00 0.00 ? 111 LEU A HD12 4  
ATOM 7523  H HD13 . LEU A 1 112 ? 4.943   -1.755  2.846   1.00 0.00 ? 111 LEU A HD13 4  
ATOM 7524  H HD21 . LEU A 1 112 ? 4.057   0.902   0.232   1.00 0.00 ? 111 LEU A HD21 4  
ATOM 7525  H HD22 . LEU A 1 112 ? 5.713   0.678   -0.489  1.00 0.00 ? 111 LEU A HD22 4  
ATOM 7526  H HD23 . LEU A 1 112 ? 5.511   1.441   1.141   1.00 0.00 ? 111 LEU A HD23 4  
ATOM 7527  N N    . SER A 1 113 ? 9.194   -1.697  2.476   1.00 0.00 ? 112 SER A N    4  
ATOM 7528  C CA   . SER A 1 113 ? 10.046  -1.292  3.618   1.00 0.00 ? 112 SER A CA   4  
ATOM 7529  C C    . SER A 1 113 ? 10.001  0.232   3.774   1.00 0.00 ? 112 SER A C    4  
ATOM 7530  O O    . SER A 1 113 ? 9.570   0.920   2.849   1.00 0.00 ? 112 SER A O    4  
ATOM 7531  C CB   . SER A 1 113 ? 11.520  -1.812  3.486   1.00 0.00 ? 112 SER A CB   4  
ATOM 7532  O OG   . SER A 1 113 ? 12.328  -1.624  4.662   1.00 0.00 ? 112 SER A OG   4  
ATOM 7533  H H    . SER A 1 113 ? 9.554   -1.495  1.552   1.00 0.00 ? 112 SER A H    4  
ATOM 7534  H HA   . SER A 1 113 ? 9.641   -1.718  4.519   1.00 0.00 ? 112 SER A HA   4  
ATOM 7535  H HB2  . SER A 1 113 ? 11.466  -2.906  3.290   1.00 0.00 ? 112 SER A HB2  4  
ATOM 7536  H HB3  . SER A 1 113 ? 12.024  -1.348  2.609   1.00 0.00 ? 112 SER A HB3  4  
ATOM 7537  H HG   . SER A 1 113 ? 11.777  -1.844  5.438   1.00 0.00 ? 112 SER A HG   4  
ATOM 7538  N N    . LEU A 1 114 ? 10.459  0.856   4.922   1.00 0.00 ? 113 LEU A N    4  
ATOM 7539  C CA   . LEU A 1 114 ? 10.382  2.333   5.112   1.00 0.00 ? 113 LEU A CA   4  
ATOM 7540  C C    . LEU A 1 114 ? 11.050  3.216   4.104   1.00 0.00 ? 113 LEU A C    4  
ATOM 7541  O O    . LEU A 1 114 ? 10.434  4.153   3.655   1.00 0.00 ? 113 LEU A O    4  
ATOM 7542  C CB   . LEU A 1 114 ? 10.731  3.062   6.431   1.00 0.00 ? 113 LEU A CB   4  
ATOM 7543  C CG   . LEU A 1 114 ? 10.117  2.508   7.720   1.00 0.00 ? 113 LEU A CG   4  
ATOM 7544  C CD1  . LEU A 1 114 ? 11.146  2.707   8.836   1.00 0.00 ? 113 LEU A CD1  4  
ATOM 7545  C CD2  . LEU A 1 114 ? 8.771   3.131   8.129   1.00 0.00 ? 113 LEU A CD2  4  
ATOM 7546  H H    . LEU A 1 114 ? 10.822  0.292   5.672   1.00 0.00 ? 113 LEU A H    4  
ATOM 7547  H HA   . LEU A 1 114 ? 9.348   2.580   5.034   1.00 0.00 ? 113 LEU A HA   4  
ATOM 7548  H HB2  . LEU A 1 114 ? 11.833  3.111   6.581   1.00 0.00 ? 113 LEU A HB2  4  
ATOM 7549  H HB3  . LEU A 1 114 ? 10.381  4.134   6.290   1.00 0.00 ? 113 LEU A HB3  4  
ATOM 7550  H HG   . LEU A 1 114 ? 9.947   1.421   7.568   1.00 0.00 ? 113 LEU A HG   4  
ATOM 7551  H HD11 . LEU A 1 114 ? 11.390  3.790   8.914   1.00 0.00 ? 113 LEU A HD11 4  
ATOM 7552  H HD12 . LEU A 1 114 ? 12.092  2.178   8.590   1.00 0.00 ? 113 LEU A HD12 4  
ATOM 7553  H HD13 . LEU A 1 114 ? 10.747  2.326   9.801   1.00 0.00 ? 113 LEU A HD13 4  
ATOM 7554  H HD21 . LEU A 1 114 ? 8.345   2.554   8.986   1.00 0.00 ? 113 LEU A HD21 4  
ATOM 7555  H HD22 . LEU A 1 114 ? 8.051   3.111   7.287   1.00 0.00 ? 113 LEU A HD22 4  
ATOM 7556  H HD23 . LEU A 1 114 ? 8.905   4.185   8.447   1.00 0.00 ? 113 LEU A HD23 4  
ATOM 7557  N N    . GLU A 1 115 ? 12.313  3.010   3.726   1.00 0.00 ? 114 GLU A N    4  
ATOM 7558  C CA   . GLU A 1 115 ? 13.013  3.885   2.754   1.00 0.00 ? 114 GLU A CA   4  
ATOM 7559  C C    . GLU A 1 115 ? 12.546  3.898   1.292   1.00 0.00 ? 114 GLU A C    4  
ATOM 7560  O O    . GLU A 1 115 ? 12.839  4.819   0.538   1.00 0.00 ? 114 GLU A O    4  
ATOM 7561  C CB   . GLU A 1 115 ? 14.511  4.164   3.008   1.00 0.00 ? 114 GLU A CB   4  
ATOM 7562  C CG   . GLU A 1 115 ? 14.662  5.627   3.500   1.00 0.00 ? 114 GLU A CG   4  
ATOM 7563  C CD   . GLU A 1 115 ? 16.132  5.966   3.714   1.00 0.00 ? 114 GLU A CD   4  
ATOM 7564  O OE1  . GLU A 1 115 ? 16.778  5.300   4.567   1.00 0.00 ? 114 GLU A OE1  4  
ATOM 7565  O OE2  . GLU A 1 115 ? 16.633  6.898   3.029   1.00 0.00 ? 114 GLU A OE2  4  
ATOM 7566  H H    . GLU A 1 115 ? 12.748  2.276   4.225   1.00 0.00 ? 114 GLU A H    4  
ATOM 7567  H HA   . GLU A 1 115 ? 12.648  4.872   3.015   1.00 0.00 ? 114 GLU A HA   4  
ATOM 7568  H HB2  . GLU A 1 115 ? 14.883  3.474   3.797   1.00 0.00 ? 114 GLU A HB2  4  
ATOM 7569  H HB3  . GLU A 1 115 ? 15.127  4.007   2.096   1.00 0.00 ? 114 GLU A HB3  4  
ATOM 7570  H HG2  . GLU A 1 115 ? 14.201  6.338   2.754   1.00 0.00 ? 114 GLU A HG2  4  
ATOM 7571  H HG3  . GLU A 1 115 ? 14.110  5.711   4.472   1.00 0.00 ? 114 GLU A HG3  4  
ATOM 7572  N N    . GLN A 1 116 ? 11.653  2.930   0.936   1.00 0.00 ? 115 GLN A N    4  
ATOM 7573  C CA   . GLN A 1 116 ? 10.797  2.962   -0.256  1.00 0.00 ? 115 GLN A CA   4  
ATOM 7574  C C    . GLN A 1 116 ? 9.578   3.897   -0.023  1.00 0.00 ? 115 GLN A C    4  
ATOM 7575  O O    . GLN A 1 116 ? 9.049   4.538   -0.924  1.00 0.00 ? 115 GLN A O    4  
ATOM 7576  C CB   . GLN A 1 116 ? 10.219  1.566   -0.608  1.00 0.00 ? 115 GLN A CB   4  
ATOM 7577  C CG   . GLN A 1 116 ? 11.281  0.466   -0.767  1.00 0.00 ? 115 GLN A CG   4  
ATOM 7578  C CD   . GLN A 1 116 ? 10.598  -0.845  -1.166  1.00 0.00 ? 115 GLN A CD   4  
ATOM 7579  O OE1  . GLN A 1 116 ? 10.201  -1.641  -0.306  1.00 0.00 ? 115 GLN A OE1  4  
ATOM 7580  N NE2  . GLN A 1 116 ? 10.446  -1.056  -2.496  1.00 0.00 ? 115 GLN A NE2  4  
ATOM 7581  H H    . GLN A 1 116 ? 11.485  2.190   1.591   1.00 0.00 ? 115 GLN A H    4  
ATOM 7582  H HA   . GLN A 1 116 ? 11.365  3.331   -1.098  1.00 0.00 ? 115 GLN A HA   4  
ATOM 7583  H HB2  . GLN A 1 116 ? 9.532   1.229   0.217   1.00 0.00 ? 115 GLN A HB2  4  
ATOM 7584  H HB3  . GLN A 1 116 ? 9.656   1.650   -1.577  1.00 0.00 ? 115 GLN A HB3  4  
ATOM 7585  H HG2  . GLN A 1 116 ? 12.047  0.746   -1.519  1.00 0.00 ? 115 GLN A HG2  4  
ATOM 7586  H HG3  . GLN A 1 116 ? 11.788  0.283   0.205   1.00 0.00 ? 115 GLN A HG3  4  
ATOM 7587  H HE21 . GLN A 1 116 ? 10.589  -0.307  -3.156  1.00 0.00 ? 115 GLN A HE21 4  
ATOM 7588  H HE22 . GLN A 1 116 ? 10.456  -2.010  -2.828  1.00 0.00 ? 115 GLN A HE22 4  
ATOM 7589  N N    . GLY A 1 117 ? 9.149   3.959   1.260   1.00 0.00 ? 116 GLY A N    4  
ATOM 7590  C CA   . GLY A 1 117 ? 8.066   4.673   1.917   1.00 0.00 ? 116 GLY A CA   4  
ATOM 7591  C C    . GLY A 1 117 ? 8.396   6.123   2.117   1.00 0.00 ? 116 GLY A C    4  
ATOM 7592  O O    . GLY A 1 117 ? 7.676   6.983   1.640   1.00 0.00 ? 116 GLY A O    4  
ATOM 7593  H H    . GLY A 1 117 ? 9.704   3.461   1.916   1.00 0.00 ? 116 GLY A H    4  
ATOM 7594  H HA2  . GLY A 1 117 ? 7.155   4.557   1.360   1.00 0.00 ? 116 GLY A HA2  4  
ATOM 7595  H HA3  . GLY A 1 117 ? 7.970   4.244   2.905   1.00 0.00 ? 116 GLY A HA3  4  
ATOM 7596  N N    . ASN A 1 118 ? 9.540   6.443   2.785   1.00 0.00 ? 117 ASN A N    4  
ATOM 7597  C CA   . ASN A 1 118 ? 10.067  7.781   3.083   1.00 0.00 ? 117 ASN A CA   4  
ATOM 7598  C C    . ASN A 1 118 ? 10.531  8.575   1.874   1.00 0.00 ? 117 ASN A C    4  
ATOM 7599  O O    . ASN A 1 118 ? 10.466  9.805   1.845   1.00 0.00 ? 117 ASN A O    4  
ATOM 7600  C CB   . ASN A 1 118 ? 11.153  7.833   4.186   1.00 0.00 ? 117 ASN A CB   4  
ATOM 7601  C CG   . ASN A 1 118 ? 10.648  7.183   5.472   1.00 0.00 ? 117 ASN A CG   4  
ATOM 7602  O OD1  . ASN A 1 118 ? 11.268  6.224   5.929   1.00 0.00 ? 117 ASN A OD1  4  
ATOM 7603  N ND2  . ASN A 1 118 ? 9.546   7.693   6.082   1.00 0.00 ? 117 ASN A ND2  4  
ATOM 7604  H H    . ASN A 1 118 ? 10.079  5.662   3.139   1.00 0.00 ? 117 ASN A H    4  
ATOM 7605  H HA   . ASN A 1 118 ? 9.250   8.335   3.482   1.00 0.00 ? 117 ASN A HA   4  
ATOM 7606  H HB2  . ASN A 1 118 ? 12.061  7.270   3.872   1.00 0.00 ? 117 ASN A HB2  4  
ATOM 7607  H HB3  . ASN A 1 118 ? 11.445  8.881   4.423   1.00 0.00 ? 117 ASN A HB3  4  
ATOM 7608  H HD21 . ASN A 1 118 ? 9.115   8.529   5.747   1.00 0.00 ? 117 ASN A HD21 4  
ATOM 7609  H HD22 . ASN A 1 118 ? 9.220   7.212   6.901   1.00 0.00 ? 117 ASN A HD22 4  
ATOM 7610  N N    . ARG A 1 119 ? 10.952  7.855   0.796   1.00 0.00 ? 118 ARG A N    4  
ATOM 7611  C CA   . ARG A 1 119 ? 11.364  8.435   -0.476  1.00 0.00 ? 118 ARG A CA   4  
ATOM 7612  C C    . ARG A 1 119 ? 10.184  9.072   -1.249  1.00 0.00 ? 118 ARG A C    4  
ATOM 7613  O O    . ARG A 1 119 ? 10.323  10.074  -1.939  1.00 0.00 ? 118 ARG A O    4  
ATOM 7614  C CB   . ARG A 1 119 ? 12.074  7.433   -1.415  1.00 0.00 ? 118 ARG A CB   4  
ATOM 7615  C CG   . ARG A 1 119 ? 11.190  6.334   -2.040  1.00 0.00 ? 118 ARG A CG   4  
ATOM 7616  C CD   . ARG A 1 119 ? 11.372  6.235   -3.564  1.00 0.00 ? 118 ARG A CD   4  
ATOM 7617  N NE   . ARG A 1 119 ? 11.091  4.828   -4.026  1.00 0.00 ? 118 ARG A NE   4  
ATOM 7618  C CZ   . ARG A 1 119 ? 12.033  3.830   -3.994  1.00 0.00 ? 118 ARG A CZ   4  
ATOM 7619  N NH1  . ARG A 1 119 ? 13.297  4.067   -3.536  1.00 0.00 ? 118 ARG A NH1  4  
ATOM 7620  N NH2  . ARG A 1 119 ? 11.703  2.577   -4.417  1.00 0.00 ? 118 ARG A NH2  4  
ATOM 7621  H H    . ARG A 1 119 ? 10.989  6.859   0.860   1.00 0.00 ? 118 ARG A H    4  
ATOM 7622  H HA   . ARG A 1 119 ? 12.129  9.156   -0.205  1.00 0.00 ? 118 ARG A HA   4  
ATOM 7623  H HB2  . ARG A 1 119 ? 12.554  8.008   -2.243  1.00 0.00 ? 118 ARG A HB2  4  
ATOM 7624  H HB3  . ARG A 1 119 ? 12.908  6.949   -0.859  1.00 0.00 ? 118 ARG A HB3  4  
ATOM 7625  H HG2  . ARG A 1 119 ? 11.451  5.376   -1.552  1.00 0.00 ? 118 ARG A HG2  4  
ATOM 7626  H HG3  . ARG A 1 119 ? 10.108  6.481   -1.803  1.00 0.00 ? 118 ARG A HG3  4  
ATOM 7627  H HD2  . ARG A 1 119 ? 10.655  6.919   -4.068  1.00 0.00 ? 118 ARG A HD2  4  
ATOM 7628  H HD3  . ARG A 1 119 ? 12.402  6.530   -3.861  1.00 0.00 ? 118 ARG A HD3  4  
ATOM 7629  H HE   . ARG A 1 119 ? 10.175  4.611   -4.365  1.00 0.00 ? 118 ARG A HE   4  
ATOM 7630  H HH11 . ARG A 1 119 ? 13.550  4.982   -3.219  1.00 0.00 ? 118 ARG A HH11 4  
ATOM 7631  H HH12 . ARG A 1 119 ? 13.968  3.326   -3.516  1.00 0.00 ? 118 ARG A HH12 4  
ATOM 7632  H HH21 . ARG A 1 119 ? 10.779  2.389   -4.749  1.00 0.00 ? 118 ARG A HH21 4  
ATOM 7633  H HH22 . ARG A 1 119 ? 12.384  1.846   -4.389  1.00 0.00 ? 118 ARG A HH22 4  
ATOM 7634  N N    . LEU A 1 120 ? 8.978   8.454   -1.065  1.00 0.00 ? 119 LEU A N    4  
ATOM 7635  C CA   . LEU A 1 120 ? 7.643   8.780   -1.558  1.00 0.00 ? 119 LEU A CA   4  
ATOM 7636  C C    . LEU A 1 120 ? 6.949   9.683   -0.594  1.00 0.00 ? 119 LEU A C    4  
ATOM 7637  O O    . LEU A 1 120 ? 6.237   10.575  -1.042  1.00 0.00 ? 119 LEU A O    4  
ATOM 7638  C CB   . LEU A 1 120 ? 6.751   7.514   -1.860  1.00 0.00 ? 119 LEU A CB   4  
ATOM 7639  C CG   . LEU A 1 120 ? 5.229   7.738   -2.069  1.00 0.00 ? 119 LEU A CG   4  
ATOM 7640  C CD1  . LEU A 1 120 ? 4.552   6.602   -2.849  1.00 0.00 ? 119 LEU A CD1  4  
ATOM 7641  C CD2  . LEU A 1 120 ? 4.414   7.798   -0.788  1.00 0.00 ? 119 LEU A CD2  4  
ATOM 7642  H H    . LEU A 1 120 ? 9.004   7.643   -0.483  1.00 0.00 ? 119 LEU A H    4  
ATOM 7643  H HA   . LEU A 1 120 ? 7.645   9.380   -2.456  1.00 0.00 ? 119 LEU A HA   4  
ATOM 7644  H HB2  . LEU A 1 120 ? 7.035   7.142   -2.850  1.00 0.00 ? 119 LEU A HB2  4  
ATOM 7645  H HB3  . LEU A 1 120 ? 6.977   6.651   -1.197  1.00 0.00 ? 119 LEU A HB3  4  
ATOM 7646  H HG   . LEU A 1 120 ? 5.158   8.712   -2.637  1.00 0.00 ? 119 LEU A HG   4  
ATOM 7647  H HD11 . LEU A 1 120 ? 5.115   6.301   -3.749  1.00 0.00 ? 119 LEU A HD11 4  
ATOM 7648  H HD12 . LEU A 1 120 ? 3.522   6.893   -3.152  1.00 0.00 ? 119 LEU A HD12 4  
ATOM 7649  H HD13 . LEU A 1 120 ? 4.428   5.726   -2.185  1.00 0.00 ? 119 LEU A HD13 4  
ATOM 7650  H HD21 . LEU A 1 120 ? 4.426   8.825   -0.381  1.00 0.00 ? 119 LEU A HD21 4  
ATOM 7651  H HD22 . LEU A 1 120 ? 4.825   7.091   -0.045  1.00 0.00 ? 119 LEU A HD22 4  
ATOM 7652  H HD23 . LEU A 1 120 ? 3.357   7.534   -1.004  1.00 0.00 ? 119 LEU A HD23 4  
ATOM 7653  N N    . ARG A 1 121 ? 7.059   9.441   0.743   1.00 0.00 ? 120 ARG A N    4  
ATOM 7654  C CA   . ARG A 1 121 ? 6.297   10.011  1.849   1.00 0.00 ? 120 ARG A CA   4  
ATOM 7655  C C    . ARG A 1 121 ? 5.849   11.483  1.822   1.00 0.00 ? 120 ARG A C    4  
ATOM 7656  O O    . ARG A 1 121 ? 4.732   11.819  2.187   1.00 0.00 ? 120 ARG A O    4  
ATOM 7657  C CB   . ARG A 1 121 ? 6.931   9.654   3.275   1.00 0.00 ? 120 ARG A CB   4  
ATOM 7658  C CG   . ARG A 1 121 ? 7.987   10.640  3.858   1.00 0.00 ? 120 ARG A CG   4  
ATOM 7659  C CD   . ARG A 1 121 ? 7.456   11.669  4.879   1.00 0.00 ? 120 ARG A CD   4  
ATOM 7660  N NE   . ARG A 1 121 ? 6.917   10.931  6.079   1.00 0.00 ? 120 ARG A NE   4  
ATOM 7661  C CZ   . ARG A 1 121 ? 6.215   11.540  7.086   1.00 0.00 ? 120 ARG A CZ   4  
ATOM 7662  N NH1  . ARG A 1 121 ? 5.994   12.885  7.071   1.00 0.00 ? 120 ARG A NH1  4  
ATOM 7663  N NH2  . ARG A 1 121 ? 5.719   10.785  8.109   1.00 0.00 ? 120 ARG A NH2  4  
ATOM 7664  H H    . ARG A 1 121 ? 7.612   8.659   1.041   1.00 0.00 ? 120 ARG A H    4  
ATOM 7665  H HA   . ARG A 1 121 ? 5.370   9.474   1.609   1.00 0.00 ? 120 ARG A HA   4  
ATOM 7666  H HB2  . ARG A 1 121 ? 6.114   9.661   4.015   1.00 0.00 ? 120 ARG A HB2  4  
ATOM 7667  H HB3  . ARG A 1 121 ? 7.347   8.599   3.358   1.00 0.00 ? 120 ARG A HB3  4  
ATOM 7668  H HG2  . ARG A 1 121 ? 8.765   10.061  4.397   1.00 0.00 ? 120 ARG A HG2  4  
ATOM 7669  H HG3  . ARG A 1 121 ? 8.518   11.161  3.031   1.00 0.00 ? 120 ARG A HG3  4  
ATOM 7670  H HD2  . ARG A 1 121 ? 8.290   12.323  5.216   1.00 0.00 ? 120 ARG A HD2  4  
ATOM 7671  H HD3  . ARG A 1 121 ? 6.653   12.293  4.434   1.00 0.00 ? 120 ARG A HD3  4  
ATOM 7672  H HE   . ARG A 1 121 ? 7.054   9.942   6.124   1.00 0.00 ? 120 ARG A HE   4  
ATOM 7673  H HH11 . ARG A 1 121 ? 6.350   13.441  6.319   1.00 0.00 ? 120 ARG A HH11 4  
ATOM 7674  H HH12 . ARG A 1 121 ? 5.474   13.316  7.810   1.00 0.00 ? 120 ARG A HH12 4  
ATOM 7675  H HH21 . ARG A 1 121 ? 5.873   9.797   8.122   1.00 0.00 ? 120 ARG A HH21 4  
ATOM 7676  H HH22 . ARG A 1 121 ? 5.200   11.220  8.846   1.00 0.00 ? 120 ARG A HH22 4  
ATOM 7677  N N    . GLU A 1 122 ? 6.737   12.382  1.337   1.00 0.00 ? 121 GLU A N    4  
ATOM 7678  C CA   . GLU A 1 122 ? 6.546   13.811  1.184   1.00 0.00 ? 121 GLU A CA   4  
ATOM 7679  C C    . GLU A 1 122 ? 6.006   14.209  -0.192  1.00 0.00 ? 121 GLU A C    4  
ATOM 7680  O O    . GLU A 1 122 ? 5.491   15.313  -0.354  1.00 0.00 ? 121 GLU A O    4  
ATOM 7681  C CB   . GLU A 1 122 ? 7.902   14.516  1.475   1.00 0.00 ? 121 GLU A CB   4  
ATOM 7682  C CG   . GLU A 1 122 ? 9.097   13.974  0.657   1.00 0.00 ? 121 GLU A CG   4  
ATOM 7683  C CD   . GLU A 1 122 ? 10.374  14.707  1.069   1.00 0.00 ? 121 GLU A CD   4  
ATOM 7684  O OE1  . GLU A 1 122 ? 10.439  15.947  0.860   1.00 0.00 ? 121 GLU A OE1  4  
ATOM 7685  O OE2  . GLU A 1 122 ? 11.301  14.033  1.592   1.00 0.00 ? 121 GLU A OE2  4  
ATOM 7686  H H    . GLU A 1 122 ? 7.630   12.051  1.047   1.00 0.00 ? 121 GLU A H    4  
ATOM 7687  H HA   . GLU A 1 122 ? 5.826   14.168  1.912   1.00 0.00 ? 121 GLU A HA   4  
ATOM 7688  H HB2  . GLU A 1 122 ? 7.804   15.616  1.324   1.00 0.00 ? 121 GLU A HB2  4  
ATOM 7689  H HB3  . GLU A 1 122 ? 8.136   14.359  2.553   1.00 0.00 ? 121 GLU A HB3  4  
ATOM 7690  H HG2  . GLU A 1 122 ? 9.231   12.883  0.834   1.00 0.00 ? 121 GLU A HG2  4  
ATOM 7691  H HG3  . GLU A 1 122 ? 8.926   14.132  -0.429  1.00 0.00 ? 121 GLU A HG3  4  
ATOM 7692  N N    . GLN A 1 123 ? 6.118   13.308  -1.207  1.00 0.00 ? 122 GLN A N    4  
ATOM 7693  C CA   . GLN A 1 123 ? 5.699   13.497  -2.585  1.00 0.00 ? 122 GLN A CA   4  
ATOM 7694  C C    . GLN A 1 123 ? 4.394   12.789  -2.929  1.00 0.00 ? 122 GLN A C    4  
ATOM 7695  O O    . GLN A 1 123 ? 3.562   13.411  -3.588  1.00 0.00 ? 122 GLN A O    4  
ATOM 7696  C CB   . GLN A 1 123 ? 6.830   13.194  -3.635  1.00 0.00 ? 122 GLN A CB   4  
ATOM 7697  C CG   . GLN A 1 123 ? 7.565   11.829  -3.547  1.00 0.00 ? 122 GLN A CG   4  
ATOM 7698  C CD   . GLN A 1 123 ? 8.640   11.693  -4.648  1.00 0.00 ? 122 GLN A CD   4  
ATOM 7699  O OE1  . GLN A 1 123 ? 8.505   12.196  -5.769  1.00 0.00 ? 122 GLN A OE1  4  
ATOM 7700  N NE2  . GLN A 1 123 ? 9.759   10.988  -4.353  1.00 0.00 ? 122 GLN A NE2  4  
ATOM 7701  H H    . GLN A 1 123 ? 6.494   12.392  -1.051  1.00 0.00 ? 122 GLN A H    4  
ATOM 7702  H HA   . GLN A 1 123 ? 5.464   14.543  -2.737  1.00 0.00 ? 122 GLN A HA   4  
ATOM 7703  H HB2  . GLN A 1 123 ? 6.414   13.312  -4.663  1.00 0.00 ? 122 GLN A HB2  4  
ATOM 7704  H HB3  . GLN A 1 123 ? 7.602   13.991  -3.506  1.00 0.00 ? 122 GLN A HB3  4  
ATOM 7705  H HG2  . GLN A 1 123 ? 8.081   11.789  -2.565  1.00 0.00 ? 122 GLN A HG2  4  
ATOM 7706  H HG3  . GLN A 1 123 ? 6.840   10.967  -3.597  1.00 0.00 ? 122 GLN A HG3  4  
ATOM 7707  H HE21 . GLN A 1 123 ? 9.903   10.644  -3.408  1.00 0.00 ? 122 GLN A HE21 4  
ATOM 7708  H HE22 . GLN A 1 123 ? 10.460  10.915  -5.062  1.00 0.00 ? 122 GLN A HE22 4  
ATOM 7709  N N    . TYR A 1 124 ? 4.152   11.485  -2.555  1.00 0.00 ? 123 TYR A N    4  
ATOM 7710  C CA   . TYR A 1 124 ? 2.890   10.851  -3.020  1.00 0.00 ? 123 TYR A CA   4  
ATOM 7711  C C    . TYR A 1 124 ? 2.024   10.119  -2.007  1.00 0.00 ? 123 TYR A C    4  
ATOM 7712  O O    . TYR A 1 124 ? 1.136   9.392   -2.451  1.00 0.00 ? 123 TYR A O    4  
ATOM 7713  C CB   . TYR A 1 124 ? 3.004   9.872   -4.255  1.00 0.00 ? 123 TYR A CB   4  
ATOM 7714  C CG   . TYR A 1 124 ? 4.151   10.130  -5.181  1.00 0.00 ? 123 TYR A CG   4  
ATOM 7715  C CD1  . TYR A 1 124 ? 4.266   11.243  -5.992  1.00 0.00 ? 123 TYR A CD1  4  
ATOM 7716  C CD2  . TYR A 1 124 ? 5.138   9.179   -5.239  1.00 0.00 ? 123 TYR A CD2  4  
ATOM 7717  C CE1  . TYR A 1 124 ? 5.368   11.378  -6.821  1.00 0.00 ? 123 TYR A CE1  4  
ATOM 7718  C CE2  . TYR A 1 124 ? 6.254   9.323   -6.005  1.00 0.00 ? 123 TYR A CE2  4  
ATOM 7719  C CZ   . TYR A 1 124 ? 6.358   10.411  -6.833  1.00 0.00 ? 123 TYR A CZ   4  
ATOM 7720  O OH   . TYR A 1 124 ? 7.542   10.611  -7.562  1.00 0.00 ? 123 TYR A OH   4  
ATOM 7721  H H    . TYR A 1 124 ? 4.818   10.938  -1.987  1.00 0.00 ? 123 TYR A H    4  
ATOM 7722  H HA   . TYR A 1 124 ? 2.199   11.608  -3.375  1.00 0.00 ? 123 TYR A HA   4  
ATOM 7723  H HB2  . TYR A 1 124 ? 3.082   8.800   -3.952  1.00 0.00 ? 123 TYR A HB2  4  
ATOM 7724  H HB3  . TYR A 1 124 ? 2.084   9.952   -4.870  1.00 0.00 ? 123 TYR A HB3  4  
ATOM 7725  H HD1  . TYR A 1 124 ? 3.510   12.017  -5.955  1.00 0.00 ? 123 TYR A HD1  4  
ATOM 7726  H HD2  . TYR A 1 124 ? 5.059   8.284   -4.662  1.00 0.00 ? 123 TYR A HD2  4  
ATOM 7727  H HE1  . TYR A 1 124 ? 5.475   12.263  -7.428  1.00 0.00 ? 123 TYR A HE1  4  
ATOM 7728  H HE2  . TYR A 1 124 ? 7.014   8.569   -5.867  1.00 0.00 ? 123 TYR A HE2  4  
ATOM 7729  H HH   . TYR A 1 124 ? 8.023   11.307  -7.062  1.00 0.00 ? 123 TYR A HH   4  
ATOM 7730  N N    . GLY A 1 125 ? 2.191   10.170  -0.654  1.00 0.00 ? 124 GLY A N    4  
ATOM 7731  C CA   . GLY A 1 125 ? 1.323   9.285   0.084   1.00 0.00 ? 124 GLY A CA   4  
ATOM 7732  C C    . GLY A 1 125 ? 1.765   9.280   1.478   1.00 0.00 ? 124 GLY A C    4  
ATOM 7733  O O    . GLY A 1 125 ? 1.101   9.927   2.270   1.00 0.00 ? 124 GLY A O    4  
ATOM 7734  H H    . GLY A 1 125 ? 2.838   10.679  -0.060  1.00 0.00 ? 124 GLY A H    4  
ATOM 7735  H HA2  . GLY A 1 125 ? 0.337   9.729   0.095   1.00 0.00 ? 124 GLY A HA2  4  
ATOM 7736  H HA3  . GLY A 1 125 ? 1.292   8.244   -0.276  1.00 0.00 ? 124 GLY A HA3  4  
ATOM 7737  N N    . LEU A 1 126 ? 2.885   8.565   1.825   1.00 0.00 ? 125 LEU A N    4  
ATOM 7738  C CA   . LEU A 1 126 ? 3.410   8.187   3.163   1.00 0.00 ? 125 LEU A CA   4  
ATOM 7739  C C    . LEU A 1 126 ? 3.562   9.227   4.306   1.00 0.00 ? 125 LEU A C    4  
ATOM 7740  O O    . LEU A 1 126 ? 4.153   8.934   5.345   1.00 0.00 ? 125 LEU A O    4  
ATOM 7741  C CB   . LEU A 1 126 ? 4.550   7.088   3.147   1.00 0.00 ? 125 LEU A CB   4  
ATOM 7742  C CG   . LEU A 1 126 ? 4.102   5.609   3.203   1.00 0.00 ? 125 LEU A CG   4  
ATOM 7743  C CD1  . LEU A 1 126 ? 3.076   5.254   4.298   1.00 0.00 ? 125 LEU A CD1  4  
ATOM 7744  C CD2  . LEU A 1 126 ? 3.718   5.118   1.800   1.00 0.00 ? 125 LEU A CD2  4  
ATOM 7745  H H    . LEU A 1 126 ? 3.365   8.099   1.087   1.00 0.00 ? 125 LEU A H    4  
ATOM 7746  H HA   . LEU A 1 126 ? 2.616   7.612   3.556   1.00 0.00 ? 125 LEU A HA   4  
ATOM 7747  H HB2  . LEU A 1 126 ? 5.143   7.101   2.202   1.00 0.00 ? 125 LEU A HB2  4  
ATOM 7748  H HB3  . LEU A 1 126 ? 5.256   7.227   3.996   1.00 0.00 ? 125 LEU A HB3  4  
ATOM 7749  H HG   . LEU A 1 126 ? 5.019   5.024   3.470   1.00 0.00 ? 125 LEU A HG   4  
ATOM 7750  H HD11 . LEU A 1 126 ? 3.458   5.537   5.295   1.00 0.00 ? 125 LEU A HD11 4  
ATOM 7751  H HD12 . LEU A 1 126 ? 2.934   4.157   4.243   1.00 0.00 ? 125 LEU A HD12 4  
ATOM 7752  H HD13 . LEU A 1 126 ? 2.090   5.764   4.209   1.00 0.00 ? 125 LEU A HD13 4  
ATOM 7753  H HD21 . LEU A 1 126 ? 2.787   5.614   1.465   1.00 0.00 ? 125 LEU A HD21 4  
ATOM 7754  H HD22 . LEU A 1 126 ? 3.601   4.015   1.779   1.00 0.00 ? 125 LEU A HD22 4  
ATOM 7755  H HD23 . LEU A 1 126 ? 4.519   5.354   1.071   1.00 0.00 ? 125 LEU A HD23 4  
ATOM 7756  N N    . GLY A 1 127 ? 2.938   10.421  4.149   1.00 0.00 ? 126 GLY A N    4  
ATOM 7757  C CA   . GLY A 1 127 ? 2.749   11.436  5.189   1.00 0.00 ? 126 GLY A CA   4  
ATOM 7758  C C    . GLY A 1 127 ? 1.952   12.660  4.761   1.00 0.00 ? 126 GLY A C    4  
ATOM 7759  O O    . GLY A 1 127 ? 2.567   13.554  4.185   1.00 0.00 ? 126 GLY A O    4  
ATOM 7760  H H    . GLY A 1 127 ? 2.486   10.554  3.238   1.00 0.00 ? 126 GLY A H    4  
ATOM 7761  H HA2  . GLY A 1 127 ? 2.236   10.999  6.037   1.00 0.00 ? 126 GLY A HA2  4  
ATOM 7762  H HA3  . GLY A 1 127 ? 3.733   11.807  5.441   1.00 0.00 ? 126 GLY A HA3  4  
ATOM 7763  N N    . PRO A 1 128 ? 0.619   12.845  4.967   1.00 0.00 ? 127 PRO A N    4  
ATOM 7764  C CA   . PRO A 1 128 ? -0.069  14.105  4.634   1.00 0.00 ? 127 PRO A CA   4  
ATOM 7765  C C    . PRO A 1 128 ? 0.043   15.147  5.778   1.00 0.00 ? 127 PRO A C    4  
ATOM 7766  O O    . PRO A 1 128 ? 0.028   16.352  5.539   1.00 0.00 ? 127 PRO A O    4  
ATOM 7767  C CB   . PRO A 1 128 ? -1.527  13.620  4.466   1.00 0.00 ? 127 PRO A CB   4  
ATOM 7768  C CG   . PRO A 1 128 ? -1.693  12.527  5.535   1.00 0.00 ? 127 PRO A CG   4  
ATOM 7769  C CD   . PRO A 1 128 ? -0.306  11.846  5.536   1.00 0.00 ? 127 PRO A CD   4  
ATOM 7770  H HA   . PRO A 1 128 ? 0.314   14.557  3.728   1.00 0.00 ? 127 PRO A HA   4  
ATOM 7771  H HB2  . PRO A 1 128 ? -2.286  14.425  4.556   1.00 0.00 ? 127 PRO A HB2  4  
ATOM 7772  H HB3  . PRO A 1 128 ? -1.627  13.154  3.459   1.00 0.00 ? 127 PRO A HB3  4  
ATOM 7773  H HG2  . PRO A 1 128 ? -1.934  13.017  6.511   1.00 0.00 ? 127 PRO A HG2  4  
ATOM 7774  H HG3  . PRO A 1 128 ? -2.538  11.848  5.317   1.00 0.00 ? 127 PRO A HG3  4  
ATOM 7775  H HD2  . PRO A 1 128 ? -0.006  11.554  6.567   1.00 0.00 ? 127 PRO A HD2  4  
ATOM 7776  H HD3  . PRO A 1 128 ? -0.330  10.945  4.884   1.00 0.00 ? 127 PRO A HD3  4  
ATOM 7777  N N    . TYR A 1 129 ? 0.092   14.655  7.035   1.00 0.00 ? 128 TYR A N    4  
ATOM 7778  C CA   . TYR A 1 129 ? 0.137   15.346  8.297   1.00 0.00 ? 128 TYR A CA   4  
ATOM 7779  C C    . TYR A 1 129 ? 1.436   14.967  8.981   1.00 0.00 ? 128 TYR A C    4  
ATOM 7780  O O    . TYR A 1 129 ? 1.926   13.845  8.826   1.00 0.00 ? 128 TYR A O    4  
ATOM 7781  C CB   . TYR A 1 129 ? -1.129  14.946  9.107   1.00 0.00 ? 128 TYR A CB   4  
ATOM 7782  C CG   . TYR A 1 129 ? -1.469  15.896  10.225  1.00 0.00 ? 128 TYR A CG   4  
ATOM 7783  C CD1  . TYR A 1 129 ? -2.190  17.049  9.966   1.00 0.00 ? 128 TYR A CD1  4  
ATOM 7784  C CD2  . TYR A 1 129 ? -1.105  15.617  11.529  1.00 0.00 ? 128 TYR A CD2  4  
ATOM 7785  C CE1  . TYR A 1 129 ? -2.555  17.896  10.993  1.00 0.00 ? 128 TYR A CE1  4  
ATOM 7786  C CE2  . TYR A 1 129 ? -1.459  16.466  12.559  1.00 0.00 ? 128 TYR A CE2  4  
ATOM 7787  C CZ   . TYR A 1 129 ? -2.191  17.604  12.290  1.00 0.00 ? 128 TYR A CZ   4  
ATOM 7788  O OH   . TYR A 1 129 ? -2.574  18.477  13.326  1.00 0.00 ? 128 TYR A OH   4  
ATOM 7789  H H    . TYR A 1 129 ? 0.144   13.661  7.089   1.00 0.00 ? 128 TYR A H    4  
ATOM 7790  H HA   . TYR A 1 129 ? 0.148   16.417  8.124   1.00 0.00 ? 128 TYR A HA   4  
ATOM 7791  H HB2  . TYR A 1 129 ? -1.985  14.997  8.402   1.00 0.00 ? 128 TYR A HB2  4  
ATOM 7792  H HB3  . TYR A 1 129 ? -1.075  13.906  9.494   1.00 0.00 ? 128 TYR A HB3  4  
ATOM 7793  H HD1  . TYR A 1 129 ? -2.485  17.281  8.950   1.00 0.00 ? 128 TYR A HD1  4  
ATOM 7794  H HD2  . TYR A 1 129 ? -0.535  14.723  11.745  1.00 0.00 ? 128 TYR A HD2  4  
ATOM 7795  H HE1  . TYR A 1 129 ? -3.125  18.792  10.790  1.00 0.00 ? 128 TYR A HE1  4  
ATOM 7796  H HE2  . TYR A 1 129 ? -1.156  16.232  13.571  1.00 0.00 ? 128 TYR A HE2  4  
ATOM 7797  H HH   . TYR A 1 129 ? -2.300  18.097  14.165  1.00 0.00 ? 128 TYR A HH   4  
ATOM 7798  N N    . GLU A 1 130 ? 2.012   15.906  9.771   1.00 0.00 ? 129 GLU A N    4  
ATOM 7799  C CA   . GLU A 1 130 ? 3.259   15.749  10.509  1.00 0.00 ? 129 GLU A CA   4  
ATOM 7800  C C    . GLU A 1 130 ? 2.982   15.473  11.982  1.00 0.00 ? 129 GLU A C    4  
ATOM 7801  O O    . GLU A 1 130 ? 2.158   16.147  12.603  1.00 0.00 ? 129 GLU A O    4  
ATOM 7802  C CB   . GLU A 1 130 ? 4.151   17.016  10.363  1.00 0.00 ? 129 GLU A CB   4  
ATOM 7803  C CG   . GLU A 1 130 ? 4.435   17.427  8.902   1.00 0.00 ? 129 GLU A CG   4  
ATOM 7804  C CD   . GLU A 1 130 ? 5.130   16.297  8.141   1.00 0.00 ? 129 GLU A CD   4  
ATOM 7805  O OE1  . GLU A 1 130 ? 6.256   15.909  8.552   1.00 0.00 ? 129 GLU A OE1  4  
ATOM 7806  O OE2  . GLU A 1 130 ? 4.545   15.811  7.136   1.00 0.00 ? 129 GLU A OE2  4  
ATOM 7807  H H    . GLU A 1 130 ? 1.571   16.794  9.878   1.00 0.00 ? 129 GLU A H    4  
ATOM 7808  H HA   . GLU A 1 130 ? 3.818   14.902  10.129  1.00 0.00 ? 129 GLU A HA   4  
ATOM 7809  H HB2  . GLU A 1 130 ? 3.655   17.889  10.850  1.00 0.00 ? 129 GLU A HB2  4  
ATOM 7810  H HB3  . GLU A 1 130 ? 5.128   16.858  10.872  1.00 0.00 ? 129 GLU A HB3  4  
ATOM 7811  H HG2  . GLU A 1 130 ? 3.483   17.693  8.393   1.00 0.00 ? 129 GLU A HG2  4  
ATOM 7812  H HG3  . GLU A 1 130 ? 5.090   18.324  8.895   1.00 0.00 ? 129 GLU A HG3  4  
ATOM 7813  N N    . ASN A 1 8   ? -14.883 12.842  -1.050  1.00 0.00 ? 7   ASN A N    5  
ATOM 7814  C CA   . ASN A 1 8   ? -15.053 12.000  -2.205  1.00 0.00 ? 7   ASN A CA   5  
ATOM 7815  C C    . ASN A 1 8   ? -13.712 11.681  -2.828  1.00 0.00 ? 7   ASN A C    5  
ATOM 7816  O O    . ASN A 1 8   ? -13.616 10.864  -3.737  1.00 0.00 ? 7   ASN A O    5  
ATOM 7817  C CB   . ASN A 1 8   ? -16.049 12.620  -3.224  1.00 0.00 ? 7   ASN A CB   5  
ATOM 7818  C CG   . ASN A 1 8   ? -15.716 14.082  -3.540  1.00 0.00 ? 7   ASN A CG   5  
ATOM 7819  O OD1  . ASN A 1 8   ? -15.772 14.946  -2.661  1.00 0.00 ? 7   ASN A OD1  5  
ATOM 7820  N ND2  . ASN A 1 8   ? -15.366 14.377  -4.814  1.00 0.00 ? 7   ASN A ND2  5  
ATOM 7821  H H    . ASN A 1 8   ? -15.233 13.782  -1.185  1.00 0.00 ? 7   ASN A H    5  
ATOM 7822  H HA   . ASN A 1 8   ? -15.459 11.062  -1.857  1.00 0.00 ? 7   ASN A HA   5  
ATOM 7823  H HB2  . ASN A 1 8   ? -16.118 12.018  -4.152  1.00 0.00 ? 7   ASN A HB2  5  
ATOM 7824  H HB3  . ASN A 1 8   ? -17.055 12.624  -2.751  1.00 0.00 ? 7   ASN A HB3  5  
ATOM 7825  H HD21 . ASN A 1 8   ? -15.218 13.619  -5.459  1.00 0.00 ? 7   ASN A HD21 5  
ATOM 7826  H HD22 . ASN A 1 8   ? -15.259 15.356  -5.029  1.00 0.00 ? 7   ASN A HD22 5  
ATOM 7827  N N    . SER A 1 9   ? -12.629 12.333  -2.336  1.00 0.00 ? 8   SER A N    5  
ATOM 7828  C CA   . SER A 1 9   ? -11.237 12.211  -2.770  1.00 0.00 ? 8   SER A CA   5  
ATOM 7829  C C    . SER A 1 9   ? -10.560 10.923  -2.310  1.00 0.00 ? 8   SER A C    5  
ATOM 7830  O O    . SER A 1 9   ? -10.009 10.149  -3.086  1.00 0.00 ? 8   SER A O    5  
ATOM 7831  C CB   . SER A 1 9   ? -10.408 13.431  -2.255  1.00 0.00 ? 8   SER A CB   5  
ATOM 7832  O OG   . SER A 1 9   ? -10.537 13.613  -0.837  1.00 0.00 ? 8   SER A OG   5  
ATOM 7833  H H    . SER A 1 9   ? -12.779 12.993  -1.598  1.00 0.00 ? 8   SER A H    5  
ATOM 7834  H HA   . SER A 1 9   ? -11.206 12.214  -3.852  1.00 0.00 ? 8   SER A HA   5  
ATOM 7835  H HB2  . SER A 1 9   ? -9.336  13.341  -2.539  1.00 0.00 ? 8   SER A HB2  5  
ATOM 7836  H HB3  . SER A 1 9   ? -10.806 14.347  -2.749  1.00 0.00 ? 8   SER A HB3  5  
ATOM 7837  H HG   . SER A 1 9   ? -9.648  13.764  -0.487  1.00 0.00 ? 8   SER A HG   5  
ATOM 7838  N N    . PHE A 1 10  ? -10.578 10.687  -0.978  1.00 0.00 ? 9   PHE A N    5  
ATOM 7839  C CA   . PHE A 1 10  ? -9.923  9.562   -0.324  1.00 0.00 ? 9   PHE A CA   5  
ATOM 7840  C C    . PHE A 1 10  ? -10.835 8.385   -0.116  1.00 0.00 ? 9   PHE A C    5  
ATOM 7841  O O    . PHE A 1 10  ? -10.385 7.305   0.235   1.00 0.00 ? 9   PHE A O    5  
ATOM 7842  C CB   . PHE A 1 10  ? -9.267  9.997   1.013   1.00 0.00 ? 9   PHE A CB   5  
ATOM 7843  C CG   . PHE A 1 10  ? -8.304  11.130  0.750   1.00 0.00 ? 9   PHE A CG   5  
ATOM 7844  C CD1  . PHE A 1 10  ? -7.371  11.047  -0.271  1.00 0.00 ? 9   PHE A CD1  5  
ATOM 7845  C CD2  . PHE A 1 10  ? -8.369  12.299  1.487   1.00 0.00 ? 9   PHE A CD2  5  
ATOM 7846  C CE1  . PHE A 1 10  ? -6.594  12.136  -0.606  1.00 0.00 ? 9   PHE A CE1  5  
ATOM 7847  C CE2  . PHE A 1 10  ? -7.560  13.375  1.183   1.00 0.00 ? 9   PHE A CE2  5  
ATOM 7848  C CZ   . PHE A 1 10  ? -6.679  13.300  0.126   1.00 0.00 ? 9   PHE A CZ   5  
ATOM 7849  H H    . PHE A 1 10  ? -11.013 11.370  -0.388  1.00 0.00 ? 9   PHE A H    5  
ATOM 7850  H HA   . PHE A 1 10  ? -9.146  9.157   -0.960  1.00 0.00 ? 9   PHE A HA   5  
ATOM 7851  H HB2  . PHE A 1 10  ? -10.046 10.346  1.726   1.00 0.00 ? 9   PHE A HB2  5  
ATOM 7852  H HB3  . PHE A 1 10  ? -8.699  9.168   1.484   1.00 0.00 ? 9   PHE A HB3  5  
ATOM 7853  H HD1  . PHE A 1 10  ? -7.269  10.136  -0.849  1.00 0.00 ? 9   PHE A HD1  5  
ATOM 7854  H HD2  . PHE A 1 10  ? -9.074  12.383  2.302   1.00 0.00 ? 9   PHE A HD2  5  
ATOM 7855  H HE1  . PHE A 1 10  ? -5.901  12.060  -1.432  1.00 0.00 ? 9   PHE A HE1  5  
ATOM 7856  H HE2  . PHE A 1 10  ? -7.627  14.281  1.771   1.00 0.00 ? 9   PHE A HE2  5  
ATOM 7857  H HZ   . PHE A 1 10  ? -6.049  14.146  -0.121  1.00 0.00 ? 9   PHE A HZ   5  
ATOM 7858  N N    . VAL A 1 11  ? -12.156 8.533   -0.365  1.00 0.00 ? 10  VAL A N    5  
ATOM 7859  C CA   . VAL A 1 11  ? -13.143 7.459   -0.185  1.00 0.00 ? 10  VAL A CA   5  
ATOM 7860  C C    . VAL A 1 11  ? -13.087 6.254   -1.161  1.00 0.00 ? 10  VAL A C    5  
ATOM 7861  O O    . VAL A 1 11  ? -13.797 5.269   -0.987  1.00 0.00 ? 10  VAL A O    5  
ATOM 7862  C CB   . VAL A 1 11  ? -14.543 8.016   0.108   1.00 0.00 ? 10  VAL A CB   5  
ATOM 7863  C CG1  . VAL A 1 11  ? -14.418 9.473   0.592   1.00 0.00 ? 10  VAL A CG1  5  
ATOM 7864  C CG2  . VAL A 1 11  ? -15.535 7.966   -1.065  1.00 0.00 ? 10  VAL A CG2  5  
ATOM 7865  H H    . VAL A 1 11  ? -12.509 9.442   -0.615  1.00 0.00 ? 10  VAL A H    5  
ATOM 7866  H HA   . VAL A 1 11  ? -12.893 7.005   0.765   1.00 0.00 ? 10  VAL A HA   5  
ATOM 7867  H HB   . VAL A 1 11  ? -14.992 7.415   0.932   1.00 0.00 ? 10  VAL A HB   5  
ATOM 7868  H HG11 . VAL A 1 11  ? -13.637 9.600   1.368   1.00 0.00 ? 10  VAL A HG11 5  
ATOM 7869  H HG12 . VAL A 1 11  ? -15.392 9.824   0.994   1.00 0.00 ? 10  VAL A HG12 5  
ATOM 7870  H HG13 . VAL A 1 11  ? -14.169 10.123  -0.270  1.00 0.00 ? 10  VAL A HG13 5  
ATOM 7871  H HG21 . VAL A 1 11  ? -16.469 8.464   -0.729  1.00 0.00 ? 10  VAL A HG21 5  
ATOM 7872  H HG22 . VAL A 1 11  ? -15.788 6.917   -1.329  1.00 0.00 ? 10  VAL A HG22 5  
ATOM 7873  H HG23 . VAL A 1 11  ? -15.128 8.497   -1.950  1.00 0.00 ? 10  VAL A HG23 5  
ATOM 7874  N N    . GLY A 1 12  ? -12.181 6.270   -2.182  1.00 0.00 ? 11  GLY A N    5  
ATOM 7875  C CA   . GLY A 1 12  ? -11.885 5.129   -3.052  1.00 0.00 ? 11  GLY A CA   5  
ATOM 7876  C C    . GLY A 1 12  ? -10.394 5.028   -3.273  1.00 0.00 ? 11  GLY A C    5  
ATOM 7877  O O    . GLY A 1 12  ? -9.921  4.760   -4.374  1.00 0.00 ? 11  GLY A O    5  
ATOM 7878  H H    . GLY A 1 12  ? -11.624 7.080   -2.340  1.00 0.00 ? 11  GLY A H    5  
ATOM 7879  H HA2  . GLY A 1 12  ? -12.175 4.192   -2.554  1.00 0.00 ? 11  GLY A HA2  5  
ATOM 7880  H HA3  . GLY A 1 12  ? -12.334 5.341   -4.028  1.00 0.00 ? 11  GLY A HA3  5  
ATOM 7881  N N    . LEU A 1 13  ? -9.605  5.247   -2.186  1.00 0.00 ? 12  LEU A N    5  
ATOM 7882  C CA   . LEU A 1 13  ? -8.143  5.269   -2.163  1.00 0.00 ? 12  LEU A CA   5  
ATOM 7883  C C    . LEU A 1 13  ? -7.492  3.913   -2.029  1.00 0.00 ? 12  LEU A C    5  
ATOM 7884  O O    . LEU A 1 13  ? -8.092  2.920   -1.598  1.00 0.00 ? 12  LEU A O    5  
ATOM 7885  C CB   . LEU A 1 13  ? -7.712  6.110   -0.957  1.00 0.00 ? 12  LEU A CB   5  
ATOM 7886  C CG   . LEU A 1 13  ? -6.401  6.896   -0.799  1.00 0.00 ? 12  LEU A CG   5  
ATOM 7887  C CD1  . LEU A 1 13  ? -6.274  8.010   -1.840  1.00 0.00 ? 12  LEU A CD1  5  
ATOM 7888  C CD2  . LEU A 1 13  ? -6.606  7.429   0.634   1.00 0.00 ? 12  LEU A CD2  5  
ATOM 7889  H H    . LEU A 1 13  ? -10.042 5.457   -1.310  1.00 0.00 ? 12  LEU A H    5  
ATOM 7890  H HA   . LEU A 1 13  ? -7.785  5.735   -3.073  1.00 0.00 ? 12  LEU A HA   5  
ATOM 7891  H HB2  . LEU A 1 13  ? -8.477  6.919   -0.928  1.00 0.00 ? 12  LEU A HB2  5  
ATOM 7892  H HB3  . LEU A 1 13  ? -7.825  5.515   -0.030  1.00 0.00 ? 12  LEU A HB3  5  
ATOM 7893  H HG   . LEU A 1 13  ? -5.414  6.348   -0.821  1.00 0.00 ? 12  LEU A HG   5  
ATOM 7894  H HD11 . LEU A 1 13  ? -5.759  7.645   -2.751  1.00 0.00 ? 12  LEU A HD11 5  
ATOM 7895  H HD12 . LEU A 1 13  ? -5.672  8.842   -1.406  1.00 0.00 ? 12  LEU A HD12 5  
ATOM 7896  H HD13 . LEU A 1 13  ? -7.272  8.406   -2.119  1.00 0.00 ? 12  LEU A HD13 5  
ATOM 7897  H HD21 . LEU A 1 13  ? -6.384  8.505   0.729   1.00 0.00 ? 12  LEU A HD21 5  
ATOM 7898  H HD22 . LEU A 1 13  ? -6.006  6.834   1.352   1.00 0.00 ? 12  LEU A HD22 5  
ATOM 7899  H HD23 . LEU A 1 13  ? -7.662  7.297   0.957   1.00 0.00 ? 12  LEU A HD23 5  
ATOM 7900  N N    . ARG A 1 14  ? -6.189  3.940   -2.392  1.00 0.00 ? 13  ARG A N    5  
ATOM 7901  C CA   . ARG A 1 14  ? -5.249  2.825   -2.501  1.00 0.00 ? 13  ARG A CA   5  
ATOM 7902  C C    . ARG A 1 14  ? -4.255  3.013   -1.389  1.00 0.00 ? 13  ARG A C    5  
ATOM 7903  O O    . ARG A 1 14  ? -3.533  4.009   -1.387  1.00 0.00 ? 13  ARG A O    5  
ATOM 7904  C CB   . ARG A 1 14  ? -4.482  2.897   -3.854  1.00 0.00 ? 13  ARG A CB   5  
ATOM 7905  C CG   . ARG A 1 14  ? -5.380  2.784   -5.096  1.00 0.00 ? 13  ARG A CG   5  
ATOM 7906  C CD   . ARG A 1 14  ? -4.561  2.955   -6.384  1.00 0.00 ? 13  ARG A CD   5  
ATOM 7907  N NE   . ARG A 1 14  ? -5.461  2.891   -7.587  1.00 0.00 ? 13  ARG A NE   5  
ATOM 7908  C CZ   . ARG A 1 14  ? -5.564  1.804   -8.414  1.00 0.00 ? 13  ARG A CZ   5  
ATOM 7909  N NH1  . ARG A 1 14  ? -4.923  0.632   -8.131  1.00 0.00 ? 13  ARG A NH1  5  
ATOM 7910  N NH2  . ARG A 1 14  ? -6.325  1.902   -9.543  1.00 0.00 ? 13  ARG A NH2  5  
ATOM 7911  H H    . ARG A 1 14  ? -5.802  4.857   -2.568  1.00 0.00 ? 13  ARG A H    5  
ATOM 7912  H HA   . ARG A 1 14  ? -5.753  1.870   -2.379  1.00 0.00 ? 13  ARG A HA   5  
ATOM 7913  H HB2  . ARG A 1 14  ? -3.930  3.863   -3.941  1.00 0.00 ? 13  ARG A HB2  5  
ATOM 7914  H HB3  . ARG A 1 14  ? -3.718  2.090   -3.920  1.00 0.00 ? 13  ARG A HB3  5  
ATOM 7915  H HG2  . ARG A 1 14  ? -5.866  1.785   -5.089  1.00 0.00 ? 13  ARG A HG2  5  
ATOM 7916  H HG3  . ARG A 1 14  ? -6.175  3.562   -5.055  1.00 0.00 ? 13  ARG A HG3  5  
ATOM 7917  H HD2  . ARG A 1 14  ? -4.086  3.960   -6.388  1.00 0.00 ? 13  ARG A HD2  5  
ATOM 7918  H HD3  . ARG A 1 14  ? -3.756  2.189   -6.437  1.00 0.00 ? 13  ARG A HD3  5  
ATOM 7919  H HE   . ARG A 1 14  ? -5.961  3.719   -7.836  1.00 0.00 ? 13  ARG A HE   5  
ATOM 7920  H HH11 . ARG A 1 14  ? -4.363  0.556   -7.307  1.00 0.00 ? 13  ARG A HH11 5  
ATOM 7921  H HH12 . ARG A 1 14  ? -5.014  -0.148  -8.751  1.00 0.00 ? 13  ARG A HH12 5  
ATOM 7922  H HH21 . ARG A 1 14  ? -6.795  2.759   -9.755  1.00 0.00 ? 13  ARG A HH21 5  
ATOM 7923  H HH22 . ARG A 1 14  ? -6.414  1.118   -10.156 1.00 0.00 ? 13  ARG A HH22 5  
ATOM 7924  N N    . VAL A 1 15  ? -4.213  2.131   -0.359  1.00 0.00 ? 14  VAL A N    5  
ATOM 7925  C CA   . VAL A 1 15  ? -3.405  2.430   0.815   1.00 0.00 ? 14  VAL A CA   5  
ATOM 7926  C C    . VAL A 1 15  ? -2.496  1.309   1.231   1.00 0.00 ? 14  VAL A C    5  
ATOM 7927  O O    . VAL A 1 15  ? -2.609  0.157   0.834   1.00 0.00 ? 14  VAL A O    5  
ATOM 7928  C CB   . VAL A 1 15  ? -4.232  3.031   1.971   1.00 0.00 ? 14  VAL A CB   5  
ATOM 7929  C CG1  . VAL A 1 15  ? -4.987  4.249   1.435   1.00 0.00 ? 14  VAL A CG1  5  
ATOM 7930  C CG2  . VAL A 1 15  ? -5.261  2.177   2.658   1.00 0.00 ? 14  VAL A CG2  5  
ATOM 7931  H H    . VAL A 1 15  ? -4.766  1.297   -0.291  1.00 0.00 ? 14  VAL A H    5  
ATOM 7932  H HA   . VAL A 1 15  ? -2.682  3.203   0.586   1.00 0.00 ? 14  VAL A HA   5  
ATOM 7933  H HB   . VAL A 1 15  ? -3.554  3.331   2.797   1.00 0.00 ? 14  VAL A HB   5  
ATOM 7934  H HG11 . VAL A 1 15  ? -5.339  4.874   2.282   1.00 0.00 ? 14  VAL A HG11 5  
ATOM 7935  H HG12 . VAL A 1 15  ? -5.841  3.936   0.801   1.00 0.00 ? 14  VAL A HG12 5  
ATOM 7936  H HG13 . VAL A 1 15  ? -4.322  4.858   0.802   1.00 0.00 ? 14  VAL A HG13 5  
ATOM 7937  H HG21 . VAL A 1 15  ? -5.754  2.768   3.453   1.00 0.00 ? 14  VAL A HG21 5  
ATOM 7938  H HG22 . VAL A 1 15  ? -4.789  1.307   3.143   1.00 0.00 ? 14  VAL A HG22 5  
ATOM 7939  H HG23 . VAL A 1 15  ? -6.038  1.891   1.930   1.00 0.00 ? 14  VAL A HG23 5  
ATOM 7940  N N    . VAL A 1 16  ? -1.499  1.620   2.079   1.00 0.00 ? 15  VAL A N    5  
ATOM 7941  C CA   . VAL A 1 16  ? -0.586  0.621   2.667   1.00 0.00 ? 15  VAL A CA   5  
ATOM 7942  C C    . VAL A 1 16  ? -0.662  0.860   4.133   1.00 0.00 ? 15  VAL A C    5  
ATOM 7943  O O    . VAL A 1 16  ? -1.097  1.929   4.536   1.00 0.00 ? 15  VAL A O    5  
ATOM 7944  C CB   . VAL A 1 16  ? 0.852   0.531   2.187   1.00 0.00 ? 15  VAL A CB   5  
ATOM 7945  C CG1  . VAL A 1 16  ? 0.867   -0.178  0.812   1.00 0.00 ? 15  VAL A CG1  5  
ATOM 7946  C CG2  . VAL A 1 16  ? 1.474   1.923   2.158   1.00 0.00 ? 15  VAL A CG2  5  
ATOM 7947  H H    . VAL A 1 16  ? -1.430  2.575   2.390   1.00 0.00 ? 15  VAL A H    5  
ATOM 7948  H HA   . VAL A 1 16  ? -0.989  -0.375  2.539   1.00 0.00 ? 15  VAL A HA   5  
ATOM 7949  H HB   . VAL A 1 16  ? 1.457   -0.100  2.896   1.00 0.00 ? 15  VAL A HB   5  
ATOM 7950  H HG11 . VAL A 1 16  ? 0.122   0.276   0.131   1.00 0.00 ? 15  VAL A HG11 5  
ATOM 7951  H HG12 . VAL A 1 16  ? 0.600   -1.250  0.932   1.00 0.00 ? 15  VAL A HG12 5  
ATOM 7952  H HG13 . VAL A 1 16  ? 1.878   -0.122  0.358   1.00 0.00 ? 15  VAL A HG13 5  
ATOM 7953  H HG21 . VAL A 1 16  ? 0.777   2.641   1.690   1.00 0.00 ? 15  VAL A HG21 5  
ATOM 7954  H HG22 . VAL A 1 16  ? 2.419   1.913   1.578   1.00 0.00 ? 15  VAL A HG22 5  
ATOM 7955  H HG23 . VAL A 1 16  ? 1.682   2.282   3.188   1.00 0.00 ? 15  VAL A HG23 5  
ATOM 7956  N N    . ALA A 1 17  ? -0.326  -0.192  4.912   1.00 0.00 ? 16  ALA A N    5  
ATOM 7957  C CA   . ALA A 1 17  ? -0.665  -0.365  6.295   1.00 0.00 ? 16  ALA A CA   5  
ATOM 7958  C C    . ALA A 1 17  ? 0.490   -0.625  7.247   1.00 0.00 ? 16  ALA A C    5  
ATOM 7959  O O    . ALA A 1 17  ? 1.050   -1.710  7.320   1.00 0.00 ? 16  ALA A O    5  
ATOM 7960  C CB   . ALA A 1 17  ? -1.678  -1.552  6.240   1.00 0.00 ? 16  ALA A CB   5  
ATOM 7961  H H    . ALA A 1 17  ? 0.065   -1.012  4.479   1.00 0.00 ? 16  ALA A H    5  
ATOM 7962  H HA   . ALA A 1 17  ? -1.155  0.502   6.685   1.00 0.00 ? 16  ALA A HA   5  
ATOM 7963  H HB1  . ALA A 1 17  ? -2.389  -1.411  5.387   1.00 0.00 ? 16  ALA A HB1  5  
ATOM 7964  H HB2  . ALA A 1 17  ? -2.264  -1.645  7.172   1.00 0.00 ? 16  ALA A HB2  5  
ATOM 7965  H HB3  . ALA A 1 17  ? -1.206  -2.528  6.007   1.00 0.00 ? 16  ALA A HB3  5  
ATOM 7966  N N    . LYS A 1 18  ? 0.842   0.377   8.083   1.00 0.00 ? 17  LYS A N    5  
ATOM 7967  C CA   . LYS A 1 18  ? 1.876   0.321   9.105   1.00 0.00 ? 17  LYS A CA   5  
ATOM 7968  C C    . LYS A 1 18  ? 1.211   0.675   10.438  1.00 0.00 ? 17  LYS A C    5  
ATOM 7969  O O    . LYS A 1 18  ? 0.480   1.650   10.482  1.00 0.00 ? 17  LYS A O    5  
ATOM 7970  C CB   . LYS A 1 18  ? 2.962   1.400   8.833   1.00 0.00 ? 17  LYS A CB   5  
ATOM 7971  C CG   . LYS A 1 18  ? 4.374   0.874   8.578   1.00 0.00 ? 17  LYS A CG   5  
ATOM 7972  C CD   . LYS A 1 18  ? 5.428   1.983   8.776   1.00 0.00 ? 17  LYS A CD   5  
ATOM 7973  C CE   . LYS A 1 18  ? 5.268   3.239   7.889   1.00 0.00 ? 17  LYS A CE   5  
ATOM 7974  N NZ   . LYS A 1 18  ? 4.357   4.240   8.476   1.00 0.00 ? 17  LYS A NZ   5  
ATOM 7975  H H    . LYS A 1 18  ? 0.386   1.270   8.003   1.00 0.00 ? 17  LYS A H    5  
ATOM 7976  H HA   . LYS A 1 18  ? 2.329   -0.660  9.115   1.00 0.00 ? 17  LYS A HA   5  
ATOM 7977  H HB2  . LYS A 1 18  ? 2.731   1.899   7.873   1.00 0.00 ? 17  LYS A HB2  5  
ATOM 7978  H HB3  . LYS A 1 18  ? 3.007   2.202   9.609   1.00 0.00 ? 17  LYS A HB3  5  
ATOM 7979  H HG2  . LYS A 1 18  ? 4.599   0.026   9.262   1.00 0.00 ? 17  LYS A HG2  5  
ATOM 7980  H HG3  . LYS A 1 18  ? 4.407   0.490   7.511   1.00 0.00 ? 17  LYS A HG3  5  
ATOM 7981  H HD2  . LYS A 1 18  ? 5.421   2.295   9.839   1.00 0.00 ? 17  LYS A HD2  5  
ATOM 7982  H HD3  . LYS A 1 18  ? 6.423   1.534   8.550   1.00 0.00 ? 17  LYS A HD3  5  
ATOM 7983  H HE2  . LYS A 1 18  ? 6.252   3.738   7.787   1.00 0.00 ? 17  LYS A HE2  5  
ATOM 7984  H HE3  . LYS A 1 18  ? 4.889   2.992   6.872   1.00 0.00 ? 17  LYS A HE3  5  
ATOM 7985  H HZ1  . LYS A 1 18  ? 4.713   4.529   9.409   1.00 0.00 ? 17  LYS A HZ1  5  
ATOM 7986  H HZ2  . LYS A 1 18  ? 3.408   3.826   8.582   1.00 0.00 ? 17  LYS A HZ2  5  
ATOM 7987  H HZ3  . LYS A 1 18  ? 4.303   5.071   7.852   1.00 0.00 ? 17  LYS A HZ3  5  
ATOM 7988  N N    . TRP A 1 19  ? 1.428   -0.012  11.586  1.00 0.00 ? 18  TRP A N    5  
ATOM 7989  C CA   . TRP A 1 19  ? 0.801   0.441   12.849  1.00 0.00 ? 18  TRP A CA   5  
ATOM 7990  C C    . TRP A 1 19  ? 1.650   1.425   13.659  1.00 0.00 ? 18  TRP A C    5  
ATOM 7991  O O    . TRP A 1 19  ? 1.238   2.524   14.018  1.00 0.00 ? 18  TRP A O    5  
ATOM 7992  C CB   . TRP A 1 19  ? 0.278   -0.742  13.700  1.00 0.00 ? 18  TRP A CB   5  
ATOM 7993  C CG   . TRP A 1 19  ? -1.038  -1.262  13.179  1.00 0.00 ? 18  TRP A CG   5  
ATOM 7994  C CD1  . TRP A 1 19  ? -1.431  -2.409  12.545  1.00 0.00 ? 18  TRP A CD1  5  
ATOM 7995  C CD2  . TRP A 1 19  ? -2.209  -0.482  13.401  1.00 0.00 ? 18  TRP A CD2  5  
ATOM 7996  N NE1  . TRP A 1 19  ? -2.804  -2.400  12.376  1.00 0.00 ? 18  TRP A NE1  5  
ATOM 7997  C CE2  . TRP A 1 19  ? -3.290  -1.222  12.922  1.00 0.00 ? 18  TRP A CE2  5  
ATOM 7998  C CE3  . TRP A 1 19  ? -2.354  0.743   13.985  1.00 0.00 ? 18  TRP A CE3  5  
ATOM 7999  C CZ2  . TRP A 1 19  ? -4.561  -0.746  13.051  1.00 0.00 ? 18  TRP A CZ2  5  
ATOM 8000  C CZ3  . TRP A 1 19  ? -3.633  1.159   14.206  1.00 0.00 ? 18  TRP A CZ3  5  
ATOM 8001  C CH2  . TRP A 1 19  ? -4.719  0.438   13.746  1.00 0.00 ? 18  TRP A CH2  5  
ATOM 8002  H H    . TRP A 1 19  ? 2.026   -0.807  11.600  1.00 0.00 ? 18  TRP A H    5  
ATOM 8003  H HA   . TRP A 1 19  ? -0.082  1.032   12.633  1.00 0.00 ? 18  TRP A HA   5  
ATOM 8004  H HB2  . TRP A 1 19  ? 0.986   -1.573  13.736  1.00 0.00 ? 18  TRP A HB2  5  
ATOM 8005  H HB3  . TRP A 1 19  ? 0.073   -0.420  14.748  1.00 0.00 ? 18  TRP A HB3  5  
ATOM 8006  H HD1  . TRP A 1 19  ? -0.760  -3.203  12.247  1.00 0.00 ? 18  TRP A HD1  5  
ATOM 8007  H HE1  . TRP A 1 19  ? -3.357  -3.125  12.021  1.00 0.00 ? 18  TRP A HE1  5  
ATOM 8008  H HE3  . TRP A 1 19  ? -1.526  1.387   14.286  1.00 0.00 ? 18  TRP A HE3  5  
ATOM 8009  H HZ2  . TRP A 1 19  ? -5.419  -1.288  12.680  1.00 0.00 ? 18  TRP A HZ2  5  
ATOM 8010  H HZ3  . TRP A 1 19  ? -3.748  2.091   14.734  1.00 0.00 ? 18  TRP A HZ3  5  
ATOM 8011  H HH2  . TRP A 1 19  ? -5.710  0.824   13.921  1.00 0.00 ? 18  TRP A HH2  5  
ATOM 8012  N N    . SER A 1 20  ? 2.890   1.026   13.955  1.00 0.00 ? 19  SER A N    5  
ATOM 8013  C CA   . SER A 1 20  ? 3.925   1.826   14.585  1.00 0.00 ? 19  SER A CA   5  
ATOM 8014  C C    . SER A 1 20  ? 5.032   1.588   13.592  1.00 0.00 ? 19  SER A C    5  
ATOM 8015  O O    . SER A 1 20  ? 4.997   0.545   12.935  1.00 0.00 ? 19  SER A O    5  
ATOM 8016  C CB   . SER A 1 20  ? 4.250   1.376   16.036  1.00 0.00 ? 19  SER A CB   5  
ATOM 8017  O OG   . SER A 1 20  ? 5.149   2.280   16.684  1.00 0.00 ? 19  SER A OG   5  
ATOM 8018  H H    . SER A 1 20  ? 3.206   0.138   13.626  1.00 0.00 ? 19  SER A H    5  
ATOM 8019  H HA   . SER A 1 20  ? 3.675   2.880   14.571  1.00 0.00 ? 19  SER A HA   5  
ATOM 8020  H HB2  . SER A 1 20  ? 3.292   1.379   16.603  1.00 0.00 ? 19  SER A HB2  5  
ATOM 8021  H HB3  . SER A 1 20  ? 4.656   0.340   16.058  1.00 0.00 ? 19  SER A HB3  5  
ATOM 8022  H HG   . SER A 1 20  ? 5.143   2.076   17.626  1.00 0.00 ? 19  SER A HG   5  
ATOM 8023  N N    . SER A 1 21  ? 6.009   2.518   13.396  1.00 0.00 ? 20  SER A N    5  
ATOM 8024  C CA   . SER A 1 21  ? 7.051   2.406   12.360  1.00 0.00 ? 20  SER A CA   5  
ATOM 8025  C C    . SER A 1 21  ? 7.942   1.171   12.453  1.00 0.00 ? 20  SER A C    5  
ATOM 8026  O O    . SER A 1 21  ? 8.741   1.002   13.368  1.00 0.00 ? 20  SER A O    5  
ATOM 8027  C CB   . SER A 1 21  ? 7.921   3.680   12.308  1.00 0.00 ? 20  SER A CB   5  
ATOM 8028  O OG   . SER A 1 21  ? 7.055   4.798   12.140  1.00 0.00 ? 20  SER A OG   5  
ATOM 8029  H H    . SER A 1 21  ? 6.021   3.371   13.914  1.00 0.00 ? 20  SER A H    5  
ATOM 8030  H HA   . SER A 1 21  ? 6.544   2.358   11.416  1.00 0.00 ? 20  SER A HA   5  
ATOM 8031  H HB2  . SER A 1 21  ? 8.498   3.799   13.254  1.00 0.00 ? 20  SER A HB2  5  
ATOM 8032  H HB3  . SER A 1 21  ? 8.626   3.642   11.448  1.00 0.00 ? 20  SER A HB3  5  
ATOM 8033  H HG   . SER A 1 21  ? 7.600   5.565   11.932  1.00 0.00 ? 20  SER A HG   5  
ATOM 8034  N N    . ASN A 1 22  ? 7.720   0.254   11.475  1.00 0.00 ? 21  ASN A N    5  
ATOM 8035  C CA   . ASN A 1 22  ? 8.225   -1.106  11.492  1.00 0.00 ? 21  ASN A CA   5  
ATOM 8036  C C    . ASN A 1 22  ? 9.467   -1.427  10.701  1.00 0.00 ? 21  ASN A C    5  
ATOM 8037  O O    . ASN A 1 22  ? 10.225  -2.327  11.044  1.00 0.00 ? 21  ASN A O    5  
ATOM 8038  C CB   . ASN A 1 22  ? 7.071   -1.945  10.827  1.00 0.00 ? 21  ASN A CB   5  
ATOM 8039  C CG   . ASN A 1 22  ? 5.848   -2.118  11.724  1.00 0.00 ? 21  ASN A CG   5  
ATOM 8040  O OD1  . ASN A 1 22  ? 4.718   -1.952  11.256  1.00 0.00 ? 21  ASN A OD1  5  
ATOM 8041  N ND2  . ASN A 1 22  ? 6.068   -2.561  12.985  1.00 0.00 ? 21  ASN A ND2  5  
ATOM 8042  H H    . ASN A 1 22  ? 7.011   0.428   10.792  1.00 0.00 ? 21  ASN A H    5  
ATOM 8043  H HA   . ASN A 1 22  ? 8.480   -1.400  12.492  1.00 0.00 ? 21  ASN A HA   5  
ATOM 8044  H HB2  . ASN A 1 22  ? 6.675   -1.391  9.928   1.00 0.00 ? 21  ASN A HB2  5  
ATOM 8045  H HB3  . ASN A 1 22  ? 7.371   -2.968  10.512  1.00 0.00 ? 21  ASN A HB3  5  
ATOM 8046  H HD21 . ASN A 1 22  ? 6.974   -2.889  13.262  1.00 0.00 ? 21  ASN A HD21 5  
ATOM 8047  H HD22 . ASN A 1 22  ? 5.270   -2.599  13.587  1.00 0.00 ? 21  ASN A HD22 5  
ATOM 8048  N N    . GLY A 1 23  ? 9.649   -0.724  9.580   1.00 0.00 ? 22  GLY A N    5  
ATOM 8049  C CA   . GLY A 1 23  ? 10.640  -0.974  8.550   1.00 0.00 ? 22  GLY A CA   5  
ATOM 8050  C C    . GLY A 1 23  ? 10.014  -1.562  7.322   1.00 0.00 ? 22  GLY A C    5  
ATOM 8051  O O    . GLY A 1 23  ? 10.577  -1.377  6.255   1.00 0.00 ? 22  GLY A O    5  
ATOM 8052  H H    . GLY A 1 23  ? 8.993   -0.009  9.360   1.00 0.00 ? 22  GLY A H    5  
ATOM 8053  H HA2  . GLY A 1 23  ? 11.100  -0.049  8.272   1.00 0.00 ? 22  GLY A HA2  5  
ATOM 8054  H HA3  . GLY A 1 23  ? 11.368  -1.701  8.889   1.00 0.00 ? 22  GLY A HA3  5  
ATOM 8055  N N    . TYR A 1 24  ? 8.801   -2.166  7.408   1.00 0.00 ? 23  TYR A N    5  
ATOM 8056  C CA   . TYR A 1 24  ? 7.874   -2.487  6.327   1.00 0.00 ? 23  TYR A CA   5  
ATOM 8057  C C    . TYR A 1 24  ? 6.418   -2.197  6.622   1.00 0.00 ? 23  TYR A C    5  
ATOM 8058  O O    . TYR A 1 24  ? 5.986   -2.226  7.773   1.00 0.00 ? 23  TYR A O    5  
ATOM 8059  C CB   . TYR A 1 24  ? 8.154   -3.734  5.465   1.00 0.00 ? 23  TYR A CB   5  
ATOM 8060  C CG   . TYR A 1 24  ? 8.655   -4.929  6.208   1.00 0.00 ? 23  TYR A CG   5  
ATOM 8061  C CD1  . TYR A 1 24  ? 7.899   -5.532  7.195   1.00 0.00 ? 23  TYR A CD1  5  
ATOM 8062  C CD2  . TYR A 1 24  ? 9.850   -5.503  5.830   1.00 0.00 ? 23  TYR A CD2  5  
ATOM 8063  C CE1  . TYR A 1 24  ? 8.326   -6.710  7.778   1.00 0.00 ? 23  TYR A CE1  5  
ATOM 8064  C CE2  . TYR A 1 24  ? 10.272  -6.684  6.405   1.00 0.00 ? 23  TYR A CE2  5  
ATOM 8065  C CZ   . TYR A 1 24  ? 9.497   -7.302  7.359   1.00 0.00 ? 23  TYR A CZ   5  
ATOM 8066  O OH   . TYR A 1 24  ? 9.870   -8.558  7.876   1.00 0.00 ? 23  TYR A OH   5  
ATOM 8067  H H    . TYR A 1 24  ? 8.396   -2.285  8.308   1.00 0.00 ? 23  TYR A H    5  
ATOM 8068  H HA   . TYR A 1 24  ? 8.038   -1.698  5.603   1.00 0.00 ? 23  TYR A HA   5  
ATOM 8069  H HB2  . TYR A 1 24  ? 7.274   -4.058  4.866   1.00 0.00 ? 23  TYR A HB2  5  
ATOM 8070  H HB3  . TYR A 1 24  ? 8.922   -3.361  4.741   1.00 0.00 ? 23  TYR A HB3  5  
ATOM 8071  H HD1  . TYR A 1 24  ? 6.949   -5.105  7.491   1.00 0.00 ? 23  TYR A HD1  5  
ATOM 8072  H HD2  . TYR A 1 24  ? 10.440  -5.044  5.047   1.00 0.00 ? 23  TYR A HD2  5  
ATOM 8073  H HE1  . TYR A 1 24  ? 7.718   -7.186  8.534   1.00 0.00 ? 23  TYR A HE1  5  
ATOM 8074  H HE2  . TYR A 1 24  ? 11.198  -7.129  6.073   1.00 0.00 ? 23  TYR A HE2  5  
ATOM 8075  H HH   . TYR A 1 24  ? 10.271  -9.092  7.163   1.00 0.00 ? 23  TYR A HH   5  
ATOM 8076  N N    . PHE A 1 25  ? 5.613   -1.886  5.563   1.00 0.00 ? 24  PHE A N    5  
ATOM 8077  C CA   . PHE A 1 25  ? 4.187   -1.568  5.602   1.00 0.00 ? 24  PHE A CA   5  
ATOM 8078  C C    . PHE A 1 25  ? 3.559   -2.672  4.766   1.00 0.00 ? 24  PHE A C    5  
ATOM 8079  O O    . PHE A 1 25  ? 4.145   -3.118  3.784   1.00 0.00 ? 24  PHE A O    5  
ATOM 8080  C CB   . PHE A 1 25  ? 3.715   -0.086  5.195   1.00 0.00 ? 24  PHE A CB   5  
ATOM 8081  C CG   . PHE A 1 25  ? 4.797   0.992   4.952   1.00 0.00 ? 24  PHE A CG   5  
ATOM 8082  C CD1  . PHE A 1 25  ? 5.971   0.990   5.692   1.00 0.00 ? 24  PHE A CD1  5  
ATOM 8083  C CD2  . PHE A 1 25  ? 4.709   1.979   3.956   1.00 0.00 ? 24  PHE A CD2  5  
ATOM 8084  C CE1  . PHE A 1 25  ? 7.043   1.784   5.452   1.00 0.00 ? 24  PHE A CE1  5  
ATOM 8085  C CE2  . PHE A 1 25  ? 5.769   2.856   3.782   1.00 0.00 ? 24  PHE A CE2  5  
ATOM 8086  C CZ   . PHE A 1 25  ? 6.934   2.738   4.498   1.00 0.00 ? 24  PHE A CZ   5  
ATOM 8087  H H    . PHE A 1 25  ? 6.008   -1.884  4.628   1.00 0.00 ? 24  PHE A H    5  
ATOM 8088  H HA   . PHE A 1 25  ? 3.782   -1.722  6.594   1.00 0.00 ? 24  PHE A HA   5  
ATOM 8089  H HB2  . PHE A 1 25  ? 3.038   -0.103  4.324   1.00 0.00 ? 24  PHE A HB2  5  
ATOM 8090  H HB3  . PHE A 1 25  ? 3.079   0.308   6.015   1.00 0.00 ? 24  PHE A HB3  5  
ATOM 8091  H HD1  . PHE A 1 25  ? 6.099   0.349   6.532   1.00 0.00 ? 24  PHE A HD1  5  
ATOM 8092  H HD2  . PHE A 1 25  ? 3.930   2.012   3.165   1.00 0.00 ? 24  PHE A HD2  5  
ATOM 8093  H HE1  . PHE A 1 25  ? 7.943   1.664   6.035   1.00 0.00 ? 24  PHE A HE1  5  
ATOM 8094  H HE2  . PHE A 1 25  ? 5.717   3.605   3.011   1.00 0.00 ? 24  PHE A HE2  5  
ATOM 8095  H HZ   . PHE A 1 25  ? 7.799   3.332   4.312   1.00 0.00 ? 24  PHE A HZ   5  
ATOM 8096  N N    . TYR A 1 26  ? 2.366   -3.094  5.223   1.00 0.00 ? 25  TYR A N    5  
ATOM 8097  C CA   . TYR A 1 26  ? 1.379   -4.089  4.851   1.00 0.00 ? 25  TYR A CA   5  
ATOM 8098  C C    . TYR A 1 26  ? 0.328   -3.450  3.969   1.00 0.00 ? 25  TYR A C    5  
ATOM 8099  O O    . TYR A 1 26  ? 0.524   -2.384  3.410   1.00 0.00 ? 25  TYR A O    5  
ATOM 8100  C CB   . TYR A 1 26  ? 0.794   -4.812  6.110   1.00 0.00 ? 25  TYR A CB   5  
ATOM 8101  C CG   . TYR A 1 26  ? 1.922   -5.223  7.031   1.00 0.00 ? 25  TYR A CG   5  
ATOM 8102  C CD1  . TYR A 1 26  ? 2.923   -6.076  6.594   1.00 0.00 ? 25  TYR A CD1  5  
ATOM 8103  C CD2  . TYR A 1 26  ? 2.017   -4.691  8.308   1.00 0.00 ? 25  TYR A CD2  5  
ATOM 8104  C CE1  . TYR A 1 26  ? 4.016   -6.349  7.395   1.00 0.00 ? 25  TYR A CE1  5  
ATOM 8105  C CE2  . TYR A 1 26  ? 3.102   -4.975  9.115   1.00 0.00 ? 25  TYR A CE2  5  
ATOM 8106  C CZ   . TYR A 1 26  ? 4.106   -5.795  8.654   1.00 0.00 ? 25  TYR A CZ   5  
ATOM 8107  O OH   . TYR A 1 26  ? 5.218   -6.060  9.480   1.00 0.00 ? 25  TYR A OH   5  
ATOM 8108  H H    . TYR A 1 26  ? 2.036   -2.629  6.050   1.00 0.00 ? 25  TYR A H    5  
ATOM 8109  H HA   . TYR A 1 26  ? 1.861   -4.786  4.169   1.00 0.00 ? 25  TYR A HA   5  
ATOM 8110  H HB2  . TYR A 1 26  ? 0.129   -4.128  6.683   1.00 0.00 ? 25  TYR A HB2  5  
ATOM 8111  H HB3  . TYR A 1 26  ? 0.231   -5.729  5.835   1.00 0.00 ? 25  TYR A HB3  5  
ATOM 8112  H HD1  . TYR A 1 26  ? 2.875   -6.497  5.599   1.00 0.00 ? 25  TYR A HD1  5  
ATOM 8113  H HD2  . TYR A 1 26  ? 1.251   -4.017  8.669   1.00 0.00 ? 25  TYR A HD2  5  
ATOM 8114  H HE1  . TYR A 1 26  ? 4.806   -6.996  7.033   1.00 0.00 ? 25  TYR A HE1  5  
ATOM 8115  H HE2  . TYR A 1 26  ? 3.161   -4.533  10.102  1.00 0.00 ? 25  TYR A HE2  5  
ATOM 8116  H HH   . TYR A 1 26  ? 5.043   -5.647  10.331  1.00 0.00 ? 25  TYR A HH   5  
ATOM 8117  N N    . SER A 1 27  ? -0.756  -4.155  3.650   1.00 0.00 ? 26  SER A N    5  
ATOM 8118  C CA   . SER A 1 27  ? -1.805  -3.740  2.726   1.00 0.00 ? 26  SER A CA   5  
ATOM 8119  C C    . SER A 1 27  ? -3.199  -3.250  3.221   1.00 0.00 ? 26  SER A C    5  
ATOM 8120  O O    . SER A 1 27  ? -3.860  -3.959  3.976   1.00 0.00 ? 26  SER A O    5  
ATOM 8121  C CB   . SER A 1 27  ? -2.059  -5.025  1.935   1.00 0.00 ? 26  SER A CB   5  
ATOM 8122  O OG   . SER A 1 27  ? -2.402  -6.153  2.747   1.00 0.00 ? 26  SER A OG   5  
ATOM 8123  H H    . SER A 1 27  ? -0.865  -5.072  4.021   1.00 0.00 ? 26  SER A H    5  
ATOM 8124  H HA   . SER A 1 27  ? -1.422  -2.972  2.064   1.00 0.00 ? 26  SER A HA   5  
ATOM 8125  H HB2  . SER A 1 27  ? -2.891  -4.811  1.251   1.00 0.00 ? 26  SER A HB2  5  
ATOM 8126  H HB3  . SER A 1 27  ? -1.120  -5.267  1.376   1.00 0.00 ? 26  SER A HB3  5  
ATOM 8127  H HG   . SER A 1 27  ? -3.137  -5.844  3.299   1.00 0.00 ? 26  SER A HG   5  
ATOM 8128  N N    . GLY A 1 28  ? -3.709  -2.067  2.749   1.00 0.00 ? 27  GLY A N    5  
ATOM 8129  C CA   . GLY A 1 28  ? -5.025  -1.499  3.101   1.00 0.00 ? 27  GLY A CA   5  
ATOM 8130  C C    . GLY A 1 28  ? -5.827  -0.846  1.972   1.00 0.00 ? 27  GLY A C    5  
ATOM 8131  O O    . GLY A 1 28  ? -5.286  -0.447  0.942   1.00 0.00 ? 27  GLY A O    5  
ATOM 8132  H H    . GLY A 1 28  ? -3.190  -1.505  2.094   1.00 0.00 ? 27  GLY A H    5  
ATOM 8133  H HA2  . GLY A 1 28  ? -5.661  -2.282  3.487   1.00 0.00 ? 27  GLY A HA2  5  
ATOM 8134  H HA3  . GLY A 1 28  ? -4.841  -0.734  3.843   1.00 0.00 ? 27  GLY A HA3  5  
ATOM 8135  N N    . LYS A 1 29  ? -7.160  -0.617  2.180   1.00 0.00 ? 28  LYS A N    5  
ATOM 8136  C CA   . LYS A 1 29  ? -8.008  0.213   1.276   1.00 0.00 ? 28  LYS A CA   5  
ATOM 8137  C C    . LYS A 1 29  ? -8.852  1.273   2.048   1.00 0.00 ? 28  LYS A C    5  
ATOM 8138  O O    . LYS A 1 29  ? -9.273  0.987   3.166   1.00 0.00 ? 28  LYS A O    5  
ATOM 8139  C CB   . LYS A 1 29  ? -8.886  -0.658  0.346   1.00 0.00 ? 28  LYS A CB   5  
ATOM 8140  C CG   . LYS A 1 29  ? -9.878  -1.591  1.056   1.00 0.00 ? 28  LYS A CG   5  
ATOM 8141  C CD   . LYS A 1 29  ? -10.556 -2.578  0.098   1.00 0.00 ? 28  LYS A CD   5  
ATOM 8142  C CE   . LYS A 1 29  ? -11.586 -3.484  0.788   1.00 0.00 ? 28  LYS A CE   5  
ATOM 8143  N NZ   . LYS A 1 29  ? -12.775 -2.707  1.205   1.00 0.00 ? 28  LYS A NZ   5  
ATOM 8144  H H    . LYS A 1 29  ? -7.605  -0.918  3.048   1.00 0.00 ? 28  LYS A H    5  
ATOM 8145  H HA   . LYS A 1 29  ? -7.377  0.780   0.608   1.00 0.00 ? 28  LYS A HA   5  
ATOM 8146  H HB2  . LYS A 1 29  ? -9.436  -0.018  -0.380  1.00 0.00 ? 28  LYS A HB2  5  
ATOM 8147  H HB3  . LYS A 1 29  ? -8.188  -1.287  -0.254  1.00 0.00 ? 28  LYS A HB3  5  
ATOM 8148  H HG2  . LYS A 1 29  ? -9.329  -2.178  1.825   1.00 0.00 ? 28  LYS A HG2  5  
ATOM 8149  H HG3  . LYS A 1 29  ? -10.648 -0.993  1.590   1.00 0.00 ? 28  LYS A HG3  5  
ATOM 8150  H HD2  . LYS A 1 29  ? -11.054 -2.023  -0.727  1.00 0.00 ? 28  LYS A HD2  5  
ATOM 8151  H HD3  . LYS A 1 29  ? -9.769  -3.222  -0.354  1.00 0.00 ? 28  LYS A HD3  5  
ATOM 8152  H HE2  . LYS A 1 29  ? -11.933 -4.275  0.091   1.00 0.00 ? 28  LYS A HE2  5  
ATOM 8153  H HE3  . LYS A 1 29  ? -11.149 -3.957  1.694   1.00 0.00 ? 28  LYS A HE3  5  
ATOM 8154  H HZ1  . LYS A 1 29  ? -12.484 -1.958  1.866   1.00 0.00 ? 28  LYS A HZ1  5  
ATOM 8155  H HZ2  . LYS A 1 29  ? -13.455 -3.339  1.675   1.00 0.00 ? 28  LYS A HZ2  5  
ATOM 8156  H HZ3  . LYS A 1 29  ? -13.221 -2.278  0.369   1.00 0.00 ? 28  LYS A HZ3  5  
ATOM 8157  N N    . ILE A 1 30  ? -9.127  2.535   1.530   1.00 0.00 ? 29  ILE A N    5  
ATOM 8158  C CA   . ILE A 1 30  ? -9.938  3.556   2.263   1.00 0.00 ? 29  ILE A CA   5  
ATOM 8159  C C    . ILE A 1 30  ? -11.392 3.644   1.831   1.00 0.00 ? 29  ILE A C    5  
ATOM 8160  O O    . ILE A 1 30  ? -11.730 3.517   0.657   1.00 0.00 ? 29  ILE A O    5  
ATOM 8161  C CB   . ILE A 1 30  ? -9.350  4.971   2.166   1.00 0.00 ? 29  ILE A CB   5  
ATOM 8162  C CG1  . ILE A 1 30  ? -7.910  4.943   2.655   1.00 0.00 ? 29  ILE A CG1  5  
ATOM 8163  C CG2  . ILE A 1 30  ? -10.056 6.103   2.944   1.00 0.00 ? 29  ILE A CG2  5  
ATOM 8164  C CD1  . ILE A 1 30  ? -7.713  4.315   4.024   1.00 0.00 ? 29  ILE A CD1  5  
ATOM 8165  H H    . ILE A 1 30  ? -8.784  2.875   0.644   1.00 0.00 ? 29  ILE A H    5  
ATOM 8166  H HA   . ILE A 1 30  ? -9.975  3.305   3.315   1.00 0.00 ? 29  ILE A HA   5  
ATOM 8167  H HB   . ILE A 1 30  ? -9.366  5.270   1.094   1.00 0.00 ? 29  ILE A HB   5  
ATOM 8168  H HG12 . ILE A 1 30  ? -7.365  4.339   1.915   1.00 0.00 ? 29  ILE A HG12 5  
ATOM 8169  H HG13 . ILE A 1 30  ? -7.492  5.972   2.662   1.00 0.00 ? 29  ILE A HG13 5  
ATOM 8170  H HG21 . ILE A 1 30  ? -9.490  7.051   2.824   1.00 0.00 ? 29  ILE A HG21 5  
ATOM 8171  H HG22 . ILE A 1 30  ? -10.101 5.876   4.023   1.00 0.00 ? 29  ILE A HG22 5  
ATOM 8172  H HG23 . ILE A 1 30  ? -11.075 6.307   2.564   1.00 0.00 ? 29  ILE A HG23 5  
ATOM 8173  H HD11 . ILE A 1 30  ? -6.685  4.519   4.394   1.00 0.00 ? 29  ILE A HD11 5  
ATOM 8174  H HD12 . ILE A 1 30  ? -7.815  3.212   3.962   1.00 0.00 ? 29  ILE A HD12 5  
ATOM 8175  H HD13 . ILE A 1 30  ? -8.446  4.709   4.758   1.00 0.00 ? 29  ILE A HD13 5  
ATOM 8176  N N    . THR A 1 31  ? -12.273 3.898   2.831   1.00 0.00 ? 30  THR A N    5  
ATOM 8177  C CA   . THR A 1 31  ? -13.719 4.030   2.680   1.00 0.00 ? 30  THR A CA   5  
ATOM 8178  C C    . THR A 1 31  ? -14.204 5.415   3.115   1.00 0.00 ? 30  THR A C    5  
ATOM 8179  O O    . THR A 1 31  ? -15.267 5.862   2.688   1.00 0.00 ? 30  THR A O    5  
ATOM 8180  C CB   . THR A 1 31  ? -14.457 2.910   3.416   1.00 0.00 ? 30  THR A CB   5  
ATOM 8181  O OG1  . THR A 1 31  ? -13.837 1.660   3.153   1.00 0.00 ? 30  THR A OG1  5  
ATOM 8182  C CG2  . THR A 1 31  ? -15.924 2.773   2.972   1.00 0.00 ? 30  THR A CG2  5  
ATOM 8183  H H    . THR A 1 31  ? -11.915 3.984   3.769   1.00 0.00 ? 30  THR A H    5  
ATOM 8184  H HA   . THR A 1 31  ? -13.986 3.949   1.632   1.00 0.00 ? 30  THR A HA   5  
ATOM 8185  H HB   . THR A 1 31  ? -14.403 3.051   4.515   1.00 0.00 ? 30  THR A HB   5  
ATOM 8186  H HG1  . THR A 1 31  ? -13.436 1.753   2.281   1.00 0.00 ? 30  THR A HG1  5  
ATOM 8187  H HG21 . THR A 1 31  ? -16.509 3.682   3.225   1.00 0.00 ? 30  THR A HG21 5  
ATOM 8188  H HG22 . THR A 1 31  ? -16.387 1.904   3.487   1.00 0.00 ? 30  THR A HG22 5  
ATOM 8189  H HG23 . THR A 1 31  ? -15.978 2.606   1.876   1.00 0.00 ? 30  THR A HG23 5  
ATOM 8190  N N    . ARG A 1 32  ? -13.442 6.159   3.982   1.00 0.00 ? 31  ARG A N    5  
ATOM 8191  C CA   . ARG A 1 32  ? -13.860 7.482   4.417   1.00 0.00 ? 31  ARG A CA   5  
ATOM 8192  C C    . ARG A 1 32  ? -12.568 8.138   4.873   1.00 0.00 ? 31  ARG A C    5  
ATOM 8193  O O    . ARG A 1 32  ? -11.600 7.430   5.130   1.00 0.00 ? 31  ARG A O    5  
ATOM 8194  C CB   . ARG A 1 32  ? -14.874 7.366   5.600   1.00 0.00 ? 31  ARG A CB   5  
ATOM 8195  C CG   . ARG A 1 32  ? -15.274 8.672   6.310   1.00 0.00 ? 31  ARG A CG   5  
ATOM 8196  C CD   . ARG A 1 32  ? -16.442 8.488   7.294   1.00 0.00 ? 31  ARG A CD   5  
ATOM 8197  N NE   . ARG A 1 32  ? -16.718 9.803   7.979   1.00 0.00 ? 31  ARG A NE   5  
ATOM 8198  C CZ   . ARG A 1 32  ? -16.054 10.233  9.098   1.00 0.00 ? 31  ARG A CZ   5  
ATOM 8199  N NH1  . ARG A 1 32  ? -15.123 9.449   9.712   1.00 0.00 ? 31  ARG A NH1  5  
ATOM 8200  N NH2  . ARG A 1 32  ? -16.328 11.472  9.605   1.00 0.00 ? 31  ARG A NH2  5  
ATOM 8201  H H    . ARG A 1 32  ? -12.549 5.903   4.409   1.00 0.00 ? 31  ARG A H    5  
ATOM 8202  H HA   . ARG A 1 32  ? -14.293 8.035   3.584   1.00 0.00 ? 31  ARG A HA   5  
ATOM 8203  H HB2  . ARG A 1 32  ? -15.799 6.903   5.191   1.00 0.00 ? 31  ARG A HB2  5  
ATOM 8204  H HB3  . ARG A 1 32  ? -14.481 6.660   6.371   1.00 0.00 ? 31  ARG A HB3  5  
ATOM 8205  H HG2  . ARG A 1 32  ? -14.394 9.048   6.878   1.00 0.00 ? 31  ARG A HG2  5  
ATOM 8206  H HG3  . ARG A 1 32  ? -15.562 9.426   5.545   1.00 0.00 ? 31  ARG A HG3  5  
ATOM 8207  H HD2  . ARG A 1 32  ? -17.361 8.200   6.740   1.00 0.00 ? 31  ARG A HD2  5  
ATOM 8208  H HD3  . ARG A 1 32  ? -16.217 7.698   8.043   1.00 0.00 ? 31  ARG A HD3  5  
ATOM 8209  H HE   . ARG A 1 32  ? -17.393 10.413  7.565   1.00 0.00 ? 31  ARG A HE   5  
ATOM 8210  H HH11 . ARG A 1 32  ? -14.916 8.541   9.346   1.00 0.00 ? 31  ARG A HH11 5  
ATOM 8211  H HH12 . ARG A 1 32  ? -14.646 9.781   10.527  1.00 0.00 ? 31  ARG A HH12 5  
ATOM 8212  H HH21 . ARG A 1 32  ? -17.006 12.055  9.157   1.00 0.00 ? 31  ARG A HH21 5  
ATOM 8213  H HH22 . ARG A 1 32  ? -15.847 11.796  10.419  1.00 0.00 ? 31  ARG A HH22 5  
ATOM 8214  N N    . ASP A 1 33  ? -12.474 9.479   5.051   1.00 0.00 ? 32  ASP A N    5  
ATOM 8215  C CA   . ASP A 1 33  ? -11.289 10.148  5.609   1.00 0.00 ? 32  ASP A CA   5  
ATOM 8216  C C    . ASP A 1 33  ? -11.587 10.584  7.047   1.00 0.00 ? 32  ASP A C    5  
ATOM 8217  O O    . ASP A 1 33  ? -12.687 11.044  7.345   1.00 0.00 ? 32  ASP A O    5  
ATOM 8218  C CB   . ASP A 1 33  ? -10.768 11.320  4.720   1.00 0.00 ? 32  ASP A CB   5  
ATOM 8219  C CG   . ASP A 1 33  ? -11.879 12.232  4.177   1.00 0.00 ? 32  ASP A CG   5  
ATOM 8220  O OD1  . ASP A 1 33  ? -12.445 13.029  4.971   1.00 0.00 ? 32  ASP A OD1  5  
ATOM 8221  O OD2  . ASP A 1 33  ? -12.164 12.147  2.951   1.00 0.00 ? 32  ASP A OD2  5  
ATOM 8222  H H    . ASP A 1 33  ? -13.243 10.091  4.881   1.00 0.00 ? 32  ASP A H    5  
ATOM 8223  H HA   . ASP A 1 33  ? -10.453 9.464   5.680   1.00 0.00 ? 32  ASP A HA   5  
ATOM 8224  H HB2  . ASP A 1 33  ? -10.008 11.931  5.253   1.00 0.00 ? 32  ASP A HB2  5  
ATOM 8225  H HB3  . ASP A 1 33  ? -10.258 10.856  3.845   1.00 0.00 ? 32  ASP A HB3  5  
ATOM 8226  N N    . VAL A 1 34  ? -10.608 10.439  7.983   1.00 0.00 ? 33  VAL A N    5  
ATOM 8227  C CA   . VAL A 1 34  ? -10.760 10.847  9.383   1.00 0.00 ? 33  VAL A CA   5  
ATOM 8228  C C    . VAL A 1 34  ? -9.907  12.102  9.527   1.00 0.00 ? 33  VAL A C    5  
ATOM 8229  O O    . VAL A 1 34  ? -8.736  12.092  9.185   1.00 0.00 ? 33  VAL A O    5  
ATOM 8230  C CB   . VAL A 1 34  ? -10.491 9.755   10.468  1.00 0.00 ? 33  VAL A CB   5  
ATOM 8231  C CG1  . VAL A 1 34  ? -11.859 9.275   10.985  1.00 0.00 ? 33  VAL A CG1  5  
ATOM 8232  C CG2  . VAL A 1 34  ? -9.692  8.523   9.990   1.00 0.00 ? 33  VAL A CG2  5  
ATOM 8233  H H    . VAL A 1 34  ? -9.708  10.096  7.722   1.00 0.00 ? 33  VAL A H    5  
ATOM 8234  H HA   . VAL A 1 34  ? -11.773 11.182  9.567   1.00 0.00 ? 33  VAL A HA   5  
ATOM 8235  H HB   . VAL A 1 34  ? -9.953  10.192  11.338  1.00 0.00 ? 33  VAL A HB   5  
ATOM 8236  H HG11 . VAL A 1 34  ? -11.728 8.545   11.810  1.00 0.00 ? 33  VAL A HG11 5  
ATOM 8237  H HG12 . VAL A 1 34  ? -12.428 8.781   10.167  1.00 0.00 ? 33  VAL A HG12 5  
ATOM 8238  H HG13 . VAL A 1 34  ? -12.456 10.125  11.373  1.00 0.00 ? 33  VAL A HG13 5  
ATOM 8239  H HG21 . VAL A 1 34  ? -10.303 7.882   9.326   1.00 0.00 ? 33  VAL A HG21 5  
ATOM 8240  H HG22 . VAL A 1 34  ? -9.299  7.852   10.785  1.00 0.00 ? 33  VAL A HG22 5  
ATOM 8241  H HG23 . VAL A 1 34  ? -8.775  8.809   9.451   1.00 0.00 ? 33  VAL A HG23 5  
ATOM 8242  N N    . GLY A 1 35  ? -10.501 13.229  9.998   1.00 0.00 ? 34  GLY A N    5  
ATOM 8243  C CA   . GLY A 1 35  ? -9.965  14.594  10.215  1.00 0.00 ? 34  GLY A CA   5  
ATOM 8244  C C    . GLY A 1 35  ? -8.698  15.118  9.533   1.00 0.00 ? 34  GLY A C    5  
ATOM 8245  O O    . GLY A 1 35  ? -8.613  15.239  8.313   1.00 0.00 ? 34  GLY A O    5  
ATOM 8246  H H    . GLY A 1 35  ? -11.462 13.141  10.235  1.00 0.00 ? 34  GLY A H    5  
ATOM 8247  H HA2  . GLY A 1 35  ? -10.749 15.262  9.883   1.00 0.00 ? 34  GLY A HA2  5  
ATOM 8248  H HA3  . GLY A 1 35  ? -9.799  14.674  11.281  1.00 0.00 ? 34  GLY A HA3  5  
ATOM 8249  N N    . ALA A 1 36  ? -7.682  15.492  10.351  1.00 0.00 ? 35  ALA A N    5  
ATOM 8250  C CA   . ALA A 1 36  ? -6.365  15.968  9.944   1.00 0.00 ? 35  ALA A CA   5  
ATOM 8251  C C    . ALA A 1 36  ? -5.313  14.908  10.159  1.00 0.00 ? 35  ALA A C    5  
ATOM 8252  O O    . ALA A 1 36  ? -4.972  14.559  11.285  1.00 0.00 ? 35  ALA A O    5  
ATOM 8253  C CB   . ALA A 1 36  ? -6.022  17.241  10.746  1.00 0.00 ? 35  ALA A CB   5  
ATOM 8254  H H    . ALA A 1 36  ? -7.788  15.397  11.336  1.00 0.00 ? 35  ALA A H    5  
ATOM 8255  H HA   . ALA A 1 36  ? -6.307  16.154  8.871   1.00 0.00 ? 35  ALA A HA   5  
ATOM 8256  H HB1  . ALA A 1 36  ? -6.015  17.028  11.840  1.00 0.00 ? 35  ALA A HB1  5  
ATOM 8257  H HB2  . ALA A 1 36  ? -6.790  18.021  10.558  1.00 0.00 ? 35  ALA A HB2  5  
ATOM 8258  H HB3  . ALA A 1 36  ? -5.035  17.655  10.455  1.00 0.00 ? 35  ALA A HB3  5  
ATOM 8259  N N    . GLY A 1 37  ? -4.753  14.386  9.037   1.00 0.00 ? 36  GLY A N    5  
ATOM 8260  C CA   . GLY A 1 37  ? -3.697  13.391  9.000   1.00 0.00 ? 36  GLY A CA   5  
ATOM 8261  C C    . GLY A 1 37  ? -4.132  11.985  9.261   1.00 0.00 ? 36  GLY A C    5  
ATOM 8262  O O    . GLY A 1 37  ? -3.333  11.191  9.745   1.00 0.00 ? 36  GLY A O    5  
ATOM 8263  H H    . GLY A 1 37  ? -5.071  14.718  8.150   1.00 0.00 ? 36  GLY A H    5  
ATOM 8264  H HA2  . GLY A 1 37  ? -3.301  13.415  8.003   1.00 0.00 ? 36  GLY A HA2  5  
ATOM 8265  H HA3  . GLY A 1 37  ? -2.961  13.621  9.760   1.00 0.00 ? 36  GLY A HA3  5  
ATOM 8266  N N    . LYS A 1 38  ? -5.415  11.651  8.998   1.00 0.00 ? 37  LYS A N    5  
ATOM 8267  C CA   . LYS A 1 38  ? -5.985  10.341  9.225   1.00 0.00 ? 37  LYS A CA   5  
ATOM 8268  C C    . LYS A 1 38  ? -6.803  9.843   8.026   1.00 0.00 ? 37  LYS A C    5  
ATOM 8269  O O    . LYS A 1 38  ? -7.216  10.594  7.143   1.00 0.00 ? 37  LYS A O    5  
ATOM 8270  C CB   . LYS A 1 38  ? -6.592  10.212  10.676  1.00 0.00 ? 37  LYS A CB   5  
ATOM 8271  C CG   . LYS A 1 38  ? -6.698  11.513  11.495  1.00 0.00 ? 37  LYS A CG   5  
ATOM 8272  C CD   . LYS A 1 38  ? -7.481  11.358  12.805  1.00 0.00 ? 37  LYS A CD   5  
ATOM 8273  C CE   . LYS A 1 38  ? -7.682  12.702  13.522  1.00 0.00 ? 37  LYS A CE   5  
ATOM 8274  N NZ   . LYS A 1 38  ? -6.386  13.296  13.928  1.00 0.00 ? 37  LYS A NZ   5  
ATOM 8275  H H    . LYS A 1 38  ? -6.077  12.301  8.634   1.00 0.00 ? 37  LYS A H    5  
ATOM 8276  H HA   . LYS A 1 38  ? -5.192  9.620   9.168   1.00 0.00 ? 37  LYS A HA   5  
ATOM 8277  H HB2  . LYS A 1 38  ? -7.566  9.692   10.704  1.00 0.00 ? 37  LYS A HB2  5  
ATOM 8278  H HB3  . LYS A 1 38  ? -5.903  9.572   11.272  1.00 0.00 ? 37  LYS A HB3  5  
ATOM 8279  H HG2  . LYS A 1 38  ? -5.667  11.859  11.740  1.00 0.00 ? 37  LYS A HG2  5  
ATOM 8280  H HG3  . LYS A 1 38  ? -7.185  12.310  10.895  1.00 0.00 ? 37  LYS A HG3  5  
ATOM 8281  H HD2  . LYS A 1 38  ? -8.482  10.923  12.585  1.00 0.00 ? 37  LYS A HD2  5  
ATOM 8282  H HD3  . LYS A 1 38  ? -6.951  10.642  13.470  1.00 0.00 ? 37  LYS A HD3  5  
ATOM 8283  H HE2  . LYS A 1 38  ? -8.186  13.423  12.845  1.00 0.00 ? 37  LYS A HE2  5  
ATOM 8284  H HE3  . LYS A 1 38  ? -8.292  12.581  14.437  1.00 0.00 ? 37  LYS A HE3  5  
ATOM 8285  H HZ1  . LYS A 1 38  ? -5.794  13.444  13.084  1.00 0.00 ? 37  LYS A HZ1  5  
ATOM 8286  H HZ2  . LYS A 1 38  ? -5.899  12.652  14.584  1.00 0.00 ? 37  LYS A HZ2  5  
ATOM 8287  H HZ3  . LYS A 1 38  ? -6.554  14.209  14.398  1.00 0.00 ? 37  LYS A HZ3  5  
ATOM 8288  N N    . TYR A 1 39  ? -7.046  8.499   7.983   1.00 0.00 ? 38  TYR A N    5  
ATOM 8289  C CA   . TYR A 1 39  ? -7.751  7.699   6.987   1.00 0.00 ? 38  TYR A CA   5  
ATOM 8290  C C    . TYR A 1 39  ? -8.659  6.638   7.661   1.00 0.00 ? 38  TYR A C    5  
ATOM 8291  O O    . TYR A 1 39  ? -8.242  6.021   8.642   1.00 0.00 ? 38  TYR A O    5  
ATOM 8292  C CB   . TYR A 1 39  ? -6.699  6.998   6.108   1.00 0.00 ? 38  TYR A CB   5  
ATOM 8293  C CG   . TYR A 1 39  ? -6.039  8.038   5.241   1.00 0.00 ? 38  TYR A CG   5  
ATOM 8294  C CD1  . TYR A 1 39  ? -6.778  8.784   4.350   1.00 0.00 ? 38  TYR A CD1  5  
ATOM 8295  C CD2  . TYR A 1 39  ? -4.711  8.351   5.423   1.00 0.00 ? 38  TYR A CD2  5  
ATOM 8296  C CE1  . TYR A 1 39  ? -6.236  9.918   3.788   1.00 0.00 ? 38  TYR A CE1  5  
ATOM 8297  C CE2  . TYR A 1 39  ? -4.117  9.435   4.803   1.00 0.00 ? 38  TYR A CE2  5  
ATOM 8298  C CZ   . TYR A 1 39  ? -4.930  10.270  4.044   1.00 0.00 ? 38  TYR A CZ   5  
ATOM 8299  O OH   . TYR A 1 39  ? -4.451  11.462  3.457   1.00 0.00 ? 38  TYR A OH   5  
ATOM 8300  H H    . TYR A 1 39  ? -6.705  7.925   8.741   1.00 0.00 ? 38  TYR A H    5  
ATOM 8301  H HA   . TYR A 1 39  ? -8.338  8.337   6.361   1.00 0.00 ? 38  TYR A HA   5  
ATOM 8302  H HB2  . TYR A 1 39  ? -5.934  6.504   6.745   1.00 0.00 ? 38  TYR A HB2  5  
ATOM 8303  H HB3  . TYR A 1 39  ? -7.161  6.252   5.447   1.00 0.00 ? 38  TYR A HB3  5  
ATOM 8304  H HD1  . TYR A 1 39  ? -7.812  8.531   4.169   1.00 0.00 ? 38  TYR A HD1  5  
ATOM 8305  H HD2  . TYR A 1 39  ? -4.154  7.729   6.102   1.00 0.00 ? 38  TYR A HD2  5  
ATOM 8306  H HE1  . TYR A 1 39  ? -6.842  10.545  3.151   1.00 0.00 ? 38  TYR A HE1  5  
ATOM 8307  H HE2  . TYR A 1 39  ? -3.045  9.605   4.945   1.00 0.00 ? 38  TYR A HE2  5  
ATOM 8308  H HH   . TYR A 1 39  ? -3.501  11.358  3.329   1.00 0.00 ? 38  TYR A HH   5  
ATOM 8309  N N    . LYS A 1 40  ? -9.940  6.379   7.202   1.00 0.00 ? 39  LYS A N    5  
ATOM 8310  C CA   . LYS A 1 40  ? -10.854 5.353   7.743   1.00 0.00 ? 39  LYS A CA   5  
ATOM 8311  C C    . LYS A 1 40  ? -10.777 4.279   6.730   1.00 0.00 ? 39  LYS A C    5  
ATOM 8312  O O    . LYS A 1 40  ? -11.094 4.416   5.538   1.00 0.00 ? 39  LYS A O    5  
ATOM 8313  C CB   . LYS A 1 40  ? -12.334 5.771   7.917   1.00 0.00 ? 39  LYS A CB   5  
ATOM 8314  C CG   . LYS A 1 40  ? -13.181 4.674   8.601   1.00 0.00 ? 39  LYS A CG   5  
ATOM 8315  C CD   . LYS A 1 40  ? -14.679 4.697   8.280   1.00 0.00 ? 39  LYS A CD   5  
ATOM 8316  C CE   . LYS A 1 40  ? -14.963 3.980   6.957   1.00 0.00 ? 39  LYS A CE   5  
ATOM 8317  N NZ   . LYS A 1 40  ? -16.396 4.052   6.597   1.00 0.00 ? 39  LYS A NZ   5  
ATOM 8318  H H    . LYS A 1 40  ? -10.386 6.803   6.389   1.00 0.00 ? 39  LYS A H    5  
ATOM 8319  H HA   . LYS A 1 40  ? -10.503 4.850   8.651   1.00 0.00 ? 39  LYS A HA   5  
ATOM 8320  H HB2  . LYS A 1 40  ? -12.385 6.700   8.528   1.00 0.00 ? 39  LYS A HB2  5  
ATOM 8321  H HB3  . LYS A 1 40  ? -12.758 6.002   6.920   1.00 0.00 ? 39  LYS A HB3  5  
ATOM 8322  H HG2  . LYS A 1 40  ? -12.827 3.661   8.308   1.00 0.00 ? 39  LYS A HG2  5  
ATOM 8323  H HG3  . LYS A 1 40  ? -13.044 4.784   9.694   1.00 0.00 ? 39  LYS A HG3  5  
ATOM 8324  H HD2  . LYS A 1 40  ? -15.232 4.159   9.084   1.00 0.00 ? 39  LYS A HD2  5  
ATOM 8325  H HD3  . LYS A 1 40  ? -15.044 5.746   8.264   1.00 0.00 ? 39  LYS A HD3  5  
ATOM 8326  H HE2  . LYS A 1 40  ? -14.379 4.459   6.142   1.00 0.00 ? 39  LYS A HE2  5  
ATOM 8327  H HE3  . LYS A 1 40  ? -14.674 2.905   7.017   1.00 0.00 ? 39  LYS A HE3  5  
ATOM 8328  H HZ1  . LYS A 1 40  ? -16.550 3.570   5.689   1.00 0.00 ? 39  LYS A HZ1  5  
ATOM 8329  H HZ2  . LYS A 1 40  ? -16.682 5.048   6.514   1.00 0.00 ? 39  LYS A HZ2  5  
ATOM 8330  H HZ3  . LYS A 1 40  ? -16.962 3.588   7.336   1.00 0.00 ? 39  LYS A HZ3  5  
ATOM 8331  N N    . LEU A 1 41  ? -10.244 3.166   7.244   1.00 0.00 ? 40  LEU A N    5  
ATOM 8332  C CA   . LEU A 1 41  ? -9.753  2.153   6.353   1.00 0.00 ? 40  LEU A CA   5  
ATOM 8333  C C    . LEU A 1 41  ? -10.231 0.809   6.666   1.00 0.00 ? 40  LEU A C    5  
ATOM 8334  O O    . LEU A 1 41  ? -10.580 0.467   7.784   1.00 0.00 ? 40  LEU A O    5  
ATOM 8335  C CB   . LEU A 1 41  ? -8.204  2.163   6.432   1.00 0.00 ? 40  LEU A CB   5  
ATOM 8336  C CG   . LEU A 1 41  ? -7.503  1.600   7.691   1.00 0.00 ? 40  LEU A CG   5  
ATOM 8337  C CD1  . LEU A 1 41  ? -8.140  1.949   9.030   1.00 0.00 ? 40  LEU A CD1  5  
ATOM 8338  C CD2  . LEU A 1 41  ? -7.168  0.099   7.545   1.00 0.00 ? 40  LEU A CD2  5  
ATOM 8339  H H    . LEU A 1 41  ? -10.057 3.061   8.249   1.00 0.00 ? 40  LEU A H    5  
ATOM 8340  H HA   . LEU A 1 41  ? -10.082 2.323   5.335   1.00 0.00 ? 40  LEU A HA   5  
ATOM 8341  H HB2  . LEU A 1 41  ? -7.775  1.662   5.533   1.00 0.00 ? 40  LEU A HB2  5  
ATOM 8342  H HB3  . LEU A 1 41  ? -7.898  3.233   6.380   1.00 0.00 ? 40  LEU A HB3  5  
ATOM 8343  H HG   . LEU A 1 41  ? -6.574  2.185   7.765   1.00 0.00 ? 40  LEU A HG   5  
ATOM 8344  H HD11 . LEU A 1 41  ? -7.456  1.704   9.862   1.00 0.00 ? 40  LEU A HD11 5  
ATOM 8345  H HD12 . LEU A 1 41  ? -9.066  1.341   9.130   1.00 0.00 ? 40  LEU A HD12 5  
ATOM 8346  H HD13 . LEU A 1 41  ? -8.376  3.048   9.091   1.00 0.00 ? 40  LEU A HD13 5  
ATOM 8347  H HD21 . LEU A 1 41  ? -6.317  -0.185  8.194   1.00 0.00 ? 40  LEU A HD21 5  
ATOM 8348  H HD22 . LEU A 1 41  ? -6.937  -0.157  6.476   1.00 0.00 ? 40  LEU A HD22 5  
ATOM 8349  H HD23 . LEU A 1 41  ? -8.037  -0.522  7.841   1.00 0.00 ? 40  LEU A HD23 5  
ATOM 8350  N N    . LEU A 1 42  ? -10.224 -0.065  5.668   1.00 0.00 ? 41  LEU A N    5  
ATOM 8351  C CA   . LEU A 1 42  ? -10.446 -1.445  5.931   1.00 0.00 ? 41  LEU A CA   5  
ATOM 8352  C C    . LEU A 1 42  ? -9.318  -2.149  5.248   1.00 0.00 ? 41  LEU A C    5  
ATOM 8353  O O    . LEU A 1 42  ? -8.866  -1.719  4.195   1.00 0.00 ? 41  LEU A O    5  
ATOM 8354  C CB   . LEU A 1 42  ? -11.951 -1.624  5.676   1.00 0.00 ? 41  LEU A CB   5  
ATOM 8355  C CG   . LEU A 1 42  ? -12.595 -2.996  5.893   1.00 0.00 ? 41  LEU A CG   5  
ATOM 8356  C CD1  . LEU A 1 42  ? -14.106 -2.906  6.181   1.00 0.00 ? 41  LEU A CD1  5  
ATOM 8357  C CD2  . LEU A 1 42  ? -12.473 -3.841  4.630   1.00 0.00 ? 41  LEU A CD2  5  
ATOM 8358  H H    . LEU A 1 42  ? -9.927  0.170   4.730   1.00 0.00 ? 41  LEU A H    5  
ATOM 8359  H HA   . LEU A 1 42  ? -10.249 -1.707  6.955   1.00 0.00 ? 41  LEU A HA   5  
ATOM 8360  H HB2  . LEU A 1 42  ? -12.328 -0.921  6.474   1.00 0.00 ? 41  LEU A HB2  5  
ATOM 8361  H HB3  . LEU A 1 42  ? -12.246 -1.211  4.690   1.00 0.00 ? 41  LEU A HB3  5  
ATOM 8362  H HG   . LEU A 1 42  ? -12.073 -3.447  6.775   1.00 0.00 ? 41  LEU A HG   5  
ATOM 8363  H HD11 . LEU A 1 42  ? -14.330 -2.147  6.951   1.00 0.00 ? 41  LEU A HD11 5  
ATOM 8364  H HD12 . LEU A 1 42  ? -14.494 -3.887  6.529   1.00 0.00 ? 41  LEU A HD12 5  
ATOM 8365  H HD13 . LEU A 1 42  ? -14.655 -2.615  5.258   1.00 0.00 ? 41  LEU A HD13 5  
ATOM 8366  H HD21 . LEU A 1 42  ? -11.423 -4.065  4.388   1.00 0.00 ? 41  LEU A HD21 5  
ATOM 8367  H HD22 . LEU A 1 42  ? -12.912 -3.291  3.771   1.00 0.00 ? 41  LEU A HD22 5  
ATOM 8368  H HD23 . LEU A 1 42  ? -13.043 -4.785  4.733   1.00 0.00 ? 41  LEU A HD23 5  
ATOM 8369  N N    . PHE A 1 43  ? -8.754  -3.263  5.778   1.00 0.00 ? 42  PHE A N    5  
ATOM 8370  C CA   . PHE A 1 43  ? -7.691  -4.013  5.060   1.00 0.00 ? 42  PHE A CA   5  
ATOM 8371  C C    . PHE A 1 43  ? -8.337  -4.766  3.889   1.00 0.00 ? 42  PHE A C    5  
ATOM 8372  O O    . PHE A 1 43  ? -9.495  -5.155  4.002   1.00 0.00 ? 42  PHE A O    5  
ATOM 8373  C CB   . PHE A 1 43  ? -6.915  -5.068  5.929   1.00 0.00 ? 42  PHE A CB   5  
ATOM 8374  C CG   . PHE A 1 43  ? -5.854  -4.476  6.843   1.00 0.00 ? 42  PHE A CG   5  
ATOM 8375  C CD1  . PHE A 1 43  ? -6.050  -3.355  7.642   1.00 0.00 ? 42  PHE A CD1  5  
ATOM 8376  C CD2  . PHE A 1 43  ? -4.623  -5.114  6.924   1.00 0.00 ? 42  PHE A CD2  5  
ATOM 8377  C CE1  . PHE A 1 43  ? -5.033  -2.862  8.442   1.00 0.00 ? 42  PHE A CE1  5  
ATOM 8378  C CE2  . PHE A 1 43  ? -3.607  -4.621  7.718   1.00 0.00 ? 42  PHE A CE2  5  
ATOM 8379  C CZ   . PHE A 1 43  ? -3.804  -3.484  8.469   1.00 0.00 ? 42  PHE A CZ   5  
ATOM 8380  H H    . PHE A 1 43  ? -9.092  -3.578  6.675   1.00 0.00 ? 42  PHE A H    5  
ATOM 8381  H HA   . PHE A 1 43  ? -6.987  -3.309  4.637   1.00 0.00 ? 42  PHE A HA   5  
ATOM 8382  H HB2  . PHE A 1 43  ? -7.627  -5.639  6.557   1.00 0.00 ? 42  PHE A HB2  5  
ATOM 8383  H HB3  . PHE A 1 43  ? -6.373  -5.792  5.259   1.00 0.00 ? 42  PHE A HB3  5  
ATOM 8384  H HD1  . PHE A 1 43  ? -7.004  -2.848  7.659   1.00 0.00 ? 42  PHE A HD1  5  
ATOM 8385  H HD2  . PHE A 1 43  ? -4.437  -6.007  6.345   1.00 0.00 ? 42  PHE A HD2  5  
ATOM 8386  H HE1  . PHE A 1 43  ? -5.199  -1.991  9.062   1.00 0.00 ? 42  PHE A HE1  5  
ATOM 8387  H HE2  . PHE A 1 43  ? -2.657  -5.139  7.761   1.00 0.00 ? 42  PHE A HE2  5  
ATOM 8388  H HZ   . PHE A 1 43  ? -3.001  -3.087  9.077   1.00 0.00 ? 42  PHE A HZ   5  
ATOM 8389  N N    . ASP A 1 44  ? -7.653  -5.030  2.735   1.00 0.00 ? 43  ASP A N    5  
ATOM 8390  C CA   . ASP A 1 44  ? -8.260  -5.697  1.552   1.00 0.00 ? 43  ASP A CA   5  
ATOM 8391  C C    . ASP A 1 44  ? -8.800  -7.138  1.764   1.00 0.00 ? 43  ASP A C    5  
ATOM 8392  O O    . ASP A 1 44  ? -9.481  -7.727  0.933   1.00 0.00 ? 43  ASP A O    5  
ATOM 8393  C CB   . ASP A 1 44  ? -7.376  -5.567  0.275   1.00 0.00 ? 43  ASP A CB   5  
ATOM 8394  C CG   . ASP A 1 44  ? -6.086  -6.392  0.311   1.00 0.00 ? 43  ASP A CG   5  
ATOM 8395  O OD1  . ASP A 1 44  ? -5.273  -6.212  1.256   1.00 0.00 ? 43  ASP A OD1  5  
ATOM 8396  O OD2  . ASP A 1 44  ? -5.903  -7.208  -0.629  1.00 0.00 ? 43  ASP A OD2  5  
ATOM 8397  H H    . ASP A 1 44  ? -6.708  -4.729  2.622   1.00 0.00 ? 43  ASP A H    5  
ATOM 8398  H HA   . ASP A 1 44  ? -9.124  -5.096  1.301   1.00 0.00 ? 43  ASP A HA   5  
ATOM 8399  H HB2  . ASP A 1 44  ? -7.969  -5.851  -0.623  1.00 0.00 ? 43  ASP A HB2  5  
ATOM 8400  H HB3  . ASP A 1 44  ? -7.098  -4.496  0.155   1.00 0.00 ? 43  ASP A HB3  5  
ATOM 8401  N N    . ASP A 1 45  ? -8.492  -7.654  2.972   1.00 0.00 ? 44  ASP A N    5  
ATOM 8402  C CA   . ASP A 1 45  ? -8.863  -8.891  3.614   1.00 0.00 ? 44  ASP A CA   5  
ATOM 8403  C C    . ASP A 1 45  ? -9.908  -8.714  4.752   1.00 0.00 ? 44  ASP A C    5  
ATOM 8404  O O    . ASP A 1 45  ? -10.354 -9.708  5.316   1.00 0.00 ? 44  ASP A O    5  
ATOM 8405  C CB   . ASP A 1 45  ? -7.547  -9.619  4.038   1.00 0.00 ? 44  ASP A CB   5  
ATOM 8406  C CG   . ASP A 1 45  ? -6.680  -8.830  5.036   1.00 0.00 ? 44  ASP A CG   5  
ATOM 8407  O OD1  . ASP A 1 45  ? -7.050  -8.767  6.238   1.00 0.00 ? 44  ASP A OD1  5  
ATOM 8408  O OD2  . ASP A 1 45  ? -5.629  -8.288  4.600   1.00 0.00 ? 44  ASP A OD2  5  
ATOM 8409  H H    . ASP A 1 45  ? -7.930  -7.067  3.541   1.00 0.00 ? 44  ASP A H    5  
ATOM 8410  H HA   . ASP A 1 45  ? -9.347  -9.530  2.884   1.00 0.00 ? 44  ASP A HA   5  
ATOM 8411  H HB2  . ASP A 1 45  ? -7.751  -10.635 4.426   1.00 0.00 ? 44  ASP A HB2  5  
ATOM 8412  H HB3  . ASP A 1 45  ? -6.942  -9.719  3.101   1.00 0.00 ? 44  ASP A HB3  5  
ATOM 8413  N N    . GLY A 1 46  ? -10.381 -7.467  5.083   1.00 0.00 ? 45  GLY A N    5  
ATOM 8414  C CA   . GLY A 1 46  ? -11.555 -7.212  5.937   1.00 0.00 ? 45  GLY A CA   5  
ATOM 8415  C C    . GLY A 1 46  ? -11.391 -6.729  7.359   1.00 0.00 ? 45  GLY A C    5  
ATOM 8416  O O    . GLY A 1 46  ? -12.344 -6.802  8.129   1.00 0.00 ? 45  GLY A O    5  
ATOM 8417  H H    . GLY A 1 46  ? -10.041 -6.633  4.613   1.00 0.00 ? 45  GLY A H    5  
ATOM 8418  H HA2  . GLY A 1 46  ? -12.060 -6.385  5.435   1.00 0.00 ? 45  GLY A HA2  5  
ATOM 8419  H HA3  . GLY A 1 46  ? -12.156 -8.120  6.035   1.00 0.00 ? 45  GLY A HA3  5  
ATOM 8420  N N    . TYR A 1 47  ? -10.215 -6.205  7.777   1.00 0.00 ? 46  TYR A N    5  
ATOM 8421  C CA   . TYR A 1 47  ? -9.976  -5.696  9.132   1.00 0.00 ? 46  TYR A CA   5  
ATOM 8422  C C    . TYR A 1 47  ? -10.094 -4.167  9.136   1.00 0.00 ? 46  TYR A C    5  
ATOM 8423  O O    . TYR A 1 47  ? -9.216  -3.475  8.627   1.00 0.00 ? 46  TYR A O    5  
ATOM 8424  C CB   . TYR A 1 47  ? -8.576  -6.190  9.634   1.00 0.00 ? 46  TYR A CB   5  
ATOM 8425  C CG   . TYR A 1 47  ? -8.311  -5.903  11.097  1.00 0.00 ? 46  TYR A CG   5  
ATOM 8426  C CD1  . TYR A 1 47  ? -8.890  -6.675  12.089  1.00 0.00 ? 46  TYR A CD1  5  
ATOM 8427  C CD2  . TYR A 1 47  ? -7.489  -4.849  11.465  1.00 0.00 ? 46  TYR A CD2  5  
ATOM 8428  C CE1  . TYR A 1 47  ? -8.666  -6.391  13.422  1.00 0.00 ? 46  TYR A CE1  5  
ATOM 8429  C CE2  . TYR A 1 47  ? -7.269  -4.558  12.798  1.00 0.00 ? 46  TYR A CE2  5  
ATOM 8430  C CZ   . TYR A 1 47  ? -7.863  -5.327  13.778  1.00 0.00 ? 46  TYR A CZ   5  
ATOM 8431  O OH   . TYR A 1 47  ? -7.657  -5.016  15.139  1.00 0.00 ? 46  TYR A OH   5  
ATOM 8432  H H    . TYR A 1 47  ? -9.452  -6.167  7.145   1.00 0.00 ? 46  TYR A H    5  
ATOM 8433  H HA   . TYR A 1 47  ? -10.723 -6.076  9.820   1.00 0.00 ? 46  TYR A HA   5  
ATOM 8434  H HB2  . TYR A 1 47  ? -8.524  -7.294  9.499   1.00 0.00 ? 46  TYR A HB2  5  
ATOM 8435  H HB3  . TYR A 1 47  ? -7.760  -5.737  9.030   1.00 0.00 ? 46  TYR A HB3  5  
ATOM 8436  H HD1  . TYR A 1 47  ? -9.529  -7.504  11.814  1.00 0.00 ? 46  TYR A HD1  5  
ATOM 8437  H HD2  . TYR A 1 47  ? -7.029  -4.240  10.696  1.00 0.00 ? 46  TYR A HD2  5  
ATOM 8438  H HE1  . TYR A 1 47  ? -9.130  -6.995  14.193  1.00 0.00 ? 46  TYR A HE1  5  
ATOM 8439  H HE2  . TYR A 1 47  ? -6.627  -3.729  13.064  1.00 0.00 ? 46  TYR A HE2  5  
ATOM 8440  H HH   . TYR A 1 47  ? -7.266  -4.140  15.174  1.00 0.00 ? 46  TYR A HH   5  
ATOM 8441  N N    . GLU A 1 48  ? -11.186 -3.584  9.710   1.00 0.00 ? 47  GLU A N    5  
ATOM 8442  C CA   . GLU A 1 48  ? -11.432 -2.132  9.767   1.00 0.00 ? 47  GLU A CA   5  
ATOM 8443  C C    . GLU A 1 48  ? -10.923 -1.418  11.006  1.00 0.00 ? 47  GLU A C    5  
ATOM 8444  O O    . GLU A 1 48  ? -10.808 -2.002  12.083  1.00 0.00 ? 47  GLU A O    5  
ATOM 8445  C CB   . GLU A 1 48  ? -12.935 -1.777  9.571   1.00 0.00 ? 47  GLU A CB   5  
ATOM 8446  C CG   . GLU A 1 48  ? -13.257 -0.264  9.416   1.00 0.00 ? 47  GLU A CG   5  
ATOM 8447  C CD   . GLU A 1 48  ? -14.523 -0.056  8.594   1.00 0.00 ? 47  GLU A CD   5  
ATOM 8448  O OE1  . GLU A 1 48  ? -15.617 -0.454  9.078   1.00 0.00 ? 47  GLU A OE1  5  
ATOM 8449  O OE2  . GLU A 1 48  ? -14.415 0.496   7.467   1.00 0.00 ? 47  GLU A OE2  5  
ATOM 8450  H H    . GLU A 1 48  ? -11.894 -4.145  10.125  1.00 0.00 ? 47  GLU A H    5  
ATOM 8451  H HA   . GLU A 1 48  ? -10.899 -1.679  8.953   1.00 0.00 ? 47  GLU A HA   5  
ATOM 8452  H HB2  . GLU A 1 48  ? -13.241 -2.303  8.645   1.00 0.00 ? 47  GLU A HB2  5  
ATOM 8453  H HB3  . GLU A 1 48  ? -13.552 -2.196  10.396  1.00 0.00 ? 47  GLU A HB3  5  
ATOM 8454  H HG2  . GLU A 1 48  ? -13.408 0.180   10.424  1.00 0.00 ? 47  GLU A HG2  5  
ATOM 8455  H HG3  . GLU A 1 48  ? -12.386 0.272   8.950   1.00 0.00 ? 47  GLU A HG3  5  
ATOM 8456  N N    . CYS A 1 49  ? -10.628 -0.092  10.854  1.00 0.00 ? 48  CYS A N    5  
ATOM 8457  C CA   . CYS A 1 49  ? -10.158 0.754   11.929  1.00 0.00 ? 48  CYS A CA   5  
ATOM 8458  C C    . CYS A 1 49  ? -10.424 2.158   11.436  1.00 0.00 ? 48  CYS A C    5  
ATOM 8459  O O    . CYS A 1 49  ? -10.837 2.347   10.287  1.00 0.00 ? 48  CYS A O    5  
ATOM 8460  C CB   . CYS A 1 49  ? -8.638  0.520   12.209  1.00 0.00 ? 48  CYS A CB   5  
ATOM 8461  S SG   . CYS A 1 49  ? -8.350  -0.677  13.550  1.00 0.00 ? 48  CYS A SG   5  
ATOM 8462  H H    . CYS A 1 49  ? -10.725 0.414   9.950   1.00 0.00 ? 48  CYS A H    5  
ATOM 8463  H HA   . CYS A 1 49  ? -10.756 0.614   12.821  1.00 0.00 ? 48  CYS A HA   5  
ATOM 8464  H HB2  . CYS A 1 49  ? -8.179  0.122   11.275  1.00 0.00 ? 48  CYS A HB2  5  
ATOM 8465  H HB3  . CYS A 1 49  ? -8.104  1.462   12.454  1.00 0.00 ? 48  CYS A HB3  5  
ATOM 8466  H HG   . CYS A 1 49  ? -9.261  -1.554  13.129  1.00 0.00 ? 48  CYS A HG   5  
ATOM 8467  N N    . ASP A 1 50  ? -10.105 3.189   12.262  1.00 0.00 ? 49  ASP A N    5  
ATOM 8468  C CA   . ASP A 1 50  ? -10.023 4.571   11.809  1.00 0.00 ? 49  ASP A CA   5  
ATOM 8469  C C    . ASP A 1 50  ? -8.638  4.808   12.299  1.00 0.00 ? 49  ASP A C    5  
ATOM 8470  O O    . ASP A 1 50  ? -8.327  4.428   13.432  1.00 0.00 ? 49  ASP A O    5  
ATOM 8471  C CB   . ASP A 1 50  ? -10.870 5.696   12.485  1.00 0.00 ? 49  ASP A CB   5  
ATOM 8472  C CG   . ASP A 1 50  ? -12.346 5.318   12.610  1.00 0.00 ? 49  ASP A CG   5  
ATOM 8473  O OD1  . ASP A 1 50  ? -12.661 4.379   13.389  1.00 0.00 ? 49  ASP A OD1  5  
ATOM 8474  O OD2  . ASP A 1 50  ? -13.183 5.982   11.941  1.00 0.00 ? 49  ASP A OD2  5  
ATOM 8475  H H    . ASP A 1 50  ? -9.682  3.051   13.165  1.00 0.00 ? 49  ASP A H    5  
ATOM 8476  H HA   . ASP A 1 50  ? -10.029 4.589   10.713  1.00 0.00 ? 49  ASP A HA   5  
ATOM 8477  H HB2  . ASP A 1 50  ? -10.462 5.996   13.484  1.00 0.00 ? 49  ASP A HB2  5  
ATOM 8478  H HB3  . ASP A 1 50  ? -10.786 6.603   11.842  1.00 0.00 ? 49  ASP A HB3  5  
ATOM 8479  N N    . VAL A 1 51  ? -7.749  5.337   11.455  1.00 0.00 ? 50  VAL A N    5  
ATOM 8480  C CA   . VAL A 1 51  ? -6.360  5.345   11.809  1.00 0.00 ? 50  VAL A CA   5  
ATOM 8481  C C    . VAL A 1 51  ? -5.660  6.532   11.239  1.00 0.00 ? 50  VAL A C    5  
ATOM 8482  O O    . VAL A 1 51  ? -6.217  7.248   10.416  1.00 0.00 ? 50  VAL A O    5  
ATOM 8483  C CB   . VAL A 1 51  ? -5.765  4.032   11.363  1.00 0.00 ? 50  VAL A CB   5  
ATOM 8484  C CG1  . VAL A 1 51  ? -5.401  4.044   9.876   1.00 0.00 ? 50  VAL A CG1  5  
ATOM 8485  C CG2  . VAL A 1 51  ? -4.679  3.553   12.326  1.00 0.00 ? 50  VAL A CG2  5  
ATOM 8486  H H    . VAL A 1 51  ? -7.934  5.642   10.510  1.00 0.00 ? 50  VAL A H    5  
ATOM 8487  H HA   . VAL A 1 51  ? -6.294  5.473   12.886  1.00 0.00 ? 50  VAL A HA   5  
ATOM 8488  H HB   . VAL A 1 51  ? -6.570  3.272   11.474  1.00 0.00 ? 50  VAL A HB   5  
ATOM 8489  H HG11 . VAL A 1 51  ? -4.455  4.591   9.674   1.00 0.00 ? 50  VAL A HG11 5  
ATOM 8490  H HG12 . VAL A 1 51  ? -6.224  4.518   9.284   1.00 0.00 ? 50  VAL A HG12 5  
ATOM 8491  H HG13 . VAL A 1 51  ? -5.294  2.987   9.559   1.00 0.00 ? 50  VAL A HG13 5  
ATOM 8492  H HG21 . VAL A 1 51  ? -4.326  2.551   12.005  1.00 0.00 ? 50  VAL A HG21 5  
ATOM 8493  H HG22 . VAL A 1 51  ? -5.165  3.454   13.328  1.00 0.00 ? 50  VAL A HG22 5  
ATOM 8494  H HG23 . VAL A 1 51  ? -3.806  4.232   12.379  1.00 0.00 ? 50  VAL A HG23 5  
ATOM 8495  N N    . LEU A 1 52  ? -4.403  6.784   11.679  1.00 0.00 ? 51  LEU A N    5  
ATOM 8496  C CA   . LEU A 1 52  ? -3.542  7.851   11.193  1.00 0.00 ? 51  LEU A CA   5  
ATOM 8497  C C    . LEU A 1 52  ? -2.868  7.627   9.847   1.00 0.00 ? 51  LEU A C    5  
ATOM 8498  O O    . LEU A 1 52  ? -2.746  6.528   9.314   1.00 0.00 ? 51  LEU A O    5  
ATOM 8499  C CB   . LEU A 1 52  ? -2.530  8.277   12.299  1.00 0.00 ? 51  LEU A CB   5  
ATOM 8500  C CG   . LEU A 1 52  ? -3.070  9.179   13.437  1.00 0.00 ? 51  LEU A CG   5  
ATOM 8501  C CD1  . LEU A 1 52  ? -3.326  10.578  12.878  1.00 0.00 ? 51  LEU A CD1  5  
ATOM 8502  C CD2  . LEU A 1 52  ? -4.325  8.671   14.167  1.00 0.00 ? 51  LEU A CD2  5  
ATOM 8503  H H    . LEU A 1 52  ? -3.985  6.170   12.343  1.00 0.00 ? 51  LEU A H    5  
ATOM 8504  H HA   . LEU A 1 52  ? -4.173  8.657   10.888  1.00 0.00 ? 51  LEU A HA   5  
ATOM 8505  H HB2  . LEU A 1 52  ? -2.095  7.361   12.745  1.00 0.00 ? 51  LEU A HB2  5  
ATOM 8506  H HB3  . LEU A 1 52  ? -1.701  8.868   11.854  1.00 0.00 ? 51  LEU A HB3  5  
ATOM 8507  H HG   . LEU A 1 52  ? -2.261  9.267   14.204  1.00 0.00 ? 51  LEU A HG   5  
ATOM 8508  H HD11 . LEU A 1 52  ? -3.689  11.269  13.667  1.00 0.00 ? 51  LEU A HD11 5  
ATOM 8509  H HD12 . LEU A 1 52  ? -4.103  10.494  12.093  1.00 0.00 ? 51  LEU A HD12 5  
ATOM 8510  H HD13 . LEU A 1 52  ? -2.415  10.996  12.402  1.00 0.00 ? 51  LEU A HD13 5  
ATOM 8511  H HD21 . LEU A 1 52  ? -5.208  8.718   13.492  1.00 0.00 ? 51  LEU A HD21 5  
ATOM 8512  H HD22 . LEU A 1 52  ? -4.535  9.314   15.050  1.00 0.00 ? 51  LEU A HD22 5  
ATOM 8513  H HD23 . LEU A 1 52  ? -4.184  7.628   14.519  1.00 0.00 ? 51  LEU A HD23 5  
ATOM 8514  N N    . GLY A 1 53  ? -2.519  8.769   9.199   1.00 0.00 ? 52  GLY A N    5  
ATOM 8515  C CA   . GLY A 1 53  ? -2.219  8.911   7.782   1.00 0.00 ? 52  GLY A CA   5  
ATOM 8516  C C    . GLY A 1 53  ? -0.778  8.813   7.405   1.00 0.00 ? 52  GLY A C    5  
ATOM 8517  O O    . GLY A 1 53  ? -0.369  8.938   6.258   1.00 0.00 ? 52  GLY A O    5  
ATOM 8518  H H    . GLY A 1 53  ? -2.676  9.659   9.660   1.00 0.00 ? 52  GLY A H    5  
ATOM 8519  H HA2  . GLY A 1 53  ? -2.892  8.197   7.329   1.00 0.00 ? 52  GLY A HA2  5  
ATOM 8520  H HA3  . GLY A 1 53  ? -2.420  9.899   7.443   1.00 0.00 ? 52  GLY A HA3  5  
ATOM 8521  N N    . LYS A 1 54  ? 0.026   8.571   8.438   1.00 0.00 ? 53  LYS A N    5  
ATOM 8522  C CA   . LYS A 1 54  ? 1.444   8.270   8.434   1.00 0.00 ? 53  LYS A CA   5  
ATOM 8523  C C    . LYS A 1 54  ? 1.555   6.782   8.858   1.00 0.00 ? 53  LYS A C    5  
ATOM 8524  O O    . LYS A 1 54  ? 2.602   6.336   9.311   1.00 0.00 ? 53  LYS A O    5  
ATOM 8525  C CB   . LYS A 1 54  ? 2.231   9.190   9.439   1.00 0.00 ? 53  LYS A CB   5  
ATOM 8526  C CG   . LYS A 1 54  ? 1.512   9.697   10.720  1.00 0.00 ? 53  LYS A CG   5  
ATOM 8527  C CD   . LYS A 1 54  ? 0.947   8.667   11.728  1.00 0.00 ? 53  LYS A CD   5  
ATOM 8528  C CE   . LYS A 1 54  ? 1.947   7.751   12.459  1.00 0.00 ? 53  LYS A CE   5  
ATOM 8529  N NZ   . LYS A 1 54  ? 2.892   8.526   13.291  1.00 0.00 ? 53  LYS A NZ   5  
ATOM 8530  H H    . LYS A 1 54  ? -0.419  8.561   9.328   1.00 0.00 ? 53  LYS A H    5  
ATOM 8531  H HA   . LYS A 1 54  ? 1.871   8.419   7.424   1.00 0.00 ? 53  LYS A HA   5  
ATOM 8532  H HB2  . LYS A 1 54  ? 3.196   8.719   9.728   1.00 0.00 ? 53  LYS A HB2  5  
ATOM 8533  H HB3  . LYS A 1 54  ? 2.509   10.109  8.871   1.00 0.00 ? 53  LYS A HB3  5  
ATOM 8534  H HG2  . LYS A 1 54  ? 2.233   10.344  11.271  1.00 0.00 ? 53  LYS A HG2  5  
ATOM 8535  H HG3  . LYS A 1 54  ? 0.677   10.364  10.406  1.00 0.00 ? 53  LYS A HG3  5  
ATOM 8536  H HD2  . LYS A 1 54  ? 0.388   9.234   12.509  1.00 0.00 ? 53  LYS A HD2  5  
ATOM 8537  H HD3  . LYS A 1 54  ? 0.217   8.014   11.205  1.00 0.00 ? 53  LYS A HD3  5  
ATOM 8538  H HE2  . LYS A 1 54  ? 1.394   7.047   13.132  1.00 0.00 ? 53  LYS A HE2  5  
ATOM 8539  H HE3  . LYS A 1 54  ? 2.536   7.141   11.748  1.00 0.00 ? 53  LYS A HE3  5  
ATOM 8540  H HZ1  . LYS A 1 54  ? 3.540   7.876   13.779  1.00 0.00 ? 53  LYS A HZ1  5  
ATOM 8541  H HZ2  . LYS A 1 54  ? 2.362   9.080   13.994  1.00 0.00 ? 53  LYS A HZ2  5  
ATOM 8542  H HZ3  . LYS A 1 54  ? 3.440   9.170   12.684  1.00 0.00 ? 53  LYS A HZ3  5  
ATOM 8543  N N    . ASP A 1 55  ? 0.434   6.009   8.776   1.00 0.00 ? 54  ASP A N    5  
ATOM 8544  C CA   . ASP A 1 55  ? 0.263   4.619   9.202   1.00 0.00 ? 54  ASP A CA   5  
ATOM 8545  C C    . ASP A 1 55  ? -0.469  3.846   8.115   1.00 0.00 ? 54  ASP A C    5  
ATOM 8546  O O    . ASP A 1 55  ? 0.143   3.082   7.367   1.00 0.00 ? 54  ASP A O    5  
ATOM 8547  C CB   . ASP A 1 55  ? -0.506  4.502   10.561  1.00 0.00 ? 54  ASP A CB   5  
ATOM 8548  C CG   . ASP A 1 55  ? 0.405   4.700   11.777  1.00 0.00 ? 54  ASP A CG   5  
ATOM 8549  O OD1  . ASP A 1 55  ? 1.645   4.529   11.652  1.00 0.00 ? 54  ASP A OD1  5  
ATOM 8550  O OD2  . ASP A 1 55  ? -0.155  5.003   12.866  1.00 0.00 ? 54  ASP A OD2  5  
ATOM 8551  H H    . ASP A 1 55  ? -0.383  6.459   8.423   1.00 0.00 ? 54  ASP A H    5  
ATOM 8552  H HA   . ASP A 1 55  ? 1.226   4.129   9.276   1.00 0.00 ? 54  ASP A HA   5  
ATOM 8553  H HB2  . ASP A 1 55  ? -1.299  5.272   10.607  1.00 0.00 ? 54  ASP A HB2  5  
ATOM 8554  H HB3  . ASP A 1 55  ? -0.997  3.513   10.690  1.00 0.00 ? 54  ASP A HB3  5  
ATOM 8555  N N    . ILE A 1 56  ? -1.819  4.006   7.976   1.00 0.00 ? 55  ILE A N    5  
ATOM 8556  C CA   . ILE A 1 56  ? -2.605  3.394   6.887   1.00 0.00 ? 55  ILE A CA   5  
ATOM 8557  C C    . ILE A 1 56  ? -3.087  4.557   6.045   1.00 0.00 ? 55  ILE A C    5  
ATOM 8558  O O    . ILE A 1 56  ? -4.002  5.292   6.393   1.00 0.00 ? 55  ILE A O    5  
ATOM 8559  C CB   . ILE A 1 56  ? -3.769  2.458   7.244   1.00 0.00 ? 55  ILE A CB   5  
ATOM 8560  C CG1  . ILE A 1 56  ? -3.457  1.176   8.075   1.00 0.00 ? 55  ILE A CG1  5  
ATOM 8561  C CG2  . ILE A 1 56  ? -4.437  1.975   5.932   1.00 0.00 ? 55  ILE A CG2  5  
ATOM 8562  C CD1  . ILE A 1 56  ? -2.568  1.274   9.318   1.00 0.00 ? 55  ILE A CD1  5  
ATOM 8563  H H    . ILE A 1 56  ? -2.309  4.635   8.581   1.00 0.00 ? 55  ILE A H    5  
ATOM 8564  H HA   . ILE A 1 56  ? -1.960  2.849   6.256   1.00 0.00 ? 55  ILE A HA   5  
ATOM 8565  H HB   . ILE A 1 56  ? -4.532  3.034   7.791   1.00 0.00 ? 55  ILE A HB   5  
ATOM 8566  H HG12 . ILE A 1 56  ? -4.439  0.778   8.414   1.00 0.00 ? 55  ILE A HG12 5  
ATOM 8567  H HG13 . ILE A 1 56  ? -3.050  0.416   7.385   1.00 0.00 ? 55  ILE A HG13 5  
ATOM 8568  H HG21 . ILE A 1 56  ? -5.072  1.093   6.135   1.00 0.00 ? 55  ILE A HG21 5  
ATOM 8569  H HG22 . ILE A 1 56  ? -3.670  1.670   5.192   1.00 0.00 ? 55  ILE A HG22 5  
ATOM 8570  H HG23 . ILE A 1 56  ? -5.084  2.763   5.496   1.00 0.00 ? 55  ILE A HG23 5  
ATOM 8571  H HD11 . ILE A 1 56  ? -2.872  2.123   9.968   1.00 0.00 ? 55  ILE A HD11 5  
ATOM 8572  H HD12 . ILE A 1 56  ? -1.504  1.406   9.035   1.00 0.00 ? 55  ILE A HD12 5  
ATOM 8573  H HD13 . ILE A 1 56  ? -2.635  0.341   9.917   1.00 0.00 ? 55  ILE A HD13 5  
ATOM 8574  N N    . LEU A 1 57  ? -2.387  4.765   4.924   1.00 0.00 ? 56  LEU A N    5  
ATOM 8575  C CA   . LEU A 1 57  ? -2.452  5.986   4.166   1.00 0.00 ? 56  LEU A CA   5  
ATOM 8576  C C    . LEU A 1 57  ? -2.587  5.897   2.705   1.00 0.00 ? 56  LEU A C    5  
ATOM 8577  O O    . LEU A 1 57  ? -2.142  4.889   2.148   1.00 0.00 ? 56  LEU A O    5  
ATOM 8578  C CB   . LEU A 1 57  ? -1.197  6.761   4.535   1.00 0.00 ? 56  LEU A CB   5  
ATOM 8579  C CG   . LEU A 1 57  ? 0.169   6.319   3.926   1.00 0.00 ? 56  LEU A CG   5  
ATOM 8580  C CD1  . LEU A 1 57  ? 0.557   4.829   3.848   1.00 0.00 ? 56  LEU A CD1  5  
ATOM 8581  C CD2  . LEU A 1 57  ? 0.305   6.849   2.502   1.00 0.00 ? 56  LEU A CD2  5  
ATOM 8582  H H    . LEU A 1 57  ? -1.647  4.131   4.690   1.00 0.00 ? 56  LEU A H    5  
ATOM 8583  H HA   . LEU A 1 57  ? -3.307  6.563   4.467   1.00 0.00 ? 56  LEU A HA   5  
ATOM 8584  H HB2  . LEU A 1 57  ? -1.337  7.839   4.275   1.00 0.00 ? 56  LEU A HB2  5  
ATOM 8585  H HB3  . LEU A 1 57  ? -1.194  6.713   5.651   1.00 0.00 ? 56  LEU A HB3  5  
ATOM 8586  H HG   . LEU A 1 57  ? 0.927   6.853   4.543   1.00 0.00 ? 56  LEU A HG   5  
ATOM 8587  H HD11 . LEU A 1 57  ? 0.852   4.423   4.833   1.00 0.00 ? 56  LEU A HD11 5  
ATOM 8588  H HD12 . LEU A 1 57  ? 1.409   4.723   3.126   1.00 0.00 ? 56  LEU A HD12 5  
ATOM 8589  H HD13 . LEU A 1 57  ? -0.239  4.202   3.414   1.00 0.00 ? 56  LEU A HD13 5  
ATOM 8590  H HD21 . LEU A 1 57  ? -0.115  6.127   1.790   1.00 0.00 ? 56  LEU A HD21 5  
ATOM 8591  H HD22 . LEU A 1 57  ? 1.310   7.017   2.088   1.00 0.00 ? 56  LEU A HD22 5  
ATOM 8592  H HD23 . LEU A 1 57  ? -0.276  7.786   2.452   1.00 0.00 ? 56  LEU A HD23 5  
ATOM 8593  N N    . LEU A 1 58  ? -3.094  7.012   2.034   1.00 0.00 ? 57  LEU A N    5  
ATOM 8594  C CA   . LEU A 1 58  ? -3.182  7.359   0.601   1.00 0.00 ? 57  LEU A CA   5  
ATOM 8595  C C    . LEU A 1 58  ? -1.857  7.235   -0.019  1.00 0.00 ? 57  LEU A C    5  
ATOM 8596  O O    . LEU A 1 58  ? -0.950  8.007   0.132   1.00 0.00 ? 57  LEU A O    5  
ATOM 8597  C CB   . LEU A 1 58  ? -3.644  8.847   0.332   1.00 0.00 ? 57  LEU A CB   5  
ATOM 8598  C CG   . LEU A 1 58  ? -2.745  10.102  0.562   1.00 0.00 ? 57  LEU A CG   5  
ATOM 8599  C CD1  . LEU A 1 58  ? -3.507  11.417  0.336   1.00 0.00 ? 57  LEU A CD1  5  
ATOM 8600  C CD2  . LEU A 1 58  ? -2.126  10.045  1.950   1.00 0.00 ? 57  LEU A CD2  5  
ATOM 8601  H H    . LEU A 1 58  ? -3.394  7.787   2.557   1.00 0.00 ? 57  LEU A H    5  
ATOM 8602  H HA   . LEU A 1 58  ? -3.827  6.649   0.093   1.00 0.00 ? 57  LEU A HA   5  
ATOM 8603  H HB2  . LEU A 1 58  ? -3.933  8.905   -0.735  1.00 0.00 ? 57  LEU A HB2  5  
ATOM 8604  H HB3  . LEU A 1 58  ? -4.536  8.994   0.972   1.00 0.00 ? 57  LEU A HB3  5  
ATOM 8605  H HG   . LEU A 1 58  ? -1.920  10.108  -0.189  1.00 0.00 ? 57  LEU A HG   5  
ATOM 8606  H HD11 . LEU A 1 58  ? -4.404  11.458  0.987   1.00 0.00 ? 57  LEU A HD11 5  
ATOM 8607  H HD12 . LEU A 1 58  ? -3.836  11.501  -0.721  1.00 0.00 ? 57  LEU A HD12 5  
ATOM 8608  H HD13 . LEU A 1 58  ? -2.855  12.287  0.569   1.00 0.00 ? 57  LEU A HD13 5  
ATOM 8609  H HD21 . LEU A 1 58  ? -1.703  11.010  2.282   1.00 0.00 ? 57  LEU A HD21 5  
ATOM 8610  H HD22 . LEU A 1 58  ? -1.307  9.290   1.960   1.00 0.00 ? 57  LEU A HD22 5  
ATOM 8611  H HD23 . LEU A 1 58  ? -2.914  9.663   2.612   1.00 0.00 ? 57  LEU A HD23 5  
ATOM 8612  N N    . CYS A 1 59  ? -1.639  6.165   -0.708  1.00 0.00 ? 58  CYS A N    5  
ATOM 8613  C CA   . CYS A 1 59  ? -0.380  5.813   -1.198  1.00 0.00 ? 58  CYS A CA   5  
ATOM 8614  C C    . CYS A 1 59  ? -0.752  5.714   -2.658  1.00 0.00 ? 58  CYS A C    5  
ATOM 8615  O O    . CYS A 1 59  ? -1.907  5.783   -3.070  1.00 0.00 ? 58  CYS A O    5  
ATOM 8616  C CB   . CYS A 1 59  ? -0.037  4.514   -0.423  1.00 0.00 ? 58  CYS A CB   5  
ATOM 8617  S SG   . CYS A 1 59  ? 1.736   4.338   -0.110  1.00 0.00 ? 58  CYS A SG   5  
ATOM 8618  H H    . CYS A 1 59  ? -2.301  5.463   -0.927  1.00 0.00 ? 58  CYS A H    5  
ATOM 8619  H HA   . CYS A 1 59  ? 0.417   6.550   -1.015  1.00 0.00 ? 58  CYS A HA   5  
ATOM 8620  H HB2  . CYS A 1 59  ? -0.508  4.579   0.581   1.00 0.00 ? 58  CYS A HB2  5  
ATOM 8621  H HB3  . CYS A 1 59  ? -0.494  3.612   -0.892  1.00 0.00 ? 58  CYS A HB3  5  
ATOM 8622  H HG   . CYS A 1 59  ? 2.151   4.588   -1.345  1.00 0.00 ? 58  CYS A HG   5  
ATOM 8623  N N    . ASP A 1 60  ? 0.223   5.485   -3.504  1.00 0.00 ? 59  ASP A N    5  
ATOM 8624  C CA   . ASP A 1 60  ? 0.028   5.043   -4.897  1.00 0.00 ? 59  ASP A CA   5  
ATOM 8625  C C    . ASP A 1 60  ? -0.484  3.540   -4.932  1.00 0.00 ? 59  ASP A C    5  
ATOM 8626  O O    . ASP A 1 60  ? -1.461  3.291   -5.633  1.00 0.00 ? 59  ASP A O    5  
ATOM 8627  C CB   . ASP A 1 60  ? 1.269   5.381   -5.798  1.00 0.00 ? 59  ASP A CB   5  
ATOM 8628  C CG   . ASP A 1 60  ? 1.666   6.852   -5.726  1.00 0.00 ? 59  ASP A CG   5  
ATOM 8629  O OD1  . ASP A 1 60  ? 0.789   7.699   -5.412  1.00 0.00 ? 59  ASP A OD1  5  
ATOM 8630  O OD2  . ASP A 1 60  ? 2.837   7.134   -6.093  1.00 0.00 ? 59  ASP A OD2  5  
ATOM 8631  H H    . ASP A 1 60  ? 1.101   5.407   -3.059  1.00 0.00 ? 59  ASP A H    5  
ATOM 8632  H HA   . ASP A 1 60  ? -0.788  5.618   -5.320  1.00 0.00 ? 59  ASP A HA   5  
ATOM 8633  H HB2  . ASP A 1 60  ? 2.154   4.730   -5.612  1.00 0.00 ? 59  ASP A HB2  5  
ATOM 8634  H HB3  . ASP A 1 60  ? 1.053   5.348   -6.863  1.00 0.00 ? 59  ASP A HB3  5  
ATOM 8635  N N    . PRO A 1 61  ? 0.046   2.517   -4.140  1.00 0.00 ? 60  PRO A N    5  
ATOM 8636  C CA   . PRO A 1 61  ? 1.042   2.632   -3.097  1.00 0.00 ? 60  PRO A CA   5  
ATOM 8637  C C    . PRO A 1 61  ? 2.346   3.147   -3.494  1.00 0.00 ? 60  PRO A C    5  
ATOM 8638  O O    . PRO A 1 61  ? 2.663   4.195   -2.962  1.00 0.00 ? 60  PRO A O    5  
ATOM 8639  C CB   . PRO A 1 61  ? 1.153   1.324   -2.316  1.00 0.00 ? 60  PRO A CB   5  
ATOM 8640  C CG   . PRO A 1 61  ? 0.408   0.351   -3.217  1.00 0.00 ? 60  PRO A CG   5  
ATOM 8641  C CD   . PRO A 1 61  ? -0.618  1.232   -3.962  1.00 0.00 ? 60  PRO A CD   5  
ATOM 8642  H HA   . PRO A 1 61  ? 0.691   3.366   -2.423  1.00 0.00 ? 60  PRO A HA   5  
ATOM 8643  H HB2  . PRO A 1 61  ? 2.192   0.979   -2.087  1.00 0.00 ? 60  PRO A HB2  5  
ATOM 8644  H HB3  . PRO A 1 61  ? 0.678   1.476   -1.318  1.00 0.00 ? 60  PRO A HB3  5  
ATOM 8645  H HG2  . PRO A 1 61  ? 1.155   -0.050  -3.937  1.00 0.00 ? 60  PRO A HG2  5  
ATOM 8646  H HG3  . PRO A 1 61  ? -0.021  -0.477  -2.629  1.00 0.00 ? 60  PRO A HG3  5  
ATOM 8647  H HD2  . PRO A 1 61  ? -0.952  0.787   -4.912  1.00 0.00 ? 60  PRO A HD2  5  
ATOM 8648  H HD3  . PRO A 1 61  ? -1.505  1.380   -3.305  1.00 0.00 ? 60  PRO A HD3  5  
ATOM 8649  N N    . ILE A 1 62  ? 3.151   2.510   -4.330  1.00 0.00 ? 61  ILE A N    5  
ATOM 8650  C CA   . ILE A 1 62  ? 4.498   2.997   -4.532  1.00 0.00 ? 61  ILE A CA   5  
ATOM 8651  C C    . ILE A 1 62  ? 4.702   3.195   -5.991  1.00 0.00 ? 61  ILE A C    5  
ATOM 8652  O O    . ILE A 1 62  ? 3.921   2.625   -6.755  1.00 0.00 ? 61  ILE A O    5  
ATOM 8653  C CB   . ILE A 1 62  ? 5.429   2.052   -3.817  1.00 0.00 ? 61  ILE A CB   5  
ATOM 8654  C CG1  . ILE A 1 62  ? 5.217   2.311   -2.319  1.00 0.00 ? 61  ILE A CG1  5  
ATOM 8655  C CG2  . ILE A 1 62  ? 6.948   2.214   -4.043  1.00 0.00 ? 61  ILE A CG2  5  
ATOM 8656  C CD1  . ILE A 1 62  ? 5.828   3.573   -1.719  1.00 0.00 ? 61  ILE A CD1  5  
ATOM 8657  H H    . ILE A 1 62  ? 2.893   1.651   -4.763  1.00 0.00 ? 61  ILE A H    5  
ATOM 8658  H HA   . ILE A 1 62  ? 4.634   3.960   -4.082  1.00 0.00 ? 61  ILE A HA   5  
ATOM 8659  H HB   . ILE A 1 62  ? 5.114   1.002   -4.072  1.00 0.00 ? 61  ILE A HB   5  
ATOM 8660  H HG12 . ILE A 1 62  ? 4.172   2.447   -1.992  1.00 0.00 ? 61  ILE A HG12 5  
ATOM 8661  H HG13 . ILE A 1 62  ? 5.628   1.410   -1.834  1.00 0.00 ? 61  ILE A HG13 5  
ATOM 8662  H HG21 . ILE A 1 62  ? 7.451   1.512   -3.346  1.00 0.00 ? 61  ILE A HG21 5  
ATOM 8663  H HG22 . ILE A 1 62  ? 7.286   3.207   -3.686  1.00 0.00 ? 61  ILE A HG22 5  
ATOM 8664  H HG23 . ILE A 1 62  ? 7.260   2.065   -5.103  1.00 0.00 ? 61  ILE A HG23 5  
ATOM 8665  H HD11 . ILE A 1 62  ? 5.112   4.082   -1.040  1.00 0.00 ? 61  ILE A HD11 5  
ATOM 8666  H HD12 . ILE A 1 62  ? 6.178   4.294   -2.477  1.00 0.00 ? 61  ILE A HD12 5  
ATOM 8667  H HD13 . ILE A 1 62  ? 6.686   3.242   -1.117  1.00 0.00 ? 61  ILE A HD13 5  
ATOM 8668  N N    . PRO A 1 63  ? 5.695   3.995   -6.446  1.00 0.00 ? 62  PRO A N    5  
ATOM 8669  C CA   . PRO A 1 63  ? 5.845   4.465   -7.806  1.00 0.00 ? 62  PRO A CA   5  
ATOM 8670  C C    . PRO A 1 63  ? 5.804   3.403   -8.907  1.00 0.00 ? 62  PRO A C    5  
ATOM 8671  O O    . PRO A 1 63  ? 6.772   2.672   -9.041  1.00 0.00 ? 62  PRO A O    5  
ATOM 8672  C CB   . PRO A 1 63  ? 7.371   4.825   -7.619  1.00 0.00 ? 62  PRO A CB   5  
ATOM 8673  C CG   . PRO A 1 63  ? 7.608   5.356   -6.207  1.00 0.00 ? 62  PRO A CG   5  
ATOM 8674  C CD   . PRO A 1 63  ? 6.288   5.027   -5.576  1.00 0.00 ? 62  PRO A CD   5  
ATOM 8675  H HA   . PRO A 1 63  ? 5.160   5.269   -8.032  1.00 0.00 ? 62  PRO A HA   5  
ATOM 8676  H HB2  . PRO A 1 63  ? 7.990   3.884   -7.480  1.00 0.00 ? 62  PRO A HB2  5  
ATOM 8677  H HB3  . PRO A 1 63  ? 7.794   5.452   -8.422  1.00 0.00 ? 62  PRO A HB3  5  
ATOM 8678  H HG2  . PRO A 1 63  ? 8.417   4.770   -5.710  1.00 0.00 ? 62  PRO A HG2  5  
ATOM 8679  H HG3  . PRO A 1 63  ? 7.896   6.415   -6.152  1.00 0.00 ? 62  PRO A HG3  5  
ATOM 8680  H HD2  . PRO A 1 63  ? 6.421   4.779   -4.507  1.00 0.00 ? 62  PRO A HD2  5  
ATOM 8681  H HD3  . PRO A 1 63  ? 5.638   5.929   -5.655  1.00 0.00 ? 62  PRO A HD3  5  
ATOM 8682  N N    . LEU A 1 64  ? 4.686   3.272   -9.708  1.00 0.00 ? 63  LEU A N    5  
ATOM 8683  C CA   . LEU A 1 64  ? 4.334   2.304   -10.790 1.00 0.00 ? 63  LEU A CA   5  
ATOM 8684  C C    . LEU A 1 64  ? 5.308   1.796   -11.837 1.00 0.00 ? 63  LEU A C    5  
ATOM 8685  O O    . LEU A 1 64  ? 4.955   1.315   -12.898 1.00 0.00 ? 63  LEU A O    5  
ATOM 8686  C CB   . LEU A 1 64  ? 2.866   2.368   -11.266 1.00 0.00 ? 63  LEU A CB   5  
ATOM 8687  C CG   . LEU A 1 64  ? 2.405   3.494   -12.215 1.00 0.00 ? 63  LEU A CG   5  
ATOM 8688  C CD1  . LEU A 1 64  ? 2.696   4.899   -11.659 1.00 0.00 ? 63  LEU A CD1  5  
ATOM 8689  C CD2  . LEU A 1 64  ? 2.875   3.292   -13.671 1.00 0.00 ? 63  LEU A CD2  5  
ATOM 8690  H H    . LEU A 1 64  ? 3.889   3.866   -9.529  1.00 0.00 ? 63  LEU A H    5  
ATOM 8691  H HA   . LEU A 1 64  ? 4.327   1.381   -10.232 1.00 0.00 ? 63  LEU A HA   5  
ATOM 8692  H HB2  . LEU A 1 64  ? 2.565   1.396   -11.721 1.00 0.00 ? 63  LEU A HB2  5  
ATOM 8693  H HB3  . LEU A 1 64  ? 2.283   2.479   -10.328 1.00 0.00 ? 63  LEU A HB3  5  
ATOM 8694  H HG   . LEU A 1 64  ? 1.292   3.388   -12.230 1.00 0.00 ? 63  LEU A HG   5  
ATOM 8695  H HD11 . LEU A 1 64  ? 3.788   5.085   -11.607 1.00 0.00 ? 63  LEU A HD11 5  
ATOM 8696  H HD12 . LEU A 1 64  ? 2.254   5.012   -10.640 1.00 0.00 ? 63  LEU A HD12 5  
ATOM 8697  H HD13 . LEU A 1 64  ? 2.242   5.668   -12.318 1.00 0.00 ? 63  LEU A HD13 5  
ATOM 8698  H HD21 . LEU A 1 64  ? 2.739   2.227   -13.980 1.00 0.00 ? 63  LEU A HD21 5  
ATOM 8699  H HD22 . LEU A 1 64  ? 3.956   3.521   -13.768 1.00 0.00 ? 63  LEU A HD22 5  
ATOM 8700  H HD23 . LEU A 1 64  ? 2.307   3.942   -14.365 1.00 0.00 ? 63  LEU A HD23 5  
ATOM 8701  N N    . ASP A 1 65  ? 6.568   2.020   -11.554 1.00 0.00 ? 64  ASP A N    5  
ATOM 8702  C CA   . ASP A 1 65  ? 7.784   1.801   -12.294 1.00 0.00 ? 64  ASP A CA   5  
ATOM 8703  C C    . ASP A 1 65  ? 8.911   1.117   -11.521 1.00 0.00 ? 64  ASP A C    5  
ATOM 8704  O O    . ASP A 1 65  ? 10.015  0.980   -12.031 1.00 0.00 ? 64  ASP A O    5  
ATOM 8705  C CB   . ASP A 1 65  ? 8.297   3.278   -12.395 1.00 0.00 ? 64  ASP A CB   5  
ATOM 8706  C CG   . ASP A 1 65  ? 7.770   3.936   -13.669 1.00 0.00 ? 64  ASP A CG   5  
ATOM 8707  O OD1  . ASP A 1 65  ? 8.186   3.497   -14.774 1.00 0.00 ? 64  ASP A OD1  5  
ATOM 8708  O OD2  . ASP A 1 65  ? 6.945   4.882   -13.554 1.00 0.00 ? 64  ASP A OD2  5  
ATOM 8709  H H    . ASP A 1 65  ? 6.629   2.395   -10.616 1.00 0.00 ? 64  ASP A H    5  
ATOM 8710  H HA   . ASP A 1 65  ? 7.632   1.295   -13.239 1.00 0.00 ? 64  ASP A HA   5  
ATOM 8711  H HB2  . ASP A 1 65  ? 7.885   3.825   -11.500 1.00 0.00 ? 64  ASP A HB2  5  
ATOM 8712  H HB3  . ASP A 1 65  ? 9.394   3.410   -12.314 1.00 0.00 ? 64  ASP A HB3  5  
ATOM 8713  N N    . THR A 1 66  ? 8.717   1.016   -10.192 1.00 0.00 ? 65  THR A N    5  
ATOM 8714  C CA   . THR A 1 66  ? 9.706   0.932   -9.160  1.00 0.00 ? 65  THR A CA   5  
ATOM 8715  C C    . THR A 1 66  ? 9.644   -0.289  -8.404  1.00 0.00 ? 65  THR A C    5  
ATOM 8716  O O    . THR A 1 66  ? 8.602   -0.847  -8.125  1.00 0.00 ? 65  THR A O    5  
ATOM 8717  C CB   . THR A 1 66  ? 9.654   2.148   -8.229  1.00 0.00 ? 65  THR A CB   5  
ATOM 8718  O OG1  . THR A 1 66  ? 9.677   3.308   -9.046  1.00 0.00 ? 65  THR A OG1  5  
ATOM 8719  C CG2  . THR A 1 66  ? 10.783  2.364   -7.200  1.00 0.00 ? 65  THR A CG2  5  
ATOM 8720  H H    . THR A 1 66  ? 7.818   0.830   -9.821  1.00 0.00 ? 65  THR A H    5  
ATOM 8721  H HA   . THR A 1 66  ? 10.664  0.882   -9.634  1.00 0.00 ? 65  THR A HA   5  
ATOM 8722  H HB   . THR A 1 66  ? 8.685   2.093   -7.668  1.00 0.00 ? 65  THR A HB   5  
ATOM 8723  H HG1  . THR A 1 66  ? 8.982   3.139   -9.694  1.00 0.00 ? 65  THR A HG1  5  
ATOM 8724  H HG21 . THR A 1 66  ? 11.777  2.305   -7.687  1.00 0.00 ? 65  THR A HG21 5  
ATOM 8725  H HG22 . THR A 1 66  ? 10.716  1.625   -6.377  1.00 0.00 ? 65  THR A HG22 5  
ATOM 8726  H HG23 . THR A 1 66  ? 10.674  3.370   -6.737  1.00 0.00 ? 65  THR A HG23 5  
ATOM 8727  N N    . GLU A 1 67  ? 10.808  -0.574  -7.861  1.00 0.00 ? 66  GLU A N    5  
ATOM 8728  C CA   . GLU A 1 67  ? 11.244  -1.560  -6.915  1.00 0.00 ? 66  GLU A CA   5  
ATOM 8729  C C    . GLU A 1 67  ? 10.494  -1.365  -5.610  1.00 0.00 ? 66  GLU A C    5  
ATOM 8730  O O    . GLU A 1 67  ? 10.422  -0.284  -5.018  1.00 0.00 ? 66  GLU A O    5  
ATOM 8731  C CB   . GLU A 1 67  ? 12.775  -1.447  -6.686  1.00 0.00 ? 66  GLU A CB   5  
ATOM 8732  C CG   . GLU A 1 67  ? 13.454  -2.668  -6.024  1.00 0.00 ? 66  GLU A CG   5  
ATOM 8733  C CD   . GLU A 1 67  ? 13.565  -3.839  -7.004  1.00 0.00 ? 66  GLU A CD   5  
ATOM 8734  O OE1  . GLU A 1 67  ? 14.045  -3.619  -8.149  1.00 0.00 ? 66  GLU A OE1  5  
ATOM 8735  O OE2  . GLU A 1 67  ? 13.196  -4.978  -6.612  1.00 0.00 ? 66  GLU A OE2  5  
ATOM 8736  H H    . GLU A 1 67  ? 11.441  0.083   -8.174  1.00 0.00 ? 66  GLU A H    5  
ATOM 8737  H HA   . GLU A 1 67  ? 11.024  -2.531  -7.313  1.00 0.00 ? 66  GLU A HA   5  
ATOM 8738  H HB2  . GLU A 1 67  ? 13.265  -1.276  -7.670  1.00 0.00 ? 66  GLU A HB2  5  
ATOM 8739  H HB3  . GLU A 1 67  ? 13.006  -0.546  -6.074  1.00 0.00 ? 66  GLU A HB3  5  
ATOM 8740  H HG2  . GLU A 1 67  ? 14.485  -2.385  -5.717  1.00 0.00 ? 66  GLU A HG2  5  
ATOM 8741  H HG3  . GLU A 1 67  ? 12.902  -2.979  -5.114  1.00 0.00 ? 66  GLU A HG3  5  
ATOM 8742  N N    . VAL A 1 68  ? 9.887   -2.482  -5.209  1.00 0.00 ? 67  VAL A N    5  
ATOM 8743  C CA   . VAL A 1 68  ? 9.000   -2.759  -4.079  1.00 0.00 ? 67  VAL A CA   5  
ATOM 8744  C C    . VAL A 1 68  ? 9.078   -4.220  -3.870  1.00 0.00 ? 67  VAL A C    5  
ATOM 8745  O O    . VAL A 1 68  ? 9.799   -4.947  -4.546  1.00 0.00 ? 67  VAL A O    5  
ATOM 8746  C CB   . VAL A 1 68  ? 7.562   -2.263  -3.990  1.00 0.00 ? 67  VAL A CB   5  
ATOM 8747  C CG1  . VAL A 1 68  ? 7.454   -1.377  -2.750  1.00 0.00 ? 67  VAL A CG1  5  
ATOM 8748  C CG2  . VAL A 1 68  ? 7.186   -1.397  -5.179  1.00 0.00 ? 67  VAL A CG2  5  
ATOM 8749  H H    . VAL A 1 68  ? 10.071  -3.245  -5.842  1.00 0.00 ? 67  VAL A H    5  
ATOM 8750  H HA   . VAL A 1 68  ? 9.445   -2.390  -3.165  1.00 0.00 ? 67  VAL A HA   5  
ATOM 8751  H HB   . VAL A 1 68  ? 6.832   -3.102  -3.804  1.00 0.00 ? 67  VAL A HB   5  
ATOM 8752  H HG11 . VAL A 1 68  ? 6.386   -1.108  -2.589  1.00 0.00 ? 67  VAL A HG11 5  
ATOM 8753  H HG12 . VAL A 1 68  ? 8.066   -0.459  -2.860  1.00 0.00 ? 67  VAL A HG12 5  
ATOM 8754  H HG13 . VAL A 1 68  ? 7.770   -1.946  -1.849  1.00 0.00 ? 67  VAL A HG13 5  
ATOM 8755  H HG21 . VAL A 1 68  ? 7.418   -1.930  -6.123  1.00 0.00 ? 67  VAL A HG21 5  
ATOM 8756  H HG22 . VAL A 1 68  ? 7.766   -0.449  -5.183  1.00 0.00 ? 67  VAL A HG22 5  
ATOM 8757  H HG23 . VAL A 1 68  ? 6.107   -1.138  -5.131  1.00 0.00 ? 67  VAL A HG23 5  
ATOM 8758  N N    . THR A 1 69  ? 8.420   -4.690  -2.801  1.00 0.00 ? 68  THR A N    5  
ATOM 8759  C CA   . THR A 1 69  ? 8.512   -6.103  -2.445  1.00 0.00 ? 68  THR A CA   5  
ATOM 8760  C C    . THR A 1 69  ? 7.186   -6.818  -2.593  1.00 0.00 ? 68  THR A C    5  
ATOM 8761  O O    . THR A 1 69  ? 6.104   -6.231  -2.578  1.00 0.00 ? 68  THR A O    5  
ATOM 8762  C CB   . THR A 1 69  ? 9.202   -6.267  -1.099  1.00 0.00 ? 68  THR A CB   5  
ATOM 8763  O OG1  . THR A 1 69  ? 9.537   -7.610  -0.763  1.00 0.00 ? 68  THR A OG1  5  
ATOM 8764  C CG2  . THR A 1 69  ? 8.264   -5.671  -0.066  1.00 0.00 ? 68  THR A CG2  5  
ATOM 8765  H H    . THR A 1 69  ? 7.784   -4.083  -2.256  1.00 0.00 ? 68  THR A H    5  
ATOM 8766  H HA   . THR A 1 69  ? 9.131   -6.631  -3.135  1.00 0.00 ? 68  THR A HA   5  
ATOM 8767  H HB   . THR A 1 69  ? 10.148  -5.672  -1.123  1.00 0.00 ? 68  THR A HB   5  
ATOM 8768  H HG1  . THR A 1 69  ? 9.704   -7.626  0.187   1.00 0.00 ? 68  THR A HG1  5  
ATOM 8769  H HG21 . THR A 1 69  ? 7.510   -6.445  0.222   1.00 0.00 ? 68  THR A HG21 5  
ATOM 8770  H HG22 . THR A 1 69  ? 7.732   -4.795  -0.552  1.00 0.00 ? 68  THR A HG22 5  
ATOM 8771  H HG23 . THR A 1 69  ? 8.807   -5.342  0.841   1.00 0.00 ? 68  THR A HG23 5  
ATOM 8772  N N    . ALA A 1 70  ? 7.271   -8.158  -2.733  1.00 0.00 ? 69  ALA A N    5  
ATOM 8773  C CA   . ALA A 1 70  ? 6.157   -9.066  -2.840  1.00 0.00 ? 69  ALA A CA   5  
ATOM 8774  C C    . ALA A 1 70  ? 5.994   -9.758  -1.500  1.00 0.00 ? 69  ALA A C    5  
ATOM 8775  O O    . ALA A 1 70  ? 6.961   -10.090 -0.819  1.00 0.00 ? 69  ALA A O    5  
ATOM 8776  C CB   . ALA A 1 70  ? 6.415   -10.053 -3.982  1.00 0.00 ? 69  ALA A CB   5  
ATOM 8777  H H    . ALA A 1 70  ? 8.170   -8.602  -2.704  1.00 0.00 ? 69  ALA A H    5  
ATOM 8778  H HA   . ALA A 1 70  ? 5.241   -8.527  -3.047  1.00 0.00 ? 69  ALA A HA   5  
ATOM 8779  H HB1  . ALA A 1 70  ? 5.572   -10.761 -4.127  1.00 0.00 ? 69  ALA A HB1  5  
ATOM 8780  H HB2  . ALA A 1 70  ? 7.346   -10.633 -3.804  1.00 0.00 ? 69  ALA A HB2  5  
ATOM 8781  H HB3  . ALA A 1 70  ? 6.551   -9.483  -4.926  1.00 0.00 ? 69  ALA A HB3  5  
ATOM 8782  N N    . LEU A 1 71  ? 4.731   -9.953  -1.055  1.00 0.00 ? 70  LEU A N    5  
ATOM 8783  C CA   . LEU A 1 71  ? 4.444   -10.508 0.263   1.00 0.00 ? 70  LEU A CA   5  
ATOM 8784  C C    . LEU A 1 71  ? 4.158   -11.989 0.249   1.00 0.00 ? 70  LEU A C    5  
ATOM 8785  O O    . LEU A 1 71  ? 3.157   -12.503 -0.242  1.00 0.00 ? 70  LEU A O    5  
ATOM 8786  C CB   . LEU A 1 71  ? 3.504   -9.651  1.147   1.00 0.00 ? 70  LEU A CB   5  
ATOM 8787  C CG   . LEU A 1 71  ? 3.976   -9.423  2.622   1.00 0.00 ? 70  LEU A CG   5  
ATOM 8788  C CD1  . LEU A 1 71  ? 3.564   -10.514 3.604   1.00 0.00 ? 70  LEU A CD1  5  
ATOM 8789  C CD2  . LEU A 1 71  ? 5.483   -9.173  2.823   1.00 0.00 ? 70  LEU A CD2  5  
ATOM 8790  H H    . LEU A 1 71  ? 3.957   -9.670  -1.637  1.00 0.00 ? 70  LEU A H    5  
ATOM 8791  H HA   . LEU A 1 71  ? 5.361   -10.455 0.819   1.00 0.00 ? 70  LEU A HA   5  
ATOM 8792  H HB2  . LEU A 1 71  ? 3.471   -8.640  0.677   1.00 0.00 ? 70  LEU A HB2  5  
ATOM 8793  H HB3  . LEU A 1 71  ? 2.460   -10.038 1.143   1.00 0.00 ? 70  LEU A HB3  5  
ATOM 8794  H HG   . LEU A 1 71  ? 3.450   -8.497  2.955   1.00 0.00 ? 70  LEU A HG   5  
ATOM 8795  H HD11 . LEU A 1 71  ? 2.471   -10.687 3.558   1.00 0.00 ? 70  LEU A HD11 5  
ATOM 8796  H HD12 . LEU A 1 71  ? 3.858   -10.189 4.627   1.00 0.00 ? 70  LEU A HD12 5  
ATOM 8797  H HD13 . LEU A 1 71  ? 4.105   -11.451 3.361   1.00 0.00 ? 70  LEU A HD13 5  
ATOM 8798  H HD21 . LEU A 1 71  ? 5.667   -8.668  3.795   1.00 0.00 ? 70  LEU A HD21 5  
ATOM 8799  H HD22 . LEU A 1 71  ? 5.899   -8.553  2.003   1.00 0.00 ? 70  LEU A HD22 5  
ATOM 8800  H HD23 . LEU A 1 71  ? 6.042   -10.132 2.828   1.00 0.00 ? 70  LEU A HD23 5  
ATOM 8801  N N    . SER A 1 72  ? 5.162   -12.664 0.818   1.00 0.00 ? 71  SER A N    5  
ATOM 8802  C CA   . SER A 1 72  ? 5.419   -14.037 1.139   1.00 0.00 ? 71  SER A CA   5  
ATOM 8803  C C    . SER A 1 72  ? 6.016   -13.768 2.508   1.00 0.00 ? 71  SER A C    5  
ATOM 8804  O O    . SER A 1 72  ? 6.265   -12.601 2.808   1.00 0.00 ? 71  SER A O    5  
ATOM 8805  C CB   . SER A 1 72  ? 6.383   -14.716 0.126   1.00 0.00 ? 71  SER A CB   5  
ATOM 8806  O OG   . SER A 1 72  ? 6.422   -16.130 0.311   1.00 0.00 ? 71  SER A OG   5  
ATOM 8807  H H    . SER A 1 72  ? 5.883   -12.103 1.237   1.00 0.00 ? 71  SER A H    5  
ATOM 8808  H HA   . SER A 1 72  ? 4.482   -14.570 1.241   1.00 0.00 ? 71  SER A HA   5  
ATOM 8809  H HB2  . SER A 1 72  ? 5.996   -14.518 -0.900  1.00 0.00 ? 71  SER A HB2  5  
ATOM 8810  H HB3  . SER A 1 72  ? 7.403   -14.280 0.181   1.00 0.00 ? 71  SER A HB3  5  
ATOM 8811  H HG   . SER A 1 72  ? 7.301   -16.441 0.060   1.00 0.00 ? 71  SER A HG   5  
ATOM 8812  N N    . GLU A 1 73  ? 6.239   -14.737 3.409   1.00 0.00 ? 72  GLU A N    5  
ATOM 8813  C CA   . GLU A 1 73  ? 6.784   -14.537 4.764   1.00 0.00 ? 72  GLU A CA   5  
ATOM 8814  C C    . GLU A 1 73  ? 7.925   -13.513 5.048   1.00 0.00 ? 72  GLU A C    5  
ATOM 8815  O O    . GLU A 1 73  ? 8.760   -13.157 4.216   1.00 0.00 ? 72  GLU A O    5  
ATOM 8816  C CB   . GLU A 1 73  ? 7.216   -15.886 5.375   1.00 0.00 ? 72  GLU A CB   5  
ATOM 8817  C CG   . GLU A 1 73  ? 7.341   -17.046 4.379   1.00 0.00 ? 72  GLU A CG   5  
ATOM 8818  C CD   . GLU A 1 73  ? 6.014   -17.729 4.060   1.00 0.00 ? 72  GLU A CD   5  
ATOM 8819  O OE1  . GLU A 1 73  ? 5.323   -18.163 5.021   1.00 0.00 ? 72  GLU A OE1  5  
ATOM 8820  O OE2  . GLU A 1 73  ? 5.675   -17.837 2.851   1.00 0.00 ? 72  GLU A OE2  5  
ATOM 8821  H H    . GLU A 1 73  ? 6.010   -15.676 3.163   1.00 0.00 ? 72  GLU A H    5  
ATOM 8822  H HA   . GLU A 1 73  ? 5.938   -14.190 5.345   1.00 0.00 ? 72  GLU A HA   5  
ATOM 8823  H HB2  . GLU A 1 73  ? 8.263   -15.829 5.766   1.00 0.00 ? 72  GLU A HB2  5  
ATOM 8824  H HB3  . GLU A 1 73  ? 6.559   -16.159 6.225   1.00 0.00 ? 72  GLU A HB3  5  
ATOM 8825  H HG2  . GLU A 1 73  ? 7.872   -16.667 3.470   1.00 0.00 ? 72  GLU A HG2  5  
ATOM 8826  H HG3  . GLU A 1 73  ? 8.001   -17.756 4.914   1.00 0.00 ? 72  GLU A HG3  5  
ATOM 8827  N N    . ASP A 1 74  ? 7.933   -13.039 6.311   1.00 0.00 ? 73  ASP A N    5  
ATOM 8828  C CA   . ASP A 1 74  ? 8.678   -11.903 6.885   1.00 0.00 ? 73  ASP A CA   5  
ATOM 8829  C C    . ASP A 1 74  ? 10.157  -11.677 6.581   1.00 0.00 ? 73  ASP A C    5  
ATOM 8830  O O    . ASP A 1 74  ? 10.540  -10.571 6.200   1.00 0.00 ? 73  ASP A O    5  
ATOM 8831  C CB   . ASP A 1 74  ? 8.483   -11.831 8.429   1.00 0.00 ? 73  ASP A CB   5  
ATOM 8832  C CG   . ASP A 1 74  ? 6.989   -11.755 8.764   1.00 0.00 ? 73  ASP A CG   5  
ATOM 8833  O OD1  . ASP A 1 74  ? 6.346   -10.745 8.371   1.00 0.00 ? 73  ASP A OD1  5  
ATOM 8834  O OD2  . ASP A 1 74  ? 6.477   -12.703 9.417   1.00 0.00 ? 73  ASP A OD2  5  
ATOM 8835  H H    . ASP A 1 74  ? 7.265   -13.477 6.904   1.00 0.00 ? 73  ASP A H    5  
ATOM 8836  H HA   . ASP A 1 74  ? 8.206   -11.042 6.456   1.00 0.00 ? 73  ASP A HA   5  
ATOM 8837  H HB2  . ASP A 1 74  ? 8.919   -12.736 8.907   1.00 0.00 ? 73  ASP A HB2  5  
ATOM 8838  H HB3  . ASP A 1 74  ? 8.970   -10.932 8.867   1.00 0.00 ? 73  ASP A HB3  5  
ATOM 8839  N N    . GLU A 1 75  ? 10.992  -12.724 6.740   1.00 0.00 ? 74  GLU A N    5  
ATOM 8840  C CA   . GLU A 1 75  ? 12.407  -12.776 6.390   1.00 0.00 ? 74  GLU A CA   5  
ATOM 8841  C C    . GLU A 1 75  ? 12.657  -13.716 5.214   1.00 0.00 ? 74  GLU A C    5  
ATOM 8842  O O    . GLU A 1 75  ? 13.798  -14.038 4.895   1.00 0.00 ? 74  GLU A O    5  
ATOM 8843  C CB   . GLU A 1 75  ? 13.286  -13.131 7.624   1.00 0.00 ? 74  GLU A CB   5  
ATOM 8844  C CG   . GLU A 1 75  ? 12.977  -14.492 8.275   1.00 0.00 ? 74  GLU A CG   5  
ATOM 8845  C CD   . GLU A 1 75  ? 13.862  -14.696 9.505   1.00 0.00 ? 74  GLU A CD   5  
ATOM 8846  O OE1  . GLU A 1 75  ? 13.735  -13.892 10.467  1.00 0.00 ? 74  GLU A OE1  5  
ATOM 8847  O OE2  . GLU A 1 75  ? 14.674  -15.660 9.499   1.00 0.00 ? 74  GLU A OE2  5  
ATOM 8848  H H    . GLU A 1 75  ? 10.617  -13.575 7.088   1.00 0.00 ? 74  GLU A H    5  
ATOM 8849  H HA   . GLU A 1 75  ? 12.737  -11.804 6.043   1.00 0.00 ? 74  GLU A HA   5  
ATOM 8850  H HB2  . GLU A 1 75  ? 14.364  -13.091 7.340   1.00 0.00 ? 74  GLU A HB2  5  
ATOM 8851  H HB3  . GLU A 1 75  ? 13.117  -12.336 8.385   1.00 0.00 ? 74  GLU A HB3  5  
ATOM 8852  H HG2  . GLU A 1 75  ? 11.912  -14.535 8.586   1.00 0.00 ? 74  GLU A HG2  5  
ATOM 8853  H HG3  . GLU A 1 75  ? 13.169  -15.311 7.550   1.00 0.00 ? 74  GLU A HG3  5  
ATOM 8854  N N    . TYR A 1 76  ? 11.574  -14.240 4.584   1.00 0.00 ? 75  TYR A N    5  
ATOM 8855  C CA   . TYR A 1 76  ? 11.630  -15.266 3.545   1.00 0.00 ? 75  TYR A CA   5  
ATOM 8856  C C    . TYR A 1 76  ? 11.256  -14.724 2.173   1.00 0.00 ? 75  TYR A C    5  
ATOM 8857  O O    . TYR A 1 76  ? 11.741  -15.237 1.165   1.00 0.00 ? 75  TYR A O    5  
ATOM 8858  C CB   . TYR A 1 76  ? 10.733  -16.463 3.923   1.00 0.00 ? 75  TYR A CB   5  
ATOM 8859  C CG   . TYR A 1 76  ? 11.200  -17.131 5.193   1.00 0.00 ? 75  TYR A CG   5  
ATOM 8860  C CD1  . TYR A 1 76  ? 10.794  -16.694 6.448   1.00 0.00 ? 75  TYR A CD1  5  
ATOM 8861  C CD2  . TYR A 1 76  ? 12.045  -18.223 5.113   1.00 0.00 ? 75  TYR A CD2  5  
ATOM 8862  C CE1  . TYR A 1 76  ? 11.200  -17.369 7.587   1.00 0.00 ? 75  TYR A CE1  5  
ATOM 8863  C CE2  . TYR A 1 76  ? 12.466  -18.884 6.250   1.00 0.00 ? 75  TYR A CE2  5  
ATOM 8864  C CZ   . TYR A 1 76  ? 12.039  -18.462 7.490   1.00 0.00 ? 75  TYR A CZ   5  
ATOM 8865  O OH   . TYR A 1 76  ? 12.471  -19.131 8.656   1.00 0.00 ? 75  TYR A OH   5  
ATOM 8866  H H    . TYR A 1 76  ? 10.657  -13.963 4.870   1.00 0.00 ? 75  TYR A H    5  
ATOM 8867  H HA   . TYR A 1 76  ? 12.643  -15.639 3.435   1.00 0.00 ? 75  TYR A HA   5  
ATOM 8868  H HB2  . TYR A 1 76  ? 9.712   -16.086 4.097   1.00 0.00 ? 75  TYR A HB2  5  
ATOM 8869  H HB3  . TYR A 1 76  ? 10.710  -17.232 3.119   1.00 0.00 ? 75  TYR A HB3  5  
ATOM 8870  H HD1  . TYR A 1 76  ? 10.172  -15.805 6.542   1.00 0.00 ? 75  TYR A HD1  5  
ATOM 8871  H HD2  . TYR A 1 76  ? 12.382  -18.569 4.145   1.00 0.00 ? 75  TYR A HD2  5  
ATOM 8872  H HE1  . TYR A 1 76  ? 10.881  -17.029 8.563   1.00 0.00 ? 75  TYR A HE1  5  
ATOM 8873  H HE2  . TYR A 1 76  ? 13.126  -19.735 6.153   1.00 0.00 ? 75  TYR A HE2  5  
ATOM 8874  H HH   . TYR A 1 76  ? 13.074  -19.830 8.392   1.00 0.00 ? 75  TYR A HH   5  
ATOM 8875  N N    . PHE A 1 77  ? 10.429  -13.637 2.132   1.00 0.00 ? 76  PHE A N    5  
ATOM 8876  C CA   . PHE A 1 77  ? 10.020  -12.870 0.934   1.00 0.00 ? 76  PHE A CA   5  
ATOM 8877  C C    . PHE A 1 77  ? 11.127  -12.306 0.003   1.00 0.00 ? 76  PHE A C    5  
ATOM 8878  O O    . PHE A 1 77  ? 12.307  -12.249 0.339   1.00 0.00 ? 76  PHE A O    5  
ATOM 8879  C CB   . PHE A 1 77  ? 9.087   -11.670 1.334   1.00 0.00 ? 76  PHE A CB   5  
ATOM 8880  C CG   . PHE A 1 77  ? 9.666   -10.475 2.084   1.00 0.00 ? 76  PHE A CG   5  
ATOM 8881  C CD1  . PHE A 1 77  ? 10.844  -10.496 2.819   1.00 0.00 ? 76  PHE A CD1  5  
ATOM 8882  C CD2  . PHE A 1 77  ? 8.959   -9.285  2.026   1.00 0.00 ? 76  PHE A CD2  5  
ATOM 8883  C CE1  . PHE A 1 77  ? 11.323  -9.349  3.413   1.00 0.00 ? 76  PHE A CE1  5  
ATOM 8884  C CE2  . PHE A 1 77  ? 9.425   -8.139  2.634   1.00 0.00 ? 76  PHE A CE2  5  
ATOM 8885  C CZ   . PHE A 1 77  ? 10.623  -8.169  3.308   1.00 0.00 ? 76  PHE A CZ   5  
ATOM 8886  H H    . PHE A 1 77  ? 9.966   -13.412 3.016   1.00 0.00 ? 76  PHE A H    5  
ATOM 8887  H HA   . PHE A 1 77  ? 9.435   -13.548 0.331   1.00 0.00 ? 76  PHE A HA   5  
ATOM 8888  H HB2  . PHE A 1 77  ? 8.576   -11.267 0.432   1.00 0.00 ? 76  PHE A HB2  5  
ATOM 8889  H HB3  . PHE A 1 77  ? 8.312   -12.063 2.006   1.00 0.00 ? 76  PHE A HB3  5  
ATOM 8890  H HD1  . PHE A 1 77  ? 11.433  -11.396 2.921   1.00 0.00 ? 76  PHE A HD1  5  
ATOM 8891  H HD2  . PHE A 1 77  ? 8.030   -9.257  1.472   1.00 0.00 ? 76  PHE A HD2  5  
ATOM 8892  H HE1  . PHE A 1 77  ? 12.245  -9.379  3.978   1.00 0.00 ? 76  PHE A HE1  5  
ATOM 8893  H HE2  . PHE A 1 77  ? 8.868   -7.212  2.589   1.00 0.00 ? 76  PHE A HE2  5  
ATOM 8894  H HZ   . PHE A 1 77  ? 11.016  -7.270  3.759   1.00 0.00 ? 76  PHE A HZ   5  
ATOM 8895  N N    . SER A 1 78  ? 10.748  -11.912 -1.238  1.00 0.00 ? 77  SER A N    5  
ATOM 8896  C CA   . SER A 1 78  ? 11.700  -11.493 -2.267  1.00 0.00 ? 77  SER A CA   5  
ATOM 8897  C C    . SER A 1 78  ? 11.140  -10.312 -3.035  1.00 0.00 ? 77  SER A C    5  
ATOM 8898  O O    . SER A 1 78  ? 9.923   -10.165 -3.167  1.00 0.00 ? 77  SER A O    5  
ATOM 8899  C CB   . SER A 1 78  ? 12.037  -12.660 -3.251  1.00 0.00 ? 77  SER A CB   5  
ATOM 8900  O OG   . SER A 1 78  ? 12.763  -13.702 -2.594  1.00 0.00 ? 77  SER A OG   5  
ATOM 8901  H H    . SER A 1 78  ? 9.787   -11.896 -1.516  1.00 0.00 ? 77  SER A H    5  
ATOM 8902  H HA   . SER A 1 78  ? 12.624  -11.146 -1.817  1.00 0.00 ? 77  SER A HA   5  
ATOM 8903  H HB2  . SER A 1 78  ? 11.100  -13.096 -3.663  1.00 0.00 ? 77  SER A HB2  5  
ATOM 8904  H HB3  . SER A 1 78  ? 12.662  -12.306 -4.100  1.00 0.00 ? 77  SER A HB3  5  
ATOM 8905  H HG   . SER A 1 78  ? 12.428  -13.755 -1.686  1.00 0.00 ? 77  SER A HG   5  
ATOM 8906  N N    . ALA A 1 79  ? 12.042  -9.434  -3.562  1.00 0.00 ? 78  ALA A N    5  
ATOM 8907  C CA   . ALA A 1 79  ? 11.710  -8.226  -4.300  1.00 0.00 ? 78  ALA A CA   5  
ATOM 8908  C C    . ALA A 1 79  ? 11.331  -8.379  -5.779  1.00 0.00 ? 78  ALA A C    5  
ATOM 8909  O O    . ALA A 1 79  ? 11.599  -9.380  -6.447  1.00 0.00 ? 78  ALA A O    5  
ATOM 8910  C CB   . ALA A 1 79  ? 12.779  -7.123  -4.095  1.00 0.00 ? 78  ALA A CB   5  
ATOM 8911  H H    . ALA A 1 79  ? 13.016  -9.581  -3.424  1.00 0.00 ? 78  ALA A H    5  
ATOM 8912  H HA   . ALA A 1 79  ? 10.831  -7.834  -3.833  1.00 0.00 ? 78  ALA A HA   5  
ATOM 8913  H HB1  . ALA A 1 79  ? 12.977  -7.015  -3.007  1.00 0.00 ? 78  ALA A HB1  5  
ATOM 8914  H HB2  . ALA A 1 79  ? 12.425  -6.125  -4.450  1.00 0.00 ? 78  ALA A HB2  5  
ATOM 8915  H HB3  . ALA A 1 79  ? 13.738  -7.376  -4.596  1.00 0.00 ? 78  ALA A HB3  5  
ATOM 8916  N N    . GLY A 1 80  ? 10.656  -7.309  -6.263  1.00 0.00 ? 79  GLY A N    5  
ATOM 8917  C CA   . GLY A 1 80  ? 10.134  -7.103  -7.598  1.00 0.00 ? 79  GLY A CA   5  
ATOM 8918  C C    . GLY A 1 80  ? 9.901   -5.660  -7.834  1.00 0.00 ? 79  GLY A C    5  
ATOM 8919  O O    . GLY A 1 80  ? 10.367  -4.777  -7.125  1.00 0.00 ? 79  GLY A O    5  
ATOM 8920  H H    . GLY A 1 80  ? 10.488  -6.526  -5.650  1.00 0.00 ? 79  GLY A H    5  
ATOM 8921  H HA2  . GLY A 1 80  ? 10.875  -7.444  -8.341  1.00 0.00 ? 79  GLY A HA2  5  
ATOM 8922  H HA3  . GLY A 1 80  ? 9.112   -7.457  -7.641  1.00 0.00 ? 79  GLY A HA3  5  
ATOM 8923  N N    . VAL A 1 81  ? 9.177   -5.365  -8.913  1.00 0.00 ? 80  VAL A N    5  
ATOM 8924  C CA   . VAL A 1 81  ? 8.901   -4.016  -9.338  1.00 0.00 ? 80  VAL A CA   5  
ATOM 8925  C C    . VAL A 1 81  ? 7.442   -3.891  -9.547  1.00 0.00 ? 80  VAL A C    5  
ATOM 8926  O O    . VAL A 1 81  ? 6.851   -4.770  -10.148 1.00 0.00 ? 80  VAL A O    5  
ATOM 8927  C CB   . VAL A 1 81  ? 9.663   -3.786  -10.648 1.00 0.00 ? 80  VAL A CB   5  
ATOM 8928  C CG1  . VAL A 1 81  ? 9.135   -2.659  -11.571 1.00 0.00 ? 80  VAL A CG1  5  
ATOM 8929  C CG2  . VAL A 1 81  ? 11.077  -3.438  -10.191 1.00 0.00 ? 80  VAL A CG2  5  
ATOM 8930  H H    . VAL A 1 81  ? 8.841   -6.105  -9.506  1.00 0.00 ? 80  VAL A H    5  
ATOM 8931  H HA   . VAL A 1 81  ? 9.156   -3.279  -8.586  1.00 0.00 ? 80  VAL A HA   5  
ATOM 8932  H HB   . VAL A 1 81  ? 9.693   -4.757  -11.210 1.00 0.00 ? 80  VAL A HB   5  
ATOM 8933  H HG11 . VAL A 1 81  ? 8.940   -1.725  -11.001 1.00 0.00 ? 80  VAL A HG11 5  
ATOM 8934  H HG12 . VAL A 1 81  ? 8.194   -2.962  -12.076 1.00 0.00 ? 80  VAL A HG12 5  
ATOM 8935  H HG13 . VAL A 1 81  ? 9.879   -2.420  -12.361 1.00 0.00 ? 80  VAL A HG13 5  
ATOM 8936  H HG21 . VAL A 1 81  ? 11.436  -4.237  -9.499  1.00 0.00 ? 80  VAL A HG21 5  
ATOM 8937  H HG22 . VAL A 1 81  ? 11.014  -2.463  -9.662  1.00 0.00 ? 80  VAL A HG22 5  
ATOM 8938  H HG23 . VAL A 1 81  ? 11.753  -3.337  -11.060 1.00 0.00 ? 80  VAL A HG23 5  
ATOM 8939  N N    . VAL A 1 82  ? 6.834   -2.742  -9.148  1.00 0.00 ? 81  VAL A N    5  
ATOM 8940  C CA   . VAL A 1 82  ? 5.477   -2.380  -9.563  1.00 0.00 ? 81  VAL A CA   5  
ATOM 8941  C C    . VAL A 1 82  ? 5.599   -1.769  -10.945 1.00 0.00 ? 81  VAL A C    5  
ATOM 8942  O O    . VAL A 1 82  ? 6.467   -0.904  -11.119 1.00 0.00 ? 81  VAL A O    5  
ATOM 8943  C CB   . VAL A 1 82  ? 4.723   -1.368  -8.689  1.00 0.00 ? 81  VAL A CB   5  
ATOM 8944  C CG1  . VAL A 1 82  ? 4.635   -1.933  -7.300  1.00 0.00 ? 81  VAL A CG1  5  
ATOM 8945  C CG2  . VAL A 1 82  ? 5.398   -0.003  -8.464  1.00 0.00 ? 81  VAL A CG2  5  
ATOM 8946  H H    . VAL A 1 82  ? 7.360   -2.028  -8.651  1.00 0.00 ? 81  VAL A H    5  
ATOM 8947  H HA   . VAL A 1 82  ? 4.901   -3.298  -9.626  1.00 0.00 ? 81  VAL A HA   5  
ATOM 8948  H HB   . VAL A 1 82  ? 3.690   -1.207  -9.083  1.00 0.00 ? 81  VAL A HB   5  
ATOM 8949  H HG11 . VAL A 1 82  ? 4.373   -1.083  -6.631  1.00 0.00 ? 81  VAL A HG11 5  
ATOM 8950  H HG12 . VAL A 1 82  ? 5.649   -2.272  -7.040  1.00 0.00 ? 81  VAL A HG12 5  
ATOM 8951  H HG13 . VAL A 1 82  ? 3.910   -2.764  -7.238  1.00 0.00 ? 81  VAL A HG13 5  
ATOM 8952  H HG21 . VAL A 1 82  ? 6.218   -0.058  -7.721  1.00 0.00 ? 81  VAL A HG21 5  
ATOM 8953  H HG22 . VAL A 1 82  ? 4.643   0.733   -8.078  1.00 0.00 ? 81  VAL A HG22 5  
ATOM 8954  H HG23 . VAL A 1 82  ? 5.815   0.409   -9.400  1.00 0.00 ? 81  VAL A HG23 5  
ATOM 8955  N N    . LYS A 1 83  ? 4.782   -2.240  -11.929 1.00 0.00 ? 82  LYS A N    5  
ATOM 8956  C CA   . LYS A 1 83  ? 4.865   -1.724  -13.301 1.00 0.00 ? 82  LYS A CA   5  
ATOM 8957  C C    . LYS A 1 83  ? 3.547   -1.230  -13.879 1.00 0.00 ? 82  LYS A C    5  
ATOM 8958  O O    . LYS A 1 83  ? 3.475   -0.806  -15.036 1.00 0.00 ? 82  LYS A O    5  
ATOM 8959  C CB   . LYS A 1 83  ? 5.525   -2.691  -14.320 1.00 0.00 ? 82  LYS A CB   5  
ATOM 8960  C CG   . LYS A 1 83  ? 4.782   -4.021  -14.562 1.00 0.00 ? 82  LYS A CG   5  
ATOM 8961  C CD   . LYS A 1 83  ? 5.439   -4.855  -15.673 1.00 0.00 ? 82  LYS A CD   5  
ATOM 8962  C CE   . LYS A 1 83  ? 4.801   -6.237  -15.882 1.00 0.00 ? 82  LYS A CE   5  
ATOM 8963  N NZ   . LYS A 1 83  ? 3.415   -6.126  -16.393 1.00 0.00 ? 82  LYS A NZ   5  
ATOM 8964  H H    . LYS A 1 83  ? 4.135   -2.989  -11.703 1.00 0.00 ? 82  LYS A H    5  
ATOM 8965  H HA   . LYS A 1 83  ? 5.501   -0.846  -13.283 1.00 0.00 ? 82  LYS A HA   5  
ATOM 8966  H HB2  . LYS A 1 83  ? 5.628   -2.128  -15.281 1.00 0.00 ? 82  LYS A HB2  5  
ATOM 8967  H HB3  . LYS A 1 83  ? 6.552   -2.928  -13.964 1.00 0.00 ? 82  LYS A HB3  5  
ATOM 8968  H HG2  . LYS A 1 83  ? 4.759   -4.612  -13.618 1.00 0.00 ? 82  LYS A HG2  5  
ATOM 8969  H HG3  . LYS A 1 83  ? 3.728   -3.829  -14.862 1.00 0.00 ? 82  LYS A HG3  5  
ATOM 8970  H HD2  . LYS A 1 83  ? 5.410   -4.283  -16.627 1.00 0.00 ? 82  LYS A HD2  5  
ATOM 8971  H HD3  . LYS A 1 83  ? 6.508   -4.998  -15.399 1.00 0.00 ? 82  LYS A HD3  5  
ATOM 8972  H HE2  . LYS A 1 83  ? 5.384   -6.818  -16.628 1.00 0.00 ? 82  LYS A HE2  5  
ATOM 8973  H HE3  . LYS A 1 83  ? 4.768   -6.800  -14.926 1.00 0.00 ? 82  LYS A HE3  5  
ATOM 8974  H HZ1  . LYS A 1 83  ? 3.019   -7.078  -16.532 1.00 0.00 ? 82  LYS A HZ1  5  
ATOM 8975  H HZ2  . LYS A 1 83  ? 3.419   -5.614  -17.298 1.00 0.00 ? 82  LYS A HZ2  5  
ATOM 8976  H HZ3  . LYS A 1 83  ? 2.834   -5.607  -15.703 1.00 0.00 ? 82  LYS A HZ3  5  
ATOM 8977  N N    . GLY A 1 84  ? 2.450   -1.286  -13.093 1.00 0.00 ? 83  GLY A N    5  
ATOM 8978  C CA   . GLY A 1 84  ? 1.129   -0.872  -13.558 1.00 0.00 ? 83  GLY A CA   5  
ATOM 8979  C C    . GLY A 1 84  ? 0.091   -1.384  -12.603 1.00 0.00 ? 83  GLY A C    5  
ATOM 8980  O O    . GLY A 1 84  ? 0.292   -2.386  -11.920 1.00 0.00 ? 83  GLY A O    5  
ATOM 8981  H H    . GLY A 1 84  ? 2.502   -1.649  -12.165 1.00 0.00 ? 83  GLY A H    5  
ATOM 8982  H HA2  . GLY A 1 84  ? 1.090   0.210   -13.559 1.00 0.00 ? 83  GLY A HA2  5  
ATOM 8983  H HA3  . GLY A 1 84  ? 0.925   -1.319  -14.524 1.00 0.00 ? 83  GLY A HA3  5  
ATOM 8984  N N    . HIS A 1 85  ? -1.066  -0.695  -12.471 1.00 0.00 ? 84  HIS A N    5  
ATOM 8985  C CA   . HIS A 1 85  ? -2.126  -1.123  -11.569 1.00 0.00 ? 84  HIS A CA   5  
ATOM 8986  C C    . HIS A 1 85  ? -3.524  -0.725  -11.945 1.00 0.00 ? 84  HIS A C    5  
ATOM 8987  O O    . HIS A 1 85  ? -3.724  0.133   -12.805 1.00 0.00 ? 84  HIS A O    5  
ATOM 8988  C CB   . HIS A 1 85  ? -1.830  -0.656  -10.148 1.00 0.00 ? 84  HIS A CB   5  
ATOM 8989  C CG   . HIS A 1 85  ? -1.321  0.760   -10.033 1.00 0.00 ? 84  HIS A CG   5  
ATOM 8990  N ND1  . HIS A 1 85  ? -2.035  1.949   -10.076 1.00 0.00 ? 84  HIS A ND1  5  
ATOM 8991  C CD2  . HIS A 1 85  ? -0.042  1.110   -9.748  1.00 0.00 ? 84  HIS A CD2  5  
ATOM 8992  C CE1  . HIS A 1 85  ? -1.147  2.941   -9.791  1.00 0.00 ? 84  HIS A CE1  5  
ATOM 8993  N NE2  . HIS A 1 85  ? 0.050   2.470   -9.564  1.00 0.00 ? 84  HIS A NE2  5  
ATOM 8994  H H    . HIS A 1 85  ? -1.277  0.119   -13.002 1.00 0.00 ? 84  HIS A H    5  
ATOM 8995  H HA   . HIS A 1 85  ? -2.181  -2.201  -11.621 1.00 0.00 ? 84  HIS A HA   5  
ATOM 8996  H HB2  . HIS A 1 85  ? -2.645  -0.875  -9.418  1.00 0.00 ? 84  HIS A HB2  5  
ATOM 8997  H HB3  . HIS A 1 85  ? -0.960  -1.279  -9.822  1.00 0.00 ? 84  HIS A HB3  5  
ATOM 8998  H HD1  . HIS A 1 85  ? -3.006  2.066   -10.292 1.00 0.00 ? 84  HIS A HD1  5  
ATOM 8999  H HD2  . HIS A 1 85  ? 0.822   0.493   -9.512  1.00 0.00 ? 84  HIS A HD2  5  
ATOM 9000  H HE1  . HIS A 1 85  ? -1.282  4.019   -9.772  1.00 0.00 ? 84  HIS A HE1  5  
ATOM 9001  N N    . ARG A 1 86  ? -4.545  -1.346  -11.281 1.00 0.00 ? 85  ARG A N    5  
ATOM 9002  C CA   . ARG A 1 86  ? -5.926  -1.087  -11.604 1.00 0.00 ? 85  ARG A CA   5  
ATOM 9003  C C    . ARG A 1 86  ? -6.825  -1.475  -10.441 1.00 0.00 ? 85  ARG A C    5  
ATOM 9004  O O    . ARG A 1 86  ? -6.459  -2.302  -9.599  1.00 0.00 ? 85  ARG A O    5  
ATOM 9005  C CB   . ARG A 1 86  ? -6.290  -2.023  -12.794 1.00 0.00 ? 85  ARG A CB   5  
ATOM 9006  C CG   . ARG A 1 86  ? -6.257  -3.530  -12.424 1.00 0.00 ? 85  ARG A CG   5  
ATOM 9007  C CD   . ARG A 1 86  ? -7.662  -4.167  -12.450 1.00 0.00 ? 85  ARG A CD   5  
ATOM 9008  N NE   . ARG A 1 86  ? -8.052  -4.501  -13.871 1.00 0.00 ? 85  ARG A NE   5  
ATOM 9009  C CZ   . ARG A 1 86  ? -8.978  -3.825  -14.621 1.00 0.00 ? 85  ARG A CZ   5  
ATOM 9010  N NH1  . ARG A 1 86  ? -9.585  -2.695  -14.157 1.00 0.00 ? 85  ARG A NH1  5  
ATOM 9011  N NH2  . ARG A 1 86  ? -9.293  -4.290  -15.866 1.00 0.00 ? 85  ARG A NH2  5  
ATOM 9012  H H    . ARG A 1 86  ? -4.448  -2.078  -10.577 1.00 0.00 ? 85  ARG A H    5  
ATOM 9013  H HA   . ARG A 1 86  ? -6.086  -0.041  -11.836 1.00 0.00 ? 85  ARG A HA   5  
ATOM 9014  H HB2  . ARG A 1 86  ? -7.289  -1.745  -13.198 1.00 0.00 ? 85  ARG A HB2  5  
ATOM 9015  H HB3  . ARG A 1 86  ? -5.558  -1.856  -13.618 1.00 0.00 ? 85  ARG A HB3  5  
ATOM 9016  H HG2  . ARG A 1 86  ? -5.579  -4.084  -13.108 1.00 0.00 ? 85  ARG A HG2  5  
ATOM 9017  H HG3  . ARG A 1 86  ? -5.818  -3.639  -11.384 1.00 0.00 ? 85  ARG A HG3  5  
ATOM 9018  H HD2  . ARG A 1 86  ? -7.636  -5.122  -11.890 1.00 0.00 ? 85  ARG A HD2  5  
ATOM 9019  H HD3  . ARG A 1 86  ? -8.415  -3.509  -11.967 1.00 0.00 ? 85  ARG A HD3  5  
ATOM 9020  H HE   . ARG A 1 86  ? -7.638  -5.317  -14.274 1.00 0.00 ? 85  ARG A HE   5  
ATOM 9021  H HH11 . ARG A 1 86  ? -9.359  -2.346  -13.247 1.00 0.00 ? 85  ARG A HH11 5  
ATOM 9022  H HH12 . ARG A 1 86  ? -10.256 -2.219  -14.724 1.00 0.00 ? 85  ARG A HH12 5  
ATOM 9023  H HH21 . ARG A 1 86  ? -8.852  -5.117  -16.217 1.00 0.00 ? 85  ARG A HH21 5  
ATOM 9024  H HH22 . ARG A 1 86  ? -9.966  -3.806  -16.425 1.00 0.00 ? 85  ARG A HH22 5  
ATOM 9025  N N    . LYS A 1 87  ? -8.073  -0.968  -10.402 1.00 0.00 ? 86  LYS A N    5  
ATOM 9026  C CA   . LYS A 1 87  ? -9.096  -1.610  -9.606  1.00 0.00 ? 86  LYS A CA   5  
ATOM 9027  C C    . LYS A 1 87  ? -10.365 -1.618  -10.415 1.00 0.00 ? 86  LYS A C    5  
ATOM 9028  O O    . LYS A 1 87  ? -10.626 -0.699  -11.191 1.00 0.00 ? 86  LYS A O    5  
ATOM 9029  C CB   . LYS A 1 87  ? -9.140  -1.169  -8.138  1.00 0.00 ? 86  LYS A CB   5  
ATOM 9030  C CG   . LYS A 1 87  ? -9.534  0.291   -7.889  1.00 0.00 ? 86  LYS A CG   5  
ATOM 9031  C CD   . LYS A 1 87  ? -9.771  0.614   -6.409  1.00 0.00 ? 86  LYS A CD   5  
ATOM 9032  C CE   . LYS A 1 87  ? -8.443  0.640   -5.671  1.00 0.00 ? 86  LYS A CE   5  
ATOM 9033  N NZ   . LYS A 1 87  ? -8.600  1.033   -4.256  1.00 0.00 ? 86  LYS A NZ   5  
ATOM 9034  H H    . LYS A 1 87  ? -8.423  -0.302  -11.059 1.00 0.00 ? 86  LYS A H    5  
ATOM 9035  H HA   . LYS A 1 87  ? -8.893  -2.678  -9.544  1.00 0.00 ? 86  LYS A HA   5  
ATOM 9036  H HB2  . LYS A 1 87  ? -9.819  -1.844  -7.576  1.00 0.00 ? 86  LYS A HB2  5  
ATOM 9037  H HB3  . LYS A 1 87  ? -8.100  -1.355  -7.771  1.00 0.00 ? 86  LYS A HB3  5  
ATOM 9038  H HG2  . LYS A 1 87  ? -8.756  0.965   -8.311  1.00 0.00 ? 86  LYS A HG2  5  
ATOM 9039  H HG3  . LYS A 1 87  ? -10.477 0.515   -8.403  1.00 0.00 ? 86  LYS A HG3  5  
ATOM 9040  H HD2  . LYS A 1 87  ? -10.247 1.618   -6.328  1.00 0.00 ? 86  LYS A HD2  5  
ATOM 9041  H HD3  . LYS A 1 87  ? -10.461 -0.134  -5.961  1.00 0.00 ? 86  LYS A HD3  5  
ATOM 9042  H HE2  . LYS A 1 87  ? -7.963  -0.355  -5.717  1.00 0.00 ? 86  LYS A HE2  5  
ATOM 9043  H HE3  . LYS A 1 87  ? -7.811  1.388   -6.190  1.00 0.00 ? 86  LYS A HE3  5  
ATOM 9044  H HZ1  . LYS A 1 87  ? -7.667  1.065   -3.798  1.00 0.00 ? 86  LYS A HZ1  5  
ATOM 9045  H HZ2  . LYS A 1 87  ? -9.203  0.340   -3.767  1.00 0.00 ? 86  LYS A HZ2  5  
ATOM 9046  H HZ3  . LYS A 1 87  ? -9.042  1.974   -4.203  1.00 0.00 ? 86  LYS A HZ3  5  
ATOM 9047  N N    . GLU A 1 88  ? -11.176 -2.688  -10.260 1.00 0.00 ? 87  GLU A N    5  
ATOM 9048  C CA   . GLU A 1 88  ? -12.433 -2.913  -10.960 1.00 0.00 ? 87  GLU A CA   5  
ATOM 9049  C C    . GLU A 1 88  ? -13.473 -3.213  -9.895  1.00 0.00 ? 87  GLU A C    5  
ATOM 9050  O O    . GLU A 1 88  ? -13.113 -3.540  -8.768  1.00 0.00 ? 87  GLU A O    5  
ATOM 9051  C CB   . GLU A 1 88  ? -12.288 -4.028  -12.032 1.00 0.00 ? 87  GLU A CB   5  
ATOM 9052  C CG   . GLU A 1 88  ? -13.409 -4.062  -13.087 1.00 0.00 ? 87  GLU A CG   5  
ATOM 9053  C CD   . GLU A 1 88  ? -13.059 -5.092  -14.160 1.00 0.00 ? 87  GLU A CD   5  
ATOM 9054  O OE1  . GLU A 1 88  ? -12.970 -6.300  -13.815 1.00 0.00 ? 87  GLU A OE1  5  
ATOM 9055  O OE2  . GLU A 1 88  ? -12.873 -4.683  -15.338 1.00 0.00 ? 87  GLU A OE2  5  
ATOM 9056  H H    . GLU A 1 88  ? -10.905 -3.417  -9.596  1.00 0.00 ? 87  GLU A H    5  
ATOM 9057  H HA   . GLU A 1 88  ? -12.750 -2.002  -11.459 1.00 0.00 ? 87  GLU A HA   5  
ATOM 9058  H HB2  . GLU A 1 88  ? -11.330 -3.834  -12.563 1.00 0.00 ? 87  GLU A HB2  5  
ATOM 9059  H HB3  . GLU A 1 88  ? -12.192 -5.031  -11.568 1.00 0.00 ? 87  GLU A HB3  5  
ATOM 9060  H HG2  . GLU A 1 88  ? -14.377 -4.336  -12.620 1.00 0.00 ? 87  GLU A HG2  5  
ATOM 9061  H HG3  . GLU A 1 88  ? -13.508 -3.056  -13.550 1.00 0.00 ? 87  GLU A HG3  5  
ATOM 9062  N N    . SER A 1 89  ? -14.799 -3.099  -10.171 1.00 0.00 ? 88  SER A N    5  
ATOM 9063  C CA   . SER A 1 89  ? -15.911 -3.340  -9.238  1.00 0.00 ? 88  SER A CA   5  
ATOM 9064  C C    . SER A 1 89  ? -16.010 -4.755  -8.626  1.00 0.00 ? 88  SER A C    5  
ATOM 9065  O O    . SER A 1 89  ? -16.812 -5.579  -9.060  1.00 0.00 ? 88  SER A O    5  
ATOM 9066  C CB   . SER A 1 89  ? -17.255 -2.980  -9.937  1.00 0.00 ? 88  SER A CB   5  
ATOM 9067  O OG   . SER A 1 89  ? -17.429 -3.731  -11.139 1.00 0.00 ? 88  SER A OG   5  
ATOM 9068  H H    . SER A 1 89  ? -15.100 -2.845  -11.087 1.00 0.00 ? 88  SER A H    5  
ATOM 9069  H HA   . SER A 1 89  ? -15.792 -2.655  -8.409  1.00 0.00 ? 88  SER A HA   5  
ATOM 9070  H HB2  . SER A 1 89  ? -18.125 -3.136  -9.261  1.00 0.00 ? 88  SER A HB2  5  
ATOM 9071  H HB3  . SER A 1 89  ? -17.236 -1.901  -10.209 1.00 0.00 ? 88  SER A HB3  5  
ATOM 9072  H HG   . SER A 1 89  ? -17.348 -4.657  -10.856 1.00 0.00 ? 88  SER A HG   5  
ATOM 9073  N N    . GLY A 1 90  ? -15.147 -5.033  -7.616  1.00 0.00 ? 89  GLY A N    5  
ATOM 9074  C CA   . GLY A 1 90  ? -14.991 -6.307  -6.927  1.00 0.00 ? 89  GLY A CA   5  
ATOM 9075  C C    . GLY A 1 90  ? -13.648 -6.952  -7.169  1.00 0.00 ? 89  GLY A C    5  
ATOM 9076  O O    . GLY A 1 90  ? -13.421 -8.065  -6.708  1.00 0.00 ? 89  GLY A O    5  
ATOM 9077  H H    . GLY A 1 90  ? -14.501 -4.310  -7.358  1.00 0.00 ? 89  GLY A H    5  
ATOM 9078  H HA2  . GLY A 1 90  ? -15.054 -6.106  -5.867  1.00 0.00 ? 89  GLY A HA2  5  
ATOM 9079  H HA3  . GLY A 1 90  ? -15.740 -7.017  -7.257  1.00 0.00 ? 89  GLY A HA3  5  
ATOM 9080  N N    . GLU A 1 91  ? -12.710 -6.283  -7.905  1.00 0.00 ? 90  GLU A N    5  
ATOM 9081  C CA   . GLU A 1 91  ? -11.400 -6.784  -8.244  1.00 0.00 ? 90  GLU A CA   5  
ATOM 9082  C C    . GLU A 1 91  ? -10.392 -5.695  -7.939  1.00 0.00 ? 90  GLU A C    5  
ATOM 9083  O O    . GLU A 1 91  ? -10.619 -4.518  -8.210  1.00 0.00 ? 90  GLU A O    5  
ATOM 9084  C CB   . GLU A 1 91  ? -11.282 -7.072  -9.762  1.00 0.00 ? 90  GLU A CB   5  
ATOM 9085  C CG   . GLU A 1 91  ? -12.403 -7.909  -10.402 1.00 0.00 ? 90  GLU A CG   5  
ATOM 9086  C CD   . GLU A 1 91  ? -12.430 -9.323  -9.828  1.00 0.00 ? 90  GLU A CD   5  
ATOM 9087  O OE1  . GLU A 1 91  ? -11.374 -10.009 -9.889  1.00 0.00 ? 90  GLU A OE1  5  
ATOM 9088  O OE2  . GLU A 1 91  ? -13.510 -9.743  -9.331  1.00 0.00 ? 90  GLU A OE2  5  
ATOM 9089  H H    . GLU A 1 91  ? -12.824 -5.367  -8.305  1.00 0.00 ? 90  GLU A H    5  
ATOM 9090  H HA   . GLU A 1 91  ? -11.148 -7.667  -7.669  1.00 0.00 ? 90  GLU A HA   5  
ATOM 9091  H HB2  . GLU A 1 91  ? -11.252 -6.126  -10.343 1.00 0.00 ? 90  GLU A HB2  5  
ATOM 9092  H HB3  . GLU A 1 91  ? -10.318 -7.570  -9.930  1.00 0.00 ? 90  GLU A HB3  5  
ATOM 9093  H HG2  . GLU A 1 91  ? -13.373 -7.393  -10.251 1.00 0.00 ? 90  GLU A HG2  5  
ATOM 9094  H HG3  . GLU A 1 91  ? -12.211 -7.962  -11.496 1.00 0.00 ? 90  GLU A HG3  5  
ATOM 9095  N N    . LEU A 1 92  ? -9.210  -6.044  -7.401  1.00 0.00 ? 91  LEU A N    5  
ATOM 9096  C CA   . LEU A 1 92  ? -8.168  -5.082  -7.122  1.00 0.00 ? 91  LEU A CA   5  
ATOM 9097  C C    . LEU A 1 92  ? -6.918  -5.712  -7.664  1.00 0.00 ? 91  LEU A C    5  
ATOM 9098  O O    . LEU A 1 92  ? -6.608  -6.806  -7.203  1.00 0.00 ? 91  LEU A O    5  
ATOM 9099  C CB   . LEU A 1 92  ? -7.979  -4.997  -5.577  1.00 0.00 ? 91  LEU A CB   5  
ATOM 9100  C CG   . LEU A 1 92  ? -7.416  -3.673  -5.019  1.00 0.00 ? 91  LEU A CG   5  
ATOM 9101  C CD1  . LEU A 1 92  ? -7.274  -3.819  -3.499  1.00 0.00 ? 91  LEU A CD1  5  
ATOM 9102  C CD2  . LEU A 1 92  ? -6.094  -3.191  -5.640  1.00 0.00 ? 91  LEU A CD2  5  
ATOM 9103  H H    . LEU A 1 92  ? -8.962  -6.987  -7.192  1.00 0.00 ? 91  LEU A H    5  
ATOM 9104  H HA   . LEU A 1 92  ? -8.369  -4.123  -7.602  1.00 0.00 ? 91  LEU A HA   5  
ATOM 9105  H HB2  . LEU A 1 92  ? -8.992  -5.110  -5.125  1.00 0.00 ? 91  LEU A HB2  5  
ATOM 9106  H HB3  . LEU A 1 92  ? -7.372  -5.864  -5.176  1.00 0.00 ? 91  LEU A HB3  5  
ATOM 9107  H HG   . LEU A 1 92  ? -8.168  -2.869  -5.215  1.00 0.00 ? 91  LEU A HG   5  
ATOM 9108  H HD11 . LEU A 1 92  ? -6.893  -2.877  -3.052  1.00 0.00 ? 91  LEU A HD11 5  
ATOM 9109  H HD12 . LEU A 1 92  ? -6.562  -4.635  -3.259  1.00 0.00 ? 91  LEU A HD12 5  
ATOM 9110  H HD13 . LEU A 1 92  ? -8.255  -4.064  -3.040  1.00 0.00 ? 91  LEU A HD13 5  
ATOM 9111  H HD21 . LEU A 1 92  ? -6.226  -2.928  -6.711  1.00 0.00 ? 91  LEU A HD21 5  
ATOM 9112  H HD22 . LEU A 1 92  ? -5.305  -3.965  -5.546  1.00 0.00 ? 91  LEU A HD22 5  
ATOM 9113  H HD23 . LEU A 1 92  ? -5.758  -2.280  -5.102  1.00 0.00 ? 91  LEU A HD23 5  
ATOM 9114  N N    . TYR A 1 93  ? -6.112  -5.141  -8.595  1.00 0.00 ? 92  TYR A N    5  
ATOM 9115  C CA   . TYR A 1 93  ? -4.846  -5.818  -8.839  1.00 0.00 ? 92  TYR A CA   5  
ATOM 9116  C C    . TYR A 1 93  ? -3.726  -4.854  -9.146  1.00 0.00 ? 92  TYR A C    5  
ATOM 9117  O O    . TYR A 1 93  ? -3.838  -3.952  -9.975  1.00 0.00 ? 92  TYR A O    5  
ATOM 9118  C CB   . TYR A 1 93  ? -4.892  -7.130  -9.724  1.00 0.00 ? 92  TYR A CB   5  
ATOM 9119  C CG   . TYR A 1 93  ? -5.890  -7.209  -10.871 1.00 0.00 ? 92  TYR A CG   5  
ATOM 9120  C CD1  . TYR A 1 93  ? -7.202  -7.615  -10.649 1.00 0.00 ? 92  TYR A CD1  5  
ATOM 9121  C CD2  . TYR A 1 93  ? -5.490  -7.057  -12.190 1.00 0.00 ? 92  TYR A CD2  5  
ATOM 9122  C CE1  . TYR A 1 93  ? -8.074  -7.844  -11.696 1.00 0.00 ? 92  TYR A CE1  5  
ATOM 9123  C CE2  . TYR A 1 93  ? -6.346  -7.326  -13.242 1.00 0.00 ? 92  TYR A CE2  5  
ATOM 9124  C CZ   . TYR A 1 93  ? -7.640  -7.725  -12.994 1.00 0.00 ? 92  TYR A CZ   5  
ATOM 9125  O OH   . TYR A 1 93  ? -8.533  -7.998  -14.051 1.00 0.00 ? 92  TYR A OH   5  
ATOM 9126  H H    . TYR A 1 93  ? -6.244  -4.240  -9.044  1.00 0.00 ? 92  TYR A H    5  
ATOM 9127  H HA   . TYR A 1 93  ? -4.479  -6.159  -7.856  1.00 0.00 ? 92  TYR A HA   5  
ATOM 9128  H HB2  . TYR A 1 93  ? -3.887  -7.413  -10.094 1.00 0.00 ? 92  TYR A HB2  5  
ATOM 9129  H HB3  . TYR A 1 93  ? -5.190  -7.954  -9.036  1.00 0.00 ? 92  TYR A HB3  5  
ATOM 9130  H HD1  . TYR A 1 93  ? -7.543  -7.783  -9.639  1.00 0.00 ? 92  TYR A HD1  5  
ATOM 9131  H HD2  . TYR A 1 93  ? -4.485  -6.757  -12.424 1.00 0.00 ? 92  TYR A HD2  5  
ATOM 9132  H HE1  . TYR A 1 93  ? -9.098  -8.137  -11.515 1.00 0.00 ? 92  TYR A HE1  5  
ATOM 9133  H HE2  . TYR A 1 93  ? -5.989  -7.209  -14.256 1.00 0.00 ? 92  TYR A HE2  5  
ATOM 9134  H HH   . TYR A 1 93  ? -8.056  -7.884  -14.875 1.00 0.00 ? 92  TYR A HH   5  
ATOM 9135  N N    . TYR A 1 94  ? -2.575  -5.076  -8.469  1.00 0.00 ? 93  TYR A N    5  
ATOM 9136  C CA   . TYR A 1 94  ? -1.304  -4.416  -8.643  1.00 0.00 ? 93  TYR A CA   5  
ATOM 9137  C C    . TYR A 1 94  ? -0.421  -5.410  -9.384  1.00 0.00 ? 93  TYR A C    5  
ATOM 9138  O O    . TYR A 1 94  ? -0.508  -6.617  -9.144  1.00 0.00 ? 93  TYR A O    5  
ATOM 9139  C CB   . TYR A 1 94  ? -0.719  -4.030  -7.256  1.00 0.00 ? 93  TYR A CB   5  
ATOM 9140  C CG   . TYR A 1 94  ? -0.369  -2.580  -7.172  1.00 0.00 ? 93  TYR A CG   5  
ATOM 9141  C CD1  . TYR A 1 94  ? -1.380  -1.641  -7.266  1.00 0.00 ? 93  TYR A CD1  5  
ATOM 9142  C CD2  . TYR A 1 94  ? 0.935   -2.156  -6.978  1.00 0.00 ? 93  TYR A CD2  5  
ATOM 9143  C CE1  . TYR A 1 94  ? -1.074  -0.291  -7.164  1.00 0.00 ? 93  TYR A CE1  5  
ATOM 9144  C CE2  . TYR A 1 94  ? 1.239   -0.818  -6.954  1.00 0.00 ? 93  TYR A CE2  5  
ATOM 9145  C CZ   . TYR A 1 94  ? 0.245   0.117   -7.038  1.00 0.00 ? 93  TYR A CZ   5  
ATOM 9146  O OH   . TYR A 1 94  ? 0.642   1.474   -7.068  1.00 0.00 ? 93  TYR A OH   5  
ATOM 9147  H H    . TYR A 1 94  ? -2.532  -5.831  -7.802  1.00 0.00 ? 93  TYR A H    5  
ATOM 9148  H HA   . TYR A 1 94  ? -1.419  -3.544  -9.259  1.00 0.00 ? 93  TYR A HA   5  
ATOM 9149  H HB2  . TYR A 1 94  ? -1.512  -4.162  -6.494  1.00 0.00 ? 93  TYR A HB2  5  
ATOM 9150  H HB3  . TYR A 1 94  ? 0.162   -4.634  -6.958  1.00 0.00 ? 93  TYR A HB3  5  
ATOM 9151  H HD1  . TYR A 1 94  ? -2.404  -1.971  -7.490  1.00 0.00 ? 93  TYR A HD1  5  
ATOM 9152  H HD2  . TYR A 1 94  ? 1.757   -2.843  -6.849  1.00 0.00 ? 93  TYR A HD2  5  
ATOM 9153  H HE1  . TYR A 1 94  ? -1.859  0.448   -7.255  1.00 0.00 ? 93  TYR A HE1  5  
ATOM 9154  H HE2  . TYR A 1 94  ? 2.271   -0.506  -6.901  1.00 0.00 ? 93  TYR A HE2  5  
ATOM 9155  H HH   . TYR A 1 94  ? 0.273   1.899   -7.874  1.00 0.00 ? 93  TYR A HH   5  
ATOM 9156  N N    . SER A 1 95  ? 0.441   -4.927  -10.324 1.00 0.00 ? 94  SER A N    5  
ATOM 9157  C CA   . SER A 1 95  ? 1.347   -5.726  -11.150 1.00 0.00 ? 94  SER A CA   5  
ATOM 9158  C C    . SER A 1 95  ? 2.761   -5.609  -10.637 1.00 0.00 ? 94  SER A C    5  
ATOM 9159  O O    . SER A 1 95  ? 3.298   -4.503  -10.559 1.00 0.00 ? 94  SER A O    5  
ATOM 9160  C CB   . SER A 1 95  ? 1.370   -5.193  -12.606 1.00 0.00 ? 94  SER A CB   5  
ATOM 9161  O OG   . SER A 1 95  ? 2.003   -6.092  -13.520 1.00 0.00 ? 94  SER A OG   5  
ATOM 9162  H H    . SER A 1 95  ? 0.488   -3.945  -10.532 1.00 0.00 ? 94  SER A H    5  
ATOM 9163  H HA   . SER A 1 95  ? 1.041   -6.773  -11.108 1.00 0.00 ? 94  SER A HA   5  
ATOM 9164  H HB2  . SER A 1 95  ? 0.320   -5.046  -12.918 1.00 0.00 ? 94  SER A HB2  5  
ATOM 9165  H HB3  . SER A 1 95  ? 1.834   -4.179  -12.660 1.00 0.00 ? 94  SER A HB3  5  
ATOM 9166  H HG   . SER A 1 95  ? 1.380   -6.824  -13.691 1.00 0.00 ? 94  SER A HG   5  
ATOM 9167  N N    . ILE A 1 96  ? 3.360   -6.778  -10.297 1.00 0.00 ? 95  ILE A N    5  
ATOM 9168  C CA   . ILE A 1 96  ? 4.650   -6.944  -9.685  1.00 0.00 ? 95  ILE A CA   5  
ATOM 9169  C C    . ILE A 1 96  ? 5.434   -7.740  -10.692 1.00 0.00 ? 95  ILE A C    5  
ATOM 9170  O O    . ILE A 1 96  ? 5.121   -8.903  -10.944 1.00 0.00 ? 95  ILE A O    5  
ATOM 9171  C CB   . ILE A 1 96  ? 4.641   -7.683  -8.328  1.00 0.00 ? 95  ILE A CB   5  
ATOM 9172  C CG1  . ILE A 1 96  ? 3.521   -7.212  -7.386  1.00 0.00 ? 95  ILE A CG1  5  
ATOM 9173  C CG2  . ILE A 1 96  ? 5.965   -7.395  -7.587  1.00 0.00 ? 95  ILE A CG2  5  
ATOM 9174  C CD1  . ILE A 1 96  ? 2.126   -7.726  -7.736  1.00 0.00 ? 95  ILE A CD1  5  
ATOM 9175  H H    . ILE A 1 96  ? 2.932   -7.690  -10.428 1.00 0.00 ? 95  ILE A H    5  
ATOM 9176  H HA   . ILE A 1 96  ? 5.106   -5.988  -9.518  1.00 0.00 ? 95  ILE A HA   5  
ATOM 9177  H HB   . ILE A 1 96  ? 4.505   -8.784  -8.455  1.00 0.00 ? 95  ILE A HB   5  
ATOM 9178  H HG12 . ILE A 1 96  ? 3.769   -7.563  -6.357  1.00 0.00 ? 95  ILE A HG12 5  
ATOM 9179  H HG13 . ILE A 1 96  ? 3.530   -6.099  -7.379  1.00 0.00 ? 95  ILE A HG13 5  
ATOM 9180  H HG21 . ILE A 1 96  ? 6.042   -6.306  -7.384  1.00 0.00 ? 95  ILE A HG21 5  
ATOM 9181  H HG22 . ILE A 1 96  ? 6.851   -7.709  -8.173  1.00 0.00 ? 95  ILE A HG22 5  
ATOM 9182  H HG23 . ILE A 1 96  ? 5.967   -7.913  -6.603  1.00 0.00 ? 95  ILE A HG23 5  
ATOM 9183  H HD11 . ILE A 1 96  ? 1.735   -7.138  -8.588  1.00 0.00 ? 95  ILE A HD11 5  
ATOM 9184  H HD12 . ILE A 1 96  ? 1.418   -7.571  -6.900  1.00 0.00 ? 95  ILE A HD12 5  
ATOM 9185  H HD13 . ILE A 1 96  ? 2.154   -8.798  -8.020  1.00 0.00 ? 95  ILE A HD13 5  
ATOM 9186  N N    . GLU A 1 97  ? 6.489   -7.148  -11.307 1.00 0.00 ? 96  GLU A N    5  
ATOM 9187  C CA   . GLU A 1 97  ? 7.406   -7.843  -12.220 1.00 0.00 ? 96  GLU A CA   5  
ATOM 9188  C C    . GLU A 1 97  ? 8.501   -8.444  -11.347 1.00 0.00 ? 96  GLU A C    5  
ATOM 9189  O O    . GLU A 1 97  ? 9.195   -7.735  -10.616 1.00 0.00 ? 96  GLU A O    5  
ATOM 9190  C CB   . GLU A 1 97  ? 7.918   -6.943  -13.367 1.00 0.00 ? 96  GLU A CB   5  
ATOM 9191  C CG   . GLU A 1 97  ? 8.870   -7.660  -14.347 1.00 0.00 ? 96  GLU A CG   5  
ATOM 9192  C CD   . GLU A 1 97  ? 9.239   -6.728  -15.500 1.00 0.00 ? 96  GLU A CD   5  
ATOM 9193  O OE1  . GLU A 1 97  ? 8.375   -6.515  -16.391 1.00 0.00 ? 96  GLU A OE1  5  
ATOM 9194  O OE2  . GLU A 1 97  ? 10.394  -6.223  -15.508 1.00 0.00 ? 96  GLU A OE2  5  
ATOM 9195  H H    . GLU A 1 97  ? 6.675   -6.179  -11.065 1.00 0.00 ? 96  GLU A H    5  
ATOM 9196  H HA   . GLU A 1 97  ? 6.864   -8.664  -12.658 1.00 0.00 ? 96  GLU A HA   5  
ATOM 9197  H HB2  . GLU A 1 97  ? 7.008   -6.621  -13.928 1.00 0.00 ? 96  GLU A HB2  5  
ATOM 9198  H HB3  . GLU A 1 97  ? 8.420   -6.045  -12.944 1.00 0.00 ? 96  GLU A HB3  5  
ATOM 9199  H HG2  . GLU A 1 97  ? 9.799   -7.967  -13.820 1.00 0.00 ? 96  GLU A HG2  5  
ATOM 9200  H HG3  . GLU A 1 97  ? 8.380   -8.571  -14.752 1.00 0.00 ? 96  GLU A HG3  5  
ATOM 9201  N N    . LYS A 1 98  ? 8.534   -9.795  -11.275 1.00 0.00 ? 97  LYS A N    5  
ATOM 9202  C CA   . LYS A 1 98  ? 9.195   -10.466 -10.174 1.00 0.00 ? 97  LYS A CA   5  
ATOM 9203  C C    . LYS A 1 98  ? 9.880   -11.741 -10.583 1.00 0.00 ? 97  LYS A C    5  
ATOM 9204  O O    . LYS A 1 98  ? 9.283   -12.603 -11.225 1.00 0.00 ? 97  LYS A O    5  
ATOM 9205  C CB   . LYS A 1 98  ? 8.045   -10.841 -9.218  1.00 0.00 ? 97  LYS A CB   5  
ATOM 9206  C CG   . LYS A 1 98  ? 8.401   -11.367 -7.823  1.00 0.00 ? 97  LYS A CG   5  
ATOM 9207  C CD   . LYS A 1 98  ? 7.136   -11.618 -7.005  1.00 0.00 ? 97  LYS A CD   5  
ATOM 9208  C CE   . LYS A 1 98  ? 7.279   -12.764 -5.990  1.00 0.00 ? 97  LYS A CE   5  
ATOM 9209  N NZ   . LYS A 1 98  ? 8.424   -12.553 -5.073  1.00 0.00 ? 97  LYS A NZ   5  
ATOM 9210  H H    . LYS A 1 98  ? 8.012   -10.411 -11.913 1.00 0.00 ? 97  LYS A H    5  
ATOM 9211  H HA   . LYS A 1 98  ? 9.939   -9.822  -9.715  1.00 0.00 ? 97  LYS A HA   5  
ATOM 9212  H HB2  . LYS A 1 98  ? 7.398   -9.943  -9.074  1.00 0.00 ? 97  LYS A HB2  5  
ATOM 9213  H HB3  . LYS A 1 98  ? 7.439   -11.593 -9.777  1.00 0.00 ? 97  LYS A HB3  5  
ATOM 9214  H HG2  . LYS A 1 98  ? 8.942   -12.331 -7.875  1.00 0.00 ? 97  LYS A HG2  5  
ATOM 9215  H HG3  . LYS A 1 98  ? 9.054   -10.648 -7.281  1.00 0.00 ? 97  LYS A HG3  5  
ATOM 9216  H HD2  . LYS A 1 98  ? 6.863   -10.665 -6.512  1.00 0.00 ? 97  LYS A HD2  5  
ATOM 9217  H HD3  . LYS A 1 98  ? 6.297   -11.866 -7.690  1.00 0.00 ? 97  LYS A HD3  5  
ATOM 9218  H HE2  . LYS A 1 98  ? 6.361   -12.852 -5.373  1.00 0.00 ? 97  LYS A HE2  5  
ATOM 9219  H HE3  . LYS A 1 98  ? 7.455   -13.722 -6.520  1.00 0.00 ? 97  LYS A HE3  5  
ATOM 9220  H HZ1  . LYS A 1 98  ? 8.286   -11.667 -4.545  1.00 0.00 ? 97  LYS A HZ1  5  
ATOM 9221  H HZ2  . LYS A 1 98  ? 9.303   -12.492 -5.627  1.00 0.00 ? 97  LYS A HZ2  5  
ATOM 9222  H HZ3  . LYS A 1 98  ? 8.488   -13.348 -4.407  1.00 0.00 ? 97  LYS A HZ3  5  
ATOM 9223  N N    . GLU A 1 99  ? 11.179  -11.916 -10.221 1.00 0.00 ? 98  GLU A N    5  
ATOM 9224  C CA   . GLU A 1 99  ? 12.013  -13.102 -10.489 1.00 0.00 ? 98  GLU A CA   5  
ATOM 9225  C C    . GLU A 1 99  ? 12.307  -13.369 -11.979 1.00 0.00 ? 98  GLU A C    5  
ATOM 9226  O O    . GLU A 1 99  ? 12.976  -14.330 -12.348 1.00 0.00 ? 98  GLU A O    5  
ATOM 9227  C CB   . GLU A 1 99  ? 11.478  -14.382 -9.757  1.00 0.00 ? 98  GLU A CB   5  
ATOM 9228  C CG   . GLU A 1 99  ? 12.055  -14.595 -8.338  1.00 0.00 ? 98  GLU A CG   5  
ATOM 9229  C CD   . GLU A 1 99  ? 11.476  -13.636 -7.296  1.00 0.00 ? 98  GLU A CD   5  
ATOM 9230  O OE1  . GLU A 1 99  ? 11.873  -12.440 -7.283  1.00 0.00 ? 98  GLU A OE1  5  
ATOM 9231  O OE2  . GLU A 1 99  ? 10.641  -14.104 -6.478  1.00 0.00 ? 98  GLU A OE2  5  
ATOM 9232  H H    . GLU A 1 99  ? 11.626  -11.196 -9.696  1.00 0.00 ? 98  GLU A H    5  
ATOM 9233  H HA   . GLU A 1 99  ? 12.984  -12.885 -10.064 1.00 0.00 ? 98  GLU A HA   5  
ATOM 9234  H HB2  . GLU A 1 99  ? 10.352  -14.354 -9.704  1.00 0.00 ? 98  GLU A HB2  5  
ATOM 9235  H HB3  . GLU A 1 99  ? 11.801  -15.307 -10.307 1.00 0.00 ? 98  GLU A HB3  5  
ATOM 9236  H HG2  . GLU A 1 99  ? 11.814  -15.637 -8.027  1.00 0.00 ? 98  GLU A HG2  5  
ATOM 9237  H HG3  . GLU A 1 99  ? 13.161  -14.497 -8.361  1.00 0.00 ? 98  GLU A HG3  5  
ATOM 9238  N N    . GLY A 1 100 ? 11.834  -12.447 -12.849 1.00 0.00 ? 99  GLY A N    5  
ATOM 9239  C CA   . GLY A 1 100 ? 12.037  -12.422 -14.293 1.00 0.00 ? 99  GLY A CA   5  
ATOM 9240  C C    . GLY A 1 100 ? 10.737  -12.484 -15.040 1.00 0.00 ? 99  GLY A C    5  
ATOM 9241  O O    . GLY A 1 100 ? 10.700  -12.271 -16.245 1.00 0.00 ? 99  GLY A O    5  
ATOM 9242  H H    . GLY A 1 100 ? 11.250  -11.745 -12.423 1.00 0.00 ? 99  GLY A H    5  
ATOM 9243  H HA2  . GLY A 1 100 ? 12.502  -11.477 -14.538 1.00 0.00 ? 99  GLY A HA2  5  
ATOM 9244  H HA3  . GLY A 1 100 ? 12.630  -13.270 -14.620 1.00 0.00 ? 99  GLY A HA3  5  
ATOM 9245  N N    . GLN A 1 101 ? 9.623   -12.780 -14.330 1.00 0.00 ? 100 GLN A N    5  
ATOM 9246  C CA   . GLN A 1 101 ? 8.277   -12.909 -14.871 1.00 0.00 ? 100 GLN A CA   5  
ATOM 9247  C C    . GLN A 1 101 ? 7.285   -12.084 -14.107 1.00 0.00 ? 100 GLN A C    5  
ATOM 9248  O O    . GLN A 1 101 ? 7.598   -11.490 -13.086 1.00 0.00 ? 100 GLN A O    5  
ATOM 9249  C CB   . GLN A 1 101 ? 7.843   -14.395 -15.061 1.00 0.00 ? 100 GLN A CB   5  
ATOM 9250  C CG   . GLN A 1 101 ? 7.963   -15.352 -13.841 1.00 0.00 ? 100 GLN A CG   5  
ATOM 9251  C CD   . GLN A 1 101 ? 6.843   -15.213 -12.802 1.00 0.00 ? 100 GLN A CD   5  
ATOM 9252  O OE1  . GLN A 1 101 ? 5.761   -15.796 -12.909 1.00 0.00 ? 100 GLN A OE1  5  
ATOM 9253  N NE2  . GLN A 1 101 ? 7.129   -14.409 -11.746 1.00 0.00 ? 100 GLN A NE2  5  
ATOM 9254  H H    . GLN A 1 101 ? 9.690   -12.927 -13.342 1.00 0.00 ? 100 GLN A H    5  
ATOM 9255  H HA   . GLN A 1 101 ? 8.250   -12.389 -15.809 1.00 0.00 ? 100 GLN A HA   5  
ATOM 9256  H HB2  . GLN A 1 101 ? 6.818   -14.466 -15.485 1.00 0.00 ? 100 GLN A HB2  5  
ATOM 9257  H HB3  . GLN A 1 101 ? 8.534   -14.808 -15.834 1.00 0.00 ? 100 GLN A HB3  5  
ATOM 9258  H HG2  . GLN A 1 101 ? 7.886   -16.393 -14.224 1.00 0.00 ? 100 GLN A HG2  5  
ATOM 9259  H HG3  . GLN A 1 101 ? 8.954   -15.253 -13.358 1.00 0.00 ? 100 GLN A HG3  5  
ATOM 9260  H HE21 . GLN A 1 101 ? 8.001   -13.884 -11.733 1.00 0.00 ? 100 GLN A HE21 5  
ATOM 9261  H HE22 . GLN A 1 101 ? 6.377   -14.260 -11.097 1.00 0.00 ? 100 GLN A HE22 5  
ATOM 9262  N N    . ARG A 1 102 ? 6.035   -11.961 -14.597 1.00 0.00 ? 101 ARG A N    5  
ATOM 9263  C CA   . ARG A 1 102 ? 5.003   -11.148 -13.968 1.00 0.00 ? 101 ARG A CA   5  
ATOM 9264  C C    . ARG A 1 102 ? 4.089   -11.895 -13.013 1.00 0.00 ? 101 ARG A C    5  
ATOM 9265  O O    . ARG A 1 102 ? 3.679   -13.027 -13.255 1.00 0.00 ? 101 ARG A O    5  
ATOM 9266  C CB   . ARG A 1 102 ? 4.258   -10.242 -14.995 1.00 0.00 ? 101 ARG A CB   5  
ATOM 9267  C CG   . ARG A 1 102 ? 3.870   -10.857 -16.364 1.00 0.00 ? 101 ARG A CG   5  
ATOM 9268  C CD   . ARG A 1 102 ? 2.981   -12.115 -16.367 1.00 0.00 ? 101 ARG A CD   5  
ATOM 9269  N NE   . ARG A 1 102 ? 1.688   -11.820 -15.656 1.00 0.00 ? 101 ARG A NE   5  
ATOM 9270  C CZ   . ARG A 1 102 ? 0.776   -12.789 -15.329 1.00 0.00 ? 101 ARG A CZ   5  
ATOM 9271  N NH1  . ARG A 1 102 ? 0.979   -14.091 -15.684 1.00 0.00 ? 101 ARG A NH1  5  
ATOM 9272  N NH2  . ARG A 1 102 ? -0.346  -12.446 -14.631 1.00 0.00 ? 101 ARG A NH2  5  
ATOM 9273  H H    . ARG A 1 102 ? 5.744   -12.432 -15.423 1.00 0.00 ? 101 ARG A H    5  
ATOM 9274  H HA   . ARG A 1 102 ? 5.457   -10.446 -13.307 1.00 0.00 ? 101 ARG A HA   5  
ATOM 9275  H HB2  . ARG A 1 102 ? 3.395   -9.729  -14.523 1.00 0.00 ? 101 ARG A HB2  5  
ATOM 9276  H HB3  . ARG A 1 102 ? 4.972   -9.420  -15.244 1.00 0.00 ? 101 ARG A HB3  5  
ATOM 9277  H HG2  . ARG A 1 102 ? 3.351   -10.067 -16.955 1.00 0.00 ? 101 ARG A HG2  5  
ATOM 9278  H HG3  . ARG A 1 102 ? 4.807   -11.106 -16.913 1.00 0.00 ? 101 ARG A HG3  5  
ATOM 9279  H HD2  . ARG A 1 102 ? 2.749   -12.405 -17.415 1.00 0.00 ? 101 ARG A HD2  5  
ATOM 9280  H HD3  . ARG A 1 102 ? 3.507   -12.955 -15.865 1.00 0.00 ? 101 ARG A HD3  5  
ATOM 9281  H HE   . ARG A 1 102 ? 1.507   -10.879 -15.375 1.00 0.00 ? 101 ARG A HE   5  
ATOM 9282  H HH11 . ARG A 1 102 ? 1.801   -14.347 -16.193 1.00 0.00 ? 101 ARG A HH11 5  
ATOM 9283  H HH12 . ARG A 1 102 ? 0.306   -14.787 -15.436 1.00 0.00 ? 101 ARG A HH12 5  
ATOM 9284  H HH21 . ARG A 1 102 ? -0.495  -11.495 -14.361 1.00 0.00 ? 101 ARG A HH21 5  
ATOM 9285  H HH22 . ARG A 1 102 ? -1.014  -13.148 -14.383 1.00 0.00 ? 101 ARG A HH22 5  
ATOM 9286  N N    . LYS A 1 103 ? 3.749   -11.218 -11.882 1.00 0.00 ? 102 LYS A N    5  
ATOM 9287  C CA   . LYS A 1 103 ? 2.806   -11.705 -10.880 1.00 0.00 ? 102 LYS A CA   5  
ATOM 9288  C C    . LYS A 1 103 ? 1.807   -10.576 -10.694 1.00 0.00 ? 102 LYS A C    5  
ATOM 9289  O O    . LYS A 1 103 ? 2.186   -9.415  -10.556 1.00 0.00 ? 102 LYS A O    5  
ATOM 9290  C CB   . LYS A 1 103 ? 3.523   -12.156 -9.568  1.00 0.00 ? 102 LYS A CB   5  
ATOM 9291  C CG   . LYS A 1 103 ? 4.042   -13.606 -9.730  1.00 0.00 ? 102 LYS A CG   5  
ATOM 9292  C CD   . LYS A 1 103 ? 5.229   -14.019 -8.847  1.00 0.00 ? 102 LYS A CD   5  
ATOM 9293  C CE   . LYS A 1 103 ? 5.475   -15.535 -8.876  1.00 0.00 ? 102 LYS A CE   5  
ATOM 9294  N NZ   . LYS A 1 103 ? 6.673   -15.897 -8.083  1.00 0.00 ? 102 LYS A NZ   5  
ATOM 9295  H H    . LYS A 1 103 ? 4.122   -10.281 -11.691 1.00 0.00 ? 102 LYS A H    5  
ATOM 9296  H HA   . LYS A 1 103 ? 2.244   -12.549 -11.257 1.00 0.00 ? 102 LYS A HA   5  
ATOM 9297  H HB2  . LYS A 1 103 ? 4.358   -11.452 -9.363  1.00 0.00 ? 102 LYS A HB2  5  
ATOM 9298  H HB3  . LYS A 1 103 ? 2.845   -12.128 -8.674  1.00 0.00 ? 102 LYS A HB3  5  
ATOM 9299  H HG2  . LYS A 1 103 ? 3.188   -14.293 -9.527  1.00 0.00 ? 102 LYS A HG2  5  
ATOM 9300  H HG3  . LYS A 1 103 ? 4.344   -13.771 -10.789 1.00 0.00 ? 102 LYS A HG3  5  
ATOM 9301  H HD2  . LYS A 1 103 ? 6.162   -13.498 -9.179  1.00 0.00 ? 102 LYS A HD2  5  
ATOM 9302  H HD3  . LYS A 1 103 ? 5.018   -13.724 -7.796  1.00 0.00 ? 102 LYS A HD3  5  
ATOM 9303  H HE2  . LYS A 1 103 ? 4.607   -16.077 -8.445  1.00 0.00 ? 102 LYS A HE2  5  
ATOM 9304  H HE3  . LYS A 1 103 ? 5.643   -15.884 -9.915  1.00 0.00 ? 102 LYS A HE3  5  
ATOM 9305  H HZ1  . LYS A 1 103 ? 7.506   -15.417 -8.478  1.00 0.00 ? 102 LYS A HZ1  5  
ATOM 9306  H HZ2  . LYS A 1 103 ? 6.816   -16.926 -8.120  1.00 0.00 ? 102 LYS A HZ2  5  
ATOM 9307  H HZ3  . LYS A 1 103 ? 6.537   -15.600 -7.096  1.00 0.00 ? 102 LYS A HZ3  5  
ATOM 9308  N N    . TRP A 1 104 ? 0.485   -10.861 -10.725 1.00 0.00 ? 103 TRP A N    5  
ATOM 9309  C CA   . TRP A 1 104 ? -0.558  -9.840  -10.600 1.00 0.00 ? 103 TRP A CA   5  
ATOM 9310  C C    . TRP A 1 104 ? -1.467  -10.233 -9.437  1.00 0.00 ? 103 TRP A C    5  
ATOM 9311  O O    . TRP A 1 104 ? -2.190  -11.227 -9.503  1.00 0.00 ? 103 TRP A O    5  
ATOM 9312  C CB   . TRP A 1 104 ? -1.333  -9.676  -11.942 1.00 0.00 ? 103 TRP A CB   5  
ATOM 9313  C CG   . TRP A 1 104 ? -0.718  -8.733  -12.986 1.00 0.00 ? 103 TRP A CG   5  
ATOM 9314  C CD1  . TRP A 1 104 ? 0.175   -8.975  -13.995 1.00 0.00 ? 103 TRP A CD1  5  
ATOM 9315  C CD2  . TRP A 1 104 ? -1.200  -7.394  -13.206 1.00 0.00 ? 103 TRP A CD2  5  
ATOM 9316  N NE1  . TRP A 1 104 ? 0.195   -7.909  -14.881 1.00 0.00 ? 103 TRP A NE1  5  
ATOM 9317  C CE2  . TRP A 1 104 ? -0.708  -6.967  -14.436 1.00 0.00 ? 103 TRP A CE2  5  
ATOM 9318  C CE3  . TRP A 1 104 ? -2.013  -6.596  -12.462 1.00 0.00 ? 103 TRP A CE3  5  
ATOM 9319  C CZ2  . TRP A 1 104 ? -1.099  -5.772  -14.969 1.00 0.00 ? 103 TRP A CZ2  5  
ATOM 9320  C CZ3  . TRP A 1 104 ? -2.359  -5.358  -12.971 1.00 0.00 ? 103 TRP A CZ3  5  
ATOM 9321  C CH2  . TRP A 1 104 ? -1.937  -4.963  -14.225 1.00 0.00 ? 103 TRP A CH2  5  
ATOM 9322  H H    . TRP A 1 104 ? 0.156   -11.794 -10.856 1.00 0.00 ? 103 TRP A H    5  
ATOM 9323  H HA   . TRP A 1 104 ? -0.149  -8.871  -10.334 1.00 0.00 ? 103 TRP A HA   5  
ATOM 9324  H HB2  . TRP A 1 104 ? -1.451  -10.684 -12.401 1.00 0.00 ? 103 TRP A HB2  5  
ATOM 9325  H HB3  . TRP A 1 104 ? -2.356  -9.282  -11.757 1.00 0.00 ? 103 TRP A HB3  5  
ATOM 9326  H HD1  . TRP A 1 104 ? 0.777   -9.866  -14.070 1.00 0.00 ? 103 TRP A HD1  5  
ATOM 9327  H HE1  . TRP A 1 104 ? 0.653   -7.878  -15.747 1.00 0.00 ? 103 TRP A HE1  5  
ATOM 9328  H HE3  . TRP A 1 104 ? -2.361  -6.896  -11.486 1.00 0.00 ? 103 TRP A HE3  5  
ATOM 9329  H HZ2  . TRP A 1 104 ? -0.758  -5.434  -15.930 1.00 0.00 ? 103 TRP A HZ2  5  
ATOM 9330  H HZ3  . TRP A 1 104 ? -2.996  -4.707  -12.387 1.00 0.00 ? 103 TRP A HZ3  5  
ATOM 9331  H HH2  . TRP A 1 104 ? -2.231  -3.995  -14.613 1.00 0.00 ? 103 TRP A HH2  5  
ATOM 9332  N N    . TYR A 1 105 ? -1.387  -9.454  -8.326  1.00 0.00 ? 104 TYR A N    5  
ATOM 9333  C CA   . TYR A 1 105 ? -2.083  -9.678  -7.057  1.00 0.00 ? 104 TYR A CA   5  
ATOM 9334  C C    . TYR A 1 105 ? -2.808  -8.444  -6.581  1.00 0.00 ? 104 TYR A C    5  
ATOM 9335  O O    . TYR A 1 105 ? -2.299  -7.347  -6.777  1.00 0.00 ? 104 TYR A O    5  
ATOM 9336  C CB   . TYR A 1 105 ? -1.164  -10.123 -5.873  1.00 0.00 ? 104 TYR A CB   5  
ATOM 9337  C CG   . TYR A 1 105 ? -0.017  -11.035 -6.240  1.00 0.00 ? 104 TYR A CG   5  
ATOM 9338  C CD1  . TYR A 1 105 ? -0.231  -12.372 -6.526  1.00 0.00 ? 104 TYR A CD1  5  
ATOM 9339  C CD2  . TYR A 1 105 ? 1.284   -10.596 -6.056  1.00 0.00 ? 104 TYR A CD2  5  
ATOM 9340  C CE1  . TYR A 1 105 ? 0.825   -13.270 -6.509  1.00 0.00 ? 104 TYR A CE1  5  
ATOM 9341  C CE2  . TYR A 1 105 ? 2.337   -11.486 -6.027  1.00 0.00 ? 104 TYR A CE2  5  
ATOM 9342  C CZ   . TYR A 1 105 ? 2.093   -12.829 -6.199  1.00 0.00 ? 104 TYR A CZ   5  
ATOM 9343  O OH   . TYR A 1 105 ? 3.128   -13.760 -5.985  1.00 0.00 ? 104 TYR A OH   5  
ATOM 9344  H H    . TYR A 1 105 ? -0.779  -8.651  -8.386  1.00 0.00 ? 104 TYR A H    5  
ATOM 9345  H HA   . TYR A 1 105 ? -2.799  -10.455 -7.099  1.00 0.00 ? 104 TYR A HA   5  
ATOM 9346  H HB2  . TYR A 1 105 ? -0.742  -9.273  -5.285  1.00 0.00 ? 104 TYR A HB2  5  
ATOM 9347  H HB3  . TYR A 1 105 ? -1.787  -10.705 -5.152  1.00 0.00 ? 104 TYR A HB3  5  
ATOM 9348  H HD1  . TYR A 1 105 ? -1.239  -12.740 -6.664  1.00 0.00 ? 104 TYR A HD1  5  
ATOM 9349  H HD2  . TYR A 1 105 ? 1.462   -9.563  -5.789  1.00 0.00 ? 104 TYR A HD2  5  
ATOM 9350  H HE1  . TYR A 1 105 ? 0.647   -14.327 -6.651  1.00 0.00 ? 104 TYR A HE1  5  
ATOM 9351  H HE2  . TYR A 1 105 ? 3.327   -11.125 -5.789  1.00 0.00 ? 104 TYR A HE2  5  
ATOM 9352  H HH   . TYR A 1 105 ? 3.894   -13.278 -5.659  1.00 0.00 ? 104 TYR A HH   5  
ATOM 9353  N N    . LYS A 1 106 ? -3.927  -8.571  -5.784  1.00 0.00 ? 105 LYS A N    5  
ATOM 9354  C CA   . LYS A 1 106 ? -4.533  -7.531  -4.965  1.00 0.00 ? 105 LYS A CA   5  
ATOM 9355  C C    . LYS A 1 106 ? -3.534  -7.028  -3.924  1.00 0.00 ? 105 LYS A C    5  
ATOM 9356  O O    . LYS A 1 106 ? -2.565  -7.730  -3.633  1.00 0.00 ? 105 LYS A O    5  
ATOM 9357  C CB   . LYS A 1 106 ? -5.754  -8.113  -4.172  1.00 0.00 ? 105 LYS A CB   5  
ATOM 9358  C CG   . LYS A 1 106 ? -6.673  -9.042  -4.985  1.00 0.00 ? 105 LYS A CG   5  
ATOM 9359  C CD   . LYS A 1 106 ? -8.152  -8.901  -4.585  1.00 0.00 ? 105 LYS A CD   5  
ATOM 9360  C CE   . LYS A 1 106 ? -9.102  -9.583  -5.580  1.00 0.00 ? 105 LYS A CE   5  
ATOM 9361  N NZ   . LYS A 1 106 ? -10.518 -9.364  -5.203  1.00 0.00 ? 105 LYS A NZ   5  
ATOM 9362  H H    . LYS A 1 106 ? -4.407  -9.415  -5.601  1.00 0.00 ? 105 LYS A H    5  
ATOM 9363  H HA   . LYS A 1 106 ? -4.828  -6.710  -5.601  1.00 0.00 ? 105 LYS A HA   5  
ATOM 9364  H HB2  . LYS A 1 106 ? -5.433  -8.718  -3.292  1.00 0.00 ? 105 LYS A HB2  5  
ATOM 9365  H HB3  . LYS A 1 106 ? -6.362  -7.264  -3.789  1.00 0.00 ? 105 LYS A HB3  5  
ATOM 9366  H HG2  . LYS A 1 106 ? -6.598  -8.797  -6.066  1.00 0.00 ? 105 LYS A HG2  5  
ATOM 9367  H HG3  . LYS A 1 106 ? -6.359  -10.103 -4.866  1.00 0.00 ? 105 LYS A HG3  5  
ATOM 9368  H HD2  . LYS A 1 106 ? -8.297  -9.325  -3.569  1.00 0.00 ? 105 LYS A HD2  5  
ATOM 9369  H HD3  . LYS A 1 106 ? -8.412  -7.821  -4.534  1.00 0.00 ? 105 LYS A HD3  5  
ATOM 9370  H HE2  . LYS A 1 106 ? -8.959  -9.162  -6.598  1.00 0.00 ? 105 LYS A HE2  5  
ATOM 9371  H HE3  . LYS A 1 106 ? -8.921  -10.677 -5.606  1.00 0.00 ? 105 LYS A HE3  5  
ATOM 9372  H HZ1  . LYS A 1 106 ? -11.137 -9.832  -5.896  1.00 0.00 ? 105 LYS A HZ1  5  
ATOM 9373  H HZ2  . LYS A 1 106 ? -10.719 -8.344  -5.192  1.00 0.00 ? 105 LYS A HZ2  5  
ATOM 9374  H HZ3  . LYS A 1 106 ? -10.690 -9.763  -4.259  1.00 0.00 ? 105 LYS A HZ3  5  
ATOM 9375  N N    . ARG A 1 107 ? -3.750  -5.836  -3.322  1.00 0.00 ? 106 ARG A N    5  
ATOM 9376  C CA   . ARG A 1 107 ? -2.901  -5.145  -2.320  1.00 0.00 ? 106 ARG A CA   5  
ATOM 9377  C C    . ARG A 1 107 ? -2.076  -5.998  -1.319  1.00 0.00 ? 106 ARG A C    5  
ATOM 9378  O O    . ARG A 1 107 ? -0.924  -5.708  -1.008  1.00 0.00 ? 106 ARG A O    5  
ATOM 9379  C CB   . ARG A 1 107 ? -3.796  -4.109  -1.556  1.00 0.00 ? 106 ARG A CB   5  
ATOM 9380  C CG   . ARG A 1 107 ? -3.081  -2.916  -0.877  1.00 0.00 ? 106 ARG A CG   5  
ATOM 9381  C CD   . ARG A 1 107 ? -2.217  -2.019  -1.783  1.00 0.00 ? 106 ARG A CD   5  
ATOM 9382  N NE   . ARG A 1 107 ? -3.077  -1.164  -2.679  1.00 0.00 ? 106 ARG A NE   5  
ATOM 9383  C CZ   . ARG A 1 107 ? -3.246  -1.396  -4.018  1.00 0.00 ? 106 ARG A CZ   5  
ATOM 9384  N NH1  . ARG A 1 107 ? -2.790  -2.545  -4.593  1.00 0.00 ? 106 ARG A NH1  5  
ATOM 9385  N NH2  . ARG A 1 107 ? -3.885  -0.468  -4.788  1.00 0.00 ? 106 ARG A NH2  5  
ATOM 9386  H H    . ARG A 1 107 ? -4.532  -5.337  -3.693  1.00 0.00 ? 106 ARG A H    5  
ATOM 9387  H HA   . ARG A 1 107 ? -2.163  -4.610  -2.901  1.00 0.00 ? 106 ARG A HA   5  
ATOM 9388  H HB2  . ARG A 1 107 ? -4.499  -3.667  -2.296  1.00 0.00 ? 106 ARG A HB2  5  
ATOM 9389  H HB3  . ARG A 1 107 ? -4.424  -4.642  -0.800  1.00 0.00 ? 106 ARG A HB3  5  
ATOM 9390  H HG2  . ARG A 1 107 ? -3.829  -2.267  -0.359  1.00 0.00 ? 106 ARG A HG2  5  
ATOM 9391  H HG3  . ARG A 1 107 ? -2.385  -3.300  -0.104  1.00 0.00 ? 106 ARG A HG3  5  
ATOM 9392  H HD2  . ARG A 1 107 ? -1.648  -1.314  -1.139  1.00 0.00 ? 106 ARG A HD2  5  
ATOM 9393  H HD3  . ARG A 1 107 ? -1.475  -2.612  -2.361  1.00 0.00 ? 106 ARG A HD3  5  
ATOM 9394  H HE   . ARG A 1 107 ? -3.445  -0.316  -2.299  1.00 0.00 ? 106 ARG A HE   5  
ATOM 9395  H HH11 . ARG A 1 107 ? -2.325  -3.232  -4.035  1.00 0.00 ? 106 ARG A HH11 5  
ATOM 9396  H HH12 . ARG A 1 107 ? -2.919  -2.699  -5.572  1.00 0.00 ? 106 ARG A HH12 5  
ATOM 9397  H HH21 . ARG A 1 107 ? -4.221  0.378   -4.375  1.00 0.00 ? 106 ARG A HH21 5  
ATOM 9398  H HH22 . ARG A 1 107 ? -4.012  -0.632  -5.766  1.00 0.00 ? 106 ARG A HH22 5  
ATOM 9399  N N    . MET A 1 108 ? -2.645  -7.162  -0.885  1.00 0.00 ? 107 MET A N    5  
ATOM 9400  C CA   . MET A 1 108 ? -2.157  -8.211  0.002   1.00 0.00 ? 107 MET A CA   5  
ATOM 9401  C C    . MET A 1 108 ? -0.839  -8.871  -0.367  1.00 0.00 ? 107 MET A C    5  
ATOM 9402  O O    . MET A 1 108 ? -0.101  -9.245  0.543   1.00 0.00 ? 107 MET A O    5  
ATOM 9403  C CB   . MET A 1 108 ? -3.270  -9.257  0.345   1.00 0.00 ? 107 MET A CB   5  
ATOM 9404  C CG   . MET A 1 108 ? -4.031  -9.906  -0.849  1.00 0.00 ? 107 MET A CG   5  
ATOM 9405  S SD   . MET A 1 108 ? -3.136  -10.949 -2.058  1.00 0.00 ? 107 MET A SD   5  
ATOM 9406  C CE   . MET A 1 108 ? -2.777  -12.391 -1.008  1.00 0.00 ? 107 MET A CE   5  
ATOM 9407  H H    . MET A 1 108 ? -3.522  -7.394  -1.276  1.00 0.00 ? 107 MET A H    5  
ATOM 9408  H HA   . MET A 1 108 ? -1.930  -7.732  0.940   1.00 0.00 ? 107 MET A HA   5  
ATOM 9409  H HB2  . MET A 1 108 ? -2.854  -10.067 0.987   1.00 0.00 ? 107 MET A HB2  5  
ATOM 9410  H HB3  . MET A 1 108 ? -4.026  -8.713  0.980   1.00 0.00 ? 107 MET A HB3  5  
ATOM 9411  H HG2  . MET A 1 108 ? -4.836  -10.538 -0.425  1.00 0.00 ? 107 MET A HG2  5  
ATOM 9412  H HG3  . MET A 1 108 ? -4.534  -9.084  -1.401  1.00 0.00 ? 107 MET A HG3  5  
ATOM 9413  H HE1  . MET A 1 108 ? -2.275  -13.194 -1.592  1.00 0.00 ? 107 MET A HE1  5  
ATOM 9414  H HE2  . MET A 1 108 ? -3.705  -12.822 -0.574  1.00 0.00 ? 107 MET A HE2  5  
ATOM 9415  H HE3  . MET A 1 108 ? -2.099  -12.108 -0.173  1.00 0.00 ? 107 MET A HE3  5  
ATOM 9416  N N    . ALA A 1 109 ? -0.469  -8.998  -1.679  1.00 0.00 ? 108 ALA A N    5  
ATOM 9417  C CA   . ALA A 1 109 ? 0.850   -9.586  -1.989  1.00 0.00 ? 108 ALA A CA   5  
ATOM 9418  C C    . ALA A 1 109 ? 1.841   -8.631  -2.606  1.00 0.00 ? 108 ALA A C    5  
ATOM 9419  O O    . ALA A 1 109 ? 2.870   -9.053  -3.124  1.00 0.00 ? 108 ALA A O    5  
ATOM 9420  C CB   . ALA A 1 109 ? 0.754   -10.914 -2.791  1.00 0.00 ? 108 ALA A CB   5  
ATOM 9421  H H    . ALA A 1 109 ? -1.089  -8.700  -2.437  1.00 0.00 ? 108 ALA A H    5  
ATOM 9422  H HA   . ALA A 1 109 ? 1.388   -9.788  -1.085  1.00 0.00 ? 108 ALA A HA   5  
ATOM 9423  H HB1  . ALA A 1 109 ? 0.168   -10.771 -3.711  1.00 0.00 ? 108 ALA A HB1  5  
ATOM 9424  H HB2  . ALA A 1 109 ? 0.241   -11.687 -2.185  1.00 0.00 ? 108 ALA A HB2  5  
ATOM 9425  H HB3  . ALA A 1 109 ? 1.745   -11.316 -3.110  1.00 0.00 ? 108 ALA A HB3  5  
ATOM 9426  N N    . VAL A 1 110 ? 1.554   -7.322  -2.574  1.00 0.00 ? 109 VAL A N    5  
ATOM 9427  C CA   . VAL A 1 110 ? 2.394   -6.237  -3.027  1.00 0.00 ? 109 VAL A CA   5  
ATOM 9428  C C    . VAL A 1 110 ? 2.553   -5.222  -1.907  1.00 0.00 ? 109 VAL A C    5  
ATOM 9429  O O    . VAL A 1 110 ? 1.643   -4.465  -1.559  1.00 0.00 ? 109 VAL A O    5  
ATOM 9430  C CB   . VAL A 1 110 ? 1.946   -5.763  -4.391  1.00 0.00 ? 109 VAL A CB   5  
ATOM 9431  C CG1  . VAL A 1 110 ? 0.501   -5.236  -4.351  1.00 0.00 ? 109 VAL A CG1  5  
ATOM 9432  C CG2  . VAL A 1 110 ? 2.966   -4.812  -5.036  1.00 0.00 ? 109 VAL A CG2  5  
ATOM 9433  H H    . VAL A 1 110 ? 0.796   -7.048  -2.004  1.00 0.00 ? 109 VAL A H    5  
ATOM 9434  H HA   . VAL A 1 110 ? 3.398   -6.633  -3.175  1.00 0.00 ? 109 VAL A HA   5  
ATOM 9435  H HB   . VAL A 1 110 ? 1.966   -6.680  -5.034  1.00 0.00 ? 109 VAL A HB   5  
ATOM 9436  H HG11 . VAL A 1 110 ? 0.480   -4.142  -4.533  1.00 0.00 ? 109 VAL A HG11 5  
ATOM 9437  H HG12 . VAL A 1 110 ? 0.021   -5.422  -3.370  1.00 0.00 ? 109 VAL A HG12 5  
ATOM 9438  H HG13 . VAL A 1 110 ? -0.111  -5.755  -5.120  1.00 0.00 ? 109 VAL A HG13 5  
ATOM 9439  H HG21 . VAL A 1 110 ? 3.003   -3.840  -4.506  1.00 0.00 ? 109 VAL A HG21 5  
ATOM 9440  H HG22 . VAL A 1 110 ? 2.671   -4.651  -6.095  1.00 0.00 ? 109 VAL A HG22 5  
ATOM 9441  H HG23 . VAL A 1 110 ? 3.972   -5.286  -5.027  1.00 0.00 ? 109 VAL A HG23 5  
ATOM 9442  N N    . ILE A 1 111 ? 3.731   -5.203  -1.261  1.00 0.00 ? 110 ILE A N    5  
ATOM 9443  C CA   . ILE A 1 111 ? 4.004   -4.337  -0.112  1.00 0.00 ? 110 ILE A CA   5  
ATOM 9444  C C    . ILE A 1 111 ? 5.288   -3.519  -0.271  1.00 0.00 ? 110 ILE A C    5  
ATOM 9445  O O    . ILE A 1 111 ? 5.889   -3.465  -1.345  1.00 0.00 ? 110 ILE A O    5  
ATOM 9446  C CB   . ILE A 1 111 ? 3.900   -5.052  1.216   1.00 0.00 ? 110 ILE A CB   5  
ATOM 9447  C CG1  . ILE A 1 111 ? 5.000   -6.078  1.510   1.00 0.00 ? 110 ILE A CG1  5  
ATOM 9448  C CG2  . ILE A 1 111 ? 2.494   -5.689  1.386   1.00 0.00 ? 110 ILE A CG2  5  
ATOM 9449  C CD1  . ILE A 1 111 ? 6.123   -5.597  2.436   1.00 0.00 ? 110 ILE A CD1  5  
ATOM 9450  H H    . ILE A 1 111 ? 4.435   -5.833  -1.592  1.00 0.00 ? 110 ILE A H    5  
ATOM 9451  H HA   . ILE A 1 111 ? 3.216   -3.603  0.040   1.00 0.00 ? 110 ILE A HA   5  
ATOM 9452  H HB   . ILE A 1 111 ? 3.961   -4.252  1.965   1.00 0.00 ? 110 ILE A HB   5  
ATOM 9453  H HG12 . ILE A 1 111 ? 4.483   -6.897  2.048   1.00 0.00 ? 110 ILE A HG12 5  
ATOM 9454  H HG13 . ILE A 1 111 ? 5.398   -6.515  0.571   1.00 0.00 ? 110 ILE A HG13 5  
ATOM 9455  H HG21 . ILE A 1 111 ? 1.691   -4.941  1.200   1.00 0.00 ? 110 ILE A HG21 5  
ATOM 9456  H HG22 . ILE A 1 111 ? 2.367   -6.078  2.418   1.00 0.00 ? 110 ILE A HG22 5  
ATOM 9457  H HG23 . ILE A 1 111 ? 2.355   -6.539  0.684   1.00 0.00 ? 110 ILE A HG23 5  
ATOM 9458  H HD11 . ILE A 1 111 ? 6.795   -4.880  1.922   1.00 0.00 ? 110 ILE A HD11 5  
ATOM 9459  H HD12 . ILE A 1 111 ? 6.731   -6.463  2.779   1.00 0.00 ? 110 ILE A HD12 5  
ATOM 9460  H HD13 . ILE A 1 111 ? 5.699   -5.100  3.333   1.00 0.00 ? 110 ILE A HD13 5  
ATOM 9461  N N    . LEU A 1 112 ? 5.738   -2.831  0.829   1.00 0.00 ? 111 LEU A N    5  
ATOM 9462  C CA   . LEU A 1 112 ? 6.910   -1.944  0.855   1.00 0.00 ? 111 LEU A CA   5  
ATOM 9463  C C    . LEU A 1 112 ? 7.686   -1.860  2.173   1.00 0.00 ? 111 LEU A C    5  
ATOM 9464  O O    . LEU A 1 112 ? 7.131   -2.072  3.242   1.00 0.00 ? 111 LEU A O    5  
ATOM 9465  C CB   . LEU A 1 112 ? 6.507   -0.493  0.487   1.00 0.00 ? 111 LEU A CB   5  
ATOM 9466  C CG   . LEU A 1 112 ? 5.067   -0.046  0.837   1.00 0.00 ? 111 LEU A CG   5  
ATOM 9467  C CD1  . LEU A 1 112 ? 4.511   -0.456  2.185   1.00 0.00 ? 111 LEU A CD1  5  
ATOM 9468  C CD2  . LEU A 1 112 ? 5.002   1.465   0.652   1.00 0.00 ? 111 LEU A CD2  5  
ATOM 9469  H H    . LEU A 1 112 ? 5.255   -2.889  1.711   1.00 0.00 ? 111 LEU A H    5  
ATOM 9470  H HA   . LEU A 1 112 ? 7.641   -2.306  0.147   1.00 0.00 ? 111 LEU A HA   5  
ATOM 9471  H HB2  . LEU A 1 112 ? 7.224   0.273   0.861   1.00 0.00 ? 111 LEU A HB2  5  
ATOM 9472  H HB3  . LEU A 1 112 ? 6.552   -0.404  -0.614  1.00 0.00 ? 111 LEU A HB3  5  
ATOM 9473  H HG   . LEU A 1 112 ? 4.393   -0.499  0.064   1.00 0.00 ? 111 LEU A HG   5  
ATOM 9474  H HD11 . LEU A 1 112 ? 5.246   -0.340  3.019   1.00 0.00 ? 111 LEU A HD11 5  
ATOM 9475  H HD12 . LEU A 1 112 ? 4.153   -1.495  2.184   1.00 0.00 ? 111 LEU A HD12 5  
ATOM 9476  H HD13 . LEU A 1 112 ? 3.635   0.155   2.455   1.00 0.00 ? 111 LEU A HD13 5  
ATOM 9477  H HD21 . LEU A 1 112 ? 4.076   1.690   0.072   1.00 0.00 ? 111 LEU A HD21 5  
ATOM 9478  H HD22 . LEU A 1 112 ? 5.924   1.710   0.089   1.00 0.00 ? 111 LEU A HD22 5  
ATOM 9479  H HD23 . LEU A 1 112 ? 5.043   2.108   1.546   1.00 0.00 ? 111 LEU A HD23 5  
ATOM 9480  N N    . SER A 1 113 ? 8.996   -1.466  2.104   1.00 0.00 ? 112 SER A N    5  
ATOM 9481  C CA   . SER A 1 113 ? 9.909   -1.195  3.222   1.00 0.00 ? 112 SER A CA   5  
ATOM 9482  C C    . SER A 1 113 ? 10.040  0.316   3.390   1.00 0.00 ? 112 SER A C    5  
ATOM 9483  O O    . SER A 1 113 ? 9.632   1.040   2.480   1.00 0.00 ? 112 SER A O    5  
ATOM 9484  C CB   . SER A 1 113 ? 11.291  -1.914  3.079   1.00 0.00 ? 112 SER A CB   5  
ATOM 9485  O OG   . SER A 1 113 ? 12.119  -1.419  2.017   1.00 0.00 ? 112 SER A OG   5  
ATOM 9486  H H    . SER A 1 113 ? 9.403   -1.285  1.211   1.00 0.00 ? 112 SER A H    5  
ATOM 9487  H HA   . SER A 1 113 ? 9.469   -1.558  4.132   1.00 0.00 ? 112 SER A HA   5  
ATOM 9488  H HB2  . SER A 1 113 ? 11.857  -1.812  4.031   1.00 0.00 ? 112 SER A HB2  5  
ATOM 9489  H HB3  . SER A 1 113 ? 11.099  -3.001  2.933   1.00 0.00 ? 112 SER A HB3  5  
ATOM 9490  H HG   . SER A 1 113 ? 11.892  -1.861  1.175   1.00 0.00 ? 112 SER A HG   5  
ATOM 9491  N N    . LEU A 1 114 ? 10.605  0.896   4.515   1.00 0.00 ? 113 LEU A N    5  
ATOM 9492  C CA   . LEU A 1 114 ? 10.623  2.371   4.669   1.00 0.00 ? 113 LEU A CA   5  
ATOM 9493  C C    . LEU A 1 114 ? 11.407  3.183   3.681   1.00 0.00 ? 113 LEU A C    5  
ATOM 9494  O O    . LEU A 1 114 ? 10.999  4.298   3.456   1.00 0.00 ? 113 LEU A O    5  
ATOM 9495  C CB   . LEU A 1 114 ? 10.789  3.143   6.025   1.00 0.00 ? 113 LEU A CB   5  
ATOM 9496  C CG   . LEU A 1 114 ? 10.364  2.466   7.334   1.00 0.00 ? 113 LEU A CG   5  
ATOM 9497  C CD1  . LEU A 1 114 ? 11.572  2.440   8.284   1.00 0.00 ? 113 LEU A CD1  5  
ATOM 9498  C CD2  . LEU A 1 114 ? 9.190   3.169   8.036   1.00 0.00 ? 113 LEU A CD2  5  
ATOM 9499  H H    . LEU A 1 114 ? 10.956  0.330   5.266   1.00 0.00 ? 113 LEU A H    5  
ATOM 9500  H HA   . LEU A 1 114 ? 9.611   2.650   4.449   1.00 0.00 ? 113 LEU A HA   5  
ATOM 9501  H HB2  . LEU A 1 114 ? 11.856  3.442   6.158   1.00 0.00 ? 113 LEU A HB2  5  
ATOM 9502  H HB3  . LEU A 1 114 ? 10.199  4.112   5.920   1.00 0.00 ? 113 LEU A HB3  5  
ATOM 9503  H HG   . LEU A 1 114 ? 10.052  1.426   7.100   1.00 0.00 ? 113 LEU A HG   5  
ATOM 9504  H HD11 . LEU A 1 114 ? 12.415  1.887   7.815   1.00 0.00 ? 113 LEU A HD11 5  
ATOM 9505  H HD12 . LEU A 1 114 ? 11.294  1.958   9.254   1.00 0.00 ? 113 LEU A HD12 5  
ATOM 9506  H HD13 . LEU A 1 114 ? 11.926  3.481   8.459   1.00 0.00 ? 113 LEU A HD13 5  
ATOM 9507  H HD21 . LEU A 1 114 ? 8.833   2.561   8.897   1.00 0.00 ? 113 LEU A HD21 5  
ATOM 9508  H HD22 . LEU A 1 114 ? 8.345   3.330   7.336   1.00 0.00 ? 113 LEU A HD22 5  
ATOM 9509  H HD23 . LEU A 1 114 ? 9.508   4.159   8.425   1.00 0.00 ? 113 LEU A HD23 5  
ATOM 9510  N N    . GLU A 1 115 ? 12.499  2.747   3.020   1.00 0.00 ? 114 GLU A N    5  
ATOM 9511  C CA   . GLU A 1 115 ? 13.145  3.641   2.019   1.00 0.00 ? 114 GLU A CA   5  
ATOM 9512  C C    . GLU A 1 115 ? 12.568  3.604   0.616   1.00 0.00 ? 114 GLU A C    5  
ATOM 9513  O O    . GLU A 1 115 ? 12.808  4.482   -0.202  1.00 0.00 ? 114 GLU A O    5  
ATOM 9514  C CB   . GLU A 1 115 ? 14.663  3.890   2.156   1.00 0.00 ? 114 GLU A CB   5  
ATOM 9515  C CG   . GLU A 1 115 ? 14.856  5.323   2.719   1.00 0.00 ? 114 GLU A CG   5  
ATOM 9516  C CD   . GLU A 1 115 ? 16.337  5.657   2.833   1.00 0.00 ? 114 GLU A CD   5  
ATOM 9517  O OE1  . GLU A 1 115 ? 17.049  4.949   3.596   1.00 0.00 ? 114 GLU A OE1  5  
ATOM 9518  O OE2  . GLU A 1 115 ? 16.781  6.626   2.160   1.00 0.00 ? 114 GLU A OE2  5  
ATOM 9519  H H    . GLU A 1 115 ? 12.826  1.822   3.208   1.00 0.00 ? 114 GLU A H    5  
ATOM 9520  H HA   . GLU A 1 115 ? 12.836  4.655   2.239   1.00 0.00 ? 114 GLU A HA   5  
ATOM 9521  H HB2  . GLU A 1 115 ? 15.100  3.150   2.860   1.00 0.00 ? 114 GLU A HB2  5  
ATOM 9522  H HB3  . GLU A 1 115 ? 15.195  3.797   1.182   1.00 0.00 ? 114 GLU A HB3  5  
ATOM 9523  H HG2  . GLU A 1 115 ? 14.332  6.066   2.050   1.00 0.00 ? 114 GLU A HG2  5  
ATOM 9524  H HG3  . GLU A 1 115 ? 14.376  5.350   3.733   1.00 0.00 ? 114 GLU A HG3  5  
ATOM 9525  N N    . GLN A 1 116 ? 11.689  2.610   0.376   1.00 0.00 ? 115 GLN A N    5  
ATOM 9526  C CA   . GLN A 1 116 ? 10.819  2.443   -0.772  1.00 0.00 ? 115 GLN A CA   5  
ATOM 9527  C C    . GLN A 1 116 ? 9.462   3.132   -0.574  1.00 0.00 ? 115 GLN A C    5  
ATOM 9528  O O    . GLN A 1 116 ? 8.832   3.531   -1.549  1.00 0.00 ? 115 GLN A O    5  
ATOM 9529  C CB   . GLN A 1 116 ? 10.643  0.949   -1.036  1.00 0.00 ? 115 GLN A CB   5  
ATOM 9530  C CG   . GLN A 1 116 ? 12.023  0.276   -1.086  1.00 0.00 ? 115 GLN A CG   5  
ATOM 9531  C CD   . GLN A 1 116 ? 11.815  -1.149  -1.529  1.00 0.00 ? 115 GLN A CD   5  
ATOM 9532  O OE1  . GLN A 1 116 ? 11.719  -2.069  -0.705  1.00 0.00 ? 115 GLN A OE1  5  
ATOM 9533  N NE2  . GLN A 1 116 ? 11.689  -1.313  -2.867  1.00 0.00 ? 115 GLN A NE2  5  
ATOM 9534  H H    . GLN A 1 116 ? 11.590  1.913   1.081   1.00 0.00 ? 115 GLN A H    5  
ATOM 9535  H HA   . GLN A 1 116 ? 11.284  2.879   -1.649  1.00 0.00 ? 115 GLN A HA   5  
ATOM 9536  H HB2  . GLN A 1 116 ? 10.059  0.473   -0.202  1.00 0.00 ? 115 GLN A HB2  5  
ATOM 9537  H HB3  . GLN A 1 116 ? 10.116  0.819   -2.020  1.00 0.00 ? 115 GLN A HB3  5  
ATOM 9538  H HG2  . GLN A 1 116 ? 12.700  0.799   -1.797  1.00 0.00 ? 115 GLN A HG2  5  
ATOM 9539  H HG3  . GLN A 1 116 ? 12.511  0.253   -0.087  1.00 0.00 ? 115 GLN A HG3  5  
ATOM 9540  H HE21 . GLN A 1 116 ? 11.330  -0.562  -3.496  1.00 0.00 ? 115 GLN A HE21 5  
ATOM 9541  H HE22 . GLN A 1 116 ? 11.713  -2.257  -3.201  1.00 0.00 ? 115 GLN A HE22 5  
ATOM 9542  N N    . GLY A 1 117 ? 9.073   3.331   0.718   1.00 0.00 ? 116 GLY A N    5  
ATOM 9543  C CA   . GLY A 1 117 ? 7.950   4.078   1.285   1.00 0.00 ? 116 GLY A CA   5  
ATOM 9544  C C    . GLY A 1 117 ? 8.203   5.534   1.642   1.00 0.00 ? 116 GLY A C    5  
ATOM 9545  O O    . GLY A 1 117 ? 7.401   6.411   1.338   1.00 0.00 ? 116 GLY A O    5  
ATOM 9546  H H    . GLY A 1 117 ? 9.646   2.919   1.417   1.00 0.00 ? 116 GLY A H    5  
ATOM 9547  H HA2  . GLY A 1 117 ? 7.094   4.046   0.633   1.00 0.00 ? 116 GLY A HA2  5  
ATOM 9548  H HA3  . GLY A 1 117 ? 7.748   3.577   2.210   1.00 0.00 ? 116 GLY A HA3  5  
ATOM 9549  N N    . ASN A 1 118 ? 9.345   5.879   2.297   1.00 0.00 ? 117 ASN A N    5  
ATOM 9550  C CA   . ASN A 1 118 ? 9.760   7.226   2.732   1.00 0.00 ? 117 ASN A CA   5  
ATOM 9551  C C    . ASN A 1 118 ? 10.260  8.088   1.590   1.00 0.00 ? 117 ASN A C    5  
ATOM 9552  O O    . ASN A 1 118 ? 10.270  9.316   1.679   1.00 0.00 ? 117 ASN A O    5  
ATOM 9553  C CB   . ASN A 1 118 ? 10.778  7.281   3.915   1.00 0.00 ? 117 ASN A CB   5  
ATOM 9554  C CG   . ASN A 1 118 ? 10.072  6.894   5.215   1.00 0.00 ? 117 ASN A CG   5  
ATOM 9555  O OD1  . ASN A 1 118 ? 8.884   6.560   5.230   1.00 0.00 ? 117 ASN A OD1  5  
ATOM 9556  N ND2  . ASN A 1 118 ? 10.817  7.000   6.343   1.00 0.00 ? 117 ASN A ND2  5  
ATOM 9557  H H    . ASN A 1 118 ? 9.997   5.159   2.594   1.00 0.00 ? 117 ASN A H    5  
ATOM 9558  H HA   . ASN A 1 118 ? 8.882   7.724   3.091   1.00 0.00 ? 117 ASN A HA   5  
ATOM 9559  H HB2  . ASN A 1 118 ? 11.637  6.606   3.731   1.00 0.00 ? 117 ASN A HB2  5  
ATOM 9560  H HB3  . ASN A 1 118 ? 11.162  8.317   4.067   1.00 0.00 ? 117 ASN A HB3  5  
ATOM 9561  H HD21 . ASN A 1 118 ? 11.777  7.272   6.277   1.00 0.00 ? 117 ASN A HD21 5  
ATOM 9562  H HD22 . ASN A 1 118 ? 10.318  6.931   7.208   1.00 0.00 ? 117 ASN A HD22 5  
ATOM 9563  N N    . ARG A 1 119 ? 10.606  7.434   0.447   1.00 0.00 ? 118 ARG A N    5  
ATOM 9564  C CA   . ARG A 1 119 ? 10.989  8.056   -0.804  1.00 0.00 ? 118 ARG A CA   5  
ATOM 9565  C C    . ARG A 1 119 ? 9.752   8.611   -1.544  1.00 0.00 ? 118 ARG A C    5  
ATOM 9566  O O    . ARG A 1 119 ? 9.850   9.480   -2.403  1.00 0.00 ? 118 ARG A O    5  
ATOM 9567  C CB   . ARG A 1 119 ? 11.666  7.046   -1.750  1.00 0.00 ? 118 ARG A CB   5  
ATOM 9568  C CG   . ARG A 1 119 ? 10.728  5.918   -2.225  1.00 0.00 ? 118 ARG A CG   5  
ATOM 9569  C CD   . ARG A 1 119 ? 10.370  5.956   -3.720  1.00 0.00 ? 118 ARG A CD   5  
ATOM 9570  N NE   . ARG A 1 119 ? 11.618  5.717   -4.528  1.00 0.00 ? 118 ARG A NE   5  
ATOM 9571  C CZ   . ARG A 1 119 ? 11.770  6.108   -5.833  1.00 0.00 ? 118 ARG A CZ   5  
ATOM 9572  N NH1  . ARG A 1 119 ? 10.785  6.791   -6.484  1.00 0.00 ? 118 ARG A NH1  5  
ATOM 9573  N NH2  . ARG A 1 119 ? 12.927  5.804   -6.491  1.00 0.00 ? 118 ARG A NH2  5  
ATOM 9574  H H    . ARG A 1 119 ? 10.574  6.437   0.434   1.00 0.00 ? 118 ARG A H    5  
ATOM 9575  H HA   . ARG A 1 119 ? 11.734  8.806   -0.555  1.00 0.00 ? 118 ARG A HA   5  
ATOM 9576  H HB2  . ARG A 1 119 ? 12.096  7.572   -2.632  1.00 0.00 ? 118 ARG A HB2  5  
ATOM 9577  H HB3  . ARG A 1 119 ? 12.530  6.598   -1.212  1.00 0.00 ? 118 ARG A HB3  5  
ATOM 9578  H HG2  . ARG A 1 119 ? 11.235  4.950   -2.034  1.00 0.00 ? 118 ARG A HG2  5  
ATOM 9579  H HG3  . ARG A 1 119 ? 9.772   5.940   -1.621  1.00 0.00 ? 118 ARG A HG3  5  
ATOM 9580  H HD2  . ARG A 1 119 ? 9.653   5.138   -3.944  1.00 0.00 ? 118 ARG A HD2  5  
ATOM 9581  H HD3  . ARG A 1 119 ? 9.916   6.939   -3.977  1.00 0.00 ? 118 ARG A HD3  5  
ATOM 9582  H HE   . ARG A 1 119 ? 12.370  5.222   -4.092  1.00 0.00 ? 118 ARG A HE   5  
ATOM 9583  H HH11 . ARG A 1 119 ? 9.935   7.014   -6.009  1.00 0.00 ? 118 ARG A HH11 5  
ATOM 9584  H HH12 . ARG A 1 119 ? 10.915  7.067   -7.436  1.00 0.00 ? 118 ARG A HH12 5  
ATOM 9585  H HH21 . ARG A 1 119 ? 13.652  5.301   -6.020  1.00 0.00 ? 118 ARG A HH21 5  
ATOM 9586  H HH22 . ARG A 1 119 ? 13.048  6.083   -7.443  1.00 0.00 ? 118 ARG A HH22 5  
ATOM 9587  N N    . LEU A 1 120 ? 8.547   8.040   -1.194  1.00 0.00 ? 119 LEU A N    5  
ATOM 9588  C CA   . LEU A 1 120 ? 7.188   8.342   -1.660  1.00 0.00 ? 119 LEU A CA   5  
ATOM 9589  C C    . LEU A 1 120 ? 6.613   9.364   -0.741  1.00 0.00 ? 119 LEU A C    5  
ATOM 9590  O O    . LEU A 1 120 ? 6.009   10.324  -1.197  1.00 0.00 ? 119 LEU A O    5  
ATOM 9591  C CB   . LEU A 1 120 ? 6.188   7.134   -1.659  1.00 0.00 ? 119 LEU A CB   5  
ATOM 9592  C CG   . LEU A 1 120 ? 4.723   7.440   -2.016  1.00 0.00 ? 119 LEU A CG   5  
ATOM 9593  C CD1  . LEU A 1 120 ? 4.193   6.590   -3.148  1.00 0.00 ? 119 LEU A CD1  5  
ATOM 9594  C CD2  . LEU A 1 120 ? 3.801   7.006   -0.886  1.00 0.00 ? 119 LEU A CD2  5  
ATOM 9595  H H    . LEU A 1 120 ? 8.593   7.315   -0.504  1.00 0.00 ? 119 LEU A H    5  
ATOM 9596  H HA   . LEU A 1 120 ? 7.181   8.817   -2.629  1.00 0.00 ? 119 LEU A HA   5  
ATOM 9597  H HB2  . LEU A 1 120 ? 6.428   6.389   -2.416  1.00 0.00 ? 119 LEU A HB2  5  
ATOM 9598  H HB3  . LEU A 1 120 ? 6.223   6.593   -0.691  1.00 0.00 ? 119 LEU A HB3  5  
ATOM 9599  H HG   . LEU A 1 120 ? 4.664   8.493   -2.367  1.00 0.00 ? 119 LEU A HG   5  
ATOM 9600  H HD11 . LEU A 1 120 ? 4.469   5.542   -2.944  1.00 0.00 ? 119 LEU A HD11 5  
ATOM 9601  H HD12 . LEU A 1 120 ? 4.570   6.887   -4.137  1.00 0.00 ? 119 LEU A HD12 5  
ATOM 9602  H HD13 . LEU A 1 120 ? 3.075   6.648   -3.138  1.00 0.00 ? 119 LEU A HD13 5  
ATOM 9603  H HD21 . LEU A 1 120 ? 2.745   7.239   -1.141  1.00 0.00 ? 119 LEU A HD21 5  
ATOM 9604  H HD22 . LEU A 1 120 ? 4.067   7.482   0.072   1.00 0.00 ? 119 LEU A HD22 5  
ATOM 9605  H HD23 . LEU A 1 120 ? 3.884   5.886   -0.799  1.00 0.00 ? 119 LEU A HD23 5  
ATOM 9606  N N    . ARG A 1 121 ? 6.773   9.172   0.580   1.00 0.00 ? 120 ARG A N    5  
ATOM 9607  C CA   . ARG A 1 121 ? 6.251   9.949   1.689   1.00 0.00 ? 120 ARG A CA   5  
ATOM 9608  C C    . ARG A 1 121 ? 6.026   11.477  1.594   1.00 0.00 ? 120 ARG A C    5  
ATOM 9609  O O    . ARG A 1 121 ? 4.987   11.993  1.999   1.00 0.00 ? 120 ARG A O    5  
ATOM 9610  C CB   . ARG A 1 121 ? 7.095   9.575   2.963   1.00 0.00 ? 120 ARG A CB   5  
ATOM 9611  C CG   . ARG A 1 121 ? 6.898   10.344  4.285   1.00 0.00 ? 120 ARG A CG   5  
ATOM 9612  C CD   . ARG A 1 121 ? 8.057   11.311  4.597   1.00 0.00 ? 120 ARG A CD   5  
ATOM 9613  N NE   . ARG A 1 121 ? 7.718   12.125  5.818   1.00 0.00 ? 120 ARG A NE   5  
ATOM 9614  C CZ   . ARG A 1 121 ? 6.991   13.287  5.784   1.00 0.00 ? 120 ARG A CZ   5  
ATOM 9615  N NH1  . ARG A 1 121 ? 6.537   13.806  4.606   1.00 0.00 ? 120 ARG A NH1  5  
ATOM 9616  N NH2  . ARG A 1 121 ? 6.714   13.934  6.954   1.00 0.00 ? 120 ARG A NH2  5  
ATOM 9617  H H    . ARG A 1 121 ? 7.232   8.333   0.873   1.00 0.00 ? 120 ARG A H    5  
ATOM 9618  H HA   . ARG A 1 121 ? 5.260   9.536   1.612   1.00 0.00 ? 120 ARG A HA   5  
ATOM 9619  H HB2  . ARG A 1 121 ? 7.060   8.470   3.189   1.00 0.00 ? 120 ARG A HB2  5  
ATOM 9620  H HB3  . ARG A 1 121 ? 8.150   9.786   2.680   1.00 0.00 ? 120 ARG A HB3  5  
ATOM 9621  H HG2  . ARG A 1 121 ? 5.948   10.914  4.266   1.00 0.00 ? 120 ARG A HG2  5  
ATOM 9622  H HG3  . ARG A 1 121 ? 6.819   9.608   5.119   1.00 0.00 ? 120 ARG A HG3  5  
ATOM 9623  H HD2  . ARG A 1 121 ? 8.979   10.732  4.822   1.00 0.00 ? 120 ARG A HD2  5  
ATOM 9624  H HD3  . ARG A 1 121 ? 8.266   11.980  3.734   1.00 0.00 ? 120 ARG A HD3  5  
ATOM 9625  H HE   . ARG A 1 121 ? 8.028   11.787  6.707   1.00 0.00 ? 120 ARG A HE   5  
ATOM 9626  H HH11 . ARG A 1 121 ? 6.732   13.335  3.746   1.00 0.00 ? 120 ARG A HH11 5  
ATOM 9627  H HH12 . ARG A 1 121 ? 6.006   14.654  4.605   1.00 0.00 ? 120 ARG A HH12 5  
ATOM 9628  H HH21 . ARG A 1 121 ? 7.042   13.559  7.821   1.00 0.00 ? 120 ARG A HH21 5  
ATOM 9629  H HH22 . ARG A 1 121 ? 6.183   14.781  6.943   1.00 0.00 ? 120 ARG A HH22 5  
ATOM 9630  N N    . GLU A 1 122 ? 7.005   12.207  1.000   1.00 0.00 ? 121 GLU A N    5  
ATOM 9631  C CA   . GLU A 1 122 ? 7.002   13.635  0.726   1.00 0.00 ? 121 GLU A CA   5  
ATOM 9632  C C    . GLU A 1 122 ? 6.408   14.012  -0.644  1.00 0.00 ? 121 GLU A C    5  
ATOM 9633  O O    . GLU A 1 122 ? 6.040   15.165  -0.857  1.00 0.00 ? 121 GLU A O    5  
ATOM 9634  C CB   . GLU A 1 122 ? 8.456   14.172  0.858   1.00 0.00 ? 121 GLU A CB   5  
ATOM 9635  C CG   . GLU A 1 122 ? 9.495   13.436  -0.015  1.00 0.00 ? 121 GLU A CG   5  
ATOM 9636  C CD   . GLU A 1 122 ? 10.887  14.016  0.240   1.00 0.00 ? 121 GLU A CD   5  
ATOM 9637  O OE1  . GLU A 1 122 ? 11.092  15.222  -0.063  1.00 0.00 ? 121 GLU A OE1  5  
ATOM 9638  O OE2  . GLU A 1 122 ? 11.762  13.260  0.739   1.00 0.00 ? 121 GLU A OE2  5  
ATOM 9639  H H    . GLU A 1 122 ? 7.829   11.741  0.692   1.00 0.00 ? 121 GLU A H    5  
ATOM 9640  H HA   . GLU A 1 122 ? 6.396   14.144  1.469   1.00 0.00 ? 121 GLU A HA   5  
ATOM 9641  H HB2  . GLU A 1 122 ? 8.479   15.266  0.647   1.00 0.00 ? 121 GLU A HB2  5  
ATOM 9642  H HB3  . GLU A 1 122 ? 8.760   14.041  1.922   1.00 0.00 ? 121 GLU A HB3  5  
ATOM 9643  H HG2  . GLU A 1 122 ? 9.503   12.352  0.235   1.00 0.00 ? 121 GLU A HG2  5  
ATOM 9644  H HG3  . GLU A 1 122 ? 9.252   13.549  -1.092  1.00 0.00 ? 121 GLU A HG3  5  
ATOM 9645  N N    . GLN A 1 123 ? 6.302   13.037  -1.593  1.00 0.00 ? 122 GLN A N    5  
ATOM 9646  C CA   . GLN A 1 123 ? 5.774   13.194  -2.940  1.00 0.00 ? 122 GLN A CA   5  
ATOM 9647  C C    . GLN A 1 123 ? 4.382   12.607  -3.145  1.00 0.00 ? 122 GLN A C    5  
ATOM 9648  O O    . GLN A 1 123 ? 3.557   13.253  -3.788  1.00 0.00 ? 122 GLN A O    5  
ATOM 9649  C CB   . GLN A 1 123 ? 6.749   12.678  -4.058  1.00 0.00 ? 122 GLN A CB   5  
ATOM 9650  C CG   . GLN A 1 123 ? 7.289   11.227  -3.939  1.00 0.00 ? 122 GLN A CG   5  
ATOM 9651  C CD   . GLN A 1 123 ? 8.148   10.853  -5.174  1.00 0.00 ? 122 GLN A CD   5  
ATOM 9652  O OE1  . GLN A 1 123 ? 8.041   11.405  -6.276  1.00 0.00 ? 122 GLN A OE1  5  
ATOM 9653  N NE2  . GLN A 1 123 ? 9.026   9.835   -4.999  1.00 0.00 ? 122 GLN A NE2  5  
ATOM 9654  H H    . GLN A 1 123 ? 6.566   12.095  -1.380  1.00 0.00 ? 122 GLN A H    5  
ATOM 9655  H HA   . GLN A 1 123 ? 5.642   14.250  -3.148  1.00 0.00 ? 122 GLN A HA   5  
ATOM 9656  H HB2  . GLN A 1 123 ? 6.260   12.797  -5.054  1.00 0.00 ? 122 GLN A HB2  5  
ATOM 9657  H HB3  . GLN A 1 123 ? 7.630   13.361  -4.052  1.00 0.00 ? 122 GLN A HB3  5  
ATOM 9658  H HG2  . GLN A 1 123 ? 7.946   11.191  -3.046  1.00 0.00 ? 122 GLN A HG2  5  
ATOM 9659  H HG3  . GLN A 1 123 ? 6.463   10.468  -3.784  1.00 0.00 ? 122 GLN A HG3  5  
ATOM 9660  H HE21 . GLN A 1 123 ? 9.297   9.598   -4.051  1.00 0.00 ? 122 GLN A HE21 5  
ATOM 9661  H HE22 . GLN A 1 123 ? 9.498   9.480   -5.805  1.00 0.00 ? 122 GLN A HE22 5  
ATOM 9662  N N    . TYR A 1 124 ? 4.077   11.355  -2.665  1.00 0.00 ? 123 TYR A N    5  
ATOM 9663  C CA   . TYR A 1 124 ? 2.800   10.717  -3.012  1.00 0.00 ? 123 TYR A CA   5  
ATOM 9664  C C    . TYR A 1 124 ? 2.014   10.136  -1.863  1.00 0.00 ? 123 TYR A C    5  
ATOM 9665  O O    . TYR A 1 124 ? 1.119   9.354   -2.166  1.00 0.00 ? 123 TYR A O    5  
ATOM 9666  C CB   . TYR A 1 124 ? 2.798   9.700   -4.245  1.00 0.00 ? 123 TYR A CB   5  
ATOM 9667  C CG   . TYR A 1 124 ? 3.672   10.127  -5.394  1.00 0.00 ? 123 TYR A CG   5  
ATOM 9668  C CD1  . TYR A 1 124 ? 3.334   11.230  -6.162  1.00 0.00 ? 123 TYR A CD1  5  
ATOM 9669  C CD2  . TYR A 1 124 ? 4.804   9.408   -5.734  1.00 0.00 ? 123 TYR A CD2  5  
ATOM 9670  C CE1  . TYR A 1 124 ? 4.154   11.656  -7.188  1.00 0.00 ? 123 TYR A CE1  5  
ATOM 9671  C CE2  . TYR A 1 124 ? 5.585   9.788   -6.804  1.00 0.00 ? 123 TYR A CE2  5  
ATOM 9672  C CZ   . TYR A 1 124 ? 5.292   10.947  -7.489  1.00 0.00 ? 123 TYR A CZ   5  
ATOM 9673  O OH   . TYR A 1 124 ? 6.263   11.485  -8.354  1.00 0.00 ? 123 TYR A OH   5  
ATOM 9674  H H    . TYR A 1 124 ? 4.729   10.810  -2.080  1.00 0.00 ? 123 TYR A H    5  
ATOM 9675  H HA   . TYR A 1 124 ? 2.109   11.483  -3.351  1.00 0.00 ? 123 TYR A HA   5  
ATOM 9676  H HB2  . TYR A 1 124 ? 2.897   8.582   -4.104  1.00 0.00 ? 123 TYR A HB2  5  
ATOM 9677  H HB3  . TYR A 1 124 ? 1.777   9.763   -4.650  1.00 0.00 ? 123 TYR A HB3  5  
ATOM 9678  H HD1  . TYR A 1 124 ? 2.455   11.807  -5.909  1.00 0.00 ? 123 TYR A HD1  5  
ATOM 9679  H HD2  . TYR A 1 124 ? 5.104   8.548   -5.158  1.00 0.00 ? 123 TYR A HD2  5  
ATOM 9680  H HE1  . TYR A 1 124 ? 3.930   12.575  -7.715  1.00 0.00 ? 123 TYR A HE1  5  
ATOM 9681  H HE2  . TYR A 1 124 ? 6.484   9.231   -7.037  1.00 0.00 ? 123 TYR A HE2  5  
ATOM 9682  H HH   . TYR A 1 124 ? 7.080   11.489  -7.820  1.00 0.00 ? 123 TYR A HH   5  
ATOM 9683  N N    . GLY A 1 125 ? 2.202   10.431  -0.532  1.00 0.00 ? 124 GLY A N    5  
ATOM 9684  C CA   . GLY A 1 125 ? 1.206   9.830   0.321   1.00 0.00 ? 124 GLY A CA   5  
ATOM 9685  C C    . GLY A 1 125 ? 1.589   9.708   1.720   1.00 0.00 ? 124 GLY A C    5  
ATOM 9686  O O    . GLY A 1 125 ? 0.814   10.011  2.610   1.00 0.00 ? 124 GLY A O    5  
ATOM 9687  H H    . GLY A 1 125 ? 2.860   11.021  -0.039  1.00 0.00 ? 124 GLY A H    5  
ATOM 9688  H HA2  . GLY A 1 125 ? 0.325   10.457  0.300   1.00 0.00 ? 124 GLY A HA2  5  
ATOM 9689  H HA3  . GLY A 1 125 ? 0.993   8.787   0.042   1.00 0.00 ? 124 GLY A HA3  5  
ATOM 9690  N N    . LEU A 1 126 ? 2.790   9.181   2.020   1.00 0.00 ? 125 LEU A N    5  
ATOM 9691  C CA   . LEU A 1 126 ? 3.229   8.748   3.354   1.00 0.00 ? 125 LEU A CA   5  
ATOM 9692  C C    . LEU A 1 126 ? 3.472   9.778   4.452   1.00 0.00 ? 125 LEU A C    5  
ATOM 9693  O O    . LEU A 1 126 ? 3.981   9.488   5.533   1.00 0.00 ? 125 LEU A O    5  
ATOM 9694  C CB   . LEU A 1 126 ? 4.236   7.580   3.148   1.00 0.00 ? 125 LEU A CB   5  
ATOM 9695  C CG   . LEU A 1 126 ? 3.593   6.260   3.474   1.00 0.00 ? 125 LEU A CG   5  
ATOM 9696  C CD1  . LEU A 1 126 ? 3.844   5.299   2.301   1.00 0.00 ? 125 LEU A CD1  5  
ATOM 9697  C CD2  . LEU A 1 126 ? 3.504   5.928   4.988   1.00 0.00 ? 125 LEU A CD2  5  
ATOM 9698  H H    . LEU A 1 126 ? 3.405   8.958   1.270   1.00 0.00 ? 125 LEU A H    5  
ATOM 9699  H HA   . LEU A 1 126 ? 2.366   8.276   3.795   1.00 0.00 ? 125 LEU A HA   5  
ATOM 9700  H HB2  . LEU A 1 126 ? 4.501   7.567   2.063   1.00 0.00 ? 125 LEU A HB2  5  
ATOM 9701  H HB3  . LEU A 1 126 ? 5.182   7.508   3.677   1.00 0.00 ? 125 LEU A HB3  5  
ATOM 9702  H HG   . LEU A 1 126 ? 2.535   6.425   3.304   1.00 0.00 ? 125 LEU A HG   5  
ATOM 9703  H HD11 . LEU A 1 126 ? 3.208   5.766   1.496   1.00 0.00 ? 125 LEU A HD11 5  
ATOM 9704  H HD12 . LEU A 1 126 ? 3.437   4.291   2.485   1.00 0.00 ? 125 LEU A HD12 5  
ATOM 9705  H HD13 . LEU A 1 126 ? 4.878   5.258   1.904   1.00 0.00 ? 125 LEU A HD13 5  
ATOM 9706  H HD21 . LEU A 1 126 ? 2.996   4.957   5.147   1.00 0.00 ? 125 LEU A HD21 5  
ATOM 9707  H HD22 . LEU A 1 126 ? 2.817   6.694   5.474   1.00 0.00 ? 125 LEU A HD22 5  
ATOM 9708  H HD23 . LEU A 1 126 ? 4.487   5.933   5.489   1.00 0.00 ? 125 LEU A HD23 5  
ATOM 9709  N N    . GLY A 1 127 ? 2.993   11.012  4.183   1.00 0.00 ? 126 GLY A N    5  
ATOM 9710  C CA   . GLY A 1 127 ? 2.970   12.112  5.135   1.00 0.00 ? 126 GLY A CA   5  
ATOM 9711  C C    . GLY A 1 127 ? 1.960   13.190  4.804   1.00 0.00 ? 126 GLY A C    5  
ATOM 9712  O O    . GLY A 1 127 ? 2.331   14.093  4.063   1.00 0.00 ? 126 GLY A O    5  
ATOM 9713  H H    . GLY A 1 127 ? 2.600   11.117  3.251   1.00 0.00 ? 126 GLY A H    5  
ATOM 9714  H HA2  . GLY A 1 127 ? 2.766   11.737  6.131   1.00 0.00 ? 126 GLY A HA2  5  
ATOM 9715  H HA3  . GLY A 1 127 ? 3.936   12.593  5.068   1.00 0.00 ? 126 GLY A HA3  5  
ATOM 9716  N N    . PRO A 1 128 ? 0.685   13.198  5.255   1.00 0.00 ? 127 PRO A N    5  
ATOM 9717  C CA   . PRO A 1 128 ? -0.243  14.325  5.074   1.00 0.00 ? 127 PRO A CA   5  
ATOM 9718  C C    . PRO A 1 128 ? -0.079  15.383  6.190   1.00 0.00 ? 127 PRO A C    5  
ATOM 9719  O O    . PRO A 1 128 ? -0.410  16.548  5.982   1.00 0.00 ? 127 PRO A O    5  
ATOM 9720  C CB   . PRO A 1 128 ? -1.613  13.622  5.179   1.00 0.00 ? 127 PRO A CB   5  
ATOM 9721  C CG   . PRO A 1 128 ? -1.394  12.540  6.245   1.00 0.00 ? 127 PRO A CG   5  
ATOM 9722  C CD   . PRO A 1 128 ? 0.055   12.086  5.976   1.00 0.00 ? 127 PRO A CD   5  
ATOM 9723  H HA   . PRO A 1 128 ? -0.107  14.821  4.120   1.00 0.00 ? 127 PRO A HA   5  
ATOM 9724  H HB2  . PRO A 1 128 ? -2.454  14.305  5.428   1.00 0.00 ? 127 PRO A HB2  5  
ATOM 9725  H HB3  . PRO A 1 128 ? -1.828  13.135  4.200   1.00 0.00 ? 127 PRO A HB3  5  
ATOM 9726  H HG2  . PRO A 1 128 ? -1.500  13.005  7.253   1.00 0.00 ? 127 PRO A HG2  5  
ATOM 9727  H HG3  . PRO A 1 128 ? -2.133  11.718  6.184   1.00 0.00 ? 127 PRO A HG3  5  
ATOM 9728  H HD2  . PRO A 1 128 ? 0.589   11.849  6.922   1.00 0.00 ? 127 PRO A HD2  5  
ATOM 9729  H HD3  . PRO A 1 128 ? 0.042   11.186  5.318   1.00 0.00 ? 127 PRO A HD3  5  
ATOM 9730  N N    . TYR A 1 129 ? 0.403   14.962  7.385   1.00 0.00 ? 128 TYR A N    5  
ATOM 9731  C CA   . TYR A 1 129 ? 0.608   15.704  8.603   1.00 0.00 ? 128 TYR A CA   5  
ATOM 9732  C C    . TYR A 1 129 ? 2.107   15.709  8.874   1.00 0.00 ? 128 TYR A C    5  
ATOM 9733  O O    . TYR A 1 129 ? 2.752   14.662  8.833   1.00 0.00 ? 128 TYR A O    5  
ATOM 9734  C CB   . TYR A 1 129 ? -0.174  14.999  9.757   1.00 0.00 ? 128 TYR A CB   5  
ATOM 9735  C CG   . TYR A 1 129 ? -0.459  15.954  10.883  1.00 0.00 ? 128 TYR A CG   5  
ATOM 9736  C CD1  . TYR A 1 129 ? -1.560  16.791  10.831  1.00 0.00 ? 128 TYR A CD1  5  
ATOM 9737  C CD2  . TYR A 1 129 ? 0.404   16.036  11.959  1.00 0.00 ? 128 TYR A CD2  5  
ATOM 9738  C CE1  . TYR A 1 129 ? -1.784  17.716  11.833  1.00 0.00 ? 128 TYR A CE1  5  
ATOM 9739  C CE2  . TYR A 1 129 ? 0.185   16.961  12.959  1.00 0.00 ? 128 TYR A CE2  5  
ATOM 9740  C CZ   . TYR A 1 129 ? -0.903  17.801  12.889  1.00 0.00 ? 128 TYR A CZ   5  
ATOM 9741  O OH   . TYR A 1 129 ? -1.103  18.747  13.906  1.00 0.00 ? 128 TYR A OH   5  
ATOM 9742  H H    . TYR A 1 129 ? 0.648   14.001  7.444   1.00 0.00 ? 128 TYR A H    5  
ATOM 9743  H HA   . TYR A 1 129 ? 0.270   16.727  8.474   1.00 0.00 ? 128 TYR A HA   5  
ATOM 9744  H HB2  . TYR A 1 129 ? -1.153  14.636  9.377   1.00 0.00 ? 128 TYR A HB2  5  
ATOM 9745  H HB3  . TYR A 1 129 ? 0.363   14.108  10.150  1.00 0.00 ? 128 TYR A HB3  5  
ATOM 9746  H HD1  . TYR A 1 129 ? -2.242  16.734  9.991   1.00 0.00 ? 128 TYR A HD1  5  
ATOM 9747  H HD2  . TYR A 1 129 ? 1.272   15.390  12.005  1.00 0.00 ? 128 TYR A HD2  5  
ATOM 9748  H HE1  . TYR A 1 129 ? -2.639  18.378  11.782  1.00 0.00 ? 128 TYR A HE1  5  
ATOM 9749  H HE2  . TYR A 1 129 ? 0.870   17.036  13.793  1.00 0.00 ? 128 TYR A HE2  5  
ATOM 9750  H HH   . TYR A 1 129 ? -1.917  19.219  13.725  1.00 0.00 ? 128 TYR A HH   5  
ATOM 9751  N N    . GLU A 1 130 ? 2.681   16.901  9.160   1.00 0.00 ? 129 GLU A N    5  
ATOM 9752  C CA   . GLU A 1 130 ? 4.093   17.090  9.429   1.00 0.00 ? 129 GLU A CA   5  
ATOM 9753  C C    . GLU A 1 130 ? 4.254   18.493  9.975   1.00 0.00 ? 129 GLU A C    5  
ATOM 9754  O O    . GLU A 1 130 ? 3.286   19.257  9.980   1.00 0.00 ? 129 GLU A O    5  
ATOM 9755  C CB   . GLU A 1 130 ? 5.001   16.865  8.181   1.00 0.00 ? 129 GLU A CB   5  
ATOM 9756  C CG   . GLU A 1 130 ? 4.661   17.723  6.944   1.00 0.00 ? 129 GLU A CG   5  
ATOM 9757  C CD   . GLU A 1 130 ? 5.483   17.241  5.750   1.00 0.00 ? 129 GLU A CD   5  
ATOM 9758  O OE1  . GLU A 1 130 ? 6.738   17.341  5.813   1.00 0.00 ? 129 GLU A OE1  5  
ATOM 9759  O OE2  . GLU A 1 130 ? 4.867   16.764  4.759   1.00 0.00 ? 129 GLU A OE2  5  
ATOM 9760  H H    . GLU A 1 130 ? 2.150   17.749  9.196   1.00 0.00 ? 129 GLU A H    5  
ATOM 9761  H HA   . GLU A 1 130 ? 4.389   16.411  10.220  1.00 0.00 ? 129 GLU A HA   5  
ATOM 9762  H HB2  . GLU A 1 130 ? 6.070   17.011  8.452   1.00 0.00 ? 129 GLU A HB2  5  
ATOM 9763  H HB3  . GLU A 1 130 ? 4.888   15.795  7.890   1.00 0.00 ? 129 GLU A HB3  5  
ATOM 9764  H HG2  . GLU A 1 130 ? 3.579   17.627  6.705   1.00 0.00 ? 129 GLU A HG2  5  
ATOM 9765  H HG3  . GLU A 1 130 ? 4.886   18.794  7.135   1.00 0.00 ? 129 GLU A HG3  5  
ATOM 9766  N N    . ASN A 1 8   ? -15.250 11.403  1.214   1.00 0.00 ? 7   ASN A N    6  
ATOM 9767  C CA   . ASN A 1 8   ? -16.023 12.073  0.201   1.00 0.00 ? 7   ASN A CA   6  
ATOM 9768  C C    . ASN A 1 8   ? -15.162 12.299  -1.029  1.00 0.00 ? 7   ASN A C    6  
ATOM 9769  O O    . ASN A 1 8   ? -15.661 12.343  -2.148  1.00 0.00 ? 7   ASN A O    6  
ATOM 9770  C CB   . ASN A 1 8   ? -16.749 13.355  0.733   1.00 0.00 ? 7   ASN A CB   6  
ATOM 9771  C CG   . ASN A 1 8   ? -15.831 14.303  1.516   1.00 0.00 ? 7   ASN A CG   6  
ATOM 9772  O OD1  . ASN A 1 8   ? -14.987 13.884  2.312   1.00 0.00 ? 7   ASN A OD1  6  
ATOM 9773  N ND2  . ASN A 1 8   ? -16.024 15.630  1.318   1.00 0.00 ? 7   ASN A ND2  6  
ATOM 9774  H H    . ASN A 1 8   ? -14.995 12.036  1.959   1.00 0.00 ? 7   ASN A H    6  
ATOM 9775  H HA   . ASN A 1 8   ? -16.791 11.378  -0.106  1.00 0.00 ? 7   ASN A HA   6  
ATOM 9776  H HB2  . ASN A 1 8   ? -17.252 13.891  -0.098  1.00 0.00 ? 7   ASN A HB2  6  
ATOM 9777  H HB3  . ASN A 1 8   ? -17.535 13.023  1.448   1.00 0.00 ? 7   ASN A HB3  6  
ATOM 9778  H HD21 . ASN A 1 8   ? -16.778 15.932  0.721   1.00 0.00 ? 7   ASN A HD21 6  
ATOM 9779  H HD22 . ASN A 1 8   ? -15.464 16.253  1.880   1.00 0.00 ? 7   ASN A HD22 6  
ATOM 9780  N N    . SER A 1 9   ? -13.822 12.405  -0.852  1.00 0.00 ? 8   SER A N    6  
ATOM 9781  C CA   . SER A 1 9   ? -12.811 12.606  -1.889  1.00 0.00 ? 8   SER A CA   6  
ATOM 9782  C C    . SER A 1 9   ? -12.043 11.337  -2.280  1.00 0.00 ? 8   SER A C    6  
ATOM 9783  O O    . SER A 1 9   ? -11.995 10.964  -3.448  1.00 0.00 ? 8   SER A O    6  
ATOM 9784  C CB   . SER A 1 9   ? -11.818 13.714  -1.433  1.00 0.00 ? 8   SER A CB   6  
ATOM 9785  O OG   . SER A 1 9   ? -11.362 13.476  -0.097  1.00 0.00 ? 8   SER A OG   6  
ATOM 9786  H H    . SER A 1 9   ? -13.463 12.370  0.082   1.00 0.00 ? 8   SER A H    6  
ATOM 9787  H HA   . SER A 1 9   ? -13.280 12.955  -2.801  1.00 0.00 ? 8   SER A HA   6  
ATOM 9788  H HB2  . SER A 1 9   ? -10.955 13.815  -2.130  1.00 0.00 ? 8   SER A HB2  6  
ATOM 9789  H HB3  . SER A 1 9   ? -12.370 14.681  -1.437  1.00 0.00 ? 8   SER A HB3  6  
ATOM 9790  H HG   . SER A 1 9   ? -10.868 14.258  0.177   1.00 0.00 ? 8   SER A HG   6  
ATOM 9791  N N    . PHE A 1 10  ? -11.401 10.645  -1.304  1.00 0.00 ? 9   PHE A N    6  
ATOM 9792  C CA   . PHE A 1 10  ? -10.524 9.486   -1.480  1.00 0.00 ? 9   PHE A CA   6  
ATOM 9793  C C    . PHE A 1 10  ? -11.190 8.152   -1.331  1.00 0.00 ? 9   PHE A C    6  
ATOM 9794  O O    . PHE A 1 10  ? -10.593 7.159   -0.938  1.00 0.00 ? 9   PHE A O    6  
ATOM 9795  C CB   . PHE A 1 10  ? -9.396  9.503   -0.445  1.00 0.00 ? 9   PHE A CB   6  
ATOM 9796  C CG   . PHE A 1 10  ? -8.532  10.673  -0.645  1.00 0.00 ? 9   PHE A CG   6  
ATOM 9797  C CD1  . PHE A 1 10  ? -7.479  10.588  -1.519  1.00 0.00 ? 9   PHE A CD1  6  
ATOM 9798  C CD2  . PHE A 1 10  ? -8.727  11.818  0.071   1.00 0.00 ? 9   PHE A CD2  6  
ATOM 9799  C CE1  . PHE A 1 10  ? -6.525  11.565  -1.556  1.00 0.00 ? 9   PHE A CE1  6  
ATOM 9800  C CE2  . PHE A 1 10  ? -7.894  12.888  -0.114  1.00 0.00 ? 9   PHE A CE2  6  
ATOM 9801  C CZ   . PHE A 1 10  ? -6.745  12.754  -0.881  1.00 0.00 ? 9   PHE A CZ   6  
ATOM 9802  H H    . PHE A 1 10  ? -11.447 11.007  -0.377  1.00 0.00 ? 9   PHE A H    6  
ATOM 9803  H HA   . PHE A 1 10  ? -10.091 9.459   -2.474  1.00 0.00 ? 9   PHE A HA   6  
ATOM 9804  H HB2  . PHE A 1 10  ? -9.743  9.475   0.608   1.00 0.00 ? 9   PHE A HB2  6  
ATOM 9805  H HB3  . PHE A 1 10  ? -8.732  8.638   -0.621  1.00 0.00 ? 9   PHE A HB3  6  
ATOM 9806  H HD1  . PHE A 1 10  ? -7.343  9.700   -2.113  1.00 0.00 ? 9   PHE A HD1  6  
ATOM 9807  H HD2  . PHE A 1 10  ? -9.560  11.894  0.757   1.00 0.00 ? 9   PHE A HD2  6  
ATOM 9808  H HE1  . PHE A 1 10  ? -5.628  11.311  -2.108  1.00 0.00 ? 9   PHE A HE1  6  
ATOM 9809  H HE2  . PHE A 1 10  ? -8.189  13.789  0.393   1.00 0.00 ? 9   PHE A HE2  6  
ATOM 9810  H HZ   . PHE A 1 10  ? -6.040  13.570  -0.962  1.00 0.00 ? 9   PHE A HZ   6  
ATOM 9811  N N    . VAL A 1 11  ? -12.464 8.112   -1.683  1.00 0.00 ? 10  VAL A N    6  
ATOM 9812  C CA   . VAL A 1 11  ? -13.418 7.024   -1.612  1.00 0.00 ? 10  VAL A CA   6  
ATOM 9813  C C    . VAL A 1 11  ? -13.026 5.674   -2.234  1.00 0.00 ? 10  VAL A C    6  
ATOM 9814  O O    . VAL A 1 11  ? -13.398 4.613   -1.746  1.00 0.00 ? 10  VAL A O    6  
ATOM 9815  C CB   . VAL A 1 11  ? -14.741 7.599   -2.090  1.00 0.00 ? 10  VAL A CB   6  
ATOM 9816  C CG1  . VAL A 1 11  ? -15.901 6.642   -1.771  1.00 0.00 ? 10  VAL A CG1  6  
ATOM 9817  C CG2  . VAL A 1 11  ? -14.907 8.981   -1.400  1.00 0.00 ? 10  VAL A CG2  6  
ATOM 9818  H H    . VAL A 1 11  ? -12.837 8.988   -1.978  1.00 0.00 ? 10  VAL A H    6  
ATOM 9819  H HA   . VAL A 1 11  ? -13.515 6.810   -0.564  1.00 0.00 ? 10  VAL A HA   6  
ATOM 9820  H HB   . VAL A 1 11  ? -14.720 7.768   -3.193  1.00 0.00 ? 10  VAL A HB   6  
ATOM 9821  H HG11 . VAL A 1 11  ? -15.773 5.690   -2.332  1.00 0.00 ? 10  VAL A HG11 6  
ATOM 9822  H HG12 . VAL A 1 11  ? -16.869 7.094   -2.073  1.00 0.00 ? 10  VAL A HG12 6  
ATOM 9823  H HG13 . VAL A 1 11  ? -15.930 6.424   -0.685  1.00 0.00 ? 10  VAL A HG13 6  
ATOM 9824  H HG21 . VAL A 1 11  ? -14.419 9.791   -1.985  1.00 0.00 ? 10  VAL A HG21 6  
ATOM 9825  H HG22 . VAL A 1 11  ? -14.462 9.018   -0.372  1.00 0.00 ? 10  VAL A HG22 6  
ATOM 9826  H HG23 . VAL A 1 11  ? -15.977 9.251   -1.324  1.00 0.00 ? 10  VAL A HG23 6  
ATOM 9827  N N    . GLY A 1 12  ? -12.200 5.696   -3.307  1.00 0.00 ? 11  GLY A N    6  
ATOM 9828  C CA   . GLY A 1 12  ? -11.563 4.546   -3.928  1.00 0.00 ? 11  GLY A CA   6  
ATOM 9829  C C    . GLY A 1 12  ? -10.062 4.703   -4.056  1.00 0.00 ? 11  GLY A C    6  
ATOM 9830  O O    . GLY A 1 12  ? -9.487  4.281   -5.055  1.00 0.00 ? 11  GLY A O    6  
ATOM 9831  H H    . GLY A 1 12  ? -11.942 6.568   -3.693  1.00 0.00 ? 11  GLY A H    6  
ATOM 9832  H HA2  . GLY A 1 12  ? -11.703 3.660   -3.293  1.00 0.00 ? 11  GLY A HA2  6  
ATOM 9833  H HA3  . GLY A 1 12  ? -11.951 4.495   -4.951  1.00 0.00 ? 11  GLY A HA3  6  
ATOM 9834  N N    . LEU A 1 13  ? -9.375  5.267   -3.002  1.00 0.00 ? 12  LEU A N    6  
ATOM 9835  C CA   . LEU A 1 13  ? -7.907  5.402   -2.850  1.00 0.00 ? 12  LEU A CA   6  
ATOM 9836  C C    . LEU A 1 13  ? -7.310  4.010   -2.417  1.00 0.00 ? 12  LEU A C    6  
ATOM 9837  O O    . LEU A 1 13  ? -8.027  3.094   -2.001  1.00 0.00 ? 12  LEU A O    6  
ATOM 9838  C CB   . LEU A 1 13  ? -7.670  6.635   -1.891  1.00 0.00 ? 12  LEU A CB   6  
ATOM 9839  C CG   . LEU A 1 13  ? -6.345  7.341   -1.504  1.00 0.00 ? 12  LEU A CG   6  
ATOM 9840  C CD1  . LEU A 1 13  ? -6.524  7.754   -0.033  1.00 0.00 ? 12  LEU A CD1  6  
ATOM 9841  C CD2  . LEU A 1 13  ? -5.182  6.464   -1.737  1.00 0.00 ? 12  LEU A CD2  6  
ATOM 9842  H H    . LEU A 1 13  ? -9.895  5.609   -2.209  1.00 0.00 ? 12  LEU A H    6  
ATOM 9843  H HA   . LEU A 1 13  ? -7.490  5.649   -3.820  1.00 0.00 ? 12  LEU A HA   6  
ATOM 9844  H HB2  . LEU A 1 13  ? -8.366  7.428   -2.236  1.00 0.00 ? 12  LEU A HB2  6  
ATOM 9845  H HB3  . LEU A 1 13  ? -8.009  6.286   -0.890  1.00 0.00 ? 12  LEU A HB3  6  
ATOM 9846  H HG   . LEU A 1 13  ? -5.896  8.244   -2.027  1.00 0.00 ? 12  LEU A HG   6  
ATOM 9847  H HD11 . LEU A 1 13  ? -6.274  8.829   0.103   1.00 0.00 ? 12  LEU A HD11 6  
ATOM 9848  H HD12 . LEU A 1 13  ? -5.920  7.111   0.633   1.00 0.00 ? 12  LEU A HD12 6  
ATOM 9849  H HD13 . LEU A 1 13  ? -7.548  7.647   0.346   1.00 0.00 ? 12  LEU A HD13 6  
ATOM 9850  H HD21 . LEU A 1 13  ? -5.282  5.613   -1.018  1.00 0.00 ? 12  LEU A HD21 6  
ATOM 9851  H HD22 . LEU A 1 13  ? -4.282  7.090   -1.597  1.00 0.00 ? 12  LEU A HD22 6  
ATOM 9852  H HD23 . LEU A 1 13  ? -5.175  6.168   -2.802  1.00 0.00 ? 12  LEU A HD23 6  
ATOM 9853  N N    . ARG A 1 14  ? -5.967  3.812   -2.534  1.00 0.00 ? 13  ARG A N    6  
ATOM 9854  C CA   . ARG A 1 14  ? -5.191  2.586   -2.392  1.00 0.00 ? 13  ARG A CA   6  
ATOM 9855  C C    . ARG A 1 14  ? -4.211  2.803   -1.255  1.00 0.00 ? 13  ARG A C    6  
ATOM 9856  O O    . ARG A 1 14  ? -3.562  3.845   -1.221  1.00 0.00 ? 13  ARG A O    6  
ATOM 9857  C CB   . ARG A 1 14  ? -4.429  2.282   -3.707  1.00 0.00 ? 13  ARG A CB   6  
ATOM 9858  C CG   . ARG A 1 14  ? -5.364  2.062   -4.913  1.00 0.00 ? 13  ARG A CG   6  
ATOM 9859  C CD   . ARG A 1 14  ? -5.108  3.005   -6.102  1.00 0.00 ? 13  ARG A CD   6  
ATOM 9860  N NE   . ARG A 1 14  ? -5.311  4.428   -5.648  1.00 0.00 ? 13  ARG A NE   6  
ATOM 9861  C CZ   . ARG A 1 14  ? -4.649  5.505   -6.175  1.00 0.00 ? 13  ARG A CZ   6  
ATOM 9862  N NH1  . ARG A 1 14  ? -3.776  5.356   -7.212  1.00 0.00 ? 13  ARG A NH1  6  
ATOM 9863  N NH2  . ARG A 1 14  ? -4.865  6.745   -5.648  1.00 0.00 ? 13  ARG A NH2  6  
ATOM 9864  H H    . ARG A 1 14  ? -5.358  4.595   -2.709  1.00 0.00 ? 13  ARG A H    6  
ATOM 9865  H HA   . ARG A 1 14  ? -5.830  1.750   -2.206  1.00 0.00 ? 13  ARG A HA   6  
ATOM 9866  H HB2  . ARG A 1 14  ? -3.725  3.115   -3.942  1.00 0.00 ? 13  ARG A HB2  6  
ATOM 9867  H HB3  . ARG A 1 14  ? -3.822  1.356   -3.590  1.00 0.00 ? 13  ARG A HB3  6  
ATOM 9868  H HG2  . ARG A 1 14  ? -5.216  1.021   -5.284  1.00 0.00 ? 13  ARG A HG2  6  
ATOM 9869  H HG3  . ARG A 1 14  ? -6.425  2.150   -4.592  1.00 0.00 ? 13  ARG A HG3  6  
ATOM 9870  H HD2  . ARG A 1 14  ? -4.072  2.851   -6.475  1.00 0.00 ? 13  ARG A HD2  6  
ATOM 9871  H HD3  . ARG A 1 14  ? -5.829  2.795   -6.920  1.00 0.00 ? 13  ARG A HD3  6  
ATOM 9872  H HE   . ARG A 1 14  ? -5.939  4.588   -4.887  1.00 0.00 ? 13  ARG A HE   6  
ATOM 9873  H HH11 . ARG A 1 14  ? -3.610  4.449   -7.600  1.00 0.00 ? 13  ARG A HH11 6  
ATOM 9874  H HH12 . ARG A 1 14  ? -3.299  6.153   -7.583  1.00 0.00 ? 13  ARG A HH12 6  
ATOM 9875  H HH21 . ARG A 1 14  ? -5.501  6.859   -4.884  1.00 0.00 ? 13  ARG A HH21 6  
ATOM 9876  H HH22 . ARG A 1 14  ? -4.386  7.539   -6.022  1.00 0.00 ? 13  ARG A HH22 6  
ATOM 9877  N N    . VAL A 1 15  ? -4.079  1.896   -0.247  1.00 0.00 ? 14  VAL A N    6  
ATOM 9878  C CA   . VAL A 1 15  ? -3.262  2.177   0.941   1.00 0.00 ? 14  VAL A CA   6  
ATOM 9879  C C    . VAL A 1 15  ? -2.287  1.125   1.339   1.00 0.00 ? 14  VAL A C    6  
ATOM 9880  O O    . VAL A 1 15  ? -2.291  -0.024  0.922   1.00 0.00 ? 14  VAL A O    6  
ATOM 9881  C CB   . VAL A 1 15  ? -4.022  2.655   2.195   1.00 0.00 ? 14  VAL A CB   6  
ATOM 9882  C CG1  . VAL A 1 15  ? -4.944  3.758   1.746   1.00 0.00 ? 14  VAL A CG1  6  
ATOM 9883  C CG2  . VAL A 1 15  ? -4.856  1.722   3.059   1.00 0.00 ? 14  VAL A CG2  6  
ATOM 9884  H H    . VAL A 1 15  ? -4.555  1.017   -0.222  1.00 0.00 ? 14  VAL A H    6  
ATOM 9885  H HA   . VAL A 1 15  ? -2.603  3.007   0.712   1.00 0.00 ? 14  VAL A HA   6  
ATOM 9886  H HB   . VAL A 1 15  ? -3.298  3.054   2.936   1.00 0.00 ? 14  VAL A HB   6  
ATOM 9887  H HG11 . VAL A 1 15  ? -5.249  4.334   2.635   1.00 0.00 ? 14  VAL A HG11 6  
ATOM 9888  H HG12 . VAL A 1 15  ? -5.831  3.309   1.254   1.00 0.00 ? 14  VAL A HG12 6  
ATOM 9889  H HG13 . VAL A 1 15  ? -4.459  4.451   1.034   1.00 0.00 ? 14  VAL A HG13 6  
ATOM 9890  H HG21 . VAL A 1 15  ? -5.247  2.294   3.931   1.00 0.00 ? 14  VAL A HG21 6  
ATOM 9891  H HG22 . VAL A 1 15  ? -4.244  0.885   3.441   1.00 0.00 ? 14  VAL A HG22 6  
ATOM 9892  H HG23 . VAL A 1 15  ? -5.743  1.385   2.500   1.00 0.00 ? 14  VAL A HG23 6  
ATOM 9893  N N    . VAL A 1 16  ? -1.367  1.516   2.232   1.00 0.00 ? 15  VAL A N    6  
ATOM 9894  C CA   . VAL A 1 16  ? -0.378  0.616   2.817   1.00 0.00 ? 15  VAL A CA   6  
ATOM 9895  C C    . VAL A 1 16  ? -0.524  0.772   4.295   1.00 0.00 ? 15  VAL A C    6  
ATOM 9896  O O    . VAL A 1 16  ? -0.932  1.839   4.737   1.00 0.00 ? 15  VAL A O    6  
ATOM 9897  C CB   . VAL A 1 16  ? 1.037   0.815   2.332   1.00 0.00 ? 15  VAL A CB   6  
ATOM 9898  C CG1  . VAL A 1 16  ? 1.131   0.129   0.956   1.00 0.00 ? 15  VAL A CG1  6  
ATOM 9899  C CG2  . VAL A 1 16  ? 1.408   2.301   2.264   1.00 0.00 ? 15  VAL A CG2  6  
ATOM 9900  H H    . VAL A 1 16  ? -1.374  2.476   2.549   1.00 0.00 ? 15  VAL A H    6  
ATOM 9901  H HA   . VAL A 1 16  ? -0.623  -0.423  2.623   1.00 0.00 ? 15  VAL A HA   6  
ATOM 9902  H HB   . VAL A 1 16  ? 1.737   0.303   3.043   1.00 0.00 ? 15  VAL A HB   6  
ATOM 9903  H HG11 . VAL A 1 16  ? 1.037   -0.967  1.106   1.00 0.00 ? 15  VAL A HG11 6  
ATOM 9904  H HG12 . VAL A 1 16  ? 2.103   0.327   0.470   1.00 0.00 ? 15  VAL A HG12 6  
ATOM 9905  H HG13 . VAL A 1 16  ? 0.313   0.454   0.282   1.00 0.00 ? 15  VAL A HG13 6  
ATOM 9906  H HG21 . VAL A 1 16  ? 0.617   2.923   1.804   1.00 0.00 ? 15  VAL A HG21 6  
ATOM 9907  H HG22 . VAL A 1 16  ? 2.334   2.430   1.665   1.00 0.00 ? 15  VAL A HG22 6  
ATOM 9908  H HG23 . VAL A 1 16  ? 1.608   2.665   3.292   1.00 0.00 ? 15  VAL A HG23 6  
ATOM 9909  N N    . ALA A 1 17  ? -0.255  -0.323  5.055   1.00 0.00 ? 16  ALA A N    6  
ATOM 9910  C CA   . ALA A 1 17  ? -0.599  -0.430  6.457   1.00 0.00 ? 16  ALA A CA   6  
ATOM 9911  C C    . ALA A 1 17  ? 0.547   -0.571  7.392   1.00 0.00 ? 16  ALA A C    6  
ATOM 9912  O O    . ALA A 1 17  ? 1.156   -1.618  7.540   1.00 0.00 ? 16  ALA A O    6  
ATOM 9913  C CB   . ALA A 1 17  ? -1.559  -1.631  6.628   1.00 0.00 ? 16  ALA A CB   6  
ATOM 9914  H H    . ALA A 1 17  ? 0.124   -1.161  4.632   1.00 0.00 ? 16  ALA A H    6  
ATOM 9915  H HA   . ALA A 1 17  ? -1.113  0.439   6.811   1.00 0.00 ? 16  ALA A HA   6  
ATOM 9916  H HB1  . ALA A 1 17  ? -1.907  -1.749  7.672   1.00 0.00 ? 16  ALA A HB1  6  
ATOM 9917  H HB2  . ALA A 1 17  ? -1.101  -2.586  6.305   1.00 0.00 ? 16  ALA A HB2  6  
ATOM 9918  H HB3  . ALA A 1 17  ? -2.451  -1.479  5.984   1.00 0.00 ? 16  ALA A HB3  6  
ATOM 9919  N N    . LYS A 1 18  ? 0.834   0.496   8.144   1.00 0.00 ? 17  LYS A N    6  
ATOM 9920  C CA   . LYS A 1 18  ? 1.857   0.510   9.154   1.00 0.00 ? 17  LYS A CA   6  
ATOM 9921  C C    . LYS A 1 18  ? 1.244   1.051   10.458  1.00 0.00 ? 17  LYS A C    6  
ATOM 9922  O O    . LYS A 1 18  ? 1.213   2.259   10.623  1.00 0.00 ? 17  LYS A O    6  
ATOM 9923  C CB   . LYS A 1 18  ? 3.082   1.383   8.710   1.00 0.00 ? 17  LYS A CB   6  
ATOM 9924  C CG   . LYS A 1 18  ? 2.950   2.306   7.473   1.00 0.00 ? 17  LYS A CG   6  
ATOM 9925  C CD   . LYS A 1 18  ? 3.637   3.666   7.697   1.00 0.00 ? 17  LYS A CD   6  
ATOM 9926  C CE   . LYS A 1 18  ? 5.073   3.768   7.194   1.00 0.00 ? 17  LYS A CE   6  
ATOM 9927  N NZ   . LYS A 1 18  ? 5.664   5.096   7.480   1.00 0.00 ? 17  LYS A NZ   6  
ATOM 9928  H H    . LYS A 1 18  ? 0.346   1.367   8.008   1.00 0.00 ? 17  LYS A H    6  
ATOM 9929  H HA   . LYS A 1 18  ? 2.228   -0.490  9.325   1.00 0.00 ? 17  LYS A HA   6  
ATOM 9930  H HB2  . LYS A 1 18  ? 3.367   2.037   9.560   1.00 0.00 ? 17  LYS A HB2  6  
ATOM 9931  H HB3  . LYS A 1 18  ? 3.925   0.696   8.507   1.00 0.00 ? 17  LYS A HB3  6  
ATOM 9932  H HG2  . LYS A 1 18  ? 3.258   1.843   6.493   1.00 0.00 ? 17  LYS A HG2  6  
ATOM 9933  H HG3  . LYS A 1 18  ? 1.893   2.576   7.347   1.00 0.00 ? 17  LYS A HG3  6  
ATOM 9934  H HD2  . LYS A 1 18  ? 3.027   4.436   7.174   1.00 0.00 ? 17  LYS A HD2  6  
ATOM 9935  H HD3  . LYS A 1 18  ? 3.593   3.922   8.779   1.00 0.00 ? 17  LYS A HD3  6  
ATOM 9936  H HE2  . LYS A 1 18  ? 5.713   3.008   7.690   1.00 0.00 ? 17  LYS A HE2  6  
ATOM 9937  H HE3  . LYS A 1 18  ? 5.081   3.616   6.085   1.00 0.00 ? 17  LYS A HE3  6  
ATOM 9938  H HZ1  . LYS A 1 18  ? 5.095   5.834   7.017   1.00 0.00 ? 17  LYS A HZ1  6  
ATOM 9939  H HZ2  . LYS A 1 18  ? 6.638   5.128   7.114   1.00 0.00 ? 17  LYS A HZ2  6  
ATOM 9940  H HZ3  . LYS A 1 18  ? 5.673   5.257   8.506   1.00 0.00 ? 17  LYS A HZ3  6  
ATOM 9941  N N    . TRP A 1 19  ? 0.746   0.252   11.456  1.00 0.00 ? 18  TRP A N    6  
ATOM 9942  C CA   . TRP A 1 19  ? 0.200   0.764   12.739  1.00 0.00 ? 18  TRP A CA   6  
ATOM 9943  C C    . TRP A 1 19  ? 1.289   1.413   13.631  1.00 0.00 ? 18  TRP A C    6  
ATOM 9944  O O    . TRP A 1 19  ? 1.134   2.498   14.190  1.00 0.00 ? 18  TRP A O    6  
ATOM 9945  C CB   . TRP A 1 19  ? -0.583  -0.330  13.534  1.00 0.00 ? 18  TRP A CB   6  
ATOM 9946  C CG   . TRP A 1 19  ? -1.952  -0.730  13.001  1.00 0.00 ? 18  TRP A CG   6  
ATOM 9947  C CD1  . TRP A 1 19  ? -2.449  -1.911  12.506  1.00 0.00 ? 18  TRP A CD1  6  
ATOM 9948  C CD2  . TRP A 1 19  ? -3.079  0.095   13.293  1.00 0.00 ? 18  TRP A CD2  6  
ATOM 9949  N NE1  . TRP A 1 19  ? -3.833  -1.873  12.496  1.00 0.00 ? 18  TRP A NE1  6  
ATOM 9950  C CE2  . TRP A 1 19  ? -4.225  -0.651  13.010  1.00 0.00 ? 18  TRP A CE2  6  
ATOM 9951  C CE3  . TRP A 1 19  ? -3.142  1.353   13.820  1.00 0.00 ? 18  TRP A CE3  6  
ATOM 9952  C CZ2  . TRP A 1 19  ? -5.461  -0.151  13.288  1.00 0.00 ? 18  TRP A CZ2  6  
ATOM 9953  C CZ3  . TRP A 1 19  ? -4.380  1.815   14.166  1.00 0.00 ? 18  TRP A CZ3  6  
ATOM 9954  C CH2  . TRP A 1 19  ? -5.521  1.072   13.926  1.00 0.00 ? 18  TRP A CH2  6  
ATOM 9955  H H    . TRP A 1 19  ? 0.747   -0.738  11.353  1.00 0.00 ? 18  TRP A H    6  
ATOM 9956  H HA   . TRP A 1 19  ? -0.500  1.559   12.511  1.00 0.00 ? 18  TRP A HA   6  
ATOM 9957  H HB2  . TRP A 1 19  ? 0.002   -1.250  13.638  1.00 0.00 ? 18  TRP A HB2  6  
ATOM 9958  H HB3  . TRP A 1 19  ? -0.792  0.043   14.565  1.00 0.00 ? 18  TRP A HB3  6  
ATOM 9959  H HD1  . TRP A 1 19  ? -1.849  -2.764  12.226  1.00 0.00 ? 18  TRP A HD1  6  
ATOM 9960  H HE1  . TRP A 1 19  ? -4.455  -2.607  12.307  1.00 0.00 ? 18  TRP A HE1  6  
ATOM 9961  H HE3  . TRP A 1 19  ? -2.270  1.975   14.002  1.00 0.00 ? 18  TRP A HE3  6  
ATOM 9962  H HZ2  . TRP A 1 19  ? -6.365  -0.709  13.087  1.00 0.00 ? 18  TRP A HZ2  6  
ATOM 9963  H HZ3  . TRP A 1 19  ? -4.426  2.779   14.640  1.00 0.00 ? 18  TRP A HZ3  6  
ATOM 9964  H HH2  . TRP A 1 19  ? -6.482  1.475   14.206  1.00 0.00 ? 18  TRP A HH2  6  
ATOM 9965  N N    . SER A 1 20  ? 2.451   0.732   13.689  1.00 0.00 ? 19  SER A N    6  
ATOM 9966  C CA   . SER A 1 20  ? 3.738   1.220   14.142  1.00 0.00 ? 19  SER A CA   6  
ATOM 9967  C C    . SER A 1 20  ? 4.598   0.794   12.962  1.00 0.00 ? 19  SER A C    6  
ATOM 9968  O O    . SER A 1 20  ? 4.286   -0.242  12.374  1.00 0.00 ? 19  SER A O    6  
ATOM 9969  C CB   . SER A 1 20  ? 4.232   0.598   15.475  1.00 0.00 ? 19  SER A CB   6  
ATOM 9970  O OG   . SER A 1 20  ? 3.518   1.148   16.582  1.00 0.00 ? 19  SER A OG   6  
ATOM 9971  H H    . SER A 1 20  ? 2.528   -0.133  13.191  1.00 0.00 ? 19  SER A H    6  
ATOM 9972  H HA   . SER A 1 20  ? 3.751   2.303   14.199  1.00 0.00 ? 19  SER A HA   6  
ATOM 9973  H HB2  . SER A 1 20  ? 4.107   -0.508  15.461  1.00 0.00 ? 19  SER A HB2  6  
ATOM 9974  H HB3  . SER A 1 20  ? 5.309   0.826   15.641  1.00 0.00 ? 19  SER A HB3  6  
ATOM 9975  H HG   . SER A 1 20  ? 2.574   1.026   16.427  1.00 0.00 ? 19  SER A HG   6  
ATOM 9976  N N    . SER A 1 21  ? 5.672   1.548   12.581  1.00 0.00 ? 20  SER A N    6  
ATOM 9977  C CA   . SER A 1 21  ? 6.619   1.245   11.477  1.00 0.00 ? 20  SER A CA   6  
ATOM 9978  C C    . SER A 1 21  ? 7.506   0.034   11.808  1.00 0.00 ? 20  SER A C    6  
ATOM 9979  O O    . SER A 1 21  ? 8.107   0.009   12.874  1.00 0.00 ? 20  SER A O    6  
ATOM 9980  C CB   . SER A 1 21  ? 7.559   2.461   11.186  1.00 0.00 ? 20  SER A CB   6  
ATOM 9981  O OG   . SER A 1 21  ? 6.904   3.482   10.436  1.00 0.00 ? 20  SER A OG   6  
ATOM 9982  H H    . SER A 1 21  ? 5.877   2.375   13.094  1.00 0.00 ? 20  SER A H    6  
ATOM 9983  H HA   . SER A 1 21  ? 6.059   1.006   10.583  1.00 0.00 ? 20  SER A HA   6  
ATOM 9984  H HB2  . SER A 1 21  ? 7.940   2.888   12.139  1.00 0.00 ? 20  SER A HB2  6  
ATOM 9985  H HB3  . SER A 1 21  ? 8.443   2.171   10.582  1.00 0.00 ? 20  SER A HB3  6  
ATOM 9986  H HG   . SER A 1 21  ? 6.142   3.809   10.933  1.00 0.00 ? 20  SER A HG   6  
ATOM 9987  N N    . ASN A 1 22  ? 7.577   -1.025  10.947  1.00 0.00 ? 21  ASN A N    6  
ATOM 9988  C CA   . ASN A 1 22  ? 8.232   -2.306  11.271  1.00 0.00 ? 21  ASN A CA   6  
ATOM 9989  C C    . ASN A 1 22  ? 9.597   -2.542  10.651  1.00 0.00 ? 21  ASN A C    6  
ATOM 9990  O O    . ASN A 1 22  ? 10.291  -3.526  10.905  1.00 0.00 ? 21  ASN A O    6  
ATOM 9991  C CB   . ASN A 1 22  ? 7.247   -3.385  10.709  1.00 0.00 ? 21  ASN A CB   6  
ATOM 9992  C CG   . ASN A 1 22  ? 7.168   -4.763  11.379  1.00 0.00 ? 21  ASN A CG   6  
ATOM 9993  O OD1  . ASN A 1 22  ? 6.172   -5.458  11.136  1.00 0.00 ? 21  ASN A OD1  6  
ATOM 9994  N ND2  . ASN A 1 22  ? 8.153   -5.148  12.219  1.00 0.00 ? 21  ASN A ND2  6  
ATOM 9995  H H    . ASN A 1 22  ? 7.051   -1.034  10.091  1.00 0.00 ? 21  ASN A H    6  
ATOM 9996  H HA   . ASN A 1 22  ? 8.409   -2.355  12.329  1.00 0.00 ? 21  ASN A HA   6  
ATOM 9997  H HB2  . ASN A 1 22  ? 6.220   -2.964  10.810  1.00 0.00 ? 21  ASN A HB2  6  
ATOM 9998  H HB3  . ASN A 1 22  ? 7.395   -3.523  9.616   1.00 0.00 ? 21  ASN A HB3  6  
ATOM 9999  H HD21 . ASN A 1 22  ? 9.042   -4.680  12.150  1.00 0.00 ? 21  ASN A HD21 6  
ATOM 10000 H HD22 . ASN A 1 22  ? 8.027   -6.011  12.709  1.00 0.00 ? 21  ASN A HD22 6  
ATOM 10001 N N    . GLY A 1 23  ? 9.899   -1.664  9.695   1.00 0.00 ? 22  GLY A N    6  
ATOM 10002 C CA   . GLY A 1 23  ? 10.941  -1.770  8.683   1.00 0.00 ? 22  GLY A CA   6  
ATOM 10003 C C    . GLY A 1 23  ? 10.270  -1.984  7.359   1.00 0.00 ? 22  GLY A C    6  
ATOM 10004 O O    . GLY A 1 23  ? 10.831  -1.682  6.313   1.00 0.00 ? 22  GLY A O    6  
ATOM 10005 H H    . GLY A 1 23  ? 9.266   -0.904  9.570   1.00 0.00 ? 22  GLY A H    6  
ATOM 10006 H HA2  . GLY A 1 23  ? 11.522  -0.880  8.652   1.00 0.00 ? 22  GLY A HA2  6  
ATOM 10007 H HA3  . GLY A 1 23  ? 11.555  -2.646  8.859   1.00 0.00 ? 22  GLY A HA3  6  
ATOM 10008 N N    . TYR A 1 24  ? 8.997   -2.439  7.415   1.00 0.00 ? 23  TYR A N    6  
ATOM 10009 C CA   . TYR A 1 24  ? 8.002   -2.579  6.366   1.00 0.00 ? 23  TYR A CA   6  
ATOM 10010 C C    . TYR A 1 24  ? 6.601   -2.113  6.760   1.00 0.00 ? 23  TYR A C    6  
ATOM 10011 O O    . TYR A 1 24  ? 6.299   -1.938  7.941   1.00 0.00 ? 23  TYR A O    6  
ATOM 10012 C CB   . TYR A 1 24  ? 7.977   -3.962  5.640   1.00 0.00 ? 23  TYR A CB   6  
ATOM 10013 C CG   . TYR A 1 24  ? 9.060   -4.927  6.052   1.00 0.00 ? 23  TYR A CG   6  
ATOM 10014 C CD1  . TYR A 1 24  ? 8.998   -5.572  7.276   1.00 0.00 ? 23  TYR A CD1  6  
ATOM 10015 C CD2  . TYR A 1 24  ? 10.127  -5.197  5.211   1.00 0.00 ? 23  TYR A CD2  6  
ATOM 10016 C CE1  . TYR A 1 24  ? 9.997   -6.441  7.665   1.00 0.00 ? 23  TYR A CE1  6  
ATOM 10017 C CE2  . TYR A 1 24  ? 11.124  -6.072  5.594   1.00 0.00 ? 23  TYR A CE2  6  
ATOM 10018 C CZ   . TYR A 1 24  ? 11.053  -6.697  6.818   1.00 0.00 ? 23  TYR A CZ   6  
ATOM 10019 O OH   . TYR A 1 24  ? 12.043  -7.622  7.192   1.00 0.00 ? 23  TYR A OH   6  
ATOM 10020 H H    . TYR A 1 24  ? 8.647   -2.640  8.324   1.00 0.00 ? 23  TYR A H    6  
ATOM 10021 H HA   . TYR A 1 24  ? 8.271   -1.857  5.609   1.00 0.00 ? 23  TYR A HA   6  
ATOM 10022 H HB2  . TYR A 1 24  ? 7.010   -4.503  5.714   1.00 0.00 ? 23  TYR A HB2  6  
ATOM 10023 H HB3  . TYR A 1 24  ? 8.141   -3.692  4.573   1.00 0.00 ? 23  TYR A HB3  6  
ATOM 10024 H HD1  . TYR A 1 24  ? 8.167   -5.380  7.941   1.00 0.00 ? 23  TYR A HD1  6  
ATOM 10025 H HD2  . TYR A 1 24  ? 10.187  -4.720  4.243   1.00 0.00 ? 23  TYR A HD2  6  
ATOM 10026 H HE1  . TYR A 1 24  ? 9.943   -6.938  8.624   1.00 0.00 ? 23  TYR A HE1  6  
ATOM 10027 H HE2  . TYR A 1 24  ? 11.956  -6.272  4.932   1.00 0.00 ? 23  TYR A HE2  6  
ATOM 10028 H HH   . TYR A 1 24  ? 12.422  -7.987  6.390   1.00 0.00 ? 23  TYR A HH   6  
ATOM 10029 N N    . PHE A 1 25  ? 5.698   -1.963  5.733   1.00 0.00 ? 24  PHE A N    6  
ATOM 10030 C CA   . PHE A 1 25  ? 4.255   -1.707  5.774   1.00 0.00 ? 24  PHE A CA   6  
ATOM 10031 C C    . PHE A 1 25  ? 3.628   -2.914  5.097   1.00 0.00 ? 24  PHE A C    6  
ATOM 10032 O O    . PHE A 1 25  ? 4.186   -3.490  4.159   1.00 0.00 ? 24  PHE A O    6  
ATOM 10033 C CB   . PHE A 1 25  ? 3.661   -0.371  5.135   1.00 0.00 ? 24  PHE A CB   6  
ATOM 10034 C CG   . PHE A 1 25  ? 4.634   0.766   4.868   1.00 0.00 ? 24  PHE A CG   6  
ATOM 10035 C CD1  . PHE A 1 25  ? 5.649   0.945   5.773   1.00 0.00 ? 24  PHE A CD1  6  
ATOM 10036 C CD2  . PHE A 1 25  ? 4.574   1.660   3.778   1.00 0.00 ? 24  PHE A CD2  6  
ATOM 10037 C CE1  . PHE A 1 25  ? 6.730   1.703   5.460   1.00 0.00 ? 24  PHE A CE1  6  
ATOM 10038 C CE2  . PHE A 1 25  ? 5.643   2.491   3.514   1.00 0.00 ? 24  PHE A CE2  6  
ATOM 10039 C CZ   . PHE A 1 25  ? 6.739   2.466   4.339   1.00 0.00 ? 24  PHE A CZ   6  
ATOM 10040 H H    . PHE A 1 25  ? 6.023   -2.115  4.784   1.00 0.00 ? 24  PHE A H    6  
ATOM 10041 H HA   . PHE A 1 25  ? 3.879   -1.717  6.787   1.00 0.00 ? 24  PHE A HA   6  
ATOM 10042 H HB2  . PHE A 1 25  ? 3.122   -0.569  4.193   1.00 0.00 ? 24  PHE A HB2  6  
ATOM 10043 H HB3  . PHE A 1 25  ? 2.896   0.015   5.836   1.00 0.00 ? 24  PHE A HB3  6  
ATOM 10044 H HD1  . PHE A 1 25  ? 5.633   0.439   6.725   1.00 0.00 ? 24  PHE A HD1  6  
ATOM 10045 H HD2  . PHE A 1 25  ? 3.819   1.621   2.987   1.00 0.00 ? 24  PHE A HD2  6  
ATOM 10046 H HE1  . PHE A 1 25  ? 7.559   1.763   6.116   1.00 0.00 ? 24  PHE A HE1  6  
ATOM 10047 H HE2  . PHE A 1 25  ? 5.635   3.117   2.635   1.00 0.00 ? 24  PHE A HE2  6  
ATOM 10048 H HZ   . PHE A 1 25  ? 7.622   3.040   4.174   1.00 0.00 ? 24  PHE A HZ   6  
ATOM 10049 N N    . TYR A 1 26  ? 2.399   -3.208  5.559   1.00 0.00 ? 25  TYR A N    6  
ATOM 10050 C CA   . TYR A 1 26  ? 1.382   -4.185  5.225   1.00 0.00 ? 25  TYR A CA   6  
ATOM 10051 C C    . TYR A 1 26  ? 0.398   -3.570  4.203   1.00 0.00 ? 25  TYR A C    6  
ATOM 10052 O O    . TYR A 1 26  ? 0.668   -2.552  3.574   1.00 0.00 ? 25  TYR A O    6  
ATOM 10053 C CB   . TYR A 1 26  ? 0.740   -4.814  6.503   1.00 0.00 ? 25  TYR A CB   6  
ATOM 10054 C CG   . TYR A 1 26  ? 1.817   -5.417  7.396   1.00 0.00 ? 25  TYR A CG   6  
ATOM 10055 C CD1  . TYR A 1 26  ? 2.335   -6.673  7.122   1.00 0.00 ? 25  TYR A CD1  6  
ATOM 10056 C CD2  . TYR A 1 26  ? 2.310   -4.745  8.510   1.00 0.00 ? 25  TYR A CD2  6  
ATOM 10057 C CE1  . TYR A 1 26  ? 3.280   -7.249  7.952   1.00 0.00 ? 25  TYR A CE1  6  
ATOM 10058 C CE2  . TYR A 1 26  ? 3.284   -5.307  9.326   1.00 0.00 ? 25  TYR A CE2  6  
ATOM 10059 C CZ   . TYR A 1 26  ? 3.752   -6.580  9.061   1.00 0.00 ? 25  TYR A CZ   6  
ATOM 10060 O OH   . TYR A 1 26  ? 4.686   -7.219  9.914   1.00 0.00 ? 25  TYR A OH   6  
ATOM 10061 H H    . TYR A 1 26  ? 2.078   -2.644  6.326   1.00 0.00 ? 25  TYR A H    6  
ATOM 10062 H HA   . TYR A 1 26  ? 1.859   -4.992  4.685   1.00 0.00 ? 25  TYR A HA   6  
ATOM 10063 H HB2  . TYR A 1 26  ? 0.199   -4.049  7.099   1.00 0.00 ? 25  TYR A HB2  6  
ATOM 10064 H HB3  . TYR A 1 26  ? 0.035   -5.633  6.238   1.00 0.00 ? 25  TYR A HB3  6  
ATOM 10065 H HD1  . TYR A 1 26  ? 1.980   -7.223  6.260   1.00 0.00 ? 25  TYR A HD1  6  
ATOM 10066 H HD2  . TYR A 1 26  ? 1.929   -3.763  8.751   1.00 0.00 ? 25  TYR A HD2  6  
ATOM 10067 H HE1  . TYR A 1 26  ? 3.657   -8.239  7.736   1.00 0.00 ? 25  TYR A HE1  6  
ATOM 10068 H HE2  . TYR A 1 26  ? 3.654   -4.763  10.187  1.00 0.00 ? 25  TYR A HE2  6  
ATOM 10069 H HH   . TYR A 1 26  ? 5.159   -6.527  10.428  1.00 0.00 ? 25  TYR A HH   6  
ATOM 10070 N N    . SER A 1 27  ? -0.698  -4.272  3.878   1.00 0.00 ? 26  SER A N    6  
ATOM 10071 C CA   . SER A 1 27  ? -1.648  -4.007  2.789   1.00 0.00 ? 26  SER A CA   6  
ATOM 10072 C C    . SER A 1 27  ? -3.100  -3.528  3.114   1.00 0.00 ? 26  SER A C    6  
ATOM 10073 O O    . SER A 1 27  ? -3.845  -4.258  3.769   1.00 0.00 ? 26  SER A O    6  
ATOM 10074 C CB   . SER A 1 27  ? -1.653  -5.424  2.122   1.00 0.00 ? 26  SER A CB   6  
ATOM 10075 O OG   . SER A 1 27  ? -2.866  -5.842  1.485   1.00 0.00 ? 26  SER A OG   6  
ATOM 10076 H H    . SER A 1 27  ? -0.853  -5.096  4.398   1.00 0.00 ? 26  SER A H    6  
ATOM 10077 H HA   . SER A 1 27  ? -1.220  -3.243  2.149   1.00 0.00 ? 26  SER A HA   6  
ATOM 10078 H HB2  . SER A 1 27  ? -0.750  -5.513  1.460   1.00 0.00 ? 26  SER A HB2  6  
ATOM 10079 H HB3  . SER A 1 27  ? -1.496  -6.157  2.946   1.00 0.00 ? 26  SER A HB3  6  
ATOM 10080 H HG   . SER A 1 27  ? -3.542  -5.777  2.173   1.00 0.00 ? 26  SER A HG   6  
ATOM 10081 N N    . GLY A 1 28  ? -3.558  -2.342  2.589   1.00 0.00 ? 27  GLY A N    6  
ATOM 10082 C CA   . GLY A 1 28  ? -4.895  -1.743  2.791   1.00 0.00 ? 27  GLY A CA   6  
ATOM 10083 C C    . GLY A 1 28  ? -5.596  -1.083  1.587   1.00 0.00 ? 27  GLY A C    6  
ATOM 10084 O O    . GLY A 1 28  ? -4.985  -0.769  0.565   1.00 0.00 ? 27  GLY A O    6  
ATOM 10085 H H    . GLY A 1 28  ? -2.959  -1.777  2.009   1.00 0.00 ? 27  GLY A H    6  
ATOM 10086 H HA2  . GLY A 1 28  ? -5.567  -2.534  3.089   1.00 0.00 ? 27  GLY A HA2  6  
ATOM 10087 H HA3  . GLY A 1 28  ? -4.800  -1.010  3.574   1.00 0.00 ? 27  GLY A HA3  6  
ATOM 10088 N N    . LYS A 1 29  ? -6.939  -0.820  1.711   1.00 0.00 ? 28  LYS A N    6  
ATOM 10089 C CA   . LYS A 1 29  ? -7.787  -0.066  0.765   1.00 0.00 ? 28  LYS A CA   6  
ATOM 10090 C C    . LYS A 1 29  ? -8.465  1.159   1.441   1.00 0.00 ? 28  LYS A C    6  
ATOM 10091 O O    . LYS A 1 29  ? -8.870  0.995   2.587   1.00 0.00 ? 28  LYS A O    6  
ATOM 10092 C CB   . LYS A 1 29  ? -8.970  -0.923  0.220   1.00 0.00 ? 28  LYS A CB   6  
ATOM 10093 C CG   . LYS A 1 29  ? -8.605  -2.285  -0.386  1.00 0.00 ? 28  LYS A CG   6  
ATOM 10094 C CD   . LYS A 1 29  ? -9.835  -3.046  -0.921  1.00 0.00 ? 28  LYS A CD   6  
ATOM 10095 C CE   . LYS A 1 29  ? -10.825 -3.450  0.186   1.00 0.00 ? 28  LYS A CE   6  
ATOM 10096 N NZ   . LYS A 1 29  ? -11.854 -4.385  -0.325  1.00 0.00 ? 28  LYS A NZ   6  
ATOM 10097 H H    . LYS A 1 29  ? -7.449  -1.043  2.560   1.00 0.00 ? 28  LYS A H    6  
ATOM 10098 H HA   . LYS A 1 29  ? -7.210  0.255   -0.064  1.00 0.00 ? 28  LYS A HA   6  
ATOM 10099 H HB2  . LYS A 1 29  ? -9.699  -1.124  1.042   1.00 0.00 ? 28  LYS A HB2  6  
ATOM 10100 H HB3  . LYS A 1 29  ? -9.491  -0.344  -0.578  1.00 0.00 ? 28  LYS A HB3  6  
ATOM 10101 H HG2  . LYS A 1 29  ? -7.877  -2.137  -1.213  1.00 0.00 ? 28  LYS A HG2  6  
ATOM 10102 H HG3  . LYS A 1 29  ? -8.116  -2.917  0.388   1.00 0.00 ? 28  LYS A HG3  6  
ATOM 10103 H HD2  . LYS A 1 29  ? -10.379 -2.419  -1.662  1.00 0.00 ? 28  LYS A HD2  6  
ATOM 10104 H HD3  . LYS A 1 29  ? -9.477  -3.966  -1.436  1.00 0.00 ? 28  LYS A HD3  6  
ATOM 10105 H HE2  . LYS A 1 29  ? -10.297 -3.959  1.017   1.00 0.00 ? 28  LYS A HE2  6  
ATOM 10106 H HE3  . LYS A 1 29  ? -11.353 -2.559  0.587   1.00 0.00 ? 28  LYS A HE3  6  
ATOM 10107 H HZ1  . LYS A 1 29  ? -12.508 -4.635  0.445   1.00 0.00 ? 28  LYS A HZ1  6  
ATOM 10108 H HZ2  . LYS A 1 29  ? -11.392 -5.247  -0.682  1.00 0.00 ? 28  LYS A HZ2  6  
ATOM 10109 H HZ3  . LYS A 1 29  ? -12.383 -3.931  -1.096  1.00 0.00 ? 28  LYS A HZ3  6  
ATOM 10110 N N    . ILE A 1 30  ? -8.702  2.382   0.819   1.00 0.00 ? 29  ILE A N    6  
ATOM 10111 C CA   . ILE A 1 30  ? -9.564  3.404   1.479   1.00 0.00 ? 29  ILE A CA   6  
ATOM 10112 C C    . ILE A 1 30  ? -11.052 3.232   1.146   1.00 0.00 ? 29  ILE A C    6  
ATOM 10113 O O    . ILE A 1 30  ? -11.417 2.739   0.083   1.00 0.00 ? 29  ILE A O    6  
ATOM 10114 C CB   . ILE A 1 30  ? -9.152  4.854   1.142   1.00 0.00 ? 29  ILE A CB   6  
ATOM 10115 C CG1  . ILE A 1 30  ? -7.802  5.227   1.758   1.00 0.00 ? 29  ILE A CG1  6  
ATOM 10116 C CG2  . ILE A 1 30  ? -10.094 5.969   1.636   1.00 0.00 ? 29  ILE A CG2  6  
ATOM 10117 C CD1  . ILE A 1 30  ? -7.618  4.797   3.211   1.00 0.00 ? 29  ILE A CD1  6  
ATOM 10118 H H    . ILE A 1 30  ? -8.388  2.659   -0.109  1.00 0.00 ? 29  ILE A H    6  
ATOM 10119 H HA   . ILE A 1 30  ? -9.523  3.297   2.553   1.00 0.00 ? 29  ILE A HA   6  
ATOM 10120 H HB   . ILE A 1 30  ? -9.094  4.933   0.034   1.00 0.00 ? 29  ILE A HB   6  
ATOM 10121 H HG12 . ILE A 1 30  ? -7.016  4.851   1.084   1.00 0.00 ? 29  ILE A HG12 6  
ATOM 10122 H HG13 . ILE A 1 30  ? -7.703  6.331   1.756   1.00 0.00 ? 29  ILE A HG13 6  
ATOM 10123 H HG21 . ILE A 1 30  ? -9.657  6.975   1.465   1.00 0.00 ? 29  ILE A HG21 6  
ATOM 10124 H HG22 . ILE A 1 30  ? -10.258 5.850   2.724   1.00 0.00 ? 29  ILE A HG22 6  
ATOM 10125 H HG23 . ILE A 1 30  ? -11.066 5.968   1.101   1.00 0.00 ? 29  ILE A HG23 6  
ATOM 10126 H HD11 . ILE A 1 30  ? -8.489  5.103   3.831   1.00 0.00 ? 29  ILE A HD11 6  
ATOM 10127 H HD12 . ILE A 1 30  ? -6.699  5.248   3.643   1.00 0.00 ? 29  ILE A HD12 6  
ATOM 10128 H HD13 . ILE A 1 30  ? -7.494  3.694   3.272   1.00 0.00 ? 29  ILE A HD13 6  
ATOM 10129 N N    . THR A 1 31  ? -11.931 3.687   2.087   1.00 0.00 ? 30  THR A N    6  
ATOM 10130 C CA   . THR A 1 31  ? -13.380 3.806   1.934   1.00 0.00 ? 30  THR A CA   6  
ATOM 10131 C C    . THR A 1 31  ? -13.771 5.282   1.988   1.00 0.00 ? 30  THR A C    6  
ATOM 10132 O O    . THR A 1 31  ? -14.616 5.729   1.213   1.00 0.00 ? 30  THR A O    6  
ATOM 10133 C CB   . THR A 1 31  ? -14.153 2.961   2.935   1.00 0.00 ? 30  THR A CB   6  
ATOM 10134 O OG1  . THR A 1 31  ? -13.742 1.613   2.780   1.00 0.00 ? 30  THR A OG1  6  
ATOM 10135 C CG2  . THR A 1 31  ? -15.674 2.999   2.686   1.00 0.00 ? 30  THR A CG2  6  
ATOM 10136 H H    . THR A 1 31  ? -11.565 4.054   2.953   1.00 0.00 ? 30  THR A H    6  
ATOM 10137 H HA   . THR A 1 31  ? -13.678 3.477   0.944   1.00 0.00 ? 30  THR A HA   6  
ATOM 10138 H HB   . THR A 1 31  ? -13.931 3.269   3.981   1.00 0.00 ? 30  THR A HB   6  
ATOM 10139 H HG1  . THR A 1 31  ? -13.163 1.614   2.004   1.00 0.00 ? 30  THR A HG1  6  
ATOM 10140 H HG21 . THR A 1 31  ? -16.181 2.252   3.336   1.00 0.00 ? 30  THR A HG21 6  
ATOM 10141 H HG22 . THR A 1 31  ? -15.886 2.746   1.624   1.00 0.00 ? 30  THR A HG22 6  
ATOM 10142 H HG23 . THR A 1 31  ? -16.105 3.997   2.904   1.00 0.00 ? 30  THR A HG23 6  
ATOM 10143 N N    . ARG A 1 32  ? -13.153 6.112   2.891   1.00 0.00 ? 31  ARG A N    6  
ATOM 10144 C CA   . ARG A 1 32  ? -13.424 7.541   2.970   1.00 0.00 ? 31  ARG A CA   6  
ATOM 10145 C C    . ARG A 1 32  ? -12.180 8.105   3.619   1.00 0.00 ? 31  ARG A C    6  
ATOM 10146 O O    . ARG A 1 32  ? -11.339 7.369   4.112   1.00 0.00 ? 31  ARG A O    6  
ATOM 10147 C CB   . ARG A 1 32  ? -14.644 7.964   3.857   1.00 0.00 ? 31  ARG A CB   6  
ATOM 10148 C CG   . ARG A 1 32  ? -16.022 7.382   3.495   1.00 0.00 ? 31  ARG A CG   6  
ATOM 10149 C CD   . ARG A 1 32  ? -17.091 7.861   4.487   1.00 0.00 ? 31  ARG A CD   6  
ATOM 10150 N NE   . ARG A 1 32  ? -18.394 7.188   4.153   1.00 0.00 ? 31  ARG A NE   6  
ATOM 10151 C CZ   . ARG A 1 32  ? -19.528 7.344   4.905   1.00 0.00 ? 31  ARG A CZ   6  
ATOM 10152 N NH1  . ARG A 1 32  ? -19.531 8.138   6.014   1.00 0.00 ? 31  ARG A NH1  6  
ATOM 10153 N NH2  . ARG A 1 32  ? -20.672 6.697   4.536   1.00 0.00 ? 31  ARG A NH2  6  
ATOM 10154 H H    . ARG A 1 32  ? -12.418 5.847   3.557   1.00 0.00 ? 31  ARG A H    6  
ATOM 10155 H HA   . ARG A 1 32  ? -13.503 7.955   1.972   1.00 0.00 ? 31  ARG A HA   6  
ATOM 10156 H HB2  . ARG A 1 32  ? -14.468 7.675   4.920   1.00 0.00 ? 31  ARG A HB2  6  
ATOM 10157 H HB3  . ARG A 1 32  ? -14.761 9.075   3.825   1.00 0.00 ? 31  ARG A HB3  6  
ATOM 10158 H HG2  . ARG A 1 32  ? -16.300 7.670   2.456   1.00 0.00 ? 31  ARG A HG2  6  
ATOM 10159 H HG3  . ARG A 1 32  ? -15.968 6.271   3.549   1.00 0.00 ? 31  ARG A HG3  6  
ATOM 10160 H HD2  . ARG A 1 32  ? -16.784 7.588   5.525   1.00 0.00 ? 31  ARG A HD2  6  
ATOM 10161 H HD3  . ARG A 1 32  ? -17.215 8.963   4.416   1.00 0.00 ? 31  ARG A HD3  6  
ATOM 10162 H HE   . ARG A 1 32  ? -18.431 6.599   3.347   1.00 0.00 ? 31  ARG A HE   6  
ATOM 10163 H HH11 . ARG A 1 32  ? -18.695 8.615   6.289   1.00 0.00 ? 31  ARG A HH11 6  
ATOM 10164 H HH12 . ARG A 1 32  ? -20.367 8.243   6.552   1.00 0.00 ? 31  ARG A HH12 6  
ATOM 10165 H HH21 . ARG A 1 32  ? -20.677 6.114   3.722   1.00 0.00 ? 31  ARG A HH21 6  
ATOM 10166 H HH22 . ARG A 1 32  ? -21.505 6.806   5.077   1.00 0.00 ? 31  ARG A HH22 6  
ATOM 10167 N N    . ASP A 1 33  ? -12.016 9.441   3.704   1.00 0.00 ? 32  ASP A N    6  
ATOM 10168 C CA   . ASP A 1 33  ? -10.953 10.081  4.499   1.00 0.00 ? 32  ASP A CA   6  
ATOM 10169 C C    . ASP A 1 33  ? -11.507 10.467  5.885   1.00 0.00 ? 32  ASP A C    6  
ATOM 10170 O O    . ASP A 1 33  ? -12.716 10.636  6.034   1.00 0.00 ? 32  ASP A O    6  
ATOM 10171 C CB   . ASP A 1 33  ? -10.299 11.302  3.773   1.00 0.00 ? 32  ASP A CB   6  
ATOM 10172 C CG   . ASP A 1 33  ? -11.285 12.410  3.363   1.00 0.00 ? 32  ASP A CG   6  
ATOM 10173 O OD1  . ASP A 1 33  ? -12.166 12.142  2.503   1.00 0.00 ? 32  ASP A OD1  6  
ATOM 10174 O OD2  . ASP A 1 33  ? -11.157 13.540  3.904   1.00 0.00 ? 32  ASP A OD2  6  
ATOM 10175 H H    . ASP A 1 33  ? -12.682 10.068  3.305   1.00 0.00 ? 32  ASP A H    6  
ATOM 10176 H HA   . ASP A 1 33  ? -10.146 9.386   4.674   1.00 0.00 ? 32  ASP A HA   6  
ATOM 10177 H HB2  . ASP A 1 33  ? -9.501  11.739  4.415   1.00 0.00 ? 32  ASP A HB2  6  
ATOM 10178 H HB3  . ASP A 1 33  ? -9.808  10.925  2.849   1.00 0.00 ? 32  ASP A HB3  6  
ATOM 10179 N N    . VAL A 1 34  ? -10.668 10.634  6.943   1.00 0.00 ? 33  VAL A N    6  
ATOM 10180 C CA   . VAL A 1 34  ? -11.164 11.124  8.235   1.00 0.00 ? 33  VAL A CA   6  
ATOM 10181 C C    . VAL A 1 34  ? -10.371 12.394  8.503   1.00 0.00 ? 33  VAL A C    6  
ATOM 10182 O O    . VAL A 1 34  ? -9.152  12.394  8.577   1.00 0.00 ? 33  VAL A O    6  
ATOM 10183 C CB   . VAL A 1 34  ? -11.173 10.103  9.415   1.00 0.00 ? 33  VAL A CB   6  
ATOM 10184 C CG1  . VAL A 1 34  ? -12.627 9.583   9.530   1.00 0.00 ? 33  VAL A CG1  6  
ATOM 10185 C CG2  . VAL A 1 34  ? -10.179 8.915   9.294   1.00 0.00 ? 33  VAL A CG2  6  
ATOM 10186 H H    . VAL A 1 34  ? -9.674  10.531  6.857   1.00 0.00 ? 33  VAL A H    6  
ATOM 10187 H HA   . VAL A 1 34  ? -12.186 11.476  8.155   1.00 0.00 ? 33  VAL A HA   6  
ATOM 10188 H HB   . VAL A 1 34  ? -10.945 10.622  10.376  1.00 0.00 ? 33  VAL A HB   6  
ATOM 10189 H HG11 . VAL A 1 34  ? -12.719 8.873   10.378  1.00 0.00 ? 33  VAL A HG11 6  
ATOM 10190 H HG12 . VAL A 1 34  ? -12.919 9.048   8.598   1.00 0.00 ? 33  VAL A HG12 6  
ATOM 10191 H HG13 . VAL A 1 34  ? -13.343 10.416  9.691   1.00 0.00 ? 33  VAL A HG13 6  
ATOM 10192 H HG21 . VAL A 1 34  ? -9.817  8.502   10.255  1.00 0.00 ? 33  VAL A HG21 6  
ATOM 10193 H HG22 . VAL A 1 34  ? -9.236  9.182   8.785   1.00 0.00 ? 33  VAL A HG22 6  
ATOM 10194 H HG23 . VAL A 1 34  ? -10.610 8.048   8.754   1.00 0.00 ? 33  VAL A HG23 6  
ATOM 10195 N N    . GLY A 1 35  ? -11.069 13.548  8.662   1.00 0.00 ? 34  GLY A N    6  
ATOM 10196 C CA   . GLY A 1 35  ? -10.551 14.919  8.877   1.00 0.00 ? 34  GLY A CA   6  
ATOM 10197 C C    . GLY A 1 35  ? -9.376  15.419  8.031   1.00 0.00 ? 34  GLY A C    6  
ATOM 10198 O O    . GLY A 1 35  ? -9.321  15.247  6.816   1.00 0.00 ? 34  GLY A O    6  
ATOM 10199 H H    . GLY A 1 35  ? -12.058 13.482  8.590   1.00 0.00 ? 34  GLY A H    6  
ATOM 10200 H HA2  . GLY A 1 35  ? -11.372 15.591  8.670   1.00 0.00 ? 34  GLY A HA2  6  
ATOM 10201 H HA3  . GLY A 1 35  ? -10.236 14.964  9.911   1.00 0.00 ? 34  GLY A HA3  6  
ATOM 10202 N N    . ALA A 1 36  ? -8.392  16.065  8.701   1.00 0.00 ? 35  ALA A N    6  
ATOM 10203 C CA   . ALA A 1 36  ? -7.071  16.414  8.198   1.00 0.00 ? 35  ALA A CA   6  
ATOM 10204 C C    . ALA A 1 36  ? -6.089  15.477  8.855   1.00 0.00 ? 35  ALA A C    6  
ATOM 10205 O O    . ALA A 1 36  ? -6.004  15.423  10.080  1.00 0.00 ? 35  ALA A O    6  
ATOM 10206 C CB   . ALA A 1 36  ? -6.707  17.888  8.488   1.00 0.00 ? 35  ALA A CB   6  
ATOM 10207 H H    . ALA A 1 36  ? -8.476  16.202  9.683   1.00 0.00 ? 35  ALA A H    6  
ATOM 10208 H HA   . ALA A 1 36  ? -6.949  16.179  7.140   1.00 0.00 ? 35  ALA A HA   6  
ATOM 10209 H HB1  . ALA A 1 36  ? -7.419  18.562  7.966   1.00 0.00 ? 35  ALA A HB1  6  
ATOM 10210 H HB2  . ALA A 1 36  ? -5.682  18.128  8.129   1.00 0.00 ? 35  ALA A HB2  6  
ATOM 10211 H HB3  . ALA A 1 36  ? -6.763  18.101  9.579   1.00 0.00 ? 35  ALA A HB3  6  
ATOM 10212 N N    . GLY A 1 37  ? -5.311  14.735  8.045   1.00 0.00 ? 36  GLY A N    6  
ATOM 10213 C CA   . GLY A 1 37  ? -4.272  13.859  8.533   1.00 0.00 ? 36  GLY A CA   6  
ATOM 10214 C C    . GLY A 1 37  ? -4.684  12.433  8.697   1.00 0.00 ? 36  GLY A C    6  
ATOM 10215 O O    . GLY A 1 37  ? -3.797  11.615  8.888   1.00 0.00 ? 36  GLY A O    6  
ATOM 10216 H H    . GLY A 1 37  ? -5.407  14.816  7.056   1.00 0.00 ? 36  GLY A H    6  
ATOM 10217 H HA2  . GLY A 1 37  ? -3.493  13.877  7.786   1.00 0.00 ? 36  GLY A HA2  6  
ATOM 10218 H HA3  . GLY A 1 37  ? -3.900  14.183  9.500   1.00 0.00 ? 36  GLY A HA3  6  
ATOM 10219 N N    . LYS A 1 38  ? -5.997  12.057  8.651   1.00 0.00 ? 37  LYS A N    6  
ATOM 10220 C CA   . LYS A 1 38  ? -6.439  10.674  8.830   1.00 0.00 ? 37  LYS A CA   6  
ATOM 10221 C C    . LYS A 1 38  ? -7.144  10.118  7.587   1.00 0.00 ? 37  LYS A C    6  
ATOM 10222 O O    . LYS A 1 38  ? -7.589  10.828  6.682   1.00 0.00 ? 37  LYS A O    6  
ATOM 10223 C CB   . LYS A 1 38  ? -7.328  10.441  10.112  1.00 0.00 ? 37  LYS A CB   6  
ATOM 10224 C CG   . LYS A 1 38  ? -7.144  11.285  11.379  1.00 0.00 ? 37  LYS A CG   6  
ATOM 10225 C CD   . LYS A 1 38  ? -8.480  11.818  11.920  1.00 0.00 ? 37  LYS A CD   6  
ATOM 10226 C CE   . LYS A 1 38  ? -8.306  12.718  13.149  1.00 0.00 ? 37  LYS A CE   6  
ATOM 10227 N NZ   . LYS A 1 38  ? -9.614  13.222  13.624  1.00 0.00 ? 37  LYS A NZ   6  
ATOM 10228 H H    . LYS A 1 38  ? -6.752  12.699  8.500   1.00 0.00 ? 37  LYS A H    6  
ATOM 10229 H HA   . LYS A 1 38  ? -5.592  10.024  8.909   1.00 0.00 ? 37  LYS A HA   6  
ATOM 10230 H HB2  . LYS A 1 38  ? -8.368  10.689  9.873   1.00 0.00 ? 37  LYS A HB2  6  
ATOM 10231 H HB3  . LYS A 1 38  ? -7.345  9.369   10.415  1.00 0.00 ? 37  LYS A HB3  6  
ATOM 10232 H HG2  . LYS A 1 38  ? -6.697  10.640  12.168  1.00 0.00 ? 37  LYS A HG2  6  
ATOM 10233 H HG3  . LYS A 1 38  ? -6.459  12.137  11.193  1.00 0.00 ? 37  LYS A HG3  6  
ATOM 10234 H HD2  . LYS A 1 38  ? -8.965  12.418  11.119  1.00 0.00 ? 37  LYS A HD2  6  
ATOM 10235 H HD3  . LYS A 1 38  ? -9.151  10.961  12.156  1.00 0.00 ? 37  LYS A HD3  6  
ATOM 10236 H HE2  . LYS A 1 38  ? -7.837  12.150  13.979  1.00 0.00 ? 37  LYS A HE2  6  
ATOM 10237 H HE3  . LYS A 1 38  ? -7.678  13.600  12.892  1.00 0.00 ? 37  LYS A HE3  6  
ATOM 10238 H HZ1  . LYS A 1 38  ? -10.222 12.417  13.881  1.00 0.00 ? 37  LYS A HZ1  6  
ATOM 10239 H HZ2  . LYS A 1 38  ? -10.069 13.772  12.867  1.00 0.00 ? 37  LYS A HZ2  6  
ATOM 10240 H HZ3  . LYS A 1 38  ? -9.471  13.829  14.456  1.00 0.00 ? 37  LYS A HZ3  6  
ATOM 10241 N N    . TYR A 1 39  ? -7.317  8.759   7.570   1.00 0.00 ? 38  TYR A N    6  
ATOM 10242 C CA   . TYR A 1 39  ? -8.009  7.952   6.554   1.00 0.00 ? 38  TYR A CA   6  
ATOM 10243 C C    . TYR A 1 39  ? -8.933  6.882   7.184   1.00 0.00 ? 38  TYR A C    6  
ATOM 10244 O O    . TYR A 1 39  ? -8.657  6.407   8.287   1.00 0.00 ? 38  TYR A O    6  
ATOM 10245 C CB   . TYR A 1 39  ? -6.972  7.282   5.627   1.00 0.00 ? 38  TYR A CB   6  
ATOM 10246 C CG   . TYR A 1 39  ? -6.192  8.340   4.903   1.00 0.00 ? 38  TYR A CG   6  
ATOM 10247 C CD1  . TYR A 1 39  ? -6.832  9.193   4.024   1.00 0.00 ? 38  TYR A CD1  6  
ATOM 10248 C CD2  . TYR A 1 39  ? -4.860  8.552   5.201   1.00 0.00 ? 38  TYR A CD2  6  
ATOM 10249 C CE1  . TYR A 1 39  ? -6.182  10.310  3.543   1.00 0.00 ? 38  TYR A CE1  6  
ATOM 10250 C CE2  . TYR A 1 39  ? -4.182  9.629   4.668   1.00 0.00 ? 38  TYR A CE2  6  
ATOM 10251 C CZ   . TYR A 1 39  ? -4.869  10.532  3.879   1.00 0.00 ? 38  TYR A CZ   6  
ATOM 10252 O OH   . TYR A 1 39  ? -4.227  11.673  3.363   1.00 0.00 ? 38  TYR A OH   6  
ATOM 10253 H H    . TYR A 1 39  ? -6.961  8.213   8.343   1.00 0.00 ? 38  TYR A H    6  
ATOM 10254 H HA   . TYR A 1 39  ? -8.657  8.588   5.971   1.00 0.00 ? 38  TYR A HA   6  
ATOM 10255 H HB2  . TYR A 1 39  ? -6.270  6.637   6.203   1.00 0.00 ? 38  TYR A HB2  6  
ATOM 10256 H HB3  . TYR A 1 39  ? -7.486  6.688   4.856   1.00 0.00 ? 38  TYR A HB3  6  
ATOM 10257 H HD1  . TYR A 1 39  ? -7.875  9.045   3.786   1.00 0.00 ? 38  TYR A HD1  6  
ATOM 10258 H HD2  . TYR A 1 39  ? -4.374  7.895   5.910   1.00 0.00 ? 38  TYR A HD2  6  
ATOM 10259 H HE1  . TYR A 1 39  ? -6.701  11.007  2.902   1.00 0.00 ? 38  TYR A HE1  6  
ATOM 10260 H HE2  . TYR A 1 39  ? -3.127  9.763   4.898   1.00 0.00 ? 38  TYR A HE2  6  
ATOM 10261 H HH   . TYR A 1 39  ? -3.332  11.400  3.130   1.00 0.00 ? 38  TYR A HH   6  
ATOM 10262 N N    . LYS A 1 40  ? -10.088 6.500   6.530   1.00 0.00 ? 39  LYS A N    6  
ATOM 10263 C CA   . LYS A 1 40  ? -11.120 5.536   6.959   1.00 0.00 ? 39  LYS A CA   6  
ATOM 10264 C C    . LYS A 1 40  ? -10.991 4.478   5.916   1.00 0.00 ? 39  LYS A C    6  
ATOM 10265 O O    . LYS A 1 40  ? -11.212 4.643   4.706   1.00 0.00 ? 39  LYS A O    6  
ATOM 10266 C CB   . LYS A 1 40  ? -12.531 6.192   7.014   1.00 0.00 ? 39  LYS A CB   6  
ATOM 10267 C CG   . LYS A 1 40  ? -13.749 5.323   6.638   1.00 0.00 ? 39  LYS A CG   6  
ATOM 10268 C CD   . LYS A 1 40  ? -14.063 4.155   7.584   1.00 0.00 ? 39  LYS A CD   6  
ATOM 10269 C CE   . LYS A 1 40  ? -15.196 3.275   7.032   1.00 0.00 ? 39  LYS A CE   6  
ATOM 10270 N NZ   . LYS A 1 40  ? -16.439 4.050   6.802   1.00 0.00 ? 39  LYS A NZ   6  
ATOM 10271 H H    . LYS A 1 40  ? -10.378 6.830   5.610   1.00 0.00 ? 39  LYS A H    6  
ATOM 10272 H HA   . LYS A 1 40  ? -10.901 5.005   7.897   1.00 0.00 ? 39  LYS A HA   6  
ATOM 10273 H HB2  . LYS A 1 40  ? -12.677 6.594   8.041   1.00 0.00 ? 39  LYS A HB2  6  
ATOM 10274 H HB3  . LYS A 1 40  ? -12.526 7.070   6.330   1.00 0.00 ? 39  LYS A HB3  6  
ATOM 10275 H HG2  . LYS A 1 40  ? -14.641 5.992   6.607   1.00 0.00 ? 39  LYS A HG2  6  
ATOM 10276 H HG3  . LYS A 1 40  ? -13.615 4.907   5.611   1.00 0.00 ? 39  LYS A HG3  6  
ATOM 10277 H HD2  . LYS A 1 40  ? -13.164 3.509   7.711   1.00 0.00 ? 39  LYS A HD2  6  
ATOM 10278 H HD3  . LYS A 1 40  ? -14.338 4.549   8.586   1.00 0.00 ? 39  LYS A HD3  6  
ATOM 10279 H HE2  . LYS A 1 40  ? -14.886 2.834   6.059   1.00 0.00 ? 39  LYS A HE2  6  
ATOM 10280 H HE3  . LYS A 1 40  ? -15.440 2.463   7.743   1.00 0.00 ? 39  LYS A HE3  6  
ATOM 10281 H HZ1  . LYS A 1 40  ? -16.249 4.814   6.121   1.00 0.00 ? 39  LYS A HZ1  6  
ATOM 10282 H HZ2  . LYS A 1 40  ? -16.763 4.459   7.701   1.00 0.00 ? 39  LYS A HZ2  6  
ATOM 10283 H HZ3  . LYS A 1 40  ? -17.174 3.421   6.420   1.00 0.00 ? 39  LYS A HZ3  6  
ATOM 10284 N N    . LEU A 1 41  ? -10.468 3.360   6.421   1.00 0.00 ? 40  LEU A N    6  
ATOM 10285 C CA   . LEU A 1 41  ? -9.922  2.336   5.578   1.00 0.00 ? 40  LEU A CA   6  
ATOM 10286 C C    . LEU A 1 41  ? -10.326 0.948   5.906   1.00 0.00 ? 40  LEU A C    6  
ATOM 10287 O O    . LEU A 1 41  ? -10.695 0.598   7.023   1.00 0.00 ? 40  LEU A O    6  
ATOM 10288 C CB   . LEU A 1 41  ? -8.393  2.499   5.608   1.00 0.00 ? 40  LEU A CB   6  
ATOM 10289 C CG   . LEU A 1 41  ? -7.661  2.076   6.897   1.00 0.00 ? 40  LEU A CG   6  
ATOM 10290 C CD1  . LEU A 1 41  ? -8.379  2.331   8.224   1.00 0.00 ? 40  LEU A CD1  6  
ATOM 10291 C CD2  . LEU A 1 41  ? -7.141  0.629   6.757   1.00 0.00 ? 40  LEU A CD2  6  
ATOM 10292 H H    . LEU A 1 41  ? -10.360 3.226   7.430   1.00 0.00 ? 40  LEU A H    6  
ATOM 10293 H HA   . LEU A 1 41  ? -10.280 2.469   4.563   1.00 0.00 ? 40  LEU A HA   6  
ATOM 10294 H HB2  . LEU A 1 41  ? -7.926  1.972   4.746   1.00 0.00 ? 40  LEU A HB2  6  
ATOM 10295 H HB3  . LEU A 1 41  ? -8.182  3.585   5.471   1.00 0.00 ? 40  LEU A HB3  6  
ATOM 10296 H HG   . LEU A 1 41  ? -6.843  2.800   6.997   1.00 0.00 ? 40  LEU A HG   6  
ATOM 10297 H HD11 . LEU A 1 41  ? -8.698  3.407   8.321   1.00 0.00 ? 40  LEU A HD11 6  
ATOM 10298 H HD12 . LEU A 1 41  ? -7.715  2.109   9.074   1.00 0.00 ? 40  LEU A HD12 6  
ATOM 10299 H HD13 . LEU A 1 41  ? -9.263  1.654   8.269   1.00 0.00 ? 40  LEU A HD13 6  
ATOM 10300 H HD21 . LEU A 1 41  ? -7.966  -0.102  6.875   1.00 0.00 ? 40  LEU A HD21 6  
ATOM 10301 H HD22 . LEU A 1 41  ? -6.399  0.412   7.550   1.00 0.00 ? 40  LEU A HD22 6  
ATOM 10302 H HD23 . LEU A 1 41  ? -6.707  0.442   5.744   1.00 0.00 ? 40  LEU A HD23 6  
ATOM 10303 N N    . LEU A 1 42  ? -10.246 0.049   4.925   1.00 0.00 ? 41  LEU A N    6  
ATOM 10304 C CA   . LEU A 1 42  ? -10.483 -1.338  5.188   1.00 0.00 ? 41  LEU A CA   6  
ATOM 10305 C C    . LEU A 1 42  ? -9.348  -2.114  4.598   1.00 0.00 ? 41  LEU A C    6  
ATOM 10306 O O    . LEU A 1 42  ? -8.937  -1.827  3.483   1.00 0.00 ? 41  LEU A O    6  
ATOM 10307 C CB   . LEU A 1 42  ? -11.923 -1.480  4.676   1.00 0.00 ? 41  LEU A CB   6  
ATOM 10308 C CG   . LEU A 1 42  ? -12.680 -2.812  4.852   1.00 0.00 ? 41  LEU A CG   6  
ATOM 10309 C CD1  . LEU A 1 42  ? -14.207 -2.587  4.883   1.00 0.00 ? 41  LEU A CD1  6  
ATOM 10310 C CD2  . LEU A 1 42  ? -12.409 -3.739  3.670   1.00 0.00 ? 41  LEU A CD2  6  
ATOM 10311 H H    . LEU A 1 42  ? -9.908  0.282   3.998   1.00 0.00 ? 41  LEU A H    6  
ATOM 10312 H HA   . LEU A 1 42  ? -10.427 -1.559  6.257   1.00 0.00 ? 41  LEU A HA   6  
ATOM 10313 H HB2  . LEU A 1 42  ? -12.377 -0.687  5.343   1.00 0.00 ? 41  LEU A HB2  6  
ATOM 10314 H HB3  . LEU A 1 42  ? -12.019 -1.130  3.627   1.00 0.00 ? 41  LEU A HB3  6  
ATOM 10315 H HG   . LEU A 1 42  ? -12.365 -3.257  5.841   1.00 0.00 ? 41  LEU A HG   6  
ATOM 10316 H HD11 . LEU A 1 42  ? -14.734 -3.528  5.148   1.00 0.00 ? 41  LEU A HD11 6  
ATOM 10317 H HD12 . LEU A 1 42  ? -14.563 -2.250  3.886   1.00 0.00 ? 41  LEU A HD12 6  
ATOM 10318 H HD13 . LEU A 1 42  ? -14.488 -1.810  5.619   1.00 0.00 ? 41  LEU A HD13 6  
ATOM 10319 H HD21 . LEU A 1 42  ? -12.789 -3.278  2.732   1.00 0.00 ? 41  LEU A HD21 6  
ATOM 10320 H HD22 . LEU A 1 42  ? -12.927 -4.711  3.800   1.00 0.00 ? 41  LEU A HD22 6  
ATOM 10321 H HD23 . LEU A 1 42  ? -11.331 -3.916  3.531   1.00 0.00 ? 41  LEU A HD23 6  
ATOM 10322 N N    . PHE A 1 43  ? -8.781  -3.171  5.253   1.00 0.00 ? 42  PHE A N    6  
ATOM 10323 C CA   . PHE A 1 43  ? -7.745  -4.041  4.638   1.00 0.00 ? 42  PHE A CA   6  
ATOM 10324 C C    . PHE A 1 43  ? -8.402  -4.927  3.570   1.00 0.00 ? 42  PHE A C    6  
ATOM 10325 O O    . PHE A 1 43  ? -9.560  -5.301  3.725   1.00 0.00 ? 42  PHE A O    6  
ATOM 10326 C CB   . PHE A 1 43  ? -6.952  -5.006  5.603   1.00 0.00 ? 42  PHE A CB   6  
ATOM 10327 C CG   . PHE A 1 43  ? -5.985  -4.306  6.546   1.00 0.00 ? 42  PHE A CG   6  
ATOM 10328 C CD1  . PHE A 1 43  ? -6.341  -3.253  7.383   1.00 0.00 ? 42  PHE A CD1  6  
ATOM 10329 C CD2  . PHE A 1 43  ? -4.686  -4.784  6.646   1.00 0.00 ? 42  PHE A CD2  6  
ATOM 10330 C CE1  . PHE A 1 43  ? -5.431  -2.690  8.256   1.00 0.00 ? 42  PHE A CE1  6  
ATOM 10331 C CE2  . PHE A 1 43  ? -3.778  -4.229  7.523   1.00 0.00 ? 42  PHE A CE2  6  
ATOM 10332 C CZ   . PHE A 1 43  ? -4.147  -3.179  8.334   1.00 0.00 ? 42  PHE A CZ   6  
ATOM 10333 H H    . PHE A 1 43  ? -9.127  -3.390  6.176   1.00 0.00 ? 42  PHE A H    6  
ATOM 10334 H HA   . PHE A 1 43  ? -7.024  -3.416  4.138   1.00 0.00 ? 42  PHE A HA   6  
ATOM 10335 H HB2  . PHE A 1 43  ? -7.658  -5.586  6.233   1.00 0.00 ? 42  PHE A HB2  6  
ATOM 10336 H HB3  . PHE A 1 43  ? -6.334  -5.738  4.996   1.00 0.00 ? 42  PHE A HB3  6  
ATOM 10337 H HD1  . PHE A 1 43  ? -7.344  -2.859  7.382   1.00 0.00 ? 42  PHE A HD1  6  
ATOM 10338 H HD2  . PHE A 1 43  ? -4.367  -5.605  6.016   1.00 0.00 ? 42  PHE A HD2  6  
ATOM 10339 H HE1  . PHE A 1 43  ? -5.728  -1.873  8.902   1.00 0.00 ? 42  PHE A HE1  6  
ATOM 10340 H HE2  . PHE A 1 43  ? -2.774  -4.628  7.588   1.00 0.00 ? 42  PHE A HE2  6  
ATOM 10341 H HZ   . PHE A 1 43  ? -3.438  -2.741  9.026   1.00 0.00 ? 42  PHE A HZ   6  
ATOM 10342 N N    . ASP A 1 44  ? -7.694  -5.322  2.472   1.00 0.00 ? 43  ASP A N    6  
ATOM 10343 C CA   . ASP A 1 44  ? -8.174  -6.152  1.331   1.00 0.00 ? 43  ASP A CA   6  
ATOM 10344 C C    . ASP A 1 44  ? -8.833  -7.494  1.676   1.00 0.00 ? 43  ASP A C    6  
ATOM 10345 O O    . ASP A 1 44  ? -9.582  -8.100  0.914   1.00 0.00 ? 43  ASP A O    6  
ATOM 10346 C CB   . ASP A 1 44  ? -7.017  -6.445  0.339   1.00 0.00 ? 43  ASP A CB   6  
ATOM 10347 C CG   . ASP A 1 44  ? -6.468  -5.118  -0.178  1.00 0.00 ? 43  ASP A CG   6  
ATOM 10348 O OD1  . ASP A 1 44  ? -5.748  -4.414  0.582   1.00 0.00 ? 43  ASP A OD1  6  
ATOM 10349 O OD2  . ASP A 1 44  ? -6.761  -4.793  -1.356  1.00 0.00 ? 43  ASP A OD2  6  
ATOM 10350 H H    . ASP A 1 44  ? -6.750  -5.012  2.361   1.00 0.00 ? 43  ASP A H    6  
ATOM 10351 H HA   . ASP A 1 44  ? -8.924  -5.578  0.807   1.00 0.00 ? 43  ASP A HA   6  
ATOM 10352 H HB2  . ASP A 1 44  ? -6.196  -7.005  0.837   1.00 0.00 ? 43  ASP A HB2  6  
ATOM 10353 H HB3  . ASP A 1 44  ? -7.372  -7.039  -0.534  1.00 0.00 ? 43  ASP A HB3  6  
ATOM 10354 N N    . ASP A 1 45  ? -8.522  -7.913  2.912   1.00 0.00 ? 44  ASP A N    6  
ATOM 10355 C CA   . ASP A 1 45  ? -8.939  -9.072  3.648   1.00 0.00 ? 44  ASP A CA   6  
ATOM 10356 C C    . ASP A 1 45  ? -10.099 -8.800  4.648   1.00 0.00 ? 44  ASP A C    6  
ATOM 10357 O O    . ASP A 1 45  ? -10.634 -9.739  5.230   1.00 0.00 ? 44  ASP A O    6  
ATOM 10358 C CB   . ASP A 1 45  ? -7.623  -9.691  4.219   1.00 0.00 ? 44  ASP A CB   6  
ATOM 10359 C CG   . ASP A 1 45  ? -6.927  -8.857  5.309   1.00 0.00 ? 44  ASP A CG   6  
ATOM 10360 O OD1  . ASP A 1 45  ? -7.458  -8.787  6.450   1.00 0.00 ? 44  ASP A OD1  6  
ATOM 10361 O OD2  . ASP A 1 45  ? -5.840  -8.293  5.011   1.00 0.00 ? 44  ASP A OD2  6  
ATOM 10362 H H    . ASP A 1 45  ? -7.900  -7.318  3.409   1.00 0.00 ? 44  ASP A H    6  
ATOM 10363 H HA   . ASP A 1 45  ? -9.338  -9.800  2.950   1.00 0.00 ? 44  ASP A HA   6  
ATOM 10364 H HB2  . ASP A 1 45  ? -7.791  -10.724 4.581   1.00 0.00 ? 44  ASP A HB2  6  
ATOM 10365 H HB3  . ASP A 1 45  ? -6.911  -9.704  3.339   1.00 0.00 ? 44  ASP A HB3  6  
ATOM 10366 N N    . GLY A 1 46  ? -10.569 -7.517  4.823   1.00 0.00 ? 45  GLY A N    6  
ATOM 10367 C CA   . GLY A 1 46  ? -11.808 -7.142  5.518   1.00 0.00 ? 45  GLY A CA   6  
ATOM 10368 C C    . GLY A 1 46  ? -11.743 -6.597  6.921   1.00 0.00 ? 45  GLY A C    6  
ATOM 10369 O O    . GLY A 1 46  ? -12.762 -6.580  7.603   1.00 0.00 ? 45  GLY A O    6  
ATOM 10370 H H    . GLY A 1 46  ? -10.158 -6.720  4.339   1.00 0.00 ? 45  GLY A H    6  
ATOM 10371 H HA2  . GLY A 1 46  ? -12.187 -6.300  4.929   1.00 0.00 ? 45  GLY A HA2  6  
ATOM 10372 H HA3  . GLY A 1 46  ? -12.486 -7.995  5.582   1.00 0.00 ? 45  GLY A HA3  6  
ATOM 10373 N N    . TYR A 1 47  ? -10.576 -6.099  7.397   1.00 0.00 ? 46  TYR A N    6  
ATOM 10374 C CA   . TYR A 1 47  ? -10.410 -5.465  8.708   1.00 0.00 ? 46  TYR A CA   6  
ATOM 10375 C C    . TYR A 1 47  ? -10.551 -3.952  8.522   1.00 0.00 ? 46  TYR A C    6  
ATOM 10376 O O    . TYR A 1 47  ? -9.646  -3.310  7.998   1.00 0.00 ? 46  TYR A O    6  
ATOM 10377 C CB   . TYR A 1 47  ? -9.015  -5.849  9.325   1.00 0.00 ? 46  TYR A CB   6  
ATOM 10378 C CG   . TYR A 1 47  ? -8.778  -5.386  10.756  1.00 0.00 ? 46  TYR A CG   6  
ATOM 10379 C CD1  . TYR A 1 47  ? -8.344  -4.095  11.034  1.00 0.00 ? 46  TYR A CD1  6  
ATOM 10380 C CD2  . TYR A 1 47  ? -8.936  -6.265  11.817  1.00 0.00 ? 46  TYR A CD2  6  
ATOM 10381 C CE1  . TYR A 1 47  ? -8.107  -3.685  12.333  1.00 0.00 ? 46  TYR A CE1  6  
ATOM 10382 C CE2  . TYR A 1 47  ? -8.670  -5.865  13.114  1.00 0.00 ? 46  TYR A CE2  6  
ATOM 10383 C CZ   . TYR A 1 47  ? -8.258  -4.574  13.377  1.00 0.00 ? 46  TYR A CZ   6  
ATOM 10384 O OH   . TYR A 1 47  ? -7.974  -4.163  14.701  1.00 0.00 ? 46  TYR A OH   6  
ATOM 10385 H H    . TYR A 1 47  ? -9.765  -6.132  6.823   1.00 0.00 ? 46  TYR A H    6  
ATOM 10386 H HA   . TYR A 1 47  ? -11.186 -5.793  9.391   1.00 0.00 ? 46  TYR A HA   6  
ATOM 10387 H HB2  . TYR A 1 47  ? -8.933  -6.958  9.313   1.00 0.00 ? 46  TYR A HB2  6  
ATOM 10388 H HB3  . TYR A 1 47  ? -8.188  -5.450  8.698   1.00 0.00 ? 46  TYR A HB3  6  
ATOM 10389 H HD1  . TYR A 1 47  ? -8.193  -3.387  10.228  1.00 0.00 ? 46  TYR A HD1  6  
ATOM 10390 H HD2  . TYR A 1 47  ? -9.253  -7.282  11.623  1.00 0.00 ? 46  TYR A HD2  6  
ATOM 10391 H HE1  . TYR A 1 47  ? -7.791  -2.665  12.521  1.00 0.00 ? 46  TYR A HE1  6  
ATOM 10392 H HE2  . TYR A 1 47  ? -8.787  -6.574  13.920  1.00 0.00 ? 46  TYR A HE2  6  
ATOM 10393 H HH   . TYR A 1 47  ? -8.067  -4.919  15.286  1.00 0.00 ? 46  TYR A HH   6  
ATOM 10394 N N    . GLU A 1 48  ? -11.678 -3.323  8.952   1.00 0.00 ? 47  GLU A N    6  
ATOM 10395 C CA   . GLU A 1 48  ? -11.883 -1.873  8.856   1.00 0.00 ? 47  GLU A CA   6  
ATOM 10396 C C    . GLU A 1 48  ? -11.716 -1.148  10.156  1.00 0.00 ? 47  GLU A C    6  
ATOM 10397 O O    . GLU A 1 48  ? -11.889 -1.686  11.253  1.00 0.00 ? 47  GLU A O    6  
ATOM 10398 C CB   . GLU A 1 48  ? -13.155 -1.456  8.077   1.00 0.00 ? 47  GLU A CB   6  
ATOM 10399 C CG   . GLU A 1 48  ? -13.583 0.038   8.006   1.00 0.00 ? 47  GLU A CG   6  
ATOM 10400 C CD   . GLU A 1 48  ? -14.513 0.396   9.168   1.00 0.00 ? 47  GLU A CD   6  
ATOM 10401 O OE1  . GLU A 1 48  ? -15.549 -0.303  9.329   1.00 0.00 ? 47  GLU A OE1  6  
ATOM 10402 O OE2  . GLU A 1 48  ? -14.211 1.377   9.898   1.00 0.00 ? 47  GLU A OE2  6  
ATOM 10403 H H    . GLU A 1 48  ? -12.410 -3.830  9.399   1.00 0.00 ? 47  GLU A H    6  
ATOM 10404 H HA   . GLU A 1 48  ? -11.073 -1.456  8.278   1.00 0.00 ? 47  GLU A HA   6  
ATOM 10405 H HB2  . GLU A 1 48  ? -12.862 -1.654  7.043   1.00 0.00 ? 47  GLU A HB2  6  
ATOM 10406 H HB3  . GLU A 1 48  ? -13.974 -2.178  8.223   1.00 0.00 ? 47  GLU A HB3  6  
ATOM 10407 H HG2  . GLU A 1 48  ? -12.677 0.718   7.973   1.00 0.00 ? 47  GLU A HG2  6  
ATOM 10408 H HG3  . GLU A 1 48  ? -14.151 0.189   7.062   1.00 0.00 ? 47  GLU A HG3  6  
ATOM 10409 N N    . CYS A 1 49  ? -11.302 0.138   10.002  1.00 0.00 ? 48  CYS A N    6  
ATOM 10410 C CA   . CYS A 1 49  ? -10.897 0.951   11.111  1.00 0.00 ? 48  CYS A CA   6  
ATOM 10411 C C    . CYS A 1 49  ? -10.863 2.360   10.583  1.00 0.00 ? 48  CYS A C    6  
ATOM 10412 O O    . CYS A 1 49  ? -11.048 2.575   9.387   1.00 0.00 ? 48  CYS A O    6  
ATOM 10413 C CB   . CYS A 1 49  ? -9.478  0.487   11.613  1.00 0.00 ? 48  CYS A CB   6  
ATOM 10414 S SG   . CYS A 1 49  ? -8.309  -0.260  10.411  1.00 0.00 ? 48  CYS A SG   6  
ATOM 10415 H H    . CYS A 1 49  ? -11.193 0.591   9.076   1.00 0.00 ? 48  CYS A H    6  
ATOM 10416 H HA   . CYS A 1 49  ? -11.630 0.919   11.907  1.00 0.00 ? 48  CYS A HA   6  
ATOM 10417 H HB2  . CYS A 1 49  ? -8.961  1.325   12.111  1.00 0.00 ? 48  CYS A HB2  6  
ATOM 10418 H HB3  . CYS A 1 49  ? -9.680  -0.312  12.353  1.00 0.00 ? 48  CYS A HB3  6  
ATOM 10419 H HG   . CYS A 1 49  ? -8.869  0.273   9.333   1.00 0.00 ? 48  CYS A HG   6  
ATOM 10420 N N    . ASP A 1 50  ? -10.550 3.363   11.439  1.00 0.00 ? 49  ASP A N    6  
ATOM 10421 C CA   . ASP A 1 50  ? -10.186 4.701   10.980  1.00 0.00 ? 49  ASP A CA   6  
ATOM 10422 C C    . ASP A 1 50  ? -8.843  4.864   11.651  1.00 0.00 ? 49  ASP A C    6  
ATOM 10423 O O    . ASP A 1 50  ? -8.665  4.413   12.788  1.00 0.00 ? 49  ASP A O    6  
ATOM 10424 C CB   . ASP A 1 50  ? -11.043 5.930   11.422  1.00 0.00 ? 49  ASP A CB   6  
ATOM 10425 C CG   . ASP A 1 50  ? -12.527 5.586   11.545  1.00 0.00 ? 49  ASP A CG   6  
ATOM 10426 O OD1  . ASP A 1 50  ? -12.907 4.934   12.553  1.00 0.00 ? 49  ASP A OD1  6  
ATOM 10427 O OD2  . ASP A 1 50  ? -13.304 5.985   10.637  1.00 0.00 ? 49  ASP A OD2  6  
ATOM 10428 H H    . ASP A 1 50  ? -10.386 3.208   12.412  1.00 0.00 ? 49  ASP A H    6  
ATOM 10429 H HA   . ASP A 1 50  ? -10.045 4.686   9.886   1.00 0.00 ? 49  ASP A HA   6  
ATOM 10430 H HB2  . ASP A 1 50  ? -10.673 6.409   12.364  1.00 0.00 ? 49  ASP A HB2  6  
ATOM 10431 H HB3  . ASP A 1 50  ? -10.926 6.697   10.626  1.00 0.00 ? 49  ASP A HB3  6  
ATOM 10432 N N    . VAL A 1 51  ? -7.862  5.461   10.955  1.00 0.00 ? 50  VAL A N    6  
ATOM 10433 C CA   . VAL A 1 51  ? -6.493  5.558   11.427  1.00 0.00 ? 50  VAL A CA   6  
ATOM 10434 C C    . VAL A 1 51  ? -5.856  6.831   10.938  1.00 0.00 ? 50  VAL A C    6  
ATOM 10435 O O    . VAL A 1 51  ? -6.361  7.458   10.009  1.00 0.00 ? 50  VAL A O    6  
ATOM 10436 C CB   . VAL A 1 51  ? -5.643  4.417   10.872  1.00 0.00 ? 50  VAL A CB   6  
ATOM 10437 C CG1  . VAL A 1 51  ? -6.141  3.070   11.432  1.00 0.00 ? 50  VAL A CG1  6  
ATOM 10438 C CG2  . VAL A 1 51  ? -5.717  4.453   9.328   1.00 0.00 ? 50  VAL A CG2  6  
ATOM 10439 H H    . VAL A 1 51  ? -8.016  5.830   10.029  1.00 0.00 ? 50  VAL A H    6  
ATOM 10440 H HA   . VAL A 1 51  ? -6.522  5.609   12.511  1.00 0.00 ? 50  VAL A HA   6  
ATOM 10441 H HB   . VAL A 1 51  ? -4.579  4.498   11.203  1.00 0.00 ? 50  VAL A HB   6  
ATOM 10442 H HG11 . VAL A 1 51  ? -6.279  3.168   12.529  1.00 0.00 ? 50  VAL A HG11 6  
ATOM 10443 H HG12 . VAL A 1 51  ? -5.415  2.261   11.218  1.00 0.00 ? 50  VAL A HG12 6  
ATOM 10444 H HG13 . VAL A 1 51  ? -7.117  2.796   10.984  1.00 0.00 ? 50  VAL A HG13 6  
ATOM 10445 H HG21 . VAL A 1 51  ? -4.849  5.001   8.901   1.00 0.00 ? 50  VAL A HG21 6  
ATOM 10446 H HG22 . VAL A 1 51  ? -6.638  4.945   8.935   1.00 0.00 ? 50  VAL A HG22 6  
ATOM 10447 H HG23 . VAL A 1 51  ? -5.737  3.414   8.963   1.00 0.00 ? 50  VAL A HG23 6  
ATOM 10448 N N    . LEU A 1 52  ? -4.669  7.214   11.504  1.00 0.00 ? 51  LEU A N    6  
ATOM 10449 C CA   . LEU A 1 52  ? -3.890  8.371   11.074  1.00 0.00 ? 51  LEU A CA   6  
ATOM 10450 C C    . LEU A 1 52  ? -3.037  8.093   9.854   1.00 0.00 ? 51  LEU A C    6  
ATOM 10451 O O    . LEU A 1 52  ? -2.713  6.959   9.501   1.00 0.00 ? 51  LEU A O    6  
ATOM 10452 C CB   . LEU A 1 52  ? -3.101  8.948   12.300  1.00 0.00 ? 51  LEU A CB   6  
ATOM 10453 C CG   . LEU A 1 52  ? -2.841  10.478  12.421  1.00 0.00 ? 51  LEU A CG   6  
ATOM 10454 C CD1  . LEU A 1 52  ? -1.751  11.079  11.526  1.00 0.00 ? 51  LEU A CD1  6  
ATOM 10455 C CD2  . LEU A 1 52  ? -4.122  11.289  12.275  1.00 0.00 ? 51  LEU A CD2  6  
ATOM 10456 H H    . LEU A 1 52  ? -4.220  6.681   12.220  1.00 0.00 ? 51  LEU A H    6  
ATOM 10457 H HA   . LEU A 1 52  ? -4.599  9.053   10.643  1.00 0.00 ? 51  LEU A HA   6  
ATOM 10458 H HB2  . LEU A 1 52  ? -3.728  8.701   13.193  1.00 0.00 ? 51  LEU A HB2  6  
ATOM 10459 H HB3  . LEU A 1 52  ? -2.141  8.409   12.433  1.00 0.00 ? 51  LEU A HB3  6  
ATOM 10460 H HG   . LEU A 1 52  ? -2.482  10.629  13.472  1.00 0.00 ? 51  LEU A HG   6  
ATOM 10461 H HD11 . LEU A 1 52  ? -2.060  11.130  10.470  1.00 0.00 ? 51  LEU A HD11 6  
ATOM 10462 H HD12 . LEU A 1 52  ? -0.823  10.492  11.604  1.00 0.00 ? 51  LEU A HD12 6  
ATOM 10463 H HD13 . LEU A 1 52  ? -1.524  12.118  11.854  1.00 0.00 ? 51  LEU A HD13 6  
ATOM 10464 H HD21 . LEU A 1 52  ? -4.591  11.089  11.285  1.00 0.00 ? 51  LEU A HD21 6  
ATOM 10465 H HD22 . LEU A 1 52  ? -3.929  12.379  12.347  1.00 0.00 ? 51  LEU A HD22 6  
ATOM 10466 H HD23 . LEU A 1 52  ? -4.852  11.004  13.063  1.00 0.00 ? 51  LEU A HD23 6  
ATOM 10467 N N    . GLY A 1 53  ? -2.790  9.160   9.060   1.00 0.00 ? 52  GLY A N    6  
ATOM 10468 C CA   . GLY A 1 53  ? -2.431  9.087   7.660   1.00 0.00 ? 52  GLY A CA   6  
ATOM 10469 C C    . GLY A 1 53  ? -0.969  8.834   7.345   1.00 0.00 ? 52  GLY A C    6  
ATOM 10470 O O    . GLY A 1 53  ? -0.524  8.826   6.204   1.00 0.00 ? 52  GLY A O    6  
ATOM 10471 H H    . GLY A 1 53  ? -3.078  10.087  9.341   1.00 0.00 ? 52  GLY A H    6  
ATOM 10472 H HA2  . GLY A 1 53  ? -3.152  8.363   7.274   1.00 0.00 ? 52  GLY A HA2  6  
ATOM 10473 H HA3  . GLY A 1 53  ? -2.618  10.038  7.218   1.00 0.00 ? 52  GLY A HA3  6  
ATOM 10474 N N    . LYS A 1 54  ? -0.170  8.596   8.403   1.00 0.00 ? 53  LYS A N    6  
ATOM 10475 C CA   . LYS A 1 54  ? 1.212   8.126   8.335   1.00 0.00 ? 53  LYS A CA   6  
ATOM 10476 C C    . LYS A 1 54  ? 1.223   6.641   8.786   1.00 0.00 ? 53  LYS A C    6  
ATOM 10477 O O    . LYS A 1 54  ? 2.269   6.046   9.023   1.00 0.00 ? 53  LYS A O    6  
ATOM 10478 C CB   . LYS A 1 54  ? 2.229   9.014   9.136   1.00 0.00 ? 53  LYS A CB   6  
ATOM 10479 C CG   . LYS A 1 54  ? 2.507   8.737   10.637  1.00 0.00 ? 53  LYS A CG   6  
ATOM 10480 C CD   . LYS A 1 54  ? 1.319   8.908   11.595  1.00 0.00 ? 53  LYS A CD   6  
ATOM 10481 C CE   . LYS A 1 54  ? 1.516   8.238   12.967  1.00 0.00 ? 53  LYS A CE   6  
ATOM 10482 N NZ   . LYS A 1 54  ? 2.655   8.832   13.702  1.00 0.00 ? 53  LYS A NZ   6  
ATOM 10483 H H    . LYS A 1 54  ? -0.575  8.685   9.308   1.00 0.00 ? 53  LYS A H    6  
ATOM 10484 H HA   . LYS A 1 54  ? 1.561   8.181   7.294   1.00 0.00 ? 53  LYS A HA   6  
ATOM 10485 H HB2  . LYS A 1 54  ? 3.212   8.882   8.621   1.00 0.00 ? 53  LYS A HB2  6  
ATOM 10486 H HB3  . LYS A 1 54  ? 1.941   10.077  9.003   1.00 0.00 ? 53  LYS A HB3  6  
ATOM 10487 H HG2  . LYS A 1 54  ? 2.914   7.708   10.749  1.00 0.00 ? 53  LYS A HG2  6  
ATOM 10488 H HG3  . LYS A 1 54  ? 3.323   9.420   10.967  1.00 0.00 ? 53  LYS A HG3  6  
ATOM 10489 H HD2  . LYS A 1 54  ? 1.137   9.995   11.736  1.00 0.00 ? 53  LYS A HD2  6  
ATOM 10490 H HD3  . LYS A 1 54  ? 0.404   8.446   11.158  1.00 0.00 ? 53  LYS A HD3  6  
ATOM 10491 H HE2  . LYS A 1 54  ? 0.605   8.358   13.590  1.00 0.00 ? 53  LYS A HE2  6  
ATOM 10492 H HE3  . LYS A 1 54  ? 1.712   7.150   12.849  1.00 0.00 ? 53  LYS A HE3  6  
ATOM 10493 H HZ1  . LYS A 1 54  ? 2.757   8.361   14.623  1.00 0.00 ? 53  LYS A HZ1  6  
ATOM 10494 H HZ2  . LYS A 1 54  ? 2.481   9.847   13.849  1.00 0.00 ? 53  LYS A HZ2  6  
ATOM 10495 H HZ3  . LYS A 1 54  ? 3.527   8.706   13.149  1.00 0.00 ? 53  LYS A HZ3  6  
ATOM 10496 N N    . ASP A 1 55  ? 0.021   6.007   8.941   1.00 0.00 ? 54  ASP A N    6  
ATOM 10497 C CA   . ASP A 1 55  ? -0.179  4.634   9.367   1.00 0.00 ? 54  ASP A CA   6  
ATOM 10498 C C    . ASP A 1 55  ? -0.846  3.850   8.261   1.00 0.00 ? 54  ASP A C    6  
ATOM 10499 O O    . ASP A 1 55  ? -0.199  3.134   7.507   1.00 0.00 ? 54  ASP A O    6  
ATOM 10500 C CB   . ASP A 1 55  ? -1.012  4.470   10.680  1.00 0.00 ? 54  ASP A CB   6  
ATOM 10501 C CG   . ASP A 1 55  ? -0.320  5.174   11.847  1.00 0.00 ? 54  ASP A CG   6  
ATOM 10502 O OD1  . ASP A 1 55  ? 0.863   4.838   12.126  1.00 0.00 ? 54  ASP A OD1  6  
ATOM 10503 O OD2  . ASP A 1 55  ? -0.970  6.047   12.480  1.00 0.00 ? 54  ASP A OD2  6  
ATOM 10504 H H    . ASP A 1 55  ? -0.837  6.494   8.773   1.00 0.00 ? 54  ASP A H    6  
ATOM 10505 H HA   . ASP A 1 55  ? 0.786   4.169   9.504   1.00 0.00 ? 54  ASP A HA   6  
ATOM 10506 H HB2  . ASP A 1 55  ? -2.034  4.888   10.567  1.00 0.00 ? 54  ASP A HB2  6  
ATOM 10507 H HB3  . ASP A 1 55  ? -1.112  3.394   10.948  1.00 0.00 ? 54  ASP A HB3  6  
ATOM 10508 N N    . ILE A 1 56  ? -2.190  3.909   8.096   1.00 0.00 ? 55  ILE A N    6  
ATOM 10509 C CA   . ILE A 1 56  ? -2.847  3.178   7.009   1.00 0.00 ? 55  ILE A CA   6  
ATOM 10510 C C    . ILE A 1 56  ? -3.403  4.275   6.121   1.00 0.00 ? 55  ILE A C    6  
ATOM 10511 O O    . ILE A 1 56  ? -4.403  4.931   6.408   1.00 0.00 ? 55  ILE A O    6  
ATOM 10512 C CB   . ILE A 1 56  ? -3.821  2.106   7.523   1.00 0.00 ? 55  ILE A CB   6  
ATOM 10513 C CG1  . ILE A 1 56  ? -3.576  1.639   9.001   1.00 0.00 ? 55  ILE A CG1  6  
ATOM 10514 C CG2  . ILE A 1 56  ? -3.902  0.934   6.520   1.00 0.00 ? 55  ILE A CG2  6  
ATOM 10515 C CD1  . ILE A 1 56  ? -2.303  0.851   9.352   1.00 0.00 ? 55  ILE A CD1  6  
ATOM 10516 H H    . ILE A 1 56  ? -2.748  4.490   8.680   1.00 0.00 ? 55  ILE A H    6  
ATOM 10517 H HA   . ILE A 1 56  ? -2.144  2.688   6.382   1.00 0.00 ? 55  ILE A HA   6  
ATOM 10518 H HB   . ILE A 1 56  ? -4.842  2.542   7.542   1.00 0.00 ? 55  ILE A HB   6  
ATOM 10519 H HG12 . ILE A 1 56  ? -3.603  2.532   9.662   1.00 0.00 ? 55  ILE A HG12 6  
ATOM 10520 H HG13 . ILE A 1 56  ? -4.457  1.018   9.293   1.00 0.00 ? 55  ILE A HG13 6  
ATOM 10521 H HG21 . ILE A 1 56  ? -4.613  1.181   5.710   1.00 0.00 ? 55  ILE A HG21 6  
ATOM 10522 H HG22 . ILE A 1 56  ? -4.251  0.014   7.034   1.00 0.00 ? 55  ILE A HG22 6  
ATOM 10523 H HG23 . ILE A 1 56  ? -2.932  0.736   6.044   1.00 0.00 ? 55  ILE A HG23 6  
ATOM 10524 H HD11 . ILE A 1 56  ? -1.357  1.356   9.060   1.00 0.00 ? 55  ILE A HD11 6  
ATOM 10525 H HD12 . ILE A 1 56  ? -2.307  -0.147  8.880   1.00 0.00 ? 55  ILE A HD12 6  
ATOM 10526 H HD13 . ILE A 1 56  ? -2.233  0.699   10.450  1.00 0.00 ? 55  ILE A HD13 6  
ATOM 10527 N N    . LEU A 1 57  ? -2.620  4.529   5.049   1.00 0.00 ? 56  LEU A N    6  
ATOM 10528 C CA   . LEU A 1 57  ? -2.660  5.761   4.288   1.00 0.00 ? 56  LEU A CA   6  
ATOM 10529 C C    . LEU A 1 57  ? -2.682  5.714   2.813   1.00 0.00 ? 56  LEU A C    6  
ATOM 10530 O O    . LEU A 1 57  ? -2.134  4.766   2.242   1.00 0.00 ? 56  LEU A O    6  
ATOM 10531 C CB   . LEU A 1 57  ? -1.425  6.593   4.663   1.00 0.00 ? 56  LEU A CB   6  
ATOM 10532 C CG   . LEU A 1 57  ? -0.012  6.306   4.068   1.00 0.00 ? 56  LEU A CG   6  
ATOM 10533 C CD1  . LEU A 1 57  ? 0.505   4.872   4.095   1.00 0.00 ? 56  LEU A CD1  6  
ATOM 10534 C CD2  . LEU A 1 57  ? 0.230   6.818   2.651   1.00 0.00 ? 56  LEU A CD2  6  
ATOM 10535 H H    . LEU A 1 57  ? -1.816  3.954   4.885   1.00 0.00 ? 56  LEU A H    6  
ATOM 10536 H HA   . LEU A 1 57  ? -3.537  6.324   4.566   1.00 0.00 ? 56  LEU A HA   6  
ATOM 10537 H HB2  . LEU A 1 57  ? -1.646  7.667   4.452   1.00 0.00 ? 56  LEU A HB2  6  
ATOM 10538 H HB3  . LEU A 1 57  ? -1.321  6.492   5.768   1.00 0.00 ? 56  LEU A HB3  6  
ATOM 10539 H HG   . LEU A 1 57  ? 0.638   6.941   4.715   1.00 0.00 ? 56  LEU A HG   6  
ATOM 10540 H HD11 . LEU A 1 57  ? -0.208  4.162   3.641   1.00 0.00 ? 56  LEU A HD11 6  
ATOM 10541 H HD12 . LEU A 1 57  ? 0.752   4.531   5.119   1.00 0.00 ? 56  LEU A HD12 6  
ATOM 10542 H HD13 . LEU A 1 57  ? 1.421   4.826   3.452   1.00 0.00 ? 56  LEU A HD13 6  
ATOM 10543 H HD21 . LEU A 1 57  ? 1.300   6.852   2.374   1.00 0.00 ? 56  LEU A HD21 6  
ATOM 10544 H HD22 . LEU A 1 57  ? -0.239  7.815   2.563   1.00 0.00 ? 56  LEU A HD22 6  
ATOM 10545 H HD23 . LEU A 1 57  ? -0.192  6.142   1.891   1.00 0.00 ? 56  LEU A HD23 6  
ATOM 10546 N N    . LEU A 1 58  ? -3.180  6.825   2.165   1.00 0.00 ? 57  LEU A N    6  
ATOM 10547 C CA   . LEU A 1 58  ? -3.234  7.189   0.767   1.00 0.00 ? 57  LEU A CA   6  
ATOM 10548 C C    . LEU A 1 58  ? -1.961  7.112   0.008   1.00 0.00 ? 57  LEU A C    6  
ATOM 10549 O O    . LEU A 1 58  ? -1.030  7.886   0.079   1.00 0.00 ? 57  LEU A O    6  
ATOM 10550 C CB   . LEU A 1 58  ? -3.767  8.671   0.652   1.00 0.00 ? 57  LEU A CB   6  
ATOM 10551 C CG   . LEU A 1 58  ? -3.007  10.009  0.887   1.00 0.00 ? 57  LEU A CG   6  
ATOM 10552 C CD1  . LEU A 1 58  ? -1.998  9.989   2.034   1.00 0.00 ? 57  LEU A CD1  6  
ATOM 10553 C CD2  . LEU A 1 58  ? -2.448  10.646  -0.402  1.00 0.00 ? 57  LEU A CD2  6  
ATOM 10554 H H    . LEU A 1 58  ? -3.626  7.568   2.628   1.00 0.00 ? 57  LEU A H    6  
ATOM 10555 H HA   . LEU A 1 58  ? -3.905  6.467   0.296   1.00 0.00 ? 57  LEU A HA   6  
ATOM 10556 H HB2  . LEU A 1 58  ? -4.198  8.788   -0.365  1.00 0.00 ? 57  LEU A HB2  6  
ATOM 10557 H HB3  . LEU A 1 58  ? -4.604  8.704   1.386   1.00 0.00 ? 57  LEU A HB3  6  
ATOM 10558 H HG   . LEU A 1 58  ? -3.824  10.718  1.175   1.00 0.00 ? 57  LEU A HG   6  
ATOM 10559 H HD11 . LEU A 1 58  ? -1.112  9.414   1.723   1.00 0.00 ? 57  LEU A HD11 6  
ATOM 10560 H HD12 . LEU A 1 58  ? -2.384  9.455   2.916   1.00 0.00 ? 57  LEU A HD12 6  
ATOM 10561 H HD13 . LEU A 1 58  ? -1.644  11.002  2.312   1.00 0.00 ? 57  LEU A HD13 6  
ATOM 10562 H HD21 . LEU A 1 58  ? -1.633  10.031  -0.830  1.00 0.00 ? 57  LEU A HD21 6  
ATOM 10563 H HD22 . LEU A 1 58  ? -2.031  11.652  -0.178  1.00 0.00 ? 57  LEU A HD22 6  
ATOM 10564 H HD23 . LEU A 1 58  ? -3.244  10.751  -1.167  1.00 0.00 ? 57  LEU A HD23 6  
ATOM 10565 N N    . CYS A 1 59  ? -1.859  6.048   -0.742  1.00 0.00 ? 58  CYS A N    6  
ATOM 10566 C CA   . CYS A 1 59  ? -0.724  5.702   -1.467  1.00 0.00 ? 58  CYS A CA   6  
ATOM 10567 C C    . CYS A 1 59  ? -1.221  5.549   -2.902  1.00 0.00 ? 58  CYS A C    6  
ATOM 10568 O O    . CYS A 1 59  ? -2.408  5.587   -3.216  1.00 0.00 ? 58  CYS A O    6  
ATOM 10569 C CB   . CYS A 1 59  ? -0.171  4.506   -0.630  1.00 0.00 ? 58  CYS A CB   6  
ATOM 10570 S SG   . CYS A 1 59  ? 1.632   4.626   -0.334  1.00 0.00 ? 58  CYS A SG   6  
ATOM 10571 H H    . CYS A 1 59  ? -2.552  5.339   -0.870  1.00 0.00 ? 58  CYS A H    6  
ATOM 10572 H HA   . CYS A 1 59  ? 0.015   6.499   -1.498  1.00 0.00 ? 58  CYS A HA   6  
ATOM 10573 H HB2  . CYS A 1 59  ? -0.662  4.516   0.375   1.00 0.00 ? 58  CYS A HB2  6  
ATOM 10574 H HB3  . CYS A 1 59  ? -0.491  3.532   -1.062  1.00 0.00 ? 58  CYS A HB3  6  
ATOM 10575 H HG   . CYS A 1 59  ? 1.990   4.605   -1.611  1.00 0.00 ? 58  CYS A HG   6  
ATOM 10576 N N    . ASP A 1 60  ? -0.249  5.325   -3.788  1.00 0.00 ? 59  ASP A N    6  
ATOM 10577 C CA   . ASP A 1 60  ? -0.284  4.860   -5.194  1.00 0.00 ? 59  ASP A CA   6  
ATOM 10578 C C    . ASP A 1 60  ? -0.687  3.357   -5.147  1.00 0.00 ? 59  ASP A C    6  
ATOM 10579 O O    . ASP A 1 60  ? -1.616  2.999   -5.864  1.00 0.00 ? 59  ASP A O    6  
ATOM 10580 C CB   . ASP A 1 60  ? 1.000   5.247   -6.049  1.00 0.00 ? 59  ASP A CB   6  
ATOM 10581 C CG   . ASP A 1 60  ? 0.697   5.581   -7.516  1.00 0.00 ? 59  ASP A CG   6  
ATOM 10582 O OD1  . ASP A 1 60  ? -0.447  5.355   -7.989  1.00 0.00 ? 59  ASP A OD1  6  
ATOM 10583 O OD2  . ASP A 1 60  ? 1.622   6.139   -8.166  1.00 0.00 ? 59  ASP A OD2  6  
ATOM 10584 H H    . ASP A 1 60  ? 0.624   5.310   -3.322  1.00 0.00 ? 59  ASP A H    6  
ATOM 10585 H HA   . ASP A 1 60  ? -1.104  5.328   -5.702  1.00 0.00 ? 59  ASP A HA   6  
ATOM 10586 H HB2  . ASP A 1 60  ? 1.409   6.208   -5.688  1.00 0.00 ? 59  ASP A HB2  6  
ATOM 10587 H HB3  . ASP A 1 60  ? 1.874   4.566   -5.921  1.00 0.00 ? 59  ASP A HB3  6  
ATOM 10588 N N    . PRO A 1 61  ? -0.127  2.441   -4.280  1.00 0.00 ? 60  PRO A N    6  
ATOM 10589 C CA   . PRO A 1 61  ? 0.909   2.620   -3.266  1.00 0.00 ? 60  PRO A CA   6  
ATOM 10590 C C    . PRO A 1 61  ? 2.168   3.206   -3.713  1.00 0.00 ? 60  PRO A C    6  
ATOM 10591 O O    . PRO A 1 61  ? 2.351   4.364   -3.361  1.00 0.00 ? 60  PRO A O    6  
ATOM 10592 C CB   . PRO A 1 61  ? 1.030   1.335   -2.437  1.00 0.00 ? 60  PRO A CB   6  
ATOM 10593 C CG   . PRO A 1 61  ? 0.048   0.377   -3.104  1.00 0.00 ? 60  PRO A CG   6  
ATOM 10594 C CD   . PRO A 1 61  ? -0.894  1.262   -3.927  1.00 0.00 ? 60  PRO A CD   6  
ATOM 10595 H HA   . PRO A 1 61  ? 0.633   3.378   -2.572  1.00 0.00 ? 60  PRO A HA   6  
ATOM 10596 H HB2  . PRO A 1 61  ? 2.061   0.915   -2.307  1.00 0.00 ? 60  PRO A HB2  6  
ATOM 10597 H HB3  . PRO A 1 61  ? 0.660   1.561   -1.411  1.00 0.00 ? 60  PRO A HB3  6  
ATOM 10598 H HG2  . PRO A 1 61  ? 0.606   -0.337  -3.736  1.00 0.00 ? 60  PRO A HG2  6  
ATOM 10599 H HG3  . PRO A 1 61  ? -0.523  -0.173  -2.334  1.00 0.00 ? 60  PRO A HG3  6  
ATOM 10600 H HD2  . PRO A 1 61  ? -1.360  0.751   -4.787  1.00 0.00 ? 60  PRO A HD2  6  
ATOM 10601 H HD3  . PRO A 1 61  ? -1.707  1.595   -3.241  1.00 0.00 ? 60  PRO A HD3  6  
ATOM 10602 N N    . ILE A 1 62  ? 3.057   2.513   -4.414  1.00 0.00 ? 61  ILE A N    6  
ATOM 10603 C CA   . ILE A 1 62  ? 4.400   3.032   -4.610  1.00 0.00 ? 61  ILE A CA   6  
ATOM 10604 C C    . ILE A 1 62  ? 4.816   3.110   -6.062  1.00 0.00 ? 61  ILE A C    6  
ATOM 10605 O O    . ILE A 1 62  ? 4.227   2.401   -6.881  1.00 0.00 ? 61  ILE A O    6  
ATOM 10606 C CB   . ILE A 1 62  ? 5.271   2.227   -3.640  1.00 0.00 ? 61  ILE A CB   6  
ATOM 10607 C CG1  . ILE A 1 62  ? 4.954   2.823   -2.250  1.00 0.00 ? 61  ILE A CG1  6  
ATOM 10608 C CG2  . ILE A 1 62  ? 6.796   2.227   -3.871  1.00 0.00 ? 61  ILE A CG2  6  
ATOM 10609 C CD1  . ILE A 1 62  ? 6.137   3.208   -1.389  1.00 0.00 ? 61  ILE A CD1  6  
ATOM 10610 H H    . ILE A 1 62  ? 2.833   1.587   -4.695  1.00 0.00 ? 61  ILE A H    6  
ATOM 10611 H HA   . ILE A 1 62  ? 4.440   4.052   -4.278  1.00 0.00 ? 61  ILE A HA   6  
ATOM 10612 H HB   . ILE A 1 62  ? 4.882   1.164   -3.651  1.00 0.00 ? 61  ILE A HB   6  
ATOM 10613 H HG12 . ILE A 1 62  ? 4.372   3.757   -2.321  1.00 0.00 ? 61  ILE A HG12 6  
ATOM 10614 H HG13 . ILE A 1 62  ? 4.257   2.130   -1.752  1.00 0.00 ? 61  ILE A HG13 6  
ATOM 10615 H HG21 . ILE A 1 62  ? 7.265   1.519   -3.157  1.00 0.00 ? 61  ILE A HG21 6  
ATOM 10616 H HG22 . ILE A 1 62  ? 7.228   3.226   -3.622  1.00 0.00 ? 61  ILE A HG22 6  
ATOM 10617 H HG23 . ILE A 1 62  ? 7.081   1.941   -4.902  1.00 0.00 ? 61  ILE A HG23 6  
ATOM 10618 H HD11 . ILE A 1 62  ? 5.742   3.569   -0.417  1.00 0.00 ? 61  ILE A HD11 6  
ATOM 10619 H HD12 . ILE A 1 62  ? 6.731   4.029   -1.862  1.00 0.00 ? 61  ILE A HD12 6  
ATOM 10620 H HD13 . ILE A 1 62  ? 6.805   2.328   -1.228  1.00 0.00 ? 61  ILE A HD13 6  
ATOM 10621 N N    . PRO A 1 63  ? 5.845   3.960   -6.430  1.00 0.00 ? 62  PRO A N    6  
ATOM 10622 C CA   . PRO A 1 63  ? 6.234   4.366   -7.771  1.00 0.00 ? 62  PRO A CA   6  
ATOM 10623 C C    . PRO A 1 63  ? 6.499   3.245   -8.742  1.00 0.00 ? 62  PRO A C    6  
ATOM 10624 O O    . PRO A 1 63  ? 7.384   2.448   -8.495  1.00 0.00 ? 62  PRO A O    6  
ATOM 10625 C CB   . PRO A 1 63  ? 7.607   5.083   -7.506  1.00 0.00 ? 62  PRO A CB   6  
ATOM 10626 C CG   . PRO A 1 63  ? 7.601   5.545   -6.047  1.00 0.00 ? 62  PRO A CG   6  
ATOM 10627 C CD   . PRO A 1 63  ? 6.272   5.040   -5.541  1.00 0.00 ? 62  PRO A CD   6  
ATOM 10628 H HA   . PRO A 1 63  ? 5.476   5.017   -8.180  1.00 0.00 ? 62  PRO A HA   6  
ATOM 10629 H HB2  . PRO A 1 63  ? 8.509   4.408   -7.550  1.00 0.00 ? 62  PRO A HB2  6  
ATOM 10630 H HB3  . PRO A 1 63  ? 7.749   5.930   -8.205  1.00 0.00 ? 62  PRO A HB3  6  
ATOM 10631 H HG2  . PRO A 1 63  ? 8.382   5.037   -5.429  1.00 0.00 ? 62  PRO A HG2  6  
ATOM 10632 H HG3  . PRO A 1 63  ? 7.715   6.643   -5.948  1.00 0.00 ? 62  PRO A HG3  6  
ATOM 10633 H HD2  . PRO A 1 63  ? 6.414   4.735   -4.490  1.00 0.00 ? 62  PRO A HD2  6  
ATOM 10634 H HD3  . PRO A 1 63  ? 5.522   5.861   -5.601  1.00 0.00 ? 62  PRO A HD3  6  
ATOM 10635 N N    . LEU A 1 64  ? 5.753   3.195   -9.867  1.00 0.00 ? 63  LEU A N    6  
ATOM 10636 C CA   . LEU A 1 64  ? 5.627   2.396   -11.093 1.00 0.00 ? 63  LEU A CA   6  
ATOM 10637 C C    . LEU A 1 64  ? 6.857   1.898   -11.858 1.00 0.00 ? 63  LEU A C    6  
ATOM 10638 O O    . LEU A 1 64  ? 6.853   1.499   -13.022 1.00 0.00 ? 63  LEU A O    6  
ATOM 10639 C CB   . LEU A 1 64  ? 4.673   3.192   -11.980 1.00 0.00 ? 63  LEU A CB   6  
ATOM 10640 C CG   . LEU A 1 64  ? 3.256   3.413   -11.385 1.00 0.00 ? 63  LEU A CG   6  
ATOM 10641 C CD1  . LEU A 1 64  ? 3.028   4.373   -10.188 1.00 0.00 ? 63  LEU A CD1  6  
ATOM 10642 C CD2  . LEU A 1 64  ? 2.505   3.963   -12.583 1.00 0.00 ? 63  LEU A CD2  6  
ATOM 10643 H H    . LEU A 1 64  ? 5.073   3.921   -9.941  1.00 0.00 ? 63  LEU A H    6  
ATOM 10644 H HA   . LEU A 1 64  ? 5.205   1.448   -10.779 1.00 0.00 ? 63  LEU A HA   6  
ATOM 10645 H HB2  . LEU A 1 64  ? 5.124   4.183   -12.217 1.00 0.00 ? 63  LEU A HB2  6  
ATOM 10646 H HB3  . LEU A 1 64  ? 4.531   2.652   -12.949 1.00 0.00 ? 63  LEU A HB3  6  
ATOM 10647 H HG   . LEU A 1 64  ? 2.821   2.418   -11.130 1.00 0.00 ? 63  LEU A HG   6  
ATOM 10648 H HD11 . LEU A 1 64  ? 3.503   5.362   -10.356 1.00 0.00 ? 63  LEU A HD11 6  
ATOM 10649 H HD12 . LEU A 1 64  ? 3.337   3.983   -9.194  1.00 0.00 ? 63  LEU A HD12 6  
ATOM 10650 H HD13 . LEU A 1 64  ? 1.937   4.562   -10.062 1.00 0.00 ? 63  LEU A HD13 6  
ATOM 10651 H HD21 . LEU A 1 64  ? 2.566   3.207   -13.394 1.00 0.00 ? 63  LEU A HD21 6  
ATOM 10652 H HD22 . LEU A 1 64  ? 3.040   4.883   -12.902 1.00 0.00 ? 63  LEU A HD22 6  
ATOM 10653 H HD23 . LEU A 1 64  ? 1.448   4.165   -12.329 1.00 0.00 ? 63  LEU A HD23 6  
ATOM 10654 N N    . ASP A 1 65  ? 7.928   2.025   -11.121 1.00 0.00 ? 64  ASP A N    6  
ATOM 10655 C CA   . ASP A 1 65  ? 9.342   1.822   -11.304 1.00 0.00 ? 64  ASP A CA   6  
ATOM 10656 C C    . ASP A 1 65  ? 9.989   1.153   -10.087 1.00 0.00 ? 64  ASP A C    6  
ATOM 10657 O O    . ASP A 1 65  ? 11.190  1.327   -9.888  1.00 0.00 ? 64  ASP A O    6  
ATOM 10658 C CB   . ASP A 1 65  ? 9.875   3.284   -11.240 1.00 0.00 ? 64  ASP A CB   6  
ATOM 10659 C CG   . ASP A 1 65  ? 9.599   4.022   -12.552 1.00 0.00 ? 64  ASP A CG   6  
ATOM 10660 O OD1  . ASP A 1 65  ? 10.170  3.607   -13.595 1.00 0.00 ? 64  ASP A OD1  6  
ATOM 10661 O OD2  . ASP A 1 65  ? 8.814   5.008   -12.526 1.00 0.00 ? 64  ASP A OD2  6  
ATOM 10662 H H    . ASP A 1 65  ? 7.591   2.360   -10.238 1.00 0.00 ? 64  ASP A H    6  
ATOM 10663 H HA   . ASP A 1 65  ? 9.586   1.283   -12.210 1.00 0.00 ? 64  ASP A HA   6  
ATOM 10664 H HB2  . ASP A 1 65  ? 9.295   3.767   -10.409 1.00 0.00 ? 64  ASP A HB2  6  
ATOM 10665 H HB3  . ASP A 1 65  ? 10.949  3.383   -10.998 1.00 0.00 ? 64  ASP A HB3  6  
ATOM 10666 N N    . THR A 1 66  ? 9.220   0.497   -9.170  1.00 0.00 ? 65  THR A N    6  
ATOM 10667 C CA   . THR A 1 66  ? 9.715   0.180   -7.833  1.00 0.00 ? 65  THR A CA   6  
ATOM 10668 C C    . THR A 1 66  ? 9.845   -1.226  -7.577  1.00 0.00 ? 65  THR A C    6  
ATOM 10669 O O    . THR A 1 66  ? 8.864   -1.915  -7.367  1.00 0.00 ? 65  THR A O    6  
ATOM 10670 C CB   . THR A 1 66  ? 8.980   0.756   -6.606  1.00 0.00 ? 65  THR A CB   6  
ATOM 10671 O OG1  . THR A 1 66  ? 9.065   2.162   -6.627  1.00 0.00 ? 65  THR A OG1  6  
ATOM 10672 C CG2  . THR A 1 66  ? 9.574   0.366   -5.235  1.00 0.00 ? 65  THR A CG2  6  
ATOM 10673 H H    . THR A 1 66  ? 8.277   0.245   -9.324  1.00 0.00 ? 65  THR A H    6  
ATOM 10674 H HA   . THR A 1 66  ? 10.706  0.538   -7.715  1.00 0.00 ? 65  THR A HA   6  
ATOM 10675 H HB   . THR A 1 66  ? 7.905   0.479   -6.612  1.00 0.00 ? 65  THR A HB   6  
ATOM 10676 H HG1  . THR A 1 66  ? 8.473   2.403   -7.374  1.00 0.00 ? 65  THR A HG1  6  
ATOM 10677 H HG21 . THR A 1 66  ? 9.327   -0.676  -4.955  1.00 0.00 ? 65  THR A HG21 6  
ATOM 10678 H HG22 . THR A 1 66  ? 9.172   1.018   -4.435  1.00 0.00 ? 65  THR A HG22 6  
ATOM 10679 H HG23 . THR A 1 66  ? 10.674  0.492   -5.257  1.00 0.00 ? 65  THR A HG23 6  
ATOM 10680 N N    . GLU A 1 67  ? 11.094  -1.660  -7.384  1.00 0.00 ? 66  GLU A N    6  
ATOM 10681 C CA   . GLU A 1 67  ? 11.402  -2.969  -6.796  1.00 0.00 ? 66  GLU A CA   6  
ATOM 10682 C C    . GLU A 1 67  ? 10.942  -3.024  -5.319  1.00 0.00 ? 66  GLU A C    6  
ATOM 10683 O O    . GLU A 1 67  ? 11.679  -2.729  -4.401  1.00 0.00 ? 66  GLU A O    6  
ATOM 10684 C CB   . GLU A 1 67  ? 12.943  -3.239  -6.805  1.00 0.00 ? 66  GLU A CB   6  
ATOM 10685 C CG   . GLU A 1 67  ? 13.649  -2.910  -8.133  1.00 0.00 ? 66  GLU A CG   6  
ATOM 10686 C CD   . GLU A 1 67  ? 15.145  -3.239  -8.077  1.00 0.00 ? 66  GLU A CD   6  
ATOM 10687 O OE1  . GLU A 1 67  ? 15.627  -3.732  -7.023  1.00 0.00 ? 66  GLU A OE1  6  
ATOM 10688 O OE2  . GLU A 1 67  ? 15.827  -2.992  -9.108  1.00 0.00 ? 66  GLU A OE2  6  
ATOM 10689 H H    . GLU A 1 67  ? 11.751  -0.965  -7.621  1.00 0.00 ? 66  GLU A H    6  
ATOM 10690 H HA   . GLU A 1 67  ? 10.927  -3.752  -7.346  1.00 0.00 ? 66  GLU A HA   6  
ATOM 10691 H HB2  . GLU A 1 67  ? 13.462  -2.621  -6.035  1.00 0.00 ? 66  GLU A HB2  6  
ATOM 10692 H HB3  . GLU A 1 67  ? 13.121  -4.310  -6.564  1.00 0.00 ? 66  GLU A HB3  6  
ATOM 10693 H HG2  . GLU A 1 67  ? 13.194  -3.495  -8.955  1.00 0.00 ? 66  GLU A HG2  6  
ATOM 10694 H HG3  . GLU A 1 67  ? 13.534  -1.823  -8.334  1.00 0.00 ? 66  GLU A HG3  6  
ATOM 10695 N N    . VAL A 1 68  ? 9.708   -3.512  -5.115  1.00 0.00 ? 67  VAL A N    6  
ATOM 10696 C CA   . VAL A 1 68  ? 8.953   -3.703  -3.891  1.00 0.00 ? 67  VAL A CA   6  
ATOM 10697 C C    . VAL A 1 68  ? 9.110   -5.125  -3.547  1.00 0.00 ? 67  VAL A C    6  
ATOM 10698 O O    . VAL A 1 68  ? 9.670   -5.875  -4.320  1.00 0.00 ? 67  VAL A O    6  
ATOM 10699 C CB   . VAL A 1 68  ? 7.464   -3.350  -3.899  1.00 0.00 ? 67  VAL A CB   6  
ATOM 10700 C CG1  . VAL A 1 68  ? 7.273   -2.303  -2.803  1.00 0.00 ? 67  VAL A CG1  6  
ATOM 10701 C CG2  . VAL A 1 68  ? 6.953   -2.841  -5.249  1.00 0.00 ? 67  VAL A CG2  6  
ATOM 10702 H H    . VAL A 1 68  ? 9.219   -3.757  -5.958  1.00 0.00 ? 67  VAL A H    6  
ATOM 10703 H HA   . VAL A 1 68  ? 9.422   -3.175  -3.071  1.00 0.00 ? 67  VAL A HA   6  
ATOM 10704 H HB   . VAL A 1 68  ? 6.819   -4.209  -3.599  1.00 0.00 ? 67  VAL A HB   6  
ATOM 10705 H HG11 . VAL A 1 68  ? 7.763   -1.346  -3.089  1.00 0.00 ? 67  VAL A HG11 6  
ATOM 10706 H HG12 . VAL A 1 68  ? 7.686   -2.705  -1.848  1.00 0.00 ? 67  VAL A HG12 6  
ATOM 10707 H HG13 . VAL A 1 68  ? 6.191   -2.147  -2.605  1.00 0.00 ? 67  VAL A HG13 6  
ATOM 10708 H HG21 . VAL A 1 68  ? 5.848   -2.711  -5.196  1.00 0.00 ? 67  VAL A HG21 6  
ATOM 10709 H HG22 . VAL A 1 68  ? 7.178   -3.558  -6.067  1.00 0.00 ? 67  VAL A HG22 6  
ATOM 10710 H HG23 . VAL A 1 68  ? 7.392   -1.844  -5.478  1.00 0.00 ? 67  VAL A HG23 6  
ATOM 10711 N N    . THR A 1 69  ? 8.637   -5.532  -2.369  1.00 0.00 ? 68  THR A N    6  
ATOM 10712 C CA   . THR A 1 69  ? 8.805   -6.903  -1.896  1.00 0.00 ? 68  THR A CA   6  
ATOM 10713 C C    . THR A 1 69  ? 7.530   -7.684  -2.162  1.00 0.00 ? 68  THR A C    6  
ATOM 10714 O O    . THR A 1 69  ? 6.425   -7.177  -2.001  1.00 0.00 ? 68  THR A O    6  
ATOM 10715 C CB   . THR A 1 69  ? 9.338   -6.887  -0.469  1.00 0.00 ? 68  THR A CB   6  
ATOM 10716 O OG1  . THR A 1 69  ? 9.333   -8.135  0.228   1.00 0.00 ? 68  THR A OG1  6  
ATOM 10717 C CG2  . THR A 1 69  ? 8.461   -5.901  0.275   1.00 0.00 ? 68  THR A CG2  6  
ATOM 10718 H H    . THR A 1 69  ? 8.076   -4.907  -1.782  1.00 0.00 ? 68  THR A H    6  
ATOM 10719 H HA   . THR A 1 69  ? 9.571   -7.413  -2.434  1.00 0.00 ? 68  THR A HA   6  
ATOM 10720 H HB   . THR A 1 69  ? 10.385  -6.500  -0.493  1.00 0.00 ? 68  THR A HB   6  
ATOM 10721 H HG1  . THR A 1 69  ? 9.566   -7.915  1.139   1.00 0.00 ? 68  THR A HG1  6  
ATOM 10722 H HG21 . THR A 1 69  ? 8.469   -4.882  -0.173  1.00 0.00 ? 68  THR A HG21 6  
ATOM 10723 H HG22 . THR A 1 69  ? 8.710   -5.854  1.348   1.00 0.00 ? 68  THR A HG22 6  
ATOM 10724 H HG23 . THR A 1 69  ? 7.424   -6.272  0.128   1.00 0.00 ? 68  THR A HG23 6  
ATOM 10725 N N    . ALA A 1 70  ? 7.663   -8.943  -2.608  1.00 0.00 ? 69  ALA A N    6  
ATOM 10726 C CA   . ALA A 1 70  ? 6.556   -9.831  -2.903  1.00 0.00 ? 69  ALA A CA   6  
ATOM 10727 C C    . ALA A 1 70  ? 6.442   -10.916 -1.843  1.00 0.00 ? 69  ALA A C    6  
ATOM 10728 O O    . ALA A 1 70  ? 7.455   -11.402 -1.342  1.00 0.00 ? 69  ALA A O    6  
ATOM 10729 C CB   . ALA A 1 70  ? 6.768   -10.339 -4.324  1.00 0.00 ? 69  ALA A CB   6  
ATOM 10730 H H    . ALA A 1 70  ? 8.587   -9.336  -2.757  1.00 0.00 ? 69  ALA A H    6  
ATOM 10731 H HA   . ALA A 1 70  ? 5.612   -9.308  -2.896  1.00 0.00 ? 69  ALA A HA   6  
ATOM 10732 H HB1  . ALA A 1 70  ? 7.771   -10.804 -4.411  1.00 0.00 ? 69  ALA A HB1  6  
ATOM 10733 H HB2  . ALA A 1 70  ? 6.739   -9.437  -4.981  1.00 0.00 ? 69  ALA A HB2  6  
ATOM 10734 H HB3  . ALA A 1 70  ? 5.971   -11.044 -4.639  1.00 0.00 ? 69  ALA A HB3  6  
ATOM 10735 N N    . LEU A 1 71  ? 5.203   -11.289 -1.434  1.00 0.00 ? 70  LEU A N    6  
ATOM 10736 C CA   . LEU A 1 71  ? 4.959   -12.208 -0.315  1.00 0.00 ? 70  LEU A CA   6  
ATOM 10737 C C    . LEU A 1 71  ? 5.403   -13.675 -0.424  1.00 0.00 ? 70  LEU A C    6  
ATOM 10738 O O    . LEU A 1 71  ? 4.883   -14.555 -1.108  1.00 0.00 ? 70  LEU A O    6  
ATOM 10739 C CB   . LEU A 1 71  ? 3.509   -12.149 0.173   1.00 0.00 ? 70  LEU A CB   6  
ATOM 10740 C CG   . LEU A 1 71  ? 3.258   -12.234 1.708   1.00 0.00 ? 70  LEU A CG   6  
ATOM 10741 C CD1  . LEU A 1 71  ? 3.784   -13.475 2.453   1.00 0.00 ? 70  LEU A CD1  6  
ATOM 10742 C CD2  . LEU A 1 71  ? 3.730   -10.958 2.421   1.00 0.00 ? 70  LEU A CD2  6  
ATOM 10743 H H    . LEU A 1 71  ? 4.393   -10.862 -1.862  1.00 0.00 ? 70  LEU A H    6  
ATOM 10744 H HA   . LEU A 1 71  ? 5.523   -11.791 0.510   1.00 0.00 ? 70  LEU A HA   6  
ATOM 10745 H HB2  . LEU A 1 71  ? 3.114   -11.155 -0.130  1.00 0.00 ? 70  LEU A HB2  6  
ATOM 10746 H HB3  . LEU A 1 71  ? 2.934   -12.913 -0.379  1.00 0.00 ? 70  LEU A HB3  6  
ATOM 10747 H HG   . LEU A 1 71  ? 2.155   -12.268 1.808   1.00 0.00 ? 70  LEU A HG   6  
ATOM 10748 H HD11 . LEU A 1 71  ? 3.553   -14.409 1.903   1.00 0.00 ? 70  LEU A HD11 6  
ATOM 10749 H HD12 . LEU A 1 71  ? 3.326   -13.535 3.464   1.00 0.00 ? 70  LEU A HD12 6  
ATOM 10750 H HD13 . LEU A 1 71  ? 4.877   -13.386 2.599   1.00 0.00 ? 70  LEU A HD13 6  
ATOM 10751 H HD21 . LEU A 1 71  ? 4.831   -10.844 2.329   1.00 0.00 ? 70  LEU A HD21 6  
ATOM 10752 H HD22 . LEU A 1 71  ? 3.482   -11.011 3.502   1.00 0.00 ? 70  LEU A HD22 6  
ATOM 10753 H HD23 . LEU A 1 71  ? 3.235   -10.063 1.988   1.00 0.00 ? 70  LEU A HD23 6  
ATOM 10754 N N    . SER A 1 72  ? 6.467   -13.897 0.340   1.00 0.00 ? 71  SER A N    6  
ATOM 10755 C CA   . SER A 1 72  ? 7.182   -15.081 0.723   1.00 0.00 ? 71  SER A CA   6  
ATOM 10756 C C    . SER A 1 72  ? 7.457   -14.772 2.169   1.00 0.00 ? 71  SER A C    6  
ATOM 10757 O O    . SER A 1 72  ? 7.212   -13.644 2.589   1.00 0.00 ? 71  SER A O    6  
ATOM 10758 C CB   . SER A 1 72  ? 8.387   -15.410 -0.168  1.00 0.00 ? 71  SER A CB   6  
ATOM 10759 O OG   . SER A 1 72  ? 7.877   -15.929 -1.391  1.00 0.00 ? 71  SER A OG   6  
ATOM 10760 H H    . SER A 1 72  ? 6.745   -13.122 0.909   1.00 0.00 ? 71  SER A H    6  
ATOM 10761 H HA   . SER A 1 72  ? 6.503   -15.926 0.721   1.00 0.00 ? 71  SER A HA   6  
ATOM 10762 H HB2  . SER A 1 72  ? 8.981   -14.499 -0.382  1.00 0.00 ? 71  SER A HB2  6  
ATOM 10763 H HB3  . SER A 1 72  ? 9.050   -16.179 0.287   1.00 0.00 ? 71  SER A HB3  6  
ATOM 10764 H HG   . SER A 1 72  ? 7.071   -15.422 -1.584  1.00 0.00 ? 71  SER A HG   6  
ATOM 10765 N N    . GLU A 1 73  ? 7.926   -15.728 2.986   1.00 0.00 ? 72  GLU A N    6  
ATOM 10766 C CA   . GLU A 1 73  ? 8.257   -15.616 4.407   1.00 0.00 ? 72  GLU A CA   6  
ATOM 10767 C C    . GLU A 1 73  ? 8.937   -14.340 4.974   1.00 0.00 ? 72  GLU A C    6  
ATOM 10768 O O    . GLU A 1 73  ? 9.591   -13.562 4.287   1.00 0.00 ? 72  GLU A O    6  
ATOM 10769 C CB   . GLU A 1 73  ? 9.209   -16.785 4.768   1.00 0.00 ? 72  GLU A CB   6  
ATOM 10770 C CG   . GLU A 1 73  ? 9.786   -17.582 3.584   1.00 0.00 ? 72  GLU A CG   6  
ATOM 10771 C CD   . GLU A 1 73  ? 8.828   -18.623 3.006   1.00 0.00 ? 72  GLU A CD   6  
ATOM 10772 O OE1  . GLU A 1 73  ? 8.330   -19.472 3.793   1.00 0.00 ? 72  GLU A OE1  6  
ATOM 10773 O OE2  . GLU A 1 73  ? 8.589   -18.588 1.770   1.00 0.00 ? 72  GLU A OE2  6  
ATOM 10774 H H    . GLU A 1 73  ? 8.084   -16.635 2.610   1.00 0.00 ? 72  GLU A H    6  
ATOM 10775 H HA   . GLU A 1 73  ? 7.325   -15.739 4.942   1.00 0.00 ? 72  GLU A HA   6  
ATOM 10776 H HB2  . GLU A 1 73  ? 10.167  -16.411 5.209   1.00 0.00 ? 72  GLU A HB2  6  
ATOM 10777 H HB3  . GLU A 1 73  ? 8.731   -17.460 5.503   1.00 0.00 ? 72  GLU A HB3  6  
ATOM 10778 H HG2  . GLU A 1 73  ? 10.164  -16.860 2.819   1.00 0.00 ? 72  GLU A HG2  6  
ATOM 10779 H HG3  . GLU A 1 73  ? 10.650  -18.101 4.043   1.00 0.00 ? 72  GLU A HG3  6  
ATOM 10780 N N    . ASP A 1 74  ? 8.788   -14.175 6.310   1.00 0.00 ? 73  ASP A N    6  
ATOM 10781 C CA   . ASP A 1 74  ? 9.080   -13.003 7.156   1.00 0.00 ? 73  ASP A CA   6  
ATOM 10782 C C    . ASP A 1 74  ? 10.386  -12.217 6.991   1.00 0.00 ? 73  ASP A C    6  
ATOM 10783 O O    . ASP A 1 74  ? 10.346  -11.000 6.849   1.00 0.00 ? 73  ASP A O    6  
ATOM 10784 C CB   . ASP A 1 74  ? 8.869   -13.389 8.658   1.00 0.00 ? 73  ASP A CB   6  
ATOM 10785 C CG   . ASP A 1 74  ? 8.595   -12.190 9.583   1.00 0.00 ? 73  ASP A CG   6  
ATOM 10786 O OD1  . ASP A 1 74  ? 7.581   -11.480 9.346   1.00 0.00 ? 73  ASP A OD1  6  
ATOM 10787 O OD2  . ASP A 1 74  ? 9.397   -11.976 10.530  1.00 0.00 ? 73  ASP A OD2  6  
ATOM 10788 H H    . ASP A 1 74  ? 8.330   -14.936 6.759   1.00 0.00 ? 73  ASP A H    6  
ATOM 10789 H HA   . ASP A 1 74  ? 8.310   -12.298 6.896   1.00 0.00 ? 73  ASP A HA   6  
ATOM 10790 H HB2  . ASP A 1 74  ? 7.976   -14.052 8.715   1.00 0.00 ? 73  ASP A HB2  6  
ATOM 10791 H HB3  . ASP A 1 74  ? 9.732   -13.973 9.037   1.00 0.00 ? 73  ASP A HB3  6  
ATOM 10792 N N    . GLU A 1 75  ? 11.554  -12.890 6.976   1.00 0.00 ? 74  GLU A N    6  
ATOM 10793 C CA   . GLU A 1 75  ? 12.854  -12.276 6.730   1.00 0.00 ? 74  GLU A CA   6  
ATOM 10794 C C    . GLU A 1 75  ? 13.401  -12.729 5.375   1.00 0.00 ? 74  GLU A C    6  
ATOM 10795 O O    . GLU A 1 75  ? 14.543  -12.463 5.015   1.00 0.00 ? 74  GLU A O    6  
ATOM 10796 C CB   . GLU A 1 75  ? 13.785  -12.646 7.926   1.00 0.00 ? 74  GLU A CB   6  
ATOM 10797 C CG   . GLU A 1 75  ? 15.202  -12.041 7.948   1.00 0.00 ? 74  GLU A CG   6  
ATOM 10798 C CD   . GLU A 1 75  ? 15.140  -10.515 7.891   1.00 0.00 ? 74  GLU A CD   6  
ATOM 10799 O OE1  . GLU A 1 75  ? 14.551  -9.911  8.827   1.00 0.00 ? 74  GLU A OE1  6  
ATOM 10800 O OE2  . GLU A 1 75  ? 15.679  -9.935  6.912   1.00 0.00 ? 74  GLU A OE2  6  
ATOM 10801 H H    . GLU A 1 75  ? 11.565  -13.874 7.114   1.00 0.00 ? 74  GLU A H    6  
ATOM 10802 H HA   . GLU A 1 75  ? 12.780  -11.197 6.679   1.00 0.00 ? 74  GLU A HA   6  
ATOM 10803 H HB2  . GLU A 1 75  ? 13.265  -12.327 8.859   1.00 0.00 ? 74  GLU A HB2  6  
ATOM 10804 H HB3  . GLU A 1 75  ? 13.889  -13.752 7.981   1.00 0.00 ? 74  GLU A HB3  6  
ATOM 10805 H HG2  . GLU A 1 75  ? 15.714  -12.353 8.882   1.00 0.00 ? 74  GLU A HG2  6  
ATOM 10806 H HG3  . GLU A 1 75  ? 15.789  -12.441 7.093   1.00 0.00 ? 74  GLU A HG3  6  
ATOM 10807 N N    . TYR A 1 76  ? 12.597  -13.523 4.619   1.00 0.00 ? 75  TYR A N    6  
ATOM 10808 C CA   . TYR A 1 76  ? 13.089  -14.296 3.483   1.00 0.00 ? 75  TYR A CA   6  
ATOM 10809 C C    . TYR A 1 76  ? 12.498  -13.889 2.147   1.00 0.00 ? 75  TYR A C    6  
ATOM 10810 O O    . TYR A 1 76  ? 13.076  -14.223 1.114   1.00 0.00 ? 75  TYR A O    6  
ATOM 10811 C CB   . TYR A 1 76  ? 12.955  -15.814 3.777   1.00 0.00 ? 75  TYR A CB   6  
ATOM 10812 C CG   . TYR A 1 76  ? 13.612  -16.159 5.096   1.00 0.00 ? 75  TYR A CG   6  
ATOM 10813 C CD1  . TYR A 1 76  ? 14.977  -16.381 5.160   1.00 0.00 ? 75  TYR A CD1  6  
ATOM 10814 C CD2  . TYR A 1 76  ? 12.881  -16.176 6.278   1.00 0.00 ? 75  TYR A CD2  6  
ATOM 10815 C CE1  . TYR A 1 76  ? 15.603  -16.589 6.377   1.00 0.00 ? 75  TYR A CE1  6  
ATOM 10816 C CE2  . TYR A 1 76  ? 13.501  -16.399 7.490   1.00 0.00 ? 75  TYR A CE2  6  
ATOM 10817 C CZ   . TYR A 1 76  ? 14.863  -16.587 7.541   1.00 0.00 ? 75  TYR A CZ   6  
ATOM 10818 O OH   . TYR A 1 76  ? 15.476  -16.748 8.799   1.00 0.00 ? 75  TYR A OH   6  
ATOM 10819 H H    . TYR A 1 76  ? 11.664  -13.714 4.917   1.00 0.00 ? 75  TYR A H    6  
ATOM 10820 H HA   . TYR A 1 76  ? 14.152  -14.125 3.346   1.00 0.00 ? 75  TYR A HA   6  
ATOM 10821 H HB2  . TYR A 1 76  ? 11.890  -16.078 3.858   1.00 0.00 ? 75  TYR A HB2  6  
ATOM 10822 H HB3  . TYR A 1 76  ? 13.431  -16.420 2.979   1.00 0.00 ? 75  TYR A HB3  6  
ATOM 10823 H HD1  . TYR A 1 76  ? 15.568  -16.351 4.253   1.00 0.00 ? 75  TYR A HD1  6  
ATOM 10824 H HD2  . TYR A 1 76  ? 11.825  -15.947 6.268   1.00 0.00 ? 75  TYR A HD2  6  
ATOM 10825 H HE1  . TYR A 1 76  ? 16.674  -16.732 6.405   1.00 0.00 ? 75  TYR A HE1  6  
ATOM 10826 H HE2  . TYR A 1 76  ? 12.927  -16.392 8.406   1.00 0.00 ? 75  TYR A HE2  6  
ATOM 10827 H HH   . TYR A 1 76  ? 16.412  -16.908 8.661   1.00 0.00 ? 75  TYR A HH   6  
ATOM 10828 N N    . PHE A 1 77  ? 11.379  -13.102 2.156   1.00 0.00 ? 76  PHE A N    6  
ATOM 10829 C CA   . PHE A 1 77  ? 10.754  -12.459 0.966   1.00 0.00 ? 76  PHE A CA   6  
ATOM 10830 C C    . PHE A 1 77  ? 11.640  -11.561 0.068   1.00 0.00 ? 76  PHE A C    6  
ATOM 10831 O O    . PHE A 1 77  ? 12.681  -11.051 0.475   1.00 0.00 ? 76  PHE A O    6  
ATOM 10832 C CB   . PHE A 1 77  ? 9.454   -11.651 1.282   1.00 0.00 ? 76  PHE A CB   6  
ATOM 10833 C CG   . PHE A 1 77  ? 9.427   -10.734 2.481   1.00 0.00 ? 76  PHE A CG   6  
ATOM 10834 C CD1  . PHE A 1 77  ? 10.533  -10.118 3.049   1.00 0.00 ? 76  PHE A CD1  6  
ATOM 10835 C CD2  . PHE A 1 77  ? 8.176   -10.440 2.993   1.00 0.00 ? 76  PHE A CD2  6  
ATOM 10836 C CE1  . PHE A 1 77  ? 10.374  -9.216  4.081   1.00 0.00 ? 76  PHE A CE1  6  
ATOM 10837 C CE2  . PHE A 1 77  ? 8.015   -9.550  4.029   1.00 0.00 ? 76  PHE A CE2  6  
ATOM 10838 C CZ   . PHE A 1 77  ? 9.117   -8.922  4.570   1.00 0.00 ? 76  PHE A CZ   6  
ATOM 10839 H H    . PHE A 1 77  ? 10.907  -13.062 3.056   1.00 0.00 ? 76  PHE A H    6  
ATOM 10840 H HA   . PHE A 1 77  ? 10.460  -13.271 0.320   1.00 0.00 ? 76  PHE A HA   6  
ATOM 10841 H HB2  . PHE A 1 77  ? 9.092   -11.048 0.420   1.00 0.00 ? 76  PHE A HB2  6  
ATOM 10842 H HB3  . PHE A 1 77  ? 8.674   -12.400 1.453   1.00 0.00 ? 76  PHE A HB3  6  
ATOM 10843 H HD1  . PHE A 1 77  ? 11.532  -10.309 2.680   1.00 0.00 ? 76  PHE A HD1  6  
ATOM 10844 H HD2  . PHE A 1 77  ? 7.304   -10.915 2.558   1.00 0.00 ? 76  PHE A HD2  6  
ATOM 10845 H HE1  . PHE A 1 77  ? 11.245  -8.748  4.518   1.00 0.00 ? 76  PHE A HE1  6  
ATOM 10846 H HE2  . PHE A 1 77  ? 7.020   -9.347  4.405   1.00 0.00 ? 76  PHE A HE2  6  
ATOM 10847 H HZ   . PHE A 1 77  ? 8.998   -8.217  5.383   1.00 0.00 ? 76  PHE A HZ   6  
ATOM 10848 N N    . SER A 1 78  ? 11.254  -11.411 -1.227  1.00 0.00 ? 77  SER A N    6  
ATOM 10849 C CA   . SER A 1 78  ? 12.183  -10.838 -2.214  1.00 0.00 ? 77  SER A CA   6  
ATOM 10850 C C    . SER A 1 78  ? 11.477  -9.869  -3.130  1.00 0.00 ? 77  SER A C    6  
ATOM 10851 O O    . SER A 1 78  ? 10.251  -9.862  -3.255  1.00 0.00 ? 77  SER A O    6  
ATOM 10852 C CB   . SER A 1 78  ? 12.965  -11.968 -2.987  1.00 0.00 ? 77  SER A CB   6  
ATOM 10853 O OG   . SER A 1 78  ? 14.037  -11.505 -3.824  1.00 0.00 ? 77  SER A OG   6  
ATOM 10854 H H    . SER A 1 78  ? 10.355  -11.751 -1.542  1.00 0.00 ? 77  SER A H    6  
ATOM 10855 H HA   . SER A 1 78  ? 12.933  -10.233 -1.717  1.00 0.00 ? 77  SER A HA   6  
ATOM 10856 H HB2  . SER A 1 78  ? 13.422  -12.633 -2.219  1.00 0.00 ? 77  SER A HB2  6  
ATOM 10857 H HB3  . SER A 1 78  ? 12.263  -12.592 -3.582  1.00 0.00 ? 77  SER A HB3  6  
ATOM 10858 H HG   . SER A 1 78  ? 13.610  -11.093 -4.584  1.00 0.00 ? 77  SER A HG   6  
ATOM 10859 N N    . ALA A 1 79  ? 12.274  -8.975  -3.775  1.00 0.00 ? 78  ALA A N    6  
ATOM 10860 C CA   . ALA A 1 79  ? 11.804  -7.879  -4.615  1.00 0.00 ? 78  ALA A CA   6  
ATOM 10861 C C    . ALA A 1 79  ? 11.480  -8.167  -6.078  1.00 0.00 ? 78  ALA A C    6  
ATOM 10862 O O    . ALA A 1 79  ? 12.041  -9.054  -6.714  1.00 0.00 ? 78  ALA A O    6  
ATOM 10863 C CB   . ALA A 1 79  ? 12.677  -6.595  -4.433  1.00 0.00 ? 78  ALA A CB   6  
ATOM 10864 H H    . ALA A 1 79  ? 13.256  -9.019  -3.615  1.00 0.00 ? 78  ALA A H    6  
ATOM 10865 H HA   . ALA A 1 79  ? 10.832  -7.668  -4.234  1.00 0.00 ? 78  ALA A HA   6  
ATOM 10866 H HB1  . ALA A 1 79  ? 12.240  -5.701  -4.936  1.00 0.00 ? 78  ALA A HB1  6  
ATOM 10867 H HB2  . ALA A 1 79  ? 13.708  -6.745  -4.809  1.00 0.00 ? 78  ALA A HB2  6  
ATOM 10868 H HB3  . ALA A 1 79  ? 12.731  -6.319  -3.357  1.00 0.00 ? 78  ALA A HB3  6  
ATOM 10869 N N    . GLY A 1 80  ? 10.520  -7.367  -6.623  1.00 0.00 ? 79  GLY A N    6  
ATOM 10870 C CA   . GLY A 1 80  ? 10.002  -7.385  -7.987  1.00 0.00 ? 79  GLY A CA   6  
ATOM 10871 C C    . GLY A 1 80  ? 9.404   -6.033  -8.174  1.00 0.00 ? 79  GLY A C    6  
ATOM 10872 O O    . GLY A 1 80  ? 9.228   -5.306  -7.210  1.00 0.00 ? 79  GLY A O    6  
ATOM 10873 H H    . GLY A 1 80  ? 10.124  -6.647  -6.027  1.00 0.00 ? 79  GLY A H    6  
ATOM 10874 H HA2  . GLY A 1 80  ? 10.860  -7.453  -8.677  1.00 0.00 ? 79  GLY A HA2  6  
ATOM 10875 H HA3  . GLY A 1 80  ? 9.182   -8.094  -8.081  1.00 0.00 ? 79  GLY A HA3  6  
ATOM 10876 N N    . VAL A 1 81  ? 9.153   -5.607  -9.423  1.00 0.00 ? 80  VAL A N    6  
ATOM 10877 C CA   . VAL A 1 81  ? 8.910   -4.218  -9.755  1.00 0.00 ? 80  VAL A CA   6  
ATOM 10878 C C    . VAL A 1 81  ? 7.491   -3.886  -9.954  1.00 0.00 ? 80  VAL A C    6  
ATOM 10879 O O    . VAL A 1 81  ? 6.883   -4.383  -10.893 1.00 0.00 ? 80  VAL A O    6  
ATOM 10880 C CB   . VAL A 1 81  ? 9.685   -3.916  -11.047 1.00 0.00 ? 80  VAL A CB   6  
ATOM 10881 C CG1  . VAL A 1 81  ? 9.534   -2.468  -11.571 1.00 0.00 ? 80  VAL A CG1  6  
ATOM 10882 C CG2  . VAL A 1 81  ? 11.159  -4.125  -10.703 1.00 0.00 ? 80  VAL A CG2  6  
ATOM 10883 H H    . VAL A 1 81  ? 9.265   -6.212  -10.219 1.00 0.00 ? 80  VAL A H    6  
ATOM 10884 H HA   . VAL A 1 81  ? 9.218   -3.564  -8.951  1.00 0.00 ? 80  VAL A HA   6  
ATOM 10885 H HB   . VAL A 1 81  ? 9.398   -4.652  -11.839 1.00 0.00 ? 80  VAL A HB   6  
ATOM 10886 H HG11 . VAL A 1 81  ? 10.185  -2.318  -12.459 1.00 0.00 ? 80  VAL A HG11 6  
ATOM 10887 H HG12 . VAL A 1 81  ? 9.853   -1.749  -10.788 1.00 0.00 ? 80  VAL A HG12 6  
ATOM 10888 H HG13 . VAL A 1 81  ? 8.496   -2.226  -11.870 1.00 0.00 ? 80  VAL A HG13 6  
ATOM 10889 H HG21 . VAL A 1 81  ? 11.385  -3.371  -9.917  1.00 0.00 ? 80  VAL A HG21 6  
ATOM 10890 H HG22 . VAL A 1 81  ? 11.787  -3.911  -11.589 1.00 0.00 ? 80  VAL A HG22 6  
ATOM 10891 H HG23 . VAL A 1 81  ? 11.360  -5.152  -10.319 1.00 0.00 ? 80  VAL A HG23 6  
ATOM 10892 N N    . VAL A 1 82  ? 6.918   -2.969  -9.114  1.00 0.00 ? 81  VAL A N    6  
ATOM 10893 C CA   . VAL A 1 82  ? 5.572   -2.427  -9.328  1.00 0.00 ? 81  VAL A CA   6  
ATOM 10894 C C    . VAL A 1 82  ? 5.555   -1.528  -10.546 1.00 0.00 ? 81  VAL A C    6  
ATOM 10895 O O    . VAL A 1 82  ? 6.494   -0.735  -10.674 1.00 0.00 ? 81  VAL A O    6  
ATOM 10896 C CB   . VAL A 1 82  ? 5.068   -1.606  -8.134  1.00 0.00 ? 81  VAL A CB   6  
ATOM 10897 C CG1  . VAL A 1 82  ? 5.678   -0.195  -7.926  1.00 0.00 ? 81  VAL A CG1  6  
ATOM 10898 C CG2  . VAL A 1 82  ? 3.572   -1.363  -8.270  1.00 0.00 ? 81  VAL A CG2  6  
ATOM 10899 H H    . VAL A 1 82  ? 7.440   -2.576  -8.323  1.00 0.00 ? 81  VAL A H    6  
ATOM 10900 H HA   . VAL A 1 82  ? 4.929   -3.286  -9.532  1.00 0.00 ? 81  VAL A HA   6  
ATOM 10901 H HB   . VAL A 1 82  ? 5.249   -2.215  -7.220  1.00 0.00 ? 81  VAL A HB   6  
ATOM 10902 H HG11 . VAL A 1 82  ? 6.754   -0.139  -8.169  1.00 0.00 ? 81  VAL A HG11 6  
ATOM 10903 H HG12 . VAL A 1 82  ? 5.492   0.179   -6.894  1.00 0.00 ? 81  VAL A HG12 6  
ATOM 10904 H HG13 . VAL A 1 82  ? 5.173   0.565   -8.571  1.00 0.00 ? 81  VAL A HG13 6  
ATOM 10905 H HG21 . VAL A 1 82  ? 3.341   -0.699  -9.128  1.00 0.00 ? 81  VAL A HG21 6  
ATOM 10906 H HG22 . VAL A 1 82  ? 3.315   -0.816  -7.347  1.00 0.00 ? 81  VAL A HG22 6  
ATOM 10907 H HG23 . VAL A 1 82  ? 3.009   -2.316  -8.330  1.00 0.00 ? 81  VAL A HG23 6  
ATOM 10908 N N    . LYS A 1 83  ? 4.549   -1.691  -11.446 1.00 0.00 ? 82  LYS A N    6  
ATOM 10909 C CA   . LYS A 1 83  ? 4.471   -0.931  -12.693 1.00 0.00 ? 82  LYS A CA   6  
ATOM 10910 C C    . LYS A 1 83  ? 3.087   -0.403  -12.980 1.00 0.00 ? 82  LYS A C    6  
ATOM 10911 O O    . LYS A 1 83  ? 2.925   0.702   -13.492 1.00 0.00 ? 82  LYS A O    6  
ATOM 10912 C CB   . LYS A 1 83  ? 4.985   -1.706  -13.942 1.00 0.00 ? 82  LYS A CB   6  
ATOM 10913 C CG   . LYS A 1 83  ? 6.495   -2.004  -13.922 1.00 0.00 ? 82  LYS A CG   6  
ATOM 10914 C CD   . LYS A 1 83  ? 6.990   -2.690  -15.202 1.00 0.00 ? 82  LYS A CD   6  
ATOM 10915 C CE   . LYS A 1 83  ? 8.500   -2.968  -15.213 1.00 0.00 ? 82  LYS A CE   6  
ATOM 10916 N NZ   . LYS A 1 83  ? 9.284   -1.711  -15.154 1.00 0.00 ? 82  LYS A NZ   6  
ATOM 10917 H H    . LYS A 1 83  ? 3.850   -2.395  -11.274 1.00 0.00 ? 82  LYS A H    6  
ATOM 10918 H HA   . LYS A 1 83  ? 5.070   -0.042  -12.615 1.00 0.00 ? 82  LYS A HA   6  
ATOM 10919 H HB2  . LYS A 1 83  ? 4.427   -2.658  -14.046 1.00 0.00 ? 82  LYS A HB2  6  
ATOM 10920 H HB3  . LYS A 1 83  ? 4.810   -1.108  -14.868 1.00 0.00 ? 82  LYS A HB3  6  
ATOM 10921 H HG2  . LYS A 1 83  ? 7.043   -1.041  -13.791 1.00 0.00 ? 82  LYS A HG2  6  
ATOM 10922 H HG3  . LYS A 1 83  ? 6.732   -2.656  -13.052 1.00 0.00 ? 82  LYS A HG3  6  
ATOM 10923 H HD2  . LYS A 1 83  ? 6.459   -3.662  -15.313 1.00 0.00 ? 82  LYS A HD2  6  
ATOM 10924 H HD3  . LYS A 1 83  ? 6.727   -2.060  -16.080 1.00 0.00 ? 82  LYS A HD3  6  
ATOM 10925 H HE2  . LYS A 1 83  ? 8.788   -3.589  -14.339 1.00 0.00 ? 82  LYS A HE2  6  
ATOM 10926 H HE3  . LYS A 1 83  ? 8.786   -3.496  -16.147 1.00 0.00 ? 82  LYS A HE3  6  
ATOM 10927 H HZ1  . LYS A 1 83  ? 10.299  -1.936  -15.163 1.00 0.00 ? 82  LYS A HZ1  6  
ATOM 10928 H HZ2  . LYS A 1 83  ? 9.049   -1.198  -14.281 1.00 0.00 ? 82  LYS A HZ2  6  
ATOM 10929 H HZ3  . LYS A 1 83  ? 9.051   -1.120  -15.977 1.00 0.00 ? 82  LYS A HZ3  6  
ATOM 10930 N N    . GLY A 1 84  ? 2.035   -1.220  -12.735 1.00 0.00 ? 83  GLY A N    6  
ATOM 10931 C CA   . GLY A 1 84  ? 0.672   -0.864  -13.137 1.00 0.00 ? 83  GLY A CA   6  
ATOM 10932 C C    . GLY A 1 84  ? -0.279  -1.244  -12.054 1.00 0.00 ? 83  GLY A C    6  
ATOM 10933 O O    . GLY A 1 84  ? -0.153  -2.283  -11.414 1.00 0.00 ? 83  GLY A O    6  
ATOM 10934 H H    . GLY A 1 84  ? 2.137   -2.126  -12.326 1.00 0.00 ? 83  GLY A H    6  
ATOM 10935 H HA2  . GLY A 1 84  ? 0.560   0.203   -13.299 1.00 0.00 ? 83  GLY A HA2  6  
ATOM 10936 H HA3  . GLY A 1 84  ? 0.429   -1.456  -14.007 1.00 0.00 ? 83  GLY A HA3  6  
ATOM 10937 N N    . HIS A 1 85  ? -1.269  -0.403  -11.726 1.00 0.00 ? 84  HIS A N    6  
ATOM 10938 C CA   . HIS A 1 85  ? -2.191  -0.759  -10.665 1.00 0.00 ? 84  HIS A CA   6  
ATOM 10939 C C    . HIS A 1 85  ? -3.540  -0.129  -10.847 1.00 0.00 ? 84  HIS A C    6  
ATOM 10940 O O    . HIS A 1 85  ? -3.712  0.797   -11.641 1.00 0.00 ? 84  HIS A O    6  
ATOM 10941 C CB   . HIS A 1 85  ? -1.607  -0.481  -9.274  1.00 0.00 ? 84  HIS A CB   6  
ATOM 10942 C CG   . HIS A 1 85  ? -0.637  0.675   -9.232  1.00 0.00 ? 84  HIS A CG   6  
ATOM 10943 N ND1  . HIS A 1 85  ? 0.731   0.579   -9.418  1.00 0.00 ? 84  HIS A ND1  6  
ATOM 10944 C CD2  . HIS A 1 85  ? -0.864  1.955   -8.840  1.00 0.00 ? 84  HIS A CD2  6  
ATOM 10945 C CE1  . HIS A 1 85  ? 1.249   1.791   -9.101  1.00 0.00 ? 84  HIS A CE1  6  
ATOM 10946 N NE2  . HIS A 1 85  ? 0.322   2.648   -8.769  1.00 0.00 ? 84  HIS A NE2  6  
ATOM 10947 H H    . HIS A 1 85  ? -1.440  0.474   -12.172 1.00 0.00 ? 84  HIS A H    6  
ATOM 10948 H HA   . HIS A 1 85  ? -2.410  -1.818  -10.713 1.00 0.00 ? 84  HIS A HA   6  
ATOM 10949 H HB2  . HIS A 1 85  ? -2.390  -0.274  -8.509  1.00 0.00 ? 84  HIS A HB2  6  
ATOM 10950 H HB3  . HIS A 1 85  ? -1.083  -1.417  -8.919  1.00 0.00 ? 84  HIS A HB3  6  
ATOM 10951 H HD1  . HIS A 1 85  ? 1.229   -0.226  -9.746  1.00 0.00 ? 84  HIS A HD1  6  
ATOM 10952 H HD2  . HIS A 1 85  ? -1.781  2.437   -8.522  1.00 0.00 ? 84  HIS A HD2  6  
ATOM 10953 H HE1  . HIS A 1 85  ? 2.293   2.053   -8.952  1.00 0.00 ? 84  HIS A HE1  6  
ATOM 10954 N N    . ARG A 1 86  ? -4.535  -0.634  -10.064 1.00 0.00 ? 85  ARG A N    6  
ATOM 10955 C CA   . ARG A 1 86  ? -5.886  -0.134  -10.133 1.00 0.00 ? 85  ARG A CA   6  
ATOM 10956 C C    . ARG A 1 86  ? -6.586  -0.427  -8.822  1.00 0.00 ? 85  ARG A C    6  
ATOM 10957 O O    . ARG A 1 86  ? -6.184  -1.324  -8.074  1.00 0.00 ? 85  ARG A O    6  
ATOM 10958 C CB   . ARG A 1 86  ? -6.636  -0.921  -11.252 1.00 0.00 ? 85  ARG A CB   6  
ATOM 10959 C CG   . ARG A 1 86  ? -6.876  -2.414  -10.906 1.00 0.00 ? 85  ARG A CG   6  
ATOM 10960 C CD   . ARG A 1 86  ? -8.364  -2.750  -10.676 1.00 0.00 ? 85  ARG A CD   6  
ATOM 10961 N NE   . ARG A 1 86  ? -9.077  -2.841  -12.004 1.00 0.00 ? 85  ARG A NE   6  
ATOM 10962 C CZ   . ARG A 1 86  ? -10.044 -1.973  -12.440 1.00 0.00 ? 85  ARG A CZ   6  
ATOM 10963 N NH1  . ARG A 1 86  ? -10.411 -0.887  -11.701 1.00 0.00 ? 85  ARG A NH1  6  
ATOM 10964 N NH2  . ARG A 1 86  ? -10.648 -2.200  -13.644 1.00 0.00 ? 85  ARG A NH2  6  
ATOM 10965 H H    . ARG A 1 86  ? -4.431  -1.418  -9.413  1.00 0.00 ? 85  ARG A H    6  
ATOM 10966 H HA   . ARG A 1 86  ? -5.904  0.936   -10.301 1.00 0.00 ? 85  ARG A HA   6  
ATOM 10967 H HB2  . ARG A 1 86  ? -7.605  -0.425  -11.478 1.00 0.00 ? 85  ARG A HB2  6  
ATOM 10968 H HB3  . ARG A 1 86  ? -6.029  -0.883  -12.187 1.00 0.00 ? 85  ARG A HB3  6  
ATOM 10969 H HG2  . ARG A 1 86  ? -6.460  -3.059  -11.709 1.00 0.00 ? 85  ARG A HG2  6  
ATOM 10970 H HG3  . ARG A 1 86  ? -6.306  -2.657  -9.960  1.00 0.00 ? 85  ARG A HG3  6  
ATOM 10971 H HD2  . ARG A 1 86  ? -8.452  -3.742  -10.186 1.00 0.00 ? 85  ARG A HD2  6  
ATOM 10972 H HD3  . ARG A 1 86  ? -8.838  -2.001  -10.009 1.00 0.00 ? 85  ARG A HD3  6  
ATOM 10973 H HE   . ARG A 1 86  ? -8.846  -3.615  -12.594 1.00 0.00 ? 85  ARG A HE   6  
ATOM 10974 H HH11 . ARG A 1 86  ? -9.975  -0.714  -10.818 1.00 0.00 ? 85  ARG A HH11 6  
ATOM 10975 H HH12 . ARG A 1 86  ? -11.119 -0.267  -12.041 1.00 0.00 ? 85  ARG A HH12 6  
ATOM 10976 H HH21 . ARG A 1 86  ? -10.384 -2.993  -14.194 1.00 0.00 ? 85  ARG A HH21 6  
ATOM 10977 H HH22 . ARG A 1 86  ? -11.354 -1.574  -13.975 1.00 0.00 ? 85  ARG A HH22 6  
ATOM 10978 N N    . LYS A 1 87  ? -7.729  0.229   -8.544  1.00 0.00 ? 86  LYS A N    6  
ATOM 10979 C CA   . LYS A 1 87  ? -8.607  -0.255  -7.499  1.00 0.00 ? 86  LYS A CA   6  
ATOM 10980 C C    . LYS A 1 87  ? -10.009 -0.140  -8.041  1.00 0.00 ? 86  LYS A C    6  
ATOM 10981 O O    . LYS A 1 87  ? -10.375 0.839   -8.694  1.00 0.00 ? 86  LYS A O    6  
ATOM 10982 C CB   . LYS A 1 87  ? -8.280  0.466   -6.183  1.00 0.00 ? 86  LYS A CB   6  
ATOM 10983 C CG   . LYS A 1 87  ? -9.086  0.100   -4.916  1.00 0.00 ? 86  LYS A CG   6  
ATOM 10984 C CD   . LYS A 1 87  ? -10.426 0.817   -4.706  1.00 0.00 ? 86  LYS A CD   6  
ATOM 10985 C CE   . LYS A 1 87  ? -11.043 0.486   -3.338  1.00 0.00 ? 86  LYS A CE   6  
ATOM 10986 N NZ   . LYS A 1 87  ? -12.405 1.053   -3.207  1.00 0.00 ? 86  LYS A NZ   6  
ATOM 10987 H H    . LYS A 1 87  ? -8.117  0.945   -9.128  1.00 0.00 ? 86  LYS A H    6  
ATOM 10988 H HA   . LYS A 1 87  ? -8.462  -1.340  -7.332  1.00 0.00 ? 86  LYS A HA   6  
ATOM 10989 H HB2  . LYS A 1 87  ? -7.222  0.122   -6.032  1.00 0.00 ? 86  LYS A HB2  6  
ATOM 10990 H HB3  . LYS A 1 87  ? -8.254  1.563   -6.340  1.00 0.00 ? 86  LYS A HB3  6  
ATOM 10991 H HG2  . LYS A 1 87  ? -9.260  -1.000  -4.892  1.00 0.00 ? 86  LYS A HG2  6  
ATOM 10992 H HG3  . LYS A 1 87  ? -8.448  0.362   -4.038  1.00 0.00 ? 86  LYS A HG3  6  
ATOM 10993 H HD2  . LYS A 1 87  ? -10.276 1.912   -4.794  1.00 0.00 ? 86  LYS A HD2  6  
ATOM 10994 H HD3  . LYS A 1 87  ? -11.139 0.518   -5.500  1.00 0.00 ? 86  LYS A HD3  6  
ATOM 10995 H HE2  . LYS A 1 87  ? -11.128 -0.614  -3.211  1.00 0.00 ? 86  LYS A HE2  6  
ATOM 10996 H HE3  . LYS A 1 87  ? -10.419 0.905   -2.519  1.00 0.00 ? 86  LYS A HE3  6  
ATOM 10997 H HZ1  . LYS A 1 87  ? -12.793 0.811   -2.273  1.00 0.00 ? 86  LYS A HZ1  6  
ATOM 10998 H HZ2  . LYS A 1 87  ? -13.016 0.658   -3.950  1.00 0.00 ? 86  LYS A HZ2  6  
ATOM 10999 H HZ3  . LYS A 1 87  ? -12.360 2.088   -3.307  1.00 0.00 ? 86  LYS A HZ3  6  
ATOM 11000 N N    . GLU A 1 88  ? -10.830 -1.181  -7.769  1.00 0.00 ? 87  GLU A N    6  
ATOM 11001 C CA   . GLU A 1 88  ? -12.226 -1.300  -8.152  1.00 0.00 ? 87  GLU A CA   6  
ATOM 11002 C C    . GLU A 1 88  ? -12.963 -1.421  -6.824  1.00 0.00 ? 87  GLU A C    6  
ATOM 11003 O O    . GLU A 1 88  ? -12.342 -1.754  -5.817  1.00 0.00 ? 87  GLU A O    6  
ATOM 11004 C CB   . GLU A 1 88  ? -12.424 -2.533  -9.088  1.00 0.00 ? 87  GLU A CB   6  
ATOM 11005 C CG   . GLU A 1 88  ? -13.507 -2.377  -10.177 1.00 0.00 ? 87  GLU A CG   6  
ATOM 11006 C CD   . GLU A 1 88  ? -14.920 -2.443  -9.598  1.00 0.00 ? 87  GLU A CD   6  
ATOM 11007 O OE1  . GLU A 1 88  ? -15.272 -3.502  -9.012  1.00 0.00 ? 87  GLU A OE1  6  
ATOM 11008 O OE2  . GLU A 1 88  ? -15.667 -1.438  -9.740  1.00 0.00 ? 87  GLU A OE2  6  
ATOM 11009 H H    . GLU A 1 88  ? -10.487 -1.970  -7.228  1.00 0.00 ? 87  GLU A H    6  
ATOM 11010 H HA   . GLU A 1 88  ? -12.570 -0.400  -8.650  1.00 0.00 ? 87  GLU A HA   6  
ATOM 11011 H HB2  . GLU A 1 88  ? -11.463 -2.688  -9.642  1.00 0.00 ? 87  GLU A HB2  6  
ATOM 11012 H HB3  . GLU A 1 88  ? -12.595 -3.466  -8.511  1.00 0.00 ? 87  GLU A HB3  6  
ATOM 11013 H HG2  . GLU A 1 88  ? -13.356 -1.414  -10.709 1.00 0.00 ? 87  GLU A HG2  6  
ATOM 11014 H HG3  . GLU A 1 88  ? -13.392 -3.201  -10.915 1.00 0.00 ? 87  GLU A HG3  6  
ATOM 11015 N N    . SER A 1 89  ? -14.291 -1.160  -6.752  1.00 0.00 ? 88  SER A N    6  
ATOM 11016 C CA   . SER A 1 89  ? -15.153 -1.197  -5.562  1.00 0.00 ? 88  SER A CA   6  
ATOM 11017 C C    . SER A 1 89  ? -15.256 -2.525  -4.785  1.00 0.00 ? 88  SER A C    6  
ATOM 11018 O O    . SER A 1 89  ? -16.307 -3.157  -4.727  1.00 0.00 ? 88  SER A O    6  
ATOM 11019 C CB   . SER A 1 89  ? -16.587 -0.752  -5.964  1.00 0.00 ? 88  SER A CB   6  
ATOM 11020 O OG   . SER A 1 89  ? -16.525 0.431   -6.765  1.00 0.00 ? 88  SER A OG   6  
ATOM 11021 H H    . SER A 1 89  ? -14.796 -0.874  -7.563  1.00 0.00 ? 88  SER A H    6  
ATOM 11022 H HA   . SER A 1 89  ? -14.767 -0.460  -4.872  1.00 0.00 ? 88  SER A HA   6  
ATOM 11023 H HB2  . SER A 1 89  ? -17.072 -1.542  -6.583  1.00 0.00 ? 88  SER A HB2  6  
ATOM 11024 H HB3  . SER A 1 89  ? -17.220 -0.571  -5.068  1.00 0.00 ? 88  SER A HB3  6  
ATOM 11025 H HG   . SER A 1 89  ? -16.764 1.186   -6.213  1.00 0.00 ? 88  SER A HG   6  
ATOM 11026 N N    . GLY A 1 90  ? -14.127 -2.953  -4.168  1.00 0.00 ? 89  GLY A N    6  
ATOM 11027 C CA   . GLY A 1 90  ? -13.957 -4.176  -3.400  1.00 0.00 ? 89  GLY A CA   6  
ATOM 11028 C C    . GLY A 1 90  ? -12.970 -5.142  -4.008  1.00 0.00 ? 89  GLY A C    6  
ATOM 11029 O O    . GLY A 1 90  ? -12.803 -6.239  -3.485  1.00 0.00 ? 89  GLY A O    6  
ATOM 11030 H H    . GLY A 1 90  ? -13.307 -2.383  -4.297  1.00 0.00 ? 89  GLY A H    6  
ATOM 11031 H HA2  . GLY A 1 90  ? -13.560 -3.892  -2.439  1.00 0.00 ? 89  GLY A HA2  6  
ATOM 11032 H HA3  . GLY A 1 90  ? -14.896 -4.712  -3.316  1.00 0.00 ? 89  GLY A HA3  6  
ATOM 11033 N N    . GLU A 1 91  ? -12.275 -4.785  -5.128  1.00 0.00 ? 90  GLU A N    6  
ATOM 11034 C CA   . GLU A 1 91  ? -11.335 -5.618  -5.831  1.00 0.00 ? 90  GLU A CA   6  
ATOM 11035 C C    . GLU A 1 91  ? -10.084 -4.784  -5.942  1.00 0.00 ? 90  GLU A C    6  
ATOM 11036 O O    . GLU A 1 91  ? -10.147 -3.593  -6.251  1.00 0.00 ? 90  GLU A O    6  
ATOM 11037 C CB   . GLU A 1 91  ? -11.807 -5.963  -7.276  1.00 0.00 ? 90  GLU A CB   6  
ATOM 11038 C CG   . GLU A 1 91  ? -13.323 -6.097  -7.512  1.00 0.00 ? 90  GLU A CG   6  
ATOM 11039 C CD   . GLU A 1 91  ? -13.922 -7.280  -6.755  1.00 0.00 ? 90  GLU A CD   6  
ATOM 11040 O OE1  . GLU A 1 91  ? -13.403 -8.415  -6.922  1.00 0.00 ? 90  GLU A OE1  6  
ATOM 11041 O OE2  . GLU A 1 91  ? -14.917 -7.066  -6.011  1.00 0.00 ? 90  GLU A OE2  6  
ATOM 11042 H H    . GLU A 1 91  ? -12.328 -3.902  -5.597  1.00 0.00 ? 90  GLU A H    6  
ATOM 11043 H HA   . GLU A 1 91  ? -11.115 -6.526  -5.278  1.00 0.00 ? 90  GLU A HA   6  
ATOM 11044 H HB2  . GLU A 1 91  ? -11.491 -5.198  -8.024  1.00 0.00 ? 90  GLU A HB2  6  
ATOM 11045 H HB3  . GLU A 1 91  ? -11.309 -6.900  -7.563  1.00 0.00 ? 90  GLU A HB3  6  
ATOM 11046 H HG2  . GLU A 1 91  ? -13.813 -5.140  -7.232  1.00 0.00 ? 90  GLU A HG2  6  
ATOM 11047 H HG3  . GLU A 1 91  ? -13.476 -6.254  -8.603  1.00 0.00 ? 90  GLU A HG3  6  
ATOM 11048 N N    . LEU A 1 92  ? -8.893  -5.371  -5.741  1.00 0.00 ? 91  LEU A N    6  
ATOM 11049 C CA   . LEU A 1 92  ? -7.667  -4.627  -5.865  1.00 0.00 ? 91  LEU A CA   6  
ATOM 11050 C C    . LEU A 1 92  ? -6.850  -5.345  -6.867  1.00 0.00 ? 91  LEU A C    6  
ATOM 11051 O O    . LEU A 1 92  ? -6.714  -6.561  -6.737  1.00 0.00 ? 91  LEU A O    6  
ATOM 11052 C CB   . LEU A 1 92  ? -6.848  -4.702  -4.540  1.00 0.00 ? 91  LEU A CB   6  
ATOM 11053 C CG   . LEU A 1 92  ? -5.965  -3.462  -4.260  1.00 0.00 ? 91  LEU A CG   6  
ATOM 11054 C CD1  . LEU A 1 92  ? -4.807  -3.213  -5.240  1.00 0.00 ? 91  LEU A CD1  6  
ATOM 11055 C CD2  . LEU A 1 92  ? -6.779  -2.176  -4.157  1.00 0.00 ? 91  LEU A CD2  6  
ATOM 11056 H H    . LEU A 1 92  ? -8.784  -6.340  -5.521  1.00 0.00 ? 91  LEU A H    6  
ATOM 11057 H HA   . LEU A 1 92  ? -7.834  -3.605  -6.210  1.00 0.00 ? 91  LEU A HA   6  
ATOM 11058 H HB2  . LEU A 1 92  ? -7.601  -4.744  -3.720  1.00 0.00 ? 91  LEU A HB2  6  
ATOM 11059 H HB3  . LEU A 1 92  ? -6.225  -5.650  -4.433  1.00 0.00 ? 91  LEU A HB3  6  
ATOM 11060 H HG   . LEU A 1 92  ? -5.528  -3.644  -3.254  1.00 0.00 ? 91  LEU A HG   6  
ATOM 11061 H HD11 . LEU A 1 92  ? -4.223  -4.143  -5.402  1.00 0.00 ? 91  LEU A HD11 6  
ATOM 11062 H HD12 . LEU A 1 92  ? -4.127  -2.432  -4.837  1.00 0.00 ? 91  LEU A HD12 6  
ATOM 11063 H HD13 . LEU A 1 92  ? -5.184  -2.834  -6.212  1.00 0.00 ? 91  LEU A HD13 6  
ATOM 11064 H HD21 . LEU A 1 92  ? -7.611  -2.267  -3.426  1.00 0.00 ? 91  LEU A HD21 6  
ATOM 11065 H HD22 . LEU A 1 92  ? -7.194  -1.934  -5.159  1.00 0.00 ? 91  LEU A HD22 6  
ATOM 11066 H HD23 . LEU A 1 92  ? -6.129  -1.323  -3.866  1.00 0.00 ? 91  LEU A HD23 6  
ATOM 11067 N N    . TYR A 1 93  ? -6.190  -4.638  -7.822  1.00 0.00 ? 92  TYR A N    6  
ATOM 11068 C CA   . TYR A 1 93  ? -5.164  -5.369  -8.553  1.00 0.00 ? 92  TYR A CA   6  
ATOM 11069 C C    . TYR A 1 93  ? -3.940  -4.478  -8.552  1.00 0.00 ? 92  TYR A C    6  
ATOM 11070 O O    . TYR A 1 93  ? -3.973  -3.340  -9.018  1.00 0.00 ? 92  TYR A O    6  
ATOM 11071 C CB   . TYR A 1 93  ? -5.523  -5.891  -9.999  1.00 0.00 ? 92  TYR A CB   6  
ATOM 11072 C CG   . TYR A 1 93  ? -6.907  -6.455  -10.215 1.00 0.00 ? 92  TYR A CG   6  
ATOM 11073 C CD1  . TYR A 1 93  ? -7.441  -7.471  -9.442  1.00 0.00 ? 92  TYR A CD1  6  
ATOM 11074 C CD2  . TYR A 1 93  ? -7.669  -5.973  -11.267 1.00 0.00 ? 92  TYR A CD2  6  
ATOM 11075 C CE1  . TYR A 1 93  ? -8.766  -7.840  -9.578  1.00 0.00 ? 92  TYR A CE1  6  
ATOM 11076 C CE2  . TYR A 1 93  ? -9.005  -6.308  -11.387 1.00 0.00 ? 92  TYR A CE2  6  
ATOM 11077 C CZ   . TYR A 1 93  ? -9.561  -7.221  -10.515 1.00 0.00 ? 92  TYR A CZ   6  
ATOM 11078 O OH   . TYR A 1 93  ? -10.928 -7.559  -10.574 1.00 0.00 ? 92  TYR A OH   6  
ATOM 11079 H H    . TYR A 1 93  ? -6.254  -3.625  -7.956  1.00 0.00 ? 92  TYR A H    6  
ATOM 11080 H HA   . TYR A 1 93  ? -4.813  -6.201  -7.939  1.00 0.00 ? 92  TYR A HA   6  
ATOM 11081 H HB2  . TYR A 1 93  ? -5.400  -5.065  -10.732 1.00 0.00 ? 92  TYR A HB2  6  
ATOM 11082 H HB3  . TYR A 1 93  ? -4.814  -6.707  -10.263 1.00 0.00 ? 92  TYR A HB3  6  
ATOM 11083 H HD1  . TYR A 1 93  ? -6.843  -7.946  -8.678  1.00 0.00 ? 92  TYR A HD1  6  
ATOM 11084 H HD2  . TYR A 1 93  ? -7.217  -5.276  -11.968 1.00 0.00 ? 92  TYR A HD2  6  
ATOM 11085 H HE1  . TYR A 1 93  ? -9.194  -8.591  -8.927  1.00 0.00 ? 92  TYR A HE1  6  
ATOM 11086 H HE2  . TYR A 1 93  ? -9.609  -5.824  -12.144 1.00 0.00 ? 92  TYR A HE2  6  
ATOM 11087 H HH   . TYR A 1 93  ? -11.320 -7.095  -11.317 1.00 0.00 ? 92  TYR A HH   6  
ATOM 11088 N N    . TYR A 1 94  ? -2.828  -5.008  -8.000  1.00 0.00 ? 93  TYR A N    6  
ATOM 11089 C CA   . TYR A 1 94  ? -1.531  -4.385  -7.923  1.00 0.00 ? 93  TYR A CA   6  
ATOM 11090 C C    . TYR A 1 94  ? -0.620  -5.342  -8.688  1.00 0.00 ? 93  TYR A C    6  
ATOM 11091 O O    . TYR A 1 94  ? -0.497  -6.512  -8.312  1.00 0.00 ? 93  TYR A O    6  
ATOM 11092 C CB   . TYR A 1 94  ? -1.120  -4.218  -6.427  1.00 0.00 ? 93  TYR A CB   6  
ATOM 11093 C CG   . TYR A 1 94  ? -0.362  -2.960  -6.193  1.00 0.00 ? 93  TYR A CG   6  
ATOM 11094 C CD1  . TYR A 1 94  ? -1.008  -1.776  -6.453  1.00 0.00 ? 93  TYR A CD1  6  
ATOM 11095 C CD2  . TYR A 1 94  ? 0.967   -2.930  -5.795  1.00 0.00 ? 93  TYR A CD2  6  
ATOM 11096 C CE1  . TYR A 1 94  ? -0.270  -0.613  -6.496  1.00 0.00 ? 93  TYR A CE1  6  
ATOM 11097 C CE2  . TYR A 1 94  ? 1.670   -1.753  -5.793  1.00 0.00 ? 93  TYR A CE2  6  
ATOM 11098 C CZ   . TYR A 1 94  ? 1.071   -0.589  -6.207  1.00 0.00 ? 93  TYR A CZ   6  
ATOM 11099 O OH   . TYR A 1 94  ? 1.777   0.632   -6.324  1.00 0.00 ? 93  TYR A OH   6  
ATOM 11100 H H    . TYR A 1 94  ? -2.850  -5.961  -7.661  1.00 0.00 ? 93  TYR A H    6  
ATOM 11101 H HA   . TYR A 1 94  ? -1.553  -3.432  -8.443  1.00 0.00 ? 93  TYR A HA   6  
ATOM 11102 H HB2  . TYR A 1 94  ? -2.023  -4.175  -5.783  1.00 0.00 ? 93  TYR A HB2  6  
ATOM 11103 H HB3  . TYR A 1 94  ? -0.491  -5.041  -6.095  1.00 0.00 ? 93  TYR A HB3  6  
ATOM 11104 H HD1  . TYR A 1 94  ? -2.056  -1.780  -6.770  1.00 0.00 ? 93  TYR A HD1  6  
ATOM 11105 H HD2  . TYR A 1 94  ? 1.529   -3.808  -5.519  1.00 0.00 ? 93  TYR A HD2  6  
ATOM 11106 H HE1  . TYR A 1 94  ? -0.741  0.297   -6.827  1.00 0.00 ? 93  TYR A HE1  6  
ATOM 11107 H HE2  . TYR A 1 94  ? 2.722   -1.786  -5.564  1.00 0.00 ? 93  TYR A HE2  6  
ATOM 11108 H HH   . TYR A 1 94  ? 2.702   0.495   -6.572  1.00 0.00 ? 93  TYR A HH   6  
ATOM 11109 N N    . SER A 1 95  ? -0.008  -4.856  -9.802  1.00 0.00 ? 94  SER A N    6  
ATOM 11110 C CA   . SER A 1 95  ? 0.806   -5.604  -10.762 1.00 0.00 ? 94  SER A CA   6  
ATOM 11111 C C    . SER A 1 95  ? 2.307   -5.434  -10.518 1.00 0.00 ? 94  SER A C    6  
ATOM 11112 O O    . SER A 1 95  ? 2.805   -4.302  -10.455 1.00 0.00 ? 94  SER A O    6  
ATOM 11113 C CB   . SER A 1 95  ? 0.451   -5.042  -12.163 1.00 0.00 ? 94  SER A CB   6  
ATOM 11114 O OG   . SER A 1 95  ? 0.686   -5.941  -13.245 1.00 0.00 ? 94  SER A OG   6  
ATOM 11115 H H    . SER A 1 95  ? -0.123  -3.896  -10.080 1.00 0.00 ? 94  SER A H    6  
ATOM 11116 H HA   . SER A 1 95  ? 0.559   -6.659  -10.714 1.00 0.00 ? 94  SER A HA   6  
ATOM 11117 H HB2  . SER A 1 95  ? -0.629  -4.789  -12.180 1.00 0.00 ? 94  SER A HB2  6  
ATOM 11118 H HB3  . SER A 1 95  ? 0.971   -4.061  -12.291 1.00 0.00 ? 94  SER A HB3  6  
ATOM 11119 H HG   . SER A 1 95  ? 0.031   -6.653  -13.200 1.00 0.00 ? 94  SER A HG   6  
ATOM 11120 N N    . ILE A 1 96  ? 3.050   -6.579  -10.372 1.00 0.00 ? 95  ILE A N    6  
ATOM 11121 C CA   . ILE A 1 96  ? 4.480   -6.607  -10.028 1.00 0.00 ? 95  ILE A CA   6  
ATOM 11122 C C    . ILE A 1 96  ? 5.185   -7.429  -11.084 1.00 0.00 ? 95  ILE A C    6  
ATOM 11123 O O    . ILE A 1 96  ? 4.727   -8.526  -11.410 1.00 0.00 ? 95  ILE A O    6  
ATOM 11124 C CB   . ILE A 1 96  ? 4.817   -7.115  -8.592  1.00 0.00 ? 95  ILE A CB   6  
ATOM 11125 C CG1  . ILE A 1 96  ? 3.779   -8.044  -7.903  1.00 0.00 ? 95  ILE A CG1  6  
ATOM 11126 C CG2  . ILE A 1 96  ? 5.191   -5.901  -7.704  1.00 0.00 ? 95  ILE A CG2  6  
ATOM 11127 C CD1  . ILE A 1 96  ? 2.405   -7.431  -7.618  1.00 0.00 ? 95  ILE A CD1  6  
ATOM 11128 H H    . ILE A 1 96  ? 2.643   -7.523  -10.470 1.00 0.00 ? 95  ILE A H    6  
ATOM 11129 H HA   . ILE A 1 96  ? 4.909   -5.620  -10.120 1.00 0.00 ? 95  ILE A HA   6  
ATOM 11130 H HB   . ILE A 1 96  ? 5.735   -7.749  -8.588  1.00 0.00 ? 95  ILE A HB   6  
ATOM 11131 H HG12 . ILE A 1 96  ? 3.661   -8.967  -8.511  1.00 0.00 ? 95  ILE A HG12 6  
ATOM 11132 H HG13 . ILE A 1 96  ? 4.224   -8.357  -6.928  1.00 0.00 ? 95  ILE A HG13 6  
ATOM 11133 H HG21 . ILE A 1 96  ? 6.032   -5.339  -8.148  1.00 0.00 ? 95  ILE A HG21 6  
ATOM 11134 H HG22 . ILE A 1 96  ? 5.526   -6.249  -6.705  1.00 0.00 ? 95  ILE A HG22 6  
ATOM 11135 H HG23 . ILE A 1 96  ? 4.322   -5.220  -7.576  1.00 0.00 ? 95  ILE A HG23 6  
ATOM 11136 H HD11 . ILE A 1 96  ? 1.999   -7.791  -6.660  1.00 0.00 ? 95  ILE A HD11 6  
ATOM 11137 H HD12 . ILE A 1 96  ? 1.686   -7.702  -8.421  1.00 0.00 ? 95  ILE A HD12 6  
ATOM 11138 H HD13 . ILE A 1 96  ? 2.455   -6.326  -7.543  1.00 0.00 ? 95  ILE A HD13 6  
ATOM 11139 N N    . GLU A 1 97  ? 6.325   -6.930  -11.655 1.00 0.00 ? 96  GLU A N    6  
ATOM 11140 C CA   . GLU A 1 97  ? 7.100   -7.639  -12.687 1.00 0.00 ? 96  GLU A CA   6  
ATOM 11141 C C    . GLU A 1 97  ? 8.296   -8.320  -12.050 1.00 0.00 ? 96  GLU A C    6  
ATOM 11142 O O    . GLU A 1 97  ? 9.116   -7.675  -11.398 1.00 0.00 ? 96  GLU A O    6  
ATOM 11143 C CB   . GLU A 1 97  ? 7.502   -6.735  -13.879 1.00 0.00 ? 96  GLU A CB   6  
ATOM 11144 C CG   . GLU A 1 97  ? 8.055   -7.511  -15.090 1.00 0.00 ? 96  GLU A CG   6  
ATOM 11145 C CD   . GLU A 1 97  ? 8.251   -6.560  -16.270 1.00 0.00 ? 96  GLU A CD   6  
ATOM 11146 O OE1  . GLU A 1 97  ? 7.228   -6.022  -16.772 1.00 0.00 ? 96  GLU A OE1  6  
ATOM 11147 O OE2  . GLU A 1 97  ? 9.424   -6.362  -16.685 1.00 0.00 ? 96  GLU A OE2  6  
ATOM 11148 H H    . GLU A 1 97  ? 6.657   -6.012  -11.350 1.00 0.00 ? 96  GLU A H    6  
ATOM 11149 H HA   . GLU A 1 97  ? 6.482   -8.429  -13.081 1.00 0.00 ? 96  GLU A HA   6  
ATOM 11150 H HB2  . GLU A 1 97  ? 6.572   -6.215  -14.199 1.00 0.00 ? 96  GLU A HB2  6  
ATOM 11151 H HB3  . GLU A 1 97  ? 8.230   -5.961  -13.555 1.00 0.00 ? 96  GLU A HB3  6  
ATOM 11152 H HG2  . GLU A 1 97  ? 9.025   -7.986  -14.831 1.00 0.00 ? 96  GLU A HG2  6  
ATOM 11153 H HG3  . GLU A 1 97  ? 7.339   -8.309  -15.382 1.00 0.00 ? 96  GLU A HG3  6  
ATOM 11154 N N    . LYS A 1 98  ? 8.368   -9.670  -12.140 1.00 0.00 ? 97  LYS A N    6  
ATOM 11155 C CA   . LYS A 1 98  ? 9.320   -10.425 -11.328 1.00 0.00 ? 97  LYS A CA   6  
ATOM 11156 C C    . LYS A 1 98  ? 9.888   -11.624 -12.038 1.00 0.00 ? 97  LYS A C    6  
ATOM 11157 O O    . LYS A 1 98  ? 9.145   -12.397 -12.638 1.00 0.00 ? 97  LYS A O    6  
ATOM 11158 C CB   . LYS A 1 98  ? 8.494   -10.978 -10.154 1.00 0.00 ? 97  LYS A CB   6  
ATOM 11159 C CG   . LYS A 1 98  ? 9.138   -11.967 -9.160  1.00 0.00 ? 97  LYS A CG   6  
ATOM 11160 C CD   . LYS A 1 98  ? 10.379  -11.482 -8.404  1.00 0.00 ? 97  LYS A CD   6  
ATOM 11161 C CE   . LYS A 1 98  ? 10.765  -12.495 -7.316  1.00 0.00 ? 97  LYS A CE   6  
ATOM 11162 N NZ   . LYS A 1 98  ? 12.029  -12.130 -6.642  1.00 0.00 ? 97  LYS A NZ   6  
ATOM 11163 H H    . LYS A 1 98  ? 7.723   -10.209 -12.753 1.00 0.00 ? 97  LYS A H    6  
ATOM 11164 H HA   . LYS A 1 98  ? 10.142  -9.801  -10.988 1.00 0.00 ? 97  LYS A HA   6  
ATOM 11165 H HB2  . LYS A 1 98  ? 8.066   -10.127 -9.578  1.00 0.00 ? 97  LYS A HB2  6  
ATOM 11166 H HB3  . LYS A 1 98  ? 7.659   -11.495 -10.683 1.00 0.00 ? 97  LYS A HB3  6  
ATOM 11167 H HG2  . LYS A 1 98  ? 8.379   -12.187 -8.378  1.00 0.00 ? 97  LYS A HG2  6  
ATOM 11168 H HG3  . LYS A 1 98  ? 9.360   -12.938 -9.654  1.00 0.00 ? 97  LYS A HG3  6  
ATOM 11169 H HD2  . LYS A 1 98  ? 11.226  -11.340 -9.109  1.00 0.00 ? 97  LYS A HD2  6  
ATOM 11170 H HD3  . LYS A 1 98  ? 10.162  -10.502 -7.927  1.00 0.00 ? 97  LYS A HD3  6  
ATOM 11171 H HE2  . LYS A 1 98  ? 9.967   -12.550 -6.547  1.00 0.00 ? 97  LYS A HE2  6  
ATOM 11172 H HE3  . LYS A 1 98  ? 10.896  -13.499 -7.771  1.00 0.00 ? 97  LYS A HE3  6  
ATOM 11173 H HZ1  . LYS A 1 98  ? 12.799  -12.102 -7.341  1.00 0.00 ? 97  LYS A HZ1  6  
ATOM 11174 H HZ2  . LYS A 1 98  ? 12.249  -12.835 -5.911  1.00 0.00 ? 97  LYS A HZ2  6  
ATOM 11175 H HZ3  . LYS A 1 98  ? 11.928  -11.192 -6.202  1.00 0.00 ? 97  LYS A HZ3  6  
ATOM 11176 N N    . GLU A 1 99  ? 11.232  -11.862 -11.982 1.00 0.00 ? 98  GLU A N    6  
ATOM 11177 C CA   . GLU A 1 99  ? 11.949  -13.025 -12.537 1.00 0.00 ? 98  GLU A CA   6  
ATOM 11178 C C    . GLU A 1 99  ? 11.933  -13.116 -14.070 1.00 0.00 ? 98  GLU A C    6  
ATOM 11179 O O    . GLU A 1 99  ? 12.466  -14.035 -14.685 1.00 0.00 ? 98  GLU A O    6  
ATOM 11180 C CB   . GLU A 1 99  ? 11.469  -14.363 -11.873 1.00 0.00 ? 98  GLU A CB   6  
ATOM 11181 C CG   . GLU A 1 99  ? 11.982  -14.575 -10.439 1.00 0.00 ? 98  GLU A CG   6  
ATOM 11182 C CD   . GLU A 1 99  ? 13.510  -14.575 -10.372 1.00 0.00 ? 98  GLU A CD   6  
ATOM 11183 O OE1  . GLU A 1 99  ? 14.134  -15.450 -11.029 1.00 0.00 ? 98  GLU A OE1  6  
ATOM 11184 O OE2  . GLU A 1 99  ? 14.070  -13.700 -9.659  1.00 0.00 ? 98  GLU A OE2  6  
ATOM 11185 H H    . GLU A 1 99  ? 11.811  -11.218 -11.490 1.00 0.00 ? 98  GLU A H    6  
ATOM 11186 H HA   . GLU A 1 99  ? 12.991  -12.883 -12.292 1.00 0.00 ? 98  GLU A HA   6  
ATOM 11187 H HB2  . GLU A 1 99  ? 10.339  -14.372 -11.799 1.00 0.00 ? 98  GLU A HB2  6  
ATOM 11188 H HB3  . GLU A 1 99  ? 11.835  -15.261 -12.431 1.00 0.00 ? 98  GLU A HB3  6  
ATOM 11189 H HG2  . GLU A 1 99  ? 11.572  -13.787 -9.781  1.00 0.00 ? 98  GLU A HG2  6  
ATOM 11190 H HG3  . GLU A 1 99  ? 11.608  -15.566 -10.109 1.00 0.00 ? 98  GLU A HG3  6  
ATOM 11191 N N    . GLY A 1 100 ? 11.328  -12.074 -14.685 1.00 0.00 ? 99  GLY A N    6  
ATOM 11192 C CA   . GLY A 1 100 ? 11.178  -11.864 -16.119 1.00 0.00 ? 99  GLY A CA   6  
ATOM 11193 C C    . GLY A 1 100 ? 9.731   -11.948 -16.506 1.00 0.00 ? 99  GLY A C    6  
ATOM 11194 O O    . GLY A 1 100 ? 9.355   -11.603 -17.620 1.00 0.00 ? 99  GLY A O    6  
ATOM 11195 H H    . GLY A 1 100 ? 10.872  -11.433 -14.052 1.00 0.00 ? 99  GLY A H    6  
ATOM 11196 H HA2  . GLY A 1 100 ? 11.517  -10.862 -16.342 1.00 0.00 ? 99  GLY A HA2  6  
ATOM 11197 H HA3  . GLY A 1 100 ? 11.709  -12.622 -16.682 1.00 0.00 ? 99  GLY A HA3  6  
ATOM 11198 N N    . GLN A 1 101 ? 8.867   -12.417 -15.573 1.00 0.00 ? 100 GLN A N    6  
ATOM 11199 C CA   . GLN A 1 101 ? 7.441   -12.595 -15.770 1.00 0.00 ? 100 GLN A CA   6  
ATOM 11200 C C    . GLN A 1 101 ? 6.616   -11.737 -14.871 1.00 0.00 ? 100 GLN A C    6  
ATOM 11201 O O    . GLN A 1 101 ? 7.105   -11.071 -13.971 1.00 0.00 ? 100 GLN A O    6  
ATOM 11202 C CB   . GLN A 1 101 ? 7.022   -14.100 -15.768 1.00 0.00 ? 100 GLN A CB   6  
ATOM 11203 C CG   . GLN A 1 101 ? 7.457   -14.985 -14.563 1.00 0.00 ? 100 GLN A CG   6  
ATOM 11204 C CD   . GLN A 1 101 ? 6.550   -14.886 -13.329 1.00 0.00 ? 100 GLN A CD   6  
ATOM 11205 O OE1  . GLN A 1 101 ? 5.501   -15.529 -13.218 1.00 0.00 ? 100 GLN A OE1  6  
ATOM 11206 N NE2  . GLN A 1 101 ? 6.984   -14.057 -12.347 1.00 0.00 ? 100 GLN A NE2  6  
ATOM 11207 H H    . GLN A 1 101 ? 9.189   -12.654 -14.656 1.00 0.00 ? 100 GLN A H    6  
ATOM 11208 H HA   . GLN A 1 101 ? 7.170   -12.133 -16.695 1.00 0.00 ? 100 GLN A HA   6  
ATOM 11209 H HB2  . GLN A 1 101 ? 5.929   -14.220 -15.933 1.00 0.00 ? 100 GLN A HB2  6  
ATOM 11210 H HB3  . GLN A 1 101 ? 7.524   -14.543 -16.661 1.00 0.00 ? 100 GLN A HB3  6  
ATOM 11211 H HG2  . GLN A 1 101 ? 7.390   -16.046 -14.890 1.00 0.00 ? 100 GLN A HG2  6  
ATOM 11212 H HG3  . GLN A 1 101 ? 8.512   -14.795 -14.287 1.00 0.00 ? 100 GLN A HG3  6  
ATOM 11213 H HE21 . GLN A 1 101 ? 7.858   -13.541 -12.474 1.00 0.00 ? 100 GLN A HE21 6  
ATOM 11214 H HE22 . GLN A 1 101 ? 6.333   -13.882 -11.603 1.00 0.00 ? 100 GLN A HE22 6  
ATOM 11215 N N    . ARG A 1 102 ? 5.294   -11.683 -15.115 1.00 0.00 ? 101 ARG A N    6  
ATOM 11216 C CA   . ARG A 1 102 ? 4.384   -10.853 -14.363 1.00 0.00 ? 101 ARG A CA   6  
ATOM 11217 C C    . ARG A 1 102 ? 3.705   -11.640 -13.268 1.00 0.00 ? 101 ARG A C    6  
ATOM 11218 O O    . ARG A 1 102 ? 3.341   -12.799 -13.449 1.00 0.00 ? 101 ARG A O    6  
ATOM 11219 C CB   . ARG A 1 102 ? 3.355   -10.203 -15.338 1.00 0.00 ? 101 ARG A CB   6  
ATOM 11220 C CG   . ARG A 1 102 ? 2.419   -9.140  -14.731 1.00 0.00 ? 101 ARG A CG   6  
ATOM 11221 C CD   . ARG A 1 102 ? 3.164   -7.900  -14.217 1.00 0.00 ? 101 ARG A CD   6  
ATOM 11222 N NE   . ARG A 1 102 ? 3.353   -6.915  -15.337 1.00 0.00 ? 101 ARG A NE   6  
ATOM 11223 C CZ   . ARG A 1 102 ? 3.759   -5.626  -15.117 1.00 0.00 ? 101 ARG A CZ   6  
ATOM 11224 N NH1  . ARG A 1 102 ? 4.018   -5.187  -13.851 1.00 0.00 ? 101 ARG A NH1  6  
ATOM 11225 N NH2  . ARG A 1 102 ? 3.903   -4.773  -16.172 1.00 0.00 ? 101 ARG A NH2  6  
ATOM 11226 H H    . ARG A 1 102 ? 4.868   -12.216 -15.839 1.00 0.00 ? 101 ARG A H    6  
ATOM 11227 H HA   . ARG A 1 102 ? 4.939   -10.083 -13.856 1.00 0.00 ? 101 ARG A HA   6  
ATOM 11228 H HB2  . ARG A 1 102 ? 3.935   -9.717  -16.156 1.00 0.00 ? 101 ARG A HB2  6  
ATOM 11229 H HB3  . ARG A 1 102 ? 2.736   -10.997 -15.809 1.00 0.00 ? 101 ARG A HB3  6  
ATOM 11230 H HG2  . ARG A 1 102 ? 1.655   -8.832  -15.483 1.00 0.00 ? 101 ARG A HG2  6  
ATOM 11231 H HG3  . ARG A 1 102 ? 1.863   -9.592  -13.878 1.00 0.00 ? 101 ARG A HG3  6  
ATOM 11232 H HD2  . ARG A 1 102 ? 2.575   -7.436  -13.401 1.00 0.00 ? 101 ARG A HD2  6  
ATOM 11233 H HD3  . ARG A 1 102 ? 4.164   -8.165  -13.823 1.00 0.00 ? 101 ARG A HD3  6  
ATOM 11234 H HE   . ARG A 1 102 ? 3.170   -7.211  -16.274 1.00 0.00 ? 101 ARG A HE   6  
ATOM 11235 H HH11 . ARG A 1 102 ? 3.914   -5.810  -13.074 1.00 0.00 ? 101 ARG A HH11 6  
ATOM 11236 H HH12 . ARG A 1 102 ? 4.315   -4.245  -13.699 1.00 0.00 ? 101 ARG A HH12 6  
ATOM 11237 H HH21 . ARG A 1 102 ? 3.713   -5.091  -17.101 1.00 0.00 ? 101 ARG A HH21 6  
ATOM 11238 H HH22 . ARG A 1 102 ? 4.200   -3.831  -16.015 1.00 0.00 ? 101 ARG A HH22 6  
ATOM 11239 N N    . LYS A 1 103 ? 3.516   -10.989 -12.094 1.00 0.00 ? 102 LYS A N    6  
ATOM 11240 C CA   . LYS A 1 103 ? 2.762   -11.546 -10.984 1.00 0.00 ? 102 LYS A CA   6  
ATOM 11241 C C    . LYS A 1 103 ? 1.664   -10.529 -10.769 1.00 0.00 ? 102 LYS A C    6  
ATOM 11242 O O    . LYS A 1 103 ? 1.922   -9.350  -10.533 1.00 0.00 ? 102 LYS A O    6  
ATOM 11243 C CB   . LYS A 1 103 ? 3.645   -11.822 -9.729  1.00 0.00 ? 102 LYS A CB   6  
ATOM 11244 C CG   . LYS A 1 103 ? 4.335   -13.207 -9.842  1.00 0.00 ? 102 LYS A CG   6  
ATOM 11245 C CD   . LYS A 1 103 ? 5.727   -13.413 -9.199  1.00 0.00 ? 102 LYS A CD   6  
ATOM 11246 C CE   . LYS A 1 103 ? 5.874   -13.034 -7.713  1.00 0.00 ? 102 LYS A CE   6  
ATOM 11247 N NZ   . LYS A 1 103 ? 5.917   -11.566 -7.496  1.00 0.00 ? 102 LYS A NZ   6  
ATOM 11248 H H    . LYS A 1 103 ? 3.830   -10.021 -11.943 1.00 0.00 ? 102 LYS A H    6  
ATOM 11249 H HA   . LYS A 1 103 ? 2.269   -12.471 -11.256 1.00 0.00 ? 102 LYS A HA   6  
ATOM 11250 H HB2  . LYS A 1 103 ? 4.391   -11.003 -9.645  1.00 0.00 ? 102 LYS A HB2  6  
ATOM 11251 H HB3  . LYS A 1 103 ? 3.041   -11.828 -8.782  1.00 0.00 ? 102 LYS A HB3  6  
ATOM 11252 H HG2  . LYS A 1 103 ? 3.634   -13.960 -9.414  1.00 0.00 ? 102 LYS A HG2  6  
ATOM 11253 H HG3  . LYS A 1 103 ? 4.438   -13.445 -10.925 1.00 0.00 ? 102 LYS A HG3  6  
ATOM 11254 H HD2  . LYS A 1 103 ? 5.970   -14.500 -9.283  1.00 0.00 ? 102 LYS A HD2  6  
ATOM 11255 H HD3  . LYS A 1 103 ? 6.514   -12.906 -9.797  1.00 0.00 ? 102 LYS A HD3  6  
ATOM 11256 H HE2  . LYS A 1 103 ? 5.046   -13.447 -7.110  1.00 0.00 ? 102 LYS A HE2  6  
ATOM 11257 H HE3  . LYS A 1 103 ? 6.831   -13.443 -7.324  1.00 0.00 ? 102 LYS A HE3  6  
ATOM 11258 H HZ1  . LYS A 1 103 ? 6.714   -11.162 -8.029  1.00 0.00 ? 102 LYS A HZ1  6  
ATOM 11259 H HZ2  . LYS A 1 103 ? 6.040   -11.369 -6.483  1.00 0.00 ? 102 LYS A HZ2  6  
ATOM 11260 H HZ3  . LYS A 1 103 ? 5.027   -11.141 -7.829  1.00 0.00 ? 102 LYS A HZ3  6  
ATOM 11261 N N    . TRP A 1 104 ? 0.379   -10.943 -10.891 1.00 0.00 ? 103 TRP A N    6  
ATOM 11262 C CA   . TRP A 1 104 ? -0.766  -10.062 -10.705 1.00 0.00 ? 103 TRP A CA   6  
ATOM 11263 C C    . TRP A 1 104 ? -1.445  -10.554 -9.422  1.00 0.00 ? 103 TRP A C    6  
ATOM 11264 O O    . TRP A 1 104 ? -1.843  -11.714 -9.291  1.00 0.00 ? 103 TRP A O    6  
ATOM 11265 C CB   . TRP A 1 104 ? -1.775  -10.114 -11.908 1.00 0.00 ? 103 TRP A CB   6  
ATOM 11266 C CG   . TRP A 1 104 ? -1.675  -9.083  -13.043 1.00 0.00 ? 103 TRP A CG   6  
ATOM 11267 C CD1  . TRP A 1 104 ? -1.471  -9.294  -14.382 1.00 0.00 ? 103 TRP A CD1  6  
ATOM 11268 C CD2  . TRP A 1 104 ? -2.173  -7.733  -12.928 1.00 0.00 ? 103 TRP A CD2  6  
ATOM 11269 N NE1  . TRP A 1 104 ? -1.867  -8.181  -15.109 1.00 0.00 ? 103 TRP A NE1  6  
ATOM 11270 C CE2  . TRP A 1 104 ? -2.338  -7.233  -14.223 1.00 0.00 ? 103 TRP A CE2  6  
ATOM 11271 C CE3  . TRP A 1 104 ? -2.518  -6.986  -11.836 1.00 0.00 ? 103 TRP A CE3  6  
ATOM 11272 C CZ2  . TRP A 1 104 ? -2.910  -6.007  -14.442 1.00 0.00 ? 103 TRP A CZ2  6  
ATOM 11273 C CZ3  . TRP A 1 104 ? -2.997  -5.713  -12.068 1.00 0.00 ? 103 TRP A CZ3  6  
ATOM 11274 C CH2  . TRP A 1 104 ? -3.227  -5.240  -13.343 1.00 0.00 ? 103 TRP A CH2  6  
ATOM 11275 H H    . TRP A 1 104 ? 0.160   -11.899 -11.090 1.00 0.00 ? 103 TRP A H    6  
ATOM 11276 H HA   . TRP A 1 104 ? -0.426  -9.029  -10.542 1.00 0.00 ? 103 TRP A HA   6  
ATOM 11277 H HB2  . TRP A 1 104 ? -1.734  -11.134 -12.348 1.00 0.00 ? 103 TRP A HB2  6  
ATOM 11278 H HB3  . TRP A 1 104 ? -2.818  -9.964  -11.545 1.00 0.00 ? 103 TRP A HB3  6  
ATOM 11279 H HD1  . TRP A 1 104 ? -1.101  -10.218 -14.803 1.00 0.00 ? 103 TRP A HD1  6  
ATOM 11280 H HE1  . TRP A 1 104 ? -1.908  -8.088  -16.084 1.00 0.00 ? 103 TRP A HE1  6  
ATOM 11281 H HE3  . TRP A 1 104 ? -2.382  -7.338  -10.824 1.00 0.00 ? 103 TRP A HE3  6  
ATOM 11282 H HZ2  . TRP A 1 104 ? -3.148  -5.630  -15.424 1.00 0.00 ? 103 TRP A HZ2  6  
ATOM 11283 H HZ3  . TRP A 1 104 ? -3.193  -5.060  -11.233 1.00 0.00 ? 103 TRP A HZ3  6  
ATOM 11284 H HH2  . TRP A 1 104 ? -3.642  -4.248  -13.482 1.00 0.00 ? 103 TRP A HH2  6  
ATOM 11285 N N    . TYR A 1 105 ? -1.550  -9.641  -8.438  1.00 0.00 ? 104 TYR A N    6  
ATOM 11286 C CA   . TYR A 1 105 ? -2.075  -9.828  -7.108  1.00 0.00 ? 104 TYR A CA   6  
ATOM 11287 C C    . TYR A 1 105 ? -3.094  -8.740  -6.861  1.00 0.00 ? 104 TYR A C    6  
ATOM 11288 O O    . TYR A 1 105 ? -3.249  -7.810  -7.645  1.00 0.00 ? 104 TYR A O    6  
ATOM 11289 C CB   . TYR A 1 105 ? -0.933  -9.799  -6.049  1.00 0.00 ? 104 TYR A CB   6  
ATOM 11290 C CG   . TYR A 1 105 ? 0.067   -10.907 -6.296  1.00 0.00 ? 104 TYR A CG   6  
ATOM 11291 C CD1  . TYR A 1 105 ? -0.378  -12.217 -6.398  1.00 0.00 ? 104 TYR A CD1  6  
ATOM 11292 C CD2  . TYR A 1 105 ? 1.438   -10.678 -6.301  1.00 0.00 ? 104 TYR A CD2  6  
ATOM 11293 C CE1  . TYR A 1 105 ? 0.504   -13.270 -6.523  1.00 0.00 ? 104 TYR A CE1  6  
ATOM 11294 C CE2  . TYR A 1 105 ? 2.319   -11.736 -6.367  1.00 0.00 ? 104 TYR A CE2  6  
ATOM 11295 C CZ   . TYR A 1 105 ? 1.855   -13.027 -6.480  1.00 0.00 ? 104 TYR A CZ   6  
ATOM 11296 O OH   . TYR A 1 105 ? 2.774   -14.090 -6.524  1.00 0.00 ? 104 TYR A OH   6  
ATOM 11297 H H    . TYR A 1 105 ? -1.196  -8.712  -8.581  1.00 0.00 ? 104 TYR A H    6  
ATOM 11298 H HA   . TYR A 1 105 ? -2.591  -10.763 -6.965  1.00 0.00 ? 104 TYR A HA   6  
ATOM 11299 H HB2  . TYR A 1 105 ? -0.416  -8.820  -6.013  1.00 0.00 ? 104 TYR A HB2  6  
ATOM 11300 H HB3  . TYR A 1 105 ? -1.346  -9.999  -5.036  1.00 0.00 ? 104 TYR A HB3  6  
ATOM 11301 H HD1  . TYR A 1 105 ? -1.434  -12.442 -6.371  1.00 0.00 ? 104 TYR A HD1  6  
ATOM 11302 H HD2  . TYR A 1 105 ? 1.855   -9.687  -6.194  1.00 0.00 ? 104 TYR A HD2  6  
ATOM 11303 H HE1  . TYR A 1 105 ? 0.123   -14.279 -6.606  1.00 0.00 ? 104 TYR A HE1  6  
ATOM 11304 H HE2  . TYR A 1 105 ? 3.381   -11.538 -6.356  1.00 0.00 ? 104 TYR A HE2  6  
ATOM 11305 H HH   . TYR A 1 105 ? 2.413   -14.788 -7.081  1.00 0.00 ? 104 TYR A HH   6  
ATOM 11306 N N    . LYS A 1 106 ? -3.746  -8.819  -5.676  1.00 0.00 ? 105 LYS A N    6  
ATOM 11307 C CA   . LYS A 1 106 ? -4.453  -7.799  -4.974  1.00 0.00 ? 105 LYS A CA   6  
ATOM 11308 C C    . LYS A 1 106 ? -3.391  -7.480  -3.944  1.00 0.00 ? 105 LYS A C    6  
ATOM 11309 O O    . LYS A 1 106 ? -2.556  -8.341  -3.640  1.00 0.00 ? 105 LYS A O    6  
ATOM 11310 C CB   . LYS A 1 106 ? -5.730  -8.332  -4.254  1.00 0.00 ? 105 LYS A CB   6  
ATOM 11311 C CG   . LYS A 1 106 ? -5.678  -9.798  -3.797  1.00 0.00 ? 105 LYS A CG   6  
ATOM 11312 C CD   . LYS A 1 106 ? -6.923  -10.201 -2.992  1.00 0.00 ? 105 LYS A CD   6  
ATOM 11313 C CE   . LYS A 1 106 ? -6.994  -11.704 -2.678  1.00 0.00 ? 105 LYS A CE   6  
ATOM 11314 N NZ   . LYS A 1 106 ? -7.139  -12.511 -3.914  1.00 0.00 ? 105 LYS A NZ   6  
ATOM 11315 H H    . LYS A 1 106 ? -3.620  -9.533  -5.016  1.00 0.00 ? 105 LYS A H    6  
ATOM 11316 H HA   . LYS A 1 106 ? -4.632  -6.926  -5.584  1.00 0.00 ? 105 LYS A HA   6  
ATOM 11317 H HB2  . LYS A 1 106 ? -6.025  -7.679  -3.402  1.00 0.00 ? 105 LYS A HB2  6  
ATOM 11318 H HB3  . LYS A 1 106 ? -6.559  -8.264  -4.980  1.00 0.00 ? 105 LYS A HB3  6  
ATOM 11319 H HG2  . LYS A 1 106 ? -5.609  -10.447 -4.700  1.00 0.00 ? 105 LYS A HG2  6  
ATOM 11320 H HG3  . LYS A 1 106 ? -4.777  -9.980  -3.174  1.00 0.00 ? 105 LYS A HG3  6  
ATOM 11321 H HD2  . LYS A 1 106 ? -6.919  -9.642  -2.029  1.00 0.00 ? 105 LYS A HD2  6  
ATOM 11322 H HD3  . LYS A 1 106 ? -7.839  -9.904  -3.551  1.00 0.00 ? 105 LYS A HD3  6  
ATOM 11323 H HE2  . LYS A 1 106 ? -6.068  -12.038 -2.166  1.00 0.00 ? 105 LYS A HE2  6  
ATOM 11324 H HE3  . LYS A 1 106 ? -7.869  -11.921 -2.033  1.00 0.00 ? 105 LYS A HE3  6  
ATOM 11325 H HZ1  . LYS A 1 106 ? -6.323  -12.340 -4.535  1.00 0.00 ? 105 LYS A HZ1  6  
ATOM 11326 H HZ2  . LYS A 1 106 ? -8.013  -12.236 -4.405  1.00 0.00 ? 105 LYS A HZ2  6  
ATOM 11327 H HZ3  . LYS A 1 106 ? -7.183  -13.519 -3.667  1.00 0.00 ? 105 LYS A HZ3  6  
ATOM 11328 N N    . ARG A 1 107 ? -3.411  -6.256  -3.371  1.00 0.00 ? 106 ARG A N    6  
ATOM 11329 C CA   . ARG A 1 107 ? -2.460  -5.687  -2.382  1.00 0.00 ? 106 ARG A CA   6  
ATOM 11330 C C    . ARG A 1 107 ? -1.777  -6.607  -1.377  1.00 0.00 ? 106 ARG A C    6  
ATOM 11331 O O    . ARG A 1 107 ? -0.640  -6.403  -0.994  1.00 0.00 ? 106 ARG A O    6  
ATOM 11332 C CB   . ARG A 1 107 ? -3.180  -4.669  -1.437  1.00 0.00 ? 106 ARG A CB   6  
ATOM 11333 C CG   . ARG A 1 107 ? -3.304  -3.240  -1.974  1.00 0.00 ? 106 ARG A CG   6  
ATOM 11334 C CD   . ARG A 1 107 ? -2.173  -2.309  -1.513  1.00 0.00 ? 106 ARG A CD   6  
ATOM 11335 N NE   . ARG A 1 107 ? -0.885  -2.698  -2.194  1.00 0.00 ? 106 ARG A NE   6  
ATOM 11336 C CZ   . ARG A 1 107 ? 0.294   -2.937  -1.539  1.00 0.00 ? 106 ARG A CZ   6  
ATOM 11337 N NH1  . ARG A 1 107 ? 0.330   -3.111  -0.188  1.00 0.00 ? 106 ARG A NH1  6  
ATOM 11338 N NH2  . ARG A 1 107 ? 1.453   -3.000  -2.258  1.00 0.00 ? 106 ARG A NH2  6  
ATOM 11339 H H    . ARG A 1 107 ? -4.106  -5.657  -3.769  1.00 0.00 ? 106 ARG A H    6  
ATOM 11340 H HA   . ARG A 1 107 ? -1.665  -5.199  -2.927  1.00 0.00 ? 106 ARG A HA   6  
ATOM 11341 H HB2  . ARG A 1 107 ? -4.145  -5.134  -1.115  1.00 0.00 ? 106 ARG A HB2  6  
ATOM 11342 H HB3  . ARG A 1 107 ? -2.622  -4.460  -0.490  1.00 0.00 ? 106 ARG A HB3  6  
ATOM 11343 H HG2  . ARG A 1 107 ? -3.334  -3.244  -3.079  1.00 0.00 ? 106 ARG A HG2  6  
ATOM 11344 H HG3  . ARG A 1 107 ? -4.251  -2.789  -1.597  1.00 0.00 ? 106 ARG A HG3  6  
ATOM 11345 H HD2  . ARG A 1 107 ? -2.408  -1.269  -1.825  1.00 0.00 ? 106 ARG A HD2  6  
ATOM 11346 H HD3  . ARG A 1 107 ? -2.088  -2.334  -0.404  1.00 0.00 ? 106 ARG A HD3  6  
ATOM 11347 H HE   . ARG A 1 107 ? -0.852  -2.611  -3.190  1.00 0.00 ? 106 ARG A HE   6  
ATOM 11348 H HH11 . ARG A 1 107 ? -0.516  -3.067  0.344   1.00 0.00 ? 106 ARG A HH11 6  
ATOM 11349 H HH12 . ARG A 1 107 ? 1.202   -3.285  0.271   1.00 0.00 ? 106 ARG A HH12 6  
ATOM 11350 H HH21 . ARG A 1 107 ? 1.432   -2.874  -3.251  1.00 0.00 ? 106 ARG A HH21 6  
ATOM 11351 H HH22 . ARG A 1 107 ? 2.320   -3.178  -1.794  1.00 0.00 ? 106 ARG A HH22 6  
ATOM 11352 N N    . MET A 1 108 ? -2.458  -7.668  -0.897  1.00 0.00 ? 107 MET A N    6  
ATOM 11353 C CA   . MET A 1 108 ? -2.020  -8.564  0.154   1.00 0.00 ? 107 MET A CA   6  
ATOM 11354 C C    . MET A 1 108 ? -0.782  -9.426  -0.142  1.00 0.00 ? 107 MET A C    6  
ATOM 11355 O O    . MET A 1 108 ? -0.100  -9.859  0.784   1.00 0.00 ? 107 MET A O    6  
ATOM 11356 C CB   . MET A 1 108 ? -3.288  -9.250  0.730   1.00 0.00 ? 107 MET A CB   6  
ATOM 11357 C CG   . MET A 1 108 ? -3.738  -10.502 -0.045  1.00 0.00 ? 107 MET A CG   6  
ATOM 11358 S SD   . MET A 1 108 ? -5.245  -11.270 0.631   1.00 0.00 ? 107 MET A SD   6  
ATOM 11359 C CE   . MET A 1 108 ? -4.557  -11.786 2.230   1.00 0.00 ? 107 MET A CE   6  
ATOM 11360 H H    . MET A 1 108 ? -3.361  -7.851  -1.275  1.00 0.00 ? 107 MET A H    6  
ATOM 11361 H HA   . MET A 1 108 ? -1.685  -7.938  0.966   1.00 0.00 ? 107 MET A HA   6  
ATOM 11362 H HB2  . MET A 1 108 ? -3.203  -9.384  1.840   1.00 0.00 ? 107 MET A HB2  6  
ATOM 11363 H HB3  . MET A 1 108 ? -4.118  -8.506  0.615   1.00 0.00 ? 107 MET A HB3  6  
ATOM 11364 H HG2  . MET A 1 108 ? -3.928  -10.191 -1.100  1.00 0.00 ? 107 MET A HG2  6  
ATOM 11365 H HG3  . MET A 1 108 ? -2.908  -11.246 -0.085  1.00 0.00 ? 107 MET A HG3  6  
ATOM 11366 H HE1  . MET A 1 108 ? -3.601  -12.336 2.092   1.00 0.00 ? 107 MET A HE1  6  
ATOM 11367 H HE2  . MET A 1 108 ? -5.263  -12.458 2.760   1.00 0.00 ? 107 MET A HE2  6  
ATOM 11368 H HE3  . MET A 1 108 ? -4.367  -10.914 2.890   1.00 0.00 ? 107 MET A HE3  6  
ATOM 11369 N N    . ALA A 1 109 ? -0.402  -9.628  -1.452  1.00 0.00 ? 108 ALA A N    6  
ATOM 11370 C CA   . ALA A 1 109 ? 0.830   -10.346 -1.811  1.00 0.00 ? 108 ALA A CA   6  
ATOM 11371 C C    . ALA A 1 109 ? 1.991   -9.484  -2.253  1.00 0.00 ? 108 ALA A C    6  
ATOM 11372 O O    . ALA A 1 109 ? 3.010   -9.992  -2.710  1.00 0.00 ? 108 ALA A O    6  
ATOM 11373 C CB   . ALA A 1 109 ? 0.599   -11.448 -2.885  1.00 0.00 ? 108 ALA A CB   6  
ATOM 11374 H H    . ALA A 1 109 ? -0.952  -9.257  -2.219  1.00 0.00 ? 108 ALA A H    6  
ATOM 11375 H HA   . ALA A 1 109 ? 1.238   -10.755 -0.919  1.00 0.00 ? 108 ALA A HA   6  
ATOM 11376 H HB1  . ALA A 1 109 ? 0.306   -11.000 -3.853  1.00 0.00 ? 108 ALA A HB1  6  
ATOM 11377 H HB2  . ALA A 1 109 ? -0.206  -12.142 -2.571  1.00 0.00 ? 108 ALA A HB2  6  
ATOM 11378 H HB3  . ALA A 1 109 ? 1.520   -12.039 -3.105  1.00 0.00 ? 108 ALA A HB3  6  
ATOM 11379 N N    . VAL A 1 110 ? 1.852   -8.164  -2.145  1.00 0.00 ? 109 VAL A N    6  
ATOM 11380 C CA   . VAL A 1 110 ? 2.806   -7.125  -2.422  1.00 0.00 ? 109 VAL A CA   6  
ATOM 11381 C C    . VAL A 1 110 ? 2.893   -6.286  -1.188  1.00 0.00 ? 109 VAL A C    6  
ATOM 11382 O O    . VAL A 1 110 ? 1.905   -5.722  -0.747  1.00 0.00 ? 109 VAL A O    6  
ATOM 11383 C CB   . VAL A 1 110 ? 2.527   -6.283  -3.669  1.00 0.00 ? 109 VAL A CB   6  
ATOM 11384 C CG1  . VAL A 1 110 ? 3.723   -6.459  -4.617  1.00 0.00 ? 109 VAL A CG1  6  
ATOM 11385 C CG2  . VAL A 1 110 ? 1.184   -6.674  -4.323  1.00 0.00 ? 109 VAL A CG2  6  
ATOM 11386 H H    . VAL A 1 110 ? 1.095   -7.841  -1.612  1.00 0.00 ? 109 VAL A H    6  
ATOM 11387 H HA   . VAL A 1 110 ? 3.781   -7.567  -2.542  1.00 0.00 ? 109 VAL A HA   6  
ATOM 11388 H HB   . VAL A 1 110 ? 2.485   -5.189  -3.462  1.00 0.00 ? 109 VAL A HB   6  
ATOM 11389 H HG11 . VAL A 1 110 ? 3.848   -7.525  -4.903  1.00 0.00 ? 109 VAL A HG11 6  
ATOM 11390 H HG12 . VAL A 1 110 ? 4.666   -6.123  -4.129  1.00 0.00 ? 109 VAL A HG12 6  
ATOM 11391 H HG13 . VAL A 1 110 ? 3.560   -5.853  -5.532  1.00 0.00 ? 109 VAL A HG13 6  
ATOM 11392 H HG21 . VAL A 1 110 ? 1.179   -7.744  -4.620  1.00 0.00 ? 109 VAL A HG21 6  
ATOM 11393 H HG22 . VAL A 1 110 ? 1.027   -6.062  -5.231  1.00 0.00 ? 109 VAL A HG22 6  
ATOM 11394 H HG23 . VAL A 1 110 ? 0.346   -6.491  -3.618  1.00 0.00 ? 109 VAL A HG23 6  
ATOM 11395 N N    . ILE A 1 111 ? 4.064   -6.127  -0.589  1.00 0.00 ? 110 ILE A N    6  
ATOM 11396 C CA   . ILE A 1 111 ? 4.267   -5.196  0.515   1.00 0.00 ? 110 ILE A CA   6  
ATOM 11397 C C    . ILE A 1 111 ? 5.453   -4.263  0.258   1.00 0.00 ? 110 ILE A C    6  
ATOM 11398 O O    . ILE A 1 111 ? 6.080   -4.313  -0.800  1.00 0.00 ? 110 ILE A O    6  
ATOM 11399 C CB   . ILE A 1 111 ? 4.344   -5.863  1.872   1.00 0.00 ? 110 ILE A CB   6  
ATOM 11400 C CG1  . ILE A 1 111 ? 5.540   -6.820  2.116   1.00 0.00 ? 110 ILE A CG1  6  
ATOM 11401 C CG2  . ILE A 1 111 ? 2.991   -6.518  2.253   1.00 0.00 ? 110 ILE A CG2  6  
ATOM 11402 C CD1  . ILE A 1 111 ? 5.651   -8.084  1.254   1.00 0.00 ? 110 ILE A CD1  6  
ATOM 11403 H H    . ILE A 1 111 ? 4.820   -6.665  -0.924  1.00 0.00 ? 110 ILE A H    6  
ATOM 11404 H HA   . ILE A 1 111 ? 3.427   -4.512  0.593   1.00 0.00 ? 110 ILE A HA   6  
ATOM 11405 H HB   . ILE A 1 111 ? 4.456   -5.003  2.558   1.00 0.00 ? 110 ILE A HB   6  
ATOM 11406 H HG12 . ILE A 1 111 ? 6.494   -6.255  2.105   1.00 0.00 ? 110 ILE A HG12 6  
ATOM 11407 H HG13 . ILE A 1 111 ? 5.394   -7.186  3.135   1.00 0.00 ? 110 ILE A HG13 6  
ATOM 11408 H HG21 . ILE A 1 111 ? 2.779   -7.380  1.588   1.00 0.00 ? 110 ILE A HG21 6  
ATOM 11409 H HG22 . ILE A 1 111 ? 2.161   -5.785  2.158   1.00 0.00 ? 110 ILE A HG22 6  
ATOM 11410 H HG23 . ILE A 1 111 ? 3.023   -6.888  3.300   1.00 0.00 ? 110 ILE A HG23 6  
ATOM 11411 H HD11 . ILE A 1 111 ? 4.694   -8.640  1.237   1.00 0.00 ? 110 ILE A HD11 6  
ATOM 11412 H HD12 . ILE A 1 111 ? 6.447   -8.755  1.644   1.00 0.00 ? 110 ILE A HD12 6  
ATOM 11413 H HD13 . ILE A 1 111 ? 5.917   -7.828  0.213   1.00 0.00 ? 110 ILE A HD13 6  
ATOM 11414 N N    . LEU A 1 112 ? 5.807   -3.369  1.230   1.00 0.00 ? 111 LEU A N    6  
ATOM 11415 C CA   . LEU A 1 112 ? 6.905   -2.402  1.065   1.00 0.00 ? 111 LEU A CA   6  
ATOM 11416 C C    . LEU A 1 112 ? 7.640   -2.056  2.353   1.00 0.00 ? 111 LEU A C    6  
ATOM 11417 O O    . LEU A 1 112 ? 7.043   -2.080  3.419   1.00 0.00 ? 111 LEU A O    6  
ATOM 11418 C CB   . LEU A 1 112 ? 6.430   -1.084  0.408   1.00 0.00 ? 111 LEU A CB   6  
ATOM 11419 C CG   . LEU A 1 112 ? 4.967   -0.652  0.657   1.00 0.00 ? 111 LEU A CG   6  
ATOM 11420 C CD1  . LEU A 1 112 ? 4.481   -0.775  2.077   1.00 0.00 ? 111 LEU A CD1  6  
ATOM 11421 C CD2  . LEU A 1 112 ? 4.916   0.808   0.265   1.00 0.00 ? 111 LEU A CD2  6  
ATOM 11422 H H    . LEU A 1 112 ? 5.308   -3.299  2.106   1.00 0.00 ? 111 LEU A H    6  
ATOM 11423 H HA   . LEU A 1 112 ? 7.672   -2.830  0.433   1.00 0.00 ? 111 LEU A HA   6  
ATOM 11424 H HB2  . LEU A 1 112 ? 7.106   -0.228  0.636   1.00 0.00 ? 111 LEU A HB2  6  
ATOM 11425 H HB3  . LEU A 1 112 ? 6.513   -1.217  -0.686  1.00 0.00 ? 111 LEU A HB3  6  
ATOM 11426 H HG   . LEU A 1 112 ? 4.292   -1.241  -0.013  1.00 0.00 ? 111 LEU A HG   6  
ATOM 11427 H HD11 . LEU A 1 112 ? 4.264   -1.801  2.405   1.00 0.00 ? 111 LEU A HD11 6  
ATOM 11428 H HD12 . LEU A 1 112 ? 3.568   -0.180  2.258   1.00 0.00 ? 111 LEU A HD12 6  
ATOM 11429 H HD13 . LEU A 1 112 ? 5.272   -0.358  2.744   1.00 0.00 ? 111 LEU A HD13 6  
ATOM 11430 H HD21 . LEU A 1 112 ? 5.527   0.805   -0.669  1.00 0.00 ? 111 LEU A HD21 6  
ATOM 11431 H HD22 . LEU A 1 112 ? 5.400   1.483   1.017   1.00 0.00 ? 111 LEU A HD22 6  
ATOM 11432 H HD23 . LEU A 1 112 ? 3.890   1.201   0.072   1.00 0.00 ? 111 LEU A HD23 6  
ATOM 11433 N N    . SER A 1 113 ? 8.957   -1.713  2.248   1.00 0.00 ? 112 SER A N    6  
ATOM 11434 C CA   . SER A 1 113 ? 9.942   -1.354  3.273   1.00 0.00 ? 112 SER A CA   6  
ATOM 11435 C C    . SER A 1 113 ? 9.954   0.151   3.584   1.00 0.00 ? 112 SER A C    6  
ATOM 11436 O O    . SER A 1 113 ? 9.442   0.932   2.785   1.00 0.00 ? 112 SER A O    6  
ATOM 11437 C CB   . SER A 1 113 ? 11.336  -1.812  2.732   1.00 0.00 ? 112 SER A CB   6  
ATOM 11438 O OG   . SER A 1 113 ? 11.494  -1.470  1.344   1.00 0.00 ? 112 SER A OG   6  
ATOM 11439 H H    . SER A 1 113 ? 9.402   -1.701  1.349   1.00 0.00 ? 112 SER A H    6  
ATOM 11440 H HA   . SER A 1 113 ? 9.733   -1.889  4.184   1.00 0.00 ? 112 SER A HA   6  
ATOM 11441 H HB2  . SER A 1 113 ? 12.178  -1.409  3.336   1.00 0.00 ? 112 SER A HB2  6  
ATOM 11442 H HB3  . SER A 1 113 ? 11.366  -2.920  2.822   1.00 0.00 ? 112 SER A HB3  6  
ATOM 11443 H HG   . SER A 1 113 ? 12.153  -2.054  0.932   1.00 0.00 ? 112 SER A HG   6  
ATOM 11444 N N    . LEU A 1 114 ? 10.555  0.684   4.726   1.00 0.00 ? 113 LEU A N    6  
ATOM 11445 C CA   . LEU A 1 114 ? 10.564  2.162   4.948   1.00 0.00 ? 113 LEU A CA   6  
ATOM 11446 C C    . LEU A 1 114 ? 11.386  2.963   3.964   1.00 0.00 ? 113 LEU A C    6  
ATOM 11447 O O    . LEU A 1 114 ? 10.903  3.999   3.575   1.00 0.00 ? 113 LEU A O    6  
ATOM 11448 C CB   . LEU A 1 114 ? 10.617  2.973   6.313   1.00 0.00 ? 113 LEU A CB   6  
ATOM 11449 C CG   . LEU A 1 114 ? 10.437  2.344   7.714   1.00 0.00 ? 113 LEU A CG   6  
ATOM 11450 C CD1  . LEU A 1 114 ? 9.161   1.536   7.927   1.00 0.00 ? 113 LEU A CD1  6  
ATOM 11451 C CD2  . LEU A 1 114 ? 11.653  1.540   8.165   1.00 0.00 ? 113 LEU A CD2  6  
ATOM 11452 H H    . LEU A 1 114 ? 10.981  0.090   5.414   1.00 0.00 ? 113 LEU A H    6  
ATOM 11453 H HA   . LEU A 1 114 ? 9.555   2.451   4.683   1.00 0.00 ? 113 LEU A HA   6  
ATOM 11454 H HB2  . LEU A 1 114 ? 11.583  3.529   6.389   1.00 0.00 ? 113 LEU A HB2  6  
ATOM 11455 H HB3  . LEU A 1 114 ? 9.836   3.793   6.186   1.00 0.00 ? 113 LEU A HB3  6  
ATOM 11456 H HG   . LEU A 1 114 ? 10.374  3.204   8.435   1.00 0.00 ? 113 LEU A HG   6  
ATOM 11457 H HD11 . LEU A 1 114 ? 8.289   2.229   7.918   1.00 0.00 ? 113 LEU A HD11 6  
ATOM 11458 H HD12 . LEU A 1 114 ? 9.179   1.025   8.909   1.00 0.00 ? 113 LEU A HD12 6  
ATOM 11459 H HD13 . LEU A 1 114 ? 9.056   0.770   7.129   1.00 0.00 ? 113 LEU A HD13 6  
ATOM 11460 H HD21 . LEU A 1 114 ? 11.414  1.070   9.159   1.00 0.00 ? 113 LEU A HD21 6  
ATOM 11461 H HD22 . LEU A 1 114 ? 12.557  2.186   8.229   1.00 0.00 ? 113 LEU A HD22 6  
ATOM 11462 H HD23 . LEU A 1 114 ? 11.848  0.729   7.435   1.00 0.00 ? 113 LEU A HD23 6  
ATOM 11463 N N    . GLU A 1 115 ? 12.593  2.599   3.459   1.00 0.00 ? 114 GLU A N    6  
ATOM 11464 C CA   . GLU A 1 115 ? 13.247  3.472   2.450   1.00 0.00 ? 114 GLU A CA   6  
ATOM 11465 C C    . GLU A 1 115 ? 12.743  3.377   1.015   1.00 0.00 ? 114 GLU A C    6  
ATOM 11466 O O    . GLU A 1 115 ? 12.992  4.248   0.193   1.00 0.00 ? 114 GLU A O    6  
ATOM 11467 C CB   . GLU A 1 115 ? 14.759  3.737   2.624   1.00 0.00 ? 114 GLU A CB   6  
ATOM 11468 C CG   . GLU A 1 115 ? 14.927  5.172   3.186   1.00 0.00 ? 114 GLU A CG   6  
ATOM 11469 C CD   . GLU A 1 115 ? 16.403  5.520   3.325   1.00 0.00 ? 114 GLU A CD   6  
ATOM 11470 O OE1  . GLU A 1 115 ? 17.108  4.819   4.100   1.00 0.00 ? 114 GLU A OE1  6  
ATOM 11471 O OE2  . GLU A 1 115 ? 16.848  6.495   2.662   1.00 0.00 ? 114 GLU A OE2  6  
ATOM 11472 H H    . GLU A 1 115 ? 13.030  1.756   3.755   1.00 0.00 ? 114 GLU A H    6  
ATOM 11473 H HA   . GLU A 1 115 ? 12.909  4.483   2.646   1.00 0.00 ? 114 GLU A HA   6  
ATOM 11474 H HB2  . GLU A 1 115 ? 15.187  3.002   3.339   1.00 0.00 ? 114 GLU A HB2  6  
ATOM 11475 H HB3  . GLU A 1 115 ? 15.318  3.647   1.665   1.00 0.00 ? 114 GLU A HB3  6  
ATOM 11476 H HG2  . GLU A 1 115 ? 14.407  5.916   2.511   1.00 0.00 ? 114 GLU A HG2  6  
ATOM 11477 H HG3  . GLU A 1 115 ? 14.432  5.191   4.190   1.00 0.00 ? 114 GLU A HG3  6  
ATOM 11478 N N    . GLN A 1 116 ? 11.908  2.355   0.698   1.00 0.00 ? 115 GLN A N    6  
ATOM 11479 C CA   . GLN A 1 116 ? 11.139  2.303   -0.545  1.00 0.00 ? 115 GLN A CA   6  
ATOM 11480 C C    . GLN A 1 116 ? 9.746   2.928   -0.384  1.00 0.00 ? 115 GLN A C    6  
ATOM 11481 O O    . GLN A 1 116 ? 9.117   3.259   -1.382  1.00 0.00 ? 115 GLN A O    6  
ATOM 11482 C CB   . GLN A 1 116 ? 11.111  0.893   -1.169  1.00 0.00 ? 115 GLN A CB   6  
ATOM 11483 C CG   . GLN A 1 116 ? 12.569  0.383   -1.239  1.00 0.00 ? 115 GLN A CG   6  
ATOM 11484 C CD   . GLN A 1 116 ? 12.795  -0.800  -2.167  1.00 0.00 ? 115 GLN A CD   6  
ATOM 11485 O OE1  . GLN A 1 116 ? 13.001  -1.930  -1.714  1.00 0.00 ? 115 GLN A OE1  6  
ATOM 11486 N NE2  . GLN A 1 116 ? 12.803  -0.532  -3.493  1.00 0.00 ? 115 GLN A NE2  6  
ATOM 11487 H H    . GLN A 1 116 ? 11.740  1.613   1.347   1.00 0.00 ? 115 GLN A H    6  
ATOM 11488 H HA   . GLN A 1 116 ? 11.632  2.907   -1.296  1.00 0.00 ? 115 GLN A HA   6  
ATOM 11489 H HB2  . GLN A 1 116 ? 10.479  0.213   -0.537  1.00 0.00 ? 115 GLN A HB2  6  
ATOM 11490 H HB3  . GLN A 1 116 ? 10.688  0.965   -2.205  1.00 0.00 ? 115 GLN A HB3  6  
ATOM 11491 H HG2  . GLN A 1 116 ? 13.226  1.211   -1.589  1.00 0.00 ? 115 GLN A HG2  6  
ATOM 11492 H HG3  . GLN A 1 116 ? 12.916  0.086   -0.226  1.00 0.00 ? 115 GLN A HG3  6  
ATOM 11493 H HE21 . GLN A 1 116 ? 12.207  0.194   -3.844  1.00 0.00 ? 115 GLN A HE21 6  
ATOM 11494 H HE22 . GLN A 1 116 ? 12.975  -1.346  -4.065  1.00 0.00 ? 115 GLN A HE22 6  
ATOM 11495 N N    . GLY A 1 117 ? 9.307   3.161   0.884   1.00 0.00 ? 116 GLY A N    6  
ATOM 11496 C CA   . GLY A 1 117 ? 8.128   3.870   1.364   1.00 0.00 ? 116 GLY A CA   6  
ATOM 11497 C C    . GLY A 1 117 ? 8.274   5.326   1.748   1.00 0.00 ? 116 GLY A C    6  
ATOM 11498 O O    . GLY A 1 117 ? 7.474   6.177   1.376   1.00 0.00 ? 116 GLY A O    6  
ATOM 11499 H H    . GLY A 1 117 ? 9.874   2.796   1.612   1.00 0.00 ? 116 GLY A H    6  
ATOM 11500 H HA2  . GLY A 1 117 ? 7.360   3.828   0.630   1.00 0.00 ? 116 GLY A HA2  6  
ATOM 11501 H HA3  . GLY A 1 117 ? 7.846   3.342   2.245   1.00 0.00 ? 116 GLY A HA3  6  
ATOM 11502 N N    . ASN A 1 118 ? 9.326   5.699   2.518   1.00 0.00 ? 117 ASN A N    6  
ATOM 11503 C CA   . ASN A 1 118 ? 9.652